1TXXA

Active-site variant of e.coli thioredoxin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCVWCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PROTEIN (THIOREDOXIN)
publication title The CXXC motif: crystal structure of an active-site variant of Escherichia coli thioredoxin.
pubmed doi rcsb
source organism Escherichia coli
total genus 29
structure length 108
sequence length 108
ec nomenclature ec 1.8.-.-:
pdb deposition date 1999-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1txxA00
1R5AA 3VURA 1Q98A 2YWOA 1R5PA 3IR4A 4ZILA 4KSOA 5IMDA 4DSSA 1A8LA 3CSHA 1AIUA 1UA5A 1PN9A 4PUFC 4ISDA 3ZIVA 1YEXA 3C73A 5KN0A 4ILFA 3UVTA 2TRXA 1EZKA 3HVVA 1PSQA 2VUPA 5D9WA 4IHUA 4XRDA 5DVBA 3UIWA 1SK2A 3GTUA 2X64A 2PERA 1NSWA 6GSYA 5JCGA 2B7JA 4V2MA 1MDIA 2OACA 1BG5A 3WT2A 3KMNA 4NHWA 1W4VA 3QFBC 2KP2A 5LCZA 2AHEA 1S3AA 4IN0A 2KUCA 2HI7A 3ERGA 2MYGA 5A4UA 3LEFA 3PGTA 4LL4B 1Z9HA 4V2NA 1EGOA 3RHCA 1WMJA 2YWIA 3DEXA 4XS4A 4JE1A 4MH2A 5JCWA 2B5EA 4OFMA 2CVBA 2KP1A 2X99A 5DCHA 2HXKA 2LTKA 5HFIA 4V2LA 3IXRA 2R3XA 4TR0A 1X9SB 4I6XA 2O8VB 4BA7A 3IK9A 3HJPA 3KTBA 6GSSA 4G2EA 2PWJA 1K0AA 2K6VA 1YY7A 2ON5A 3ZYWA 1FOVA 4YQMA 3TKPA 1BJXA 3GMFA 2L5OA 3GX8A 3CRTA 3ZIJA 1GSUA 1VGLA 1WIKA 2V2GA 2FY6A 2E0QA 5F05A 1O73A 1YF1A 5IM9A 3UL3A 4I2UA 3MAKA 2A4VA 3GYKA 4L8EA 3IE3A 2H73A 1EOHA 2RLIA 2F51A 5D9VA 2I81A 5CO3A 1O6JA 2I1UA 2KOKA 2MZCA 3UVHA 2GZPA 5IQYA 1G0TA 4MP4A 3GX0A 2H0GA 4O7HA 5G1LA 3BJ5A 2V41A 2X8GA 1CQGA 1QK8A 4GLTA 4ZL7A 2VL3A 4KCAA 3V1WA 1GTUA 1GSYA 2H1AA 1TW9A 2E7PA 2C0FA 4F03A 2IMIA 4EDYA 4K7IA 1H75A 1C72A 3P90A 2N5FA 1B48A 4WBRD 2O85A 2RUEA 3IC4A 4TXOB 2PU9C 2LS5A 4PXOA 4XS4B 2LRTA 1FG4A 3U6VA 2AYTA 3FRCA 4EL1A 5DCGA 5EL8A 4ZIJA 3ZRDA 3VWXA 2LRCA 5HR2A 4D73B 4MH3A 5DBQA 1SENA 3IK7A 4HZ2A 2L57A 1YJ6A 3G9BA 3TJFA 2H1DA 1XCCA 2AV4A 5FHIA 2B3SA 1PRXA 1B8XA 3L9UA 4MJCA 4IKHA 2XC2A 2H6YA 2MBTA 2RM5A 2EIRA 2FCHA 1URMA 1WRYA 1YKAA 3APQA 4OO5A 4PURA 2YWMA 5G30A 2GSSA 1V98A 1WWJA 4PX1A 2FWHA 2MBSA 1EV9A 2CX4A 3FY7A 1R7HA 2VCVA 3M3MA 2F9SA 4LA1A 1ZYQB 3L9SA 1HNBA 1XIYA 2L59A 4ML1A 1XWGA 2FGXA 4J2FA 3ERFA 2JU5A 2H74A 3VPTA 5E59A 3GURA 3D22A 2WJUA 2NBSA 1A24A 2FWGA 4GQCA 3KZQA 2ON7A 2L4QA 3KJYA 3TCOA 3TKQA 3ZVJD 3IV4A 4ECIA 3KD0A 4MZWA 3C8EA 5D9TA 3WD6A 2K8VA 4MPGA 2IFQA 1K3YA 2VCTA 5ID2A 1SJIA 3LXZA 3QMXA 4CDOA 5ECPB 2OBIA 1EP8A 3TRQA 2WGRA 3NOFA 5DQSA 2IMDA 2B1LA 1OKTA 1A8YA 3ISOA 1SL0B 4FIWA 1DE1A 3MDKA 1RW1A 4LMVA 5IMZA 3KH9A 5D73A 2CT6A 5J41A 2CA8A 1GRXA 2JACA 1A0RP 3KM6A 2DSAA 4HU7A 2YANA 3KP9A 3L9VA 2JL4A 4OFNA 4BPYA 1J9BA 2P31A 1T4YA 2VD1A 3LYKA 4DEJA 3ZMKA 1F6MC 2NDOA 5ELAA 2L5LA 3M8NA 4E8EA 1WPIA 4MK3A 1QQ2A 3F6FA 2O89A 1V2AA 3HZ4A 3VLNA 1GP1A 8GSSA 5D96A 5CRHA 3MNGA 4POKA 2H66A 4HJ2A 1ZCPA 2GS3A 2C0DA 1WJKA 1ZOFA 1NM3A 2VO4A 3ME7A 5CAXA 5CYYA 2VL2A 2CZ2A 4EXJA 1NHOA 1SKWB 1SKSB 4Q5FA 2H70A 4K7OA 1M2BA 1FVKA 2NTOA 2CQ9A 11GSA 2GT5A 3UBKA 2YJ7A 4PGTA 3TKSC 4OO4A 2C0GA 2VLVA 1UN2A 1I5GA 4XHMA 1PGTA 4WF5A 3VPQA 3L78A 3LORA 2CV4A 3DYRA 1VF3A 1U3IA 3FZAA 3QFAC 5F06A 3ZITA 5A4VA 1ZZYA 1MD4A 2IIYA 4HZ4A 1J08A 2OE3A 1E2YA 1XW5A 4K6XA 4XIHA 4TOPA 1T3BA 3CBUA 1GNWA 3R2QA 3GHAA 4L0WA 3K8NA 2H71A 1SK0A 4XTSA 3W6GA 1GWCA 1UC7A 2GQLA 2TIRA 3EMXA 19GSA 14GSA 3ZZXA 5KN3A 4L5LA 1OE8A 2HYXA 3DIEA 1GSQA 5JWQB 1HNCA 2CVKA 3IAM2 2H0HA 2FD3A 2WB9A 3ED3A 4MJAA 2B5XA 3J7Yk 2VCZA 2GQKA 3UJ1A 5JWRB 3D5JA 3QCPA 5D93A 1PQNA 4MZCA 4ZBDA 4N0VA 4J56E 4N11A 1SK1A 2PUKC 1V58A 4IP1A 1JZWA 5J3RA 4WEYA 3QR6A 2IPAA 1K3OA 4KX4A 4O32A 4OD7A 5KEJA 2R37A 2YPMA 2YWNA 2CX3A 2LJRA 2GVPA 3ZREA 4IW9A 4HQZA 2PPTA 1T4ZA 4POLA 2WFCA 4IJIA 3DKSA 5ECQB 2LKUA 1N2AA 2YZUA 4MJEA 2LV3A 1YEPA 3BCIA 5EVOA 3F0IA 2M80A 3LG6A 5ECHB 1RQMA 4EC0A 2A2SA 3HVXA 2VOCA 2O87A 3P7XA 4I8BA 4K8MA 3M0FA 3EU3A 2C3TA 4KAEA 1VF2A 2YNXA 2GSRA 2VLTA 3F3RA 3DWVA 1XZOA 1T7PB 1XFLA 1SJZA 2ZNMA 2DLXA 2F8FA 3L4NA 3EINA 4ECJA 4OCFA 3CYNA 4JRRA 1DSBA 3HJOA 4PQIA 2WZ9A 3FZ4A 1XPVA 5ECNB 2XBIA 2I9HA 3G7JA 1K0NA 1BAYA 1XWBA 4Z7XA 5CP1A 3CTGA 3Q6OA 5GSTA 3W8SA 2P0GA 3LXTA 4ACSA 1ACVA 1DUGA 3FR9A 5J9BA 4XCSA 2CVDA 4TXOA 4DVCA 2C3NA 1XBSA 3CSIA 4YQVA 1EV4A 2P5QA 3IDVA 3TJGA 5LD0A 1TKDB 3L0HA 1ERVA 4I97A 1MTCA 4MF6A 1TJDA 2IMEA 1TP9A 1LU4A 2IMFA 4D73A 1VF4A 1IYHA 2GZZA 3QDNA 1Z3EA 3E9JB 2H01A 2REMA 2DMMA 1PA3A 3FZ5A 1A2LA 1TI3A 4YAVA 4YQUA 1TTZA 1H4OA 2IWTA 1OKDA 2HZFA 1JHBA 3I6AA 1XWAA 2PVQA 2HZEA 4N10A 4NPBA 3A5WA 2YOIA 3RAZA 1ILOA 1ST9A 2XBQA 2HRNA 2AAWA 1T00A 3NZNA 5IO2A 4GSTA 1EWXA 1Y25A 2BTOT 1X5CA 4NXIA 4EO3A 3C1RA 1SYXA 2DBCA 4X1UA 3QAGA 5AISA 2D2ZA 4L5OA 20GSA 1CQHA 3FKFA 4LMWA 5IIZA 5IMCA 1TDIA 4FO5A 4AGSA 4HJMA 5B7CA 2YN1A 1AUCA 5DAKB 3CSJA 4MA9A 3QPMA 3TJKA 4WR5A 2R6KA 2WRTA 4ID0A 4GXZA 3TOUA 1ERUA 1JFUA 1WOUA 1GH2A 1KEBA 4F9ZA 2JZSA 4F2IA 2XHFA 3UMAA 2V6OA 4AJ8A 1GULA 4FH8A 3QAWA 2VM2A 3CRUA 3EYTA 4KH7A 1ML6A 3F6DA 4WETA 1BQ7A 2FNOA 1G7OA 2OE1A 1AW9A 1W89A 4JBBA 1TK5B 1T1VA 5HR0A 2BMXA 4MF7A 1M9BA 2HZEB 2JZRA 3TB2A 4EKZA 3W8JA 4ZL9A 2VCXA 1FB0A 2C4JA 1I9DA 1TOFA 3N5OA 5ECKB 1JLVA 22GSA 4GQFA 3D21A 3WGEA 3ZL5A 2ALBA 3Q74A 2IN3A 3WGXA 3VFIA 1J0FA 4F0BA 2FA8A 4NHZA 4IBPA 3GL3A 1VF1A 1PL2A 3P2AA 5CREA 3FW2A 1XW9A 4LL1B 4HS1A 1TXXA 4HU9A 5GAND 3VWVA 3H93A 3JCML 16GSA 1MEKA 3C1SA 18GSA 3US3A 3UAPA 2M72A 4N30A 4EF0A 2BJXA 4OMVA 3DGQA 4MF5A 1BYEA 4RUVA 1FAAA 3LFLA 3F63A 4WKWA 1GTAA 4NAXA 3TRPA 2IMKA 2LUSA 2V6KA 2LJAA 1GSSA 4EDZA 5B8BA 3F4SA 5AIVA 1GNEA 1JZRA 2YZHA 2GSQA 4I2TA 1OE7A 2C1YA 4XS6A 4MMMA 1XOBA 1TK0B 1N8JA 1LBKA 2XPDA 3I9V2 1MDKA 4CHSA 1USBA 1TK8B 3I43A 4G19A 2WULA 1YQ1A 4ZB8A 2JSZA 1F3BA 4GSSA 1XWCA 1DE2A 1GUKA 1O85A 1Z7RA 1M0UA 2G0FA 6GSTA 2WDUA 5G2ZA 4PUAA 1GUHA 3RPNA 3D0ZA 3MSZA 4CW9A 2GSTA 4KB3A 4DSRA 1FB6A 2X8CA 4K7NA 1O81A 3GFKA 3LGCA 5EPFA 3DD3A 4K9ZA 4TXVA 4HOJA 3EURA 3GRXA 3G7IA 3BCKA 4KDXA 4O5RA 1XXUA 4K0NA 4KDUA 5L71A 4KCEA 1Z5YE 3VI5A 3H4KA 1K0MA 2L6CA 3GKXA 2F3MA 2HT9A 1B9XC 2R5GA 2A2RA 4IVFA 4NV2A 1YKCA 1AQWA 4IQAA 1FVJA 3HZ8A 2WS2A 2LEGA 3A2XA 4PNGA 4HI7A 2H0IA 1V9WA 3GSSA 3HXSA 2GT6A 1F3AA 3HYPA 4MJBA 2OADA 2FA4A 2QSIA 4TW5A 3ZVJA 1DBYA 2ES7A 3J7Yb 2V32A 2LQOA 5IO0A 2RM6A 2VM1A 4F82A 3D6IA 1AQXA 2DJ0A 1U6TA 3IHQA 4V1Ag 3UOMA 3F4TA 5GSSA 2XPEA 3F3QA 1PD21 2GLRA 5G31A 2DC5A 2JZTA 3SBCA 1EOGA 3LSZA 2H76A 2KLXA 5ENUA 1SKRB 3GN3A 3P8WA 4TVEA 5FWGA 2DJJA 5F0GA 2J9HA 1ERWA 2LNSA 3M9JA 2GZYA 1TU7A 2EC4A 3TKSE 3GL5A 3APOA 5LNKe 3UARA 1SD8A 6GSVA 4ECCA 1V40A 4KGIA 4H86A 5DJLA 3O3TA 2MMOA 1GTBA 2J23A 4OFTA 4KE3A 3RBTA 1EP7A 2OBKA 1K3LA 3GKNA 2FWEA 4K1FA 1EEMA 3N9JA 1VRSD 2TRCP 1Q4JA 1Z6MA 5HQPA 2K8SA 3O76A 2LQQA 5B8AA 3HHVA 17GSA 2K9FA 1SD9A 3HD5A 3LYPA 1IYIA 3QAVA 3KIJA 5HFKA 1O7UA 3GKMA 2DJ3A 3TOTA 3FR3A 3M1GA 4EUYA 4POBA 1X9MB 2H75A 1QGVA 3KTLA 4TR4A 1YZXA 4IS0A 3MWHA 2QC7A 5KN1A 3Q19A 1HYUA 4O92A 2CAIA 5IPGA 5A4WA 1SJ6A 1GLQA 5B6MA 3FEUA 2VL9A 1F37A 1XOAA 3S9FA 2QGVA 3QOUA 1U3AA 3EC3A 4MDCA 4GTUA 1XW6A 1X5EA 3WGDA 3E3EA 4PQHA 1SL1B 2JADA 3KXOA 4DSQA 1U87A 2C8UA 4ZBAA 1G6WA 4KDYA 3KP8A 3M9KA 4BVYA 3KMOA 2AUVA 4K2DA 1Z7PA 2E2MA 5CRDA 3UEMA 1GSDA 1EGRA 3BOAA 3H8QA 2MMZA 1R26A 2F8AA 4WXTA 1KTEA 1ZYEA 5CRGA 1TRSA 3DMLA 2JSYA 6GSUA 4XRAA 5J9CA 3CMIA 2PMTA 2VL2C 4MZBA 1K0BA 3I69A 3ME8A 3ZMLA 5DAKA 1A2MA 2K18A 2YCDA 2OA7A 4RI6A 5HR3A 3GKKA 5HFGA 2E2GA 3GNJA 5INYA 4JR6A 1ON4A 1X0RA 2PGTA 4PNFA 1HQOA 2OKAA 5ABRA 1GUMA 3ERWA 4RI7A 1TU8A 3OR5A 4HEA2 3UBLA 3SWLA 2YP6A 2CZ3A 2H6XA 5G5EA 4AJ6A 5FT3A 2C80A 4BWQA 1YF0A 2DJ1A 1F9MA 3WYWA 1HNAA 2GQMA 2H1GA 3LQ7A 4GSNA 2N5AA 3ZFLA 4DSSB 2ZCTA 1QMVA 2L4CA 1ZMAA 5HR1A 3EU4A 2B7KA 4QQ7A 2ZUPA 4Q5RA 4TN8A 3HJMA 2EIQA 1K0DA 1OYJA 2H72A 1SYRA 4KW6A 1E6BA 1S3DA 4ECBA 1HD2A 4GRFA 2OJLA 4ZB6A 2B6MA 4NV5A 2M46A 3GIXA 2GTUA 1QUWA 1OC3A 2PVOC 3PINA 5IMFA 5DQYA 1QXHA 3PH9A 2HE3A 3GTUB 1KBNA 2DJ2A 1MD3A 1SU9A 4KNDA 1FW1A 3ZTLA 3G7YA 4ZB9A 3RPPA 1XWKA 1M7TA 4NMUA 1TRVA 2I4AA 2YV7A 2I3YA 3FYGA 2DIZA 4WR4A 4RQRA 5AIXA 1NW2A 2KHPA 2HLSA 3VI7A 3RHBA 3LWAA 1B9YC 1M2DA 1OVNA 1PL1A 3TJJA 1AXDA 5CNWA 3GH6A 3A2VA 1MDJA 1OAZA 1AQVA 1KNGA 3VWUA 1GSEA 3H79A 1B4PA 3U5RE 5F07A 2FLSA 4HUAA 1GLPA 4EE0A 4MLYA 3TKSA 5IOXA 1XVQA 5IOWA 5D8IA 1B4QA 4ZBBA 4GF0A 1JZOA 2MMNA 2GDRA 4FYBA 3IAS2 2FWFA 4HQSA 3IBHA 1G7EA 3APSA 1OC8A 4AF2A 1TRWA 1Z6NA 2R4VA 5EY6A 4K0GA 5ECIB 2GGTA 2MMAA 1A0FA 3PR8A 10GSA 2HSHA 2H1BA 3VWWA 1PMTA 1GSFA 1WP0A 2VCWA 2LJKA 2O7KA 2DMLA 4QL9A 3EVIA 4G10A 1RK4A 4TR3A 5J4UA 3HKRA 2B5YA 2DIYA 3RDWA 5GZZB 4FYCA 4OCEA 3QD9A 4MPFA 3DVXA 1QFNA 1ZL9A 1F2EA 3FZ9A 1ZGNA 3D4MA 2N5BA 1UVZA 4YH2A 4IP6A 4BWSA 2L6DA 3DVWA 4WBJA 3TDGA 3O6TA 3D4TA 5COHA 3GUSA 5A5KA 2RIIA 4ZL8A 5JCUA 3F4RA 2LNTA 4RQXA 3HCZA 6GSWA 3TKRA 1V57A 1ABAA 3EWLA 4IGJA 1JZDA 1WE0A 2C3QA 1YDKA 3GA4A 2H19A 1PKWA 2CAQA 4TRXA 5ECRB 4Q5NA 2HNLA 5JWOB 3A3TA 2VLUA 2Z9SA 2HSYA 5DALA 5H5SA 4MABA 4TR1A 4HDEA 7GSSA 12GSA 2H8LA 5H5RA 5DJMA 4LLRA 2PN8A 3FR6A 2VIMA 2YJHA 2AJQB 1PX6A 6GSXA 3C7MA 1K0CA 2HRFA 3IA1A 4G9HA 3E0UA 2OE0A 4OWYA 1OC9A 4XS1A 4F0CA 2FUG2 4WF4A 4EVMA 5C00A 2EIOA 3IOSA 4J57E 1JLWA 3FK8A 3A2WA 1Y6EA 5G1KA 1T8EB 2LSTA 5IMVA 1M2AA 2VAFA 1S3CA 1TRUA 3F8UA 1R4WA 2V1MA 3DXBA 2R2JA 4PQ1A 1FHEA 1ERTA 3NIVA 2X8HA 3DRNA 2P5RA 5AN1A 3LJRA 1PX7A 5IMAA 2VCQA 3HVSA 5D9XA 4L0UA 1GL8A 4JU5A 2NVLA 2IFQB 1O8WA 4I5QA 1O8XA 4P3YB 5ID2B 3GSTA 3IRAA 1PKZA 2H6ZA 1AC1A 1FO5A 3C71A 5E4WA 5KN2A 1THOA 5GAPD 2H30A 13GSA 1G6YA 1TI1A 3ZLPA 2DJKA 1BEDA 4KUNA 4N0ZA 5DALB 3CTFA 3VK9A 4TR1B 1X9WB 1U88A 1THXA 5B6NA 3KGKA 3HY2A 2IL3A 2C0EA 3BBYA 3CXGA 4NWYA 4V1Ap 2LRNA 5ECLB 5ELGA 1SL2B 5CRWA 3TRXA 5F8BA 2NPBA 2RUFA 1LJRA 4JEDA 3TGZA 9GSSA 4QL7A 4TKYA 2IJYA 3KCMA 1BX9A 3GH9A 2YV9A 1OC9B 1AAZA 3Q18A 5C04A 5IPHA 3ZFBA 5AGYA 4ML6A 2AB6A 4JZQA 3TJBA 3GV1A 4IQ1A 1EEJA 3HA9A 4ULXA 3FHKA 3KEBA 4POMA 5ECOB 2VD0A 1A2JA 4KSMA 4AJ7A 4Q5QA 4GWRA 1GTIA 4FYUA 1NHYA 3IPZA 4X43A 2QKEA 4BVXA 4ZXGA 2B1KA 3TUEA 4IJ3A 1A23A 4JR4A 1X5DA 4IELA 3F9UA 3EMPA 5H5QA 4X0XA 1M9AA 2G2QA 4YAPA 3BD2A 5ECMB 3WT1A 1M99A 5ECSA 5G5FA 2FHEA 5DDLA 4BL7A 5J5NA 1K0OA 3HDCA 4MCUA 3KH7A 4GCIA 2WCIA 3H1NA 3AY8A 2PBJA 4E8HA 3EE2A 4KA0A 1XVWA 2HFDA
chains in the Genus database with same CATH superfamily
1R5AA 4YKGA 4YKFA 3VURA 1Q98A 2YWOA 1R5PA 3IR4A 4ZILA 4KSOA 5IMDA 4DSSA 1A8LA 3CSHA 1AIUA 1UA5A 1PN9A 4PUFC 4ISDA 3ZIVA 1YEXA 3C73A 4Z2RA 5KN0A 4ILFA 3UVTA 2TRXA 1EZKA 3HVVA 1PSQA 2VUPA 5D9WA 4IHUA 4XRDA 5DVBA 3UIWA 1SK2A 2UZ8A 3GTUA 2X64A 2PERA 1NSWA 6GSYA 5KOXA 5JCGA 2B7JA 4V2MA 1MDIA 2OACA 1BG5A 3WT2A 3KMNA 4NHWA 1ZYNA 1W4VA 3QFBC 2KP2A 5LCZA 4BL7B 2AHEA 1S3AA 4IN0A 2KUCA 2HI7A 3ERGA 2MYGA 5A4UA 3LEFA 3PGTA 2R0PA 4LL4B 1Z9HA 4V2NA 1EGOA 3RHCA 1WMJA 2YWIA 3DEXA 4XS4A 4JE1A 4MH2A 2HRAA 5JCWA 2B5EA 4OFMA 2CVBA 2KP1A 2X99A 5DCHA 2HXKA 2LTKA 5HFIA 4V2LA 3IXRA 2R3XA 4TR0A 1X9SB 4I6XA 2O8VB 3R3EA 4BA7A 3IK9A 3HJPA 3KTBA 6GSSA 4G2EA 2PWJA 1K0AA 2K6VA 1YY7A 2ON5A 3ZYWA 1FOVA 4YQMA 3TKPA 1BJXA 3GMFA 2L5OA 3GX8A 3CRTA 3ZIJA 1GSUA 1VGLA 1WIKA 2V2GA 2FY6A 2E0QA 5F05A 1O73A 1YF1A 5IM9A 3UL3A 4I2UA 3MAKA 2A4VA 3GYKA 4L8EA 3IE3A 2H73A 1EOHA 2RLIA 2F51A 5D9VA 2I81A 5CO3A 1O6JA 2I1UA 2KOKA 2MZCA 3UVHA 2GZPA 5IQYA 1G0TA 4MP4A 3GX0A 2H0GA 4O7HA 5G1LA 3BJ5A 2V41A 2X8GA 1CQGA 1QK8A 4GLTA 4ZL7A 2VL3A 4KCAA 3V1WA 1GTUA 1GSYA 2H1AA 1TW9A 2E7PA 2C0FA 4F03A 2IMIA 4EDYA 4K7IA 1H75A 1C72A 3P90A 2N5FA 1B48A 4WBRD 2O85A 2RUEA 3IC4A 4TXOB 2PU9C 2LS5A 4PXOA 4XS4B 2LRTA 1FG4A 3U6VA 2AYTA 3FRCA 4EL1A 5DCGA 4Z2TA 5EL8A 4ZIJA 3ZRDA 3VWXA 1ZYPA 2LRCA 5HR2A 2QA2A 4D73B 4MH3A 5DBQA 1SENA 3IK7A 4HZ2A 2L57A 1YJ6A 3G9BA 3TJFA 2H1DA 1XCCA 2AV4A 5FHIA 2B3SA 1PRXA 1B8XA 3L9UA 4MJCA 4IKHA 2XC2A 2H6YA 2MBTA 2RM5A 2EIRA 2FCHA 1URMA 1WRYA 3CQFA 1YKAA 3APQA 4OO5A 4PURA 2YWMA 5G30A 2GSSA 1V98A 1WWJA 4PX1A 2FWHA 2MBSA 1EV9A 2CX4A 3FY7A 1R7HA 2VCVA 3M3MA 2F9SA 4LA1A 1ZYQB 3L9SA 1HNBA 1XIYA 2L59A 4ML1A 1XWGA 2FGXA 4J2FA 3ERFA 2JU5A 2H74A 3VPTA 5E59A 3GURA 3D22A 2WJUA 2NBSA 1A24A 2FWGA 4GQCA 3KZQA 2ON7A 2L4QA 3KJYA 3TCOA 3TKQA 3ZVJD 3IV4A 4ECIA 3KD0A 4MZWA 3C8EA 5D9TA 3WD6A 2K8VA 4MPGA 2IFQA 1K3YA 2VCTA 5ID2A 1SJIA 3LXZA 3QMXA 4CDOA 2OBIA 5ECPB 2HSMA 1EP8A 3TRQA 2WGRA 3NOFA 5DQSA 2IMDA 2B1LA 1OKTA 1A8YA 3ISOA 1SL0B 4FIWA 1DE1A 3MDKA 1RW1A 4LMVA 5IMZA 3KH9A 5D73A 2CT6A 5J41A 2CA8A 1GRXA 2JACA 1A0RP 3KM6A 2DSAA 4HU7A 2YANA 3KP9A 3L9VA 2JL4A 4OFNA 4BPYA 1J9BA 2P31A 1XG8A 1T4YA 3A5IA 2VD1A 3LYKA 4DEJA 3ZMKA 1F6MC 2NDOA 5ELAA 2L5LA 3M8NA 4E8EA 1WPIA 4MK3A 1QQ2A 3F6FA 2O89A 1V2AA 3HZ4A 3VLNA 1GP1A 8GSSA 5D96A 5CRHA 4MNNA 5KOWA 3MNGA 4POKA 2H66A 4HJ2A 1ZCPA 2GS3A 2C0DA 1WJKA 1ZOFA 1NM3A 2VO4A 3ME7A 5CAXA 5CYYA 2VL2A 2CZ2A 4EXJA 1NHOA 1SKWB 1SKSB 4Q5FA 2H70A 4K7OA 1M2BA 1FVKA 2NTOA 2CQ9A 11GSA 2GT5A 3UBKA 2YJ7A 4PGTA 3TKSC 4OO4A 2C0GA 2VLVA 1UN2A 1I5GA 4K5RA 4XHMA 1PGTA 4WF5A 3VPQA 3L78A 3LORA 2CV4A 3DYRA 1VF3A 1U3IA 3FZAA 3QFAC 5F06A 3ZITA 5A4VA 1ZZYA 1MD4A 2IIYA 4HZ4A 1J08A 2OE3A 1E2YA 1PFOA 1XW5A 4K6XA 4XIHA 4TOPA 1T3BA 3CBUA 4BIKA 1GNWA 3R2QA 3GHAA 4L0WA 3K8NA 2H71A 1SK0A 4XTSA 3W6GA 1GWCA 1UC7A 4KF9A 2GQLA 2TIRA 3EMXA 19GSA 14GSA 3ZZXA 5KN3A 4L5LA 1OE8A 2HYXA 3DIEA 1GSQA 5JWQB 1HNCA 2CVKA 3IAM2 2H0HA 2FD3A 2WB9A 3ED3A 4MJAA 2B5XA 3J7Yk 2VCZA 2GQKA 3UJ1A 5JWRB 3D5JA 3QCPA 5D93A 1PQNA 4MZCA 4ZBDA 4N0VA 4J56E 4N11A 1SK1A 2PUKC 1V58A 4IP1A 1JZWA 5J3RA 4WEYA 3QR6A 2IPAA 1K3OA 4KX4A 4O32A 4OD7A 4K2XA 5KEJA 2R37A 2YPMA 2YWNA 2CX3A 2LJRA 2GVPA 3ZREA 4IW9A 4HQZA 2PPTA 1T4ZA 4POLA 2WFCA 4IJIA 3DKSA 5ECQB 2LKUA 1N2AA 2YZUA 4MJEA 2LV3A 1YEPA 2DKIA 3BCIA 5EVOA 3F0IA 2M80A 3LG6A 5ECHB 1RQMA 4EC0A 2A2SA 3HVXA 2VOCA 2O87A 5BMUA 3P7XA 4I8BA 4K8MA 3M0FA 3EU3A 2C3TA 4KAEA 1VF2A 2YNXA 3IC8A 2GSRA 2VLTA 3F3RA 3DWVA 2HRKA 1XZOA 1T7PB 1XFLA 1SJZA 2ZNMA 1M3IA 2DLXA 2F8FA 3L4NA 3EINA 4ECJA 4OCFA 3CYNA 4JRRA 1DSBA 3HJOA 4PQIA 2WZ9A 3FZ4A 1XPVA 5ECNB 2XBIA 2I9HA 3G7JA 1K0NA 1BAYA 1XWBA 4Z7XA 5CP1A 3CTGA 3Q6OA 5GSTA 3W8SA 2P0GA 3LXTA 4ACSA 1ACVA 1DUGA 3FR9A 5J9BA 2X4AA 4XCSA 2CVDA 4TXOA 4DVCA 2C3NA 1XBSA 3CSIA 4YQVA 1EV4A 2P5QA 3IDVA 3TJGA 5LD0A 1TKDB 3L0HA 1ERVA 4I97A 1MTCA 4MF6A 1TJDA 2IMEA 1TP9A 1LU4A 2IMFA 4D73A 1VF4A 1IYHA 2GZZA 3QDNA 1Z3EA 3E9JB 2H01A 2REMA 2DMMA 1PA3A 3FZ5A 1A2LA 1TI3A 4YAVA 4YQUA 1TTZA 1H4OA 2IWTA 1OKDA 2HZFA 1JHBA 3I6AA 1XWAA 2PVQA 2HZEA 4N10A 4NPBA 3A5WA 2YOIA 3RAZA 1ILOA 1ST9A 2XBQA 2HRNA 2AAWA 1T00A 3NZNA 5IO2A 4GSTA 1EWXA 1Y25A 2BTOT 1X5CA 4NXIA 4EO3A 3C1RA 1SYXA 2DBCA 4X1UA 3QAGA 5AISA 2D2ZA 4L5OA 20GSA 1CQHA 3FKFA 4LMWA 5IIZA 5IMCA 1TDIA 4FO5A 4AGSA 4HJMA 5B7CA 2YN1A 1AUCA 5DAKB 3CSJA 4MA9A 3QPMA 3TJKA 4WR5A 2R6KA 2WRTA 4ID0A 4GXZA 3TOUA 1ERUA 1JFUA 1WOUA 1GH2A 1PN0A 1KEBA 4F9ZA 2JZSA 4Z2UA 4F2IA 2XHFA 3UMAA 2V6OA 4AJ8A 1GULA 4FH8A 3QAWA 2VM2A 3CRUA 3EYTA 4KH7A 1ML6A 3F6DA 2DKHA 4WETA 4O5QA 1BQ7A 2FNOA 1G7OA 2OE1A 1AW9A 1W89A 4JBBA 1TK5B 1T1VA 5HR0A 2BMXA 4X4JA 4MF7A 1M9BA 2HZEB 2JZRA 3TB2A 4EKZA 3W8JA 4ZL9A 2VCXA 1FB0A 2C4JA 1FOHA 1I9DA 1TOFA 3N5OA 5ECKB 1JLVA 22GSA 4GQFA 3D21A 3WGEA 3ZL5A 2ALBA 3Q74A 2IN3A 3WGXA 3VFIA 1J0FA 4F0BA 2FA8A 4NHZA 4IBPA 3GL3A 1VF1A 1PL2A 3P2AA 2A2PA 5CREA 3FW2A 1XW9A 4LL1B 4HS1A 1TXXA 4HU9A 5GAND 3VWVA 3H93A 3JCML 16GSA 1MEKA 3C1SA 18GSA 3US3A 3UAPA 2M72A 4N30A 4EF0A 2BJXA 4OMVA 3DGQA 4MF5A 1BYEA 4RUVA 2R0GA 1FAAA 3LFLA 3F63A 4WKWA 1GTAA 4NAXA 3TRPA 2IMKA 4K5SA 2LUSA 2V6KA 2LJAA 1GSSA 4EDZA 5B8BA 3F4SA 5AIVA 1GNEA 1JZRA 2YZHA 2GSQA 4I2TA 1OE7A 2C1YA 4XS6A 4MMMA 1XOBA 1TK0B 1N8JA 1LBKA 2XPDA 3I9V2 1MDKA 4CHSA 1USBA 1TK8B 3I43A 4G19A 2WULA 1YQ1A 4ZB8A 2JSZA 1F3BA 4GSSA 1XWCA 1DE2A 1GUKA 1O85A 1Z7RA 1M0UA 2G0FA 6GSTA 2WDUA 5G2ZA 4PUAA 1GUHA 3RPNA 3D0ZA 3MSZA 4CW9A 2GSTA 4KB3A 4DSRA 1FB6A 2X8CA 4K7NA 1O81A 3GFKA 3LGCA 5EPFA 3DD3A 4K9ZA 4TXVA 4HOJA 3EURA 3GRXA 3G7IA 3BCKA 4KDXA 4O5RA 1XXUA 4K0NA 4KDUA 5L71A 4KCEA 1Z5YE 3VI5A 3H4KA 1K0MA 2L6CA 3GKXA 2F3MA 2HT9A 1B9XC 4FQUA 2R5GA 2A2RA 4IVFA 4NV2A 1YKCA 1AQWA 4IQAA 4CY6A 1FVJA 3HZ8A 2WS2A 2LEGA 3A2XA 4PNGA 4HI7A 2H0IA 1V9WA 3GSSA 3HXSA 2GT6A 1F3AA 4EIPA 3HYPA 4MJBA 2OADA 2FA4A 2QSIA 4TW5A 3ZVJA 1DBYA 2ES7A 3J7Yb 2V32A 2LQOA 5IO0A 2RM6A 2VM1A 4F82A 3D6IA 1AQXA 2DJ0A 1U6TA 3IHQA 4V1Ag 3UOMA 3F4TA 5GSSA 2XPEA 3F3QA 1PD21 2GLRA 5G31A 2DC5A 2JZTA 3SBCA 1EOGA 3LSZA 2H76A 2KLXA 5ENUA 1SKRB 3GN3A 3P8WA 4TVEA 5FWGA 2DJJA 5F0GA 2J9HA 2A4HA 1ERWA 2LNSA 3M9JA 2GZYA 1TU7A 2EC4A 3TKSE 4CY8A 3GL5A 3APOA 5LNKe 3UARA 1SD8A 6GSVA 4ECCA 1V40A 4KGIA 4H86A 5DJLA 3O3TA 2MMOA 1GTBA 3FMWA 2J23A 4O5UA 4OFTA 4KE3A 3RBTA 1EP7A 2OBKA 1K3LA 3GKNA 2FWEA 4K1FA 1EEMA 3N9JA 1VRSD 2TRCP 1Q4JA 4ICYA 1Z6MA 5HQPA 2K8SA 3O76A 2LQQA 5B8AA 3HHVA 17GSA 2K9FA 1SD9A 3HD5A 3LYPA 1IYIA 3QAVA 3KIJA 5HFKA 1O7UA 4G0IA 3GKMA 2DJ3A 3TOTA 3FR3A 3M1GA 4EUYA 4POBA 1X9MB 2H75A 1QGVA 3KTLA 4TR4A 1YZXA 4IS0A 3MWHA 2QC7A 5KN1A 3Q19A 1HYUA 4O92A 2CAIA 5IPGA 5A4WA 1SJ6A 1GLQA 5B6MA 3FEUA 2VL9A 1F37A 1XOAA 3S9FA 2QGVA 3QOUA 1U3AA 3EC3A 4MDCA 4GTUA 1XW6A 1X5EA 3WGDA 3E3EA 4PQHA 1SL1B 2JADA 3KXOA 4DSQA 1U87A 2C8UA 4ZBAA 1G6WA 2QA1A 4KDYA 3KP8A 3M9KA 4BVYA 3KMOA 2AUVA 4K2DA 1Z7PA 2E2MA 5CRDA 3UEMA 1GSDA 1EGRA 3BOAA 3H8QA 2MMZA 1R26A 2F8AA 4WXTA 1KTEA 1ZYEA 5CRGA 1TRSA 3DMLA 2JSYA 6GSUA 4XRAA 4BVXB 5J9CA 3CMIA 2PMTA 2VL2C 4MZBA 1K0BA 3I69A 3ME8A 3ZMLA 5DAKA 1A2MA 2K18A 2YCDA 2OA7A 4RI6A 5HR3A 3GKKA 5HFGA 2E2GA 3GNJA 5INYA 4JR6A 1ON4A 1X0RA 2PGTA 5BRTA 4PNFA 1HQOA 2OKAA 5ABRA 1GUMA 3ERWA 4RI7A 1TU8A 3OR5A 4HEA2 3UBLA 3SWLA 2YP6A 2CZ3A 2H6XA 5G5EA 4AJ6A 5FT3A 2C80A 4BWQA 1YF0A 2DJ1A 1F9MA 3WYWA 1HNAA 2GQMA 2H1GA 3LQ7A 4GSNA 2N5AA 3ZFLA 4DSSB 2ZCTA 1QMVA 2L4CA 1ZMAA 5HR1A 3EU4A 2B7KA 4QQ7A 2ZUPA 4Q5RA 4TN8A 3HJMA 2EIQA 4BVYB 1K0DA 1OYJA 2H72A 1SYRA 4KW6A 1E6BA 1S3RA 1S3DA 4ECBA 3EPTA 1HD2A 4GRFA 2OJLA 4ZB6A 2B6MA 4NV5A 2M46A 3GIXA 2GTUA 1QUWA 1OC3A 2PVOC 3PINA 5IMFA 5DQYA 1QXHA 3PH9A 2HE3A 3GTUB 1KBNA 4A5PA 2DJ2A 1MD3A 1SU9A 4KNDA 1FW1A 3ZTLA 3G7YA 4ZB9A 3RPPA 1XWKA 1M7TA 4NMUA 1TRVA 2I4AA 2YV7A 3IHGA 2I3YA 3FYGA 2DIZA 4WR4A 4RQRA 5AIXA 1NW2A 2KHPA 2HLSA 3VI7A 3RHBA 3LWAA 1B9YC 1M2DA 1OVNA 1PL1A 3TJJA 1AXDA 5CNWA 3GH6A 3A2VA 1MDJA 1OAZA 1AQVA 1KNGA 3VWUA 4EIQA 1GSEA 3H79A 1B4PA 3U5RE 5F07A 2FLSA 4HUAA 1GLPA 4EE0A 4MLYA 3TKSA 5IOXA 1XVQA 5IOWA 5D8IA 1B4QA 4ZBBA 4GF0A 1JZOA 2MMNA 2GDRA 4FYBA 3IAS2 2FWFA 4HQSA 3IBHA 1G7EA 3APSA 1OC8A 4AF2A 1TRWA 1Z6NA 2R4VA 4USSA 5EY6A 4K0GA 5ECIB 2GGTA 2MMAA 1A0FA 3PR8A 10GSA 2HSHA 2H1BA 3VWWA 1PMTA 1GSFA 1WP0A 2VCWA 2LJKA 2O7KA 2DMLA 4QL9A 3EVIA 4G10A 1RK4A 4TR3A 5J4UA 3HKRA 2B5YA 2DIYA 3RDWA 5GZZB 4FYCA 4OCEA 3QD9A 4MPFA 3DVXA 1QFNA 1ZL9A 1F2EA 3FZ9A 1ZGNA 3D4MA 2N5BA 1UVZA 4YH2A 4IP6A 4BWSA 2L6DA 3DVWA 4WBJA 3TDGA 3O6TA 3D4TA 5COHA 3GUSA 5A5KA 2RIIA 4ZL8A 3HVNA 5JCUA 3F4RA 2LNTA 3MYDA 4RQXA 3HCZA 6GSWA 3TKRA 1V57A 1ABAA 3EWLA 4IGJA 3MIXA 1JZDA 1WE0A 2C3QA 1YDKA 3GA4A 2H19A 1PKWA 4PTSA 2CAQA 4TRXA 5ECRB 4Q5NA 2HNLA 5JWOB 3A3TA 2Z9SA 2VLUA 2HSYA 5DALA 5H5SA 4MABA 4TR1A 4HDEA 7GSSA 12GSA 2H8LA 5H5RA 5DJMA 4LLRA 2PN8A 3FR6A 2VIMA 4G0LA 2YJHA 2AJQB 1PX6A 6GSXA 3C7MA 1K0CA 2HRFA 3IA1A 4G9HA 3E0UA 2OE0A 1M3JA 4OWYA 1OC9A 4XS1A 4F0CA 2FUG2 4WF4A 4EVMA 5C00A 2EIOA 3IOSA 4J57E 1JLWA 3FK8A 3A2WA 1Y6EA 5G1KA 1T8EB 2LSTA 5IMVA 3PPUA 1M2AA 2VAFA 1S3CA 1TRUA 3F8UA 1R4WA 2V1MA 3DXBA 2R2JA 4PQ1A 1FHEA 1ERTA 3NIVA 2X8HA 3DRNA 2P5RA 5AN1A 3LJRA 1PX7A 2R0CA 5IMAA 2VCQA 3HVSA 5D9XA 4L0UA 1GL8A 4JU5A 2NVLA 2IFQB 1O8WA 4G0KA 4I5QA 1O8XA 2X49A 4P3YB 5ID2B 3GSTA 3IRAA 1PKZA 2H6ZA 1AC1A 1FO5A 3C71A 5E4WA 5KN2A 1THOA 5GAPD 2H30A 13GSA 1G6YA 1TI1A 3ZLPA 2DJKA 1BEDA 4KUNA 4N0ZA 5DALB 3CTFA 3VK9A 4TR1B 1X9WB 1U88A 1THXA 5B6NA 3KGKA 3HY2A 2IL3A 2C0EA 3BBYA 3CXGA 4NWYA 4V1Ap 2LRNA 5ECLB 5ELGA 1SL2B 5CRWA 3TRXA 5F8BA 2NPBA 2RUFA 1LJRA 4JEDA 3TGZA 9GSSA 4QL7A 4TKYA 2IJYA 3KCMA 3LW9A 1BX9A 3GH9A 2YV9A 1OC9B 1AAZA 3Q18A 5C04A 5IPHA 3ZFBA 5AGYA 4ML6A 2AB6A 4JZQA 3TJBA 3GV1A 4IQ1A 1EEJA 3HA9A 4ULXA 3FHKA 3KEBA 4POMA 5ECOB 2VD0A 1A2JA 4KSMA 4AJ7A 4Q5QA 4GWRA 1GTIA 4FYUA 1NHYA 3IPZA 4X43A 2QKEA 4BVXA 4ZXGA 2B1KA 3TUEA 4IJ3A 1A23A 4JR4A 1X5DA 4IELA 3F9UA 3EMPA 5H5QA 4HSCX 4X0XA 1M9AA 2G2QA 4YAPA 3BD2A 5ECMB 3WT1A 1M99A 5ECSA 5G5FA 2FHEA 5DDLA 4BL7A 5J5NA 1K0OA 3HDCA 4MCUA 3KH7A 4GCIA 2WCIA 3H1NA 3AY8A 2PBJA 4E8HA 3EE2A 4KA0A 1XVWA 2HFDA
chains in the Genus database with same CATH topology
1R5AA 4YKGA 4YKFA 3VURA 1Q98A 2YWOA 1R5PA 3IR4A 4ZILA 4KSOA 5IMDA 4DSSA 1A8LA 3CSHA 1AIUA 1UA5A 1PN9A 4PUFC 4ISDA 3ZIVA 1YEXA 3C73A 4Z2RA 5KN0A 4ILFA 3UVTA 2TRXA 1EZKA 3HVVA 1PSQA 2VUPA 5D9WA 4IHUA 4XRDA 5DVBA 3UIWA 1SK2A 2UZ8A 3GTUA 2X64A 2PERA 1NSWA 6GSYA 5KOXA 5JCGA 2B7JA 4V2MA 1MDIA 2OACA 1BG5A 3WT2A 3KMNA 4NHWA 1ZYNA 1W4VA 3QFBC 2KP2A 5LCZA 4BL7B 2AHEA 1S3AA 4IN0A 2KUCA 2HI7A 3ERGA 2MYGA 5A4UA 3LEFA 3PGTA 2R0PA 4LL4B 1Z9HA 4V2NA 1EGOA 3RHCA 1WMJA 2YWIA 3DEXA 4XS4A 4JE1A 4MH2A 2HRAA 5JCWA 2B5EA 4OFMA 2CVBA 2KP1A 2X99A 5DCHA 2HXKA 2LTKA 5HFIA 4V2LA 3IXRA 2R3XA 4TR0A 1X9SB 4I6XA 2O8VB 3R3EA 4BA7A 3IK9A 3HJPA 3KTBA 6GSSA 4G2EA 2PWJA 1K0AA 2K6VA 1YY7A 2ON5A 3ZYWA 1FOVA 4YQMA 3TKPA 1BJXA 3GMFA 2L5OA 3GX8A 3CRTA 3ZIJA 1GSUA 1VGLA 1WIKA 2V2GA 2FY6A 2E0QA 5F05A 1O73A 1YF1A 5IM9A 3UL3A 4I2UA 3MAKA 2A4VA 3GYKA 4L8EA 3IE3A 2H73A 1EOHA 2RLIA 2F51A 5D9VA 2I81A 5CO3A 1O6JA 2I1UA 2KOKA 2MZCA 3UVHA 2GZPA 5IQYA 1G0TA 4MP4A 3GX0A 2H0GA 4O7HA 5G1LA 3BJ5A 2V41A 2X8GA 1CQGA 1QK8A 4GLTA 4ZL7A 2VL3A 4KCAA 3V1WA 1GTUA 1GSYA 2H1AA 1TW9A 2E7PA 2C0FA 4F03A 2IMIA 4EDYA 4K7IA 1H75A 1C72A 3P90A 2N5FA 1B48A 4WBRD 2O85A 2RUEA 3IC4A 4TXOB 2PU9C 2LS5A 4PXOA 4XS4B 2LRTA 1FG4A 3U6VA 2AYTA 3FRCA 4EL1A 5DCGA 4Z2TA 5EL8A 4ZIJA 3ZRDA 3VWXA 1ZYPA 2LRCA 5HR2A 2QA2A 4D73B 4MH3A 5DBQA 1SENA 3IK7A 4HZ2A 2L57A 1YJ6A 3G9BA 3TJFA 2H1DA 1XCCA 2AV4A 5FHIA 2B3SA 1PRXA 1B8XA 3L9UA 4MJCA 4IKHA 2XC2A 2H6YA 2MBTA 2RM5A 2EIRA 2FCHA 1URMA 1WRYA 1YKAA 3APQA 4OO5A 4PURA 2YWMA 5G30A 2GSSA 1V98A 1WWJA 4PX1A 2FWHA 2MBSA 1EV9A 2CX4A 3FY7A 1R7HA 2VCVA 3M3MA 2F9SA 4LA1A 1ZYQB 3L9SA 1HNBA 1XIYA 2L59A 4ML1A 1XWGA 2FGXA 4J2FA 3ERFA 2JU5A 2H74A 3VPTA 5E59A 3GURA 3D22A 2WJUA 2NBSA 1A24A 2FWGA 4GQCA 3KZQA 2ON7A 2L4QA 3KJYA 3TCOA 3TKQA 3ZVJD 3IV4A 4ECIA 3KD0A 4MZWA 3C8EA 5D9TA 3WD6A 2K8VA 4MPGA 2IFQA 1K3YA 2VCTA 5ID2A 1SJIA 3LXZA 3QMXA 4CDOA 2OBIA 5ECPB 2HSMA 1EP8A 3TRQA 2WGRA 3NOFA 5DQSA 2IMDA 2B1LA 1OKTA 1A8YA 3ISOA 1SL0B 4FIWA 1DE1A 3MDKA 1RW1A 4LMVA 5IMZA 3KH9A 5D73A 2CT6A 5J41A 2CA8A 1GRXA 2JACA 1A0RP 3KM6A 2DSAA 4HU7A 2YANA 3KP9A 3L9VA 2JL4A 4OFNA 4BPYA 1J9BA 2P31A 1T4YA 3A5IA 2VD1A 3LYKA 4DEJA 3ZMKA 1F6MC 2NDOA 5ELAA 2L5LA 3M8NA 4E8EA 1WPIA 4MK3A 1QQ2A 3F6FA 2O89A 1V2AA 3HZ4A 3VLNA 1GP1A 8GSSA 5D96A 5CRHA 4MNNA 5KOWA 3MNGA 4POKA 2H66A 4HJ2A 1ZCPA 2GS3A 2C0DA 1WJKA 1ZOFA 1NM3A 2VO4A 3ME7A 5CAXA 5CYYA 2VL2A 2CZ2A 4EXJA 1NHOA 1SKWB 1SKSB 4Q5FA 2H70A 4K7OA 1M2BA 1FVKA 2NTOA 2CQ9A 11GSA 2GT5A 3UBKA 2YJ7A 4PGTA 3TKSC 4OO4A 2C0GA 2VLVA 1UN2A 1I5GA 4K5RA 4XHMA 1PGTA 4WF5A 3VPQA 3L78A 3LORA 2CV4A 3DYRA 1VF3A 1U3IA 3FZAA 3QFAC 5F06A 3ZITA 5A4VA 1ZZYA 1MD4A 2IIYA 4HZ4A 1J08A 2OE3A 1E2YA 1XW5A 4K6XA 4XIHA 4TOPA 1T3BA 3CBUA 1GNWA 3R2QA 3GHAA 4L0WA 3K8NA 2H71A 1SK0A 4XTSA 3W6GA 1GWCA 1UC7A 4KF9A 2GQLA 2TIRA 3EMXA 19GSA 14GSA 3ZZXA 5KN3A 4L5LA 1OE8A 2HYXA 3DIEA 1GSQA 5JWQB 1HNCA 2CVKA 3IAM2 2H0HA 2FD3A 2WB9A 3ED3A 4MJAA 2B5XA 3J7Yk 2VCZA 2GQKA 3UJ1A 5JWRB 3D5JA 3QCPA 5D93A 1PQNA 4MZCA 4ZBDA 4N0VA 4J56E 4N11A 1SK1A 2PUKC 1V58A 4IP1A 1JZWA 5J3RA 4WEYA 3QR6A 2IPAA 1K3OA 4KX4A 4O32A 4OD7A 4K2XA 5KEJA 2R37A 2YPMA 2YWNA 2CX3A 2LJRA 2GVPA 3ZREA 4IW9A 4HQZA 2PPTA 1T4ZA 4POLA 2WFCA 4IJIA 3DKSA 5ECQB 2LKUA 1N2AA 2YZUA 4MJEA 2LV3A 1YEPA 2DKIA 3BCIA 5EVOA 3F0IA 2M80A 3LG6A 5ECHB 1RQMA 4EC0A 2A2SA 3HVXA 2VOCA 2O87A 5BMUA 3P7XA 4I8BA 4K8MA 3M0FA 3EU3A 2C3TA 4KAEA 1VF2A 2YNXA 3IC8A 2GSRA 2VLTA 3F3RA 3DWVA 2HRKA 1XZOA 1T7PB 1XFLA 1SJZA 2ZNMA 2DLXA 2F8FA 3L4NA 3EINA 4ECJA 4OCFA 3CYNA 4JRRA 1DSBA 3HJOA 4PQIA 2WZ9A 3FZ4A 1XPVA 5ECNB 2XBIA 2I9HA 3G7JA 1K0NA 1BAYA 1XWBA 4Z7XA 5CP1A 3CTGA 3Q6OA 5GSTA 3W8SA 2P0GA 3LXTA 4ACSA 1ACVA 1DUGA 3FR9A 5J9BA 2X4AA 4XCSA 2CVDA 4TXOA 4DVCA 2C3NA 1XBSA 3CSIA 4YQVA 1EV4A 2P5QA 3IDVA 3TJGA 5LD0A 1TKDB 3L0HA 1ERVA 4I97A 1MTCA 4MF6A 1TJDA 2IMEA 1TP9A 1LU4A 2IMFA 4D73A 1VF4A 1IYHA 2GZZA 3QDNA 1Z3EA 3E9JB 2H01A 2REMA 2DMMA 1PA3A 3FZ5A 1A2LA 1TI3A 4YAVA 4YQUA 1TTZA 1H4OA 2IWTA 1OKDA 2HZFA 1JHBA 3I6AA 1XWAA 2PVQA 2HZEA 4N10A 4NPBA 3A5WA 2YOIA 3RAZA 1ILOA 1ST9A 2XBQA 2HRNA 2AAWA 1T00A 3NZNA 5IO2A 4GSTA 1EWXA 1Y25A 2BTOT 1X5CA 4NXIA 4EO3A 3C1RA 1SYXA 2DBCA 4X1UA 3QAGA 5AISA 2D2ZA 4L5OA 20GSA 1CQHA 3FKFA 4LMWA 5IIZA 5IMCA 1TDIA 4FO5A 4AGSA 4HJMA 5B7CA 2YN1A 1AUCA 5DAKB 3CSJA 4MA9A 3QPMA 3TJKA 4WR5A 2R6KA 2WRTA 4ID0A 4GXZA 3TOUA 1ERUA 1JFUA 1WOUA 1GH2A 1PN0A 1KEBA 4F9ZA 2JZSA 4Z2UA 4F2IA 2XHFA 3UMAA 2V6OA 4AJ8A 1GULA 4FH8A 3QAWA 2VM2A 3CRUA 3EYTA 4KH7A 1ML6A 3F6DA 2DKHA 4WETA 4O5QA 1BQ7A 2FNOA 1G7OA 2OE1A 1AW9A 1W89A 4JBBA 1TK5B 1T1VA 5HR0A 2BMXA 4X4JA 4MF7A 1M9BA 2HZEB 2JZRA 3TB2A 4EKZA 3W8JA 4ZL9A 2VCXA 1FB0A 2C4JA 1FOHA 1I9DA 1TOFA 3N5OA 5ECKB 1JLVA 22GSA 4GQFA 3D21A 3WGEA 3ZL5A 2ALBA 3Q74A 2IN3A 3WGXA 3VFIA 1J0FA 4F0BA 2FA8A 4NHZA 4IBPA 3GL3A 1VF1A 1PL2A 3P2AA 2A2PA 5CREA 3FW2A 1XW9A 4LL1B 4HS1A 1TXXA 4HU9A 5GAND 3VWVA 3H93A 3JCML 16GSA 1MEKA 3C1SA 18GSA 3US3A 3UAPA 2M72A 4N30A 4EF0A 2BJXA 4OMVA 3DGQA 4MF5A 1BYEA 4RUVA 2R0GA 1FAAA 3LFLA 3F63A 4WKWA 1GTAA 4NAXA 3TRPA 2IMKA 4K5SA 2LUSA 2V6KA 2LJAA 1GSSA 4EDZA 5B8BA 3F4SA 5AIVA 1GNEA 1JZRA 2YZHA 2GSQA 4I2TA 1OE7A 2C1YA 4XS6A 4MMMA 1XOBA 1TK0B 1N8JA 1LBKA 2XPDA 3I9V2 1MDKA 4CHSA 1USBA 1TK8B 3I43A 4G19A 2WULA 1YQ1A 4ZB8A 2JSZA 1F3BA 4GSSA 1XWCA 1DE2A 1GUKA 1O85A 1Z7RA 1M0UA 2G0FA 6GSTA 2WDUA 5G2ZA 4PUAA 1GUHA 3RPNA 3D0ZA 3MSZA 4CW9A 2GSTA 4KB3A 4DSRA 1FB6A 2X8CA 4K7NA 1O81A 3GFKA 3LGCA 5EPFA 3DD3A 4K9ZA 4TXVA 4HOJA 3EURA 3GRXA 3G7IA 3BCKA 4KDXA 4O5RA 1XXUA 4K0NA 4KDUA 5L71A 4KCEA 1Z5YE 3VI5A 3H4KA 1K0MA 2L6CA 3GKXA 2F3MA 2HT9A 1B9XC 4FQUA 2R5GA 2A2RA 4IVFA 4NV2A 1YKCA 1AQWA 4IQAA 4CY6A 1FVJA 3HZ8A 2WS2A 2LEGA 3A2XA 4PNGA 4HI7A 2H0IA 1V9WA 3GSSA 3HXSA 2GT6A 1F3AA 4EIPA 3HYPA 4MJBA 2OADA 2FA4A 2QSIA 4TW5A 3ZVJA 1DBYA 2ES7A 3J7Yb 2V32A 2LQOA 5IO0A 2RM6A 2VM1A 4F82A 3D6IA 1AQXA 2DJ0A 1U6TA 3IHQA 4V1Ag 3UOMA 3F4TA 5GSSA 2XPEA 3F3QA 1PD21 2GLRA 5G31A 2DC5A 2JZTA 3SBCA 1EOGA 3LSZA 2H76A 2KLXA 5ENUA 1SKRB 3GN3A 3P8WA 4TVEA 5FWGA 2DJJA 5F0GA 2J9HA 2A4HA 1ERWA 2LNSA 3M9JA 2GZYA 1TU7A 2EC4A 3TKSE 4CY8A 3GL5A 3APOA 5LNKe 3UARA 1SD8A 6GSVA 4ECCA 1V40A 4KGIA 4H86A 5DJLA 3O3TA 2MMOA 1GTBA 3FMWA 2J23A 4O5UA 4OFTA 4KE3A 3RBTA 1EP7A 2OBKA 1K3LA 3GKNA 2FWEA 4K1FA 1EEMA 3N9JA 1VRSD 2TRCP 1Q4JA 4ICYA 1Z6MA 5HQPA 2K8SA 3O76A 2LQQA 5B8AA 3HHVA 17GSA 2K9FA 1SD9A 3HD5A 3LYPA 1IYIA 3QAVA 3KIJA 5HFKA 1O7UA 4G0IA 3GKMA 2DJ3A 3TOTA 3FR3A 3M1GA 4EUYA 4POBA 1X9MB 2H75A 1QGVA 3KTLA 4TR4A 1YZXA 4IS0A 3MWHA 2QC7A 5KN1A 3Q19A 1HYUA 4O92A 2CAIA 5IPGA 5A4WA 1SJ6A 1GLQA 5B6MA 3FEUA 2VL9A 1F37A 1XOAA 3S9FA 2QGVA 3QOUA 1U3AA 3EC3A 4MDCA 4GTUA 1XW6A 1X5EA 3WGDA 3E3EA 4PQHA 1SL1B 2JADA 3KXOA 4DSQA 1U87A 2C8UA 4ZBAA 1G6WA 2QA1A 4KDYA 3KP8A 3M9KA 4BVYA 3KMOA 2AUVA 4K2DA 1Z7PA 2E2MA 5CRDA 3UEMA 1GSDA 1EGRA 3BOAA 3H8QA 2MMZA 1R26A 2F8AA 4WXTA 1KTEA 1ZYEA 5CRGA 1TRSA 3DMLA 2JSYA 6GSUA 4XRAA 4BVXB 5J9CA 3CMIA 2PMTA 2VL2C 4MZBA 1K0BA 3I69A 3ME8A 3ZMLA 5DAKA 1A2MA 2K18A 2YCDA 2OA7A 4RI6A 5HR3A 3GKKA 5HFGA 2E2GA 3GNJA 5INYA 4JR6A 1ON4A 1X0RA 2PGTA 5BRTA 4PNFA 1HQOA 2OKAA 5ABRA 1GUMA 3ERWA 4RI7A 1TU8A 3OR5A 4HEA2 3UBLA 3SWLA 2YP6A 2CZ3A 2H6XA 5G5EA 4AJ6A 5FT3A 2C80A 4BWQA 1YF0A 2DJ1A 1F9MA 3WYWA 1HNAA 2GQMA 2H1GA 3LQ7A 4GSNA 2N5AA 3ZFLA 4DSSB 2ZCTA 1QMVA 2L4CA 1ZMAA 5HR1A 3EU4A 2B7KA 4QQ7A 2ZUPA 4Q5RA 4TN8A 3HJMA 2EIQA 4BVYB 1K0DA 1OYJA 2H72A 1SYRA 4KW6A 1E6BA 1S3DA 4ECBA 3EPTA 1HD2A 4GRFA 2OJLA 4ZB6A 2B6MA 4NV5A 2M46A 3GIXA 2GTUA 1QUWA 1OC3A 2PVOC 3PINA 5IMFA 5DQYA 1QXHA 3PH9A 2HE3A 3GTUB 1KBNA 4A5PA 2DJ2A 1MD3A 1SU9A 4KNDA 1FW1A 3ZTLA 3G7YA 4ZB9A 3RPPA 1XWKA 1M7TA 4NMUA 1TRVA 2I4AA 2YV7A 3IHGA 2I3YA 3FYGA 2DIZA 4WR4A 4RQRA 5AIXA 1NW2A 2KHPA 2HLSA 3VI7A 3RHBA 3LWAA 1B9YC 1M2DA 1OVNA 1PL1A 3TJJA 1AXDA 5CNWA 3GH6A 3A2VA 1MDJA 1OAZA 1AQVA 1KNGA 3VWUA 4EIQA 1GSEA 3H79A 1B4PA 3U5RE 5F07A 2FLSA 4HUAA 1GLPA 4EE0A 4MLYA 3TKSA 5IOXA 1XVQA 5IOWA 5D8IA 1B4QA 4ZBBA 4GF0A 1JZOA 2MMNA 2GDRA 4FYBA 3IAS2 2FWFA 4HQSA 3IBHA 1G7EA 3APSA 1OC8A 4AF2A 1TRWA 1Z6NA 2R4VA 4USSA 5EY6A 4K0GA 5ECIB 2GGTA 2MMAA 1A0FA 3PR8A 10GSA 2HSHA 2H1BA 3VWWA 1PMTA 1GSFA 1WP0A 2VCWA 2LJKA 2O7KA 2DMLA 4QL9A 3EVIA 4G10A 1RK4A 4TR3A 5J4UA 3HKRA 2B5YA 2DIYA 3RDWA 5GZZB 4FYCA 4OCEA 3QD9A 4MPFA 3DVXA 1QFNA 1ZL9A 1F2EA 3FZ9A 1ZGNA 3D4MA 2N5BA 1UVZA 4YH2A 4IP6A 4BWSA 2L6DA 3DVWA 4WBJA 3TDGA 3O6TA 3D4TA 5COHA 3GUSA 5A5KA 2RIIA 4ZL8A 5JCUA 3F4RA 2LNTA 3MYDA 4RQXA 3HCZA 6GSWA 3TKRA 1V57A 1ABAA 3EWLA 4IGJA 3MIXA 1JZDA 1WE0A 2C3QA 1YDKA 3GA4A 2H19A 1PKWA 4PTSA 2CAQA 4TRXA 5ECRB 4Q5NA 2HNLA 5JWOB 3A3TA 2Z9SA 2VLUA 2HSYA 5DALA 5H5SA 4MABA 4TR1A 4HDEA 7GSSA 12GSA 2H8LA 5H5RA 5DJMA 4LLRA 2PN8A 3FR6A 2VIMA 4G0LA 2YJHA 2AJQB 1PX6A 6GSXA 3C7MA 1K0CA 2HRFA 3IA1A 4G9HA 3E0UA 2OE0A 4OWYA 1OC9A 4XS1A 4F0CA 2FUG2 4WF4A 4EVMA 5C00A 2EIOA 3IOSA 4J57E 1JLWA 3FK8A 3A2WA 1Y6EA 5G1KA 1T8EB 2LSTA 5IMVA 3PPUA 1M2AA 2VAFA 1S3CA 1TRUA 3F8UA 1R4WA 2V1MA 3DXBA 2R2JA 4PQ1A 1FHEA 1ERTA 3NIVA 2X8HA 3DRNA 2P5RA 5AN1A 3LJRA 1PX7A 2R0CA 5IMAA 2VCQA 3HVSA 5D9XA 4L0UA 1GL8A 4JU5A 2NVLA 2IFQB 1O8WA 4G0KA 4I5QA 1O8XA 2X49A 4P3YB 5ID2B 3GSTA 3IRAA 1PKZA 2H6ZA 1AC1A 1FO5A 3C71A 5E4WA 5KN2A 1THOA 5GAPD 2H30A 13GSA 1G6YA 1TI1A 3ZLPA 2DJKA 1BEDA 4KUNA 4N0ZA 5DALB 3CTFA 3VK9A 4TR1B 1X9WB 1U88A 1THXA 5B6NA 3KGKA 3HY2A 2IL3A 2C0EA 3BBYA 3CXGA 4NWYA 4V1Ap 2LRNA 5ECLB 5ELGA 1SL2B 5CRWA 3TRXA 5F8BA 2NPBA 2RUFA 1LJRA 4JEDA 3TGZA 9GSSA 4QL7A 4TKYA 2IJYA 3KCMA 3LW9A 1BX9A 3GH9A 2YV9A 1OC9B 1AAZA 3Q18A 5C04A 5IPHA 3ZFBA 5AGYA 4ML6A 2AB6A 4JZQA 3TJBA 3GV1A 4IQ1A 1EEJA 3HA9A 4ULXA 3FHKA 3KEBA 4POMA 5ECOB 2VD0A 1A2JA 4KSMA 4AJ7A 4Q5QA 4GWRA 1GTIA 4FYUA 1NHYA 3IPZA 4X43A 2QKEA 4BVXA 4ZXGA 2B1KA 3TUEA 4IJ3A 1A23A 4JR4A 1X5DA 4IELA 3F9UA 3EMPA 5H5QA 4X0XA 1M9AA 2G2QA 4YAPA 3BD2A 5ECMB 3WT1A 1M99A 5ECSA 5G5FA 2FHEA 5DDLA 4BL7A 5J5NA 1K0OA 3HDCA 4MCUA 3KH7A 4GCIA 2WCIA 3H1NA 3AY8A 2PBJA 4E8HA 3EE2A 4KA0A 1XVWA 2HFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5A A;  3VUR A;  1Q98 A;  2YWO A;  1R5P A;  3IR4 A;  4ZIL A;  4KSO A;  5IMD A;  4DSS A;  1A8L A;  3CSH A;  1AIU A;  1UA5 A;  1PN9 A;  4PUF C;  4ISD A;  3ZIV A;  1YEX A;  3C73 A;  5KN0 A;  4ILF A;  3UVT A;  2TRX A;  1EZK A;  3HVV A;  1PSQ A;  2VUP A;  5D9W A;  4IHU A;  4XRD A;  5DVB A;  3UIW A;  1SK2 A;  3GTU A;  2X64 A;  2PER A;  1NSW A;  6GSY A;  5JCG A;  2B7J A;  4V2M A;  1MDI A;  2OAC A;  1BG5 A;  3WT2 A;  3KMN A;  4NHW A;  1W4V A;  3QFB C;  2KP2 A;  5LCZ A;  2AHE A;  1S3A A;  4IN0 A;  2KUC A;  2HI7 A;  3ERG A;  2MYG A;  5A4U A;  3LEF A;  3PGT A;  4LL4 B;  1Z9H A;  4V2N A;  1EGO A;  3RHC A;  1WMJ A;  2YWI A;  3DEX A;  4XS4 A;  4JE1 A;  4MH2 A;  5JCW A;  2B5E A;  4OFM A;  2CVB A;  2KP1 A;  2X99 A;  5DCH A;  2HXK A;  2LTK A;  5HFI A;  4V2L A;  3IXR A;  2R3X A;  4TR0 A;  1X9S B;  4I6X A;  2O8V B;  4BA7 A;  3IK9 A;  3HJP A;  3KTB A;  6GSS A;  4G2E A;  2PWJ A;  1K0A A;  2K6V A;  1YY7 A;  2ON5 A;  3ZYW A;  1FOV A;  4YQM A;  3TKP A;  1BJX A;  3GMF A;  2L5O A;  3GX8 A;  3CRT A;  3ZIJ A;  1GSU A;  1VGL A;  1WIK A;  2V2G A;  2FY6 A;  2E0Q A;  5F05 A;  1O73 A;  1YF1 A;  5IM9 A;  3UL3 A;  4I2U A;  3MAK A;  2A4V A;  3GYK A;  4L8E A;  3IE3 A;  2H73 A;  1EOH A;  2RLI A;  2F51 A;  5D9V A;  2I81 A;  5CO3 A;  1O6J A;  2I1U A;  2KOK A;  2MZC A;  3UVH A;  2GZP A;  5IQY A;  1G0T A;  4MP4 A;  3GX0 A;  2H0G A;  4O7H A;  5G1L A;  3BJ5 A;  2V41 A;  2X8G A;  1CQG A;  1QK8 A;  4GLT A;  4ZL7 A;  2VL3 A;  4KCA A;  3V1W A;  1GTU A;  1GSY A;  2H1A A;  1TW9 A;  2E7P A;  2C0F A;  4F03 A;  2IMI A;  4EDY A;  4K7I A;  1H75 A;  1C72 A;  3P90 A;  2N5F A;  1B48 A;  4WBR D;  2O85 A;  2RUE A;  3IC4 A;  4TXO B;  2PU9 C;  2LS5 A;  4PXO A;  4XS4 B;  2LRT A;  1FG4 A;  3U6V A;  2AYT A;  3FRC A;  4EL1 A;  5DCG A;  5EL8 A;  4ZIJ A;  3ZRD A;  3VWX A;  2LRC A;  5HR2 A;  4D73 B;  4MH3 A;  5DBQ A;  1SEN A;  3IK7 A;  4HZ2 A;  2L57 A;  1YJ6 A;  3G9B A;  3TJF A;  2H1D A;  1XCC A;  2AV4 A;  5FHI A;  2B3S A;  1PRX A;  1B8X A;  3L9U A;  4MJC A;  4IKH A;  2XC2 A;  2H6Y A;  2MBT A;  2RM5 A;  2EIR A;  2FCH A;  1URM A;  1WRY A;  1YKA A;  3APQ A;  4OO5 A;  4PUR A;  2YWM A;  5G30 A;  2GSS A;  1V98 A;  1WWJ A;  4PX1 A;  2FWH A;  2MBS A;  1EV9 A;  2CX4 A;  3FY7 A;  1R7H A;  2VCV A;  3M3M A;  2F9S A;  4LA1 A;  1ZYQ B;  3L9S A;  1HNB A;  1XIY A;  2L59 A;  4ML1 A;  1XWG A;  2FGX A;  4J2F A;  3ERF A;  2JU5 A;  2H74 A;  3VPT A;  5E59 A;  3GUR A;  3D22 A;  2WJU A;  2NBS A;  1A24 A;  2FWG A;  4GQC A;  3KZQ A;  2ON7 A;  2L4Q A;  3KJY A;  3TCO A;  3TKQ A;  3ZVJ D;  3IV4 A;  4ECI A;  3KD0 A;  4MZW A;  3C8E A;  5D9T A;  3WD6 A;  2K8V A;  4MPG A;  2IFQ A;  1K3Y A;  2VCT A;  5ID2 A;  1SJI A;  3LXZ A;  3QMX A;  4CDO A;  5ECP B;  2OBI A;  1EP8 A;  3TRQ A;  2WGR A;  3NOF A;  5DQS A;  2IMD A;  2B1L A;  1OKT A;  1A8Y A;  3ISO A;  1SL0 B;  4FIW A;  1DE1 A;  3MDK A;  1RW1 A;  4LMV A;  5IMZ A;  3KH9 A;  5D73 A;  2CT6 A;  5J41 A;  2CA8 A;  1GRX A;  2JAC A;  1A0R P;  3KM6 A;  2DSA A;  4HU7 A;  2YAN A;  3KP9 A;  3L9V A;  2JL4 A;  4OFN A;  4BPY A;  1J9B A;  2P31 A;  1T4Y A;  2VD1 A;  3LYK A;  4DEJ A;  3ZMK A;  1F6M C;  2NDO A;  5ELA A;  2L5L A;  3M8N A;  4E8E A;  1WPI A;  4MK3 A;  1QQ2 A;  3F6F A;  2O89 A;  1V2A A;  3HZ4 A;  3VLN A;  1GP1 A;  8GSS A;  5D96 A;  5CRH A;  3MNG A;  4POK A;  2H66 A;  4HJ2 A;  1ZCP A;  2GS3 A;  2C0D A;  1WJK A;  1ZOF A;  1NM3 A;  2VO4 A;  3ME7 A;  5CAX A;  5CYY A;  2VL2 A;  2CZ2 A;  4EXJ A;  1NHO A;  1SKW B;  1SKS B;  4Q5F A;  2H70 A;  4K7O A;  1M2B A;  1FVK A;  2NTO A;  2CQ9 A;  11GS A;  2GT5 A;  3UBK A;  2YJ7 A;  4PGT A;  3TKS C;  4OO4 A;  2C0G A;  2VLV A;  1UN2 A;  1I5G A;  4XHM A;  1PGT A;  4WF5 A;  3VPQ A;  3L78 A;  3LOR A;  2CV4 A;  3DYR A;  1VF3 A;  1U3I A;  3FZA A;  3QFA C;  5F06 A;  3ZIT A;  5A4V A;  1ZZY A;  1MD4 A;  2IIY A;  4HZ4 A;  1J08 A;  2OE3 A;  1E2Y A;  1XW5 A;  4K6X A;  4XIH A;  4TOP A;  1T3B A;  3CBU A;  1GNW A;  3R2Q A;  3GHA A;  4L0W A;  3K8N A;  2H71 A;  1SK0 A;  4XTS A;  3W6G A;  1GWC A;  1UC7 A;  2GQL A;  2TIR A;  3EMX A;  19GS A;  14GS A;  3ZZX A;  5KN3 A;  4L5L A;  1OE8 A;  2HYX A;  3DIE A;  1GSQ A;  5JWQ B;  1HNC A;  2CVK A;  3IAM 2;  2H0H A;  2FD3 A;  2WB9 A;  3ED3 A;  4MJA A;  2B5X A;  3J7Y k;  2VCZ A;  2GQK A;  3UJ1 A;  5JWR B;  3D5J A;  3QCP A;  5D93 A;  1PQN A;  4MZC A;  4ZBD A;  4N0V A;  4J56 E;  4N11 A;  1SK1 A;  2PUK C;  1V58 A;  4IP1 A;  1JZW A;  5J3R A;  4WEY A;  3QR6 A;  2IPA A;  1K3O A;  4KX4 A;  4O32 A;  4OD7 A;  5KEJ A;  2R37 A;  2YPM A;  2YWN A;  2CX3 A;  2LJR A;  2GVP A;  3ZRE A;  4IW9 A;  4HQZ A;  2PPT A;  1T4Z A;  4POL A;  2WFC A;  4IJI A;  3DKS A;  5ECQ B;  2LKU A;  1N2A A;  2YZU A;  4MJE A;  2LV3 A;  1YEP A;  3BCI A;  5EVO A;  3F0I A;  2M80 A;  3LG6 A;  5ECH B;  1RQM A;  4EC0 A;  2A2S A;  3HVX A;  2VOC A;  2O87 A;  3P7X A;  4I8B A;  4K8M A;  3M0F A;  3EU3 A;  2C3T A;  4KAE A;  1VF2 A;  2YNX A;  2GSR A;  2VLT A;  3F3R A;  3DWV A;  1XZO A;  1T7P B;  1XFL A;  1SJZ A;  2ZNM A;  2DLX A;  2F8F A;  3L4N A;  3EIN A;  4ECJ A;  4OCF A;  3CYN A;  4JRR A;  1DSB A;  3HJO A;  4PQI A;  2WZ9 A;  3FZ4 A;  1XPV A;  5ECN B;  2XBI A;  2I9H A;  3G7J A;  1K0N A;  1BAY A;  1XWB A;  4Z7X A;  5CP1 A;  3CTG A;  3Q6O A;  5GST A;  3W8S A;  2P0G A;  3LXT A;  4ACS A;  1ACV A;  1DUG A;  3FR9 A;  5J9B A;  4XCS A;  2CVD A;  4TXO A;  4DVC A;  2C3N A;  1XBS A;  3CSI A;  4YQV A;  1EV4 A;  2P5Q A;  3IDV A;  3TJG A;  5LD0 A;  1TKD B;  3L0H A;  1ERV A;  4I97 A;  1MTC A;  4MF6 A;  1TJD A;  2IME A;  1TP9 A;  1LU4 A;  2IMF A;  4D73 A;  1VF4 A;  1IYH A;  2GZZ A;  3QDN A;  1Z3E A;  3E9J B;  2H01 A;  2REM A;  2DMM A;  1PA3 A;  3FZ5 A;  1A2L A;  1TI3 A;  4YAV A;  4YQU A;  1TTZ A;  1H4O A;  2IWT A;  1OKD A;  2HZF A;  1JHB A;  3I6A A;  1XWA A;  2PVQ A;  2HZE A;  4N10 A;  4NPB A;  3A5W A;  2YOI A;  3RAZ A;  1ILO A;  1ST9 A;  2XBQ A;  2HRN A;  2AAW A;  1T00 A;  3NZN A;  5IO2 A;  4GST A;  1EWX A;  1Y25 A;  2BTO T;  1X5C A;  4NXI A;  4EO3 A;  3C1R A;  1SYX A;  2DBC A;  4X1U A;  3QAG A;  5AIS A;  2D2Z A;  4L5O A;  20GS A;  1CQH A;  3FKF A;  4LMW A;  5IIZ A;  5IMC A;  1TDI A;  4FO5 A;  4AGS A;  4HJM A;  5B7C A;  2YN1 A;  1AUC A;  5DAK B;  3CSJ A;  4MA9 A;  3QPM A;  3TJK A;  4WR5 A;  2R6K A;  2WRT A;  4ID0 A;  4GXZ A;  3TOU A;  1ERU A;  1JFU A;  1WOU A;  1GH2 A;  1KEB A;  4F9Z A;  2JZS A;  4F2I A;  2XHF A;  3UMA A;  2V6O A;  4AJ8 A;  1GUL A;  4FH8 A;  3QAW A;  2VM2 A;  3CRU A;  3EYT A;  4KH7 A;  1ML6 A;  3F6D A;  4WET A;  1BQ7 A;  2FNO A;  1G7O A;  2OE1 A;  1AW9 A;  1W89 A;  4JBB A;  1TK5 B;  1T1V A;  5HR0 A;  2BMX A;  4MF7 A;  1M9B A;  2HZE B;  2JZR A;  3TB2 A;  4EKZ A;  3W8J A;  4ZL9 A;  2VCX A;  1FB0 A;  2C4J A;  1I9D A;  1TOF A;  3N5O A;  5ECK B;  1JLV A;  22GS A;  4GQF A;  3D21 A;  3WGE A;  3ZL5 A;  2ALB A;  3Q74 A;  2IN3 A;  3WGX A;  3VFI A;  1J0F A;  4F0B A;  2FA8 A;  4NHZ A;  4IBP A;  3GL3 A;  1VF1 A;  1PL2 A;  3P2A A;  5CRE A;  3FW2 A;  1XW9 A;  4LL1 B;  4HS1 A;  1TXX A;  4HU9 A;  5GAN D;  3VWV A;  3H93 A;  3JCM L;  16GS A;  1MEK A;  3C1S A;  18GS A;  3US3 A;  3UAP A;  2M72 A;  4N30 A;  4EF0 A;  2BJX A;  4OMV A;  3DGQ A;  4MF5 A;  1BYE A;  4RUV A;  1FAA A;  3LFL A;  3F63 A;  4WKW A;  1GTA A;  4NAX A;  3TRP A;  2IMK A;  2LUS A;  2V6K A;  2LJA A;  1GSS A;  4EDZ A;  5B8B A;  3F4S A;  5AIV A;  1GNE A;  1JZR A;  2YZH A;  2GSQ A;  4I2T A;  1OE7 A;  2C1Y A;  4XS6 A;  4MMM A;  1XOB A;  1TK0 B;  1N8J A;  1LBK A;  2XPD A;  3I9V 2;  1MDK A;  4CHS A;  1USB A;  1TK8 B;  3I43 A;  4G19 A;  2WUL A;  1YQ1 A;  4ZB8 A;  2JSZ A;  1F3B A;  4GSS A;  1XWC A;  1DE2 A;  1GUK A;  1O85 A;  1Z7R A;  1M0U A;  2G0F A;  6GST A;  2WDU A;  5G2Z A;  4PUA A;  1GUH A;  3RPN A;  3D0Z A;  3MSZ A;  4CW9 A;  2GST A;  4KB3 A;  4DSR A;  1FB6 A;  2X8C A;  4K7N A;  1O81 A;  3GFK A;  3LGC A;  5EPF A;  3DD3 A;  4K9Z A;  4TXV A;  4HOJ A;  3EUR A;  3GRX A;  3G7I A;  3BCK A;  4KDX A;  4O5R A;  1XXU A;  4K0N A;  4KDU A;  5L71 A;  4KCE A;  1Z5Y E;  3VI5 A;  3H4K A;  1K0M A;  2L6C A;  3GKX A;  2F3M A;  2HT9 A;  1B9X C;  2R5G A;  2A2R A;  4IVF A;  4NV2 A;  1YKC A;  1AQW A;  4IQA A;  1FVJ A;  3HZ8 A;  2WS2 A;  2LEG A;  3A2X A;  4PNG A;  4HI7 A;  2H0I A;  1V9W A;  3GSS A;  3HXS A;  2GT6 A;  1F3A A;  3HYP A;  4MJB A;  2OAD A;  2FA4 A;  2QSI A;  4TW5 A;  3ZVJ A;  1DBY A;  2ES7 A;  3J7Y b;  2V32 A;  2LQO A;  5IO0 A;  2RM6 A;  2VM1 A;  4F82 A;  3D6I A;  1AQX A;  2DJ0 A;  1U6T A;  3IHQ A;  4V1A g;  3UOM A;  3F4T A;  5GSS A;  2XPE A;  3F3Q A;  1PD2 1;  2GLR A;  5G31 A;  2DC5 A;  2JZT A;  3SBC A;  1EOG A;  3LSZ A;  2H76 A;  2KLX A;  5ENU A;  1SKR B;  3GN3 A;  3P8W A;  4TVE A;  5FWG A;  2DJJ A;  5F0G A;  2J9H A;  1ERW A;  2LNS A;  3M9J A;  2GZY A;  1TU7 A;  2EC4 A;  3TKS E;  3GL5 A;  3APO A;  5LNK e;  3UAR A;  1SD8 A;  6GSV A;  4ECC A;  1V40 A;  4KGI A;  4H86 A;  5DJL A;  3O3T A;  2MMO A;  1GTB A;  2J23 A;  4OFT A;  4KE3 A;  3RBT A;  1EP7 A;  2OBK A;  1K3L A;  3GKN A;  2FWE A;  4K1F A;  1EEM A;  3N9J A;  1VRS D;  2TRC P;  1Q4J A;  1Z6M A;  5HQP A;  2K8S A;  3O76 A;  2LQQ A;  5B8A A;  3HHV A;  17GS A;  2K9F A;  1SD9 A;  3HD5 A;  3LYP A;  1IYI A;  3QAV A;  3KIJ A;  5HFK A;  1O7U A;  3GKM A;  2DJ3 A;  3TOT A;  3FR3 A;  3M1G A;  4EUY A;  4POB A;  1X9M B;  2H75 A;  1QGV A;  3KTL A;  4TR4 A;  1YZX A;  4IS0 A;  3MWH A;  2QC7 A;  5KN1 A;  3Q19 A;  1HYU A;  4O92 A;  2CAI A;  5IPG A;  5A4W A;  1SJ6 A;  1GLQ A;  5B6M A;  3FEU A;  2VL9 A;  1F37 A;  1XOA A;  3S9F A;  2QGV A;  3QOU A;  1U3A A;  3EC3 A;  4MDC A;  4GTU A;  1XW6 A;  1X5E A;  3WGD A;  3E3E A;  4PQH A;  1SL1 B;  2JAD A;  3KXO A;  4DSQ A;  1U87 A;  2C8U A;  4ZBA A;  1G6W A;  4KDY A;  3KP8 A;  3M9K A;  4BVY A;  3KMO A;  2AUV A;  4K2D A;  1Z7P A;  2E2M A;  5CRD A;  3UEM A;  1GSD A;  1EGR A;  3BOA A;  3H8Q A;  2MMZ A;  1R26 A;  2F8A A;  4WXT A;  1KTE A;  1ZYE A;  5CRG A;  1TRS A;  3DML A;  2JSY A;  6GSU A;  4XRA A;  5J9C A;  3CMI A;  2PMT A;  2VL2 C;  4MZB A;  1K0B A;  3I69 A;  3ME8 A;  3ZML A;  5DAK A;  1A2M A;  2K18 A;  2YCD A;  2OA7 A;  4RI6 A;  5HR3 A;  3GKK A;  5HFG A;  2E2G A;  3GNJ A;  5INY A;  4JR6 A;  1ON4 A;  1X0R A;  2PGT A;  4PNF A;  1HQO A;  2OKA A;  5ABR A;  1GUM A;  3ERW A;  4RI7 A;  1TU8 A;  3OR5 A;  4HEA 2;  3UBL A;  3SWL A;  2YP6 A;  2CZ3 A;  2H6X A;  5G5E A;  4AJ6 A;  5FT3 A;  2C80 A;  4BWQ A;  1YF0 A;  2DJ1 A;  1F9M A;  3WYW A;  1HNA A;  2GQM A;  2H1G A;  3LQ7 A;  4GSN A;  2N5A A;  3ZFL A;  4DSS B;  2ZCT A;  1QMV A;  2L4C A;  1ZMA A;  5HR1 A;  3EU4 A;  2B7K A;  4QQ7 A;  2ZUP A;  4Q5R A;  4TN8 A;  3HJM A;  2EIQ A;  1K0D A;  1OYJ A;  2H72 A;  1SYR A;  4KW6 A;  1E6B A;  1S3D A;  4ECB A;  1HD2 A;  4GRF A;  2OJL A;  4ZB6 A;  2B6M A;  4NV5 A;  2M46 A;  3GIX A;  2GTU A;  1QUW A;  1OC3 A;  2PVO C;  3PIN A;  5IMF A;  5DQY A;  1QXH A;  3PH9 A;  2HE3 A;  3GTU B;  1KBN A;  2DJ2 A;  1MD3 A;  1SU9 A;  4KND A;  1FW1 A;  3ZTL A;  3G7Y A;  4ZB9 A;  3RPP A;  1XWK A;  1M7T A;  4NMU A;  1TRV A;  2I4A A;  2YV7 A;  2I3Y A;  3FYG A;  2DIZ A;  4WR4 A;  4RQR A;  5AIX A;  1NW2 A;  2KHP A;  2HLS A;  3VI7 A;  3RHB A;  3LWA A;  1B9Y C;  1M2D A;  1OVN A;  1PL1 A;  3TJJ A;  1AXD A;  5CNW A;  3GH6 A;  3A2V A;  1MDJ A;  1OAZ A;  1AQV A;  1KNG A;  3VWU A;  1GSE A;  3H79 A;  1B4P A;  3U5R E;  5F07 A;  2FLS A;  4HUA A;  1GLP A;  4EE0 A;  4MLY A;  3TKS A;  5IOX A;  1XVQ A;  5IOW A;  5D8I A;  1B4Q A;  4ZBB A;  4GF0 A;  1JZO A;  2MMN A;  2GDR A;  4FYB A;  3IAS 2;  2FWF A;  4HQS A;  3IBH A;  1G7E A;  3APS A;  1OC8 A;  4AF2 A;  1TRW A;  1Z6N A;  2R4V A;  5EY6 A;  4K0G A;  5ECI B;  2GGT A;  2MMA A;  1A0F A;  3PR8 A;  10GS A;  2HSH A;  2H1B A;  3VWW A;  1PMT A;  1GSF A;  1WP0 A;  2VCW A;  2LJK A;  2O7K A;  2DML A;  4QL9 A;  3EVI A;  4G10 A;  1RK4 A;  4TR3 A;  5J4U A;  3HKR A;  2B5Y A;  2DIY A;  3RDW A;  5GZZ B;  4FYC A;  4OCE A;  3QD9 A;  4MPF A;  3DVX A;  1QFN A;  1ZL9 A;  1F2E A;  3FZ9 A;  1ZGN A;  3D4M A;  2N5B A;  1UVZ A;  4YH2 A;  4IP6 A;  4BWS A;  2L6D A;  3DVW A;  4WBJ A;  3TDG A;  3O6T A;  3D4T A;  5COH A;  3GUS A;  5A5K A;  2RII A;  4ZL8 A;  5JCU A;  3F4R A;  2LNT A;  4RQX A;  3HCZ A;  6GSW A;  3TKR A;  1V57 A;  1ABA A;  3EWL A;  4IGJ A;  1JZD A;  1WE0 A;  2C3Q A;  1YDK A;  3GA4 A;  2H19 A;  1PKW A;  2CAQ A;  4TRX A;  5ECR B;  4Q5N A;  2HNL A;  5JWO B;  3A3T A;  2VLU A;  2Z9S A;  2HSY A;  5DAL A;  5H5S A;  4MAB A;  4TR1 A;  4HDE A;  7GSS A;  12GS A;  2H8L A;  5H5R A;  5DJM A;  4LLR A;  2PN8 A;  3FR6 A;  2VIM A;  2YJH A;  2AJQ B;  1PX6 A;  6GSX A;  3C7M A;  1K0C A;  2HRF A;  3IA1 A;  4G9H A;  3E0U A;  2OE0 A;  4OWY A;  1OC9 A;  4XS1 A;  4F0C A;  2FUG 2;  4WF4 A;  4EVM A;  5C00 A;  2EIO A;  3IOS A;  4J57 E;  1JLW A;  3FK8 A;  3A2W A;  1Y6E A;  5G1K A;  1T8E B;  2LST A;  5IMV A;  1M2A A;  2VAF A;  1S3C A;  1TRU A;  3F8U A;  1R4W A;  2V1M A;  3DXB A;  2R2J A;  4PQ1 A;  1FHE A;  1ERT A;  3NIV A;  2X8H A;  3DRN A;  2P5R A;  5AN1 A;  3LJR A;  1PX7 A;  5IMA A;  2VCQ A;  3HVS A;  5D9X A;  4L0U A;  1GL8 A;  4JU5 A;  2NVL A;  2IFQ B;  1O8W A;  4I5Q A;  1O8X A;  4P3Y B;  5ID2 B;  3GST A;  3IRA A;  1PKZ A;  2H6Z A;  1AC1 A;  1FO5 A;  3C71 A;  5E4W A;  5KN2 A;  1THO A;  5GAP D;  2H30 A;  13GS A;  1G6Y A;  1TI1 A;  3ZLP A;  2DJK A;  1BED A;  4KUN A;  4N0Z A;  5DAL B;  3CTF A;  3VK9 A;  4TR1 B;  1X9W B;  1U88 A;  1THX A;  5B6N A;  3KGK A;  3HY2 A;  2IL3 A;  2C0E A;  3BBY A;  3CXG A;  4NWY A;  4V1A p;  2LRN A;  5ECL B;  5ELG A;  1SL2 B;  5CRW A;  3TRX A;  5F8B A;  2NPB A;  2RUF A;  1LJR A;  4JED A;  3TGZ A;  9GSS A;  4QL7 A;  4TKY A;  2IJY A;  3KCM A;  1BX9 A;  3GH9 A;  2YV9 A;  1OC9 B;  1AAZ A;  3Q18 A;  5C04 A;  5IPH A;  3ZFB A;  5AGY A;  4ML6 A;  2AB6 A;  4JZQ A;  3TJB A;  3GV1 A;  4IQ1 A;  1EEJ A;  3HA9 A;  4ULX A;  3FHK A;  3KEB A;  4POM A;  5ECO B;  2VD0 A;  1A2J A;  4KSM A;  4AJ7 A;  4Q5Q A;  4GWR A;  1GTI A;  4FYU A;  1NHY A;  3IPZ A;  4X43 A;  2QKE A;  4BVX A;  4ZXG A;  2B1K A;  3TUE A;  4IJ3 A;  1A23 A;  4JR4 A;  1X5D A;  4IEL A;  3F9U A;  3EMP A;  5H5Q A;  4X0X A;  1M9A A;  2G2Q A;  4YAP A;  3BD2 A;  5ECM B;  3WT1 A;  1M99 A;  5ECS A;  5G5F A;  2FHE A;  5DDL A;  4BL7 A;  5J5N A;  1K0O A;  3HDC A;  4MCU A;  3KH7 A;  4GCI A;  2WCI A;  3H1N A;  3AY8 A;  2PBJ A;  4E8H A;  3EE2 A;  4KA0 A;  1XVW A;  2HFD A; 
#chains in the Genus database with same CATH topology
 1R5A A;  4YKG A;  4YKF A;  3VUR A;  1Q98 A;  2YWO A;  1R5P A;  3IR4 A;  4ZIL A;  4KSO A;  5IMD A;  4DSS A;  1A8L A;  3CSH A;  1AIU A;  1UA5 A;  1PN9 A;  4PUF C;  4ISD A;  3ZIV A;  1YEX A;  3C73 A;  4Z2R A;  5KN0 A;  4ILF A;  3UVT A;  2TRX A;  1EZK A;  3HVV A;  1PSQ A;  2VUP A;  5D9W A;  4IHU A;  4XRD A;  5DVB A;  3UIW A;  1SK2 A;  2UZ8 A;  3GTU A;  2X64 A;  2PER A;  1NSW A;  6GSY A;  5KOX A;  5JCG A;  2B7J A;  4V2M A;  1MDI A;  2OAC A;  1BG5 A;  3WT2 A;  3KMN A;  4NHW A;  1ZYN A;  1W4V A;  3QFB C;  2KP2 A;  5LCZ A;  4BL7 B;  2AHE A;  1S3A A;  4IN0 A;  2KUC A;  2HI7 A;  3ERG A;  2MYG A;  5A4U A;  3LEF A;  3PGT A;  2R0P A;  4LL4 B;  1Z9H A;  4V2N A;  1EGO A;  3RHC A;  1WMJ A;  2YWI A;  3DEX A;  4XS4 A;  4JE1 A;  4MH2 A;  2HRA A;  5JCW A;  2B5E A;  4OFM A;  2CVB A;  2KP1 A;  2X99 A;  5DCH A;  2HXK A;  2LTK A;  5HFI A;  4V2L A;  3IXR A;  2R3X A;  4TR0 A;  1X9S B;  4I6X A;  2O8V B;  3R3E A;  4BA7 A;  3IK9 A;  3HJP A;  3KTB A;  6GSS A;  4G2E A;  2PWJ A;  1K0A A;  2K6V A;  1YY7 A;  2ON5 A;  3ZYW A;  1FOV A;  4YQM A;  3TKP A;  1BJX A;  3GMF A;  2L5O A;  3GX8 A;  3CRT A;  3ZIJ A;  1GSU A;  1VGL A;  1WIK A;  2V2G A;  2FY6 A;  2E0Q A;  5F05 A;  1O73 A;  1YF1 A;  5IM9 A;  3UL3 A;  4I2U A;  3MAK A;  2A4V A;  3GYK A;  4L8E A;  3IE3 A;  2H73 A;  1EOH A;  2RLI A;  2F51 A;  5D9V A;  2I81 A;  5CO3 A;  1O6J A;  2I1U A;  2KOK A;  2MZC A;  3UVH A;  2GZP A;  5IQY A;  1G0T A;  4MP4 A;  3GX0 A;  2H0G A;  4O7H A;  5G1L A;  3BJ5 A;  2V41 A;  2X8G A;  1CQG A;  1QK8 A;  4GLT A;  4ZL7 A;  2VL3 A;  4KCA A;  3V1W A;  1GTU A;  1GSY A;  2H1A A;  1TW9 A;  2E7P A;  2C0F A;  4F03 A;  2IMI A;  4EDY A;  4K7I A;  1H75 A;  1C72 A;  3P90 A;  2N5F A;  1B48 A;  4WBR D;  2O85 A;  2RUE A;  3IC4 A;  4TXO B;  2PU9 C;  2LS5 A;  4PXO A;  4XS4 B;  2LRT A;  1FG4 A;  3U6V A;  2AYT A;  3FRC A;  4EL1 A;  5DCG A;  4Z2T A;  5EL8 A;  4ZIJ A;  3ZRD A;  3VWX A;  1ZYP A;  2LRC A;  5HR2 A;  2QA2 A;  4D73 B;  4MH3 A;  5DBQ A;  1SEN A;  3IK7 A;  4HZ2 A;  2L57 A;  1YJ6 A;  3G9B A;  3TJF A;  2H1D A;  1XCC A;  2AV4 A;  5FHI A;  2B3S A;  1PRX A;  1B8X A;  3L9U A;  4MJC A;  4IKH A;  2XC2 A;  2H6Y A;  2MBT A;  2RM5 A;  2EIR A;  2FCH A;  1URM A;  1WRY A;  3CQF A;  1YKA A;  3APQ A;  4OO5 A;  4PUR A;  2YWM A;  5G30 A;  2GSS A;  1V98 A;  1WWJ A;  4PX1 A;  2FWH A;  2MBS A;  1EV9 A;  2CX4 A;  3FY7 A;  1R7H A;  2VCV A;  3M3M A;  2F9S A;  4LA1 A;  1ZYQ B;  3L9S A;  1HNB A;  1XIY A;  2L59 A;  4ML1 A;  1XWG A;  2FGX A;  4J2F A;  3ERF A;  2JU5 A;  2H74 A;  3VPT A;  5E59 A;  3GUR A;  3D22 A;  2WJU A;  2NBS A;  1A24 A;  2FWG A;  4GQC A;  3KZQ A;  2ON7 A;  2L4Q A;  3KJY A;  3TCO A;  3TKQ A;  3ZVJ D;  3IV4 A;  4ECI A;  3KD0 A;  4MZW A;  3C8E A;  5D9T A;  3WD6 A;  2K8V A;  4MPG A;  2IFQ A;  1K3Y A;  2VCT A;  5ID2 A;  1SJI A;  3LXZ A;  3QMX A;  4CDO A;  2OBI A;  5ECP B;  2HSM A;  1EP8 A;  3TRQ A;  2WGR A;  3NOF A;  5DQS A;  2IMD A;  2B1L A;  1OKT A;  1A8Y A;  3ISO A;  1SL0 B;  4FIW A;  1DE1 A;  3MDK A;  1RW1 A;  4LMV A;  5IMZ A;  3KH9 A;  5D73 A;  2CT6 A;  5J41 A;  2CA8 A;  1GRX A;  2JAC A;  1A0R P;  3KM6 A;  2DSA A;  4HU7 A;  2YAN A;  3KP9 A;  3L9V A;  2JL4 A;  4OFN A;  4BPY A;  1J9B A;  2P31 A;  1XG8 A;  1T4Y A;  3A5I A;  2VD1 A;  3LYK A;  4DEJ A;  3ZMK A;  1F6M C;  2NDO A;  5ELA A;  2L5L A;  3M8N A;  4E8E A;  1WPI A;  4MK3 A;  1QQ2 A;  3F6F A;  2O89 A;  1V2A A;  3HZ4 A;  3VLN A;  1GP1 A;  8GSS A;  5D96 A;  5CRH A;  4MNN A;  5KOW A;  3MNG A;  4POK A;  2H66 A;  4HJ2 A;  1ZCP A;  2GS3 A;  2C0D A;  1WJK A;  1ZOF A;  1NM3 A;  2VO4 A;  3ME7 A;  5CAX A;  5CYY A;  2VL2 A;  2CZ2 A;  4EXJ A;  1NHO A;  1SKW B;  1SKS B;  4Q5F A;  2H70 A;  4K7O A;  1M2B A;  1FVK A;  2NTO A;  2CQ9 A;  11GS A;  2GT5 A;  3UBK A;  2YJ7 A;  4PGT A;  3TKS C;  4OO4 A;  2C0G A;  2VLV A;  1UN2 A;  1I5G A;  4K5R A;  4XHM A;  1PGT A;  4WF5 A;  3VPQ A;  3L78 A;  3LOR A;  2CV4 A;  3DYR A;  1VF3 A;  1U3I A;  3FZA A;  3QFA C;  5F06 A;  3ZIT A;  5A4V A;  1ZZY A;  1MD4 A;  2IIY A;  4HZ4 A;  1J08 A;  2OE3 A;  1E2Y A;  1PFO A;  1XW5 A;  4K6X A;  4XIH A;  4TOP A;  1T3B A;  3CBU A;  4BIK A;  1GNW A;  3R2Q A;  3GHA A;  4L0W A;  3K8N A;  2H71 A;  1SK0 A;  4XTS A;  3W6G A;  1GWC A;  1UC7 A;  4KF9 A;  2GQL A;  2TIR A;  3EMX A;  19GS A;  14GS A;  3ZZX A;  5KN3 A;  4L5L A;  1OE8 A;  2HYX A;  3DIE A;  1GSQ A;  5JWQ B;  1HNC A;  2CVK A;  3IAM 2;  2H0H A;  2FD3 A;  2WB9 A;  3ED3 A;  4MJA A;  2B5X A;  3J7Y k;  2VCZ A;  2GQK A;  3UJ1 A;  5JWR B;  3D5J A;  3QCP A;  5D93 A;  1PQN A;  4MZC A;  4ZBD A;  4N0V A;  4J56 E;  4N11 A;  1SK1 A;  2PUK C;  1V58 A;  4IP1 A;  1JZW A;  5J3R A;  4WEY A;  3QR6 A;  2IPA A;  1K3O A;  4KX4 A;  4O32 A;  4OD7 A;  4K2X A;  5KEJ A;  2R37 A;  2YPM A;  2YWN A;  2CX3 A;  2LJR A;  2GVP A;  3ZRE A;  4IW9 A;  4HQZ A;  2PPT A;  1T4Z A;  4POL A;  2WFC A;  4IJI A;  3DKS A;  5ECQ B;  2LKU A;  1N2A A;  2YZU A;  4MJE A;  2LV3 A;  1YEP A;  2DKI A;  3BCI A;  5EVO A;  3F0I A;  2M80 A;  3LG6 A;  5ECH B;  1RQM A;  4EC0 A;  2A2S A;  3HVX A;  2VOC A;  2O87 A;  5BMU A;  3P7X A;  4I8B A;  4K8M A;  3M0F A;  3EU3 A;  2C3T A;  4KAE A;  1VF2 A;  2YNX A;  3IC8 A;  2GSR A;  2VLT A;  3F3R A;  3DWV A;  2HRK A;  1XZO A;  1T7P B;  1XFL A;  1SJZ A;  2ZNM A;  1M3I A;  2DLX A;  2F8F A;  3L4N A;  3EIN A;  4ECJ A;  4OCF A;  3CYN A;  4JRR A;  1DSB A;  3HJO A;  4PQI A;  2WZ9 A;  3FZ4 A;  1XPV A;  5ECN B;  2XBI A;  2I9H A;  3G7J A;  1K0N A;  1BAY A;  1XWB A;  4Z7X A;  5CP1 A;  3CTG A;  3Q6O A;  5GST A;  3W8S A;  2P0G A;  3LXT A;  4ACS A;  1ACV A;  1DUG A;  3FR9 A;  5J9B A;  2X4A A;  4XCS A;  2CVD A;  4TXO A;  4DVC A;  2C3N A;  1XBS A;  3CSI A;  4YQV A;  1EV4 A;  2P5Q A;  3IDV A;  3TJG A;  5LD0 A;  1TKD B;  3L0H A;  1ERV A;  4I97 A;  1MTC A;  4MF6 A;  1TJD A;  2IME A;  1TP9 A;  1LU4 A;  2IMF A;  4D73 A;  1VF4 A;  1IYH A;  2GZZ A;  3QDN A;  1Z3E A;  3E9J B;  2H01 A;  2REM A;  2DMM A;  1PA3 A;  3FZ5 A;  1A2L A;  1TI3 A;  4YAV A;  4YQU A;  1TTZ A;  1H4O A;  2IWT A;  1OKD A;  2HZF A;  1JHB A;  3I6A A;  1XWA A;  2PVQ A;  2HZE A;  4N10 A;  4NPB A;  3A5W A;  2YOI A;  3RAZ A;  1ILO A;  1ST9 A;  2XBQ A;  2HRN A;  2AAW A;  1T00 A;  3NZN A;  5IO2 A;  4GST A;  1EWX A;  1Y25 A;  2BTO T;  1X5C A;  4NXI A;  4EO3 A;  3C1R A;  1SYX A;  2DBC A;  4X1U A;  3QAG A;  5AIS A;  2D2Z A;  4L5O A;  20GS A;  1CQH A;  3FKF A;  4LMW A;  5IIZ A;  5IMC A;  1TDI A;  4FO5 A;  4AGS A;  4HJM A;  5B7C A;  2YN1 A;  1AUC A;  5DAK B;  3CSJ A;  4MA9 A;  3QPM A;  3TJK A;  4WR5 A;  2R6K A;  2WRT A;  4ID0 A;  4GXZ A;  3TOU A;  1ERU A;  1JFU A;  1WOU A;  1GH2 A;  1PN0 A;  1KEB A;  4F9Z A;  2JZS A;  4Z2U A;  4F2I A;  2XHF A;  3UMA A;  2V6O A;  4AJ8 A;  1GUL A;  4FH8 A;  3QAW A;  2VM2 A;  3CRU A;  3EYT A;  4KH7 A;  1ML6 A;  3F6D A;  2DKH A;  4WET A;  4O5Q A;  1BQ7 A;  2FNO A;  1G7O A;  2OE1 A;  1AW9 A;  1W89 A;  4JBB A;  1TK5 B;  1T1V A;  5HR0 A;  2BMX A;  4X4J A;  4MF7 A;  1M9B A;  2HZE B;  2JZR A;  3TB2 A;  4EKZ A;  3W8J A;  4ZL9 A;  2VCX A;  1FB0 A;  2C4J A;  1FOH A;  1I9D A;  1TOF A;  3N5O A;  5ECK B;  1JLV A;  22GS A;  4GQF A;  3D21 A;  3WGE A;  3ZL5 A;  2ALB A;  3Q74 A;  2IN3 A;  3WGX A;  3VFI A;  1J0F A;  4F0B A;  2FA8 A;  4NHZ A;  4IBP A;  3GL3 A;  1VF1 A;  1PL2 A;  3P2A A;  2A2P A;  5CRE A;  3FW2 A;  1XW9 A;  4LL1 B;  4HS1 A;  1TXX A;  4HU9 A;  5GAN D;  3VWV A;  3H93 A;  3JCM L;  16GS A;  1MEK A;  3C1S A;  18GS A;  3US3 A;  3UAP A;  2M72 A;  4N30 A;  4EF0 A;  2BJX A;  4OMV A;  3DGQ A;  4MF5 A;  1BYE A;  4RUV A;  2R0G A;  1FAA A;  3LFL A;  3F63 A;  4WKW A;  1GTA A;  4NAX A;  3TRP A;  2IMK A;  4K5S A;  2LUS A;  2V6K A;  2LJA A;  1GSS A;  4EDZ A;  5B8B A;  3F4S A;  5AIV A;  1GNE A;  1JZR A;  2YZH A;  2GSQ A;  4I2T A;  1OE7 A;  2C1Y A;  4XS6 A;  4MMM A;  1XOB A;  1TK0 B;  1N8J A;  1LBK A;  2XPD A;  3I9V 2;  1MDK A;  4CHS A;  1USB A;  1TK8 B;  3I43 A;  4G19 A;  2WUL A;  1YQ1 A;  4ZB8 A;  2JSZ A;  1F3B A;  4GSS A;  1XWC A;  1DE2 A;  1GUK A;  1O85 A;  1Z7R A;  1M0U A;  2G0F A;  6GST A;  2WDU A;  5G2Z A;  4PUA A;  1GUH A;  3RPN A;  3D0Z A;  3MSZ A;  4CW9 A;  2GST A;  4KB3 A;  4DSR A;  1FB6 A;  2X8C A;  4K7N A;  1O81 A;  3GFK A;  3LGC A;  5EPF A;  3DD3 A;  4K9Z A;  4TXV A;  4HOJ A;  3EUR A;  3GRX A;  3G7I A;  3BCK A;  4KDX A;  4O5R A;  1XXU A;  4K0N A;  4KDU A;  5L71 A;  4KCE A;  1Z5Y E;  3VI5 A;  3H4K A;  1K0M A;  2L6C A;  3GKX A;  2F3M A;  2HT9 A;  1B9X C;  4FQU A;  2R5G A;  2A2R A;  4IVF A;  4NV2 A;  1YKC A;  1AQW A;  4IQA A;  4CY6 A;  1FVJ A;  3HZ8 A;  2WS2 A;  2LEG A;  3A2X A;  4PNG A;  4HI7 A;  2H0I A;  1V9W A;  3GSS A;  3HXS A;  2GT6 A;  1F3A A;  4EIP A;  3HYP A;  4MJB A;  2OAD A;  2FA4 A;  2QSI A;  4TW5 A;  3ZVJ A;  1DBY A;  2ES7 A;  3J7Y b;  2V32 A;  2LQO A;  5IO0 A;  2RM6 A;  2VM1 A;  4F82 A;  3D6I A;  1AQX A;  2DJ0 A;  1U6T A;  3IHQ A;  4V1A g;  3UOM A;  3F4T A;  5GSS A;  2XPE A;  3F3Q A;  1PD2 1;  2GLR A;  5G31 A;  2DC5 A;  2JZT A;  3SBC A;  1EOG A;  3LSZ A;  2H76 A;  2KLX A;  5ENU A;  1SKR B;  3GN3 A;  3P8W A;  4TVE A;  5FWG A;  2DJJ A;  5F0G A;  2J9H A;  2A4H A;  1ERW A;  2LNS A;  3M9J A;  2GZY A;  1TU7 A;  2EC4 A;  3TKS E;  4CY8 A;  3GL5 A;  3APO A;  5LNK e;  3UAR A;  1SD8 A;  6GSV A;  4ECC A;  1V40 A;  4KGI A;  4H86 A;  5DJL A;  3O3T A;  2MMO A;  1GTB A;  3FMW A;  2J23 A;  4O5U A;  4OFT A;  4KE3 A;  3RBT A;  1EP7 A;  2OBK A;  1K3L A;  3GKN A;  2FWE A;  4K1F A;  1EEM A;  3N9J A;  1VRS D;  2TRC P;  1Q4J A;  4ICY A;  1Z6M A;  5HQP A;  2K8S A;  3O76 A;  2LQQ A;  5B8A A;  3HHV A;  17GS A;  2K9F A;  1SD9 A;  3HD5 A;  3LYP A;  1IYI A;  3QAV A;  3KIJ A;  5HFK A;  1O7U A;  4G0I A;  3GKM A;  2DJ3 A;  3TOT A;  3FR3 A;  3M1G A;  4EUY A;  4POB A;  1X9M B;  2H75 A;  1QGV A;  3KTL A;  4TR4 A;  1YZX A;  4IS0 A;  3MWH A;  2QC7 A;  5KN1 A;  3Q19 A;  1HYU A;  4O92 A;  2CAI A;  5IPG A;  5A4W A;  1SJ6 A;  1GLQ A;  5B6M A;  3FEU A;  2VL9 A;  1F37 A;  1XOA A;  3S9F A;  2QGV A;  3QOU A;  1U3A A;  3EC3 A;  4MDC A;  4GTU A;  1XW6 A;  1X5E A;  3WGD A;  3E3E A;  4PQH A;  1SL1 B;  2JAD A;  3KXO A;  4DSQ A;  1U87 A;  2C8U A;  4ZBA A;  1G6W A;  2QA1 A;  4KDY A;  3KP8 A;  3M9K A;  4BVY A;  3KMO A;  2AUV A;  4K2D A;  1Z7P A;  2E2M A;  5CRD A;  3UEM A;  1GSD A;  1EGR A;  3BOA A;  3H8Q A;  2MMZ A;  1R26 A;  2F8A A;  4WXT A;  1KTE A;  1ZYE A;  5CRG A;  1TRS A;  3DML A;  2JSY A;  6GSU A;  4XRA A;  4BVX B;  5J9C A;  3CMI A;  2PMT A;  2VL2 C;  4MZB A;  1K0B A;  3I69 A;  3ME8 A;  3ZML A;  5DAK A;  1A2M A;  2K18 A;  2YCD A;  2OA7 A;  4RI6 A;  5HR3 A;  3GKK A;  5HFG A;  2E2G A;  3GNJ A;  5INY A;  4JR6 A;  1ON4 A;  1X0R A;  2PGT A;  5BRT A;  4PNF A;  1HQO A;  2OKA A;  5ABR A;  1GUM A;  3ERW A;  4RI7 A;  1TU8 A;  3OR5 A;  4HEA 2;  3UBL A;  3SWL A;  2YP6 A;  2CZ3 A;  2H6X A;  5G5E A;  4AJ6 A;  5FT3 A;  2C80 A;  4BWQ A;  1YF0 A;  2DJ1 A;  1F9M A;  3WYW A;  1HNA A;  2GQM A;  2H1G A;  3LQ7 A;  4GSN A;  2N5A A;  3ZFL A;  4DSS B;  2ZCT A;  1QMV A;  2L4C A;  1ZMA A;  5HR1 A;  3EU4 A;  2B7K A;  4QQ7 A;  2ZUP A;  4Q5R A;  4TN8 A;  3HJM A;  2EIQ A;  4BVY B;  1K0D A;  1OYJ A;  2H72 A;  1SYR A;  4KW6 A;  1E6B A;  1S3R A;  1S3D A;  4ECB A;  3EPT A;  1HD2 A;  4GRF A;  2OJL A;  4ZB6 A;  2B6M A;  4NV5 A;  2M46 A;  3GIX A;  2GTU A;  1QUW A;  1OC3 A;  2PVO C;  3PIN A;  5IMF A;  5DQY A;  1QXH A;  3PH9 A;  2HE3 A;  3GTU B;  1KBN A;  4A5P A;  2DJ2 A;  1MD3 A;  1SU9 A;  4KND A;  1FW1 A;  3ZTL A;  3G7Y A;  4ZB9 A;  3RPP A;  1XWK A;  1M7T A;  4NMU A;  1TRV A;  2I4A A;  2YV7 A;  3IHG A;  2I3Y A;  3FYG A;  2DIZ A;  4WR4 A;  4RQR A;  5AIX A;  1NW2 A;  2KHP A;  2HLS A;  3VI7 A;  3RHB A;  3LWA A;  1B9Y C;  1M2D A;  1OVN A;  1PL1 A;  3TJJ A;  1AXD A;  5CNW A;  3GH6 A;  3A2V A;  1MDJ A;  1OAZ A;  1AQV A;  1KNG A;  3VWU A;  4EIQ A;  1GSE A;  3H79 A;  1B4P A;  3U5R E;  5F07 A;  2FLS A;  4HUA A;  1GLP A;  4EE0 A;  4MLY A;  3TKS A;  5IOX A;  1XVQ A;  5IOW A;  5D8I A;  1B4Q A;  4ZBB A;  4GF0 A;  1JZO A;  2MMN A;  2GDR A;  4FYB A;  3IAS 2;  2FWF A;  4HQS A;  3IBH A;  1G7E A;  3APS A;  1OC8 A;  4AF2 A;  1TRW A;  1Z6N A;  2R4V A;  4USS A;  5EY6 A;  4K0G A;  5ECI B;  2GGT A;  2MMA A;  1A0F A;  3PR8 A;  10GS A;  2HSH A;  2H1B A;  3VWW A;  1PMT A;  1GSF A;  1WP0 A;  2VCW A;  2LJK A;  2O7K A;  2DML A;  4QL9 A;  3EVI A;  4G10 A;  1RK4 A;  4TR3 A;  5J4U A;  3HKR A;  2B5Y A;  2DIY A;  3RDW A;  5GZZ B;  4FYC A;  4OCE A;  3QD9 A;  4MPF A;  3DVX A;  1QFN A;  1ZL9 A;  1F2E A;  3FZ9 A;  1ZGN A;  3D4M A;  2N5B A;  1UVZ A;  4YH2 A;  4IP6 A;  4BWS A;  2L6D A;  3DVW A;  4WBJ A;  3TDG A;  3O6T A;  3D4T A;  5COH A;  3GUS A;  5A5K A;  2RII A;  4ZL8 A;  3HVN A;  5JCU A;  3F4R A;  2LNT A;  3MYD A;  4RQX A;  3HCZ A;  6GSW A;  3TKR A;  1V57 A;  1ABA A;  3EWL A;  4IGJ A;  3MIX A;  1JZD A;  1WE0 A;  2C3Q A;  1YDK A;  3GA4 A;  2H19 A;  1PKW A;  4PTS A;  2CAQ A;  4TRX A;  5ECR B;  4Q5N A;  2HNL A;  5JWO B;  3A3T A;  2Z9S A;  2VLU A;  2HSY A;  5DAL A;  5H5S A;  4MAB A;  4TR1 A;  4HDE A;  7GSS A;  12GS A;  2H8L A;  5H5R A;  5DJM A;  4LLR A;  2PN8 A;  3FR6 A;  2VIM A;  4G0L A;  2YJH A;  2AJQ B;  1PX6 A;  6GSX A;  3C7M A;  1K0C A;  2HRF A;  3IA1 A;  4G9H A;  3E0U A;  2OE0 A;  1M3J A;  4OWY A;  1OC9 A;  4XS1 A;  4F0C A;  2FUG 2;  4WF4 A;  4EVM A;  5C00 A;  2EIO A;  3IOS A;  4J57 E;  1JLW A;  3FK8 A;  3A2W A;  1Y6E A;  5G1K A;  1T8E B;  2LST A;  5IMV A;  3PPU A;  1M2A A;  2VAF A;  1S3C A;  1TRU A;  3F8U A;  1R4W A;  2V1M A;  3DXB A;  2R2J A;  4PQ1 A;  1FHE A;  1ERT A;  3NIV A;  2X8H A;  3DRN A;  2P5R A;  5AN1 A;  3LJR A;  1PX7 A;  2R0C A;  5IMA A;  2VCQ A;  3HVS A;  5D9X A;  4L0U A;  1GL8 A;  4JU5 A;  2NVL A;  2IFQ B;  1O8W A;  4G0K A;  4I5Q A;  1O8X A;  2X49 A;  4P3Y B;  5ID2 B;  3GST A;  3IRA A;  1PKZ A;  2H6Z A;  1AC1 A;  1FO5 A;  3C71 A;  5E4W A;  5KN2 A;  1THO A;  5GAP D;  2H30 A;  13GS A;  1G6Y A;  1TI1 A;  3ZLP A;  2DJK A;  1BED A;  4KUN A;  4N0Z A;  5DAL B;  3CTF A;  3VK9 A;  4TR1 B;  1X9W B;  1U88 A;  1THX A;  5B6N A;  3KGK A;  3HY2 A;  2IL3 A;  2C0E A;  3BBY A;  3CXG A;  4NWY A;  4V1A p;  2LRN A;  5ECL B;  5ELG A;  1SL2 B;  5CRW A;  3TRX A;  5F8B A;  2NPB A;  2RUF A;  1LJR A;  4JED A;  3TGZ A;  9GSS A;  4QL7 A;  4TKY A;  2IJY A;  3KCM A;  3LW9 A;  1BX9 A;  3GH9 A;  2YV9 A;  1OC9 B;  1AAZ A;  3Q18 A;  5C04 A;  5IPH A;  3ZFB A;  5AGY A;  4ML6 A;  2AB6 A;  4JZQ A;  3TJB A;  3GV1 A;  4IQ1 A;  1EEJ A;  3HA9 A;  4ULX A;  3FHK A;  3KEB A;  4POM A;  5ECO B;  2VD0 A;  1A2J A;  4KSM A;  4AJ7 A;  4Q5Q A;  4GWR A;  1GTI A;  4FYU A;  1NHY A;  3IPZ A;  4X43 A;  2QKE A;  4BVX A;  4ZXG A;  2B1K A;  3TUE A;  4IJ3 A;  1A23 A;  4JR4 A;  1X5D A;  4IEL A;  3F9U A;  3EMP A;  5H5Q A;  4HSC X;  4X0X A;  1M9A A;  2G2Q A;  4YAP A;  3BD2 A;  5ECM B;  3WT1 A;  1M99 A;  5ECS A;  5G5F A;  2FHE A;  5DDL A;  4BL7 A;  5J5N A;  1K0O A;  3HDC A;  4MCU A;  3KH7 A;  4GCI A;  2WCI A;  3H1N A;  3AY8 A;  2PBJ A;  4E8H A;  3EE2 A;  4KA0 A;  1XVW A;  2HFD A; 
#chains in the Genus database with same CATH homology
 1R5A A;  4YKG A;  4YKF A;  3VUR A;  1Q98 A;  2YWO A;  1R5P A;  3IR4 A;  4ZIL A;  4KSO A;  5IMD A;  4DSS A;  1A8L A;  3CSH A;  1AIU A;  1UA5 A;  1PN9 A;  4PUF C;  4ISD A;  3ZIV A;  1YEX A;  3C73 A;  4Z2R A;  5KN0 A;  4ILF A;  3UVT A;  2TRX A;  1EZK A;  3HVV A;  1PSQ A;  2VUP A;  5D9W A;  4IHU A;  4XRD A;  5DVB A;  3UIW A;  1SK2 A;  2UZ8 A;  3GTU A;  2X64 A;  2PER A;  1NSW A;  6GSY A;  5KOX A;  5JCG A;  2B7J A;  4V2M A;  1MDI A;  2OAC A;  1BG5 A;  3WT2 A;  3KMN A;  4NHW A;  1ZYN A;  1W4V A;  3QFB C;  2KP2 A;  5LCZ A;  4BL7 B;  2AHE A;  1S3A A;  4IN0 A;  2KUC A;  2HI7 A;  3ERG A;  2MYG A;  5A4U A;  3LEF A;  3PGT A;  2R0P A;  4LL4 B;  1Z9H A;  4V2N A;  1EGO A;  3RHC A;  1WMJ A;  2YWI A;  3DEX A;  4XS4 A;  4JE1 A;  4MH2 A;  2HRA A;  5JCW A;  2B5E A;  4OFM A;  2CVB A;  2KP1 A;  2X99 A;  5DCH A;  2HXK A;  2LTK A;  5HFI A;  4V2L A;  3IXR A;  2R3X A;  4TR0 A;  1X9S B;  4I6X A;  2O8V B;  3R3E A;  4BA7 A;  3IK9 A;  3HJP A;  3KTB A;  6GSS A;  4G2E A;  2PWJ A;  1K0A A;  2K6V A;  1YY7 A;  2ON5 A;  3ZYW A;  1FOV A;  4YQM A;  3TKP A;  1BJX A;  3GMF A;  2L5O A;  3GX8 A;  3CRT A;  3ZIJ A;  1GSU A;  1VGL A;  1WIK A;  2V2G A;  2FY6 A;  2E0Q A;  5F05 A;  1O73 A;  1YF1 A;  5IM9 A;  3UL3 A;  4I2U A;  3MAK A;  2A4V A;  3GYK A;  4L8E A;  3IE3 A;  2H73 A;  1EOH A;  2RLI A;  2F51 A;  5D9V A;  2I81 A;  5CO3 A;  1O6J A;  2I1U A;  2KOK A;  2MZC A;  3UVH A;  2GZP A;  5IQY A;  1G0T A;  4MP4 A;  3GX0 A;  2H0G A;  4O7H A;  5G1L A;  3BJ5 A;  2V41 A;  2X8G A;  1CQG A;  1QK8 A;  4GLT A;  4ZL7 A;  2VL3 A;  4KCA A;  3V1W A;  1GTU A;  1GSY A;  2H1A A;  1TW9 A;  2E7P A;  2C0F A;  4F03 A;  2IMI A;  4EDY A;  4K7I A;  1H75 A;  1C72 A;  3P90 A;  2N5F A;  1B48 A;  4WBR D;  2O85 A;  2RUE A;  3IC4 A;  4TXO B;  2PU9 C;  2LS5 A;  4PXO A;  4XS4 B;  2LRT A;  1FG4 A;  3U6V A;  2AYT A;  3FRC A;  4EL1 A;  5DCG A;  4Z2T A;  5EL8 A;  4ZIJ A;  3ZRD A;  3VWX A;  1ZYP A;  2LRC A;  5HR2 A;  2QA2 A;  4D73 B;  4MH3 A;  5DBQ A;  1SEN A;  3IK7 A;  4HZ2 A;  2L57 A;  1YJ6 A;  3G9B A;  3TJF A;  2H1D A;  1XCC A;  2AV4 A;  5FHI A;  2B3S A;  1PRX A;  1B8X A;  3L9U A;  4MJC A;  4IKH A;  2XC2 A;  2H6Y A;  2MBT A;  2RM5 A;  2EIR A;  2FCH A;  1URM A;  1WRY A;  1YKA A;  3APQ A;  4OO5 A;  4PUR A;  2YWM A;  5G30 A;  2GSS A;  1V98 A;  1WWJ A;  4PX1 A;  2FWH A;  2MBS A;  1EV9 A;  2CX4 A;  3FY7 A;  1R7H A;  2VCV A;  3M3M A;  2F9S A;  4LA1 A;  1ZYQ B;  3L9S A;  1HNB A;  1XIY A;  2L59 A;  4ML1 A;  1XWG A;  2FGX A;  4J2F A;  3ERF A;  2JU5 A;  2H74 A;  3VPT A;  5E59 A;  3GUR A;  3D22 A;  2WJU A;  2NBS A;  1A24 A;  2FWG A;  4GQC A;  3KZQ A;  2ON7 A;  2L4Q A;  3KJY A;  3TCO A;  3TKQ A;  3ZVJ D;  3IV4 A;  4ECI A;  3KD0 A;  4MZW A;  3C8E A;  5D9T A;  3WD6 A;  2K8V A;  4MPG A;  2IFQ A;  1K3Y A;  2VCT A;  5ID2 A;  1SJI A;  3LXZ A;  3QMX A;  4CDO A;  2OBI A;  5ECP B;  2HSM A;  1EP8 A;  3TRQ A;  2WGR A;  3NOF A;  5DQS A;  2IMD A;  2B1L A;  1OKT A;  1A8Y A;  3ISO A;  1SL0 B;  4FIW A;  1DE1 A;  3MDK A;  1RW1 A;  4LMV A;  5IMZ A;  3KH9 A;  5D73 A;  2CT6 A;  5J41 A;  2CA8 A;  1GRX A;  2JAC A;  1A0R P;  3KM6 A;  2DSA A;  4HU7 A;  2YAN A;  3KP9 A;  3L9V A;  2JL4 A;  4OFN A;  4BPY A;  1J9B A;  2P31 A;  1T4Y A;  3A5I A;  2VD1 A;  3LYK A;  4DEJ A;  3ZMK A;  1F6M C;  2NDO A;  5ELA A;  2L5L A;  3M8N A;  4E8E A;  1WPI A;  4MK3 A;  1QQ2 A;  3F6F A;  2O89 A;  1V2A A;  3HZ4 A;  3VLN A;  1GP1 A;  8GSS A;  5D96 A;  5CRH A;  4MNN A;  5KOW A;  3MNG A;  4POK A;  2H66 A;  4HJ2 A;  1ZCP A;  2GS3 A;  2C0D A;  1WJK A;  1ZOF A;  1NM3 A;  2VO4 A;  3ME7 A;  5CAX A;  5CYY A;  2VL2 A;  2CZ2 A;  4EXJ A;  1NHO A;  1SKW B;  1SKS B;  4Q5F A;  2H70 A;  4K7O A;  1M2B A;  1FVK A;  2NTO A;  2CQ9 A;  11GS A;  2GT5 A;  3UBK A;  2YJ7 A;  4PGT A;  3TKS C;  4OO4 A;  2C0G A;  2VLV A;  1UN2 A;  1I5G A;  4K5R A;  4XHM A;  1PGT A;  4WF5 A;  3VPQ A;  3L78 A;  3LOR A;  2CV4 A;  3DYR A;  1VF3 A;  1U3I A;  3FZA A;  3QFA C;  5F06 A;  3ZIT A;  5A4V A;  1ZZY A;  1MD4 A;  2IIY A;  4HZ4 A;  1J08 A;  2OE3 A;  1E2Y A;  1XW5 A;  4K6X A;  4XIH A;  4TOP A;  1T3B A;  3CBU A;  1GNW A;  3R2Q A;  3GHA A;  4L0W A;  3K8N A;  2H71 A;  1SK0 A;  4XTS A;  3W6G A;  1GWC A;  1UC7 A;  4KF9 A;  2GQL A;  2TIR A;  3EMX A;  19GS A;  14GS A;  3ZZX A;  5KN3 A;  4L5L A;  1OE8 A;  2HYX A;  3DIE A;  1GSQ A;  5JWQ B;  1HNC A;  2CVK A;  3IAM 2;  2H0H A;  2FD3 A;  2WB9 A;  3ED3 A;  4MJA A;  2B5X A;  3J7Y k;  2VCZ A;  2GQK A;  3UJ1 A;  5JWR B;  3D5J A;  3QCP A;  5D93 A;  1PQN A;  4MZC A;  4ZBD A;  4N0V A;  4J56 E;  4N11 A;  1SK1 A;  2PUK C;  1V58 A;  4IP1 A;  1JZW A;  5J3R A;  4WEY A;  3QR6 A;  2IPA A;  1K3O A;  4KX4 A;  4O32 A;  4OD7 A;  4K2X A;  5KEJ A;  2R37 A;  2YPM A;  2YWN A;  2CX3 A;  2LJR A;  2GVP A;  3ZRE A;  4IW9 A;  4HQZ A;  2PPT A;  1T4Z A;  4POL A;  2WFC A;  4IJI A;  3DKS A;  5ECQ B;  2LKU A;  1N2A A;  2YZU A;  4MJE A;  2LV3 A;  1YEP A;  2DKI A;  3BCI A;  5EVO A;  3F0I A;  2M80 A;  3LG6 A;  5ECH B;  1RQM A;  4EC0 A;  2A2S A;  3HVX A;  2VOC A;  2O87 A;  5BMU A;  3P7X A;  4I8B A;  4K8M A;  3M0F A;  3EU3 A;  2C3T A;  4KAE A;  1VF2 A;  2YNX A;  3IC8 A;  2GSR A;  2VLT A;  3F3R A;  3DWV A;  2HRK A;  1XZO A;  1T7P B;  1XFL A;  1SJZ A;  2ZNM A;  2DLX A;  2F8F A;  3L4N A;  3EIN A;  4ECJ A;  4OCF A;  3CYN A;  4JRR A;  1DSB A;  3HJO A;  4PQI A;  2WZ9 A;  3FZ4 A;  1XPV A;  5ECN B;  2XBI A;  2I9H A;  3G7J A;  1K0N A;  1BAY A;  1XWB A;  4Z7X A;  5CP1 A;  3CTG A;  3Q6O A;  5GST A;  3W8S A;  2P0G A;  3LXT A;  4ACS A;  1ACV A;  1DUG A;  3FR9 A;  5J9B A;  2X4A A;  4XCS A;  2CVD A;  4TXO A;  4DVC A;  2C3N A;  1XBS A;  3CSI A;  4YQV A;  1EV4 A;  2P5Q A;  3IDV A;  3TJG A;  5LD0 A;  1TKD B;  3L0H A;  1ERV A;  4I97 A;  1MTC A;  4MF6 A;  1TJD A;  2IME A;  1TP9 A;  1LU4 A;  2IMF A;  4D73 A;  1VF4 A;  1IYH A;  2GZZ A;  3QDN A;  1Z3E A;  3E9J B;  2H01 A;  2REM A;  2DMM A;  1PA3 A;  3FZ5 A;  1A2L A;  1TI3 A;  4YAV A;  4YQU A;  1TTZ A;  1H4O A;  2IWT A;  1OKD A;  2HZF A;  1JHB A;  3I6A A;  1XWA A;  2PVQ A;  2HZE A;  4N10 A;  4NPB A;  3A5W A;  2YOI A;  3RAZ A;  1ILO A;  1ST9 A;  2XBQ A;  2HRN A;  2AAW A;  1T00 A;  3NZN A;  5IO2 A;  4GST A;  1EWX A;  1Y25 A;  2BTO T;  1X5C A;  4NXI A;  4EO3 A;  3C1R A;  1SYX A;  2DBC A;  4X1U A;  3QAG A;  5AIS A;  2D2Z A;  4L5O A;  20GS A;  1CQH A;  3FKF A;  4LMW A;  5IIZ A;  5IMC A;  1TDI A;  4FO5 A;  4AGS A;  4HJM A;  5B7C A;  2YN1 A;  1AUC A;  5DAK B;  3CSJ A;  4MA9 A;  3QPM A;  3TJK A;  4WR5 A;  2R6K A;  2WRT A;  4ID0 A;  4GXZ A;  3TOU A;  1ERU A;  1JFU A;  1WOU A;  1GH2 A;  1PN0 A;  1KEB A;  4F9Z A;  2JZS A;  4Z2U A;  4F2I A;  2XHF A;  3UMA A;  2V6O A;  4AJ8 A;  1GUL A;  4FH8 A;  3QAW A;  2VM2 A;  3CRU A;  3EYT A;  4KH7 A;  1ML6 A;  3F6D A;  2DKH A;  4WET A;  4O5Q A;  1BQ7 A;  2FNO A;  1G7O A;  2OE1 A;  1AW9 A;  1W89 A;  4JBB A;  1TK5 B;  1T1V A;  5HR0 A;  2BMX A;  4X4J A;  4MF7 A;  1M9B A;  2HZE B;  2JZR A;  3TB2 A;  4EKZ A;  3W8J A;  4ZL9 A;  2VCX A;  1FB0 A;  2C4J A;  1FOH A;  1I9D A;  1TOF A;  3N5O A;  5ECK B;  1JLV A;  22GS A;  4GQF A;  3D21 A;  3WGE A;  3ZL5 A;  2ALB A;  3Q74 A;  2IN3 A;  3WGX A;  3VFI A;  1J0F A;  4F0B A;  2FA8 A;  4NHZ A;  4IBP A;  3GL3 A;  1VF1 A;  1PL2 A;  3P2A A;  2A2P A;  5CRE A;  3FW2 A;  1XW9 A;  4LL1 B;  4HS1 A;  1TXX A;  4HU9 A;  5GAN D;  3VWV A;  3H93 A;  3JCM L;  16GS A;  1MEK A;  3C1S A;  18GS A;  3US3 A;  3UAP A;  2M72 A;  4N30 A;  4EF0 A;  2BJX A;  4OMV A;  3DGQ A;  4MF5 A;  1BYE A;  4RUV A;  2R0G A;  1FAA A;  3LFL A;  3F63 A;  4WKW A;  1GTA A;  4NAX A;  3TRP A;  2IMK A;  4K5S A;  2LUS A;  2V6K A;  2LJA A;  1GSS A;  4EDZ A;  5B8B A;  3F4S A;  5AIV A;  1GNE A;  1JZR A;  2YZH A;  2GSQ A;  4I2T A;  1OE7 A;  2C1Y A;  4XS6 A;  4MMM A;  1XOB A;  1TK0 B;  1N8J A;  1LBK A;  2XPD A;  3I9V 2;  1MDK A;  4CHS A;  1USB A;  1TK8 B;  3I43 A;  4G19 A;  2WUL A;  1YQ1 A;  4ZB8 A;  2JSZ A;  1F3B A;  4GSS A;  1XWC A;  1DE2 A;  1GUK A;  1O85 A;  1Z7R A;  1M0U A;  2G0F A;  6GST A;  2WDU A;  5G2Z A;  4PUA A;  1GUH A;  3RPN A;  3D0Z A;  3MSZ A;  4CW9 A;  2GST A;  4KB3 A;  4DSR A;  1FB6 A;  2X8C A;  4K7N A;  1O81 A;  3GFK A;  3LGC A;  5EPF A;  3DD3 A;  4K9Z A;  4TXV A;  4HOJ A;  3EUR A;  3GRX A;  3G7I A;  3BCK A;  4KDX A;  4O5R A;  1XXU A;  4K0N A;  4KDU A;  5L71 A;  4KCE A;  1Z5Y E;  3VI5 A;  3H4K A;  1K0M A;  2L6C A;  3GKX A;  2F3M A;  2HT9 A;  1B9X C;  4FQU A;  2R5G A;  2A2R A;  4IVF A;  4NV2 A;  1YKC A;  1AQW A;  4IQA A;  4CY6 A;  1FVJ A;  3HZ8 A;  2WS2 A;  2LEG A;  3A2X A;  4PNG A;  4HI7 A;  2H0I A;  1V9W A;  3GSS A;  3HXS A;  2GT6 A;  1F3A A;  4EIP A;  3HYP A;  4MJB A;  2OAD A;  2FA4 A;  2QSI A;  4TW5 A;  3ZVJ A;  1DBY A;  2ES7 A;  3J7Y b;  2V32 A;  2LQO A;  5IO0 A;  2RM6 A;  2VM1 A;  4F82 A;  3D6I A;  1AQX A;  2DJ0 A;  1U6T A;  3IHQ A;  4V1A g;  3UOM A;  3F4T A;  5GSS A;  2XPE A;  3F3Q A;  1PD2 1;  2GLR A;  5G31 A;  2DC5 A;  2JZT A;  3SBC A;  1EOG A;  3LSZ A;  2H76 A;  2KLX A;  5ENU A;  1SKR B;  3GN3 A;  3P8W A;  4TVE A;  5FWG A;  2DJJ A;  5F0G A;  2J9H A;  2A4H A;  1ERW A;  2LNS A;  3M9J A;  2GZY A;  1TU7 A;  2EC4 A;  3TKS E;  4CY8 A;  3GL5 A;  3APO A;  5LNK e;  3UAR A;  1SD8 A;  6GSV A;  4ECC A;  1V40 A;  4KGI A;  4H86 A;  5DJL A;  3O3T A;  2MMO A;  1GTB A;  3FMW A;  2J23 A;  4O5U A;  4OFT A;  4KE3 A;  3RBT A;  1EP7 A;  2OBK A;  1K3L A;  3GKN A;  2FWE A;  4K1F A;  1EEM A;  3N9J A;  1VRS D;  2TRC P;  1Q4J A;  4ICY A;  1Z6M A;  5HQP A;  2K8S A;  3O76 A;  2LQQ A;  5B8A A;  3HHV A;  17GS A;  2K9F A;  1SD9 A;  3HD5 A;  3LYP A;  1IYI A;  3QAV A;  3KIJ A;  5HFK A;  1O7U A;  4G0I A;  3GKM A;  2DJ3 A;  3TOT A;  3FR3 A;  3M1G A;  4EUY A;  4POB A;  1X9M B;  2H75 A;  1QGV A;  3KTL A;  4TR4 A;  1YZX A;  4IS0 A;  3MWH A;  2QC7 A;  5KN1 A;  3Q19 A;  1HYU A;  4O92 A;  2CAI A;  5IPG A;  5A4W A;  1SJ6 A;  1GLQ A;  5B6M A;  3FEU A;  2VL9 A;  1F37 A;  1XOA A;  3S9F A;  2QGV A;  3QOU A;  1U3A A;  3EC3 A;  4MDC A;  4GTU A;  1XW6 A;  1X5E A;  3WGD A;  3E3E A;  4PQH A;  1SL1 B;  2JAD A;  3KXO A;  4DSQ A;  1U87 A;  2C8U A;  4ZBA A;  1G6W A;  2QA1 A;  4KDY A;  3KP8 A;  3M9K A;  4BVY A;  3KMO A;  2AUV A;  4K2D A;  1Z7P A;  2E2M A;  5CRD A;  3UEM A;  1GSD A;  1EGR A;  3BOA A;  3H8Q A;  2MMZ A;  1R26 A;  2F8A A;  4WXT A;  1KTE A;  1ZYE A;  5CRG A;  1TRS A;  3DML A;  2JSY A;  6GSU A;  4XRA A;  4BVX B;  5J9C A;  3CMI A;  2PMT A;  2VL2 C;  4MZB A;  1K0B A;  3I69 A;  3ME8 A;  3ZML A;  5DAK A;  1A2M A;  2K18 A;  2YCD A;  2OA7 A;  4RI6 A;  5HR3 A;  3GKK A;  5HFG A;  2E2G A;  3GNJ A;  5INY A;  4JR6 A;  1ON4 A;  1X0R A;  2PGT A;  5BRT A;  4PNF A;  1HQO A;  2OKA A;  5ABR A;  1GUM A;  3ERW A;  4RI7 A;  1TU8 A;  3OR5 A;  4HEA 2;  3UBL A;  3SWL A;  2YP6 A;  2CZ3 A;  2H6X A;  5G5E A;  4AJ6 A;  5FT3 A;  2C80 A;  4BWQ A;  1YF0 A;  2DJ1 A;  1F9M A;  3WYW A;  1HNA A;  2GQM A;  2H1G A;  3LQ7 A;  4GSN A;  2N5A A;  3ZFL A;  4DSS B;  2ZCT A;  1QMV A;  2L4C A;  1ZMA A;  5HR1 A;  3EU4 A;  2B7K A;  4QQ7 A;  2ZUP A;  4Q5R A;  4TN8 A;  3HJM A;  2EIQ A;  4BVY B;  1K0D A;  1OYJ A;  2H72 A;  1SYR A;  4KW6 A;  1E6B A;  1S3D A;  4ECB A;  3EPT A;  1HD2 A;  4GRF A;  2OJL A;  4ZB6 A;  2B6M A;  4NV5 A;  2M46 A;  3GIX A;  2GTU A;  1QUW A;  1OC3 A;  2PVO C;  3PIN A;  5IMF A;  5DQY A;  1QXH A;  3PH9 A;  2HE3 A;  3GTU B;  1KBN A;  4A5P A;  2DJ2 A;  1MD3 A;  1SU9 A;  4KND A;  1FW1 A;  3ZTL A;  3G7Y A;  4ZB9 A;  3RPP A;  1XWK A;  1M7T A;  4NMU A;  1TRV A;  2I4A A;  2YV7 A;  3IHG A;  2I3Y A;  3FYG A;  2DIZ A;  4WR4 A;  4RQR A;  5AIX A;  1NW2 A;  2KHP A;  2HLS A;  3VI7 A;  3RHB A;  3LWA A;  1B9Y C;  1M2D A;  1OVN A;  1PL1 A;  3TJJ A;  1AXD A;  5CNW A;  3GH6 A;  3A2V A;  1MDJ A;  1OAZ A;  1AQV A;  1KNG A;  3VWU A;  4EIQ A;  1GSE A;  3H79 A;  1B4P A;  3U5R E;  5F07 A;  2FLS A;  4HUA A;  1GLP A;  4EE0 A;  4MLY A;  3TKS A;  5IOX A;  1XVQ A;  5IOW A;  5D8I A;  1B4Q A;  4ZBB A;  4GF0 A;  1JZO A;  2MMN A;  2GDR A;  4FYB A;  3IAS 2;  2FWF A;  4HQS A;  3IBH A;  1G7E A;  3APS A;  1OC8 A;  4AF2 A;  1TRW A;  1Z6N A;  2R4V A;  4USS A;  5EY6 A;  4K0G A;  5ECI B;  2GGT A;  2MMA A;  1A0F A;  3PR8 A;  10GS A;  2HSH A;  2H1B A;  3VWW A;  1PMT A;  1GSF A;  1WP0 A;  2VCW A;  2LJK A;  2O7K A;  2DML A;  4QL9 A;  3EVI A;  4G10 A;  1RK4 A;  4TR3 A;  5J4U A;  3HKR A;  2B5Y A;  2DIY A;  3RDW A;  5GZZ B;  4FYC A;  4OCE A;  3QD9 A;  4MPF A;  3DVX A;  1QFN A;  1ZL9 A;  1F2E A;  3FZ9 A;  1ZGN A;  3D4M A;  2N5B A;  1UVZ A;  4YH2 A;  4IP6 A;  4BWS A;  2L6D A;  3DVW A;  4WBJ A;  3TDG A;  3O6T A;  3D4T A;  5COH A;  3GUS A;  5A5K A;  2RII A;  4ZL8 A;  5JCU A;  3F4R A;  2LNT A;  3MYD A;  4RQX A;  3HCZ A;  6GSW A;  3TKR A;  1V57 A;  1ABA A;  3EWL A;  4IGJ A;  3MIX A;  1JZD A;  1WE0 A;  2C3Q A;  1YDK A;  3GA4 A;  2H19 A;  1PKW A;  4PTS A;  2CAQ A;  4TRX A;  5ECR B;  4Q5N A;  2HNL A;  5JWO B;  3A3T A;  2Z9S A;  2VLU A;  2HSY A;  5DAL A;  5H5S A;  4MAB A;  4TR1 A;  4HDE A;  7GSS A;  12GS A;  2H8L A;  5H5R A;  5DJM A;  4LLR A;  2PN8 A;  3FR6 A;  2VIM A;  4G0L A;  2YJH A;  2AJQ B;  1PX6 A;  6GSX A;  3C7M A;  1K0C A;  2HRF A;  3IA1 A;  4G9H A;  3E0U A;  2OE0 A;  4OWY A;  1OC9 A;  4XS1 A;  4F0C A;  2FUG 2;  4WF4 A;  4EVM A;  5C00 A;  2EIO A;  3IOS A;  4J57 E;  1JLW A;  3FK8 A;  3A2W A;  1Y6E A;  5G1K A;  1T8E B;  2LST A;  5IMV A;  3PPU A;  1M2A A;  2VAF A;  1S3C A;  1TRU A;  3F8U A;  1R4W A;  2V1M A;  3DXB A;  2R2J A;  4PQ1 A;  1FHE A;  1ERT A;  3NIV A;  2X8H A;  3DRN A;  2P5R A;  5AN1 A;  3LJR A;  1PX7 A;  2R0C A;  5IMA A;  2VCQ A;  3HVS A;  5D9X A;  4L0U A;  1GL8 A;  4JU5 A;  2NVL A;  2IFQ B;  1O8W A;  4G0K A;  4I5Q A;  1O8X A;  2X49 A;  4P3Y B;  5ID2 B;  3GST A;  3IRA A;  1PKZ A;  2H6Z A;  1AC1 A;  1FO5 A;  3C71 A;  5E4W A;  5KN2 A;  1THO A;  5GAP D;  2H30 A;  13GS A;  1G6Y A;  1TI1 A;  3ZLP A;  2DJK A;  1BED A;  4KUN A;  4N0Z A;  5DAL B;  3CTF A;  3VK9 A;  4TR1 B;  1X9W B;  1U88 A;  1THX A;  5B6N A;  3KGK A;  3HY2 A;  2IL3 A;  2C0E A;  3BBY A;  3CXG A;  4NWY A;  4V1A p;  2LRN A;  5ECL B;  5ELG A;  1SL2 B;  5CRW A;  3TRX A;  5F8B A;  2NPB A;  2RUF A;  1LJR A;  4JED A;  3TGZ A;  9GSS A;  4QL7 A;  4TKY A;  2IJY A;  3KCM A;  3LW9 A;  1BX9 A;  3GH9 A;  2YV9 A;  1OC9 B;  1AAZ A;  3Q18 A;  5C04 A;  5IPH A;  3ZFB A;  5AGY A;  4ML6 A;  2AB6 A;  4JZQ A;  3TJB A;  3GV1 A;  4IQ1 A;  1EEJ A;  3HA9 A;  4ULX A;  3FHK A;  3KEB A;  4POM A;  5ECO B;  2VD0 A;  1A2J A;  4KSM A;  4AJ7 A;  4Q5Q A;  4GWR A;  1GTI A;  4FYU A;  1NHY A;  3IPZ A;  4X43 A;  2QKE A;  4BVX A;  4ZXG A;  2B1K A;  3TUE A;  4IJ3 A;  1A23 A;  4JR4 A;  1X5D A;  4IEL A;  3F9U A;  3EMP A;  5H5Q A;  4X0X A;  1M9A A;  2G2Q A;  4YAP A;  3BD2 A;  5ECM B;  3WT1 A;  1M99 A;  5ECS A;  5G5F A;  2FHE A;  5DDL A;  4BL7 A;  5J5N A;  1K0O A;  3HDC A;  4MCU A;  3KH7 A;  4GCI A;  2WCI A;  3H1N A;  3AY8 A;  2PBJ A;  4E8H A;  3EE2 A;  4KA0 A;  1XVW A;  2HFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...