1TXXA

Active-site variant of e.coli thioredoxin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCVWCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (THIOREDOXIN)
publication title The CXXC motif: crystal structure of an active-site variant of Escherichia coli thioredoxin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 29
structure length 108
sequence length 108
ec nomenclature ec 1.8.-.-:
pdb deposition date 1999-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1txxA00
2L57A 1GSFA 1V9WA 3DWVA 4MZBA 2H1DA 2Z9SA 3HZ4A 4X43A 4Z7XA 1TDIA 4PGTA 4EDYA 1QUWA 3IPZA 4ACSA 2CQ9A 2FA8A 4O92A 4H86A 1OAZA 4IN0A 3CSIA 2RUFA 1K0AA 1MEKA 1R4WA 4MF5A 1M2BA 1EWXA 2AYTA 3P90A 4HU9A 4N11A 2YWNA 1SL0B 5IO2A 1IYIA 1B48A 3HY2A 2R37A 3FKFA 3IAS2 1PQNA 2DIZA 1R7HA 5F0GA 3DXBA 1ZCPA 2PBJA 1K0MA 3A2VA 4XS4B 1PD21 5IMZA 3VLNA 1PX6A 3TRXA 3GFKA 3WT2A 3KZQA 3WGXA 2IMFA 1ZYQB 2YCDA 4NMUA 4GF0A 5B6MA 1Y25A 5AIXA 2GSSA 5HFGA 1GSDA 2DJ0A 4MDCA 4ULXA 3UVHA 4LL4B 2HLSA 4PUAA 3A2WA 1H4OA 2DJKA 4PQIA 4ZBDA 2C3TA 4E8EA 1Q4JA 3A3TA 3GL3A 6GSYA 5INYA 4IS0A 1Z9HA 2L4QA 1ST9A 2LNSA 3FRCA 3L9UA 4HU7A 1V2AA 3IBHA 4ZXGA 2F9SA 3PR8A 3IE3A 2GSTA 4LLRA 2HYXA 2ZNMA 4DSSB 1WE0A 4RQRA 2FY6A 1TI3A 3ZFLA 1XCCA 2O85A 3KP9A 1FVJA 2JZSA 1K3OA 3EMPA 4IELA 2C8UA 5HFKA 19GSA 3QDNA 3TKQA 1VGLA 3P8WA 1FAAA 3N9JA 3KJYA 3W8SA 1YZXA 3F63A 1AAZA 5KEJA 3I9V2 2B5YA 4OFNA 2MZCA 3GV1A 1G7EA 1ERWA 1OC9B 2HSYA 3QFAC 1O81A 4WF4A 5ELGA 3VI5A 3MSZA 1PGTA 2KHPA 4POLA 5COHA 1J0FA 3F3RA 3WYWA 2OE3A 1AQXA 3V1WA 1TK5B 3LXZA 2HZEA 5H5RA 3KXOA 2DIYA 4KDUA 3FZ4A 3GIXA 7GSSA 1ABAA 1I9DA 5JWQB 1DBYA 2LRTA 3EU3A 1UA5A 1JZRA 2GQLA 4TKYA 4YH2A 4YAPA 2X8HA 3IV4A 3LORA 1NM3A 2JADA 1A2MA 1OKTA 4BWSA 3TGZA 2C3NA 2M72A 1A8LA 4IP6A 5ECHB 2FWHA 3KH9A 2C0DA 4MP4A 1ON4A 4Q5RA 3EU4A 3VK9A 1GTIA 3S9FA 3GTUA 3LEFA 3GH9A 1FHEA 1V40A 1UN2A 1A23A 2R5GA 3BD2A 4MH2A 2WS2A 3I69A 2I9HA 1C72A 2LSTA 4QL7A 3CRTA 4WEYA 2FA4A 1O85A 4ML1A 3HYPA 1O8XA 3TUEA 4ECIA 3IDVA 3US3A 1GH2A 3C1SA 1X9WB 2ON5A 4HEA2 5D9TA 3OR5A 2IMEA 3FYGA 2H8LA 1GWCA 2WJUA 2YWIA 3GKMA 3O6TA 4ZB6A 1EGRA 4V2MA 2MBTA 4I8BA 4PURA 2FNOA 1S3AA 4HZ4A 2MMZA 5FHIA 3IOSA 2N5BA 4PXOA 1WOUA 5IMAA 5AN1A 1OC8A 5EY6A 1NHYA 2NVLA 2GVPA 4EO3A 3H1NA 1WRYA 1YDKA 3KGKA 5KN0A 1FO5A 1EEJA 1XVQA 4RQXA 1G6YA 1MDIA 3NZNA 4X0XA 1E2YA 3D5JA 1GUKA 3TRQA 3ERGA 1F2EA 1XWCA 5JCWA 5FWGA 3WD6A 2JZRA 1M7TA 1XWBA 2VD1A 3TJBA 3TJKA 5LNKe 2VD0A 5G1LA 2VCXA 5DDLA 1ML6A 3DYRA 5IPGA 1G6WA 1BEDA 4F2IA 3U6VA 3QPMA 2GTUA 2DMMA 3FZ9A 2GGTA 2B7KA 5DALB 4DSQA 2C4JA 5DCHA 3EC3A 4GLTA 1THOA 4IBPA 1K0NA 3W8JA 1G0TA 4XS6A 3VPTA 2LJKA 2PUKC 1GTAA 5B7CA 2GZPA 3TJFA 1EOGA 3VFIA 1ERVA 4DSRA 3HVVA 1Z5YE 3D21A 4IQAA 1KEBA 1THXA 2C0EA 2LS5A 4O32A 1OE7A 1FOVA 4K7IA 5DQYA 3HXSA 4OWYA 3GNJA 4D73B 4MPFA 5ELAA 5HR0A 1Z6NA 2V1MA 3F6FA 3LYPA 1JZOA 4RI6A 2C0FA 1GNWA 2VM2A 1X5CA 3FEUA 3KIJA 1F37A 5H5QA 4N0VA 5G1KA 2EIOA 2R2JA 4FYUA 4BVYA 9GSSA 2L4CA 3IR4A 2JACA 1UVZA 3RDWA 1FG4A 3KTBA 4X1UA 2DC5A 2VAFA 3F9UA 1U88A 2ON7A 1TI1A 3ZRDA 5GSTA 2IL3A 4NV2A 1T3BA 1A2JA 4PQ1A 2EC4A 1N8JA 2ZCTA 3BCIA 1TU8A 1TK0B 2J9HA 3L4NA 2VLUA 1XIYA 4L0UA 4HI7A 1FB6A 1K0OA 2YWOA 4E8HA 4PUFC 1PA3A 2TRCP 4FO5A 5ECPB 3TJGA 2TRXA 1H75A 3HVSA 1XWGA 2WZ9A 3C71A 1TXXA 2LRNA 4JE1A 2AHEA 2HSHA 5E4WA 3QFBC 4BL7A 8GSSA 3FY7A 1USBA 3RAZA 3MNGA 5GZZB 5JCGA 5D8IA 4FIWA 1KBNA 2LV3A 2GQKA 3BBYA 4V2NA 2V6KA 3G7IA 4K7OA 1XZOA 1BX9A 3GUSA 3VWXA 2I4AA 4K2DA 1T00A 2H71A 3FZ5A 2OADA 1M0UA 1XOBA 1LU4A 3DVXA 3TKRA 4EDZA 5F8BA 3DKSA 2PVOC 2VL2C 3BCKA 1V58A 1U87A 13GSA 1O8WA 1WMJA 4YQMA 3F4TA 1GTBA 5IIZA 2B6MA 3IA1A 5FT3A 1YEPA 5ID2A 1XPVA 3QAWA 5A5KA 2P5RA 4PX1A 2XHFA 2H0IA 2PVQA 2JSYA 2YOIA 1PKZA 2QC7A 4TOPA 4TR1B 2A2RA 3TOUA 4KNDA 5AIVA 2C3QA 2B5XA 2OJLA 3D4MA 3GURA 2LRCA 5IQYA 2X99A 3TRPA 2F51A 4OMVA 4CW9A 2H76A 4N30A 6GSXA 1PMTA 1SK0A 4BVXA 3IC4A 5HFIA 2XPDA 1F6MC 1U3IA 14GSA 5DVBA 3QR6A 3CYNA 4WR4A 5AISA 3VI7A 4V1Ap 5EPFA 1V98A 2F3MA 5CRHA 2FD3A 2JL4A 1URMA 1PL2A 3QMXA 2X8GA 2LJAA 2DJ1A 4KGIA 1A0RP 4EXJA 2A2SA 3CTFA 2IMDA 2RIIA 4HOJA 4POMA 2C80A 2PN8A 1ILOA 3TKPA 3F3QA 2H74A 1QQ2A 3ZYWA 1YKAA 3HKRA 2GSRA 1WWJA 1A2LA 2H6YA 1Z6MA 3FR6A 1TP9A 4ZBBA 2O89A 1AW9A 1JZWA 2HXKA 4KCEA 4L8EA 4ID0A 5IMCA 5IM9A 2PWJA 3D6IA 4F9ZA 2FLSA 1B9XC 3LG6A 4WR5A 1O6JA 10GSA 2H1AA 4G10A 1SJIA 3KCMA 3EURA 2AB6A 5C00A 2YN1A 4KA0A 3DVWA 6GSSA 1WP0A 1B4QA 4IGJA 3F8UA 1JLVA 1J08A 5CRDA 1X0RA 3QAVA 1RQMA 1ZYEA 2A4VA 4NHZA 4F03A 3TJJA 4LMWA 4P3YB 1A8YA 1OKDA 4KAEA 3GSSA 2CVKA 3A2XA 2KOKA 5CRWA 2DBCA 3KTLA 3UL3A 1NHOA 2K18A 5D9VA 4WXTA 3ZLPA 4IQ1A 4J57E 1T4YA 2AJQB 3ZMKA 1XW9A 1SJZA 3EMXA 4IHUA 2WGRA 3LJRA 5CREA 3G7JA 3IXRA 2X64A 2LUSA 4K1FA 2DMLA 1BYEA 1FB0A 2YPMA 1X5DA 2L5OA 5G5EA 3NOFA 4K7NA 5DAKA 2VM1A 1Z7RA 5G5FA 4NHWA 1WIKA 1G7OA 5JWOB 4TR4A 2FWFA 3W6GA 3DMLA 2IMIA 1K0DA 4GSNA 1JLWA 2B3SA 4K8MA 4KSMA 2H66A 3UEMA 5A4WA 1TJDA 2IFQB 5F07A 2NPBA 2B5EA 3L9VA 1SD8A 1TKDB 4DEJA 1WJKA 2PGTA 1YF0A 4JR4A 4TVEA 1HYUA 1XBSA 4ZBAA 2LKUA 3FK8A 5CAXA 2GT5A 3M1GA 18GSA 4HJ2A 4TXOB 2IN3A 4F82A 2YNXA 3MAKA 1VF3A 2FWGA 2E7PA 4WF5A 1FVKA 2M46A 2VL3A 5ENUA 2YANA 1EV4A 4KW6A 2V32A 2RLIA 1QGVA 4I97A 1B8XA 4HDEA 3GH6A 1ZZYA 2WRTA 2OKAA 1YQ1A 1SL2B 2BTOT 2O8VB 2FUG2 4KE3A 2G2QA 3HJPA 4AJ8A 3EE2A 2CA8A 1YF1A 1K0BA 4L0WA 3JCML 3ZFBA 4N0ZA 2WFCA 1M99A 1YY7A 1X9SB 3IRAA 1XWKA 2HZFA 3L78A 5A4UA 3TCOA 2P5QA 1T7PB 2MBSA 4MJCA 2XC2A 3SWLA 1QK8A 1M9AA 1IYHA 5CNWA 3ZITA 2R3XA 1EOHA 2F8AA 3SBCA 4QL9A 3KM6A 1TRSA 2G0FA 2QGVA 1OC3A 4ECCA 4TR1A 3FW2A 4PQHA 1GTUA 1DE1A 5D96A 2H6ZA 2VL2A 3TDGA 3HVXA 3C8EA 2IPAA 3ZREA 2N5AA 4JR6A 1QFNA 1TOFA 3GN3A 1M9BA 1GSQA 1V57A 4KCAA 3EYTA 3D0ZA 1LBKA 2VOCA 2R4VA 1DSBA 2GT6A 1HNCA 1AUCA 4PNFA 5CYYA 3KMOA 2QSIA 3F6DA 5GSSA 3RHCA 2BJXA 3CSJA 1DE2A 2YJHA 4AJ7A 2C0GA 5L71A 2B7JA 3H8QA 1TRWA 2H1BA 3M8NA 4TR0A 3GKNA 4HJMA 2CZ2A 1MDJA 4NXIA 1KNGA 3UARA 2O7KA 3L9SA 4AJ6A 5A4VA 3DGQA 2VL9A 4XS4A 5F06A 2KP1A 1MTCA 5J9CA 1AXDA 2GS3A 17GSA 2IIYA 4NAXA 4MK3A 3J7Yb 2O87A 1TTZA 1GULA 1LJRA 5AGYA 3F4RA 4XCSA 3HA9A 1SL1B 2KLXA 3QAGA 1SKWB 1SKSB 4FH8A 3BOAA 1TW9A 5KN2A 4FYBA 2HZEB 5DBQA 3BJ5A 2HE3A 4IJ3A 3HD5A 1E6BA 4KDYA 4IP1A 2D2ZA 4OD7A 3UJ1A 4YAVA 3P2AA 3QOUA 2I1UA 2EIQA 2FCHA 4GSSA 2H19A 4KB3A 4DSSA 3GX8A 2H1GA 3WT1A 4JU5A 1GP1A 3ME7A 3C7MA 1SK1A 3PGTA 1VF1A 5CRGA 1GUMA 1T8EB 3AY8A 1K0CA 1SJ6A 3UVTA 3J7Yk 2H75A 1QXHA 4OCEA 4ECJA 2P0GA 3GTUB 1VRSD 3M3MA 2L6DA 2CVBA 2OBKA 2MYGA 3H93A 2YP6A 3CTGA 1BAYA 3G9BA 4FYCA 2ALBA 1OC9A 1SENA 1SU9A 4TW5A 3C1RA 4O7HA 1XWAA 4GQFA 4MZWA 2IJYA 2KP2A 2WDUA 2LQOA 1ERUA 3D4TA 1R5PA 4POBA 3KP8A 3GYKA 3K8NA 5IMFA 3KH7A 5B6NA 3PINA 2IWTA 3I43A 5D73A 2E2GA 4KH7A 1JHBA 2XBIA 16GSA 3UMAA 3ME8A 3IK9A 3KD0A 3LWAA 2WCIA 5ECSA 4LL1B 4CHSA 1GSUA 2VLVA 3G7YA 1FW1A 5JWRB 1TK8B 2H0HA 4I5QA 2I3YA 3E9JB 4TR3A 4TN8A 1GUHA 2P31A 1XOAA 2YZHA 1JFUA 2VCTA 4YQUA 4ZL8A 3E3EA 4JZQA 4OFTA 3TKSC 2LNTA 3WGEA 4BPYA 2KUCA 4CDOA 3M9KA 4ZB8A 2K9FA 3N5OA 2LJRA 3RPNA 2GDRA 1JZDA 2XPEA 3F0IA 1F3BA 3ZIVA 3ZMLA 3UIWA 5ECMB 1CQHA 4HUAA 1TU7A 1SK2A 4ML6A 4K6XA 3ED3A 6GSWA 3HDCA 1M2DA 1SYRA 3KMNA 4IJIA 1YEXA 5E59A 4V2LA 3QD9A 3WGDA 2VIMA 3M0FA 3RHBA 5HR2A 4ECBA 3ZVJD 4WETA 5G30A 1I5GA 3DRNA 5G2ZA 1KTEA 2MMOA 4MJBA 3VPQA 4GRFA 1X5EA 3UAPA 3R2QA 5CP1A 2X8CA 5IPHA 2HT9A 4EE0A 1MD3A 3GKXA 5HQPA 1HNAA 1M2AA 2LTKA 4TRXA 1BJXA 2H72A 1UC7A 3ERWA 2ES7A 4MJEA 2HFDA 5DALA 4J2FA 1EP8A 1PKWA 5ECOB 3Q19A 3I6AA 4GTUA 2N5FA 4KSOA 5GAPD 3DEXA 2OE0A 1EV9A 4MF7A 1HQOA 5GAND 1XVWA 2OACA 4QQ7A 1RK4A 2H70A 5J3RA 1GSEA 5ABRA 1K3YA 1SYXA 4D73A 3C73A 3FHKA 1A24A 4JEDA 2I81A 4WBJA 1ZMAA 3ERFA 3PH9A 1Q98A 3H79A 5D93A 2L59A 4G9HA 2DJ3A 3HJMA 5EVOA 4O5RA 2DLXA 2JZTA 1PX7A 3ZL5A 4TXVA 4XHMA 1U3AA 4Q5FA 4ZILA 4G19A 4BA7A 4YQVA 4Q5NA 3TOTA 1N2AA 2H6XA 1ZOFA 2H01A 1NW2A 1T1VA 1YKCA 2HRFA 3EVIA 2B1KA 6GSUA 1EEMA 4Q5QA 5ID2B 1GLQA 5KN3A 4MPGA 2NBSA 1ERTA 1T4ZA 1F3AA 4ZL7A 3CBUA 4RUVA 4JRRA 1XFLA 5CO3A 2CX4A 5ECIB 2L6CA 2K8VA 2HNLA 4MF6A 5HR3A 3IAM2 2V6OA 1Z7PA 2YJ7A 3GMFA 2GZYA 2JSZA 3HJOA 1QMVA 5D9WA 3LQ7A 5J5NA 3GSTA 2LQQA 4K9ZA 2WULA 4MCUA 4N10A 4MABA 2H30A 1EZKA 5F05A 3HHVA 2CZ3A 4OFMA 2XBQA 5B8AA 1R5AA 3O76A 4WBRD 2OBIA 3Q6OA 2NTOA 4J56E 2R6KA 3L0HA 2DSAA 2H73A 20GSA 2AV4A 4G2EA 1PSQA 4MA9A 2MMNA 2VCZA 1B4PA 1ZGNA 2GZZA 2OE1A 4IKHA 5D9XA 1VF2A 4XRAA 12GSA 2HI7A 4WKWA 1K3LA 4XTSA 3DD3A 4LMVA 3GRXA 3ZIJA 2E2MA 1EGOA 2V2GA 5J4UA 1S3CA 2C1YA 1AQVA 2B1LA 5DQSA 3FR3A 2QKEA 4BWQA 1OE8A 5IMDA 3LFLA 2RUEA 4ZIJA 1GSSA 5C04A 1MDKA 4OO5A 6GSTA 1XW5A 2F8FA 1O73A 4OO4A 5IO0A 1OVNA 4HZ2A 2VUPA 3UOMA 5IOWA 5IMVA 3Q74A 2DJJA 3UBKA 4AGSA 3LSZA 3TKSE 2NDOA 2PPTA 3IK7A 2IMKA 2PU9C 5HR1A 4I2TA 5JCUA 1BG5A 3GKKA 1GSYA 5G31A 2K6VA 4MLYA 4MH3A 5J41A 2EIRA 2VO4A 5ECNB 4GCIA 5ECLB 1BQ7A 2L5LA 1A0FA 1SD9A 2VLTA 2YZUA 1MD4A 3E0UA 4IVFA 1XXUA 2YWMA 2ZUPA 1AIUA 3EINA 3RBTA 2DJ2A 3TKSA 3CRUA 3FZAA 2YV7A 3EWLA 3GA4A 3KEBA 1U6TA 5LCZA 4L5OA 3FR9A 2MMAA 3A5WA 1B9YC 4MZCA 1W4VA 2GSQA 2AUVA 3GL5A 4MJAA 4LA1A 1DUGA 5DAKB 2CX3A 2PERA 4V1Ag 4IW9A 4F0CA 3HCZA 3ISOA 1AC1A 3P7XA 1PL1A 1W89A 2J23A 2VCWA 1YJ6A 1EP7A 4I2UA 4NWYA 2CV4A 1J9BA 4EUYA 2FWEA 11GSA 4NV5A 2WB9A 3M9JA 1AQWA 4GXZA 4DVCA 3VURA 1GL8A 2AAWA 2E0QA 3VWUA 3H4KA 1Z3EA 1TRVA 4HQSA 4F0BA 4NPBA 1VF4A 4KUNA 4HS1A 4JBBA 2FGXA 3ZVJA 4I6XA 4ZB9A 3GHAA 2JU5A 2V41A 5DCGA 2RM6A 2VCVA 4MMMA 2HRNA 3F4SA 1RW1A 1O7UA 2OA7A 5DJMA 5EL8A 4PNGA 1R26A 5H5SA 1GNEA 3DIEA 4AF2A 3TB2A 4L5LA 2GLRA 2FHEA 4ILFA 4K0GA 1TRUA 3APQA 4GQCA 2GQMA 4POKA 5IOXA 3LXTA 3Q18A 1HD2A 3VWVA 4EF0A 3CXGA 4EC0A 2YV9A 1HNBA 4HQZA 1F9MA 3MWHA 5ECRB 5J9BA 3GX0A 3D22A 3U5RE 1GLPA 4EL1A 4KX4A 3RPPA 1OYJA 4RI7A 3ZTLA 3LGCA 6GSVA 1WPIA 2CVDA 2TIRA 4ISDA 2K8SA 1ZL9A 3IHQA 2REMA 1CQGA 2H0GA 1X9MB 22GSA 3VWWA 2IFQA 1NSWA 4XIHA 1SKRB 1PN9A 3APSA 2VCQA 3ZZXA 4EVMA 4GSTA 5LD0A 1GRXA 4K0NA 2CAIA 3UBLA 4ZL9A 5ECKB 3O3TA 2PMTA 1PRXA 1XW6A 3CMIA 5KN1A 4OCFA 2LEGA 5B8BA 3NIVA 2CT6A 3APOA 4XS1A 5DJLA 4XRDA 3CSHA 4EKZA 1ACVA 2BMXA 1S3DA 2RM5A 2M80A 3QCPA 3HZ8A 4TXOA 1Y6EA 4GWRA 2CAQA 3MDKA 5ECQB 3LYKA 4KDXA
chains in the Genus database with same CATH superfamily
2L57A 4YKGA 1GSFA 1V9WA 3DWVA 4MZBA 2H1DA 2Z9SA 4HSCX 3HZ4A 4X43A 4Z7XA 1TDIA 4PGTA 4EDYA 1QUWA 3IPZA 4ACSA 2CQ9A 2DKHA 2FA8A 4O92A 4H86A 1OAZA 4IN0A 3CSIA 2RUFA 1K0AA 2X4AA 1MEKA 1R4WA 4MF5A 1M2BA 1EWXA 2AYTA 3P90A 4HU9A 4N11A 2YWNA 1SL0B 4PTSA 5IO2A 1IYIA 1B48A 3HY2A 2R37A 3FKFA 3IAS2 1PQNA 2DIZA 1R7HA 5F0GA 3DXBA 1ZCPA 2PBJA 1K0MA 3A2VA 4BIKA 4XS4B 1PD21 5IMZA 3VLNA 3MYDA 1PX6A 3TRXA 3GFKA 3WT2A 3KZQA 2X49A 3WGXA 2IMFA 1ZYQB 2YCDA 4NMUA 4GF0A 5B6MA 1Y25A 5AIXA 2GSSA 5HFGA 1GSDA 2DJ0A 4MDCA 4ULXA 3UVHA 4LL4B 4CY8A 2HLSA 4PUAA 3A2WA 1H4OA 3IHGA 2DJKA 4PQIA 4ZBDA 2C3TA 4E8EA 1Q4JA 3A3TA 3GL3A 6GSYA 5INYA 4IS0A 1Z9HA 2L4QA 1ST9A 2LNSA 3FRCA 3L9UA 4HU7A 1V2AA 3IBHA 4ZXGA 2F9SA 3PR8A 3IE3A 2GSTA 4LLRA 2HYXA 2ZNMA 4DSSB 1WE0A 4RQRA 2FY6A 4CY6A 1TI3A 3ZFLA 1XCCA 2O85A 3KP9A 1FVJA 2JZSA 1K3OA 3EMPA 4IELA 2C8UA 5HFKA 19GSA 3QDNA 3TKQA 1VGLA 3P8WA 1FAAA 3N9JA 3KJYA 3W8SA 1XG8A 1YZXA 3F63A 1AAZA 5KEJA 3I9V2 4YKFA 2B5YA 4OFNA 2MZCA 3GV1A 1G7EA 1ERWA 1OC9B 2HSYA 3QFAC 1O81A 4WF4A 5ELGA 3VI5A 3MSZA 1PGTA 2KHPA 4POLA 5COHA 1J0FA 3F3RA 3WYWA 2OE3A 1AQXA 3V1WA 1TK5B 3LXZA 2HZEA 5H5RA 3KXOA 2DIYA 3HVNA 4KDUA 3FZ4A 3GIXA 7GSSA 1ABAA 1I9DA 5JWQB 1DBYA 2LRTA 3EU3A 1UA5A 1JZRA 2GQLA 2R0CA 4TKYA 4YH2A 4YAPA 2X8HA 3IV4A 3LORA 1NM3A 2JADA 1A2MA 1OKTA 4BWSA 3TGZA 2C3NA 2M72A 1A8LA 4IP6A 5ECHB 2FWHA 3KH9A 2C0DA 4MP4A 1ON4A 4Q5RA 3EU4A 3VK9A 1GTIA 3S9FA 3GTUA 3LEFA 3GH9A 1FHEA 1V40A 1UN2A 1A23A 2R5GA 3BD2A 4MH2A 2WS2A 3I69A 2I9HA 1C72A 2LSTA 4QL7A 3CRTA 4WEYA 2FA4A 1O85A 4ML1A 4USSA 3HYPA 1O8XA 3TUEA 4ECIA 3IDVA 3US3A 1GH2A 3C1SA 5BRTA 1X9WB 2ON5A 4HEA2 5D9TA 3OR5A 2IMEA 3FYGA 2H8LA 1GWCA 2WJUA 2YWIA 3GKMA 3O6TA 4ZB6A 1EGRA 4V2MA 2MBTA 4I8BA 4PURA 2FNOA 1S3AA 4HZ4A 2MMZA 5FHIA 3IOSA 2N5BA 4O5UA 4PXOA 1WOUA 5IMAA 5AN1A 1OC8A 5EY6A 1NHYA 2NVLA 2GVPA 4EO3A 3H1NA 1WRYA 1YDKA 1PFOA 3KGKA 3A5IA 5KN0A 1FO5A 1EEJA 1XVQA 4RQXA 1G6YA 1MDIA 3NZNA 4X0XA 1E2YA 3D5JA 1GUKA 3TRQA 3ERGA 1F2EA 1XWCA 5JCWA 5FWGA 3WD6A 2JZRA 1M7TA 1XWBA 2VD1A 3TJBA 3TJKA 5LNKe 2VD0A 5G1LA 2VCXA 5DDLA 1ML6A 3DYRA 5IPGA 1G6WA 1BEDA 4F2IA 3U6VA 3QPMA 2GTUA 2DMMA 3FZ9A 2GGTA 2B7KA 5DALB 4DSQA 2C4JA 3EC3A 5DCHA 4GLTA 1THOA 4IBPA 1K0NA 3W8JA 3CQFA 1ZYPA 1G0TA 4XS6A 3VPTA 2LJKA 2PUKC 1GTAA 5B7CA 2GZPA 3TJFA 1EOGA 3VFIA 1ERVA 4DSRA 3HVVA 1Z5YE 3D21A 4IQAA 1KEBA 1THXA 2C0EA 2LS5A 4O32A 1OE7A 1FOVA 4K7IA 3HXSA 5DQYA 4OWYA 3GNJA 4D73B 4MPFA 5ELAA 5HR0A 1Z6NA 2V1MA 3F6FA 3LYPA 1JZOA 4RI6A 2C0FA 1GNWA 2VM2A 1X5CA 3FEUA 3KIJA 1F37A 5H5QA 4N0VA 5G1KA 2EIOA 2R2JA 4FYUA 4BVYA 9GSSA 2L4CA 3IR4A 2JACA 1UVZA 3RDWA 1FG4A 3KTBA 4X1UA 2DC5A 2VAFA 3F9UA 1U88A 2ON7A 1TI1A 3ZRDA 5GSTA 2IL3A 4NV2A 1T3BA 1A2JA 4PQ1A 2EC4A 1N8JA 2ZCTA 3BCIA 1TU8A 1TK0B 2J9HA 3L4NA 2VLUA 1XIYA 4L0UA 4HI7A 1FB6A 1K0OA 2YWOA 4E8HA 4PUFC 1PA3A 2TRCP 4FO5A 5ECPB 3TJGA 2TRXA 1H75A 3HVSA 1XWGA 2WZ9A 3C71A 1TXXA 2LRNA 4JE1A 2AHEA 2HSHA 5E4WA 3QFBC 4BL7A 8GSSA 3FY7A 1USBA 3RAZA 3MNGA 5GZZB 5JCGA 5D8IA 4FIWA 1KBNA 2LV3A 2GQKA 3BBYA 4V2NA 2V6KA 3G7IA 4K7OA 1XZOA 1BX9A 3GUSA 3VWXA 2I4AA 4K2DA 1T00A 2H71A 3FZ5A 2OADA 1M0UA 1XOBA 1LU4A 3DVXA 3TKRA 4EDZA 5F8BA 3DKSA 2PVOC 2VL2C 3BCKA 1V58A 1U87A 13GSA 1O8WA 1WMJA 4YQMA 3F4TA 1GTBA 5IIZA 2B6MA 3IA1A 5FT3A 1YEPA 5ID2A 1XPVA 3QAWA 5A5KA 4K5SA 2P5RA 4PX1A 2XHFA 2H0IA 2PVQA 2JSYA 2YOIA 1PKZA 2QC7A 4TOPA 3PPUA 4TR1B 2A2RA 3TOUA 4KNDA 2UZ8A 5AIVA 2C3QA 2B5XA 2OJLA 3D4MA 3GURA 2LRCA 5IQYA 2X99A 3TRPA 2F51A 4OMVA 4CW9A 2H76A 4N30A 6GSXA 1PMTA 1SK0A 4BVXA 3IC4A 5HFIA 2XPDA 1F6MC 1U3IA 2A2PA 14GSA 5DVBA 3QR6A 3CYNA 4WR4A 5AISA 3VI7A 4V1Ap 5EPFA 1V98A 2F3MA 5CRHA 2FD3A 2JL4A 1URMA 1PL2A 3QMXA 2X8GA 2LJAA 2DJ1A 4G0KA 4KGIA 1A0RP 4EXJA 2A2SA 3CTFA 2IMDA 2RIIA 4HOJA 4POMA 2C80A 2PN8A 1ILOA 3TKPA 3F3QA 2H74A 1QQ2A 3ZYWA 1YKAA 3HKRA 2GSRA 1WWJA 1A2LA 2H6YA 1Z6MA 3FR6A 1TP9A 4ZBBA 2O89A 1AW9A 1JZWA 2HXKA 4KCEA 4L8EA 4ID0A 5IMCA 5IM9A 2PWJA 3D6IA 4F9ZA 2FLSA 1B9XC 3LG6A 4WR5A 1O6JA 10GSA 2H1AA 4G10A 1SJIA 3KCMA 3EURA 2AB6A 5C00A 2YN1A 4KA0A 3DVWA 6GSSA 3EPTA 2HRAA 1WP0A 1B4QA 4IGJA 3F8UA 1JLVA 1J08A 5CRDA 1X0RA 3QAVA 1RQMA 1ZYEA 4EIQA 4A5PA 2A4VA 4NHZA 4F03A 3TJJA 4LMWA 4P3YB 1A8YA 1OKDA 4KAEA 3GSSA 2CVKA 3A2XA 2KOKA 5CRWA 2DBCA 3KTLA 3UL3A 1NHOA 2HRKA 2K18A 5D9VA 4WXTA 3ZLPA 4IQ1A 4J57E 1T4YA 2AJQB 3ZMKA 1XW9A 1SJZA 3EMXA 4IHUA 2WGRA 3IC8A 3LJRA 5CREA 3G7JA 3IXRA 2X64A 2LUSA 4K1FA 2DMLA 1BYEA 1FB0A 2YPMA 1X5DA 2L5OA 5G5EA 3NOFA 4K7NA 5DAKA 2VM1A 1Z7RA 5G5FA 4NHWA 1WIKA 1G7OA 5JWOB 4TR4A 2FWFA 3W6GA 3DMLA 2IMIA 1K0DA 4GSNA 1JLWA 2B3SA 4K8MA 4KSMA 2H66A 3UEMA 5A4WA 1TJDA 2IFQB 5F07A 2NPBA 2B5EA 3L9VA 1SD8A 4KF9A 1TKDB 4DEJA 1WJKA 2PGTA 1YF0A 4JR4A 4TVEA 1HYUA 1XBSA 4ZBAA 2LKUA 3FK8A 5CAXA 2GT5A 3M1GA 18GSA 4HJ2A 4TXOB 2IN3A 4F82A 2YNXA 3MAKA 1VF3A 2FWGA 2E7PA 4WF5A 1FVKA 2M46A 2VL3A 5ENUA 2YANA 1EV4A 4KW6A 2V32A 2RLIA 1QGVA 4I97A 1B8XA 4HDEA 3GH6A 1ZZYA 2WRTA 2OKAA 1YQ1A 1SL2B 2BTOT 2O8VB 2FUG2 4KE3A 2G2QA 3HJPA 4AJ8A 3EE2A 2CA8A 4Z2TA 1YF1A 1K0BA 4L0WA 3JCML 3ZFBA 4N0ZA 2WFCA 1M99A 1YY7A 1X9SB 3IRAA 1XWKA 2HZFA 3L78A 5A4UA 3TCOA 2P5QA 1T7PB 2MBSA 4MJCA 2XC2A 3SWLA 1QK8A 1M9AA 1IYHA 5CNWA 3ZITA 2R3XA 1EOHA 2F8AA 3SBCA 4QL9A 3KM6A 1TRSA 1M3JA 2G0FA 2QGVA 1OC3A 4ECCA 4TR1A 3FW2A 4PQHA 1GTUA 1DE1A 5D96A 2H6ZA 2VL2A 3TDGA 3HVXA 3C8EA 2IPAA 3ZREA 2N5AA 4JR6A 1QFNA 1TOFA 3GN3A 1M9BA 1GSQA 1V57A 4KCAA 3EYTA 3D0ZA 1LBKA 2VOCA 2A4HA 2R4VA 1DSBA 2GT6A 1HNCA 1AUCA 4PNFA 5CYYA 3KMOA 2QSIA 3F6DA 5GSSA 2DKIA 3RHCA 2BJXA 3CSJA 1DE2A 2YJHA 4AJ7A 2C0GA 5L71A 2B7JA 3H8QA 1TRWA 2H1BA 1FOHA 3M8NA 4TR0A 3GKNA 4HJMA 2CZ2A 1MDJA 5KOWA 4NXIA 1KNGA 3UARA 2O7KA 3L9SA 4AJ6A 5A4VA 3DGQA 2VL9A 4XS4A 5F06A 2KP1A 1MTCA 5J9CA 1AXDA 2GS3A 17GSA 2IIYA 4NAXA 4MK3A 3J7Yb 2O87A 1TTZA 4EIPA 1GULA 1LJRA 5AGYA 3F4RA 4XCSA 3HA9A 1SL1B 2KLXA 3QAGA 1SKWB 1SKSB 4FH8A 3BOAA 1TW9A 5KN2A 2QA1A 4FYBA 2HZEB 5DBQA 3BJ5A 2HE3A 4IJ3A 3HD5A 1E6BA 4KDYA 4IP1A 2D2ZA 4OD7A 3UJ1A 4YAVA 3P2AA 3QOUA 2I1UA 2EIQA 2FCHA 4GSSA 2H19A 4KB3A 4DSSA 3GX8A 2H1GA 3WT1A 4JU5A 2R0PA 1GP1A 3ME7A 3C7MA 1SK1A 3PGTA 1VF1A 4MNNA 1M3IA 5CRGA 1GUMA 1T8EB 3AY8A 1K0CA 1SJ6A 3UVTA 3J7Yk 2H75A 1QXHA 4OCEA 4ECJA 2P0GA 3GTUB 1VRSD 3M3MA 2L6DA 2CVBA 2OBKA 2MYGA 3H93A 2YP6A 3CTGA 1BAYA 3G9BA 4FYCA 2ALBA 1OC9A 1SENA 1SU9A 4TW5A 3C1RA 4O7HA 1XWAA 4GQFA 4MZWA 2IJYA 2KP2A 2WDUA 2LQOA 1ERUA 3D4TA 1R5PA 4POBA 3KP8A 3GYKA 3K8NA 5IMFA 3KH7A 5B6NA 3PINA 2IWTA 3I43A 5D73A 2E2GA 4KH7A 1JHBA 2XBIA 16GSA 3UMAA 3ME8A 3IK9A 3KD0A 3LWAA 2WCIA 5ECSA 4LL1B 4CHSA 1GSUA 2VLVA 3G7YA 1FW1A 5JWRB 1TK8B 2H0HA 4I5QA 2I3YA 3E9JB 4TR3A 4TN8A 1GUHA 2P31A 1XOAA 2YZHA 1JFUA 2VCTA 4YQUA 4ZL8A 3E3EA 4JZQA 4OFTA 3TKSC 2LNTA 3WGEA 4BPYA 2KUCA 4CDOA 3M9KA 4ZB8A 2K9FA 3N5OA 2LJRA 3RPNA 2GDRA 1JZDA 2XPEA 3F0IA 1F3BA 3ZIVA 3ZMLA 3UIWA 5ECMB 1CQHA 4HUAA 1TU7A 1SK2A 4ML6A 4K6XA 3ED3A 6GSWA 3HDCA 1M2DA 1SYRA 3KMNA 4IJIA 1YEXA 5E59A 4V2LA 3QD9A 3WGDA 2VIMA 3M0FA 3RHBA 5HR2A 1ZYNA 4ECBA 3ZVJD 4WETA 5G30A 1I5GA 3DRNA 5G2ZA 1KTEA 2MMOA 4MJBA 3VPQA 4GRFA 3FMWA 1X5EA 3UAPA 4K5RA 3R2QA 5CP1A 4BVYB 2X8CA 3MIXA 4O5QA 5IPHA 2HT9A 4EE0A 1MD3A 1S3RA 3GKXA 5HQPA 1HNAA 1M2AA 2LTKA 4TRXA 1BJXA 2H72A 1UC7A 3ERWA 2ES7A 4MJEA 2HFDA 5DALA 4J2FA 1EP8A 1PKWA 5ECOB 3Q19A 3I6AA 5BMUA 4GTUA 2N5FA 4KSOA 5GAPD 3DEXA 2OE0A 1EV9A 4MF7A 1HQOA 5GAND 1XVWA 2OACA 4QQ7A 2R0GA 4G0LA 1RK4A 2H70A 5J3RA 1GSEA 4BL7B 5ABRA 1K3YA 1SYXA 4D73A 3C73A 3FHKA 1A24A 4JEDA 2I81A 4WBJA 1ZMAA 3ERFA 3PH9A 1Q98A 3H79A 5D93A 2L59A 4G9HA 2DJ3A 3HJMA 5EVOA 4O5RA 2DLXA 2JZTA 1PX7A 3ZL5A 4TXVA 4XHMA 1U3AA 4Q5FA 4ZILA 4G19A 4BA7A 4YQVA 4Q5NA 3TOTA 1N2AA 2H6XA 1ZOFA 2H01A 1NW2A 4K2XA 1T1VA 1YKCA 2HRFA 3EVIA 2B1KA 4FQUA 6GSUA 1EEMA 4Q5QA 5ID2B 1GLQA 5KN3A 4MPGA 2NBSA 1ERTA 1T4ZA 1F3AA 4ZL7A 3CBUA 4RUVA 4JRRA 1XFLA 5CO3A 2CX4A 5ECIB 2L6CA 2K8VA 2HNLA 4MF6A 5HR3A 3IAM2 2V6OA 1Z7PA 2YJ7A 3GMFA 2GZYA 2JSZA 3HJOA 1QMVA 5D9WA 3LQ7A 5J5NA 4BVXB 3GSTA 2LQQA 3LW9A 4K9ZA 2WULA 4MCUA 4N10A 4MABA 2H30A 1EZKA 5F05A 3HHVA 2CZ3A 4OFMA 2XBQA 5B8AA 1R5AA 3O76A 4WBRD 2OBIA 3Q6OA 2NTOA 4J56E 2R6KA 3L0HA 2DSAA 2H73A 20GSA 2AV4A 4G2EA 1PSQA 4G0IA 4MA9A 2MMNA 2VCZA 1B4PA 1ZGNA 2GZZA 2OE1A 4IKHA 5D9XA 1VF2A 4XRAA 12GSA 2HI7A 4WKWA 1K3LA 4XTSA 3DD3A 4LMVA 3GRXA 3ZIJA 2E2MA 1EGOA 2V2GA 5J4UA 1S3CA 5KOXA 2C1YA 1AQVA 2B1LA 4Z2RA 5DQSA 3FR3A 2QKEA 4BWQA 1OE8A 5IMDA 3LFLA 2RUEA 4ZIJA 1GSSA 5C04A 1MDKA 4OO5A 6GSTA 1XW5A 2F8FA 1O73A 4OO4A 1PN0A 5IO0A 1OVNA 4HZ2A 2VUPA 3UOMA 5IOWA 5IMVA 3Q74A 2DJJA 3UBKA 4AGSA 3LSZA 3TKSE 2NDOA 2PPTA 3IK7A 2IMKA 2PU9C 5HR1A 4I2TA 5JCUA 1BG5A 3GKKA 1GSYA 5G31A 2K6VA 4MLYA 4MH3A 5J41A 2EIRA 2VO4A 5ECNB 4GCIA 5ECLB 1BQ7A 2L5LA 1A0FA 1SD9A 2VLTA 2YZUA 1MD4A 3E0UA 4IVFA 1XXUA 2YWMA 2ZUPA 1AIUA 3EINA 3RBTA 2DJ2A 3TKSA 3CRUA 3FZAA 2YV7A 3EWLA 3GA4A 3KEBA 1U6TA 5LCZA 4L5OA 3FR9A 2MMAA 3A5WA 1B9YC 4MZCA 1W4VA 2GSQA 2AUVA 3GL5A 4MJAA 4LA1A 1DUGA 5DAKB 2CX3A 2PERA 4V1Ag 2HSMA 4IW9A 4F0CA 3HCZA 3ISOA 1AC1A 3P7XA 1PL1A 1W89A 4Z2UA 2J23A 2VCWA 1YJ6A 1EP7A 4I2UA 4NWYA 2CV4A 1J9BA 4EUYA 2FWEA 11GSA 4NV5A 2WB9A 3M9JA 1AQWA 4GXZA 4DVCA 3VURA 1GL8A 2AAWA 2E0QA 3VWUA 4ICYA 3H4KA 1Z3EA 1TRVA 4HQSA 4F0BA 4NPBA 1VF4A 4KUNA 4HS1A 4JBBA 2FGXA 3ZVJA 4I6XA 4ZB9A 3GHAA 2JU5A 2V41A 5DCGA 2RM6A 2VCVA 3R3EA 4MMMA 2HRNA 3F4SA 1RW1A 1O7UA 2OA7A 5DJMA 5EL8A 4PNGA 1R26A 5H5SA 1GNEA 3DIEA 4AF2A 3TB2A 4L5LA 2GLRA 2FHEA 4ILFA 4K0GA 1TRUA 3APQA 4GQCA 2GQMA 4POKA 5IOXA 3LXTA 3Q18A 1HD2A 3VWVA 2QA2A 4EF0A 3CXGA 4EC0A 2YV9A 1HNBA 4HQZA 1F9MA 3MWHA 5ECRB 5J9BA 3GX0A 3D22A 3U5RE 1GLPA 4EL1A 4KX4A 3RPPA 1OYJA 4RI7A 3ZTLA 3LGCA 6GSVA 1WPIA 2CVDA 2TIRA 4ISDA 2K8SA 1ZL9A 3IHQA 2REMA 1CQGA 2H0GA 1X9MB 22GSA 3VWWA 2IFQA 1NSWA 4XIHA 1SKRB 1PN9A 3APSA 2VCQA 3ZZXA 4EVMA 4GSTA 5LD0A 1GRXA 4K0NA 2CAIA 3UBLA 4ZL9A 5ECKB 3O3TA 2PMTA 1PRXA 1XW6A 3CMIA 5KN1A 4OCFA 2LEGA 5B8BA 3NIVA 2CT6A 3APOA 4XS1A 5DJLA 4XRDA 3CSHA 4EKZA 1ACVA 2BMXA 1S3DA 2RM5A 2M80A 3QCPA 3HZ8A 4TXOA 1Y6EA 4GWRA 4X4JA 2CAQA 3MDKA 5ECQB 3LYKA 4KDXA
chains in the Genus database with same CATH topology
2L57A 4YKGA 1GSFA 1V9WA 3DWVA 4MZBA 2H1DA 2Z9SA 3HZ4A 4X43A 4Z7XA 1TDIA 4PGTA 4EDYA 1QUWA 3IPZA 4ACSA 2CQ9A 2DKHA 2FA8A 4O92A 4H86A 1OAZA 4IN0A 3CSIA 2RUFA 1K0AA 2X4AA 1MEKA 1R4WA 4MF5A 1M2BA 1EWXA 2AYTA 3P90A 4HU9A 4N11A 2YWNA 1SL0B 4PTSA 5IO2A 1IYIA 1B48A 3HY2A 2R37A 3FKFA 3IAS2 1PQNA 2DIZA 1R7HA 5F0GA 3DXBA 1ZCPA 2PBJA 1K0MA 3A2VA 4XS4B 1PD21 5IMZA 3VLNA 3MYDA 1PX6A 3TRXA 3GFKA 3WT2A 3KZQA 2X49A 3WGXA 2IMFA 1ZYQB 2YCDA 4NMUA 4GF0A 5B6MA 1Y25A 5AIXA 2GSSA 5HFGA 1GSDA 2DJ0A 4MDCA 4ULXA 3UVHA 4LL4B 4CY8A 2HLSA 4PUAA 3A2WA 1H4OA 3IHGA 2DJKA 4PQIA 4ZBDA 2C3TA 4E8EA 1Q4JA 3A3TA 3GL3A 6GSYA 5INYA 4IS0A 1Z9HA 2L4QA 1ST9A 2LNSA 3FRCA 3L9UA 4HU7A 1V2AA 3IBHA 4ZXGA 2F9SA 3PR8A 3IE3A 2GSTA 4LLRA 2HYXA 2ZNMA 4DSSB 1WE0A 4RQRA 2FY6A 4CY6A 1TI3A 3ZFLA 1XCCA 2O85A 3KP9A 1FVJA 2JZSA 1K3OA 3EMPA 4IELA 2C8UA 5HFKA 19GSA 3QDNA 3TKQA 1VGLA 3P8WA 1FAAA 3N9JA 3KJYA 3W8SA 1YZXA 3F63A 1AAZA 5KEJA 3I9V2 4YKFA 2B5YA 4OFNA 2MZCA 3GV1A 1G7EA 1ERWA 1OC9B 2HSYA 3QFAC 1O81A 4WF4A 5ELGA 3VI5A 3MSZA 1PGTA 2KHPA 4POLA 5COHA 1J0FA 3F3RA 3WYWA 2OE3A 1AQXA 3V1WA 1TK5B 3LXZA 2HZEA 5H5RA 3KXOA 2DIYA 4KDUA 3FZ4A 3GIXA 7GSSA 1ABAA 1I9DA 5JWQB 1DBYA 2LRTA 3EU3A 1UA5A 1JZRA 2GQLA 2R0CA 4TKYA 4YH2A 4YAPA 2X8HA 3IV4A 3LORA 1NM3A 2JADA 1A2MA 1OKTA 4BWSA 3TGZA 2C3NA 2M72A 1A8LA 4IP6A 5ECHB 2FWHA 3KH9A 2C0DA 4MP4A 1ON4A 4Q5RA 3EU4A 3VK9A 1GTIA 3S9FA 3GTUA 3LEFA 3GH9A 1FHEA 1V40A 1UN2A 1A23A 2R5GA 3BD2A 4MH2A 2WS2A 3I69A 2I9HA 1C72A 2LSTA 4QL7A 3CRTA 4WEYA 2FA4A 1O85A 4ML1A 4USSA 3HYPA 1O8XA 3TUEA 4ECIA 3IDVA 3US3A 1GH2A 3C1SA 5BRTA 1X9WB 2ON5A 4HEA2 5D9TA 3OR5A 2IMEA 3FYGA 2H8LA 1GWCA 2WJUA 2YWIA 3GKMA 3O6TA 4ZB6A 1EGRA 4V2MA 2MBTA 4I8BA 4PURA 2FNOA 1S3AA 4HZ4A 2MMZA 5FHIA 3IOSA 2N5BA 4O5UA 4PXOA 1WOUA 5IMAA 5AN1A 1OC8A 5EY6A 1NHYA 2NVLA 2GVPA 4EO3A 3H1NA 1WRYA 1YDKA 3KGKA 3A5IA 5KN0A 1FO5A 1EEJA 1XVQA 4RQXA 1G6YA 1MDIA 3NZNA 4X0XA 1E2YA 3D5JA 1GUKA 3TRQA 3ERGA 1F2EA 1XWCA 5JCWA 5FWGA 3WD6A 2JZRA 1M7TA 1XWBA 2VD1A 3TJBA 3TJKA 5LNKe 2VD0A 5G1LA 2VCXA 5DDLA 1ML6A 3DYRA 5IPGA 1G6WA 1BEDA 4F2IA 3U6VA 3QPMA 2GTUA 2DMMA 3FZ9A 2GGTA 2B7KA 5DALB 4DSQA 2C4JA 3EC3A 5DCHA 4GLTA 1THOA 4IBPA 1K0NA 3W8JA 1ZYPA 1G0TA 4XS6A 3VPTA 2LJKA 2PUKC 1GTAA 5B7CA 2GZPA 3TJFA 1EOGA 3VFIA 1ERVA 4DSRA 3HVVA 1Z5YE 3D21A 4IQAA 1KEBA 1THXA 2C0EA 2LS5A 4O32A 1OE7A 1FOVA 4K7IA 3HXSA 5DQYA 4OWYA 3GNJA 4D73B 4MPFA 5ELAA 5HR0A 1Z6NA 2V1MA 3F6FA 3LYPA 1JZOA 4RI6A 2C0FA 1GNWA 2VM2A 1X5CA 3FEUA 3KIJA 1F37A 5H5QA 4N0VA 5G1KA 2EIOA 2R2JA 4FYUA 4BVYA 9GSSA 2L4CA 3IR4A 2JACA 1UVZA 3RDWA 1FG4A 3KTBA 4X1UA 2DC5A 2VAFA 3F9UA 1U88A 2ON7A 1TI1A 3ZRDA 5GSTA 2IL3A 4NV2A 1T3BA 1A2JA 4PQ1A 2EC4A 1N8JA 2ZCTA 3BCIA 1TU8A 1TK0B 2J9HA 3L4NA 2VLUA 1XIYA 4L0UA 4HI7A 1FB6A 1K0OA 2YWOA 4E8HA 4PUFC 1PA3A 2TRCP 4FO5A 5ECPB 3TJGA 2TRXA 1H75A 3HVSA 1XWGA 2WZ9A 3C71A 1TXXA 2LRNA 4JE1A 2AHEA 2HSHA 5E4WA 3QFBC 4BL7A 8GSSA 3FY7A 1USBA 3RAZA 3MNGA 5GZZB 5JCGA 5D8IA 4FIWA 1KBNA 2LV3A 2GQKA 3BBYA 4V2NA 2V6KA 3G7IA 4K7OA 1XZOA 1BX9A 3GUSA 3VWXA 2I4AA 4K2DA 1T00A 2H71A 3FZ5A 2OADA 1M0UA 1XOBA 1LU4A 3DVXA 3TKRA 4EDZA 5F8BA 3DKSA 2PVOC 2VL2C 3BCKA 1V58A 1U87A 13GSA 1O8WA 1WMJA 4YQMA 3F4TA 1GTBA 5IIZA 2B6MA 3IA1A 5FT3A 1YEPA 5ID2A 1XPVA 3QAWA 5A5KA 4K5SA 2P5RA 4PX1A 2XHFA 2H0IA 2PVQA 2JSYA 2YOIA 1PKZA 2QC7A 4TOPA 3PPUA 4TR1B 2A2RA 3TOUA 4KNDA 2UZ8A 5AIVA 2C3QA 2B5XA 2OJLA 3D4MA 3GURA 2LRCA 5IQYA 2X99A 3TRPA 2F51A 4OMVA 4CW9A 2H76A 4N30A 6GSXA 1PMTA 1SK0A 4BVXA 3IC4A 5HFIA 2XPDA 1F6MC 1U3IA 2A2PA 14GSA 5DVBA 3QR6A 3CYNA 4WR4A 5AISA 3VI7A 4V1Ap 5EPFA 1V98A 2F3MA 5CRHA 2FD3A 2JL4A 1URMA 1PL2A 3QMXA 2X8GA 2LJAA 2DJ1A 4G0KA 4KGIA 1A0RP 4EXJA 2A2SA 3CTFA 2IMDA 2RIIA 4HOJA 4POMA 2C80A 2PN8A 1ILOA 3TKPA 3F3QA 2H74A 1QQ2A 3ZYWA 1YKAA 3HKRA 2GSRA 1WWJA 1A2LA 2H6YA 1Z6MA 3FR6A 1TP9A 4ZBBA 2O89A 1AW9A 1JZWA 2HXKA 4KCEA 4L8EA 4ID0A 5IMCA 5IM9A 2PWJA 3D6IA 4F9ZA 2FLSA 1B9XC 3LG6A 4WR5A 1O6JA 10GSA 2H1AA 4G10A 1SJIA 3KCMA 3EURA 2AB6A 5C00A 2YN1A 4KA0A 3DVWA 6GSSA 3EPTA 2HRAA 1WP0A 1B4QA 4IGJA 3F8UA 1JLVA 1J08A 5CRDA 1X0RA 3QAVA 1RQMA 1ZYEA 4EIQA 4A5PA 2A4VA 4NHZA 4F03A 3TJJA 4LMWA 4P3YB 1A8YA 1OKDA 4KAEA 3GSSA 2CVKA 3A2XA 2KOKA 5CRWA 2DBCA 3KTLA 3UL3A 1NHOA 2HRKA 2K18A 5D9VA 4WXTA 3ZLPA 4IQ1A 4J57E 1T4YA 2AJQB 3ZMKA 1XW9A 1SJZA 3EMXA 4IHUA 2WGRA 3IC8A 3LJRA 5CREA 3G7JA 3IXRA 2X64A 2LUSA 4K1FA 2DMLA 1BYEA 1FB0A 2YPMA 1X5DA 2L5OA 5G5EA 3NOFA 4K7NA 5DAKA 2VM1A 1Z7RA 5G5FA 4NHWA 1WIKA 1G7OA 5JWOB 4TR4A 2FWFA 3W6GA 3DMLA 2IMIA 1K0DA 4GSNA 1JLWA 2B3SA 4K8MA 4KSMA 2H66A 3UEMA 5A4WA 1TJDA 2IFQB 5F07A 2NPBA 2B5EA 3L9VA 1SD8A 4KF9A 1TKDB 4DEJA 1WJKA 2PGTA 1YF0A 4JR4A 4TVEA 1HYUA 1XBSA 4ZBAA 2LKUA 3FK8A 5CAXA 2GT5A 3M1GA 18GSA 4HJ2A 4TXOB 2IN3A 4F82A 2YNXA 3MAKA 1VF3A 2FWGA 2E7PA 4WF5A 1FVKA 2M46A 2VL3A 5ENUA 2YANA 1EV4A 4KW6A 2V32A 2RLIA 1QGVA 4I97A 1B8XA 4HDEA 3GH6A 1ZZYA 2WRTA 2OKAA 1YQ1A 1SL2B 2BTOT 2O8VB 2FUG2 4KE3A 2G2QA 3HJPA 4AJ8A 3EE2A 2CA8A 4Z2TA 1YF1A 1K0BA 4L0WA 3JCML 3ZFBA 4N0ZA 2WFCA 1M99A 1YY7A 1X9SB 3IRAA 1XWKA 2HZFA 3L78A 5A4UA 3TCOA 2P5QA 1T7PB 2MBSA 4MJCA 2XC2A 3SWLA 1QK8A 1M9AA 1IYHA 5CNWA 3ZITA 2R3XA 1EOHA 2F8AA 3SBCA 4QL9A 3KM6A 1TRSA 2G0FA 2QGVA 1OC3A 4ECCA 4TR1A 3FW2A 4PQHA 1GTUA 1DE1A 5D96A 2H6ZA 2VL2A 3TDGA 3HVXA 3C8EA 2IPAA 3ZREA 2N5AA 4JR6A 1QFNA 1TOFA 3GN3A 1M9BA 1GSQA 1V57A 4KCAA 3EYTA 3D0ZA 1LBKA 2VOCA 2A4HA 2R4VA 1DSBA 2GT6A 1HNCA 1AUCA 4PNFA 5CYYA 3KMOA 2QSIA 3F6DA 5GSSA 2DKIA 3RHCA 2BJXA 3CSJA 1DE2A 2YJHA 4AJ7A 2C0GA 5L71A 2B7JA 3H8QA 1TRWA 2H1BA 1FOHA 3M8NA 4TR0A 3GKNA 4HJMA 2CZ2A 1MDJA 5KOWA 4NXIA 1KNGA 3UARA 2O7KA 3L9SA 4AJ6A 5A4VA 3DGQA 2VL9A 4XS4A 5F06A 2KP1A 1MTCA 5J9CA 1AXDA 2GS3A 17GSA 2IIYA 4NAXA 4MK3A 3J7Yb 2O87A 1TTZA 4EIPA 1GULA 1LJRA 5AGYA 3F4RA 4XCSA 3HA9A 1SL1B 2KLXA 3QAGA 1SKWB 1SKSB 4FH8A 3BOAA 1TW9A 5KN2A 2QA1A 4FYBA 2HZEB 5DBQA 3BJ5A 2HE3A 4IJ3A 3HD5A 1E6BA 4KDYA 4IP1A 2D2ZA 4OD7A 3UJ1A 4YAVA 3P2AA 3QOUA 2I1UA 2EIQA 2FCHA 4GSSA 2H19A 4KB3A 4DSSA 3GX8A 2H1GA 3WT1A 4JU5A 2R0PA 1GP1A 3ME7A 3C7MA 1SK1A 3PGTA 1VF1A 4MNNA 5CRGA 1GUMA 1T8EB 3AY8A 1K0CA 1SJ6A 3UVTA 3J7Yk 2H75A 1QXHA 4OCEA 4ECJA 2P0GA 3GTUB 1VRSD 3M3MA 2L6DA 2CVBA 2OBKA 2MYGA 3H93A 2YP6A 3CTGA 1BAYA 3G9BA 4FYCA 2ALBA 1OC9A 1SENA 1SU9A 4TW5A 3C1RA 4O7HA 1XWAA 4GQFA 4MZWA 2IJYA 2KP2A 2WDUA 2LQOA 1ERUA 3D4TA 1R5PA 4POBA 3KP8A 3GYKA 3K8NA 5IMFA 3KH7A 5B6NA 3PINA 2IWTA 3I43A 5D73A 2E2GA 4KH7A 1JHBA 2XBIA 16GSA 3UMAA 3ME8A 3IK9A 3KD0A 3LWAA 2WCIA 5ECSA 4LL1B 4CHSA 1GSUA 2VLVA 3G7YA 1FW1A 5JWRB 1TK8B 2H0HA 4I5QA 2I3YA 3E9JB 4TR3A 4TN8A 1GUHA 2P31A 1XOAA 2YZHA 1JFUA 2VCTA 4YQUA 4ZL8A 3E3EA 4JZQA 4OFTA 3TKSC 2LNTA 3WGEA 4BPYA 2KUCA 4CDOA 3M9KA 4ZB8A 2K9FA 3N5OA 2LJRA 3RPNA 2GDRA 1JZDA 2XPEA 3F0IA 1F3BA 3ZIVA 3ZMLA 3UIWA 5ECMB 1CQHA 4HUAA 1TU7A 1SK2A 4ML6A 4K6XA 3ED3A 6GSWA 3HDCA 1M2DA 1SYRA 3KMNA 4IJIA 1YEXA 5E59A 4V2LA 3QD9A 3WGDA 2VIMA 3M0FA 3RHBA 5HR2A 1ZYNA 4ECBA 3ZVJD 4WETA 5G30A 1I5GA 3DRNA 5G2ZA 1KTEA 2MMOA 4MJBA 3VPQA 4GRFA 3FMWA 1X5EA 3UAPA 4K5RA 3R2QA 5CP1A 4BVYB 2X8CA 3MIXA 4O5QA 5IPHA 2HT9A 4EE0A 1MD3A 3GKXA 5HQPA 1HNAA 1M2AA 2LTKA 4TRXA 1BJXA 2H72A 1UC7A 3ERWA 2ES7A 4MJEA 2HFDA 5DALA 4J2FA 1EP8A 1PKWA 5ECOB 3Q19A 3I6AA 5BMUA 4GTUA 2N5FA 4KSOA 5GAPD 3DEXA 2OE0A 1EV9A 4MF7A 1HQOA 5GAND 1XVWA 2OACA 4QQ7A 2R0GA 4G0LA 1RK4A 2H70A 5J3RA 1GSEA 4BL7B 5ABRA 1K3YA 1SYXA 4D73A 3C73A 3FHKA 1A24A 4JEDA 2I81A 4WBJA 1ZMAA 3ERFA 3PH9A 1Q98A 3H79A 5D93A 2L59A 4G9HA 2DJ3A 3HJMA 5EVOA 4O5RA 2DLXA 2JZTA 1PX7A 3ZL5A 4TXVA 4XHMA 1U3AA 4Q5FA 4ZILA 4G19A 4BA7A 4YQVA 4Q5NA 3TOTA 1N2AA 2H6XA 1ZOFA 2H01A 1NW2A 4K2XA 1T1VA 1YKCA 2HRFA 3EVIA 2B1KA 4FQUA 6GSUA 1EEMA 4Q5QA 5ID2B 1GLQA 5KN3A 4MPGA 2NBSA 1ERTA 1T4ZA 1F3AA 4ZL7A 3CBUA 4RUVA 4JRRA 1XFLA 5CO3A 2CX4A 5ECIB 2L6CA 2K8VA 2HNLA 4MF6A 5HR3A 3IAM2 2V6OA 1Z7PA 2YJ7A 3GMFA 2GZYA 2JSZA 3HJOA 1QMVA 5D9WA 3LQ7A 5J5NA 4BVXB 3GSTA 2LQQA 3LW9A 4K9ZA 2WULA 4MCUA 4N10A 4MABA 2H30A 1EZKA 5F05A 3HHVA 2CZ3A 4OFMA 2XBQA 5B8AA 1R5AA 3O76A 4WBRD 2OBIA 3Q6OA 2NTOA 4J56E 2R6KA 3L0HA 2DSAA 2H73A 20GSA 2AV4A 4G2EA 1PSQA 4G0IA 4MA9A 2MMNA 2VCZA 1B4PA 1ZGNA 2GZZA 2OE1A 4IKHA 5D9XA 1VF2A 4XRAA 12GSA 2HI7A 4WKWA 1K3LA 4XTSA 3DD3A 4LMVA 3GRXA 3ZIJA 2E2MA 1EGOA 2V2GA 5J4UA 1S3CA 5KOXA 2C1YA 1AQVA 2B1LA 4Z2RA 5DQSA 3FR3A 2QKEA 4BWQA 1OE8A 5IMDA 3LFLA 2RUEA 4ZIJA 1GSSA 5C04A 1MDKA 4OO5A 6GSTA 1XW5A 2F8FA 1O73A 4OO4A 1PN0A 5IO0A 1OVNA 4HZ2A 2VUPA 3UOMA 5IOWA 5IMVA 3Q74A 2DJJA 3UBKA 4AGSA 3LSZA 3TKSE 2NDOA 2PPTA 3IK7A 2IMKA 2PU9C 5HR1A 4I2TA 5JCUA 1BG5A 3GKKA 1GSYA 5G31A 2K6VA 4MLYA 4MH3A 5J41A 2EIRA 2VO4A 5ECNB 4GCIA 5ECLB 1BQ7A 2L5LA 1A0FA 1SD9A 2VLTA 2YZUA 1MD4A 3E0UA 4IVFA 1XXUA 2YWMA 2ZUPA 1AIUA 3EINA 3RBTA 2DJ2A 3TKSA 3CRUA 3FZAA 2YV7A 3EWLA 3GA4A 3KEBA 1U6TA 5LCZA 4L5OA 3FR9A 2MMAA 3A5WA 1B9YC 4MZCA 1W4VA 2GSQA 2AUVA 3GL5A 4MJAA 4LA1A 1DUGA 5DAKB 2CX3A 2PERA 4V1Ag 2HSMA 4IW9A 4F0CA 3HCZA 3ISOA 1AC1A 3P7XA 1PL1A 1W89A 4Z2UA 2J23A 2VCWA 1YJ6A 1EP7A 4I2UA 4NWYA 2CV4A 1J9BA 4EUYA 2FWEA 11GSA 4NV5A 2WB9A 3M9JA 1AQWA 4GXZA 4DVCA 3VURA 1GL8A 2AAWA 2E0QA 3VWUA 4ICYA 3H4KA 1Z3EA 1TRVA 4HQSA 4F0BA 4NPBA 1VF4A 4KUNA 4HS1A 4JBBA 2FGXA 3ZVJA 4I6XA 4ZB9A 3GHAA 2JU5A 2V41A 5DCGA 2RM6A 2VCVA 3R3EA 4MMMA 2HRNA 3F4SA 1RW1A 1O7UA 2OA7A 5DJMA 5EL8A 4PNGA 1R26A 5H5SA 1GNEA 3DIEA 4AF2A 3TB2A 4L5LA 2GLRA 2FHEA 4ILFA 4K0GA 1TRUA 3APQA 4GQCA 2GQMA 4POKA 5IOXA 3LXTA 3Q18A 1HD2A 3VWVA 2QA2A 4EF0A 3CXGA 4EC0A 2YV9A 1HNBA 4HQZA 1F9MA 3MWHA 5ECRB 5J9BA 3GX0A 3D22A 3U5RE 1GLPA 4EL1A 4KX4A 3RPPA 1OYJA 4RI7A 3ZTLA 3LGCA 6GSVA 1WPIA 2CVDA 2TIRA 4ISDA 2K8SA 1ZL9A 3IHQA 2REMA 1CQGA 2H0GA 1X9MB 22GSA 3VWWA 2IFQA 1NSWA 4XIHA 1SKRB 1PN9A 3APSA 2VCQA 3ZZXA 4EVMA 4GSTA 5LD0A 1GRXA 4K0NA 2CAIA 3UBLA 4ZL9A 5ECKB 3O3TA 2PMTA 1PRXA 1XW6A 3CMIA 5KN1A 4OCFA 2LEGA 5B8BA 3NIVA 2CT6A 3APOA 4XS1A 5DJLA 4XRDA 3CSHA 4EKZA 1ACVA 2BMXA 1S3DA 2RM5A 2M80A 3QCPA 3HZ8A 4TXOA 1Y6EA 4GWRA 4X4JA 2CAQA 3MDKA 5ECQB 3LYKA 4KDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L57 A;  1GSF A;  1V9W A;  3DWV A;  4MZB A;  2H1D A;  2Z9S A;  3HZ4 A;  4X43 A;  4Z7X A;  1TDI A;  4PGT A;  4EDY A;  1QUW A;  3IPZ A;  4ACS A;  2CQ9 A;  2FA8 A;  4O92 A;  4H86 A;  1OAZ A;  4IN0 A;  3CSI A;  2RUF A;  1K0A A;  1MEK A;  1R4W A;  4MF5 A;  1M2B A;  1EWX A;  2AYT A;  3P90 A;  4HU9 A;  4N11 A;  2YWN A;  1SL0 B;  5IO2 A;  1IYI A;  1B48 A;  3HY2 A;  2R37 A;  3FKF A;  3IAS 2;  1PQN A;  2DIZ A;  1R7H A;  5F0G A;  3DXB A;  1ZCP A;  2PBJ A;  1K0M A;  3A2V A;  4XS4 B;  1PD2 1;  5IMZ A;  3VLN A;  1PX6 A;  3TRX A;  3GFK A;  3WT2 A;  3KZQ A;  3WGX A;  2IMF A;  1ZYQ B;  2YCD A;  4NMU A;  4GF0 A;  5B6M A;  1Y25 A;  5AIX A;  2GSS A;  5HFG A;  1GSD A;  2DJ0 A;  4MDC A;  4ULX A;  3UVH A;  4LL4 B;  2HLS A;  4PUA A;  3A2W A;  1H4O A;  2DJK A;  4PQI A;  4ZBD A;  2C3T A;  4E8E A;  1Q4J A;  3A3T A;  3GL3 A;  6GSY A;  5INY A;  4IS0 A;  1Z9H A;  2L4Q A;  1ST9 A;  2LNS A;  3FRC A;  3L9U A;  4HU7 A;  1V2A A;  3IBH A;  4ZXG A;  2F9S A;  3PR8 A;  3IE3 A;  2GST A;  4LLR A;  2HYX A;  2ZNM A;  4DSS B;  1WE0 A;  4RQR A;  2FY6 A;  1TI3 A;  3ZFL A;  1XCC A;  2O85 A;  3KP9 A;  1FVJ A;  2JZS A;  1K3O A;  3EMP A;  4IEL A;  2C8U A;  5HFK A;  19GS A;  3QDN A;  3TKQ A;  1VGL A;  3P8W A;  1FAA A;  3N9J A;  3KJY A;  3W8S A;  1YZX A;  3F63 A;  1AAZ A;  5KEJ A;  3I9V 2;  2B5Y A;  4OFN A;  2MZC A;  3GV1 A;  1G7E A;  1ERW A;  1OC9 B;  2HSY A;  3QFA C;  1O81 A;  4WF4 A;  5ELG A;  3VI5 A;  3MSZ A;  1PGT A;  2KHP A;  4POL A;  5COH A;  1J0F A;  3F3R A;  3WYW A;  2OE3 A;  1AQX A;  3V1W A;  1TK5 B;  3LXZ A;  2HZE A;  5H5R A;  3KXO A;  2DIY A;  4KDU A;  3FZ4 A;  3GIX A;  7GSS A;  1ABA A;  1I9D A;  5JWQ B;  1DBY A;  2LRT A;  3EU3 A;  1UA5 A;  1JZR A;  2GQL A;  4TKY A;  4YH2 A;  4YAP A;  2X8H A;  3IV4 A;  3LOR A;  1NM3 A;  2JAD A;  1A2M A;  1OKT A;  4BWS A;  3TGZ A;  2C3N A;  2M72 A;  1A8L A;  4IP6 A;  5ECH B;  2FWH A;  3KH9 A;  2C0D A;  4MP4 A;  1ON4 A;  4Q5R A;  3EU4 A;  3VK9 A;  1GTI A;  3S9F A;  3GTU A;  3LEF A;  3GH9 A;  1FHE A;  1V40 A;  1UN2 A;  1A23 A;  2R5G A;  3BD2 A;  4MH2 A;  2WS2 A;  3I69 A;  2I9H A;  1C72 A;  2LST A;  4QL7 A;  3CRT A;  4WEY A;  2FA4 A;  1O85 A;  4ML1 A;  3HYP A;  1O8X A;  3TUE A;  4ECI A;  3IDV A;  3US3 A;  1GH2 A;  3C1S A;  1X9W B;  2ON5 A;  4HEA 2;  5D9T A;  3OR5 A;  2IME A;  3FYG A;  2H8L A;  1GWC A;  2WJU A;  2YWI A;  3GKM A;  3O6T A;  4ZB6 A;  1EGR A;  4V2M A;  2MBT A;  4I8B A;  4PUR A;  2FNO A;  1S3A A;  4HZ4 A;  2MMZ A;  5FHI A;  3IOS A;  2N5B A;  4PXO A;  1WOU A;  5IMA A;  5AN1 A;  1OC8 A;  5EY6 A;  1NHY A;  2NVL A;  2GVP A;  4EO3 A;  3H1N A;  1WRY A;  1YDK A;  3KGK A;  5KN0 A;  1FO5 A;  1EEJ A;  1XVQ A;  4RQX A;  1G6Y A;  1MDI A;  3NZN A;  4X0X A;  1E2Y A;  3D5J A;  1GUK A;  3TRQ A;  3ERG A;  1F2E A;  1XWC A;  5JCW A;  5FWG A;  3WD6 A;  2JZR A;  1M7T A;  1XWB A;  2VD1 A;  3TJB A;  3TJK A;  5LNK e;  2VD0 A;  5G1L A;  2VCX A;  5DDL A;  1ML6 A;  3DYR A;  5IPG A;  1G6W A;  1BED A;  4F2I A;  3U6V A;  3QPM A;  2GTU A;  2DMM A;  3FZ9 A;  2GGT A;  2B7K A;  5DAL B;  4DSQ A;  2C4J A;  5DCH A;  3EC3 A;  4GLT A;  1THO A;  4IBP A;  1K0N A;  3W8J A;  1G0T A;  4XS6 A;  3VPT A;  2LJK A;  2PUK C;  1GTA A;  5B7C A;  2GZP A;  3TJF A;  1EOG A;  3VFI A;  1ERV A;  4DSR A;  3HVV A;  1Z5Y E;  3D21 A;  4IQA A;  1KEB A;  1THX A;  2C0E A;  2LS5 A;  4O32 A;  1OE7 A;  1FOV A;  4K7I A;  5DQY A;  3HXS A;  4OWY A;  3GNJ A;  4D73 B;  4MPF A;  5ELA A;  5HR0 A;  1Z6N A;  2V1M A;  3F6F A;  3LYP A;  1JZO A;  4RI6 A;  2C0F A;  1GNW A;  2VM2 A;  1X5C A;  3FEU A;  3KIJ A;  1F37 A;  5H5Q A;  4N0V A;  5G1K A;  2EIO A;  2R2J A;  4FYU A;  4BVY A;  9GSS A;  2L4C A;  3IR4 A;  2JAC A;  1UVZ A;  3RDW A;  1FG4 A;  3KTB A;  4X1U A;  2DC5 A;  2VAF A;  3F9U A;  1U88 A;  2ON7 A;  1TI1 A;  3ZRD A;  5GST A;  2IL3 A;  4NV2 A;  1T3B A;  1A2J A;  4PQ1 A;  2EC4 A;  1N8J A;  2ZCT A;  3BCI A;  1TU8 A;  1TK0 B;  2J9H A;  3L4N A;  2VLU A;  1XIY A;  4L0U A;  4HI7 A;  1FB6 A;  1K0O A;  2YWO A;  4E8H A;  4PUF C;  1PA3 A;  2TRC P;  4FO5 A;  5ECP B;  3TJG A;  2TRX A;  1H75 A;  3HVS A;  1XWG A;  2WZ9 A;  3C71 A;  1TXX A;  2LRN A;  4JE1 A;  2AHE A;  2HSH A;  5E4W A;  3QFB C;  4BL7 A;  8GSS A;  3FY7 A;  1USB A;  3RAZ A;  3MNG A;  5GZZ B;  5JCG A;  5D8I A;  4FIW A;  1KBN A;  2LV3 A;  2GQK A;  3BBY A;  4V2N A;  2V6K A;  3G7I A;  4K7O A;  1XZO A;  1BX9 A;  3GUS A;  3VWX A;  2I4A A;  4K2D A;  1T00 A;  2H71 A;  3FZ5 A;  2OAD A;  1M0U A;  1XOB A;  1LU4 A;  3DVX A;  3TKR A;  4EDZ A;  5F8B A;  3DKS A;  2PVO C;  2VL2 C;  3BCK A;  1V58 A;  1U87 A;  13GS A;  1O8W A;  1WMJ A;  4YQM A;  3F4T A;  1GTB A;  5IIZ A;  2B6M A;  3IA1 A;  5FT3 A;  1YEP A;  5ID2 A;  1XPV A;  3QAW A;  5A5K A;  2P5R A;  4PX1 A;  2XHF A;  2H0I A;  2PVQ A;  2JSY A;  2YOI A;  1PKZ A;  2QC7 A;  4TOP A;  4TR1 B;  2A2R A;  3TOU A;  4KND A;  5AIV A;  2C3Q A;  2B5X A;  2OJL A;  3D4M A;  3GUR A;  2LRC A;  5IQY A;  2X99 A;  3TRP A;  2F51 A;  4OMV A;  4CW9 A;  2H76 A;  4N30 A;  6GSX A;  1PMT A;  1SK0 A;  4BVX A;  3IC4 A;  5HFI A;  2XPD A;  1F6M C;  1U3I A;  14GS A;  5DVB A;  3QR6 A;  3CYN A;  4WR4 A;  5AIS A;  3VI7 A;  4V1A p;  5EPF A;  1V98 A;  2F3M A;  5CRH A;  2FD3 A;  2JL4 A;  1URM A;  1PL2 A;  3QMX A;  2X8G A;  2LJA A;  2DJ1 A;  4KGI A;  1A0R P;  4EXJ A;  2A2S A;  3CTF A;  2IMD A;  2RII A;  4HOJ A;  4POM A;  2C80 A;  2PN8 A;  1ILO A;  3TKP A;  3F3Q A;  2H74 A;  1QQ2 A;  3ZYW A;  1YKA A;  3HKR A;  2GSR A;  1WWJ A;  1A2L A;  2H6Y A;  1Z6M A;  3FR6 A;  1TP9 A;  4ZBB A;  2O89 A;  1AW9 A;  1JZW A;  2HXK A;  4KCE A;  4L8E A;  4ID0 A;  5IMC A;  5IM9 A;  2PWJ A;  3D6I A;  4F9Z A;  2FLS A;  1B9X C;  3LG6 A;  4WR5 A;  1O6J A;  10GS A;  2H1A A;  4G10 A;  1SJI A;  3KCM A;  3EUR A;  2AB6 A;  5C00 A;  2YN1 A;  4KA0 A;  3DVW A;  6GSS A;  1WP0 A;  1B4Q A;  4IGJ A;  3F8U A;  1JLV A;  1J08 A;  5CRD A;  1X0R A;  3QAV A;  1RQM A;  1ZYE A;  2A4V A;  4NHZ A;  4F03 A;  3TJJ A;  4LMW A;  4P3Y B;  1A8Y A;  1OKD A;  4KAE A;  3GSS A;  2CVK A;  3A2X A;  2KOK A;  5CRW A;  2DBC A;  3KTL A;  3UL3 A;  1NHO A;  2K18 A;  5D9V A;  4WXT A;  3ZLP A;  4IQ1 A;  4J57 E;  1T4Y A;  2AJQ B;  3ZMK A;  1XW9 A;  1SJZ A;  3EMX A;  4IHU A;  2WGR A;  3LJR A;  5CRE A;  3G7J A;  3IXR A;  2X64 A;  2LUS A;  4K1F A;  2DML A;  1BYE A;  1FB0 A;  2YPM A;  1X5D A;  2L5O A;  5G5E A;  3NOF A;  4K7N A;  5DAK A;  2VM1 A;  1Z7R A;  5G5F A;  4NHW A;  1WIK A;  1G7O A;  5JWO B;  4TR4 A;  2FWF A;  3W6G A;  3DML A;  2IMI A;  1K0D A;  4GSN A;  1JLW A;  2B3S A;  4K8M A;  4KSM A;  2H66 A;  3UEM A;  5A4W A;  1TJD A;  2IFQ B;  5F07 A;  2NPB A;  2B5E A;  3L9V A;  1SD8 A;  1TKD B;  4DEJ A;  1WJK A;  2PGT A;  1YF0 A;  4JR4 A;  4TVE A;  1HYU A;  1XBS A;  4ZBA A;  2LKU A;  3FK8 A;  5CAX A;  2GT5 A;  3M1G A;  18GS A;  4HJ2 A;  4TXO B;  2IN3 A;  4F82 A;  2YNX A;  3MAK A;  1VF3 A;  2FWG A;  2E7P A;  4WF5 A;  1FVK A;  2M46 A;  2VL3 A;  5ENU A;  2YAN A;  1EV4 A;  4KW6 A;  2V32 A;  2RLI A;  1QGV A;  4I97 A;  1B8X A;  4HDE A;  3GH6 A;  1ZZY A;  2WRT A;  2OKA A;  1YQ1 A;  1SL2 B;  2BTO T;  2O8V B;  2FUG 2;  4KE3 A;  2G2Q A;  3HJP A;  4AJ8 A;  3EE2 A;  2CA8 A;  1YF1 A;  1K0B A;  4L0W A;  3JCM L;  3ZFB A;  4N0Z A;  2WFC A;  1M99 A;  1YY7 A;  1X9S B;  3IRA A;  1XWK A;  2HZF A;  3L78 A;  5A4U A;  3TCO A;  2P5Q A;  1T7P B;  2MBS A;  4MJC A;  2XC2 A;  3SWL A;  1QK8 A;  1M9A A;  1IYH A;  5CNW A;  3ZIT A;  2R3X A;  1EOH A;  2F8A A;  3SBC A;  4QL9 A;  3KM6 A;  1TRS A;  2G0F A;  2QGV A;  1OC3 A;  4ECC A;  4TR1 A;  3FW2 A;  4PQH A;  1GTU A;  1DE1 A;  5D96 A;  2H6Z A;  2VL2 A;  3TDG A;  3HVX A;  3C8E A;  2IPA A;  3ZRE A;  2N5A A;  4JR6 A;  1QFN A;  1TOF A;  3GN3 A;  1M9B A;  1GSQ A;  1V57 A;  4KCA A;  3EYT A;  3D0Z A;  1LBK A;  2VOC A;  2R4V A;  1DSB A;  2GT6 A;  1HNC A;  1AUC A;  4PNF A;  5CYY A;  3KMO A;  2QSI A;  3F6D A;  5GSS A;  3RHC A;  2BJX A;  3CSJ A;  1DE2 A;  2YJH A;  4AJ7 A;  2C0G A;  5L71 A;  2B7J A;  3H8Q A;  1TRW A;  2H1B A;  3M8N A;  4TR0 A;  3GKN A;  4HJM A;  2CZ2 A;  1MDJ A;  4NXI A;  1KNG A;  3UAR A;  2O7K A;  3L9S A;  4AJ6 A;  5A4V A;  3DGQ A;  2VL9 A;  4XS4 A;  5F06 A;  2KP1 A;  1MTC A;  5J9C A;  1AXD A;  2GS3 A;  17GS A;  2IIY A;  4NAX A;  4MK3 A;  3J7Y b;  2O87 A;  1TTZ A;  1GUL A;  1LJR A;  5AGY A;  3F4R A;  4XCS A;  3HA9 A;  1SL1 B;  2KLX A;  3QAG A;  1SKW B;  1SKS B;  4FH8 A;  3BOA A;  1TW9 A;  5KN2 A;  4FYB A;  2HZE B;  5DBQ A;  3BJ5 A;  2HE3 A;  4IJ3 A;  3HD5 A;  1E6B A;  4KDY A;  4IP1 A;  2D2Z A;  4OD7 A;  3UJ1 A;  4YAV A;  3P2A A;  3QOU A;  2I1U A;  2EIQ A;  2FCH A;  4GSS A;  2H19 A;  4KB3 A;  4DSS A;  3GX8 A;  2H1G A;  3WT1 A;  4JU5 A;  1GP1 A;  3ME7 A;  3C7M A;  1SK1 A;  3PGT A;  1VF1 A;  5CRG A;  1GUM A;  1T8E B;  3AY8 A;  1K0C A;  1SJ6 A;  3UVT A;  3J7Y k;  2H75 A;  1QXH A;  4OCE A;  4ECJ A;  2P0G A;  3GTU B;  1VRS D;  3M3M A;  2L6D A;  2CVB A;  2OBK A;  2MYG A;  3H93 A;  2YP6 A;  3CTG A;  1BAY A;  3G9B A;  4FYC A;  2ALB A;  1OC9 A;  1SEN A;  1SU9 A;  4TW5 A;  3C1R A;  4O7H A;  1XWA A;  4GQF A;  4MZW A;  2IJY A;  2KP2 A;  2WDU A;  2LQO A;  1ERU A;  3D4T A;  1R5P A;  4POB A;  3KP8 A;  3GYK A;  3K8N A;  5IMF A;  3KH7 A;  5B6N A;  3PIN A;  2IWT A;  3I43 A;  5D73 A;  2E2G A;  4KH7 A;  1JHB A;  2XBI A;  16GS A;  3UMA A;  3ME8 A;  3IK9 A;  3KD0 A;  3LWA A;  2WCI A;  5ECS A;  4LL1 B;  4CHS A;  1GSU A;  2VLV A;  3G7Y A;  1FW1 A;  5JWR B;  1TK8 B;  2H0H A;  4I5Q A;  2I3Y A;  3E9J B;  4TR3 A;  4TN8 A;  1GUH A;  2P31 A;  1XOA A;  2YZH A;  1JFU A;  2VCT A;  4YQU A;  4ZL8 A;  3E3E A;  4JZQ A;  4OFT A;  3TKS C;  2LNT A;  3WGE A;  4BPY A;  2KUC A;  4CDO A;  3M9K A;  4ZB8 A;  2K9F A;  3N5O A;  2LJR A;  3RPN A;  2GDR A;  1JZD A;  2XPE A;  3F0I A;  1F3B A;  3ZIV A;  3ZML A;  3UIW A;  5ECM B;  1CQH A;  4HUA A;  1TU7 A;  1SK2 A;  4ML6 A;  4K6X A;  3ED3 A;  6GSW A;  3HDC A;  1M2D A;  1SYR A;  3KMN A;  4IJI A;  1YEX A;  5E59 A;  4V2L A;  3QD9 A;  3WGD A;  2VIM A;  3M0F A;  3RHB A;  5HR2 A;  4ECB A;  3ZVJ D;  4WET A;  5G30 A;  1I5G A;  3DRN A;  5G2Z A;  1KTE A;  2MMO A;  4MJB A;  3VPQ A;  4GRF A;  1X5E A;  3UAP A;  3R2Q A;  5CP1 A;  2X8C A;  5IPH A;  2HT9 A;  4EE0 A;  1MD3 A;  3GKX A;  5HQP A;  1HNA A;  1M2A A;  2LTK A;  4TRX A;  1BJX A;  2H72 A;  1UC7 A;  3ERW A;  2ES7 A;  4MJE A;  2HFD A;  5DAL A;  4J2F A;  1EP8 A;  1PKW A;  5ECO B;  3Q19 A;  3I6A A;  4GTU A;  2N5F A;  4KSO A;  5GAP D;  3DEX A;  2OE0 A;  1EV9 A;  4MF7 A;  1HQO A;  5GAN D;  1XVW A;  2OAC A;  4QQ7 A;  1RK4 A;  2H70 A;  5J3R A;  1GSE A;  5ABR A;  1K3Y A;  1SYX A;  4D73 A;  3C73 A;  3FHK A;  1A24 A;  4JED A;  2I81 A;  4WBJ A;  1ZMA A;  3ERF A;  3PH9 A;  1Q98 A;  3H79 A;  5D93 A;  2L59 A;  4G9H A;  2DJ3 A;  3HJM A;  5EVO A;  4O5R A;  2DLX A;  2JZT A;  1PX7 A;  3ZL5 A;  4TXV A;  4XHM A;  1U3A A;  4Q5F A;  4ZIL A;  4G19 A;  4BA7 A;  4YQV A;  4Q5N A;  3TOT A;  1N2A A;  2H6X A;  1ZOF A;  2H01 A;  1NW2 A;  1T1V A;  1YKC A;  2HRF A;  3EVI A;  2B1K A;  6GSU A;  1EEM A;  4Q5Q A;  5ID2 B;  1GLQ A;  5KN3 A;  4MPG A;  2NBS A;  1ERT A;  1T4Z A;  1F3A A;  4ZL7 A;  3CBU A;  4RUV A;  4JRR A;  1XFL A;  5CO3 A;  2CX4 A;  5ECI B;  2L6C A;  2K8V A;  2HNL A;  4MF6 A;  5HR3 A;  3IAM 2;  2V6O A;  1Z7P A;  2YJ7 A;  3GMF A;  2GZY A;  2JSZ A;  3HJO A;  1QMV A;  5D9W A;  3LQ7 A;  5J5N A;  3GST A;  2LQQ A;  4K9Z A;  2WUL A;  4MCU A;  4N10 A;  4MAB A;  2H30 A;  1EZK A;  5F05 A;  3HHV A;  2CZ3 A;  4OFM A;  2XBQ A;  5B8A A;  1R5A A;  3O76 A;  4WBR D;  2OBI A;  3Q6O A;  2NTO A;  4J56 E;  2R6K A;  3L0H A;  2DSA A;  2H73 A;  20GS A;  2AV4 A;  4G2E A;  1PSQ A;  4MA9 A;  2MMN A;  2VCZ A;  1B4P A;  1ZGN A;  2GZZ A;  2OE1 A;  4IKH A;  5D9X A;  1VF2 A;  4XRA A;  12GS A;  2HI7 A;  4WKW A;  1K3L A;  4XTS A;  3DD3 A;  4LMV A;  3GRX A;  3ZIJ A;  2E2M A;  1EGO A;  2V2G A;  5J4U A;  1S3C A;  2C1Y A;  1AQV A;  2B1L A;  5DQS A;  3FR3 A;  2QKE A;  4BWQ A;  1OE8 A;  5IMD A;  3LFL A;  2RUE A;  4ZIJ A;  1GSS A;  5C04 A;  1MDK A;  4OO5 A;  6GST A;  1XW5 A;  2F8F A;  1O73 A;  4OO4 A;  5IO0 A;  1OVN A;  4HZ2 A;  2VUP A;  3UOM A;  5IOW A;  5IMV A;  3Q74 A;  2DJJ A;  3UBK A;  4AGS A;  3LSZ A;  3TKS E;  2NDO A;  2PPT A;  3IK7 A;  2IMK A;  2PU9 C;  5HR1 A;  4I2T A;  5JCU A;  1BG5 A;  3GKK A;  1GSY A;  5G31 A;  2K6V A;  4MLY A;  4MH3 A;  5J41 A;  2EIR A;  2VO4 A;  5ECN B;  4GCI A;  5ECL B;  1BQ7 A;  2L5L A;  1A0F A;  1SD9 A;  2VLT A;  2YZU A;  1MD4 A;  3E0U A;  4IVF A;  1XXU A;  2YWM A;  2ZUP A;  1AIU A;  3EIN A;  3RBT A;  2DJ2 A;  3TKS A;  3CRU A;  3FZA A;  2YV7 A;  3EWL A;  3GA4 A;  3KEB A;  1U6T A;  5LCZ A;  4L5O A;  3FR9 A;  2MMA A;  3A5W A;  1B9Y C;  4MZC A;  1W4V A;  2GSQ A;  2AUV A;  3GL5 A;  4MJA A;  4LA1 A;  1DUG A;  5DAK B;  2CX3 A;  2PER A;  4V1A g;  4IW9 A;  4F0C A;  3HCZ A;  3ISO A;  1AC1 A;  3P7X A;  1PL1 A;  1W89 A;  2J23 A;  2VCW A;  1YJ6 A;  1EP7 A;  4I2U A;  4NWY A;  2CV4 A;  1J9B A;  4EUY A;  2FWE A;  11GS A;  4NV5 A;  2WB9 A;  3M9J A;  1AQW A;  4GXZ A;  4DVC A;  3VUR A;  1GL8 A;  2AAW A;  2E0Q A;  3VWU A;  3H4K A;  1Z3E A;  1TRV A;  4HQS A;  4F0B A;  4NPB A;  1VF4 A;  4KUN A;  4HS1 A;  4JBB A;  2FGX A;  3ZVJ A;  4I6X A;  4ZB9 A;  3GHA A;  2JU5 A;  2V41 A;  5DCG A;  2RM6 A;  2VCV A;  4MMM A;  2HRN A;  3F4S A;  1RW1 A;  1O7U A;  2OA7 A;  5DJM A;  5EL8 A;  4PNG A;  1R26 A;  5H5S A;  1GNE A;  3DIE A;  4AF2 A;  3TB2 A;  4L5L A;  2GLR A;  2FHE A;  4ILF A;  4K0G A;  1TRU A;  3APQ A;  4GQC A;  2GQM A;  4POK A;  5IOX A;  3LXT A;  3Q18 A;  1HD2 A;  3VWV A;  4EF0 A;  3CXG A;  4EC0 A;  2YV9 A;  1HNB A;  4HQZ A;  1F9M A;  3MWH A;  5ECR B;  5J9B A;  3GX0 A;  3D22 A;  3U5R E;  1GLP A;  4EL1 A;  4KX4 A;  3RPP A;  1OYJ A;  4RI7 A;  3ZTL A;  3LGC A;  6GSV A;  1WPI A;  2CVD A;  2TIR A;  4ISD A;  2K8S A;  1ZL9 A;  3IHQ A;  2REM A;  1CQG A;  2H0G A;  1X9M B;  22GS A;  3VWW A;  2IFQ A;  1NSW A;  4XIH A;  1SKR B;  1PN9 A;  3APS A;  2VCQ A;  3ZZX A;  4EVM A;  4GST A;  5LD0 A;  1GRX A;  4K0N A;  2CAI A;  3UBL A;  4ZL9 A;  5ECK B;  3O3T A;  2PMT A;  1PRX A;  1XW6 A;  3CMI A;  5KN1 A;  4OCF A;  2LEG A;  5B8B A;  3NIV A;  2CT6 A;  3APO A;  4XS1 A;  5DJL A;  4XRD A;  3CSH A;  4EKZ A;  1ACV A;  2BMX A;  1S3D A;  2RM5 A;  2M80 A;  3QCP A;  3HZ8 A;  4TXO A;  1Y6E A;  4GWR A;  2CAQ A;  3MDK A;  5ECQ B;  3LYK A;  4KDX A; 
#chains in the Genus database with same CATH topology
 2L57 A;  4YKG A;  1GSF A;  1V9W A;  3DWV A;  4MZB A;  2H1D A;  2Z9S A;  4HSC X;  3HZ4 A;  4X43 A;  4Z7X A;  1TDI A;  4PGT A;  4EDY A;  1QUW A;  3IPZ A;  4ACS A;  2CQ9 A;  2DKH A;  2FA8 A;  4O92 A;  4H86 A;  1OAZ A;  4IN0 A;  3CSI A;  2RUF A;  1K0A A;  2X4A A;  1MEK A;  1R4W A;  4MF5 A;  1M2B A;  1EWX A;  2AYT A;  3P90 A;  4HU9 A;  4N11 A;  2YWN A;  1SL0 B;  4PTS A;  5IO2 A;  1IYI A;  1B48 A;  3HY2 A;  2R37 A;  3FKF A;  3IAS 2;  1PQN A;  2DIZ A;  1R7H A;  5F0G A;  3DXB A;  1ZCP A;  2PBJ A;  1K0M A;  3A2V A;  4BIK A;  4XS4 B;  1PD2 1;  5IMZ A;  3VLN A;  3MYD A;  1PX6 A;  3TRX A;  3GFK A;  3WT2 A;  3KZQ A;  2X49 A;  3WGX A;  2IMF A;  1ZYQ B;  2YCD A;  4NMU A;  4GF0 A;  5B6M A;  1Y25 A;  5AIX A;  2GSS A;  5HFG A;  1GSD A;  2DJ0 A;  4MDC A;  4ULX A;  3UVH A;  4LL4 B;  4CY8 A;  2HLS A;  4PUA A;  3A2W A;  1H4O A;  3IHG A;  2DJK A;  4PQI A;  4ZBD A;  2C3T A;  4E8E A;  1Q4J A;  3A3T A;  3GL3 A;  6GSY A;  5INY A;  4IS0 A;  1Z9H A;  2L4Q A;  1ST9 A;  2LNS A;  3FRC A;  3L9U A;  4HU7 A;  1V2A A;  3IBH A;  4ZXG A;  2F9S A;  3PR8 A;  3IE3 A;  2GST A;  4LLR A;  2HYX A;  2ZNM A;  4DSS B;  1WE0 A;  4RQR A;  2FY6 A;  4CY6 A;  1TI3 A;  3ZFL A;  1XCC A;  2O85 A;  3KP9 A;  1FVJ A;  2JZS A;  1K3O A;  3EMP A;  4IEL A;  2C8U A;  5HFK A;  19GS A;  3QDN A;  3TKQ A;  1VGL A;  3P8W A;  1FAA A;  3N9J A;  3KJY A;  3W8S A;  1XG8 A;  1YZX A;  3F63 A;  1AAZ A;  5KEJ A;  3I9V 2;  4YKF A;  2B5Y A;  4OFN A;  2MZC A;  3GV1 A;  1G7E A;  1ERW A;  1OC9 B;  2HSY A;  3QFA C;  1O81 A;  4WF4 A;  5ELG A;  3VI5 A;  3MSZ A;  1PGT A;  2KHP A;  4POL A;  5COH A;  1J0F A;  3F3R A;  3WYW A;  2OE3 A;  1AQX A;  3V1W A;  1TK5 B;  3LXZ A;  2HZE A;  5H5R A;  3KXO A;  2DIY A;  3HVN A;  4KDU A;  3FZ4 A;  3GIX A;  7GSS A;  1ABA A;  1I9D A;  5JWQ B;  1DBY A;  2LRT A;  3EU3 A;  1UA5 A;  1JZR A;  2GQL A;  2R0C A;  4TKY A;  4YH2 A;  4YAP A;  2X8H A;  3IV4 A;  3LOR A;  1NM3 A;  2JAD A;  1A2M A;  1OKT A;  4BWS A;  3TGZ A;  2C3N A;  2M72 A;  1A8L A;  4IP6 A;  5ECH B;  2FWH A;  3KH9 A;  2C0D A;  4MP4 A;  1ON4 A;  4Q5R A;  3EU4 A;  3VK9 A;  1GTI A;  3S9F A;  3GTU A;  3LEF A;  3GH9 A;  1FHE A;  1V40 A;  1UN2 A;  1A23 A;  2R5G A;  3BD2 A;  4MH2 A;  2WS2 A;  3I69 A;  2I9H A;  1C72 A;  2LST A;  4QL7 A;  3CRT A;  4WEY A;  2FA4 A;  1O85 A;  4ML1 A;  4USS A;  3HYP A;  1O8X A;  3TUE A;  4ECI A;  3IDV A;  3US3 A;  1GH2 A;  3C1S A;  5BRT A;  1X9W B;  2ON5 A;  4HEA 2;  5D9T A;  3OR5 A;  2IME A;  3FYG A;  2H8L A;  1GWC A;  2WJU A;  2YWI A;  3GKM A;  3O6T A;  4ZB6 A;  1EGR A;  4V2M A;  2MBT A;  4I8B A;  4PUR A;  2FNO A;  1S3A A;  4HZ4 A;  2MMZ A;  5FHI A;  3IOS A;  2N5B A;  4O5U A;  4PXO A;  1WOU A;  5IMA A;  5AN1 A;  1OC8 A;  5EY6 A;  1NHY A;  2NVL A;  2GVP A;  4EO3 A;  3H1N A;  1WRY A;  1YDK A;  1PFO A;  3KGK A;  3A5I A;  5KN0 A;  1FO5 A;  1EEJ A;  1XVQ A;  4RQX A;  1G6Y A;  1MDI A;  3NZN A;  4X0X A;  1E2Y A;  3D5J A;  1GUK A;  3TRQ A;  3ERG A;  1F2E A;  1XWC A;  5JCW A;  5FWG A;  3WD6 A;  2JZR A;  1M7T A;  1XWB A;  2VD1 A;  3TJB A;  3TJK A;  5LNK e;  2VD0 A;  5G1L A;  2VCX A;  5DDL A;  1ML6 A;  3DYR A;  5IPG A;  1G6W A;  1BED A;  4F2I A;  3U6V A;  3QPM A;  2GTU A;  2DMM A;  3FZ9 A;  2GGT A;  2B7K A;  5DAL B;  4DSQ A;  2C4J A;  3EC3 A;  5DCH A;  4GLT A;  1THO A;  4IBP A;  1K0N A;  3W8J A;  3CQF A;  1ZYP A;  1G0T A;  4XS6 A;  3VPT A;  2LJK A;  2PUK C;  1GTA A;  5B7C A;  2GZP A;  3TJF A;  1EOG A;  3VFI A;  1ERV A;  4DSR A;  3HVV A;  1Z5Y E;  3D21 A;  4IQA A;  1KEB A;  1THX A;  2C0E A;  2LS5 A;  4O32 A;  1OE7 A;  1FOV A;  4K7I A;  3HXS A;  5DQY A;  4OWY A;  3GNJ A;  4D73 B;  4MPF A;  5ELA A;  5HR0 A;  1Z6N A;  2V1M A;  3F6F A;  3LYP A;  1JZO A;  4RI6 A;  2C0F A;  1GNW A;  2VM2 A;  1X5C A;  3FEU A;  3KIJ A;  1F37 A;  5H5Q A;  4N0V A;  5G1K A;  2EIO A;  2R2J A;  4FYU A;  4BVY A;  9GSS A;  2L4C A;  3IR4 A;  2JAC A;  1UVZ A;  3RDW A;  1FG4 A;  3KTB A;  4X1U A;  2DC5 A;  2VAF A;  3F9U A;  1U88 A;  2ON7 A;  1TI1 A;  3ZRD A;  5GST A;  2IL3 A;  4NV2 A;  1T3B A;  1A2J A;  4PQ1 A;  2EC4 A;  1N8J A;  2ZCT A;  3BCI A;  1TU8 A;  1TK0 B;  2J9H A;  3L4N A;  2VLU A;  1XIY A;  4L0U A;  4HI7 A;  1FB6 A;  1K0O A;  2YWO A;  4E8H A;  4PUF C;  1PA3 A;  2TRC P;  4FO5 A;  5ECP B;  3TJG A;  2TRX A;  1H75 A;  3HVS A;  1XWG A;  2WZ9 A;  3C71 A;  1TXX A;  2LRN A;  4JE1 A;  2AHE A;  2HSH A;  5E4W A;  3QFB C;  4BL7 A;  8GSS A;  3FY7 A;  1USB A;  3RAZ A;  3MNG A;  5GZZ B;  5JCG A;  5D8I A;  4FIW A;  1KBN A;  2LV3 A;  2GQK A;  3BBY A;  4V2N A;  2V6K A;  3G7I A;  4K7O A;  1XZO A;  1BX9 A;  3GUS A;  3VWX A;  2I4A A;  4K2D A;  1T00 A;  2H71 A;  3FZ5 A;  2OAD A;  1M0U A;  1XOB A;  1LU4 A;  3DVX A;  3TKR A;  4EDZ A;  5F8B A;  3DKS A;  2PVO C;  2VL2 C;  3BCK A;  1V58 A;  1U87 A;  13GS A;  1O8W A;  1WMJ A;  4YQM A;  3F4T A;  1GTB A;  5IIZ A;  2B6M A;  3IA1 A;  5FT3 A;  1YEP A;  5ID2 A;  1XPV A;  3QAW A;  5A5K A;  4K5S A;  2P5R A;  4PX1 A;  2XHF A;  2H0I A;  2PVQ A;  2JSY A;  2YOI A;  1PKZ A;  2QC7 A;  4TOP A;  3PPU A;  4TR1 B;  2A2R A;  3TOU A;  4KND A;  2UZ8 A;  5AIV A;  2C3Q A;  2B5X A;  2OJL A;  3D4M A;  3GUR A;  2LRC A;  5IQY A;  2X99 A;  3TRP A;  2F51 A;  4OMV A;  4CW9 A;  2H76 A;  4N30 A;  6GSX A;  1PMT A;  1SK0 A;  4BVX A;  3IC4 A;  5HFI A;  2XPD A;  1F6M C;  1U3I A;  2A2P A;  14GS A;  5DVB A;  3QR6 A;  3CYN A;  4WR4 A;  5AIS A;  3VI7 A;  4V1A p;  5EPF A;  1V98 A;  2F3M A;  5CRH A;  2FD3 A;  2JL4 A;  1URM A;  1PL2 A;  3QMX A;  2X8G A;  2LJA A;  2DJ1 A;  4G0K A;  4KGI A;  1A0R P;  4EXJ A;  2A2S A;  3CTF A;  2IMD A;  2RII A;  4HOJ A;  4POM A;  2C80 A;  2PN8 A;  1ILO A;  3TKP A;  3F3Q A;  2H74 A;  1QQ2 A;  3ZYW A;  1YKA A;  3HKR A;  2GSR A;  1WWJ A;  1A2L A;  2H6Y A;  1Z6M A;  3FR6 A;  1TP9 A;  4ZBB A;  2O89 A;  1AW9 A;  1JZW A;  2HXK A;  4KCE A;  4L8E A;  4ID0 A;  5IMC A;  5IM9 A;  2PWJ A;  3D6I A;  4F9Z A;  2FLS A;  1B9X C;  3LG6 A;  4WR5 A;  1O6J A;  10GS A;  2H1A A;  4G10 A;  1SJI A;  3KCM A;  3EUR A;  2AB6 A;  5C00 A;  2YN1 A;  4KA0 A;  3DVW A;  6GSS A;  3EPT A;  2HRA A;  1WP0 A;  1B4Q A;  4IGJ A;  3F8U A;  1JLV A;  1J08 A;  5CRD A;  1X0R A;  3QAV A;  1RQM A;  1ZYE A;  4EIQ A;  4A5P A;  2A4V A;  4NHZ A;  4F03 A;  3TJJ A;  4LMW A;  4P3Y B;  1A8Y A;  1OKD A;  4KAE A;  3GSS A;  2CVK A;  3A2X A;  2KOK A;  5CRW A;  2DBC A;  3KTL A;  3UL3 A;  1NHO A;  2HRK A;  2K18 A;  5D9V A;  4WXT A;  3ZLP A;  4IQ1 A;  4J57 E;  1T4Y A;  2AJQ B;  3ZMK A;  1XW9 A;  1SJZ A;  3EMX A;  4IHU A;  2WGR A;  3IC8 A;  3LJR A;  5CRE A;  3G7J A;  3IXR A;  2X64 A;  2LUS A;  4K1F A;  2DML A;  1BYE A;  1FB0 A;  2YPM A;  1X5D A;  2L5O A;  5G5E A;  3NOF A;  4K7N A;  5DAK A;  2VM1 A;  1Z7R A;  5G5F A;  4NHW A;  1WIK A;  1G7O A;  5JWO B;  4TR4 A;  2FWF A;  3W6G A;  3DML A;  2IMI A;  1K0D A;  4GSN A;  1JLW A;  2B3S A;  4K8M A;  4KSM A;  2H66 A;  3UEM A;  5A4W A;  1TJD A;  2IFQ B;  5F07 A;  2NPB A;  2B5E A;  3L9V A;  1SD8 A;  4KF9 A;  1TKD B;  4DEJ A;  1WJK A;  2PGT A;  1YF0 A;  4JR4 A;  4TVE A;  1HYU A;  1XBS A;  4ZBA A;  2LKU A;  3FK8 A;  5CAX A;  2GT5 A;  3M1G A;  18GS A;  4HJ2 A;  4TXO B;  2IN3 A;  4F82 A;  2YNX A;  3MAK A;  1VF3 A;  2FWG A;  2E7P A;  4WF5 A;  1FVK A;  2M46 A;  2VL3 A;  5ENU A;  2YAN A;  1EV4 A;  4KW6 A;  2V32 A;  2RLI A;  1QGV A;  4I97 A;  1B8X A;  4HDE A;  3GH6 A;  1ZZY A;  2WRT A;  2OKA A;  1YQ1 A;  1SL2 B;  2BTO T;  2O8V B;  2FUG 2;  4KE3 A;  2G2Q A;  3HJP A;  4AJ8 A;  3EE2 A;  2CA8 A;  4Z2T A;  1YF1 A;  1K0B A;  4L0W A;  3JCM L;  3ZFB A;  4N0Z A;  2WFC A;  1M99 A;  1YY7 A;  1X9S B;  3IRA A;  1XWK A;  2HZF A;  3L78 A;  5A4U A;  3TCO A;  2P5Q A;  1T7P B;  2MBS A;  4MJC A;  2XC2 A;  3SWL A;  1QK8 A;  1M9A A;  1IYH A;  5CNW A;  3ZIT A;  2R3X A;  1EOH A;  2F8A A;  3SBC A;  4QL9 A;  3KM6 A;  1TRS A;  1M3J A;  2G0F A;  2QGV A;  1OC3 A;  4ECC A;  4TR1 A;  3FW2 A;  4PQH A;  1GTU A;  1DE1 A;  5D96 A;  2H6Z A;  2VL2 A;  3TDG A;  3HVX A;  3C8E A;  2IPA A;  3ZRE A;  2N5A A;  4JR6 A;  1QFN A;  1TOF A;  3GN3 A;  1M9B A;  1GSQ A;  1V57 A;  4KCA A;  3EYT A;  3D0Z A;  1LBK A;  2VOC A;  2A4H A;  2R4V A;  1DSB A;  2GT6 A;  1HNC A;  1AUC A;  4PNF A;  5CYY A;  3KMO A;  2QSI A;  3F6D A;  5GSS A;  2DKI A;  3RHC A;  2BJX A;  3CSJ A;  1DE2 A;  2YJH A;  4AJ7 A;  2C0G A;  5L71 A;  2B7J A;  3H8Q A;  1TRW A;  2H1B A;  1FOH A;  3M8N A;  4TR0 A;  3GKN A;  4HJM A;  2CZ2 A;  1MDJ A;  5KOW A;  4NXI A;  1KNG A;  3UAR A;  2O7K A;  3L9S A;  4AJ6 A;  5A4V A;  3DGQ A;  2VL9 A;  4XS4 A;  5F06 A;  2KP1 A;  1MTC A;  5J9C A;  1AXD A;  2GS3 A;  17GS A;  2IIY A;  4NAX A;  4MK3 A;  3J7Y b;  2O87 A;  1TTZ A;  4EIP A;  1GUL A;  1LJR A;  5AGY A;  3F4R A;  4XCS A;  3HA9 A;  1SL1 B;  2KLX A;  3QAG A;  1SKW B;  1SKS B;  4FH8 A;  3BOA A;  1TW9 A;  5KN2 A;  2QA1 A;  4FYB A;  2HZE B;  5DBQ A;  3BJ5 A;  2HE3 A;  4IJ3 A;  3HD5 A;  1E6B A;  4KDY A;  4IP1 A;  2D2Z A;  4OD7 A;  3UJ1 A;  4YAV A;  3P2A A;  3QOU A;  2I1U A;  2EIQ A;  2FCH A;  4GSS A;  2H19 A;  4KB3 A;  4DSS A;  3GX8 A;  2H1G A;  3WT1 A;  4JU5 A;  2R0P A;  1GP1 A;  3ME7 A;  3C7M A;  1SK1 A;  3PGT A;  1VF1 A;  4MNN A;  1M3I A;  5CRG A;  1GUM A;  1T8E B;  3AY8 A;  1K0C A;  1SJ6 A;  3UVT A;  3J7Y k;  2H75 A;  1QXH A;  4OCE A;  4ECJ A;  2P0G A;  3GTU B;  1VRS D;  3M3M A;  2L6D A;  2CVB A;  2OBK A;  2MYG A;  3H93 A;  2YP6 A;  3CTG A;  1BAY A;  3G9B A;  4FYC A;  2ALB A;  1OC9 A;  1SEN A;  1SU9 A;  4TW5 A;  3C1R A;  4O7H A;  1XWA A;  4GQF A;  4MZW A;  2IJY A;  2KP2 A;  2WDU A;  2LQO A;  1ERU A;  3D4T A;  1R5P A;  4POB A;  3KP8 A;  3GYK A;  3K8N A;  5IMF A;  3KH7 A;  5B6N A;  3PIN A;  2IWT A;  3I43 A;  5D73 A;  2E2G A;  4KH7 A;  1JHB A;  2XBI A;  16GS A;  3UMA A;  3ME8 A;  3IK9 A;  3KD0 A;  3LWA A;  2WCI A;  5ECS A;  4LL1 B;  4CHS A;  1GSU A;  2VLV A;  3G7Y A;  1FW1 A;  5JWR B;  1TK8 B;  2H0H A;  4I5Q A;  2I3Y A;  3E9J B;  4TR3 A;  4TN8 A;  1GUH A;  2P31 A;  1XOA A;  2YZH A;  1JFU A;  2VCT A;  4YQU A;  4ZL8 A;  3E3E A;  4JZQ A;  4OFT A;  3TKS C;  2LNT A;  3WGE A;  4BPY A;  2KUC A;  4CDO A;  3M9K A;  4ZB8 A;  2K9F A;  3N5O A;  2LJR A;  3RPN A;  2GDR A;  1JZD A;  2XPE A;  3F0I A;  1F3B A;  3ZIV A;  3ZML A;  3UIW A;  5ECM B;  1CQH A;  4HUA A;  1TU7 A;  1SK2 A;  4ML6 A;  4K6X A;  3ED3 A;  6GSW A;  3HDC A;  1M2D A;  1SYR A;  3KMN A;  4IJI A;  1YEX A;  5E59 A;  4V2L A;  3QD9 A;  3WGD A;  2VIM A;  3M0F A;  3RHB A;  5HR2 A;  1ZYN A;  4ECB A;  3ZVJ D;  4WET A;  5G30 A;  1I5G A;  3DRN A;  5G2Z A;  1KTE A;  2MMO A;  4MJB A;  3VPQ A;  4GRF A;  3FMW A;  1X5E A;  3UAP A;  4K5R A;  3R2Q A;  5CP1 A;  4BVY B;  2X8C A;  3MIX A;  4O5Q A;  5IPH A;  2HT9 A;  4EE0 A;  1MD3 A;  1S3R A;  3GKX A;  5HQP A;  1HNA A;  1M2A A;  2LTK A;  4TRX A;  1BJX A;  2H72 A;  1UC7 A;  3ERW A;  2ES7 A;  4MJE A;  2HFD A;  5DAL A;  4J2F A;  1EP8 A;  1PKW A;  5ECO B;  3Q19 A;  3I6A A;  5BMU A;  4GTU A;  2N5F A;  4KSO A;  5GAP D;  3DEX A;  2OE0 A;  1EV9 A;  4MF7 A;  1HQO A;  5GAN D;  1XVW A;  2OAC A;  4QQ7 A;  2R0G A;  4G0L A;  1RK4 A;  2H70 A;  5J3R A;  1GSE A;  4BL7 B;  5ABR A;  1K3Y A;  1SYX A;  4D73 A;  3C73 A;  3FHK A;  1A24 A;  4JED A;  2I81 A;  4WBJ A;  1ZMA A;  3ERF A;  3PH9 A;  1Q98 A;  3H79 A;  5D93 A;  2L59 A;  4G9H A;  2DJ3 A;  3HJM A;  5EVO A;  4O5R A;  2DLX A;  2JZT A;  1PX7 A;  3ZL5 A;  4TXV A;  4XHM A;  1U3A A;  4Q5F A;  4ZIL A;  4G19 A;  4BA7 A;  4YQV A;  4Q5N A;  3TOT A;  1N2A A;  2H6X A;  1ZOF A;  2H01 A;  1NW2 A;  4K2X A;  1T1V A;  1YKC A;  2HRF A;  3EVI A;  2B1K A;  4FQU A;  6GSU A;  1EEM A;  4Q5Q A;  5ID2 B;  1GLQ A;  5KN3 A;  4MPG A;  2NBS A;  1ERT A;  1T4Z A;  1F3A A;  4ZL7 A;  3CBU A;  4RUV A;  4JRR A;  1XFL A;  5CO3 A;  2CX4 A;  5ECI B;  2L6C A;  2K8V A;  2HNL A;  4MF6 A;  5HR3 A;  3IAM 2;  2V6O A;  1Z7P A;  2YJ7 A;  3GMF A;  2GZY A;  2JSZ A;  3HJO A;  1QMV A;  5D9W A;  3LQ7 A;  5J5N A;  4BVX B;  3GST A;  2LQQ A;  3LW9 A;  4K9Z A;  2WUL A;  4MCU A;  4N10 A;  4MAB A;  2H30 A;  1EZK A;  5F05 A;  3HHV A;  2CZ3 A;  4OFM A;  2XBQ A;  5B8A A;  1R5A A;  3O76 A;  4WBR D;  2OBI A;  3Q6O A;  2NTO A;  4J56 E;  2R6K A;  3L0H A;  2DSA A;  2H73 A;  20GS A;  2AV4 A;  4G2E A;  1PSQ A;  4G0I A;  4MA9 A;  2MMN A;  2VCZ A;  1B4P A;  1ZGN A;  2GZZ A;  2OE1 A;  4IKH A;  5D9X A;  1VF2 A;  4XRA A;  12GS A;  2HI7 A;  4WKW A;  1K3L A;  4XTS A;  3DD3 A;  4LMV A;  3GRX A;  3ZIJ A;  2E2M A;  1EGO A;  2V2G A;  5J4U A;  1S3C A;  5KOX A;  2C1Y A;  1AQV A;  2B1L A;  4Z2R A;  5DQS A;  3FR3 A;  2QKE A;  4BWQ A;  1OE8 A;  5IMD A;  3LFL A;  2RUE A;  4ZIJ A;  1GSS A;  5C04 A;  1MDK A;  4OO5 A;  6GST A;  1XW5 A;  2F8F A;  1O73 A;  4OO4 A;  1PN0 A;  5IO0 A;  1OVN A;  4HZ2 A;  2VUP A;  3UOM A;  5IOW A;  5IMV A;  3Q74 A;  2DJJ A;  3UBK A;  4AGS A;  3LSZ A;  3TKS E;  2NDO A;  2PPT A;  3IK7 A;  2IMK A;  2PU9 C;  5HR1 A;  4I2T A;  5JCU A;  1BG5 A;  3GKK A;  1GSY A;  5G31 A;  2K6V A;  4MLY A;  4MH3 A;  5J41 A;  2EIR A;  2VO4 A;  5ECN B;  4GCI A;  5ECL B;  1BQ7 A;  2L5L A;  1A0F A;  1SD9 A;  2VLT A;  2YZU A;  1MD4 A;  3E0U A;  4IVF A;  1XXU A;  2YWM A;  2ZUP A;  1AIU A;  3EIN A;  3RBT A;  2DJ2 A;  3TKS A;  3CRU A;  3FZA A;  2YV7 A;  3EWL A;  3GA4 A;  3KEB A;  1U6T A;  5LCZ A;  4L5O A;  3FR9 A;  2MMA A;  3A5W A;  1B9Y C;  4MZC A;  1W4V A;  2GSQ A;  2AUV A;  3GL5 A;  4MJA A;  4LA1 A;  1DUG A;  5DAK B;  2CX3 A;  2PER A;  4V1A g;  2HSM A;  4IW9 A;  4F0C A;  3HCZ A;  3ISO A;  1AC1 A;  3P7X A;  1PL1 A;  1W89 A;  4Z2U A;  2J23 A;  2VCW A;  1YJ6 A;  1EP7 A;  4I2U A;  4NWY A;  2CV4 A;  1J9B A;  4EUY A;  2FWE A;  11GS A;  4NV5 A;  2WB9 A;  3M9J A;  1AQW A;  4GXZ A;  4DVC A;  3VUR A;  1GL8 A;  2AAW A;  2E0Q A;  3VWU A;  4ICY A;  3H4K A;  1Z3E A;  1TRV A;  4HQS A;  4F0B A;  4NPB A;  1VF4 A;  4KUN A;  4HS1 A;  4JBB A;  2FGX A;  3ZVJ A;  4I6X A;  4ZB9 A;  3GHA A;  2JU5 A;  2V41 A;  5DCG A;  2RM6 A;  2VCV A;  3R3E A;  4MMM A;  2HRN A;  3F4S A;  1RW1 A;  1O7U A;  2OA7 A;  5DJM A;  5EL8 A;  4PNG A;  1R26 A;  5H5S A;  1GNE A;  3DIE A;  4AF2 A;  3TB2 A;  4L5L A;  2GLR A;  2FHE A;  4ILF A;  4K0G A;  1TRU A;  3APQ A;  4GQC A;  2GQM A;  4POK A;  5IOX A;  3LXT A;  3Q18 A;  1HD2 A;  3VWV A;  2QA2 A;  4EF0 A;  3CXG A;  4EC0 A;  2YV9 A;  1HNB A;  4HQZ A;  1F9M A;  3MWH A;  5ECR B;  5J9B A;  3GX0 A;  3D22 A;  3U5R E;  1GLP A;  4EL1 A;  4KX4 A;  3RPP A;  1OYJ A;  4RI7 A;  3ZTL A;  3LGC A;  6GSV A;  1WPI A;  2CVD A;  2TIR A;  4ISD A;  2K8S A;  1ZL9 A;  3IHQ A;  2REM A;  1CQG A;  2H0G A;  1X9M B;  22GS A;  3VWW A;  2IFQ A;  1NSW A;  4XIH A;  1SKR B;  1PN9 A;  3APS A;  2VCQ A;  3ZZX A;  4EVM A;  4GST A;  5LD0 A;  1GRX A;  4K0N A;  2CAI A;  3UBL A;  4ZL9 A;  5ECK B;  3O3T A;  2PMT A;  1PRX A;  1XW6 A;  3CMI A;  5KN1 A;  4OCF A;  2LEG A;  5B8B A;  3NIV A;  2CT6 A;  3APO A;  4XS1 A;  5DJL A;  4XRD A;  3CSH A;  4EKZ A;  1ACV A;  2BMX A;  1S3D A;  2RM5 A;  2M80 A;  3QCP A;  3HZ8 A;  4TXO A;  1Y6E A;  4GWR A;  4X4J A;  2CAQ A;  3MDK A;  5ECQ B;  3LYK A;  4KDX A; 
#chains in the Genus database with same CATH homology
 2L57 A;  4YKG A;  1GSF A;  1V9W A;  3DWV A;  4MZB A;  2H1D A;  2Z9S A;  3HZ4 A;  4X43 A;  4Z7X A;  1TDI A;  4PGT A;  4EDY A;  1QUW A;  3IPZ A;  4ACS A;  2CQ9 A;  2DKH A;  2FA8 A;  4O92 A;  4H86 A;  1OAZ A;  4IN0 A;  3CSI A;  2RUF A;  1K0A A;  2X4A A;  1MEK A;  1R4W A;  4MF5 A;  1M2B A;  1EWX A;  2AYT A;  3P90 A;  4HU9 A;  4N11 A;  2YWN A;  1SL0 B;  4PTS A;  5IO2 A;  1IYI A;  1B48 A;  3HY2 A;  2R37 A;  3FKF A;  3IAS 2;  1PQN A;  2DIZ A;  1R7H A;  5F0G A;  3DXB A;  1ZCP A;  2PBJ A;  1K0M A;  3A2V A;  4XS4 B;  1PD2 1;  5IMZ A;  3VLN A;  3MYD A;  1PX6 A;  3TRX A;  3GFK A;  3WT2 A;  3KZQ A;  2X49 A;  3WGX A;  2IMF A;  1ZYQ B;  2YCD A;  4NMU A;  4GF0 A;  5B6M A;  1Y25 A;  5AIX A;  2GSS A;  5HFG A;  1GSD A;  2DJ0 A;  4MDC A;  4ULX A;  3UVH A;  4LL4 B;  4CY8 A;  2HLS A;  4PUA A;  3A2W A;  1H4O A;  3IHG A;  2DJK A;  4PQI A;  4ZBD A;  2C3T A;  4E8E A;  1Q4J A;  3A3T A;  3GL3 A;  6GSY A;  5INY A;  4IS0 A;  1Z9H A;  2L4Q A;  1ST9 A;  2LNS A;  3FRC A;  3L9U A;  4HU7 A;  1V2A A;  3IBH A;  4ZXG A;  2F9S A;  3PR8 A;  3IE3 A;  2GST A;  4LLR A;  2HYX A;  2ZNM A;  4DSS B;  1WE0 A;  4RQR A;  2FY6 A;  4CY6 A;  1TI3 A;  3ZFL A;  1XCC A;  2O85 A;  3KP9 A;  1FVJ A;  2JZS A;  1K3O A;  3EMP A;  4IEL A;  2C8U A;  5HFK A;  19GS A;  3QDN A;  3TKQ A;  1VGL A;  3P8W A;  1FAA A;  3N9J A;  3KJY A;  3W8S A;  1YZX A;  3F63 A;  1AAZ A;  5KEJ A;  3I9V 2;  4YKF A;  2B5Y A;  4OFN A;  2MZC A;  3GV1 A;  1G7E A;  1ERW A;  1OC9 B;  2HSY A;  3QFA C;  1O81 A;  4WF4 A;  5ELG A;  3VI5 A;  3MSZ A;  1PGT A;  2KHP A;  4POL A;  5COH A;  1J0F A;  3F3R A;  3WYW A;  2OE3 A;  1AQX A;  3V1W A;  1TK5 B;  3LXZ A;  2HZE A;  5H5R A;  3KXO A;  2DIY A;  4KDU A;  3FZ4 A;  3GIX A;  7GSS A;  1ABA A;  1I9D A;  5JWQ B;  1DBY A;  2LRT A;  3EU3 A;  1UA5 A;  1JZR A;  2GQL A;  2R0C A;  4TKY A;  4YH2 A;  4YAP A;  2X8H A;  3IV4 A;  3LOR A;  1NM3 A;  2JAD A;  1A2M A;  1OKT A;  4BWS A;  3TGZ A;  2C3N A;  2M72 A;  1A8L A;  4IP6 A;  5ECH B;  2FWH A;  3KH9 A;  2C0D A;  4MP4 A;  1ON4 A;  4Q5R A;  3EU4 A;  3VK9 A;  1GTI A;  3S9F A;  3GTU A;  3LEF A;  3GH9 A;  1FHE A;  1V40 A;  1UN2 A;  1A23 A;  2R5G A;  3BD2 A;  4MH2 A;  2WS2 A;  3I69 A;  2I9H A;  1C72 A;  2LST A;  4QL7 A;  3CRT A;  4WEY A;  2FA4 A;  1O85 A;  4ML1 A;  4USS A;  3HYP A;  1O8X A;  3TUE A;  4ECI A;  3IDV A;  3US3 A;  1GH2 A;  3C1S A;  5BRT A;  1X9W B;  2ON5 A;  4HEA 2;  5D9T A;  3OR5 A;  2IME A;  3FYG A;  2H8L A;  1GWC A;  2WJU A;  2YWI A;  3GKM A;  3O6T A;  4ZB6 A;  1EGR A;  4V2M A;  2MBT A;  4I8B A;  4PUR A;  2FNO A;  1S3A A;  4HZ4 A;  2MMZ A;  5FHI A;  3IOS A;  2N5B A;  4O5U A;  4PXO A;  1WOU A;  5IMA A;  5AN1 A;  1OC8 A;  5EY6 A;  1NHY A;  2NVL A;  2GVP A;  4EO3 A;  3H1N A;  1WRY A;  1YDK A;  3KGK A;  3A5I A;  5KN0 A;  1FO5 A;  1EEJ A;  1XVQ A;  4RQX A;  1G6Y A;  1MDI A;  3NZN A;  4X0X A;  1E2Y A;  3D5J A;  1GUK A;  3TRQ A;  3ERG A;  1F2E A;  1XWC A;  5JCW A;  5FWG A;  3WD6 A;  2JZR A;  1M7T A;  1XWB A;  2VD1 A;  3TJB A;  3TJK A;  5LNK e;  2VD0 A;  5G1L A;  2VCX A;  5DDL A;  1ML6 A;  3DYR A;  5IPG A;  1G6W A;  1BED A;  4F2I A;  3U6V A;  3QPM A;  2GTU A;  2DMM A;  3FZ9 A;  2GGT A;  2B7K A;  5DAL B;  4DSQ A;  2C4J A;  3EC3 A;  5DCH A;  4GLT A;  1THO A;  4IBP A;  1K0N A;  3W8J A;  1ZYP A;  1G0T A;  4XS6 A;  3VPT A;  2LJK A;  2PUK C;  1GTA A;  5B7C A;  2GZP A;  3TJF A;  1EOG A;  3VFI A;  1ERV A;  4DSR A;  3HVV A;  1Z5Y E;  3D21 A;  4IQA A;  1KEB A;  1THX A;  2C0E A;  2LS5 A;  4O32 A;  1OE7 A;  1FOV A;  4K7I A;  3HXS A;  5DQY A;  4OWY A;  3GNJ A;  4D73 B;  4MPF A;  5ELA A;  5HR0 A;  1Z6N A;  2V1M A;  3F6F A;  3LYP A;  1JZO A;  4RI6 A;  2C0F A;  1GNW A;  2VM2 A;  1X5C A;  3FEU A;  3KIJ A;  1F37 A;  5H5Q A;  4N0V A;  5G1K A;  2EIO A;  2R2J A;  4FYU A;  4BVY A;  9GSS A;  2L4C A;  3IR4 A;  2JAC A;  1UVZ A;  3RDW A;  1FG4 A;  3KTB A;  4X1U A;  2DC5 A;  2VAF A;  3F9U A;  1U88 A;  2ON7 A;  1TI1 A;  3ZRD A;  5GST A;  2IL3 A;  4NV2 A;  1T3B A;  1A2J A;  4PQ1 A;  2EC4 A;  1N8J A;  2ZCT A;  3BCI A;  1TU8 A;  1TK0 B;  2J9H A;  3L4N A;  2VLU A;  1XIY A;  4L0U A;  4HI7 A;  1FB6 A;  1K0O A;  2YWO A;  4E8H A;  4PUF C;  1PA3 A;  2TRC P;  4FO5 A;  5ECP B;  3TJG A;  2TRX A;  1H75 A;  3HVS A;  1XWG A;  2WZ9 A;  3C71 A;  1TXX A;  2LRN A;  4JE1 A;  2AHE A;  2HSH A;  5E4W A;  3QFB C;  4BL7 A;  8GSS A;  3FY7 A;  1USB A;  3RAZ A;  3MNG A;  5GZZ B;  5JCG A;  5D8I A;  4FIW A;  1KBN A;  2LV3 A;  2GQK A;  3BBY A;  4V2N A;  2V6K A;  3G7I A;  4K7O A;  1XZO A;  1BX9 A;  3GUS A;  3VWX A;  2I4A A;  4K2D A;  1T00 A;  2H71 A;  3FZ5 A;  2OAD A;  1M0U A;  1XOB A;  1LU4 A;  3DVX A;  3TKR A;  4EDZ A;  5F8B A;  3DKS A;  2PVO C;  2VL2 C;  3BCK A;  1V58 A;  1U87 A;  13GS A;  1O8W A;  1WMJ A;  4YQM A;  3F4T A;  1GTB A;  5IIZ A;  2B6M A;  3IA1 A;  5FT3 A;  1YEP A;  5ID2 A;  1XPV A;  3QAW A;  5A5K A;  4K5S A;  2P5R A;  4PX1 A;  2XHF A;  2H0I A;  2PVQ A;  2JSY A;  2YOI A;  1PKZ A;  2QC7 A;  4TOP A;  3PPU A;  4TR1 B;  2A2R A;  3TOU A;  4KND A;  2UZ8 A;  5AIV A;  2C3Q A;  2B5X A;  2OJL A;  3D4M A;  3GUR A;  2LRC A;  5IQY A;  2X99 A;  3TRP A;  2F51 A;  4OMV A;  4CW9 A;  2H76 A;  4N30 A;  6GSX A;  1PMT A;  1SK0 A;  4BVX A;  3IC4 A;  5HFI A;  2XPD A;  1F6M C;  1U3I A;  2A2P A;  14GS A;  5DVB A;  3QR6 A;  3CYN A;  4WR4 A;  5AIS A;  3VI7 A;  4V1A p;  5EPF A;  1V98 A;  2F3M A;  5CRH A;  2FD3 A;  2JL4 A;  1URM A;  1PL2 A;  3QMX A;  2X8G A;  2LJA A;  2DJ1 A;  4G0K A;  4KGI A;  1A0R P;  4EXJ A;  2A2S A;  3CTF A;  2IMD A;  2RII A;  4HOJ A;  4POM A;  2C80 A;  2PN8 A;  1ILO A;  3TKP A;  3F3Q A;  2H74 A;  1QQ2 A;  3ZYW A;  1YKA A;  3HKR A;  2GSR A;  1WWJ A;  1A2L A;  2H6Y A;  1Z6M A;  3FR6 A;  1TP9 A;  4ZBB A;  2O89 A;  1AW9 A;  1JZW A;  2HXK A;  4KCE A;  4L8E A;  4ID0 A;  5IMC A;  5IM9 A;  2PWJ A;  3D6I A;  4F9Z A;  2FLS A;  1B9X C;  3LG6 A;  4WR5 A;  1O6J A;  10GS A;  2H1A A;  4G10 A;  1SJI A;  3KCM A;  3EUR A;  2AB6 A;  5C00 A;  2YN1 A;  4KA0 A;  3DVW A;  6GSS A;  3EPT A;  2HRA A;  1WP0 A;  1B4Q A;  4IGJ A;  3F8U A;  1JLV A;  1J08 A;  5CRD A;  1X0R A;  3QAV A;  1RQM A;  1ZYE A;  4EIQ A;  4A5P A;  2A4V A;  4NHZ A;  4F03 A;  3TJJ A;  4LMW A;  4P3Y B;  1A8Y A;  1OKD A;  4KAE A;  3GSS A;  2CVK A;  3A2X A;  2KOK A;  5CRW A;  2DBC A;  3KTL A;  3UL3 A;  1NHO A;  2HRK A;  2K18 A;  5D9V A;  4WXT A;  3ZLP A;  4IQ1 A;  4J57 E;  1T4Y A;  2AJQ B;  3ZMK A;  1XW9 A;  1SJZ A;  3EMX A;  4IHU A;  2WGR A;  3IC8 A;  3LJR A;  5CRE A;  3G7J A;  3IXR A;  2X64 A;  2LUS A;  4K1F A;  2DML A;  1BYE A;  1FB0 A;  2YPM A;  1X5D A;  2L5O A;  5G5E A;  3NOF A;  4K7N A;  5DAK A;  2VM1 A;  1Z7R A;  5G5F A;  4NHW A;  1WIK A;  1G7O A;  5JWO B;  4TR4 A;  2FWF A;  3W6G A;  3DML A;  2IMI A;  1K0D A;  4GSN A;  1JLW A;  2B3S A;  4K8M A;  4KSM A;  2H66 A;  3UEM A;  5A4W A;  1TJD A;  2IFQ B;  5F07 A;  2NPB A;  2B5E A;  3L9V A;  1SD8 A;  4KF9 A;  1TKD B;  4DEJ A;  1WJK A;  2PGT A;  1YF0 A;  4JR4 A;  4TVE A;  1HYU A;  1XBS A;  4ZBA A;  2LKU A;  3FK8 A;  5CAX A;  2GT5 A;  3M1G A;  18GS A;  4HJ2 A;  4TXO B;  2IN3 A;  4F82 A;  2YNX A;  3MAK A;  1VF3 A;  2FWG A;  2E7P A;  4WF5 A;  1FVK A;  2M46 A;  2VL3 A;  5ENU A;  2YAN A;  1EV4 A;  4KW6 A;  2V32 A;  2RLI A;  1QGV A;  4I97 A;  1B8X A;  4HDE A;  3GH6 A;  1ZZY A;  2WRT A;  2OKA A;  1YQ1 A;  1SL2 B;  2BTO T;  2O8V B;  2FUG 2;  4KE3 A;  2G2Q A;  3HJP A;  4AJ8 A;  3EE2 A;  2CA8 A;  4Z2T A;  1YF1 A;  1K0B A;  4L0W A;  3JCM L;  3ZFB A;  4N0Z A;  2WFC A;  1M99 A;  1YY7 A;  1X9S B;  3IRA A;  1XWK A;  2HZF A;  3L78 A;  5A4U A;  3TCO A;  2P5Q A;  1T7P B;  2MBS A;  4MJC A;  2XC2 A;  3SWL A;  1QK8 A;  1M9A A;  1IYH A;  5CNW A;  3ZIT A;  2R3X A;  1EOH A;  2F8A A;  3SBC A;  4QL9 A;  3KM6 A;  1TRS A;  2G0F A;  2QGV A;  1OC3 A;  4ECC A;  4TR1 A;  3FW2 A;  4PQH A;  1GTU A;  1DE1 A;  5D96 A;  2H6Z A;  2VL2 A;  3TDG A;  3HVX A;  3C8E A;  2IPA A;  3ZRE A;  2N5A A;  4JR6 A;  1QFN A;  1TOF A;  3GN3 A;  1M9B A;  1GSQ A;  1V57 A;  4KCA A;  3EYT A;  3D0Z A;  1LBK A;  2VOC A;  2A4H A;  2R4V A;  1DSB A;  2GT6 A;  1HNC A;  1AUC A;  4PNF A;  5CYY A;  3KMO A;  2QSI A;  3F6D A;  5GSS A;  2DKI A;  3RHC A;  2BJX A;  3CSJ A;  1DE2 A;  2YJH A;  4AJ7 A;  2C0G A;  5L71 A;  2B7J A;  3H8Q A;  1TRW A;  2H1B A;  1FOH A;  3M8N A;  4TR0 A;  3GKN A;  4HJM A;  2CZ2 A;  1MDJ A;  5KOW A;  4NXI A;  1KNG A;  3UAR A;  2O7K A;  3L9S A;  4AJ6 A;  5A4V A;  3DGQ A;  2VL9 A;  4XS4 A;  5F06 A;  2KP1 A;  1MTC A;  5J9C A;  1AXD A;  2GS3 A;  17GS A;  2IIY A;  4NAX A;  4MK3 A;  3J7Y b;  2O87 A;  1TTZ A;  4EIP A;  1GUL A;  1LJR A;  5AGY A;  3F4R A;  4XCS A;  3HA9 A;  1SL1 B;  2KLX A;  3QAG A;  1SKW B;  1SKS B;  4FH8 A;  3BOA A;  1TW9 A;  5KN2 A;  2QA1 A;  4FYB A;  2HZE B;  5DBQ A;  3BJ5 A;  2HE3 A;  4IJ3 A;  3HD5 A;  1E6B A;  4KDY A;  4IP1 A;  2D2Z A;  4OD7 A;  3UJ1 A;  4YAV A;  3P2A A;  3QOU A;  2I1U A;  2EIQ A;  2FCH A;  4GSS A;  2H19 A;  4KB3 A;  4DSS A;  3GX8 A;  2H1G A;  3WT1 A;  4JU5 A;  2R0P A;  1GP1 A;  3ME7 A;  3C7M A;  1SK1 A;  3PGT A;  1VF1 A;  4MNN A;  5CRG A;  1GUM A;  1T8E B;  3AY8 A;  1K0C A;  1SJ6 A;  3UVT A;  3J7Y k;  2H75 A;  1QXH A;  4OCE A;  4ECJ A;  2P0G A;  3GTU B;  1VRS D;  3M3M A;  2L6D A;  2CVB A;  2OBK A;  2MYG A;  3H93 A;  2YP6 A;  3CTG A;  1BAY A;  3G9B A;  4FYC A;  2ALB A;  1OC9 A;  1SEN A;  1SU9 A;  4TW5 A;  3C1R A;  4O7H A;  1XWA A;  4GQF A;  4MZW A;  2IJY A;  2KP2 A;  2WDU A;  2LQO A;  1ERU A;  3D4T A;  1R5P A;  4POB A;  3KP8 A;  3GYK A;  3K8N A;  5IMF A;  3KH7 A;  5B6N A;  3PIN A;  2IWT A;  3I43 A;  5D73 A;  2E2G A;  4KH7 A;  1JHB A;  2XBI A;  16GS A;  3UMA A;  3ME8 A;  3IK9 A;  3KD0 A;  3LWA A;  2WCI A;  5ECS A;  4LL1 B;  4CHS A;  1GSU A;  2VLV A;  3G7Y A;  1FW1 A;  5JWR B;  1TK8 B;  2H0H A;  4I5Q A;  2I3Y A;  3E9J B;  4TR3 A;  4TN8 A;  1GUH A;  2P31 A;  1XOA A;  2YZH A;  1JFU A;  2VCT A;  4YQU A;  4ZL8 A;  3E3E A;  4JZQ A;  4OFT A;  3TKS C;  2LNT A;  3WGE A;  4BPY A;  2KUC A;  4CDO A;  3M9K A;  4ZB8 A;  2K9F A;  3N5O A;  2LJR A;  3RPN A;  2GDR A;  1JZD A;  2XPE A;  3F0I A;  1F3B A;  3ZIV A;  3ZML A;  3UIW A;  5ECM B;  1CQH A;  4HUA A;  1TU7 A;  1SK2 A;  4ML6 A;  4K6X A;  3ED3 A;  6GSW A;  3HDC A;  1M2D A;  1SYR A;  3KMN A;  4IJI A;  1YEX A;  5E59 A;  4V2L A;  3QD9 A;  3WGD A;  2VIM A;  3M0F A;  3RHB A;  5HR2 A;  1ZYN A;  4ECB A;  3ZVJ D;  4WET A;  5G30 A;  1I5G A;  3DRN A;  5G2Z A;  1KTE A;  2MMO A;  4MJB A;  3VPQ A;  4GRF A;  3FMW A;  1X5E A;  3UAP A;  4K5R A;  3R2Q A;  5CP1 A;  4BVY B;  2X8C A;  3MIX A;  4O5Q A;  5IPH A;  2HT9 A;  4EE0 A;  1MD3 A;  3GKX A;  5HQP A;  1HNA A;  1M2A A;  2LTK A;  4TRX A;  1BJX A;  2H72 A;  1UC7 A;  3ERW A;  2ES7 A;  4MJE A;  2HFD A;  5DAL A;  4J2F A;  1EP8 A;  1PKW A;  5ECO B;  3Q19 A;  3I6A A;  5BMU A;  4GTU A;  2N5F A;  4KSO A;  5GAP D;  3DEX A;  2OE0 A;  1EV9 A;  4MF7 A;  1HQO A;  5GAN D;  1XVW A;  2OAC A;  4QQ7 A;  2R0G A;  4G0L A;  1RK4 A;  2H70 A;  5J3R A;  1GSE A;  4BL7 B;  5ABR A;  1K3Y A;  1SYX A;  4D73 A;  3C73 A;  3FHK A;  1A24 A;  4JED A;  2I81 A;  4WBJ A;  1ZMA A;  3ERF A;  3PH9 A;  1Q98 A;  3H79 A;  5D93 A;  2L59 A;  4G9H A;  2DJ3 A;  3HJM A;  5EVO A;  4O5R A;  2DLX A;  2JZT A;  1PX7 A;  3ZL5 A;  4TXV A;  4XHM A;  1U3A A;  4Q5F A;  4ZIL A;  4G19 A;  4BA7 A;  4YQV A;  4Q5N A;  3TOT A;  1N2A A;  2H6X A;  1ZOF A;  2H01 A;  1NW2 A;  4K2X A;  1T1V A;  1YKC A;  2HRF A;  3EVI A;  2B1K A;  4FQU A;  6GSU A;  1EEM A;  4Q5Q A;  5ID2 B;  1GLQ A;  5KN3 A;  4MPG A;  2NBS A;  1ERT A;  1T4Z A;  1F3A A;  4ZL7 A;  3CBU A;  4RUV A;  4JRR A;  1XFL A;  5CO3 A;  2CX4 A;  5ECI B;  2L6C A;  2K8V A;  2HNL A;  4MF6 A;  5HR3 A;  3IAM 2;  2V6O A;  1Z7P A;  2YJ7 A;  3GMF A;  2GZY A;  2JSZ A;  3HJO A;  1QMV A;  5D9W A;  3LQ7 A;  5J5N A;  4BVX B;  3GST A;  2LQQ A;  3LW9 A;  4K9Z A;  2WUL A;  4MCU A;  4N10 A;  4MAB A;  2H30 A;  1EZK A;  5F05 A;  3HHV A;  2CZ3 A;  4OFM A;  2XBQ A;  5B8A A;  1R5A A;  3O76 A;  4WBR D;  2OBI A;  3Q6O A;  2NTO A;  4J56 E;  2R6K A;  3L0H A;  2DSA A;  2H73 A;  20GS A;  2AV4 A;  4G2E A;  1PSQ A;  4G0I A;  4MA9 A;  2MMN A;  2VCZ A;  1B4P A;  1ZGN A;  2GZZ A;  2OE1 A;  4IKH A;  5D9X A;  1VF2 A;  4XRA A;  12GS A;  2HI7 A;  4WKW A;  1K3L A;  4XTS A;  3DD3 A;  4LMV A;  3GRX A;  3ZIJ A;  2E2M A;  1EGO A;  2V2G A;  5J4U A;  1S3C A;  5KOX A;  2C1Y A;  1AQV A;  2B1L A;  4Z2R A;  5DQS A;  3FR3 A;  2QKE A;  4BWQ A;  1OE8 A;  5IMD A;  3LFL A;  2RUE A;  4ZIJ A;  1GSS A;  5C04 A;  1MDK A;  4OO5 A;  6GST A;  1XW5 A;  2F8F A;  1O73 A;  4OO4 A;  1PN0 A;  5IO0 A;  1OVN A;  4HZ2 A;  2VUP A;  3UOM A;  5IOW A;  5IMV A;  3Q74 A;  2DJJ A;  3UBK A;  4AGS A;  3LSZ A;  3TKS E;  2NDO A;  2PPT A;  3IK7 A;  2IMK A;  2PU9 C;  5HR1 A;  4I2T A;  5JCU A;  1BG5 A;  3GKK A;  1GSY A;  5G31 A;  2K6V A;  4MLY A;  4MH3 A;  5J41 A;  2EIR A;  2VO4 A;  5ECN B;  4GCI A;  5ECL B;  1BQ7 A;  2L5L A;  1A0F A;  1SD9 A;  2VLT A;  2YZU A;  1MD4 A;  3E0U A;  4IVF A;  1XXU A;  2YWM A;  2ZUP A;  1AIU A;  3EIN A;  3RBT A;  2DJ2 A;  3TKS A;  3CRU A;  3FZA A;  2YV7 A;  3EWL A;  3GA4 A;  3KEB A;  1U6T A;  5LCZ A;  4L5O A;  3FR9 A;  2MMA A;  3A5W A;  1B9Y C;  4MZC A;  1W4V A;  2GSQ A;  2AUV A;  3GL5 A;  4MJA A;  4LA1 A;  1DUG A;  5DAK B;  2CX3 A;  2PER A;  4V1A g;  2HSM A;  4IW9 A;  4F0C A;  3HCZ A;  3ISO A;  1AC1 A;  3P7X A;  1PL1 A;  1W89 A;  4Z2U A;  2J23 A;  2VCW A;  1YJ6 A;  1EP7 A;  4I2U A;  4NWY A;  2CV4 A;  1J9B A;  4EUY A;  2FWE A;  11GS A;  4NV5 A;  2WB9 A;  3M9J A;  1AQW A;  4GXZ A;  4DVC A;  3VUR A;  1GL8 A;  2AAW A;  2E0Q A;  3VWU A;  4ICY A;  3H4K A;  1Z3E A;  1TRV A;  4HQS A;  4F0B A;  4NPB A;  1VF4 A;  4KUN A;  4HS1 A;  4JBB A;  2FGX A;  3ZVJ A;  4I6X A;  4ZB9 A;  3GHA A;  2JU5 A;  2V41 A;  5DCG A;  2RM6 A;  2VCV A;  3R3E A;  4MMM A;  2HRN A;  3F4S A;  1RW1 A;  1O7U A;  2OA7 A;  5DJM A;  5EL8 A;  4PNG A;  1R26 A;  5H5S A;  1GNE A;  3DIE A;  4AF2 A;  3TB2 A;  4L5L A;  2GLR A;  2FHE A;  4ILF A;  4K0G A;  1TRU A;  3APQ A;  4GQC A;  2GQM A;  4POK A;  5IOX A;  3LXT A;  3Q18 A;  1HD2 A;  3VWV A;  2QA2 A;  4EF0 A;  3CXG A;  4EC0 A;  2YV9 A;  1HNB A;  4HQZ A;  1F9M A;  3MWH A;  5ECR B;  5J9B A;  3GX0 A;  3D22 A;  3U5R E;  1GLP A;  4EL1 A;  4KX4 A;  3RPP A;  1OYJ A;  4RI7 A;  3ZTL A;  3LGC A;  6GSV A;  1WPI A;  2CVD A;  2TIR A;  4ISD A;  2K8S A;  1ZL9 A;  3IHQ A;  2REM A;  1CQG A;  2H0G A;  1X9M B;  22GS A;  3VWW A;  2IFQ A;  1NSW A;  4XIH A;  1SKR B;  1PN9 A;  3APS A;  2VCQ A;  3ZZX A;  4EVM A;  4GST A;  5LD0 A;  1GRX A;  4K0N A;  2CAI A;  3UBL A;  4ZL9 A;  5ECK B;  3O3T A;  2PMT A;  1PRX A;  1XW6 A;  3CMI A;  5KN1 A;  4OCF A;  2LEG A;  5B8B A;  3NIV A;  2CT6 A;  3APO A;  4XS1 A;  5DJL A;  4XRD A;  3CSH A;  4EKZ A;  1ACV A;  2BMX A;  1S3D A;  2RM5 A;  2M80 A;  3QCP A;  3HZ8 A;  4TXO A;  1Y6E A;  4GWR A;  4X4J A;  2CAQ A;  3MDK A;  5ECQ B;  3LYK A;  4KDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...