1TXXA

Active-site variant of e.coli thioredoxin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
b'SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCVWCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (THIOREDOXIN)
publication title The CXXC motif: crystal structure of an active-site variant of Escherichia coli thioredoxin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 29
structure length 108
sequence length 108
ec nomenclature ec 1.8.-.-:
pdb deposition date 1999-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1txxA00
2LS5A 2TRXA 3S9FA 1B9XC 5DAKB 5CRWA 2JU5A 4ZBAA 4L5OA 1A23A 3U5RE 4ILFA 3TRPA 3WT2A 3DVWA 1ZYEA 2VCVA 1BQ7A 1EZKA 3VI5A 2IMEA 1FVJA 1U87A 2AYTA 3ME8A 3L9VA 3GUSA 4I6XA 5IOWA 4PUFC 1UVZA 1AQWA 4XS1A 22GSA 4IN0A 1XWKA 3IHQA 3SBCA 1USBA 3LYPA 2VL9A 4KAEA 1TU7A 3U6VA 3BBYA 3ZMLA 2WFCA 4MJAA 2C1YA 6GSTA 1SK2A 4E8EA 2QKEA 5F05A 3FZ5A 2V2GA 4IP6A 1JLWA 1EOHA 2LEGA 4ZILA 1G7EA 4MF5A 2AV4A 2DJ3A 2K6VA 3IXRA 4BA7A 4KA0A 2R6KA 3C73A 2XC2A 1TI3A 5ELGA 1J08A 4BL7A 1XZOA 3QR6A 3TB2A 2B6MA 3KH7A 4KDYA 1YZXA 2K8SA 3UL3A 1U88A 5KN1A 4AJ8A 4EC0A 2EC4A 5ECQB 2H0IA 3F4RA 3I69A 2YJHA 2PPTA 3GNJA 1TK8B 2FWHA 4MCUA 7GSSA 8GSSA 4K1FA 2AJQB 5IMZA 4GXZA 5D96A 2EIOA 2H74A 4Q5QA 4TN8A 1VF3A 3QPMA 4NV5A 3EC3A 3HKRA 2DSAA 3P90A 1XOAA 2I81A 1R4WA 2PVQA 5KEJA 1GSUA 4Q5RA 2J23A 1E6BA 3CSHA 1JZDA 5CNWA 1Y25A 6GSYA 2OJLA 2H01A 2YPMA 3UARA 5J9CA 1XWGA 3QAVA 2MMNA 1EGRA 5F8BA 3LEFA 5GSTA 2C0FA 1TRUA 3H4KA 2QSIA 2GZYA 1WWJA 3M1GA 2C3NA 2XPDA 3GX0A 2N5FA 3UIWA 1EOGA 1PMTA 3I6AA 2YJ7A 2GDRA 5ELAA 1E2YA 4OO5A 4K7IA 1SYXA 2XBIA 4TRXA 3GSTA 4MLYA 2LKUA 1IYIA 1SJ6A 1SKSB 2CQ9A 2AAWA 1QK8A 2IJYA 2V1MA 5B6MA 1G7OA 1VF4A 3GV1A 2H76A 2HRFA 4BPYA 2LNTA 2KUCA 2CVKA 1NHYA 2GGTA 2IPAA 3CSIA 1GUHA 4YQUA 1HNBA 4J2FA 1RQMA 3GL3A 5DCHA 3TCOA 4WXTA 1Q4JA 1OE8A 1QFNA 4FIWA 1EGOA 1PA3A 1GSYA 1W4VA 5JWOB 3RBTA 2GSSA 2RUEA 1TXXA 5GAND 3CTGA 2IFQA 4OCFA 1S3AA 5G2ZA 4G10A 5LCZA 1V40A 1AIUA 5DALA 3HYPA 2PERA 2GLRA 3VURA 5HFGA 2YWIA 1LBKA 1SD9A 2B5YA 3VI7A 2FCHA 2R5GA 4F82A 1YY7A 2H6ZA 3RHBA 4KDUA 3FHKA 3GTUA 1T3BA 4TOPA 2B7JA 4OWYA 1M2BA 3Q19A 2IMIA 2M46A 4BWSA 2P5QA 1T1VA 4PQ1A 1BX9A 2C3QA 4O32A 5FHIA 2YV7A 1W89A 4I2TA 4I8BA 3FR9A 2VCWA 4JEDA 1HNCA 3O6TA 4GCIA 2MYGA 3ERWA 2KHPA 1GSQA 2IN3A 2F3MA 3KD0A 4PNGA 4HEA2 2VAFA 2F51A 2CVDA 4MZBA 5IQYA 3F0IA 1ZL9A 4E8HA 1ZYQB 3GL5A 3ZMKA 3J7Yk 2DLXA 4KW6A 2GT5A 3VWVA 1ERVA 3KP9A 1AQVA 2C0DA 3UOMA 3CRTA 3ZZXA 4K8MA 3BOAA 1PGTA 3HXSA 2VL2C 2VLUA 4ECIA 5A4WA 2LV3A 1J9BA 4GSSA 1K3LA 3WGXA 5DJLA 1Z6NA 2MMZA 2FWEA 3TRXA 3UBKA 4EKZA 1MDJA 2DBCA 3KJYA 2L6DA 2VD0A 5A4UA 4EUYA 4MH2A 3ZVJA 1GRXA 2NBSA 3A2VA 4YQMA 1DSBA 1M99A 4WBJA 4O5RA 1SL1B 1GL8A 4FO5A 4EVMA 5IOXA 1ZZYA 4IP1A 1F3AA 3LWAA 5HQPA 4EDZA 3DEXA 1B4PA 2M72A 3HHVA 2ES7A 3LJRA 1ACVA 4XHMA 4XCSA 3GKKA 1GP1A 3TOTA 1JHBA 1OC8A 2PVOC 2XPEA 3ZL5A 1XIYA 16GSA 2DC5A 2HSHA 1EV9A 3Q18A 2BTOT 4GWRA 3BCIA 1X0RA 4G9HA 3HVSA 1OVNA 4K9ZA 3KM6A 4KDXA 3QOUA 3NZNA 1YKCA 4IJIA 3F63A 2L6CA 1GTUA 3M9JA 5JCUA 2OBKA 2LQQA 1UN2A 4V2LA 5JCWA 4F9ZA 1AW9A 4NHWA 3UAPA 3W6GA 3WGEA 3E3EA 3TKSE 3FEUA 5GSSA 2HLSA 3V1WA 3DRNA 1I9DA 1ILOA 4QL7A 1BEDA 3WGDA 1N2AA 5H5SA 5LNKe 1A0RP 5DBQA 3EINA 1X9WB 2LNSA 1OC3A 3HA9A 3SWLA 4DVCA 4FH8A 3D0ZA 3LXTA 1OC9B 2OKAA 5KN2A 1MDKA 5AIXA 3LQ7A 5IPGA 4IVFA 2HZFA 2CX3A 4O92A 1PKZA 2MBSA 1JLVA 2HNLA 3IOSA 2IMKA 5G31A 5INYA 5J9BA 1EEJA 3TKQA 2D2ZA 5IM9A 4XS4A 1V98A 2HSYA 2MMAA 4MABA 1XVQA 4AJ6A 3ZVJD 4DEJA 4NWYA 1K3YA 3F3RA 1RK4A 4L8EA 4WF5A 4JRRA 2IL3A 4POLA 1A8LA 5HFIA 1S3DA 2N5BA 1T8EB 1SL2B 1XW6A 1M9BA 2KLXA 2BMXA 2OE1A 5ECRB 1QQ2A 4KNDA 1YF1A 1TK5B 3KXOA 1OKDA 1GSEA 1XPVA 2VL2A 3KEBA 1RW1A 1WP0A 5CYYA 4YAVA 4MJBA 4DSSB 1F37A 1H4OA 2YNXA 1VRSD 1K0OA 3A5WA 3BCKA 5J4UA 4DSRA 3ZFLA 2ALBA 2FHEA 2HZEA 2NDOA 2OACA 2GSRA 1PRXA 4TR1A 3GYKA 1S3CA 1AXDA 1JZRA 3E9JB 1B9YC 3LORA 3FK8A 4QQ7A 1HQOA 1MD4A 4KCAA 1J0FA 4GTUA 4ISDA 1YQ1A 2IIYA 3TDGA 2RIIA 1Z7RA 2A2SA 4HUAA 1XWBA 5D93A 5IIZA 1HNAA 5B7CA 2OE0A 5ID2A 3APSA 4FYBA 2WB9A 4J57E 2ZUPA 2HE3A 3ISOA 2K18A 2GTUA 3N5OA 2L4QA 1FB6A 1TDIA 1WJKA 4HQZA 5DCGA 2IWTA 3A2XA 1A2MA 2F9SA 1X5EA 1VF1A 1X9MB 2VLTA 5F06A 5EL8A 4ZB8A 3FYGA 6GSUA 4OFMA 1LJRA 1JZOA 3GKMA 1YEXA 2CT6A 1R7HA 2X64A 3KH9A 1DE2A 4JU5A 4TR0A 4MJCA 2GSTA 2TIRA 5DAKA 1OE7A 2YCDA 3WD6A 2FA8A 4RI7A 2VM2A 1FOVA 2B5XA 3HVXA 1EWXA 4X0XA 4ZL7A 3GA4A 1SYRA 3CTFA 1LU4A 3TKPA 2PU9C 4KB3A 1ERWA 2WJUA 1QGVA 4ML6A 1PN9A 1KNGA 1AC1A 4ZB9A 3KP8A 5H5RA 4P3YB 2NTOA 1A2LA 2I3YA 2NVLA 2DIZA 4KE3A 5FWGA 4TKYA 4BVXA 1FVKA 1XOBA 2E2MA 1KEBA 1O7UA 4XRDA 5JCGA 4RQRA 5E59A 4OMVA 3J7Yb 3UMAA 2H1BA 4KUNA 3QFAC 4KSMA 1TRSA 2LRTA 2REMA 3VPTA 2P31A 3RPPA 3GHAA 4V2NA 3D4MA 2GQKA 5G1LA 4MJEA 3HCZA 1BYEA 4NPBA 3ZFBA 2TRCP 1JZWA 2IFQB 5IMVA 4RQXA 1Y6EA 3IAM2 3DKSA 3HVVA 2YANA 1ML6A 1EP8A 1GSSA 4MF6A 2JSZA 5J5NA 2VLVA 3DD3A 2XHFA 3FR3A 3DWVA 1C72A 2YN1A 1QXHA 1YKAA 4JE1A 3RDWA 1XCCA 1NHOA 1ST9A 1M7TA 1V2AA 5ECNB 5L71A 1G6YA 2CVBA 2LSTA 4AF2A 5COHA 2AHEA 1FO5A 1R5PA 4G2EA 3N9JA 3M8NA 3CBUA 1CQGA 2E2GA 3IBHA 3K8NA 3CYNA 4EDYA 1SKWB 1K0BA 4LMVA 2CZ3A 3F4TA 5ECKB 1GSDA 2BJXA 5AGYA 3ED3A 3M3MA 2R37A 1Z7PA 1A8YA 1THOA 1DBYA 3D5JA 4IGJA 2E7PA 4WF4A 2OE3A 1BG5A 2R3XA 5GZZB 3RAZA 2LRNA 4ZBBA 1TRVA 4ULXA 3CXGA 3WT1A 3PR8A 1SD8A 5IPHA 2L5LA 3IV4A 1YDKA 2C3TA 1XXUA 3APQA 2A4VA 2FWFA 3L78A 5A5KA 4IHUA 2FD3A 4ZBDA 1K0DA 1Z9HA 1SK1A 4N0VA 1JFUA 3HY2A 4V2MA 5DQYA 2HFDA 2RUFA 4MP4A 1YEPA 1A24A 1TK0B 3O3TA 2VO4A 3M0FA 3UVHA 3MWHA 2JSYA 1WRYA 5C04A 2IMDA 3M9KA 2I9HA 4BVYA 4K0NA 2ZCTA 4QL9A 5EPFA 4GSNA 4V1Ap 3FR6A 1KBNA 1U3IA 4N10A 1X5DA 2PN8A 4F2IA 4HJMA 4I2UA 1YF0A 2AUVA 2HYXA 2YWOA 3IE3A 5B8BA 4ML1A 4TXVA 3DMLA 1K0NA 2X8HA 1OKTA 1ZMAA 3TUEA 1O6JA 3BJ5A 1XW9A 1O73A 3IRAA 2YOIA 4D73B 2K9FA 5IO2A 3HD5A 3TRQA 3GRXA 6GSXA 1GUKA 4PUAA 2H75A 2LJAA 3GKNA 1U6TA 2LRCA 3TJJA 1ERUA 4V1Ag 2I1UA 2F8AA 3H93A 1SJIA 2WULA 3EU3A 2L57A 3F3QA 2H1GA 1F2EA 5AISA 2RM5A 2GZPA 3EYTA 3QDNA 3QFBC 10GSA 1VF2A 1OYJA 1AUCA 5CRHA 2KP2A 3W8SA 3I43A 4NMUA 2H71A 2LTKA 6GSSA 1T4ZA 2C80A 2DIYA 1TU8A 1HYUA 4MZWA 3GIXA 3KMOA 11GSA 3L9SA 2GQLA 2JL4A 3IR4A 14GSA 4JBBA 3AY8A 1R26A 1ON4A 1BJXA 4WR4A 17GSA 3IC4A 1N8JA 2CAIA 1M9AA 4EL1A 4HOJA 2YWNA 2JZTA 3PINA 3L9UA 3VK9A 1UC7A 2VUPA 3VFIA 1T4YA 4J56E 2H19A 4TXOB 1XWCA 4XTSA 4OFNA 3BD2A 3H8QA 4Q5NA 2PBJA 4I5QA 1M2AA 4JR4A 4LA1A 3F8UA 4DSQA 5CAXA 1WMJA 1F6MC 2H70A 4FYUA 2OBIA 2RM6A 2C4JA 3HZ4A 1Z5YE 3G7YA 4NHZA 3QD9A 4MZCA 3UVTA 12GSA 2JADA 3FZAA 3QAGA 4F0CA 1GNEA 5D8IA 3C8EA 3PH9A 2GVPA 2WS2A 1PL1A 3VWWA 4GQFA 4IJ3A 2YP6A 2HZEB 3GSSA 1TOFA 4TR1B 5ABRA 3HJPA 3P8WA 4ZL9A 5AIVA 1FG4A 1GULA 3HDCA 4TVEA 2H6XA 4MMMA 2VL3A 4JR6A 3GX8A 3EMPA 3D4TA 2AB6A 1DUGA 1PQNA 3ZLPA 1V57A 5DDLA 4EXJA 2H0GA 4POBA 1GWCA 1FW1A 4IQ1A 3TGZA 1VGLA 3LSZA 2Z9SA 2P0GA 5ECPB 2J9HA 3GKXA 2FWGA 4LMWA 5C00A 1A2JA 3FZ4A 4MPFA 3FRCA 4HJ2A 2O8VB 3MNGA 4RUVA 3TOUA 2VD1A 1SKRB 3ZTLA 2ON7A 1TKDB 4PX1A 4NAXA 2DJ1A 3E0UA 1GTBA 4PGTA 2VOCA 3D6IA 4KH7A 3G7JA 2H1DA 3F6FA 3GN3A 4KSOA 1SJZA 1TW9A 4AJ7A 3UEMA 3UJ1A 1ZCPA 2DJJA 3NOFA 1WIKA 2OA7A 2L5OA 3F9UA 5B8AA 4HZ4A 3JCML 1WE0A 3DYRA 5IMFA 5J41A 1AQXA 3A2WA 1PL2A 9GSSA 5HR0A 4YAPA 3IDVA 2B1KA 1GNWA 5HFKA 1GH2A 3GMFA 1Z3EA 1XBSA 1TI1A 3QCPA 4NXIA 4F0BA 4DSSA 4ECBA 2G2QA 1K3OA 5B6NA 5EY6A 4K7OA 2V6KA 5G5FA 4HU9A 2CX4A 1V9WA 2EIQA 3PGTA 1PKWA 3TJFA 2P5RA 5ECMB 1TJDA 2WZ9A 2R4VA 4EO3A 4HU7A 2FNOA 2I4AA 4IBPA 4X1UA 3TJKA 3L4NA 3NIVA 5KN0A 2C0EA 3CRUA 4HZ2A 4KX4A 5D9WA 2A2RA 3GH9A 3ME7A 4AGSA 5CREA 5G5EA 4IKHA 4RI6A 1NW2A 5HR2A 2O87A 4OCEA 5ECHB 3EMXA 2FLSA 3MSZA 4G19A 4N0ZA 1DE1A 4IQAA 2CAQA 3H1NA 3TJBA 3VLNA 1MEKA 2DJKA 3MAKA 4MDCA 5D73A 4XIHA 4XRAA 1MTCA 3G9BA 4LLRA 2B7KA 2LQOA 4GRFA 3DGQA 4LL1B 1QUWA 2L59A 3TJGA 5ENUA 3LFLA 3D21A 2LJKA 3DVXA 3US3A 4GSTA 1G6WA 5GAPD 6GSVA 2CZ2A 2PMTA 4GQCA 1K0AA 4HI7A 1Z6MA 2YV9A 5DALB 3VWUA 4YH2A 3MDKA 2PGTA 1X9SB 2H72A 4HS1A 2X8CA 4X43A 19GSA 1FAAA 2VCTA 3H79A 4BWQA 1B8XA 1UA5A 3TKRA 5ECSA 2WCIA 4POKA 13GSA 2R2JA 2DMLA 4PXOA 2HT9A 2B1LA 3C7MA 3WYWA 3GTUB 4O7HA 1WOUA 3F6DA 5CRDA 18GSA 4PURA 3LYKA 5CP1A 2FUG2 2E0QA 2JACA 3F4SA 4K7NA 1XVWA 1AAZA 4EF0A 5DVBA 3TKSC 1F3BA 1GTAA 3LXZA 4OO4A 3IK7A 2EIRA 3FKFA 2C8UA 2H6YA 4MH3A 1YJ6A 1WPIA 5JWRB 3QAWA 1OAZA 2DJ2A 1EP7A 1O85A 3KTBA 2V32A 2YWMA 5J3RA 1XFLA 5A4VA 2PWJA 2K8VA 1BAYA 4XS6A 2WGRA 4H86A 4L0UA 5IMDA 5ECLB 2LUSA 2IMFA 3Q74A 2GSQA 1SK0A 2MZCA 2O85A 3C1RA 2QGVA 2N5AA 1CQHA 5CRGA 1ZGNA 5HR1A 1GLQA 3KZQA 4Z7XA 5H5QA 1K0CA 3APOA 5EVOA 3EVIA 1IYHA 3HJMA 4F03A 1THXA 4IS0A 1GUMA 5IMAA 2GT6A 1KTEA 4MK3A 4K6XA 4JZQA 4PQIA 5JWQB 3Q6OA 3IA1A 5IMCA 2WRTA 4OFTA 4TW5A 1FB0A 2OADA 4HQSA 4N11A 1O81A 1MDIA 4HDEA 4K2DA 5ECIB 5D9VA 3QMXA 5ECOB 3R2QA 5AN1A 2L4CA 2H0HA 2H66A 2HXKA 4Q5FA 4MF7A 4YQVA 1XWAA 3RHCA 1G0TA 2LJRA 2V41A 1ZOFA 1H75A 2YZUA 2G0FA 4ACSA 3DIEA 2KOKA 5D9TA 3VWXA 4WR5A 1TP9A 3KTLA 3GFKA 2PUKC 4MPGA 1EV4A 3KIJA 2C0GA 2XBQA 3KMNA 4ECJA 3I9V2 5HR3A 3P7XA 2M80A 2H73A 2VCXA 2VM1A 1K0MA 2X8GA 1R5AA 3CMIA 1O8XA 4CHSA 6GSWA 3O76A 3W8JA 1GSFA 4IW9A 3C1SA 1SL0B 4ZXGA 1M2DA 4POMA 4KGIA 2O89A 3IPZA 2CV4A 4ID0A 1PD21 4ECCA 1TTZA 3IAS2 2QC7A 3DXBA 4OD7A 1QMVA 2GZZA 3G7IA 3ZITA 1B4QA 1SU9A 3FW2A 20GSA 2KP1A 2VCZA 2VIMA 4NV2A 1MD3A 4D73A 4WEYA 1F9MA 1ERTA 2CA8A 3OR5A 3TKSA 2FY6A 1XW5A 4XS4B 3C71A 2V6OA 3ZIVA 3VPQA 5F0GA 3ERGA 1HD2A 2H1AA 1A0FA 1T7PB 4ZB6A 2DMMA 3ZIJA 4ZIJA 3FZ9A 2MBTA 1EEMA 4GF0A 2ZNMA 3L0HA 1M0UA 2F8FA 5DQSA 4CDOA 4IELA 1FHEA 5D9XA 3GURA 4K0GA 3EE2A 1NM3A 5E4WA 1TRWA 2FA4A 5CO3A 3ZRDA 1ABAA 2GS3A 1Q98A 1O8WA 1SENA 2DJ0A 3KCMA 2JZSA 2NPBA 3EURA 3GH6A 4PQHA 5FT3A 4MA9A 4KCEA 4GLTA 5KN3A 5DJMA 4TR3A 3HJOA 1I5GA 5IO0A 3EU4A 1PX7A 5G1KA 3LG6A 3ERFA 2MMOA 5LD0A 4TXOA 4WKWA 3KGKA 1URMA 1U3AA 2B3SA 5ID2B 4PNFA 3D22A 4WETA 2ON5A 3IK9A 3LGCA 4LL4B 4L0WA 1PSQA 2HI7A 2H30A 3A3TA 4I97A 3ZREA 3FY7A 1NSWA 4WBRD 2JZRA 5F07A 3CSJA 4CW9A 2HRNA 1X5CA 2H8LA 2VCQA 1OC9A 2B5EA 1GTIA 2FGXA 1PX6A 1V58A 3HZ8A 4EE0A 2GQMA 3P2AA 4L5LA 1GLPA 1T00A 2X99A 3RPNA 4TR4A 2YZHA 5G30A 4N30A 2O7KA 2WDUA 3ZYWA 4FYCA 2RLIA 1B48A 4ZL8A 3UBLA 3EWLA
chains in the Genus database with same CATH superfamily
2LS5A 2TRXA 3S9FA 1B9XC 5DAKB 5CRWA 2JU5A 4ZBAA 4L5OA 1A23A 3U5RE 4ILFA 3TRPA 3WT2A 3DVWA 1ZYEA 2VCVA 1BQ7A 1PN0A 1EZKA 3VI5A 2IMEA 1FVJA 1U87A 2AYTA 3ME8A 3L9VA 3GUSA 4I6XA 5IOWA 4PUFC 1UVZA 1AQWA 4XS1A 22GSA 4IN0A 1XWKA 3IHQA 3SBCA 1M3IA 1USBA 3LYPA 2QA2A 2VL9A 4KAEA 1TU7A 4EIQA 3U6VA 3BBYA 3ZMLA 2WFCA 4MJAA 2C1YA 6GSTA 1SK2A 4E8EA 2QKEA 5F05A 3FZ5A 2V2GA 4IP6A 1JLWA 1EOHA 2LEGA 4ZILA 1G7EA 4MF5A 2AV4A 2DJ3A 2K6VA 3IXRA 4BA7A 4KA0A 2R6KA 3C73A 2XC2A 1TI3A 5ELGA 1J08A 4BL7A 1XZOA 3QR6A 3TB2A 2B6MA 3KH7A 4KDYA 1YZXA 2K8SA 3UL3A 1U88A 5KN1A 4AJ8A 4EC0A 2EC4A 5ECQB 2H0IA 3F4RA 3I69A 2YJHA 2PPTA 3GNJA 1TK8B 2FWHA 4MCUA 7GSSA 8GSSA 4K1FA 2AJQB 2HRAA 5IMZA 4GXZA 5D96A 2EIOA 2H74A 4Q5QA 4TN8A 1VF3A 3QPMA 4NV5A 3EC3A 3HKRA 2DSAA 3P90A 1XOAA 2I81A 1R4WA 2PVQA 5KEJA 1GSUA 4Q5RA 2J23A 1E6BA 3CSHA 1JZDA 5CNWA 1Y25A 6GSYA 2OJLA 2H01A 2YPMA 3UARA 5J9CA 1XWGA 3QAVA 2MMNA 1EGRA 5F8BA 3LEFA 5GSTA 2C0FA 1TRUA 3H4KA 2QSIA 2GZYA 1ZYNA 1WWJA 3M1GA 2C3NA 2XPDA 3GX0A 2N5FA 3UIWA 1EOGA 1PMTA 3I6AA 2YJ7A 4G0LA 2GDRA 5ELAA 1E2YA 4OO5A 4K7IA 1SYXA 2XBIA 4A5PA 4TRXA 3GSTA 4MLYA 2LKUA 1IYIA 1SJ6A 1SKSB 2CQ9A 2AAWA 1QK8A 2IJYA 4YKFA 2V1MA 5B6MA 1G7OA 1VF4A 3GV1A 2H76A 2HRFA 4BPYA 2LNTA 2KUCA 2CVKA 1NHYA 2GGTA 2IPAA 3CSIA 1GUHA 4YQUA 1HNBA 4J2FA 1RQMA 3GL3A 5DCHA 3TCOA 4WXTA 4FIWA 1Q4JA 1OE8A 1QFNA 2R0CA 1EGOA 1PA3A 1GSYA 1W4VA 5JWOB 3RBTA 2GSSA 2RUEA 1TXXA 5GAND 3CTGA 5KOWA 2IFQA 4OCFA 1S3AA 5G2ZA 4G10A 5LCZA 1V40A 1AIUA 5DALA 3HYPA 2PERA 2GLRA 3VURA 5HFGA 2YWIA 1LBKA 1SD9A 2B5YA 3VI7A 2FCHA 2R5GA 4F82A 1YY7A 2H6ZA 3RHBA 4KDUA 3FHKA 3GTUA 1T3BA 4TOPA 2B7JA 4OWYA 1M2BA 3Q19A 2IMIA 2M46A 4BWSA 2P5QA 1T1VA 4PQ1A 1BX9A 2C3QA 4O32A 5FHIA 2YV7A 1W89A 4I2TA 4I8BA 3FR9A 2VCWA 4JEDA 1HNCA 3IC8A 3O6TA 4GCIA 2MYGA 3ERWA 2KHPA 1GSQA 2IN3A 3PPUA 2F3MA 3KD0A 4PNGA 4HEA2 2VAFA 2F51A 2CVDA 4MZBA 5IQYA 3F0IA 1ZL9A 4E8HA 1ZYQB 2UZ8A 3GL5A 3ZMKA 3J7Yk 2DLXA 4KW6A 2GT5A 1PFOA 3VWVA 1ERVA 3KP9A 1AQVA 2C0DA 3UOMA 3CRTA 3ZZXA 4K8MA 3BOAA 1PGTA 3HXSA 2VL2C 2VLUA 4ECIA 5A4WA 2LV3A 1J9BA 4GSSA 1K3LA 3WGXA 5DJLA 1Z6NA 2MMZA 2FWEA 3TRXA 3UBKA 4EKZA 1MDJA 2DBCA 3KJYA 2L6DA 2VD0A 5A4UA 4EUYA 4MH2A 3ZVJA 1GRXA 2NBSA 3A2VA 4YQMA 1DSBA 1M99A 4WBJA 4O5RA 1SL1B 3CQFA 1GL8A 4FO5A 4EVMA 5IOXA 1ZZYA 4IP1A 1F3AA 3LWAA 5HQPA 4EDZA 3DEXA 1B4PA 2M72A 3HHVA 2ES7A 3LJRA 1ACVA 4XHMA 4XCSA 3GKKA 1GP1A 3TOTA 1JHBA 1OC8A 2PVOC 4PTSA 2XPEA 3ZL5A 1XIYA 16GSA 2DC5A 2HSHA 1EV9A 3Q18A 2BTOT 4GWRA 3BCIA 1X0RA 4G9HA 3HVSA 1OVNA 4K9ZA 4O5UA 3KM6A 4KDXA 3QOUA 3NZNA 1YKCA 4IJIA 3F63A 2L6CA 1GTUA 4HSCX 3M9JA 5JCUA 2OBKA 2LQQA 1UN2A 4V2LA 5JCWA 4F9ZA 1AW9A 4NHWA 3UAPA 3W6GA 3WGEA 3E3EA 3TKSE 3FEUA 5GSSA 2HLSA 3V1WA 3DRNA 1I9DA 1ILOA 4QL7A 4CY8A 1BEDA 3WGDA 1N2AA 5H5SA 5LNKe 5KOXA 1A0RP 5DBQA 3EINA 1X9WB 2LNSA 1OC3A 3HA9A 3SWLA 4DVCA 4KF9A 4FH8A 3D0ZA 3LXTA 1OC9B 2OKAA 5KN2A 1MDKA 5AIXA 3LQ7A 5IPGA 4IVFA 2HZFA 2CX3A 4O92A 1PKZA 2MBSA 1JLVA 2HNLA 3IOSA 2IMKA 5G31A 5INYA 5J9BA 1EEJA 3TKQA 2D2ZA 5IM9A 4XS4A 1V98A 2HSYA 2MMAA 4MABA 1XVQA 4AJ6A 3ZVJD 4DEJA 4NWYA 1K3YA 3F3RA 1RK4A 4L8EA 4WF5A 4JRRA 2IL3A 4POLA 1A8LA 5HFIA 1S3DA 2N5BA 1T8EB 1SL2B 1XW6A 1M9BA 2KLXA 2BMXA 2OE1A 5ECRB 1QQ2A 4KNDA 1YF1A 1TK5B 3KXOA 1OKDA 1GSEA 1XPVA 2VL2A 3KEBA 1RW1A 1WP0A 5CYYA 4YAVA 4MJBA 4DSSB 1F37A 1H4OA 2YNXA 1VRSD 1K0OA 3A5WA 3BCKA 5J4UA 4DSRA 3ZFLA 2ALBA 2FHEA 2HZEA 2NDOA 2OACA 2GSRA 1PRXA 4TR1A 3GYKA 1S3CA 1AXDA 1JZRA 3E9JB 1B9YC 2HSMA 3LORA 3FK8A 4QQ7A 1HQOA 1MD4A 4KCAA 1J0FA 4GTUA 4ISDA 1YQ1A 2IIYA 3TDGA 2RIIA 1Z7RA 2A2SA 2QA1A 4HUAA 1XWBA 5D93A 5IIZA 1HNAA 5B7CA 2OE0A 5ID2A 3APSA 4FYBA 2WB9A 4J57E 2ZUPA 2HE3A 3ISOA 2K18A 2GTUA 3N5OA 2L4QA 1FB6A 1TDIA 1WJKA 2X49A 4HQZA 5DCGA 2IWTA 3A2XA 1A2MA 2F9SA 1X5EA 1VF1A 1X9MB 2VLTA 5F06A 5EL8A 4ZB8A 3FYGA 6GSUA 4OFMA 1LJRA 1JZOA 3GKMA 1YEXA 2CT6A 1R7HA 2X64A 3KH9A 1DE2A 4JU5A 4TR0A 4MJCA 2GSTA 2TIRA 5DAKA 1OE7A 2YCDA 3WD6A 2FA8A 4RI7A 2VM2A 1FOVA 2B5XA 3HVXA 1EWXA 4X0XA 4ZL7A 3GA4A 1SYRA 3CTFA 1LU4A 3TKPA 2PU9C 4KB3A 1ERWA 2WJUA 1QGVA 4ML6A 1PN9A 1KNGA 1AC1A 1XG8A 4ZB9A 3KP8A 5H5RA 4P3YB 2NTOA 1A2LA 2I3YA 2NVLA 2DIZA 4KE3A 5FWGA 4TKYA 4BVXA 1FVKA 1XOBA 2E2MA 1KEBA 1O7UA 4XRDA 5JCGA 4RQRA 5E59A 4OMVA 3J7Yb 3UMAA 2H1BA 4KUNA 3QFAC 4KSMA 1TRSA 2LRTA 2REMA 3VPTA 2P31A 4G0KA 3RPPA 3GHAA 4V2NA 3D4MA 2GQKA 5G1LA 4MJEA 3HCZA 1BYEA 4NPBA 3ZFBA 2TRCP 1JZWA 2IFQB 2R0PA 5IMVA 4RQXA 1Y6EA 3IAM2 3DKSA 3HVVA 2YANA 1ML6A 1EP8A 1GSSA 4MF6A 2JSZA 5J5NA 2VLVA 3DD3A 2XHFA 3FR3A 3DWVA 1C72A 2YN1A 1QXHA 1YKAA 4JE1A 3RDWA 1XCCA 1NHOA 1ST9A 1M7TA 1V2AA 5ECNB 5L71A 1G6YA 2CVBA 3EPTA 2LSTA 4AF2A 5COHA 2AHEA 1FO5A 1R5PA 4G2EA 3N9JA 3M8NA 3CBUA 1CQGA 4MNNA 2E2GA 3IBHA 3K8NA 3CYNA 4EDYA 4O5QA 1SKWB 1K0BA 4LMVA 2CZ3A 2DKHA 3F4TA 5ECKB 1GSDA 5AGYA 2BJXA 1FOHA 3ED3A 3M3MA 2R37A 1Z7PA 1A8YA 1THOA 1DBYA 3D5JA 4IGJA 2E7PA 4WF4A 2OE3A 1BG5A 2R3XA 5GZZB 3RAZA 2LRNA 4ZBBA 1TRVA 4ULXA 3CXGA 3WT1A 3PR8A 1SD8A 5IPHA 2L5LA 3IV4A 1YDKA 2C3TA 1XXUA 3APQA 2A4VA 2FWFA 3L78A 5A5KA 4IHUA 2FD3A 4ZBDA 1K0DA 1Z9HA 1SK1A 4N0VA 1JFUA 3HY2A 4V2MA 5DQYA 2HFDA 2RUFA 4MP4A 1YEPA 1A24A 1TK0B 3O3TA 2VO4A 3M0FA 3UVHA 3MWHA 2JSYA 1WRYA 5C04A 2IMDA 3M9KA 5BMUA 2I9HA 4BVYA 4K0NA 2ZCTA 4QL9A 5EPFA 4GSNA 4V1Ap 3FR6A 1KBNA 1U3IA 4N10A 1X5DA 2PN8A 4F2IA 4HJMA 4Z2RA 4I2UA 1YF0A 2AUVA 2HYXA 2YWOA 3IE3A 5B8BA 4ML1A 4TXVA 3DMLA 4CY6A 1K0NA 2X8HA 1OKTA 1ZMAA 3TUEA 1O6JA 3BJ5A 1XW9A 1O73A 3IRAA 2YOIA 4D73B 4K5RA 2K9FA 5IO2A 3HD5A 3TRQA 3GRXA 6GSXA 1GUKA 4PUAA 2H75A 2LJAA 3GKNA 1U6TA 2LRCA 3TJJA 1ERUA 4V1Ag 2I1UA 2F8AA 3H93A 1SJIA 2WULA 3EU3A 2L57A 3F3QA 2H1GA 1F2EA 5AISA 2RM5A 2GZPA 3EYTA 3QDNA 3QFBC 10GSA 1VF2A 1OYJA 1AUCA 5CRHA 2KP2A 3W8SA 3I43A 4NMUA 2H71A 2LTKA 6GSSA 1T4ZA 2C80A 2DIYA 1TU8A 1HYUA 4MZWA 3GIXA 3KMOA 11GSA 3L9SA 2GQLA 2JL4A 3IR4A 14GSA 4JBBA 3AY8A 1R26A 1ON4A 1BJXA 4WR4A 17GSA 3IC4A 1N8JA 2CAIA 1M9AA 4EL1A 4HOJA 2YWNA 2JZTA 3PINA 3L9UA 3VK9A 1UC7A 2VUPA 3VFIA 1T4YA 4J56E 2H19A 4TXOB 2X4AA 1XWCA 4XTSA 4OFNA 3BD2A 3H8QA 4Q5NA 2PBJA 4I5QA 1M2AA 4JR4A 4LA1A 3F8UA 4DSQA 5CAXA 1WMJA 1F6MC 2H70A 4FYUA 4X4JA 2OBIA 2RM6A 2C4JA 3HZ4A 1Z5YE 3G7YA 4NHZA 3QD9A 4MZCA 3UVTA 12GSA 2JADA 3FZAA 3QAGA 3IHGA 4YKGA 4F0CA 1GNEA 5D8IA 3C8EA 3PH9A 2GVPA 2WS2A 1PL1A 3VWWA 4GQFA 4IJ3A 2YP6A 2HZEB 3GSSA 1TOFA 4TR1B 5ABRA 3HJPA 3P8WA 4ZL9A 5AIVA 1FG4A 1GULA 3HDCA 4TVEA 2H6XA 4MMMA 2VL3A 4JR6A 3GX8A 3EMPA 3D4TA 2AB6A 1DUGA 1PQNA 3ZLPA 1V57A 5DDLA 4EXJA 2H0GA 4POBA 1GWCA 1FW1A 4IQ1A 3TGZA 1VGLA 3LSZA 2Z9SA 2P0GA 5ECPB 2J9HA 3GKXA 2FWGA 4LMWA 5C00A 1A2JA 3FZ4A 4MPFA 3FRCA 4HJ2A 2O8VB 3MNGA 4RUVA 3TOUA 2VD1A 1SKRB 3ZTLA 2ON7A 1TKDB 4PX1A 4NAXA 2DJ1A 3E0UA 1ZYPA 1GTBA 4PGTA 2VOCA 3D6IA 4KH7A 3G7JA 2H1DA 3F6FA 3GN3A 4KSOA 1SJZA 2DKIA 1TW9A 4AJ7A 3UEMA 3UJ1A 1ZCPA 2DJJA 3NOFA 1WIKA 2OA7A 2L5OA 3F9UA 5B8AA 4HZ4A 4BL7B 3JCML 1WE0A 3DYRA 5IMFA 5J41A 1AQXA 3A2WA 3LW9A 1PL2A 9GSSA 5HR0A 4YAPA 3IDVA 2B1KA 1GNWA 5HFKA 1GH2A 3GMFA 1Z3EA 1XBSA 1TI1A 3QCPA 4NXIA 4F0BA 4DSSA 4ECBA 2G2QA 1K3OA 5B6NA 5EY6A 4K7OA 2V6KA 5G5FA 4HU9A 4BVXB 2CX4A 1V9WA 2EIQA 3PGTA 1PKWA 3TJFA 2P5RA 5ECMB 1TJDA 2WZ9A 2R4VA 4EO3A 4HU7A 2FNOA 2HRKA 3R3EA 2I4AA 4IBPA 4X1UA 3TJKA 3L4NA 3NIVA 5KN0A 2C0EA 3CRUA 4HZ2A 4KX4A 5D9WA 2A2RA 3GH9A 3ME7A 4AGSA 5CREA 5G5EA 4IKHA 4RI6A 1NW2A 5HR2A 2O87A 4OCEA 5ECHB 3EMXA 2FLSA 3MSZA 4G19A 4N0ZA 1DE1A 4IQAA 2CAQA 3H1NA 3TJBA 3VLNA 1MEKA 2DJKA 3MAKA 4MDCA 5D73A 4XIHA 4XRAA 1MTCA 3G9BA 4LLRA 2B7KA 2LQOA 4GRFA 3DGQA 4LL1B 4EIPA 1QUWA 2L59A 3TJGA 5ENUA 3LFLA 3D21A 2LJKA 3DVXA 3US3A 4GSTA 1G6WA 5GAPD 6GSVA 2CZ2A 2PMTA 4GQCA 1K0AA 4HI7A 1Z6MA 2YV9A 5DALB 3VWUA 4YH2A 3MDKA 2PGTA 1X9SB 2H72A 4HS1A 2X8CA 4X43A 19GSA 1FAAA 2VCTA 3H79A 4BWQA 1B8XA 1UA5A 3TKRA 5ECSA 2WCIA 4POKA 13GSA 2R2JA 2DMLA 4PXOA 2HT9A 2B1LA 3C7MA 3WYWA 3GTUB 4O7HA 1WOUA 3F6DA 5CRDA 18GSA 4PURA 3LYKA 4USSA 3MYDA 5CP1A 2FUG2 2E0QA 2JACA 3F4SA 4K7NA 1XVWA 1AAZA 4EF0A 5DVBA 3TKSC 1F3BA 1GTAA 3LXZA 4OO4A 4BVYB 3IK7A 2EIRA 3FKFA 2C8UA 2H6YA 4MH3A 3MIXA 1YJ6A 1WPIA 5JWRB 3QAWA 2R0GA 1OAZA 2DJ2A 1EP7A 1O85A 3KTBA 2V32A 2YWMA 5J3RA 1XFLA 5A4VA 4Z2TA 2PWJA 2K8VA 1BAYA 4XS6A 2WGRA 4H86A 4L0UA 5IMDA 4ICYA 5ECLB 2LUSA 4FQUA 2IMFA 3Q74A 2GSQA 1SK0A 2MZCA 2O85A 3C1RA 2QGVA 2N5AA 1CQHA 5CRGA 1ZGNA 5HR1A 1GLQA 3KZQA 4Z7XA 5H5QA 1K0CA 3APOA 5EVOA 3EVIA 1IYHA 3HJMA 4F03A 1THXA 4IS0A 1GUMA 5IMAA 2GT6A 1KTEA 4MK3A 4K6XA 4JZQA 4PQIA 5JWQB 2A4HA 3Q6OA 3IA1A 5IMCA 2WRTA 4OFTA 4TW5A 1FB0A 2OADA 4HQSA 4N11A 1O81A 1MDIA 4HDEA 4K2DA 5ECIB 5D9VA 3QMXA 5ECOB 3R2QA 2A2PA 5AN1A 2L4CA 2H0HA 2H66A 2HXKA 4Q5FA 4MF7A 4YQVA 1XWAA 3RHCA 1G0TA 2LJRA 2V41A 1ZOFA 1H75A 2YZUA 2G0FA 4ACSA 3DIEA 2KOKA 5D9TA 3VWXA 4WR5A 1TP9A 3KTLA 3GFKA 2PUKC 4MPGA 3FMWA 1EV4A 3KIJA 2C0GA 2XBQA 3KMNA 4ECJA 3I9V2 5HR3A 3P7XA 2M80A 2H73A 2VCXA 2VM1A 1K0MA 2X8GA 1R5AA 3CMIA 1O8XA 4CHSA 6GSWA 3O76A 3W8JA 1GSFA 4IW9A 3C1SA 1SL0B 4ZXGA 1M2DA 4POMA 4KGIA 2O89A 3IPZA 2CV4A 4ID0A 1PD21 4ECCA 4Z2UA 1TTZA 3IAS2 2QC7A 3DXBA 4OD7A 1QMVA 2GZZA 3G7IA 3ZITA 1B4QA 1SU9A 3FW2A 20GSA 2KP1A 2VCZA 1M3JA 2VIMA 4NV2A 1MD3A 4D73A 4WEYA 1F9MA 1ERTA 2CA8A 3OR5A 3TKSA 2FY6A 1XW5A 4XS4B 3C71A 2V6OA 3ZIVA 3VPQA 5F0GA 3ERGA 1HD2A 2H1AA 1A0FA 1T7PB 4ZB6A 2DMMA 3ZIJA 4ZIJA 4BIKA 3FZ9A 2MBTA 1EEMA 4GF0A 2ZNMA 3L0HA 1M0UA 2F8FA 5DQSA 4CDOA 4IELA 1FHEA 5D9XA 3GURA 4K0GA 3EE2A 1NM3A 5E4WA 5BRTA 1TRWA 2FA4A 5CO3A 3ZRDA 1ABAA 2GS3A 1Q98A 1O8WA 1SENA 2DJ0A 3KCMA 2JZSA 2NPBA 3EURA 3GH6A 4PQHA 5FT3A 4MA9A 4KCEA 3HVNA 4GLTA 5KN3A 5DJMA 4TR3A 3HJOA 1I5GA 5IO0A 3EU4A 1PX7A 5G1KA 3LG6A 3ERFA 2MMOA 5LD0A 4TXOA 4WKWA 4K2XA 3KGKA 1URMA 1U3AA 2B3SA 5ID2B 4PNFA 3D22A 4WETA 2ON5A 3IK9A 3LGCA 4LL4B 4L0WA 1PSQA 2HI7A 4K5SA 2H30A 3A3TA 4I97A 3ZREA 3A5IA 3FY7A 1NSWA 4WBRD 2JZRA 5F07A 3CSJA 4CW9A 1S3RA 2HRNA 1X5CA 2H8LA 2VCQA 1OC9A 2B5EA 1GTIA 2FGXA 1PX6A 1V58A 3HZ8A 4EE0A 2GQMA 3P2AA 4L5LA 1GLPA 1T00A 2X99A 4G0IA 3RPNA 4TR4A 2YZHA 5G30A 4N30A 2O7KA 2WDUA 3ZYWA 4FYCA 2RLIA 1B48A 4ZL8A 3UBLA 3EWLA
chains in the Genus database with same CATH topology
2LS5A 2TRXA 3S9FA 1B9XC 5DAKB 5CRWA 2JU5A 4ZBAA 4L5OA 1A23A 3U5RE 4ILFA 3TRPA 3WT2A 3DVWA 1ZYEA 2VCVA 1BQ7A 1PN0A 1EZKA 3VI5A 2IMEA 1FVJA 1U87A 2AYTA 3ME8A 3L9VA 3GUSA 4I6XA 5IOWA 4PUFC 1UVZA 1AQWA 4XS1A 22GSA 4IN0A 1XWKA 3IHQA 3SBCA 1USBA 3LYPA 2QA2A 2VL9A 4KAEA 1TU7A 4EIQA 3U6VA 3BBYA 3ZMLA 2WFCA 4MJAA 2C1YA 6GSTA 1SK2A 4E8EA 2QKEA 5F05A 3FZ5A 2V2GA 4IP6A 1JLWA 1EOHA 2LEGA 4ZILA 1G7EA 4MF5A 2AV4A 2DJ3A 2K6VA 3IXRA 4BA7A 4KA0A 2R6KA 3C73A 2XC2A 1TI3A 5ELGA 1J08A 4BL7A 1XZOA 3QR6A 3TB2A 2B6MA 3KH7A 4KDYA 1YZXA 2K8SA 3UL3A 1U88A 5KN1A 4AJ8A 4EC0A 2EC4A 5ECQB 2H0IA 3F4RA 3I69A 2YJHA 2PPTA 3GNJA 1TK8B 2FWHA 4MCUA 7GSSA 8GSSA 4K1FA 2AJQB 2HRAA 5IMZA 4GXZA 5D96A 2EIOA 2H74A 4Q5QA 4TN8A 1VF3A 3QPMA 4NV5A 3EC3A 3HKRA 2DSAA 3P90A 1XOAA 2I81A 1R4WA 2PVQA 5KEJA 1GSUA 4Q5RA 2J23A 1E6BA 3CSHA 1JZDA 5CNWA 1Y25A 6GSYA 2OJLA 2H01A 2YPMA 3UARA 5J9CA 1XWGA 3QAVA 2MMNA 1EGRA 5F8BA 3LEFA 5GSTA 2C0FA 1TRUA 3H4KA 2QSIA 2GZYA 1ZYNA 1WWJA 3M1GA 2C3NA 2XPDA 3GX0A 2N5FA 3UIWA 1EOGA 1PMTA 3I6AA 2YJ7A 4G0LA 2GDRA 5ELAA 1E2YA 4OO5A 4K7IA 1SYXA 2XBIA 4A5PA 4TRXA 3GSTA 4MLYA 2LKUA 1IYIA 1SJ6A 1SKSB 2CQ9A 2AAWA 1QK8A 2IJYA 4YKFA 2V1MA 5B6MA 1G7OA 1VF4A 3GV1A 2H76A 2HRFA 4BPYA 2LNTA 2KUCA 2CVKA 1NHYA 2GGTA 2IPAA 3CSIA 1GUHA 4YQUA 1HNBA 4J2FA 1RQMA 3GL3A 5DCHA 3TCOA 4WXTA 4FIWA 1Q4JA 1OE8A 1QFNA 2R0CA 1EGOA 1PA3A 1GSYA 1W4VA 5JWOB 3RBTA 2GSSA 2RUEA 1TXXA 5GAND 3CTGA 5KOWA 2IFQA 4OCFA 1S3AA 5G2ZA 4G10A 5LCZA 1V40A 1AIUA 5DALA 3HYPA 2PERA 2GLRA 3VURA 5HFGA 2YWIA 1LBKA 1SD9A 2B5YA 3VI7A 2FCHA 2R5GA 4F82A 1YY7A 2H6ZA 3RHBA 4KDUA 3FHKA 3GTUA 1T3BA 4TOPA 2B7JA 4OWYA 1M2BA 3Q19A 2IMIA 2M46A 4BWSA 2P5QA 1T1VA 4PQ1A 1BX9A 2C3QA 4O32A 5FHIA 2YV7A 1W89A 4I2TA 4I8BA 3FR9A 2VCWA 4JEDA 1HNCA 3IC8A 3O6TA 4GCIA 2MYGA 3ERWA 2KHPA 1GSQA 2IN3A 3PPUA 2F3MA 3KD0A 4PNGA 4HEA2 2VAFA 2F51A 2CVDA 4MZBA 5IQYA 3F0IA 1ZL9A 4E8HA 1ZYQB 2UZ8A 3GL5A 3ZMKA 3J7Yk 2DLXA 4KW6A 2GT5A 3VWVA 1ERVA 3KP9A 1AQVA 2C0DA 3UOMA 3CRTA 3ZZXA 4K8MA 3BOAA 1PGTA 3HXSA 2VL2C 2VLUA 4ECIA 5A4WA 2LV3A 1J9BA 4GSSA 1K3LA 3WGXA 5DJLA 1Z6NA 2MMZA 2FWEA 3TRXA 3UBKA 4EKZA 1MDJA 2DBCA 3KJYA 2L6DA 2VD0A 5A4UA 4EUYA 4MH2A 3ZVJA 1GRXA 2NBSA 3A2VA 4YQMA 1DSBA 1M99A 4WBJA 4O5RA 1SL1B 1GL8A 4FO5A 4EVMA 5IOXA 1ZZYA 4IP1A 1F3AA 3LWAA 5HQPA 4EDZA 3DEXA 1B4PA 2M72A 3HHVA 2ES7A 3LJRA 1ACVA 4XHMA 4XCSA 3GKKA 1GP1A 3TOTA 1JHBA 1OC8A 2PVOC 4PTSA 2XPEA 3ZL5A 1XIYA 16GSA 2DC5A 2HSHA 1EV9A 3Q18A 2BTOT 4GWRA 3BCIA 1X0RA 4G9HA 3HVSA 1OVNA 4K9ZA 4O5UA 3KM6A 4KDXA 3QOUA 3NZNA 1YKCA 4IJIA 3F63A 2L6CA 1GTUA 3M9JA 5JCUA 2OBKA 2LQQA 1UN2A 4V2LA 5JCWA 4F9ZA 1AW9A 4NHWA 3UAPA 3W6GA 3WGEA 3E3EA 3TKSE 3FEUA 5GSSA 2HLSA 3V1WA 3DRNA 1I9DA 1ILOA 4QL7A 4CY8A 1BEDA 3WGDA 1N2AA 5H5SA 5LNKe 5KOXA 1A0RP 5DBQA 3EINA 1X9WB 2LNSA 1OC3A 3HA9A 3SWLA 4DVCA 4KF9A 4FH8A 3D0ZA 3LXTA 1OC9B 2OKAA 5KN2A 1MDKA 5AIXA 3LQ7A 5IPGA 4IVFA 2HZFA 2CX3A 4O92A 1PKZA 2MBSA 1JLVA 2HNLA 3IOSA 2IMKA 5G31A 5INYA 5J9BA 1EEJA 3TKQA 2D2ZA 5IM9A 4XS4A 1V98A 2HSYA 2MMAA 4MABA 1XVQA 4AJ6A 3ZVJD 4DEJA 4NWYA 1K3YA 3F3RA 1RK4A 4L8EA 4WF5A 4JRRA 2IL3A 4POLA 1A8LA 5HFIA 1S3DA 2N5BA 1T8EB 1SL2B 1XW6A 1M9BA 2KLXA 2BMXA 2OE1A 5ECRB 1QQ2A 4KNDA 1YF1A 1TK5B 3KXOA 1OKDA 1GSEA 1XPVA 2VL2A 3KEBA 1RW1A 1WP0A 5CYYA 4YAVA 4MJBA 4DSSB 1F37A 1H4OA 2YNXA 1VRSD 1K0OA 3A5WA 3BCKA 5J4UA 4DSRA 3ZFLA 2ALBA 2FHEA 2HZEA 2NDOA 2OACA 2GSRA 1PRXA 4TR1A 3GYKA 1S3CA 1AXDA 1JZRA 3E9JB 1B9YC 2HSMA 3LORA 3FK8A 4QQ7A 1HQOA 1MD4A 4KCAA 1J0FA 4GTUA 4ISDA 1YQ1A 2IIYA 3TDGA 2RIIA 1Z7RA 2A2SA 2QA1A 4HUAA 1XWBA 5D93A 5IIZA 1HNAA 5B7CA 2OE0A 5ID2A 3APSA 4FYBA 2WB9A 4J57E 2ZUPA 2HE3A 3ISOA 2K18A 2GTUA 3N5OA 2L4QA 1FB6A 1TDIA 1WJKA 2X49A 4HQZA 5DCGA 2IWTA 3A2XA 1A2MA 2F9SA 1X5EA 1VF1A 1X9MB 2VLTA 5F06A 5EL8A 4ZB8A 3FYGA 6GSUA 4OFMA 1LJRA 1JZOA 3GKMA 1YEXA 2CT6A 1R7HA 2X64A 3KH9A 1DE2A 4JU5A 4TR0A 4MJCA 2GSTA 2TIRA 5DAKA 1OE7A 2YCDA 3WD6A 2FA8A 4RI7A 2VM2A 1FOVA 2B5XA 3HVXA 1EWXA 4X0XA 4ZL7A 3GA4A 1SYRA 3CTFA 1LU4A 3TKPA 2PU9C 4KB3A 1ERWA 2WJUA 1QGVA 4ML6A 1PN9A 1KNGA 1AC1A 4ZB9A 3KP8A 5H5RA 4P3YB 2NTOA 1A2LA 2I3YA 2NVLA 2DIZA 4KE3A 5FWGA 4TKYA 4BVXA 1FVKA 1XOBA 2E2MA 1KEBA 1O7UA 4XRDA 5JCGA 4RQRA 5E59A 4OMVA 3J7Yb 3UMAA 2H1BA 4KUNA 3QFAC 4KSMA 1TRSA 2LRTA 2REMA 3VPTA 2P31A 4G0KA 3RPPA 3GHAA 4V2NA 3D4MA 2GQKA 5G1LA 4MJEA 3HCZA 1BYEA 4NPBA 3ZFBA 2TRCP 1JZWA 2IFQB 2R0PA 5IMVA 4RQXA 1Y6EA 3IAM2 3DKSA 3HVVA 2YANA 1ML6A 1EP8A 1GSSA 4MF6A 2JSZA 5J5NA 2VLVA 3DD3A 2XHFA 3FR3A 3DWVA 1C72A 2YN1A 1QXHA 1YKAA 4JE1A 3RDWA 1XCCA 1NHOA 1ST9A 1M7TA 1V2AA 5ECNB 5L71A 1G6YA 2CVBA 3EPTA 2LSTA 4AF2A 5COHA 2AHEA 1FO5A 1R5PA 4G2EA 3N9JA 3M8NA 3CBUA 1CQGA 4MNNA 2E2GA 3IBHA 3K8NA 3CYNA 4EDYA 4O5QA 1SKWB 1K0BA 4LMVA 2CZ3A 2DKHA 3F4TA 5ECKB 1GSDA 5AGYA 2BJXA 1FOHA 3ED3A 3M3MA 2R37A 1Z7PA 1A8YA 1THOA 1DBYA 3D5JA 4IGJA 2E7PA 4WF4A 2OE3A 1BG5A 2R3XA 5GZZB 3RAZA 2LRNA 4ZBBA 1TRVA 4ULXA 3CXGA 3WT1A 3PR8A 1SD8A 5IPHA 2L5LA 3IV4A 1YDKA 2C3TA 1XXUA 3APQA 2A4VA 2FWFA 3L78A 5A5KA 4IHUA 2FD3A 4ZBDA 1K0DA 1Z9HA 1SK1A 4N0VA 1JFUA 3HY2A 4V2MA 5DQYA 2HFDA 2RUFA 4MP4A 1YEPA 1A24A 1TK0B 3O3TA 2VO4A 3M0FA 3UVHA 3MWHA 2JSYA 1WRYA 5C04A 2IMDA 3M9KA 5BMUA 2I9HA 4BVYA 4K0NA 2ZCTA 4QL9A 5EPFA 4GSNA 4V1Ap 3FR6A 1KBNA 1U3IA 4N10A 1X5DA 2PN8A 4F2IA 4HJMA 4Z2RA 4I2UA 1YF0A 2AUVA 2HYXA 2YWOA 3IE3A 5B8BA 4ML1A 4TXVA 3DMLA 4CY6A 1K0NA 2X8HA 1OKTA 1ZMAA 3TUEA 1O6JA 3BJ5A 1XW9A 1O73A 3IRAA 2YOIA 4D73B 4K5RA 2K9FA 5IO2A 3HD5A 3TRQA 3GRXA 6GSXA 1GUKA 4PUAA 2H75A 2LJAA 3GKNA 1U6TA 2LRCA 3TJJA 1ERUA 4V1Ag 2I1UA 2F8AA 3H93A 1SJIA 2WULA 3EU3A 2L57A 3F3QA 2H1GA 1F2EA 5AISA 2RM5A 2GZPA 3EYTA 3QDNA 3QFBC 10GSA 1VF2A 1OYJA 1AUCA 5CRHA 2KP2A 3W8SA 3I43A 4NMUA 2H71A 2LTKA 6GSSA 1T4ZA 2C80A 2DIYA 1TU8A 1HYUA 4MZWA 3GIXA 3KMOA 11GSA 3L9SA 2GQLA 2JL4A 3IR4A 14GSA 4JBBA 3AY8A 1R26A 1ON4A 1BJXA 4WR4A 17GSA 3IC4A 1N8JA 2CAIA 1M9AA 4EL1A 4HOJA 2YWNA 2JZTA 3PINA 3L9UA 3VK9A 1UC7A 2VUPA 3VFIA 1T4YA 4J56E 2H19A 4TXOB 2X4AA 1XWCA 4XTSA 4OFNA 3BD2A 3H8QA 4Q5NA 2PBJA 4I5QA 1M2AA 4JR4A 4LA1A 3F8UA 4DSQA 5CAXA 1WMJA 1F6MC 2H70A 4FYUA 4X4JA 2OBIA 2RM6A 2C4JA 3HZ4A 1Z5YE 3G7YA 4NHZA 3QD9A 4MZCA 3UVTA 12GSA 2JADA 3FZAA 3QAGA 3IHGA 4YKGA 4F0CA 1GNEA 5D8IA 3C8EA 3PH9A 2GVPA 2WS2A 1PL1A 3VWWA 4GQFA 4IJ3A 2YP6A 2HZEB 3GSSA 1TOFA 4TR1B 5ABRA 3HJPA 3P8WA 4ZL9A 5AIVA 1FG4A 1GULA 3HDCA 4TVEA 2H6XA 4MMMA 2VL3A 4JR6A 3GX8A 3EMPA 3D4TA 2AB6A 1DUGA 1PQNA 3ZLPA 1V57A 5DDLA 4EXJA 2H0GA 4POBA 1GWCA 1FW1A 4IQ1A 3TGZA 1VGLA 3LSZA 2Z9SA 2P0GA 5ECPB 2J9HA 3GKXA 2FWGA 4LMWA 5C00A 1A2JA 3FZ4A 4MPFA 3FRCA 4HJ2A 2O8VB 3MNGA 4RUVA 3TOUA 2VD1A 1SKRB 3ZTLA 2ON7A 1TKDB 4PX1A 4NAXA 2DJ1A 3E0UA 1ZYPA 1GTBA 4PGTA 2VOCA 3D6IA 4KH7A 3G7JA 2H1DA 3F6FA 3GN3A 4KSOA 1SJZA 2DKIA 1TW9A 4AJ7A 3UEMA 3UJ1A 1ZCPA 2DJJA 3NOFA 1WIKA 2OA7A 2L5OA 3F9UA 5B8AA 4HZ4A 4BL7B 3JCML 1WE0A 3DYRA 5IMFA 5J41A 1AQXA 3A2WA 3LW9A 1PL2A 9GSSA 5HR0A 4YAPA 3IDVA 2B1KA 1GNWA 5HFKA 1GH2A 3GMFA 1Z3EA 1XBSA 1TI1A 3QCPA 4NXIA 4F0BA 4DSSA 4ECBA 2G2QA 1K3OA 5B6NA 5EY6A 4K7OA 2V6KA 5G5FA 4HU9A 4BVXB 2CX4A 1V9WA 2EIQA 3PGTA 1PKWA 3TJFA 2P5RA 5ECMB 1TJDA 2WZ9A 2R4VA 4EO3A 4HU7A 2FNOA 2HRKA 3R3EA 2I4AA 4IBPA 4X1UA 3TJKA 3L4NA 3NIVA 5KN0A 2C0EA 3CRUA 4HZ2A 4KX4A 5D9WA 2A2RA 3GH9A 3ME7A 4AGSA 5CREA 5G5EA 4IKHA 4RI6A 1NW2A 5HR2A 2O87A 4OCEA 5ECHB 3EMXA 2FLSA 3MSZA 4G19A 4N0ZA 1DE1A 4IQAA 2CAQA 3H1NA 3TJBA 3VLNA 1MEKA 2DJKA 3MAKA 4MDCA 5D73A 4XIHA 4XRAA 1MTCA 3G9BA 4LLRA 2B7KA 2LQOA 4GRFA 3DGQA 4LL1B 4EIPA 1QUWA 2L59A 3TJGA 5ENUA 3LFLA 3D21A 2LJKA 3DVXA 3US3A 4GSTA 1G6WA 5GAPD 6GSVA 2CZ2A 2PMTA 4GQCA 1K0AA 4HI7A 1Z6MA 2YV9A 5DALB 3VWUA 4YH2A 3MDKA 2PGTA 1X9SB 2H72A 4HS1A 2X8CA 4X43A 19GSA 1FAAA 2VCTA 3H79A 4BWQA 1B8XA 1UA5A 3TKRA 5ECSA 2WCIA 4POKA 13GSA 2R2JA 2DMLA 4PXOA 2HT9A 2B1LA 3C7MA 3WYWA 3GTUB 4O7HA 1WOUA 3F6DA 5CRDA 18GSA 4PURA 3LYKA 4USSA 3MYDA 5CP1A 2FUG2 2E0QA 2JACA 3F4SA 4K7NA 1XVWA 1AAZA 4EF0A 5DVBA 3TKSC 1F3BA 1GTAA 3LXZA 4OO4A 4BVYB 3IK7A 2EIRA 3FKFA 2C8UA 2H6YA 4MH3A 3MIXA 1YJ6A 1WPIA 5JWRB 3QAWA 2R0GA 1OAZA 2DJ2A 1EP7A 1O85A 3KTBA 2V32A 2YWMA 5J3RA 1XFLA 5A4VA 4Z2TA 2PWJA 2K8VA 1BAYA 4XS6A 2WGRA 4H86A 4L0UA 5IMDA 4ICYA 5ECLB 2LUSA 4FQUA 2IMFA 3Q74A 2GSQA 1SK0A 2MZCA 2O85A 3C1RA 2QGVA 2N5AA 1CQHA 5CRGA 1ZGNA 5HR1A 1GLQA 3KZQA 4Z7XA 5H5QA 1K0CA 3APOA 5EVOA 3EVIA 1IYHA 3HJMA 4F03A 1THXA 4IS0A 1GUMA 5IMAA 2GT6A 1KTEA 4MK3A 4K6XA 4JZQA 4PQIA 5JWQB 2A4HA 3Q6OA 3IA1A 5IMCA 2WRTA 4OFTA 4TW5A 1FB0A 2OADA 4HQSA 4N11A 1O81A 1MDIA 4HDEA 4K2DA 5ECIB 5D9VA 3QMXA 5ECOB 3R2QA 2A2PA 5AN1A 2L4CA 2H0HA 2H66A 2HXKA 4Q5FA 4MF7A 4YQVA 1XWAA 3RHCA 1G0TA 2LJRA 2V41A 1ZOFA 1H75A 2YZUA 2G0FA 4ACSA 3DIEA 2KOKA 5D9TA 3VWXA 4WR5A 1TP9A 3KTLA 3GFKA 2PUKC 4MPGA 3FMWA 1EV4A 3KIJA 2C0GA 2XBQA 3KMNA 4ECJA 3I9V2 5HR3A 3P7XA 2M80A 2H73A 2VCXA 2VM1A 1K0MA 2X8GA 1R5AA 3CMIA 1O8XA 4CHSA 6GSWA 3O76A 3W8JA 1GSFA 4IW9A 3C1SA 1SL0B 4ZXGA 1M2DA 4POMA 4KGIA 2O89A 3IPZA 2CV4A 4ID0A 1PD21 4ECCA 4Z2UA 1TTZA 3IAS2 2QC7A 3DXBA 4OD7A 1QMVA 2GZZA 3G7IA 3ZITA 1B4QA 1SU9A 3FW2A 20GSA 2KP1A 2VCZA 2VIMA 4NV2A 1MD3A 4D73A 4WEYA 1F9MA 1ERTA 2CA8A 3OR5A 3TKSA 2FY6A 1XW5A 4XS4B 3C71A 2V6OA 3ZIVA 3VPQA 5F0GA 3ERGA 1HD2A 2H1AA 1A0FA 1T7PB 4ZB6A 2DMMA 3ZIJA 4ZIJA 3FZ9A 2MBTA 1EEMA 4GF0A 2ZNMA 3L0HA 1M0UA 2F8FA 5DQSA 4CDOA 4IELA 1FHEA 5D9XA 3GURA 4K0GA 3EE2A 1NM3A 5E4WA 5BRTA 1TRWA 2FA4A 5CO3A 3ZRDA 1ABAA 2GS3A 1Q98A 1O8WA 1SENA 2DJ0A 3KCMA 2JZSA 2NPBA 3EURA 3GH6A 4PQHA 5FT3A 4MA9A 4KCEA 4GLTA 5KN3A 5DJMA 4TR3A 3HJOA 1I5GA 5IO0A 3EU4A 1PX7A 5G1KA 3LG6A 3ERFA 2MMOA 5LD0A 4TXOA 4WKWA 4K2XA 3KGKA 1URMA 1U3AA 2B3SA 5ID2B 4PNFA 3D22A 4WETA 2ON5A 3IK9A 3LGCA 4LL4B 4L0WA 1PSQA 2HI7A 4K5SA 2H30A 3A3TA 4I97A 3ZREA 3A5IA 3FY7A 1NSWA 4WBRD 2JZRA 5F07A 3CSJA 4CW9A 2HRNA 1X5CA 2H8LA 2VCQA 1OC9A 2B5EA 1GTIA 2FGXA 1PX6A 1V58A 3HZ8A 4EE0A 2GQMA 3P2AA 4L5LA 1GLPA 1T00A 2X99A 4G0IA 3RPNA 4TR4A 2YZHA 5G30A 4N30A 2O7KA 2WDUA 3ZYWA 4FYCA 2RLIA 1B48A 4ZL8A 3UBLA 3EWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LS5 A;  2TRX A;  3S9F A;  1B9X C;  5DAK B;  5CRW A;  2JU5 A;  4ZBA A;  4L5O A;  1A23 A;  3U5R E;  4ILF A;  3TRP A;  3WT2 A;  3DVW A;  1ZYE A;  2VCV A;  1BQ7 A;  1EZK A;  3VI5 A;  2IME A;  1FVJ A;  1U87 A;  2AYT A;  3ME8 A;  3L9V A;  3GUS A;  4I6X A;  5IOW A;  4PUF C;  1UVZ A;  1AQW A;  4XS1 A;  22GS A;  4IN0 A;  1XWK A;  3IHQ A;  3SBC A;  1USB A;  3LYP A;  2VL9 A;  4KAE A;  1TU7 A;  3U6V A;  3BBY A;  3ZML A;  2WFC A;  4MJA A;  2C1Y A;  6GST A;  1SK2 A;  4E8E A;  2QKE A;  5F05 A;  3FZ5 A;  2V2G A;  4IP6 A;  1JLW A;  1EOH A;  2LEG A;  4ZIL A;  1G7E A;  4MF5 A;  2AV4 A;  2DJ3 A;  2K6V A;  3IXR A;  4BA7 A;  4KA0 A;  2R6K A;  3C73 A;  2XC2 A;  1TI3 A;  5ELG A;  1J08 A;  4BL7 A;  1XZO A;  3QR6 A;  3TB2 A;  2B6M A;  3KH7 A;  4KDY A;  1YZX A;  2K8S A;  3UL3 A;  1U88 A;  5KN1 A;  4AJ8 A;  4EC0 A;  2EC4 A;  5ECQ B;  2H0I A;  3F4R A;  3I69 A;  2YJH A;  2PPT A;  3GNJ A;  1TK8 B;  2FWH A;  4MCU A;  7GSS A;  8GSS A;  4K1F A;  2AJQ B;  5IMZ A;  4GXZ A;  5D96 A;  2EIO A;  2H74 A;  4Q5Q A;  4TN8 A;  1VF3 A;  3QPM A;  4NV5 A;  3EC3 A;  3HKR A;  2DSA A;  3P90 A;  1XOA A;  2I81 A;  1R4W A;  2PVQ A;  5KEJ A;  1GSU A;  4Q5R A;  2J23 A;  1E6B A;  3CSH A;  1JZD A;  5CNW A;  1Y25 A;  6GSY A;  2OJL A;  2H01 A;  2YPM A;  3UAR A;  5J9C A;  1XWG A;  3QAV A;  2MMN A;  1EGR A;  5F8B A;  3LEF A;  5GST A;  2C0F A;  1TRU A;  3H4K A;  2QSI A;  2GZY A;  1WWJ A;  3M1G A;  2C3N A;  2XPD A;  3GX0 A;  2N5F A;  3UIW A;  1EOG A;  1PMT A;  3I6A A;  2YJ7 A;  2GDR A;  5ELA A;  1E2Y A;  4OO5 A;  4K7I A;  1SYX A;  2XBI A;  4TRX A;  3GST A;  4MLY A;  2LKU A;  1IYI A;  1SJ6 A;  1SKS B;  2CQ9 A;  2AAW A;  1QK8 A;  2IJY A;  2V1M A;  5B6M A;  1G7O A;  1VF4 A;  3GV1 A;  2H76 A;  2HRF A;  4BPY A;  2LNT A;  2KUC A;  2CVK A;  1NHY A;  2GGT A;  2IPA A;  3CSI A;  1GUH A;  4YQU A;  1HNB A;  4J2F A;  1RQM A;  3GL3 A;  5DCH A;  3TCO A;  4WXT A;  1Q4J A;  1OE8 A;  1QFN A;  4FIW A;  1EGO A;  1PA3 A;  1GSY A;  1W4V A;  5JWO B;  3RBT A;  2GSS A;  2RUE A;  1TXX A;  5GAN D;  3CTG A;  2IFQ A;  4OCF A;  1S3A A;  5G2Z A;  4G10 A;  5LCZ A;  1V40 A;  1AIU A;  5DAL A;  3HYP A;  2PER A;  2GLR A;  3VUR A;  5HFG A;  2YWI A;  1LBK A;  1SD9 A;  2B5Y A;  3VI7 A;  2FCH A;  2R5G A;  4F82 A;  1YY7 A;  2H6Z A;  3RHB A;  4KDU A;  3FHK A;  3GTU A;  1T3B A;  4TOP A;  2B7J A;  4OWY A;  1M2B A;  3Q19 A;  2IMI A;  2M46 A;  4BWS A;  2P5Q A;  1T1V A;  4PQ1 A;  1BX9 A;  2C3Q A;  4O32 A;  5FHI A;  2YV7 A;  1W89 A;  4I2T A;  4I8B A;  3FR9 A;  2VCW A;  4JED A;  1HNC A;  3O6T A;  4GCI A;  2MYG A;  3ERW A;  2KHP A;  1GSQ A;  2IN3 A;  2F3M A;  3KD0 A;  4PNG A;  4HEA 2;  2VAF A;  2F51 A;  2CVD A;  4MZB A;  5IQY A;  3F0I A;  1ZL9 A;  4E8H A;  1ZYQ B;  3GL5 A;  3ZMK A;  3J7Y k;  2DLX A;  4KW6 A;  2GT5 A;  3VWV A;  1ERV A;  3KP9 A;  1AQV A;  2C0D A;  3UOM A;  3CRT A;  3ZZX A;  4K8M A;  3BOA A;  1PGT A;  3HXS A;  2VL2 C;  2VLU A;  4ECI A;  5A4W A;  2LV3 A;  1J9B A;  4GSS A;  1K3L A;  3WGX A;  5DJL A;  1Z6N A;  2MMZ A;  2FWE A;  3TRX A;  3UBK A;  4EKZ A;  1MDJ A;  2DBC A;  3KJY A;  2L6D A;  2VD0 A;  5A4U A;  4EUY A;  4MH2 A;  3ZVJ A;  1GRX A;  2NBS A;  3A2V A;  4YQM A;  1DSB A;  1M99 A;  4WBJ A;  4O5R A;  1SL1 B;  1GL8 A;  4FO5 A;  4EVM A;  5IOX A;  1ZZY A;  4IP1 A;  1F3A A;  3LWA A;  5HQP A;  4EDZ A;  3DEX A;  1B4P A;  2M72 A;  3HHV A;  2ES7 A;  3LJR A;  1ACV A;  4XHM A;  4XCS A;  3GKK A;  1GP1 A;  3TOT A;  1JHB A;  1OC8 A;  2PVO C;  2XPE A;  3ZL5 A;  1XIY A;  16GS A;  2DC5 A;  2HSH A;  1EV9 A;  3Q18 A;  2BTO T;  4GWR A;  3BCI A;  1X0R A;  4G9H A;  3HVS A;  1OVN A;  4K9Z A;  3KM6 A;  4KDX A;  3QOU A;  3NZN A;  1YKC A;  4IJI A;  3F63 A;  2L6C A;  1GTU A;  3M9J A;  5JCU A;  2OBK A;  2LQQ A;  1UN2 A;  4V2L A;  5JCW A;  4F9Z A;  1AW9 A;  4NHW A;  3UAP A;  3W6G A;  3WGE A;  3E3E A;  3TKS E;  3FEU A;  5GSS A;  2HLS A;  3V1W A;  3DRN A;  1I9D A;  1ILO A;  4QL7 A;  1BED A;  3WGD A;  1N2A A;  5H5S A;  5LNK e;  1A0R P;  5DBQ A;  3EIN A;  1X9W B;  2LNS A;  1OC3 A;  3HA9 A;  3SWL A;  4DVC A;  4FH8 A;  3D0Z A;  3LXT A;  1OC9 B;  2OKA A;  5KN2 A;  1MDK A;  5AIX A;  3LQ7 A;  5IPG A;  4IVF A;  2HZF A;  2CX3 A;  4O92 A;  1PKZ A;  2MBS A;  1JLV A;  2HNL A;  3IOS A;  2IMK A;  5G31 A;  5INY A;  5J9B A;  1EEJ A;  3TKQ A;  2D2Z A;  5IM9 A;  4XS4 A;  1V98 A;  2HSY A;  2MMA A;  4MAB A;  1XVQ A;  4AJ6 A;  3ZVJ D;  4DEJ A;  4NWY A;  1K3Y A;  3F3R A;  1RK4 A;  4L8E A;  4WF5 A;  4JRR A;  2IL3 A;  4POL A;  1A8L A;  5HFI A;  1S3D A;  2N5B A;  1T8E B;  1SL2 B;  1XW6 A;  1M9B A;  2KLX A;  2BMX A;  2OE1 A;  5ECR B;  1QQ2 A;  4KND A;  1YF1 A;  1TK5 B;  3KXO A;  1OKD A;  1GSE A;  1XPV A;  2VL2 A;  3KEB A;  1RW1 A;  1WP0 A;  5CYY A;  4YAV A;  4MJB A;  4DSS B;  1F37 A;  1H4O A;  2YNX A;  1VRS D;  1K0O A;  3A5W A;  3BCK A;  5J4U A;  4DSR A;  3ZFL A;  2ALB A;  2FHE A;  2HZE A;  2NDO A;  2OAC A;  2GSR A;  1PRX A;  4TR1 A;  3GYK A;  1S3C A;  1AXD A;  1JZR A;  3E9J B;  1B9Y C;  3LOR A;  3FK8 A;  4QQ7 A;  1HQO A;  1MD4 A;  4KCA A;  1J0F A;  4GTU A;  4ISD A;  1YQ1 A;  2IIY A;  3TDG A;  2RII A;  1Z7R A;  2A2S A;  4HUA A;  1XWB A;  5D93 A;  5IIZ A;  1HNA A;  5B7C A;  2OE0 A;  5ID2 A;  3APS A;  4FYB A;  2WB9 A;  4J57 E;  2ZUP A;  2HE3 A;  3ISO A;  2K18 A;  2GTU A;  3N5O A;  2L4Q A;  1FB6 A;  1TDI A;  1WJK A;  4HQZ A;  5DCG A;  2IWT A;  3A2X A;  1A2M A;  2F9S A;  1X5E A;  1VF1 A;  1X9M B;  2VLT A;  5F06 A;  5EL8 A;  4ZB8 A;  3FYG A;  6GSU A;  4OFM A;  1LJR A;  1JZO A;  3GKM A;  1YEX A;  2CT6 A;  1R7H A;  2X64 A;  3KH9 A;  1DE2 A;  4JU5 A;  4TR0 A;  4MJC A;  2GST A;  2TIR A;  5DAK A;  1OE7 A;  2YCD A;  3WD6 A;  2FA8 A;  4RI7 A;  2VM2 A;  1FOV A;  2B5X A;  3HVX A;  1EWX A;  4X0X A;  4ZL7 A;  3GA4 A;  1SYR A;  3CTF A;  1LU4 A;  3TKP A;  2PU9 C;  4KB3 A;  1ERW A;  2WJU A;  1QGV A;  4ML6 A;  1PN9 A;  1KNG A;  1AC1 A;  4ZB9 A;  3KP8 A;  5H5R A;  4P3Y B;  2NTO A;  1A2L A;  2I3Y A;  2NVL A;  2DIZ A;  4KE3 A;  5FWG A;  4TKY A;  4BVX A;  1FVK A;  1XOB A;  2E2M A;  1KEB A;  1O7U A;  4XRD A;  5JCG A;  4RQR A;  5E59 A;  4OMV A;  3J7Y b;  3UMA A;  2H1B A;  4KUN A;  3QFA C;  4KSM A;  1TRS A;  2LRT A;  2REM A;  3VPT A;  2P31 A;  3RPP A;  3GHA A;  4V2N A;  3D4M A;  2GQK A;  5G1L A;  4MJE A;  3HCZ A;  1BYE A;  4NPB A;  3ZFB A;  2TRC P;  1JZW A;  2IFQ B;  5IMV A;  4RQX A;  1Y6E A;  3IAM 2;  3DKS A;  3HVV A;  2YAN A;  1ML6 A;  1EP8 A;  1GSS A;  4MF6 A;  2JSZ A;  5J5N A;  2VLV A;  3DD3 A;  2XHF A;  3FR3 A;  3DWV A;  1C72 A;  2YN1 A;  1QXH A;  1YKA A;  4JE1 A;  3RDW A;  1XCC A;  1NHO A;  1ST9 A;  1M7T A;  1V2A A;  5ECN B;  5L71 A;  1G6Y A;  2CVB A;  2LST A;  4AF2 A;  5COH A;  2AHE A;  1FO5 A;  1R5P A;  4G2E A;  3N9J A;  3M8N A;  3CBU A;  1CQG A;  2E2G A;  3IBH A;  3K8N A;  3CYN A;  4EDY A;  1SKW B;  1K0B A;  4LMV A;  2CZ3 A;  3F4T A;  5ECK B;  1GSD A;  2BJX A;  5AGY A;  3ED3 A;  3M3M A;  2R37 A;  1Z7P A;  1A8Y A;  1THO A;  1DBY A;  3D5J A;  4IGJ A;  2E7P A;  4WF4 A;  2OE3 A;  1BG5 A;  2R3X A;  5GZZ B;  3RAZ A;  2LRN A;  4ZBB A;  1TRV A;  4ULX A;  3CXG A;  3WT1 A;  3PR8 A;  1SD8 A;  5IPH A;  2L5L A;  3IV4 A;  1YDK A;  2C3T A;  1XXU A;  3APQ A;  2A4V A;  2FWF A;  3L78 A;  5A5K A;  4IHU A;  2FD3 A;  4ZBD A;  1K0D A;  1Z9H A;  1SK1 A;  4N0V A;  1JFU A;  3HY2 A;  4V2M A;  5DQY A;  2HFD A;  2RUF A;  4MP4 A;  1YEP A;  1A24 A;  1TK0 B;  3O3T A;  2VO4 A;  3M0F A;  3UVH A;  3MWH A;  2JSY A;  1WRY A;  5C04 A;  2IMD A;  3M9K A;  2I9H A;  4BVY A;  4K0N A;  2ZCT A;  4QL9 A;  5EPF A;  4GSN A;  4V1A p;  3FR6 A;  1KBN A;  1U3I A;  4N10 A;  1X5D A;  2PN8 A;  4F2I A;  4HJM A;  4I2U A;  1YF0 A;  2AUV A;  2HYX A;  2YWO A;  3IE3 A;  5B8B A;  4ML1 A;  4TXV A;  3DML A;  1K0N A;  2X8H A;  1OKT A;  1ZMA A;  3TUE A;  1O6J A;  3BJ5 A;  1XW9 A;  1O73 A;  3IRA A;  2YOI A;  4D73 B;  2K9F A;  5IO2 A;  3HD5 A;  3TRQ A;  3GRX A;  6GSX A;  1GUK A;  4PUA A;  2H75 A;  2LJA A;  3GKN A;  1U6T A;  2LRC A;  3TJJ A;  1ERU A;  4V1A g;  2I1U A;  2F8A A;  3H93 A;  1SJI A;  2WUL A;  3EU3 A;  2L57 A;  3F3Q A;  2H1G A;  1F2E A;  5AIS A;  2RM5 A;  2GZP A;  3EYT A;  3QDN A;  3QFB C;  10GS A;  1VF2 A;  1OYJ A;  1AUC A;  5CRH A;  2KP2 A;  3W8S A;  3I43 A;  4NMU A;  2H71 A;  2LTK A;  6GSS A;  1T4Z A;  2C80 A;  2DIY A;  1TU8 A;  1HYU A;  4MZW A;  3GIX A;  3KMO A;  11GS A;  3L9S A;  2GQL A;  2JL4 A;  3IR4 A;  14GS A;  4JBB A;  3AY8 A;  1R26 A;  1ON4 A;  1BJX A;  4WR4 A;  17GS A;  3IC4 A;  1N8J A;  2CAI A;  1M9A A;  4EL1 A;  4HOJ A;  2YWN A;  2JZT A;  3PIN A;  3L9U A;  3VK9 A;  1UC7 A;  2VUP A;  3VFI A;  1T4Y A;  4J56 E;  2H19 A;  4TXO B;  1XWC A;  4XTS A;  4OFN A;  3BD2 A;  3H8Q A;  4Q5N A;  2PBJ A;  4I5Q A;  1M2A A;  4JR4 A;  4LA1 A;  3F8U A;  4DSQ A;  5CAX A;  1WMJ A;  1F6M C;  2H70 A;  4FYU A;  2OBI A;  2RM6 A;  2C4J A;  3HZ4 A;  1Z5Y E;  3G7Y A;  4NHZ A;  3QD9 A;  4MZC A;  3UVT A;  12GS A;  2JAD A;  3FZA A;  3QAG A;  4F0C A;  1GNE A;  5D8I A;  3C8E A;  3PH9 A;  2GVP A;  2WS2 A;  1PL1 A;  3VWW A;  4GQF A;  4IJ3 A;  2YP6 A;  2HZE B;  3GSS A;  1TOF A;  4TR1 B;  5ABR A;  3HJP A;  3P8W A;  4ZL9 A;  5AIV A;  1FG4 A;  1GUL A;  3HDC A;  4TVE A;  2H6X A;  4MMM A;  2VL3 A;  4JR6 A;  3GX8 A;  3EMP A;  3D4T A;  2AB6 A;  1DUG A;  1PQN A;  3ZLP A;  1V57 A;  5DDL A;  4EXJ A;  2H0G A;  4POB A;  1GWC A;  1FW1 A;  4IQ1 A;  3TGZ A;  1VGL A;  3LSZ A;  2Z9S A;  2P0G A;  5ECP B;  2J9H A;  3GKX A;  2FWG A;  4LMW A;  5C00 A;  1A2J A;  3FZ4 A;  4MPF A;  3FRC A;  4HJ2 A;  2O8V B;  3MNG A;  4RUV A;  3TOU A;  2VD1 A;  1SKR B;  3ZTL A;  2ON7 A;  1TKD B;  4PX1 A;  4NAX A;  2DJ1 A;  3E0U A;  1GTB A;  4PGT A;  2VOC A;  3D6I A;  4KH7 A;  3G7J A;  2H1D A;  3F6F A;  3GN3 A;  4KSO A;  1SJZ A;  1TW9 A;  4AJ7 A;  3UEM A;  3UJ1 A;  1ZCP A;  2DJJ A;  3NOF A;  1WIK A;  2OA7 A;  2L5O A;  3F9U A;  5B8A A;  4HZ4 A;  3JCM L;  1WE0 A;  3DYR A;  5IMF A;  5J41 A;  1AQX A;  3A2W A;  1PL2 A;  9GSS A;  5HR0 A;  4YAP A;  3IDV A;  2B1K A;  1GNW A;  5HFK A;  1GH2 A;  3GMF A;  1Z3E A;  1XBS A;  1TI1 A;  3QCP A;  4NXI A;  4F0B A;  4DSS A;  4ECB A;  2G2Q A;  1K3O A;  5B6N A;  5EY6 A;  4K7O A;  2V6K A;  5G5F A;  4HU9 A;  2CX4 A;  1V9W A;  2EIQ A;  3PGT A;  1PKW A;  3TJF A;  2P5R A;  5ECM B;  1TJD A;  2WZ9 A;  2R4V A;  4EO3 A;  4HU7 A;  2FNO A;  2I4A A;  4IBP A;  4X1U A;  3TJK A;  3L4N A;  3NIV A;  5KN0 A;  2C0E A;  3CRU A;  4HZ2 A;  4KX4 A;  5D9W A;  2A2R A;  3GH9 A;  3ME7 A;  4AGS A;  5CRE A;  5G5E A;  4IKH A;  4RI6 A;  1NW2 A;  5HR2 A;  2O87 A;  4OCE A;  5ECH B;  3EMX A;  2FLS A;  3MSZ A;  4G19 A;  4N0Z A;  1DE1 A;  4IQA A;  2CAQ A;  3H1N A;  3TJB A;  3VLN A;  1MEK A;  2DJK A;  3MAK A;  4MDC A;  5D73 A;  4XIH A;  4XRA A;  1MTC A;  3G9B A;  4LLR A;  2B7K A;  2LQO A;  4GRF A;  3DGQ A;  4LL1 B;  1QUW A;  2L59 A;  3TJG A;  5ENU A;  3LFL A;  3D21 A;  2LJK A;  3DVX A;  3US3 A;  4GST A;  1G6W A;  5GAP D;  6GSV A;  2CZ2 A;  2PMT A;  4GQC A;  1K0A A;  4HI7 A;  1Z6M A;  2YV9 A;  5DAL B;  3VWU A;  4YH2 A;  3MDK A;  2PGT A;  1X9S B;  2H72 A;  4HS1 A;  2X8C A;  4X43 A;  19GS A;  1FAA A;  2VCT A;  3H79 A;  4BWQ A;  1B8X A;  1UA5 A;  3TKR A;  5ECS A;  2WCI A;  4POK A;  13GS A;  2R2J A;  2DML A;  4PXO A;  2HT9 A;  2B1L A;  3C7M A;  3WYW A;  3GTU B;  4O7H A;  1WOU A;  3F6D A;  5CRD A;  18GS A;  4PUR A;  3LYK A;  5CP1 A;  2FUG 2;  2E0Q A;  2JAC A;  3F4S A;  4K7N A;  1XVW A;  1AAZ A;  4EF0 A;  5DVB A;  3TKS C;  1F3B A;  1GTA A;  3LXZ A;  4OO4 A;  3IK7 A;  2EIR A;  3FKF A;  2C8U A;  2H6Y A;  4MH3 A;  1YJ6 A;  1WPI A;  5JWR B;  3QAW A;  1OAZ A;  2DJ2 A;  1EP7 A;  1O85 A;  3KTB A;  2V32 A;  2YWM A;  5J3R A;  1XFL A;  5A4V A;  2PWJ A;  2K8V A;  1BAY A;  4XS6 A;  2WGR A;  4H86 A;  4L0U A;  5IMD A;  5ECL B;  2LUS A;  2IMF A;  3Q74 A;  2GSQ A;  1SK0 A;  2MZC A;  2O85 A;  3C1R A;  2QGV A;  2N5A A;  1CQH A;  5CRG A;  1ZGN A;  5HR1 A;  1GLQ A;  3KZQ A;  4Z7X A;  5H5Q A;  1K0C A;  3APO A;  5EVO A;  3EVI A;  1IYH A;  3HJM A;  4F03 A;  1THX A;  4IS0 A;  1GUM A;  5IMA A;  2GT6 A;  1KTE A;  4MK3 A;  4K6X A;  4JZQ A;  4PQI A;  5JWQ B;  3Q6O A;  3IA1 A;  5IMC A;  2WRT A;  4OFT A;  4TW5 A;  1FB0 A;  2OAD A;  4HQS A;  4N11 A;  1O81 A;  1MDI A;  4HDE A;  4K2D A;  5ECI B;  5D9V A;  3QMX A;  5ECO B;  3R2Q A;  5AN1 A;  2L4C A;  2H0H A;  2H66 A;  2HXK A;  4Q5F A;  4MF7 A;  4YQV A;  1XWA A;  3RHC A;  1G0T A;  2LJR A;  2V41 A;  1ZOF A;  1H75 A;  2YZU A;  2G0F A;  4ACS A;  3DIE A;  2KOK A;  5D9T A;  3VWX A;  4WR5 A;  1TP9 A;  3KTL A;  3GFK A;  2PUK C;  4MPG A;  1EV4 A;  3KIJ A;  2C0G A;  2XBQ A;  3KMN A;  4ECJ A;  3I9V 2;  5HR3 A;  3P7X A;  2M80 A;  2H73 A;  2VCX A;  2VM1 A;  1K0M A;  2X8G A;  1R5A A;  3CMI A;  1O8X A;  4CHS A;  6GSW A;  3O76 A;  3W8J A;  1GSF A;  4IW9 A;  3C1S A;  1SL0 B;  4ZXG A;  1M2D A;  4POM A;  4KGI A;  2O89 A;  3IPZ A;  2CV4 A;  4ID0 A;  1PD2 1;  4ECC A;  1TTZ A;  3IAS 2;  2QC7 A;  3DXB A;  4OD7 A;  1QMV A;  2GZZ A;  3G7I A;  3ZIT A;  1B4Q A;  1SU9 A;  3FW2 A;  20GS A;  2KP1 A;  2VCZ A;  2VIM A;  4NV2 A;  1MD3 A;  4D73 A;  4WEY A;  1F9M A;  1ERT A;  2CA8 A;  3OR5 A;  3TKS A;  2FY6 A;  1XW5 A;  4XS4 B;  3C71 A;  2V6O A;  3ZIV A;  3VPQ A;  5F0G A;  3ERG A;  1HD2 A;  2H1A A;  1A0F A;  1T7P B;  4ZB6 A;  2DMM A;  3ZIJ A;  4ZIJ A;  3FZ9 A;  2MBT A;  1EEM A;  4GF0 A;  2ZNM A;  3L0H A;  1M0U A;  2F8F A;  5DQS A;  4CDO A;  4IEL A;  1FHE A;  5D9X A;  3GUR A;  4K0G A;  3EE2 A;  1NM3 A;  5E4W A;  1TRW A;  2FA4 A;  5CO3 A;  3ZRD A;  1ABA A;  2GS3 A;  1Q98 A;  1O8W A;  1SEN A;  2DJ0 A;  3KCM A;  2JZS A;  2NPB A;  3EUR A;  3GH6 A;  4PQH A;  5FT3 A;  4MA9 A;  4KCE A;  4GLT A;  5KN3 A;  5DJM A;  4TR3 A;  3HJO A;  1I5G A;  5IO0 A;  3EU4 A;  1PX7 A;  5G1K A;  3LG6 A;  3ERF A;  2MMO A;  5LD0 A;  4TXO A;  4WKW A;  3KGK A;  1URM A;  1U3A A;  2B3S A;  5ID2 B;  4PNF A;  3D22 A;  4WET A;  2ON5 A;  3IK9 A;  3LGC A;  4LL4 B;  4L0W A;  1PSQ A;  2HI7 A;  2H30 A;  3A3T A;  4I97 A;  3ZRE A;  3FY7 A;  1NSW A;  4WBR D;  2JZR A;  5F07 A;  3CSJ A;  4CW9 A;  2HRN A;  1X5C A;  2H8L A;  2VCQ A;  1OC9 A;  2B5E A;  1GTI A;  2FGX A;  1PX6 A;  1V58 A;  3HZ8 A;  4EE0 A;  2GQM A;  3P2A A;  4L5L A;  1GLP A;  1T00 A;  2X99 A;  3RPN A;  4TR4 A;  2YZH A;  5G30 A;  4N30 A;  2O7K A;  2WDU A;  3ZYW A;  4FYC A;  2RLI A;  1B48 A;  4ZL8 A;  3UBL A;  3EWL A; 
#chains in the Genus database with same CATH topology
 2LS5 A;  2TRX A;  3S9F A;  1B9X C;  5DAK B;  5CRW A;  2JU5 A;  4ZBA A;  4L5O A;  1A23 A;  3U5R E;  4ILF A;  3TRP A;  3WT2 A;  3DVW A;  1ZYE A;  2VCV A;  1BQ7 A;  1PN0 A;  1EZK A;  3VI5 A;  2IME A;  1FVJ A;  1U87 A;  2AYT A;  3ME8 A;  3L9V A;  3GUS A;  4I6X A;  5IOW A;  4PUF C;  1UVZ A;  1AQW A;  4XS1 A;  22GS A;  4IN0 A;  1XWK A;  3IHQ A;  3SBC A;  1M3I A;  1USB A;  3LYP A;  2QA2 A;  2VL9 A;  4KAE A;  1TU7 A;  4EIQ A;  3U6V A;  3BBY A;  3ZML A;  2WFC A;  4MJA A;  2C1Y A;  6GST A;  1SK2 A;  4E8E A;  2QKE A;  5F05 A;  3FZ5 A;  2V2G A;  4IP6 A;  1JLW A;  1EOH A;  2LEG A;  4ZIL A;  1G7E A;  4MF5 A;  2AV4 A;  2DJ3 A;  2K6V A;  3IXR A;  4BA7 A;  4KA0 A;  2R6K A;  3C73 A;  2XC2 A;  1TI3 A;  5ELG A;  1J08 A;  4BL7 A;  1XZO A;  3QR6 A;  3TB2 A;  2B6M A;  3KH7 A;  4KDY A;  1YZX A;  2K8S A;  3UL3 A;  1U88 A;  5KN1 A;  4AJ8 A;  4EC0 A;  2EC4 A;  5ECQ B;  2H0I A;  3F4R A;  3I69 A;  2YJH A;  2PPT A;  3GNJ A;  1TK8 B;  2FWH A;  4MCU A;  7GSS A;  8GSS A;  4K1F A;  2AJQ B;  2HRA A;  5IMZ A;  4GXZ A;  5D96 A;  2EIO A;  2H74 A;  4Q5Q A;  4TN8 A;  1VF3 A;  3QPM A;  4NV5 A;  3EC3 A;  3HKR A;  2DSA A;  3P90 A;  1XOA A;  2I81 A;  1R4W A;  2PVQ A;  5KEJ A;  1GSU A;  4Q5R A;  2J23 A;  1E6B A;  3CSH A;  1JZD A;  5CNW A;  1Y25 A;  6GSY A;  2OJL A;  2H01 A;  2YPM A;  3UAR A;  5J9C A;  1XWG A;  3QAV A;  2MMN A;  1EGR A;  5F8B A;  3LEF A;  5GST A;  2C0F A;  1TRU A;  3H4K A;  2QSI A;  2GZY A;  1ZYN A;  1WWJ A;  3M1G A;  2C3N A;  2XPD A;  3GX0 A;  2N5F A;  3UIW A;  1EOG A;  1PMT A;  3I6A A;  2YJ7 A;  4G0L A;  2GDR A;  5ELA A;  1E2Y A;  4OO5 A;  4K7I A;  1SYX A;  2XBI A;  4A5P A;  4TRX A;  3GST A;  4MLY A;  2LKU A;  1IYI A;  1SJ6 A;  1SKS B;  2CQ9 A;  2AAW A;  1QK8 A;  2IJY A;  4YKF A;  2V1M A;  5B6M A;  1G7O A;  1VF4 A;  3GV1 A;  2H76 A;  2HRF A;  4BPY A;  2LNT A;  2KUC A;  2CVK A;  1NHY A;  2GGT A;  2IPA A;  3CSI A;  1GUH A;  4YQU A;  1HNB A;  4J2F A;  1RQM A;  3GL3 A;  5DCH A;  3TCO A;  4WXT A;  4FIW A;  1Q4J A;  1OE8 A;  1QFN A;  2R0C A;  1EGO A;  1PA3 A;  1GSY A;  1W4V A;  5JWO B;  3RBT A;  2GSS A;  2RUE A;  1TXX A;  5GAN D;  3CTG A;  5KOW A;  2IFQ A;  4OCF A;  1S3A A;  5G2Z A;  4G10 A;  5LCZ A;  1V40 A;  1AIU A;  5DAL A;  3HYP A;  2PER A;  2GLR A;  3VUR A;  5HFG A;  2YWI A;  1LBK A;  1SD9 A;  2B5Y A;  3VI7 A;  2FCH A;  2R5G A;  4F82 A;  1YY7 A;  2H6Z A;  3RHB A;  4KDU A;  3FHK A;  3GTU A;  1T3B A;  4TOP A;  2B7J A;  4OWY A;  1M2B A;  3Q19 A;  2IMI A;  2M46 A;  4BWS A;  2P5Q A;  1T1V A;  4PQ1 A;  1BX9 A;  2C3Q A;  4O32 A;  5FHI A;  2YV7 A;  1W89 A;  4I2T A;  4I8B A;  3FR9 A;  2VCW A;  4JED A;  1HNC A;  3IC8 A;  3O6T A;  4GCI A;  2MYG A;  3ERW A;  2KHP A;  1GSQ A;  2IN3 A;  3PPU A;  2F3M A;  3KD0 A;  4PNG A;  4HEA 2;  2VAF A;  2F51 A;  2CVD A;  4MZB A;  5IQY A;  3F0I A;  1ZL9 A;  4E8H A;  1ZYQ B;  2UZ8 A;  3GL5 A;  3ZMK A;  3J7Y k;  2DLX A;  4KW6 A;  2GT5 A;  1PFO A;  3VWV A;  1ERV A;  3KP9 A;  1AQV A;  2C0D A;  3UOM A;  3CRT A;  3ZZX A;  4K8M A;  3BOA A;  1PGT A;  3HXS A;  2VL2 C;  2VLU A;  4ECI A;  5A4W A;  2LV3 A;  1J9B A;  4GSS A;  1K3L A;  3WGX A;  5DJL A;  1Z6N A;  2MMZ A;  2FWE A;  3TRX A;  3UBK A;  4EKZ A;  1MDJ A;  2DBC A;  3KJY A;  2L6D A;  2VD0 A;  5A4U A;  4EUY A;  4MH2 A;  3ZVJ A;  1GRX A;  2NBS A;  3A2V A;  4YQM A;  1DSB A;  1M99 A;  4WBJ A;  4O5R A;  1SL1 B;  3CQF A;  1GL8 A;  4FO5 A;  4EVM A;  5IOX A;  1ZZY A;  4IP1 A;  1F3A A;  3LWA A;  5HQP A;  4EDZ A;  3DEX A;  1B4P A;  2M72 A;  3HHV A;  2ES7 A;  3LJR A;  1ACV A;  4XHM A;  4XCS A;  3GKK A;  1GP1 A;  3TOT A;  1JHB A;  1OC8 A;  2PVO C;  4PTS A;  2XPE A;  3ZL5 A;  1XIY A;  16GS A;  2DC5 A;  2HSH A;  1EV9 A;  3Q18 A;  2BTO T;  4GWR A;  3BCI A;  1X0R A;  4G9H A;  3HVS A;  1OVN A;  4K9Z A;  4O5U A;  3KM6 A;  4KDX A;  3QOU A;  3NZN A;  1YKC A;  4IJI A;  3F63 A;  2L6C A;  1GTU A;  4HSC X;  3M9J A;  5JCU A;  2OBK A;  2LQQ A;  1UN2 A;  4V2L A;  5JCW A;  4F9Z A;  1AW9 A;  4NHW A;  3UAP A;  3W6G A;  3WGE A;  3E3E A;  3TKS E;  3FEU A;  5GSS A;  2HLS A;  3V1W A;  3DRN A;  1I9D A;  1ILO A;  4QL7 A;  4CY8 A;  1BED A;  3WGD A;  1N2A A;  5H5S A;  5LNK e;  5KOX A;  1A0R P;  5DBQ A;  3EIN A;  1X9W B;  2LNS A;  1OC3 A;  3HA9 A;  3SWL A;  4DVC A;  4KF9 A;  4FH8 A;  3D0Z A;  3LXT A;  1OC9 B;  2OKA A;  5KN2 A;  1MDK A;  5AIX A;  3LQ7 A;  5IPG A;  4IVF A;  2HZF A;  2CX3 A;  4O92 A;  1PKZ A;  2MBS A;  1JLV A;  2HNL A;  3IOS A;  2IMK A;  5G31 A;  5INY A;  5J9B A;  1EEJ A;  3TKQ A;  2D2Z A;  5IM9 A;  4XS4 A;  1V98 A;  2HSY A;  2MMA A;  4MAB A;  1XVQ A;  4AJ6 A;  3ZVJ D;  4DEJ A;  4NWY A;  1K3Y A;  3F3R A;  1RK4 A;  4L8E A;  4WF5 A;  4JRR A;  2IL3 A;  4POL A;  1A8L A;  5HFI A;  1S3D A;  2N5B A;  1T8E B;  1SL2 B;  1XW6 A;  1M9B A;  2KLX A;  2BMX A;  2OE1 A;  5ECR B;  1QQ2 A;  4KND A;  1YF1 A;  1TK5 B;  3KXO A;  1OKD A;  1GSE A;  1XPV A;  2VL2 A;  3KEB A;  1RW1 A;  1WP0 A;  5CYY A;  4YAV A;  4MJB A;  4DSS B;  1F37 A;  1H4O A;  2YNX A;  1VRS D;  1K0O A;  3A5W A;  3BCK A;  5J4U A;  4DSR A;  3ZFL A;  2ALB A;  2FHE A;  2HZE A;  2NDO A;  2OAC A;  2GSR A;  1PRX A;  4TR1 A;  3GYK A;  1S3C A;  1AXD A;  1JZR A;  3E9J B;  1B9Y C;  2HSM A;  3LOR A;  3FK8 A;  4QQ7 A;  1HQO A;  1MD4 A;  4KCA A;  1J0F A;  4GTU A;  4ISD A;  1YQ1 A;  2IIY A;  3TDG A;  2RII A;  1Z7R A;  2A2S A;  2QA1 A;  4HUA A;  1XWB A;  5D93 A;  5IIZ A;  1HNA A;  5B7C A;  2OE0 A;  5ID2 A;  3APS A;  4FYB A;  2WB9 A;  4J57 E;  2ZUP A;  2HE3 A;  3ISO A;  2K18 A;  2GTU A;  3N5O A;  2L4Q A;  1FB6 A;  1TDI A;  1WJK A;  2X49 A;  4HQZ A;  5DCG A;  2IWT A;  3A2X A;  1A2M A;  2F9S A;  1X5E A;  1VF1 A;  1X9M B;  2VLT A;  5F06 A;  5EL8 A;  4ZB8 A;  3FYG A;  6GSU A;  4OFM A;  1LJR A;  1JZO A;  3GKM A;  1YEX A;  2CT6 A;  1R7H A;  2X64 A;  3KH9 A;  1DE2 A;  4JU5 A;  4TR0 A;  4MJC A;  2GST A;  2TIR A;  5DAK A;  1OE7 A;  2YCD A;  3WD6 A;  2FA8 A;  4RI7 A;  2VM2 A;  1FOV A;  2B5X A;  3HVX A;  1EWX A;  4X0X A;  4ZL7 A;  3GA4 A;  1SYR A;  3CTF A;  1LU4 A;  3TKP A;  2PU9 C;  4KB3 A;  1ERW A;  2WJU A;  1QGV A;  4ML6 A;  1PN9 A;  1KNG A;  1AC1 A;  1XG8 A;  4ZB9 A;  3KP8 A;  5H5R A;  4P3Y B;  2NTO A;  1A2L A;  2I3Y A;  2NVL A;  2DIZ A;  4KE3 A;  5FWG A;  4TKY A;  4BVX A;  1FVK A;  1XOB A;  2E2M A;  1KEB A;  1O7U A;  4XRD A;  5JCG A;  4RQR A;  5E59 A;  4OMV A;  3J7Y b;  3UMA A;  2H1B A;  4KUN A;  3QFA C;  4KSM A;  1TRS A;  2LRT A;  2REM A;  3VPT A;  2P31 A;  4G0K A;  3RPP A;  3GHA A;  4V2N A;  3D4M A;  2GQK A;  5G1L A;  4MJE A;  3HCZ A;  1BYE A;  4NPB A;  3ZFB A;  2TRC P;  1JZW A;  2IFQ B;  2R0P A;  5IMV A;  4RQX A;  1Y6E A;  3IAM 2;  3DKS A;  3HVV A;  2YAN A;  1ML6 A;  1EP8 A;  1GSS A;  4MF6 A;  2JSZ A;  5J5N A;  2VLV A;  3DD3 A;  2XHF A;  3FR3 A;  3DWV A;  1C72 A;  2YN1 A;  1QXH A;  1YKA A;  4JE1 A;  3RDW A;  1XCC A;  1NHO A;  1ST9 A;  1M7T A;  1V2A A;  5ECN B;  5L71 A;  1G6Y A;  2CVB A;  3EPT A;  2LST A;  4AF2 A;  5COH A;  2AHE A;  1FO5 A;  1R5P A;  4G2E A;  3N9J A;  3M8N A;  3CBU A;  1CQG A;  4MNN A;  2E2G A;  3IBH A;  3K8N A;  3CYN A;  4EDY A;  4O5Q A;  1SKW B;  1K0B A;  4LMV A;  2CZ3 A;  2DKH A;  3F4T A;  5ECK B;  1GSD A;  5AGY A;  2BJX A;  1FOH A;  3ED3 A;  3M3M A;  2R37 A;  1Z7P A;  1A8Y A;  1THO A;  1DBY A;  3D5J A;  4IGJ A;  2E7P A;  4WF4 A;  2OE3 A;  1BG5 A;  2R3X A;  5GZZ B;  3RAZ A;  2LRN A;  4ZBB A;  1TRV A;  4ULX A;  3CXG A;  3WT1 A;  3PR8 A;  1SD8 A;  5IPH A;  2L5L A;  3IV4 A;  1YDK A;  2C3T A;  1XXU A;  3APQ A;  2A4V A;  2FWF A;  3L78 A;  5A5K A;  4IHU A;  2FD3 A;  4ZBD A;  1K0D A;  1Z9H A;  1SK1 A;  4N0V A;  1JFU A;  3HY2 A;  4V2M A;  5DQY A;  2HFD A;  2RUF A;  4MP4 A;  1YEP A;  1A24 A;  1TK0 B;  3O3T A;  2VO4 A;  3M0F A;  3UVH A;  3MWH A;  2JSY A;  1WRY A;  5C04 A;  2IMD A;  3M9K A;  5BMU A;  2I9H A;  4BVY A;  4K0N A;  2ZCT A;  4QL9 A;  5EPF A;  4GSN A;  4V1A p;  3FR6 A;  1KBN A;  1U3I A;  4N10 A;  1X5D A;  2PN8 A;  4F2I A;  4HJM A;  4Z2R A;  4I2U A;  1YF0 A;  2AUV A;  2HYX A;  2YWO A;  3IE3 A;  5B8B A;  4ML1 A;  4TXV A;  3DML A;  4CY6 A;  1K0N A;  2X8H A;  1OKT A;  1ZMA A;  3TUE A;  1O6J A;  3BJ5 A;  1XW9 A;  1O73 A;  3IRA A;  2YOI A;  4D73 B;  4K5R A;  2K9F A;  5IO2 A;  3HD5 A;  3TRQ A;  3GRX A;  6GSX A;  1GUK A;  4PUA A;  2H75 A;  2LJA A;  3GKN A;  1U6T A;  2LRC A;  3TJJ A;  1ERU A;  4V1A g;  2I1U A;  2F8A A;  3H93 A;  1SJI A;  2WUL A;  3EU3 A;  2L57 A;  3F3Q A;  2H1G A;  1F2E A;  5AIS A;  2RM5 A;  2GZP A;  3EYT A;  3QDN A;  3QFB C;  10GS A;  1VF2 A;  1OYJ A;  1AUC A;  5CRH A;  2KP2 A;  3W8S A;  3I43 A;  4NMU A;  2H71 A;  2LTK A;  6GSS A;  1T4Z A;  2C80 A;  2DIY A;  1TU8 A;  1HYU A;  4MZW A;  3GIX A;  3KMO A;  11GS A;  3L9S A;  2GQL A;  2JL4 A;  3IR4 A;  14GS A;  4JBB A;  3AY8 A;  1R26 A;  1ON4 A;  1BJX A;  4WR4 A;  17GS A;  3IC4 A;  1N8J A;  2CAI A;  1M9A A;  4EL1 A;  4HOJ A;  2YWN A;  2JZT A;  3PIN A;  3L9U A;  3VK9 A;  1UC7 A;  2VUP A;  3VFI A;  1T4Y A;  4J56 E;  2H19 A;  4TXO B;  2X4A A;  1XWC A;  4XTS A;  4OFN A;  3BD2 A;  3H8Q A;  4Q5N A;  2PBJ A;  4I5Q A;  1M2A A;  4JR4 A;  4LA1 A;  3F8U A;  4DSQ A;  5CAX A;  1WMJ A;  1F6M C;  2H70 A;  4FYU A;  4X4J A;  2OBI A;  2RM6 A;  2C4J A;  3HZ4 A;  1Z5Y E;  3G7Y A;  4NHZ A;  3QD9 A;  4MZC A;  3UVT A;  12GS A;  2JAD A;  3FZA A;  3QAG A;  3IHG A;  4YKG A;  4F0C A;  1GNE A;  5D8I A;  3C8E A;  3PH9 A;  2GVP A;  2WS2 A;  1PL1 A;  3VWW A;  4GQF A;  4IJ3 A;  2YP6 A;  2HZE B;  3GSS A;  1TOF A;  4TR1 B;  5ABR A;  3HJP A;  3P8W A;  4ZL9 A;  5AIV A;  1FG4 A;  1GUL A;  3HDC A;  4TVE A;  2H6X A;  4MMM A;  2VL3 A;  4JR6 A;  3GX8 A;  3EMP A;  3D4T A;  2AB6 A;  1DUG A;  1PQN A;  3ZLP A;  1V57 A;  5DDL A;  4EXJ A;  2H0G A;  4POB A;  1GWC A;  1FW1 A;  4IQ1 A;  3TGZ A;  1VGL A;  3LSZ A;  2Z9S A;  2P0G A;  5ECP B;  2J9H A;  3GKX A;  2FWG A;  4LMW A;  5C00 A;  1A2J A;  3FZ4 A;  4MPF A;  3FRC A;  4HJ2 A;  2O8V B;  3MNG A;  4RUV A;  3TOU A;  2VD1 A;  1SKR B;  3ZTL A;  2ON7 A;  1TKD B;  4PX1 A;  4NAX A;  2DJ1 A;  3E0U A;  1ZYP A;  1GTB A;  4PGT A;  2VOC A;  3D6I A;  4KH7 A;  3G7J A;  2H1D A;  3F6F A;  3GN3 A;  4KSO A;  1SJZ A;  2DKI A;  1TW9 A;  4AJ7 A;  3UEM A;  3UJ1 A;  1ZCP A;  2DJJ A;  3NOF A;  1WIK A;  2OA7 A;  2L5O A;  3F9U A;  5B8A A;  4HZ4 A;  4BL7 B;  3JCM L;  1WE0 A;  3DYR A;  5IMF A;  5J41 A;  1AQX A;  3A2W A;  3LW9 A;  1PL2 A;  9GSS A;  5HR0 A;  4YAP A;  3IDV A;  2B1K A;  1GNW A;  5HFK A;  1GH2 A;  3GMF A;  1Z3E A;  1XBS A;  1TI1 A;  3QCP A;  4NXI A;  4F0B A;  4DSS A;  4ECB A;  2G2Q A;  1K3O A;  5B6N A;  5EY6 A;  4K7O A;  2V6K A;  5G5F A;  4HU9 A;  4BVX B;  2CX4 A;  1V9W A;  2EIQ A;  3PGT A;  1PKW A;  3TJF A;  2P5R A;  5ECM B;  1TJD A;  2WZ9 A;  2R4V A;  4EO3 A;  4HU7 A;  2FNO A;  2HRK A;  3R3E A;  2I4A A;  4IBP A;  4X1U A;  3TJK A;  3L4N A;  3NIV A;  5KN0 A;  2C0E A;  3CRU A;  4HZ2 A;  4KX4 A;  5D9W A;  2A2R A;  3GH9 A;  3ME7 A;  4AGS A;  5CRE A;  5G5E A;  4IKH A;  4RI6 A;  1NW2 A;  5HR2 A;  2O87 A;  4OCE A;  5ECH B;  3EMX A;  2FLS A;  3MSZ A;  4G19 A;  4N0Z A;  1DE1 A;  4IQA A;  2CAQ A;  3H1N A;  3TJB A;  3VLN A;  1MEK A;  2DJK A;  3MAK A;  4MDC A;  5D73 A;  4XIH A;  4XRA A;  1MTC A;  3G9B A;  4LLR A;  2B7K A;  2LQO A;  4GRF A;  3DGQ A;  4LL1 B;  4EIP A;  1QUW A;  2L59 A;  3TJG A;  5ENU A;  3LFL A;  3D21 A;  2LJK A;  3DVX A;  3US3 A;  4GST A;  1G6W A;  5GAP D;  6GSV A;  2CZ2 A;  2PMT A;  4GQC A;  1K0A A;  4HI7 A;  1Z6M A;  2YV9 A;  5DAL B;  3VWU A;  4YH2 A;  3MDK A;  2PGT A;  1X9S B;  2H72 A;  4HS1 A;  2X8C A;  4X43 A;  19GS A;  1FAA A;  2VCT A;  3H79 A;  4BWQ A;  1B8X A;  1UA5 A;  3TKR A;  5ECS A;  2WCI A;  4POK A;  13GS A;  2R2J A;  2DML A;  4PXO A;  2HT9 A;  2B1L A;  3C7M A;  3WYW A;  3GTU B;  4O7H A;  1WOU A;  3F6D A;  5CRD A;  18GS A;  4PUR A;  3LYK A;  4USS A;  3MYD A;  5CP1 A;  2FUG 2;  2E0Q A;  2JAC A;  3F4S A;  4K7N A;  1XVW A;  1AAZ A;  4EF0 A;  5DVB A;  3TKS C;  1F3B A;  1GTA A;  3LXZ A;  4OO4 A;  4BVY B;  3IK7 A;  2EIR A;  3FKF A;  2C8U A;  2H6Y A;  4MH3 A;  3MIX A;  1YJ6 A;  1WPI A;  5JWR B;  3QAW A;  2R0G A;  1OAZ A;  2DJ2 A;  1EP7 A;  1O85 A;  3KTB A;  2V32 A;  2YWM A;  5J3R A;  1XFL A;  5A4V A;  4Z2T A;  2PWJ A;  2K8V A;  1BAY A;  4XS6 A;  2WGR A;  4H86 A;  4L0U A;  5IMD A;  4ICY A;  5ECL B;  2LUS A;  4FQU A;  2IMF A;  3Q74 A;  2GSQ A;  1SK0 A;  2MZC A;  2O85 A;  3C1R A;  2QGV A;  2N5A A;  1CQH A;  5CRG A;  1ZGN A;  5HR1 A;  1GLQ A;  3KZQ A;  4Z7X A;  5H5Q A;  1K0C A;  3APO A;  5EVO A;  3EVI A;  1IYH A;  3HJM A;  4F03 A;  1THX A;  4IS0 A;  1GUM A;  5IMA A;  2GT6 A;  1KTE A;  4MK3 A;  4K6X A;  4JZQ A;  4PQI A;  5JWQ B;  2A4H A;  3Q6O A;  3IA1 A;  5IMC A;  2WRT A;  4OFT A;  4TW5 A;  1FB0 A;  2OAD A;  4HQS A;  4N11 A;  1O81 A;  1MDI A;  4HDE A;  4K2D A;  5ECI B;  5D9V A;  3QMX A;  5ECO B;  3R2Q A;  2A2P A;  5AN1 A;  2L4C A;  2H0H A;  2H66 A;  2HXK A;  4Q5F A;  4MF7 A;  4YQV A;  1XWA A;  3RHC A;  1G0T A;  2LJR A;  2V41 A;  1ZOF A;  1H75 A;  2YZU A;  2G0F A;  4ACS A;  3DIE A;  2KOK A;  5D9T A;  3VWX A;  4WR5 A;  1TP9 A;  3KTL A;  3GFK A;  2PUK C;  4MPG A;  3FMW A;  1EV4 A;  3KIJ A;  2C0G A;  2XBQ A;  3KMN A;  4ECJ A;  3I9V 2;  5HR3 A;  3P7X A;  2M80 A;  2H73 A;  2VCX A;  2VM1 A;  1K0M A;  2X8G A;  1R5A A;  3CMI A;  1O8X A;  4CHS A;  6GSW A;  3O76 A;  3W8J A;  1GSF A;  4IW9 A;  3C1S A;  1SL0 B;  4ZXG A;  1M2D A;  4POM A;  4KGI A;  2O89 A;  3IPZ A;  2CV4 A;  4ID0 A;  1PD2 1;  4ECC A;  4Z2U A;  1TTZ A;  3IAS 2;  2QC7 A;  3DXB A;  4OD7 A;  1QMV A;  2GZZ A;  3G7I A;  3ZIT A;  1B4Q A;  1SU9 A;  3FW2 A;  20GS A;  2KP1 A;  2VCZ A;  1M3J A;  2VIM A;  4NV2 A;  1MD3 A;  4D73 A;  4WEY A;  1F9M A;  1ERT A;  2CA8 A;  3OR5 A;  3TKS A;  2FY6 A;  1XW5 A;  4XS4 B;  3C71 A;  2V6O A;  3ZIV A;  3VPQ A;  5F0G A;  3ERG A;  1HD2 A;  2H1A A;  1A0F A;  1T7P B;  4ZB6 A;  2DMM A;  3ZIJ A;  4ZIJ A;  4BIK A;  3FZ9 A;  2MBT A;  1EEM A;  4GF0 A;  2ZNM A;  3L0H A;  1M0U A;  2F8F A;  5DQS A;  4CDO A;  4IEL A;  1FHE A;  5D9X A;  3GUR A;  4K0G A;  3EE2 A;  1NM3 A;  5E4W A;  5BRT A;  1TRW A;  2FA4 A;  5CO3 A;  3ZRD A;  1ABA A;  2GS3 A;  1Q98 A;  1O8W A;  1SEN A;  2DJ0 A;  3KCM A;  2JZS A;  2NPB A;  3EUR A;  3GH6 A;  4PQH A;  5FT3 A;  4MA9 A;  4KCE A;  3HVN A;  4GLT A;  5KN3 A;  5DJM A;  4TR3 A;  3HJO A;  1I5G A;  5IO0 A;  3EU4 A;  1PX7 A;  5G1K A;  3LG6 A;  3ERF A;  2MMO A;  5LD0 A;  4TXO A;  4WKW A;  4K2X A;  3KGK A;  1URM A;  1U3A A;  2B3S A;  5ID2 B;  4PNF A;  3D22 A;  4WET A;  2ON5 A;  3IK9 A;  3LGC A;  4LL4 B;  4L0W A;  1PSQ A;  2HI7 A;  4K5S A;  2H30 A;  3A3T A;  4I97 A;  3ZRE A;  3A5I A;  3FY7 A;  1NSW A;  4WBR D;  2JZR A;  5F07 A;  3CSJ A;  4CW9 A;  1S3R A;  2HRN A;  1X5C A;  2H8L A;  2VCQ A;  1OC9 A;  2B5E A;  1GTI A;  2FGX A;  1PX6 A;  1V58 A;  3HZ8 A;  4EE0 A;  2GQM A;  3P2A A;  4L5L A;  1GLP A;  1T00 A;  2X99 A;  4G0I A;  3RPN A;  4TR4 A;  2YZH A;  5G30 A;  4N30 A;  2O7K A;  2WDU A;  3ZYW A;  4FYC A;  2RLI A;  1B48 A;  4ZL8 A;  3UBL A;  3EWL A; 
#chains in the Genus database with same CATH homology
 2LS5 A;  2TRX A;  3S9F A;  1B9X C;  5DAK B;  5CRW A;  2JU5 A;  4ZBA A;  4L5O A;  1A23 A;  3U5R E;  4ILF A;  3TRP A;  3WT2 A;  3DVW A;  1ZYE A;  2VCV A;  1BQ7 A;  1PN0 A;  1EZK A;  3VI5 A;  2IME A;  1FVJ A;  1U87 A;  2AYT A;  3ME8 A;  3L9V A;  3GUS A;  4I6X A;  5IOW A;  4PUF C;  1UVZ A;  1AQW A;  4XS1 A;  22GS A;  4IN0 A;  1XWK A;  3IHQ A;  3SBC A;  1USB A;  3LYP A;  2QA2 A;  2VL9 A;  4KAE A;  1TU7 A;  4EIQ A;  3U6V A;  3BBY A;  3ZML A;  2WFC A;  4MJA A;  2C1Y A;  6GST A;  1SK2 A;  4E8E A;  2QKE A;  5F05 A;  3FZ5 A;  2V2G A;  4IP6 A;  1JLW A;  1EOH A;  2LEG A;  4ZIL A;  1G7E A;  4MF5 A;  2AV4 A;  2DJ3 A;  2K6V A;  3IXR A;  4BA7 A;  4KA0 A;  2R6K A;  3C73 A;  2XC2 A;  1TI3 A;  5ELG A;  1J08 A;  4BL7 A;  1XZO A;  3QR6 A;  3TB2 A;  2B6M A;  3KH7 A;  4KDY A;  1YZX A;  2K8S A;  3UL3 A;  1U88 A;  5KN1 A;  4AJ8 A;  4EC0 A;  2EC4 A;  5ECQ B;  2H0I A;  3F4R A;  3I69 A;  2YJH A;  2PPT A;  3GNJ A;  1TK8 B;  2FWH A;  4MCU A;  7GSS A;  8GSS A;  4K1F A;  2AJQ B;  2HRA A;  5IMZ A;  4GXZ A;  5D96 A;  2EIO A;  2H74 A;  4Q5Q A;  4TN8 A;  1VF3 A;  3QPM A;  4NV5 A;  3EC3 A;  3HKR A;  2DSA A;  3P90 A;  1XOA A;  2I81 A;  1R4W A;  2PVQ A;  5KEJ A;  1GSU A;  4Q5R A;  2J23 A;  1E6B A;  3CSH A;  1JZD A;  5CNW A;  1Y25 A;  6GSY A;  2OJL A;  2H01 A;  2YPM A;  3UAR A;  5J9C A;  1XWG A;  3QAV A;  2MMN A;  1EGR A;  5F8B A;  3LEF A;  5GST A;  2C0F A;  1TRU A;  3H4K A;  2QSI A;  2GZY A;  1ZYN A;  1WWJ A;  3M1G A;  2C3N A;  2XPD A;  3GX0 A;  2N5F A;  3UIW A;  1EOG A;  1PMT A;  3I6A A;  2YJ7 A;  4G0L A;  2GDR A;  5ELA A;  1E2Y A;  4OO5 A;  4K7I A;  1SYX A;  2XBI A;  4A5P A;  4TRX A;  3GST A;  4MLY A;  2LKU A;  1IYI A;  1SJ6 A;  1SKS B;  2CQ9 A;  2AAW A;  1QK8 A;  2IJY A;  4YKF A;  2V1M A;  5B6M A;  1G7O A;  1VF4 A;  3GV1 A;  2H76 A;  2HRF A;  4BPY A;  2LNT A;  2KUC A;  2CVK A;  1NHY A;  2GGT A;  2IPA A;  3CSI A;  1GUH A;  4YQU A;  1HNB A;  4J2F A;  1RQM A;  3GL3 A;  5DCH A;  3TCO A;  4WXT A;  4FIW A;  1Q4J A;  1OE8 A;  1QFN A;  2R0C A;  1EGO A;  1PA3 A;  1GSY A;  1W4V A;  5JWO B;  3RBT A;  2GSS A;  2RUE A;  1TXX A;  5GAN D;  3CTG A;  5KOW A;  2IFQ A;  4OCF A;  1S3A A;  5G2Z A;  4G10 A;  5LCZ A;  1V40 A;  1AIU A;  5DAL A;  3HYP A;  2PER A;  2GLR A;  3VUR A;  5HFG A;  2YWI A;  1LBK A;  1SD9 A;  2B5Y A;  3VI7 A;  2FCH A;  2R5G A;  4F82 A;  1YY7 A;  2H6Z A;  3RHB A;  4KDU A;  3FHK A;  3GTU A;  1T3B A;  4TOP A;  2B7J A;  4OWY A;  1M2B A;  3Q19 A;  2IMI A;  2M46 A;  4BWS A;  2P5Q A;  1T1V A;  4PQ1 A;  1BX9 A;  2C3Q A;  4O32 A;  5FHI A;  2YV7 A;  1W89 A;  4I2T A;  4I8B A;  3FR9 A;  2VCW A;  4JED A;  1HNC A;  3IC8 A;  3O6T A;  4GCI A;  2MYG A;  3ERW A;  2KHP A;  1GSQ A;  2IN3 A;  3PPU A;  2F3M A;  3KD0 A;  4PNG A;  4HEA 2;  2VAF A;  2F51 A;  2CVD A;  4MZB A;  5IQY A;  3F0I A;  1ZL9 A;  4E8H A;  1ZYQ B;  2UZ8 A;  3GL5 A;  3ZMK A;  3J7Y k;  2DLX A;  4KW6 A;  2GT5 A;  3VWV A;  1ERV A;  3KP9 A;  1AQV A;  2C0D A;  3UOM A;  3CRT A;  3ZZX A;  4K8M A;  3BOA A;  1PGT A;  3HXS A;  2VL2 C;  2VLU A;  4ECI A;  5A4W A;  2LV3 A;  1J9B A;  4GSS A;  1K3L A;  3WGX A;  5DJL A;  1Z6N A;  2MMZ A;  2FWE A;  3TRX A;  3UBK A;  4EKZ A;  1MDJ A;  2DBC A;  3KJY A;  2L6D A;  2VD0 A;  5A4U A;  4EUY A;  4MH2 A;  3ZVJ A;  1GRX A;  2NBS A;  3A2V A;  4YQM A;  1DSB A;  1M99 A;  4WBJ A;  4O5R A;  1SL1 B;  1GL8 A;  4FO5 A;  4EVM A;  5IOX A;  1ZZY A;  4IP1 A;  1F3A A;  3LWA A;  5HQP A;  4EDZ A;  3DEX A;  1B4P A;  2M72 A;  3HHV A;  2ES7 A;  3LJR A;  1ACV A;  4XHM A;  4XCS A;  3GKK A;  1GP1 A;  3TOT A;  1JHB A;  1OC8 A;  2PVO C;  4PTS A;  2XPE A;  3ZL5 A;  1XIY A;  16GS A;  2DC5 A;  2HSH A;  1EV9 A;  3Q18 A;  2BTO T;  4GWR A;  3BCI A;  1X0R A;  4G9H A;  3HVS A;  1OVN A;  4K9Z A;  4O5U A;  3KM6 A;  4KDX A;  3QOU A;  3NZN A;  1YKC A;  4IJI A;  3F63 A;  2L6C A;  1GTU A;  3M9J A;  5JCU A;  2OBK A;  2LQQ A;  1UN2 A;  4V2L A;  5JCW A;  4F9Z A;  1AW9 A;  4NHW A;  3UAP A;  3W6G A;  3WGE A;  3E3E A;  3TKS E;  3FEU A;  5GSS A;  2HLS A;  3V1W A;  3DRN A;  1I9D A;  1ILO A;  4QL7 A;  4CY8 A;  1BED A;  3WGD A;  1N2A A;  5H5S A;  5LNK e;  5KOX A;  1A0R P;  5DBQ A;  3EIN A;  1X9W B;  2LNS A;  1OC3 A;  3HA9 A;  3SWL A;  4DVC A;  4KF9 A;  4FH8 A;  3D0Z A;  3LXT A;  1OC9 B;  2OKA A;  5KN2 A;  1MDK A;  5AIX A;  3LQ7 A;  5IPG A;  4IVF A;  2HZF A;  2CX3 A;  4O92 A;  1PKZ A;  2MBS A;  1JLV A;  2HNL A;  3IOS A;  2IMK A;  5G31 A;  5INY A;  5J9B A;  1EEJ A;  3TKQ A;  2D2Z A;  5IM9 A;  4XS4 A;  1V98 A;  2HSY A;  2MMA A;  4MAB A;  1XVQ A;  4AJ6 A;  3ZVJ D;  4DEJ A;  4NWY A;  1K3Y A;  3F3R A;  1RK4 A;  4L8E A;  4WF5 A;  4JRR A;  2IL3 A;  4POL A;  1A8L A;  5HFI A;  1S3D A;  2N5B A;  1T8E B;  1SL2 B;  1XW6 A;  1M9B A;  2KLX A;  2BMX A;  2OE1 A;  5ECR B;  1QQ2 A;  4KND A;  1YF1 A;  1TK5 B;  3KXO A;  1OKD A;  1GSE A;  1XPV A;  2VL2 A;  3KEB A;  1RW1 A;  1WP0 A;  5CYY A;  4YAV A;  4MJB A;  4DSS B;  1F37 A;  1H4O A;  2YNX A;  1VRS D;  1K0O A;  3A5W A;  3BCK A;  5J4U A;  4DSR A;  3ZFL A;  2ALB A;  2FHE A;  2HZE A;  2NDO A;  2OAC A;  2GSR A;  1PRX A;  4TR1 A;  3GYK A;  1S3C A;  1AXD A;  1JZR A;  3E9J B;  1B9Y C;  2HSM A;  3LOR A;  3FK8 A;  4QQ7 A;  1HQO A;  1MD4 A;  4KCA A;  1J0F A;  4GTU A;  4ISD A;  1YQ1 A;  2IIY A;  3TDG A;  2RII A;  1Z7R A;  2A2S A;  2QA1 A;  4HUA A;  1XWB A;  5D93 A;  5IIZ A;  1HNA A;  5B7C A;  2OE0 A;  5ID2 A;  3APS A;  4FYB A;  2WB9 A;  4J57 E;  2ZUP A;  2HE3 A;  3ISO A;  2K18 A;  2GTU A;  3N5O A;  2L4Q A;  1FB6 A;  1TDI A;  1WJK A;  2X49 A;  4HQZ A;  5DCG A;  2IWT A;  3A2X A;  1A2M A;  2F9S A;  1X5E A;  1VF1 A;  1X9M B;  2VLT A;  5F06 A;  5EL8 A;  4ZB8 A;  3FYG A;  6GSU A;  4OFM A;  1LJR A;  1JZO A;  3GKM A;  1YEX A;  2CT6 A;  1R7H A;  2X64 A;  3KH9 A;  1DE2 A;  4JU5 A;  4TR0 A;  4MJC A;  2GST A;  2TIR A;  5DAK A;  1OE7 A;  2YCD A;  3WD6 A;  2FA8 A;  4RI7 A;  2VM2 A;  1FOV A;  2B5X A;  3HVX A;  1EWX A;  4X0X A;  4ZL7 A;  3GA4 A;  1SYR A;  3CTF A;  1LU4 A;  3TKP A;  2PU9 C;  4KB3 A;  1ERW A;  2WJU A;  1QGV A;  4ML6 A;  1PN9 A;  1KNG A;  1AC1 A;  4ZB9 A;  3KP8 A;  5H5R A;  4P3Y B;  2NTO A;  1A2L A;  2I3Y A;  2NVL A;  2DIZ A;  4KE3 A;  5FWG A;  4TKY A;  4BVX A;  1FVK A;  1XOB A;  2E2M A;  1KEB A;  1O7U A;  4XRD A;  5JCG A;  4RQR A;  5E59 A;  4OMV A;  3J7Y b;  3UMA A;  2H1B A;  4KUN A;  3QFA C;  4KSM A;  1TRS A;  2LRT A;  2REM A;  3VPT A;  2P31 A;  4G0K A;  3RPP A;  3GHA A;  4V2N A;  3D4M A;  2GQK A;  5G1L A;  4MJE A;  3HCZ A;  1BYE A;  4NPB A;  3ZFB A;  2TRC P;  1JZW A;  2IFQ B;  2R0P A;  5IMV A;  4RQX A;  1Y6E A;  3IAM 2;  3DKS A;  3HVV A;  2YAN A;  1ML6 A;  1EP8 A;  1GSS A;  4MF6 A;  2JSZ A;  5J5N A;  2VLV A;  3DD3 A;  2XHF A;  3FR3 A;  3DWV A;  1C72 A;  2YN1 A;  1QXH A;  1YKA A;  4JE1 A;  3RDW A;  1XCC A;  1NHO A;  1ST9 A;  1M7T A;  1V2A A;  5ECN B;  5L71 A;  1G6Y A;  2CVB A;  3EPT A;  2LST A;  4AF2 A;  5COH A;  2AHE A;  1FO5 A;  1R5P A;  4G2E A;  3N9J A;  3M8N A;  3CBU A;  1CQG A;  4MNN A;  2E2G A;  3IBH A;  3K8N A;  3CYN A;  4EDY A;  4O5Q A;  1SKW B;  1K0B A;  4LMV A;  2CZ3 A;  2DKH A;  3F4T A;  5ECK B;  1GSD A;  5AGY A;  2BJX A;  1FOH A;  3ED3 A;  3M3M A;  2R37 A;  1Z7P A;  1A8Y A;  1THO A;  1DBY A;  3D5J A;  4IGJ A;  2E7P A;  4WF4 A;  2OE3 A;  1BG5 A;  2R3X A;  5GZZ B;  3RAZ A;  2LRN A;  4ZBB A;  1TRV A;  4ULX A;  3CXG A;  3WT1 A;  3PR8 A;  1SD8 A;  5IPH A;  2L5L A;  3IV4 A;  1YDK A;  2C3T A;  1XXU A;  3APQ A;  2A4V A;  2FWF A;  3L78 A;  5A5K A;  4IHU A;  2FD3 A;  4ZBD A;  1K0D A;  1Z9H A;  1SK1 A;  4N0V A;  1JFU A;  3HY2 A;  4V2M A;  5DQY A;  2HFD A;  2RUF A;  4MP4 A;  1YEP A;  1A24 A;  1TK0 B;  3O3T A;  2VO4 A;  3M0F A;  3UVH A;  3MWH A;  2JSY A;  1WRY A;  5C04 A;  2IMD A;  3M9K A;  5BMU A;  2I9H A;  4BVY A;  4K0N A;  2ZCT A;  4QL9 A;  5EPF A;  4GSN A;  4V1A p;  3FR6 A;  1KBN A;  1U3I A;  4N10 A;  1X5D A;  2PN8 A;  4F2I A;  4HJM A;  4Z2R A;  4I2U A;  1YF0 A;  2AUV A;  2HYX A;  2YWO A;  3IE3 A;  5B8B A;  4ML1 A;  4TXV A;  3DML A;  4CY6 A;  1K0N A;  2X8H A;  1OKT A;  1ZMA A;  3TUE A;  1O6J A;  3BJ5 A;  1XW9 A;  1O73 A;  3IRA A;  2YOI A;  4D73 B;  4K5R A;  2K9F A;  5IO2 A;  3HD5 A;  3TRQ A;  3GRX A;  6GSX A;  1GUK A;  4PUA A;  2H75 A;  2LJA A;  3GKN A;  1U6T A;  2LRC A;  3TJJ A;  1ERU A;  4V1A g;  2I1U A;  2F8A A;  3H93 A;  1SJI A;  2WUL A;  3EU3 A;  2L57 A;  3F3Q A;  2H1G A;  1F2E A;  5AIS A;  2RM5 A;  2GZP A;  3EYT A;  3QDN A;  3QFB C;  10GS A;  1VF2 A;  1OYJ A;  1AUC A;  5CRH A;  2KP2 A;  3W8S A;  3I43 A;  4NMU A;  2H71 A;  2LTK A;  6GSS A;  1T4Z A;  2C80 A;  2DIY A;  1TU8 A;  1HYU A;  4MZW A;  3GIX A;  3KMO A;  11GS A;  3L9S A;  2GQL A;  2JL4 A;  3IR4 A;  14GS A;  4JBB A;  3AY8 A;  1R26 A;  1ON4 A;  1BJX A;  4WR4 A;  17GS A;  3IC4 A;  1N8J A;  2CAI A;  1M9A A;  4EL1 A;  4HOJ A;  2YWN A;  2JZT A;  3PIN A;  3L9U A;  3VK9 A;  1UC7 A;  2VUP A;  3VFI A;  1T4Y A;  4J56 E;  2H19 A;  4TXO B;  2X4A A;  1XWC A;  4XTS A;  4OFN A;  3BD2 A;  3H8Q A;  4Q5N A;  2PBJ A;  4I5Q A;  1M2A A;  4JR4 A;  4LA1 A;  3F8U A;  4DSQ A;  5CAX A;  1WMJ A;  1F6M C;  2H70 A;  4FYU A;  4X4J A;  2OBI A;  2RM6 A;  2C4J A;  3HZ4 A;  1Z5Y E;  3G7Y A;  4NHZ A;  3QD9 A;  4MZC A;  3UVT A;  12GS A;  2JAD A;  3FZA A;  3QAG A;  3IHG A;  4YKG A;  4F0C A;  1GNE A;  5D8I A;  3C8E A;  3PH9 A;  2GVP A;  2WS2 A;  1PL1 A;  3VWW A;  4GQF A;  4IJ3 A;  2YP6 A;  2HZE B;  3GSS A;  1TOF A;  4TR1 B;  5ABR A;  3HJP A;  3P8W A;  4ZL9 A;  5AIV A;  1FG4 A;  1GUL A;  3HDC A;  4TVE A;  2H6X A;  4MMM A;  2VL3 A;  4JR6 A;  3GX8 A;  3EMP A;  3D4T A;  2AB6 A;  1DUG A;  1PQN A;  3ZLP A;  1V57 A;  5DDL A;  4EXJ A;  2H0G A;  4POB A;  1GWC A;  1FW1 A;  4IQ1 A;  3TGZ A;  1VGL A;  3LSZ A;  2Z9S A;  2P0G A;  5ECP B;  2J9H A;  3GKX A;  2FWG A;  4LMW A;  5C00 A;  1A2J A;  3FZ4 A;  4MPF A;  3FRC A;  4HJ2 A;  2O8V B;  3MNG A;  4RUV A;  3TOU A;  2VD1 A;  1SKR B;  3ZTL A;  2ON7 A;  1TKD B;  4PX1 A;  4NAX A;  2DJ1 A;  3E0U A;  1ZYP A;  1GTB A;  4PGT A;  2VOC A;  3D6I A;  4KH7 A;  3G7J A;  2H1D A;  3F6F A;  3GN3 A;  4KSO A;  1SJZ A;  2DKI A;  1TW9 A;  4AJ7 A;  3UEM A;  3UJ1 A;  1ZCP A;  2DJJ A;  3NOF A;  1WIK A;  2OA7 A;  2L5O A;  3F9U A;  5B8A A;  4HZ4 A;  4BL7 B;  3JCM L;  1WE0 A;  3DYR A;  5IMF A;  5J41 A;  1AQX A;  3A2W A;  3LW9 A;  1PL2 A;  9GSS A;  5HR0 A;  4YAP A;  3IDV A;  2B1K A;  1GNW A;  5HFK A;  1GH2 A;  3GMF A;  1Z3E A;  1XBS A;  1TI1 A;  3QCP A;  4NXI A;  4F0B A;  4DSS A;  4ECB A;  2G2Q A;  1K3O A;  5B6N A;  5EY6 A;  4K7O A;  2V6K A;  5G5F A;  4HU9 A;  4BVX B;  2CX4 A;  1V9W A;  2EIQ A;  3PGT A;  1PKW A;  3TJF A;  2P5R A;  5ECM B;  1TJD A;  2WZ9 A;  2R4V A;  4EO3 A;  4HU7 A;  2FNO A;  2HRK A;  3R3E A;  2I4A A;  4IBP A;  4X1U A;  3TJK A;  3L4N A;  3NIV A;  5KN0 A;  2C0E A;  3CRU A;  4HZ2 A;  4KX4 A;  5D9W A;  2A2R A;  3GH9 A;  3ME7 A;  4AGS A;  5CRE A;  5G5E A;  4IKH A;  4RI6 A;  1NW2 A;  5HR2 A;  2O87 A;  4OCE A;  5ECH B;  3EMX A;  2FLS A;  3MSZ A;  4G19 A;  4N0Z A;  1DE1 A;  4IQA A;  2CAQ A;  3H1N A;  3TJB A;  3VLN A;  1MEK A;  2DJK A;  3MAK A;  4MDC A;  5D73 A;  4XIH A;  4XRA A;  1MTC A;  3G9B A;  4LLR A;  2B7K A;  2LQO A;  4GRF A;  3DGQ A;  4LL1 B;  4EIP A;  1QUW A;  2L59 A;  3TJG A;  5ENU A;  3LFL A;  3D21 A;  2LJK A;  3DVX A;  3US3 A;  4GST A;  1G6W A;  5GAP D;  6GSV A;  2CZ2 A;  2PMT A;  4GQC A;  1K0A A;  4HI7 A;  1Z6M A;  2YV9 A;  5DAL B;  3VWU A;  4YH2 A;  3MDK A;  2PGT A;  1X9S B;  2H72 A;  4HS1 A;  2X8C A;  4X43 A;  19GS A;  1FAA A;  2VCT A;  3H79 A;  4BWQ A;  1B8X A;  1UA5 A;  3TKR A;  5ECS A;  2WCI A;  4POK A;  13GS A;  2R2J A;  2DML A;  4PXO A;  2HT9 A;  2B1L A;  3C7M A;  3WYW A;  3GTU B;  4O7H A;  1WOU A;  3F6D A;  5CRD A;  18GS A;  4PUR A;  3LYK A;  4USS A;  3MYD A;  5CP1 A;  2FUG 2;  2E0Q A;  2JAC A;  3F4S A;  4K7N A;  1XVW A;  1AAZ A;  4EF0 A;  5DVB A;  3TKS C;  1F3B A;  1GTA A;  3LXZ A;  4OO4 A;  4BVY B;  3IK7 A;  2EIR A;  3FKF A;  2C8U A;  2H6Y A;  4MH3 A;  3MIX A;  1YJ6 A;  1WPI A;  5JWR B;  3QAW A;  2R0G A;  1OAZ A;  2DJ2 A;  1EP7 A;  1O85 A;  3KTB A;  2V32 A;  2YWM A;  5J3R A;  1XFL A;  5A4V A;  4Z2T A;  2PWJ A;  2K8V A;  1BAY A;  4XS6 A;  2WGR A;  4H86 A;  4L0U A;  5IMD A;  4ICY A;  5ECL B;  2LUS A;  4FQU A;  2IMF A;  3Q74 A;  2GSQ A;  1SK0 A;  2MZC A;  2O85 A;  3C1R A;  2QGV A;  2N5A A;  1CQH A;  5CRG A;  1ZGN A;  5HR1 A;  1GLQ A;  3KZQ A;  4Z7X A;  5H5Q A;  1K0C A;  3APO A;  5EVO A;  3EVI A;  1IYH A;  3HJM A;  4F03 A;  1THX A;  4IS0 A;  1GUM A;  5IMA A;  2GT6 A;  1KTE A;  4MK3 A;  4K6X A;  4JZQ A;  4PQI A;  5JWQ B;  2A4H A;  3Q6O A;  3IA1 A;  5IMC A;  2WRT A;  4OFT A;  4TW5 A;  1FB0 A;  2OAD A;  4HQS A;  4N11 A;  1O81 A;  1MDI A;  4HDE A;  4K2D A;  5ECI B;  5D9V A;  3QMX A;  5ECO B;  3R2Q A;  2A2P A;  5AN1 A;  2L4C A;  2H0H A;  2H66 A;  2HXK A;  4Q5F A;  4MF7 A;  4YQV A;  1XWA A;  3RHC A;  1G0T A;  2LJR A;  2V41 A;  1ZOF A;  1H75 A;  2YZU A;  2G0F A;  4ACS A;  3DIE A;  2KOK A;  5D9T A;  3VWX A;  4WR5 A;  1TP9 A;  3KTL A;  3GFK A;  2PUK C;  4MPG A;  3FMW A;  1EV4 A;  3KIJ A;  2C0G A;  2XBQ A;  3KMN A;  4ECJ A;  3I9V 2;  5HR3 A;  3P7X A;  2M80 A;  2H73 A;  2VCX A;  2VM1 A;  1K0M A;  2X8G A;  1R5A A;  3CMI A;  1O8X A;  4CHS A;  6GSW A;  3O76 A;  3W8J A;  1GSF A;  4IW9 A;  3C1S A;  1SL0 B;  4ZXG A;  1M2D A;  4POM A;  4KGI A;  2O89 A;  3IPZ A;  2CV4 A;  4ID0 A;  1PD2 1;  4ECC A;  4Z2U A;  1TTZ A;  3IAS 2;  2QC7 A;  3DXB A;  4OD7 A;  1QMV A;  2GZZ A;  3G7I A;  3ZIT A;  1B4Q A;  1SU9 A;  3FW2 A;  20GS A;  2KP1 A;  2VCZ A;  2VIM A;  4NV2 A;  1MD3 A;  4D73 A;  4WEY A;  1F9M A;  1ERT A;  2CA8 A;  3OR5 A;  3TKS A;  2FY6 A;  1XW5 A;  4XS4 B;  3C71 A;  2V6O A;  3ZIV A;  3VPQ A;  5F0G A;  3ERG A;  1HD2 A;  2H1A A;  1A0F A;  1T7P B;  4ZB6 A;  2DMM A;  3ZIJ A;  4ZIJ A;  3FZ9 A;  2MBT A;  1EEM A;  4GF0 A;  2ZNM A;  3L0H A;  1M0U A;  2F8F A;  5DQS A;  4CDO A;  4IEL A;  1FHE A;  5D9X A;  3GUR A;  4K0G A;  3EE2 A;  1NM3 A;  5E4W A;  5BRT A;  1TRW A;  2FA4 A;  5CO3 A;  3ZRD A;  1ABA A;  2GS3 A;  1Q98 A;  1O8W A;  1SEN A;  2DJ0 A;  3KCM A;  2JZS A;  2NPB A;  3EUR A;  3GH6 A;  4PQH A;  5FT3 A;  4MA9 A;  4KCE A;  4GLT A;  5KN3 A;  5DJM A;  4TR3 A;  3HJO A;  1I5G A;  5IO0 A;  3EU4 A;  1PX7 A;  5G1K A;  3LG6 A;  3ERF A;  2MMO A;  5LD0 A;  4TXO A;  4WKW A;  4K2X A;  3KGK A;  1URM A;  1U3A A;  2B3S A;  5ID2 B;  4PNF A;  3D22 A;  4WET A;  2ON5 A;  3IK9 A;  3LGC A;  4LL4 B;  4L0W A;  1PSQ A;  2HI7 A;  4K5S A;  2H30 A;  3A3T A;  4I97 A;  3ZRE A;  3A5I A;  3FY7 A;  1NSW A;  4WBR D;  2JZR A;  5F07 A;  3CSJ A;  4CW9 A;  2HRN A;  1X5C A;  2H8L A;  2VCQ A;  1OC9 A;  2B5E A;  1GTI A;  2FGX A;  1PX6 A;  1V58 A;  3HZ8 A;  4EE0 A;  2GQM A;  3P2A A;  4L5L A;  1GLP A;  1T00 A;  2X99 A;  4G0I A;  3RPN A;  4TR4 A;  2YZH A;  5G30 A;  4N30 A;  2O7K A;  2WDU A;  3ZYW A;  4FYC A;  2RLI A;  1B48 A;  4ZL8 A;  3UBL A;  3EWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...