4BPYA

Crystal structure of the c90a mutant of the sco copper chaperone protein from streptomyces lividans
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
175
structure length
162
Chain Sequence
QAATVLDKPFEKPDLVLTDTQGKKYDLREQTAGKPTLIYFGYTHPDVAPLTMNNIAVAKKQLSQAEQDKLRVVFVSTDPERDTPAALGKWLKGIDPQIVGLTGEFDTIQAGARTLGISIDPPGTQVVAFSPKSDAGYVLYGEDATVDDYTKDLPKLIKGENP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords SCO PROTEIN
publication title Structural and Mechanistic Insights Into an Extracytoplasmic Copper Trafficking Pathway in Streptomyces Lividans.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 48
structure length 162
sequence length 175
ec nomenclature
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4bpyA00
2HZEB 3QAVA 6GSXA 2DLXA 3G7IA 3F3QA 5KN2A 2KUCA 5CRDA 1XW6A 1XIYA 1OKTA 1Z9HA 5ECIB 2H75A 4BWQA 3GTUA 2LRCA 3TKPA 3UMAA 3LGCA 3UARA 4N30A 4NHWA 2GSTA 2EIOA 2V6KA 3IPZA 1OE8A 3E9JB 3P90A 4LMVA 4NV2A 1TOFA 2NTOA 1HNCA 2A2SA 4JR4A 3C1SA 1FVKA 2YANA 1GSUA 1X5DA 2YOIA 1EWXA 3P2AA 1X5CA 3CBUA 1VF2A 4X0XA 4TOPA 4XRDA 4KAEA 2P0GA 3RDWA 3HVVA 4GXZA 1W4VA 1XOAA 1HNBA 3LFLA 4ML1A 2FUG2 5J9BA 3HKRA 2DJ3A 4TR3A 1IYHA 1TKDB 2O87A 3IR4A 2DJ0A 3TRPA 2C3NA 3MNGA 2QSIA 1DE1A 2TRCP 4TKYA 1MTCA 3KCMA 3BBYA 1HD2A 4TXVA 2OA7A 2BJXA 2H6YA 1FAAA 1YF0A 1GP1A 1QK8A 3GIXA 5DQSA 5C04A 3WGXA 2KOKA 3M0FA 2DC5A 3GL3A 3GKKA 3EURA 4EF0A 3RPNA 3WT1A 4KSMA 1YKCA 3LXZA 4K7NA 2IMFA 3GUSA 2LRTA 2YWNA 1TU8A 4WBRD 3IRAA 2H70A 4JZQA 5D9WA 4Q5FA 3L4NA 1O8XA 3APOA 4MF5A 4AGSA 1U88A 4KDXA 3HVSA 2IMEA 1GWCA 4DVCA 4ID0A 3CMIA 3CSHA 4G9HA 3QCPA 2VUPA 4MMMA 2DJJA 1B4PA 5IMVA 2CQ9A 3GFKA 4HJMA 4KE3A 2H19A 4IBPA 2B7JA 1KTEA 4IJ3A 2K8SA 4GQCA 3CRUA 1TI1A 5LD0A 2X8HA 5H5SA 4OCEA 3GSSA 1FB0A 13GSA 2K8VA 1Y25A 4K8MA 3TRXA 3IHQA 1TRVA 1PD21 4ZILA 1Z7RA 4WBJA 3VPTA 5CO3A 2LJKA 2CA8A 4BVXA 1S3AA 3GRXA 4TW5A 1M2BA 1B9XC 2IPAA 4GQFA 5IMFA 3G7YA 18GSA 4V2MA 1B9YC 1TXXA 3TJBA 3FK8A 1JHBA 5CRGA 4ZB9A 4IP1A 3J7Yk 2GS3A 4IGJA 1GSYA 1SK2A 2ON7A 1RW1A 1PRXA 3ISOA 3DKSA 1TK0B 4N0ZA 3M1GA 2VLVA 3US3A 3TRQA 3CTFA 1TRSA 2YJHA 2JSZA 3GL5A 3CYNA 3VFIA 1DBYA 4IN0A 2YNXA 1BQ7A 3FZ9A 1WRYA 1GTAA 2GQKA 5G5EA 3GURA 2IL3A 2HT9A 3ZIJA 2CX4A 2LQQA 3PGTA 2LKUA 2L4QA 1FB6A 3EWLA 5CRWA 4K7OA 1V2AA 1PGTA 5ECSA 6GSSA 1SKRB 4WEYA 5ECMB 4FH8A 3JCML 4I97A 5HR2A 4HJ2A 3S9FA 1FOVA 2C8UA 1EEJA 3AY8A 3KZQA 5IM9A 3DRNA 1GLQA 4MF6A 1T1VA 3VK9A 2C3TA 3VLNA 4MPFA 1OYJA 6GSYA 1XW5A 3EC3A 4AJ7A 4F9ZA 3M3MA 1B48A 2H30A 2KP2A 3FW2A 2YV9A 2YN1A 5AN1A 4F2IA 4NV5A 3HJMA 4ISDA 1OKDA 4ZBDA 4PX1A 4ECCA 2NVLA 1NM3A 4BL7A 2PUKC 1BJXA 3G7JA 4MJEA 4HDEA 1A2JA 5D8IA 2XHFA 2R3XA 3EVIA 2YP6A 3IA1A 4X1UA 2JL4A 1TDIA 3E3EA 1LJRA 3CXGA 1JZDA 2C0DA 2GLRA 1R26A 5DJMA 1KBNA 1FW1A 3P8WA 5J9CA 3ZITA 3RBTA 1FO5A 2JADA 3TCOA 3TB2A 1H75A 4FYCA 5DBQA 2WCIA 4WXTA 7GSSA 5F06A 5F07A 3FHKA 1A8YA 1WWJA 1NHYA 2JZRA 2GZZA 2VIMA 3HVXA 4XCSA 2AV4A 5G31A 1PKZA 1A8LA 3ZYWA 4WF4A 2PGTA 1G7OA 1TI3A 5J5NA 1F3BA 2VCQA 3CRTA 1ST9A 4ZXGA 4KB3A 5D93A 3DWVA 2N5BA 1GL8A 3TKSE 2YCDA 5AISA 1PX7A 3D6IA 5CREA 1UVZA 3KXOA 5D73A 2OE3A 3IXRA 3L9SA 5HFGA 2RM5A 1T00A 4LL1B 5KN0A 4MLYA 2O8VB 3ZVJA 2F8AA 1Q98A 2VL9A 1M2DA 3APSA 1J9BA 3ERWA 1AQWA 2F8FA 3CSJA 3F3RA 1NSWA 2PMTA 2V41A 4LMWA 1U87A 3MSZA 2LNTA 4GF0A 3PR8A 1THOA 1AAZA 1DUGA 3UOMA 3BOAA 3C71A 4EC0A 1VF4A 2VOCA 1CQHA 2RUFA 5DAKA 5A4UA 2GSQA 4E8HA 2FA4A 4DSSA 3O76A 2KLXA 1SYXA 5DVBA 2H8LA 3IK9A 5DDLA 4QL9A 4POMA 3KJYA 1EGRA 1OC9A 4MDCA 1PL2A 3D4TA 1QUWA 1LBKA 4JR6A 1PL1A 2OE1A 12GSA 3IAM2 5F0GA 3C8EA 4HZ2A 2FD3A 2B5YA 4ECBA 4F82A 2H74A 4KUNA 1OE7A 2VCWA 3GYKA 5IMCA 3OR5A 3LQ7A 2GZYA 2YJ7A 2ZNMA 4PUFC 5HR0A 4RQRA 3HCZA 3D5JA 1EOGA 3VI7A 2HI7A 1F9MA 5CNWA 5KN1A 2PERA 4Q5QA 4GWRA 6GSWA 1I5GA 5IQYA 1T4ZA 2IMIA 2PPTA 1ZZYA 2ZCTA 3KIJA 4K9ZA 1H4OA 2H0HA 2ON5A 3MDKA 1R5PA 3KEBA 2V32A 3TKSC 2VCZA 4XS4A 5A4VA 4ULXA 2WS2A 1R5AA 2AAWA 3D21A 3BD2A 3F4RA 2HSYA 5F8BA 3QMXA 1GSQA 3UIWA 1VF1A 2GSSA 2X8CA 5J41A 3NZNA 4NHZA 1HQOA 5IMZA 5JCWA 1O81A 2VL3A 3QFAC 2XPDA 4KH7A 1SKWB 1GTUA 3F6DA 1EV4A 1X5EA 3A2VA 2PVOC 3F4TA 4K6XA 1ERVA 3GA4A 1CQGA 5JWRB 3VURA 1X0RA 1GNWA 4MK3A 1KEBA 4KW6A 2FY6A 1AW9A 1BAYA 3GKXA 1XWKA 3ZLPA 2OBIA 2R5GA 3EYTA 2H0IA 4OO4A 4AJ6A 5ID2B 3TJKA 2GQLA 3KGKA 1K0MA 4IQAA 5G2ZA 1JZRA 2FHEA 3GV1A 3RAZA 5D9XA 3ZZXA 1K0AA 2VLUA 1TRWA 1K3YA 3HHVA 4GSTA 5FHIA 4L5LA 3HJOA 4KNDA 1YY7A 5HQPA 5AGYA 1AUCA 1RQMA 2CX3A 1Z6MA 4J56E 4DEJA 2HZEA 2FWGA 1N2AA 3LJRA 1G7EA 4PQHA 4EXJA 4I8BA 1HNAA 4TR1B 3HD5A 1YEXA 1PA3A 2L59A 17GSA 2M72A 5ECLB 1TW9A 2AB6A 3PH9A 1O7UA 4RI6A 2B5XA 2WB9A 3HA9A 2CV4A 4KDUA 5E4WA 5J4UA 1OC3A 3UVTA 4TR4A 3FR6A 1TTZA 2J9HA 4OFMA 3TKSA 4IHUA 4MH2A 2PBJA 1EP7A 3W8SA 4KDYA 4G19A 1QQ2A 3IAS2 1ZL9A 2FGXA 5HFKA 3GKMA 4J2FA 1K0DA 3V1WA 5C00A 2ES7A 2IFQB 2KP1A 1DSBA 5B6MA 1XW9A 3FYGA 1BYEA 5H5QA 1W89A 2VM1A 2VCVA 5B8BA 4HI7A 3ZREA 1M2AA 3ME8A 5B7CA 2FA8A 4V1Ag 4F03A 1QGVA 2LTKA 1AQXA 3H8QA 1YJ6A 2WULA 5EPFA 1JZWA 2H72A 1FHEA 2EIQA 1WMJA 5HR1A 4IW9A 2CZ3A 1SU9A 1VRSD 3L78A 5D96A 2R4VA 4G10A 2K18A 4BPYA 1WJKA 4RQXA 1WPIA 1U3AA 2DJ1A 5DALB 10GSA 3SBCA 2WDUA 2I1UA 1MEKA 4EDZA 2FWFA 3KMOA 3TUEA 5ELAA 5LCZA 2CAQA 2R6KA 1LU4A 2JZSA 1A0RP 4TVEA 5IMDA 1FVJA 2DSAA 2DMLA 3U6VA 3LG6A 3R2QA 5ABRA 3IE3A 1YKAA 1AXDA 2F3MA 4POKA 2IWTA 4HU7A 1GSEA 3D22A 2L4CA 3GKNA 4LL4B 5FT3A 4HUAA 3HZ8A 1TK5B 2NDOA 3DEXA 1F2EA 2C80A 3RHCA 4GSSA 1SL1B 1QXHA 3IDVA 2HRNA 3WGDA 1AQVA 2CVDA 1BG5A 5JWQB 2WZ9A 4OMVA 1TK8B 5B8AA 1THXA 14GSA 3DD3A 4CHSA 1N8JA 3QAWA 4J57E 1GSFA 4HQSA 1V58A 3EINA 2GVPA 1PN9A 2VAFA 2E2MA 3K8NA 2H0GA 2CVKA 5B6NA 3FZ4A 3DYRA 4KCAA 4ECIA 2R2JA 2R37A 2CZ2A 1T8EB 2B1LA 4PXOA 1K3OA 1XVQA 3NOFA 2AYTA 1T7PB 3F6FA 5GSTA 4EO3A 1Q4JA 1G6YA 2ALBA 1BEDA 4GTUA 4I6XA 5IIZA 2B6MA 3W6GA 4LLRA 5GAPD 2YV7A 4TRXA 2E2GA 2K6VA 5FWGA 1A23A 1DE2A 3O3TA 3DVWA 4V2NA 3TDGA 3DMLA 1PSQA 1QFNA 2VL2C 3L0HA 3APQA 5ECRB 22GSA 3LYKA 3LSZA 2A2RA 1Z7PA 1X9MB 3J7Yb 1MDKA 3A2WA 5HR3A 2GGTA 3F8UA 1TU7A 2LV3A 3ZTLA 1MDIA 1WP0A 4HEA2 3Q18A 4KGIA 1XBSA 4OWYA 1WE0A 3VWXA 3F0IA 4ILFA 4L0WA 2QC7A 4NWYA 3M9KA 1A24A 1K0NA 3DIEA 1U3IA 4TXOB 3ZRDA 5EVOA 2I3YA 5A4WA 4MP4A 3GH6A 1MDJA 1ZYQB 1SJZA 1TP9A 4IP6A 3FRCA 5GSSA 3BCIA 3TJFA 1SK0A 5G1KA 1OVNA 1SYRA 2I4AA 4ZL7A 1B8XA 3GMFA 2M80A 2B3SA 4K1FA 3GH9A 4BVYA 4D73B 2GSRA 5CRHA 2FNOA 2LUSA 1ZYEA 1SJIA 3H79A 1F3AA 1ML6A 1YZXA 1X9SB 1F37A 2GZPA 16GSA 2L57A 1OAZA 3IOSA 1A2LA 1XWCA 3LXTA 3QFBC 1EEMA 4OD7A 5G30A 4IQ1A 3GTUB 2H71A 1SD9A 4XS6A 1GTIA 5ECHB 2REMA 2RLIA 4XIHA 4IS0A 3WGEA 3A5WA 2GT6A 1SKSB 3RHBA 2F51A 2H1GA 3VI5A 3MAKA 1A0FA 6GSTA 3IBHA 4JU5A 2N5FA 2AHEA 4GSNA 1X9WB 2EC4A 2YZHA 2TIRA 2D2ZA 3H1NA 2HYXA 4L0UA 3UBLA 6GSVA 1GUMA 3H93A 2V1MA 2C0FA 3E0UA 1V57A 1Y6EA 1URMA 2CT6A 3F63A 2TRXA 2FCHA 1HYUA 1O6JA 3VWUA 3QR6A 3I43A 3DGQA 2MMNA 1JZOA 4EE0A 1JFUA 1GULA 4K2DA 2AUVA 1T3BA 1SJ6A 2I9HA 5ECKB 1ERWA 5CAXA 2VL2A 9GSSA 3ZIVA 5CYYA 4HOJA 4MJCA 5A5KA 5DCGA 2FWHA 2HLSA 2PU9C 2DJKA 5DQYA 1ERTA 4EL1A 1IYIA 2XBIA 2WFCA 3ME7A 1XWAA 3FY7A 4CW9A 4EUYA 2WJUA 2H6ZA 1GUHA 4WF5A 1XWBA 3HY2A 2FLSA 2B7KA 3HDCA 1EV9A 2LQOA 4MF7A 3TJGA 3EMXA 1K0BA 1XXUA 3L9UA 1C72A 4MPGA 4JE1A 5IO2A 2L5OA 1J08A 1XWGA 4I5QA 3O6TA 2PVQA 3QOUA 4NAXA 1GSSA 3KTLA 4ZBAA 3ZL5A 4RI7A 2NPBA 1K0OA 5LNKe 1M9AA 4PUAA 1G6WA 2YWIA 4XTSA 3F4SA 1ZGNA 3DXBA 4Q5NA 3CTGA 4XHMA 4WETA 4I2TA 4JBBA 5J3RA 4JRRA 5EY6A 3EU4A 1WIKA 4NPBA 4YQUA 4KSOA 1XZOA 3G9BA 3KH7A 3Q6OA 3HXSA 2MBSA 2LJAA 4YH2A 2VD1A 3A2XA 2ZUPA 1M0UA 1JLVA 2H1AA 1J0FA 4ZB6A 3KD0A 1YDKA 3IV4A 3QD9A 5L71A 5E59A 2XC2A 1SK1A 1GUKA 4H86A 4XS1A 1OC8A 1PMTA 5IPHA 2LSTA 3UVHA 1EOHA 4PNFA 5GZZB 4KCEA 1V40A 1EZKA 3ZMLA 3WD6A 4WKWA 5COHA 1JLWA 4ZB8A 1GH2A 1S3DA 2YZUA 1TRUA 4ML6A 1PKWA 3ZMKA 6GSUA 3TOUA 2B5EA 2H1BA 4KA0A 4E8EA 3EU3A 5ELGA 3PINA 1O85A 2VO4A 3N9JA 1UA5A 2H66A 2G0FA 2G2QA 2QGVA 3C1RA 1QMVA 2IN3A 2PWJA 1GLPA 4Q5RA 4AJ8A 2FWEA 5KEJA 2XPEA 4P3YB 5ID2A 2MBTA 1RK4A 3U5RE 2WGRA 4DSQA 1I9DA 2C0EA 2PN8A 2GQMA 4IELA 2MMZA 3UAPA 3TKRA 4PQIA 3VWVA 3L9VA 2DMMA 2H6XA 2X99A 2JU5A 3IK7A 2DBCA 2GDRA 5ECNB 3TKQA 3GSTA 3ED3A 1AIUA 5EL8A 2MMAA 4QQ7A 11GSA 1XPVA 2MYGA 3ERGA 4N11A 2L6DA 1EP8A 2OKAA 1O8WA 3TGZA 1T4YA 2GT5A 2YWOA 3EMPA 2DIYA 1PQNA 4F0BA 1V98A 4POLA 4L5OA 3M9JA 4MZCA 4TR1A 4XRAA 4POBA 2HE3A 4ECJA 1ZCPA 5IOWA 1XVWA 1UC7A 3KM6A 3Q19A 3QPMA 4O7HA 4OFNA 1Z3EA 4PQ1A 5GAND 4LA1A 4BA7A 4G2EA 1YQ1A 1V9WA 3I9V2 4N0VA 3KH9A 1VF3A 2E0QA 4TN8A 3ZFLA 2OADA 4K0GA 1SL0B 1ERUA 1Z6NA 2K9FA 2MZCA 4ACSA 1E6BA 4V2LA 4CDOA 2VD0A 4GLTA 2HXKA 1KNGA 2L5LA 2DIZA 1ZOFA 1F6MC 3QAGA 2JZTA 5AIXA 2YWMA 2KHPA 3EE2A 1K3LA 2HNLA 2LJRA 2V6OA 3UBKA 2IJYA 3HJPA 1YEPA 2YPMA 4PNGA 2VM2A 3DVXA 2HRFA 1GSDA 1SENA 4WR4A 3LYPA 2OE0A 2IFQA 2H73A 3VWWA 5ECQB 2RIIA 1USBA 4N10A 1A2MA 5HFIA 4QL7A 5ECOB 3RPPA 2J23A 2MMOA 2B1KA 1MD4A 2VLTA 3KP9A 1BX9A 2L6CA 4ZBBA 2A4VA 4OO5A 3FR9A 2EIRA 5AIVA 1E2YA 2N5AA 3I6AA 4YAPA 4OCFA 2P31A 5D9VA 5JCUA 4Z7XA 2JSYA 3LWAA 5KN3A 4NMUA 2XBQA 2QKEA 4MH3A 1GRXA 3GHAA 1ABAA 3FKFA 4MCUA 4TR0A 4K7IA 4MJAA 2E7PA 1WOUA 2HSHA 2RM6A 1YF1A 1UN2A 4ZL9A 3VPQA 2H76A 1G0TA 3TOTA 5DALA 4DSRA 2C4JA 3GX8A 1ILOA 2C0GA 4K0NA 4IVFA 2IMKA 19GSA 5JCGA 3ZVJD 2VCXA 5D9TA 4FYBA 4FIWA 4YQVA 3H4KA 5DAKB 1SD8A 4GCIA 2O85A 5IPGA 2HZFA 2M46A 4IJIA 3FEUA 2LEGA 4DSSB 4O5RA 4BWSA 4NXIA 3BJ5A 2OJLA 2O7KA 1R4WA 1OC9B 20GSA 3GNJA 3LORA 2WRTA 1M99A 4HZ4A 4MZWA 1XFLA 4I2UA 3ERFA 4JEDA 1ACVA 3C7MA 3UEMA 4O32A 4RUVA 3GN3A 3D0ZA 3QDNA 2IIYA 3HYPA 4HS1A 3A3TA 4HU9A 3W8JA 5F05A 5IMAA 2IMDA 5CP1A 1Z5YE 4KX4A 3WYWA 4ZIJA 4OFTA 3BCKA 3ZFBA 1PX6A 4FO5A 1AC1A 3F9UA 3KP8A 2CAIA 4X43A 2OBKA 4EVMA 4EKZA 1XOBA 1MD3A 1R7HA 3FR3A 3KMNA 4MA9A 1ON4A 2X8GA 4XS4B 3TJJA 4PGTA 2V2GA 2P5RA 3NIVA 5INYA 2BMXA 2JACA 1GTBA 2C1YA 3HZ4A 3D4MA 1M7TA 1K0CA 2HFDA 3M8NA 4MJBA 2RUEA 3KTBA 4O92A 4PURA 4MABA 5G1LA 3UL3A 2CVBA 4F0CA 2AJQB 4HQZA 4L8EA 1S3CA 3GX0A 1NHOA 2X64A 2H1DA 4V1Ap 2I81A 2C3QA 3WT2A 2LS5A 1EGOA 3SWLA 3C73A 4YAVA 1U6TA 5ECPB 4YQMA 5ENUA 3FZAA 2DJ2A 2VCTA 3N5OA 4MZBA 5H5RA 2NBSA 4AF2A 1B4QA 2GTUA 1SL2B 3P7XA 1O73A 3Q74A 1FG4A 1M9BA 4GRFA 4IKHA 5IOXA 4TXOA 4WR5A 5DJLA 1GNEA 1ZMAA 2BTOT 4FYUA 5G5FA 2LRNA 3MWHA 2Z9SA 2LNSA 2O89A 3FZ5A 2H01A 2P5QA 3UJ1A 4EDYA 4D73A 2OACA 8GSSA 3I69A 3LEFA 4ZL8A 1XCCA 3IC4A 5JWOB 5DCHA 5IO0A 1NW2A 1VGLA 1TJDA 2F9SA 3CSIA
chains in the Genus database with same CATH superfamily
4O5QA 2HZEB 3QAVA 6GSXA 2DLXA 3G7IA 3F3QA 5KN2A 2KUCA 5CRDA 1XW6A 1XIYA 1OKTA 1Z9HA 5ECIB 2H75A 4BWQA 3GTUA 2LRCA 3TKPA 3UMAA 3LGCA 3UARA 4N30A 4NHWA 2GSTA 2EIOA 2V6KA 3IPZA 1OE8A 3E9JB 3P90A 4LMVA 4NV2A 1TOFA 2NTOA 1HNCA 2A2SA 4JR4A 3C1SA 1FVKA 2YANA 4USSA 1GSUA 1X5DA 2YOIA 1EWXA 3P2AA 1X5CA 3CBUA 1VF2A 4X0XA 4TOPA 4XRDA 4KAEA 4O5UA 2P0GA 3RDWA 3HVVA 4GXZA 1W4VA 1XOAA 1HNBA 3LFLA 4ML1A 1M3IA 2FUG2 5J9BA 3HKRA 2DJ3A 4TR3A 1IYHA 1TKDB 2O87A 3IR4A 2DJ0A 3TRPA 2C3NA 3MNGA 2QSIA 1DE1A 2TRCP 4TKYA 1MTCA 3KCMA 3BBYA 1HD2A 4TXVA 2OA7A 2BJXA 2H6YA 1FAAA 4K5RA 1YF0A 1GP1A 2DKIA 1QK8A 3GIXA 5DQSA 5C04A 3WGXA 2KOKA 3M0FA 2DC5A 3GL3A 3GKKA 3EURA 4EF0A 3RPNA 3WT1A 4KSMA 1YKCA 3LXZA 4K7NA 2IMFA 3GUSA 2LRTA 2YWNA 1TU8A 4WBRD 3IRAA 2H70A 4JZQA 5D9WA 4Q5FA 3L4NA 1O8XA 3APOA 4MF5A 4AGSA 1U88A 4KDXA 3HVSA 2IMEA 1GWCA 4DVCA 4ID0A 3CMIA 3CSHA 4G9HA 3QCPA 2VUPA 4MMMA 2DJJA 1B4PA 5IMVA 2CQ9A 3GFKA 4HJMA 4KE3A 2H19A 4IBPA 2B7JA 2QA1A 4K2XA 1KTEA 4IJ3A 2K8SA 4GQCA 3CRUA 1TI1A 5LD0A 2X8HA 5H5SA 4OCEA 3GSSA 1FB0A 13GSA 2K8VA 1Y25A 4K8MA 3TRXA 3IHQA 1TRVA 1PD21 4ZILA 1Z7RA 4WBJA 3VPTA 5CO3A 2LJKA 2CA8A 4BVXA 1S3AA 3GRXA 4TW5A 1M2BA 1B9XC 2IPAA 4GQFA 5IMFA 3G7YA 18GSA 4V2MA 1B9YC 1TXXA 3TJBA 3FK8A 1JHBA 5CRGA 4ZB9A 4IP1A 3J7Yk 2GS3A 4IGJA 1GSYA 1SK2A 2ON7A 1RW1A 1PRXA 3ISOA 3DKSA 1TK0B 4N0ZA 4HSCX 3M1GA 2VLVA 3MIXA 3US3A 3TRQA 3CTFA 1TRSA 2YJHA 2JSZA 3GL5A 1ZYPA 3CYNA 3VFIA 1DBYA 4IN0A 2YNXA 3HVNA 1BQ7A 3FZ9A 1WRYA 1GTAA 2GQKA 5G5EA 3GURA 2IL3A 2HT9A 3ZIJA 2CX4A 2LQQA 3PGTA 2LKUA 2L4QA 1FB6A 3EWLA 5CRWA 4K7OA 1V2AA 1PGTA 5ECSA 6GSSA 1SKRB 4WEYA 5ECMB 4FH8A 3JCML 4I97A 5HR2A 4HJ2A 3S9FA 1FOVA 2C8UA 1EEJA 3AY8A 3KZQA 5IM9A 3DRNA 1GLQA 4MF6A 1T1VA 3VK9A 2C3TA 3VLNA 4MPFA 1OYJA 6GSYA 1XW5A 3EC3A 4AJ7A 4F9ZA 3M3MA 1B48A 2H30A 2KP2A 3FW2A 2YV9A 2YN1A 5AN1A 4F2IA 4NV5A 3HJMA 4ISDA 1OKDA 4ZBDA 4PX1A 4ECCA 2NVLA 2X49A 1NM3A 2X4AA 4BL7A 1S3RA 2PUKC 1BJXA 3G7JA 4MJEA 4HDEA 1A2JA 5D8IA 2XHFA 2R3XA 3EVIA 2YP6A 3IA1A 4X1UA 2JL4A 1TDIA 3E3EA 1LJRA 3CXGA 1JZDA 2C0DA 2GLRA 1R26A 5DJMA 1KBNA 1FW1A 3P8WA 5J9CA 3ZITA 3RBTA 1FO5A 2JADA 3TCOA 3TB2A 1H75A 4FYCA 3PPUA 5DBQA 2WCIA 4WXTA 7GSSA 5F06A 4BVYB 5F07A 3FHKA 1A8YA 5KOWA 1WWJA 1NHYA 2JZRA 2GZZA 2VIMA 3HVXA 4XCSA 2AV4A 5G31A 1PKZA 1A8LA 3ZYWA 4WF4A 2PGTA 1G7OA 1TI3A 3CQFA 5J5NA 1F3BA 2VCQA 3CRTA 1ST9A 4ZXGA 2R0GA 4KB3A 5D93A 3DWVA 2N5BA 1GL8A 3TKSE 2YCDA 5AISA 1PX7A 3D6IA 5CREA 1UVZA 3KXOA 4G0IA 4G0KA 5D73A 2OE3A 3IXRA 3L9SA 5HFGA 2RM5A 1T00A 4LL1B 5KN0A 4MLYA 2O8VB 3ZVJA 2F8AA 1Q98A 2VL9A 1M2DA 3APSA 1J9BA 3ERWA 1AQWA 2F8FA 4PTSA 3CSJA 3F3RA 1NSWA 2PMTA 2V41A 4LMWA 1U87A 3MSZA 2LNTA 4GF0A 3PR8A 1THOA 1AAZA 1DUGA 3UOMA 3BOAA 3C71A 4EC0A 1VF4A 2VOCA 1CQHA 2RUFA 5DAKA 5A4UA 2GSQA 4E8HA 2FA4A 4DSSA 3O76A 2KLXA 1SYXA 5DVBA 2H8LA 3IK9A 5DDLA 4QL9A 4POMA 3KJYA 1EGRA 1OC9A 4MDCA 5KOXA 1PL2A 3D4TA 1QUWA 1LBKA 4JR6A 1PL1A 2OE1A 12GSA 3IAM2 5F0GA 3C8EA 4HZ2A 2FD3A 2B5YA 4ECBA 4F82A 2H74A 4KUNA 1OE7A 2VCWA 3GYKA 5IMCA 3OR5A 3LQ7A 2GZYA 2YJ7A 2ZNMA 4PUFC 5HR0A 4RQRA 3HCZA 3D5JA 1EOGA 3VI7A 2HI7A 1F9MA 5CNWA 5KN1A 2PERA 3FMWA 4Q5QA 4GWRA 6GSWA 1I5GA 5IQYA 4X4JA 1T4ZA 2IMIA 2PPTA 1ZZYA 2ZCTA 3KIJA 4K9ZA 1H4OA 2H0HA 2ON5A 3MDKA 1R5PA 3KEBA 2V32A 3TKSC 2VCZA 4XS4A 5A4VA 4ULXA 2WS2A 1R5AA 2AAWA 3D21A 3BD2A 3F4RA 2HSYA 5F8BA 3QMXA 1GSQA 3UIWA 1VF1A 2GSSA 2X8CA 5J41A 3NZNA 4NHZA 1HQOA 5IMZA 5JCWA 1O81A 2QA2A 2VL3A 3QFAC 2UZ8A 2XPDA 4KH7A 1SKWB 1GTUA 3F6DA 1EV4A 1X5EA 3LW9A 3A2VA 2PVOC 3F4TA 4K6XA 1ERVA 3GA4A 1CQGA 5JWRB 3VURA 1X0RA 1GNWA 4MK3A 1KEBA 1XG8A 4KW6A 2FY6A 1AW9A 1BAYA 3GKXA 1XWKA 3ZLPA 2OBIA 2R5GA 3EYTA 2H0IA 4OO4A 4AJ6A 5ID2B 3TJKA 2GQLA 3KGKA 1K0MA 4IQAA 5G2ZA 1JZRA 2FHEA 3GV1A 3RAZA 5D9XA 3ZZXA 1K0AA 2VLUA 1TRWA 1K3YA 3HHVA 4GSTA 5FHIA 4L5LA 3HJOA 4KNDA 1YY7A 5HQPA 5AGYA 1AUCA 1RQMA 2CX3A 1Z6MA 4J56E 4DEJA 2HZEA 2FWGA 1N2AA 3LJRA 1G7EA 4PQHA 4EXJA 4I8BA 1HNAA 4TR1B 3HD5A 1YEXA 1PA3A 2L59A 17GSA 2M72A 5ECLB 1TW9A 2AB6A 3PH9A 1O7UA 4RI6A 2B5XA 2WB9A 3HA9A 2CV4A 4KDUA 5E4WA 5J4UA 1OC3A 3UVTA 4TR4A 3FR6A 1TTZA 2J9HA 4OFMA 3TKSA 4IHUA 4MH2A 2PBJA 1EP7A 3W8SA 3EPTA 4KDYA 4G19A 2HRKA 1QQ2A 3IAS2 1ZL9A 4BIKA 2FGXA 5HFKA 3GKMA 4J2FA 1K0DA 3V1WA 5C00A 2ES7A 2IFQB 2KP1A 1FOHA 1DSBA 5B6MA 1XW9A 3FYGA 1BYEA 5H5QA 1W89A 2VM1A 2VCVA 5B8BA 4HI7A 3ZREA 1M2AA 3ME8A 5B7CA 2FA8A 4V1Ag 4F03A 1QGVA 2LTKA 1AQXA 3H8QA 1YJ6A 2WULA 5EPFA 1JZWA 2H72A 1FHEA 2EIQA 1WMJA 5HR1A 4A5PA 4IW9A 2CZ3A 1SU9A 1VRSD 3L78A 5D96A 2R4VA 2DKHA 4G10A 2K18A 4BPYA 1WJKA 4RQXA 1WPIA 1U3AA 2DJ1A 5DALB 10GSA 3SBCA 2WDUA 2I1UA 1MEKA 5BRTA 4EDZA 2FWFA 3KMOA 3TUEA 5ELAA 5LCZA 2CAQA 2R6KA 1LU4A 2JZSA 1A0RP 4TVEA 5IMDA 1FVJA 2DSAA 2DMLA 3U6VA 3LG6A 3R2QA 5ABRA 3IE3A 1YKAA 1AXDA 2F3MA 4POKA 2IWTA 4HU7A 1GSEA 3D22A 2L4CA 3GKNA 4LL4B 5FT3A 4HUAA 3HZ8A 1TK5B 2NDOA 3DEXA 1F2EA 4CY8A 2C80A 3RHCA 4GSSA 1SL1B 1QXHA 3IDVA 2HRNA 3WGDA 1AQVA 2CVDA 1BG5A 4ICYA 5JWQB 2WZ9A 4OMVA 1TK8B 1M3JA 4YKGA 5B8AA 1THXA 14GSA 3DD3A 4CHSA 1N8JA 3QAWA 4J57E 1GSFA 4HQSA 1V58A 3EINA 2GVPA 1PN9A 2VAFA 2E2MA 3K8NA 2H0GA 2CVKA 5B6NA 3FZ4A 3DYRA 4KCAA 4ECIA 2R2JA 2R37A 2CZ2A 1T8EB 2B1LA 4PXOA 1K3OA 1XVQA 3NOFA 2AYTA 1T7PB 3F6FA 5GSTA 4EO3A 1Q4JA 1G6YA 2ALBA 1BEDA 4GTUA 4I6XA 5IIZA 4YKFA 2B6MA 3W6GA 4LLRA 5GAPD 2YV7A 4TRXA 2E2GA 2K6VA 5FWGA 1A23A 1DE2A 3O3TA 3DVWA 4V2NA 3TDGA 3DMLA 1PSQA 1QFNA 2VL2C 3L0HA 3APQA 5BMUA 22GSA 5ECRB 3LYKA 3LSZA 2A2RA 1Z7PA 1X9MB 3J7Yb 1MDKA 3A2WA 5HR3A 2GGTA 3F8UA 1TU7A 2LV3A 4Z2UA 3ZTLA 1MDIA 1WP0A 4HEA2 3Q18A 4KGIA 1XBSA 4OWYA 1WE0A 3VWXA 3F0IA 4ILFA 4L0WA 2QC7A 4NWYA 3M9KA 1A24A 1K0NA 3DIEA 1U3IA 4TXOB 3ZRDA 5EVOA 2I3YA 5A4WA 4MP4A 3GH6A 1MDJA 1ZYQB 1SJZA 1TP9A 4IP6A 3FRCA 5GSSA 3BCIA 3TJFA 1SK0A 4FQUA 5G1KA 1OVNA 1SYRA 2I4AA 4ZL7A 1B8XA 3GMFA 2M80A 2B3SA 4K1FA 3GH9A 4BVYA 4D73B 2GSRA 5CRHA 2FNOA 2LUSA 1ZYEA 2R0PA 1SJIA 3H79A 1F3AA 1ML6A 1YZXA 1X9SB 1F37A 2GZPA 16GSA 2L57A 1OAZA 3IOSA 1A2LA 1XWCA 3LXTA 2A2PA 3QFBC 1EEMA 4OD7A 5G30A 4IQ1A 3GTUB 2H71A 1SD9A 4XS6A 1GTIA 5ECHB 2REMA 2RLIA 4XIHA 1PFOA 4IS0A 3WGEA 3A5WA 2GT6A 1SKSB 3RHBA 2F51A 2H1GA 3VI5A 3MAKA 1A0FA 6GSTA 3IBHA 4JU5A 2N5FA 4Z2TA 2AHEA 4GSNA 1X9WB 2EC4A 2YZHA 2TIRA 2D2ZA 3H1NA 2HYXA 4L0UA 3UBLA 6GSVA 1GUMA 3H93A 2V1MA 2C0FA 3E0UA 1V57A 1Y6EA 1URMA 2CT6A 3F63A 2TRXA 2FCHA 1HYUA 1O6JA 3VWUA 3QR6A 3I43A 3DGQA 2MMNA 1JZOA 4EE0A 1JFUA 1GULA 4K2DA 2AUVA 1T3BA 1SJ6A 2I9HA 5ECKB 1ERWA 5CAXA 2VL2A 9GSSA 3ZIVA 5CYYA 4HOJA 4MJCA 5A5KA 5DCGA 2FWHA 2HLSA 2PU9C 2DJKA 5DQYA 1ERTA 4EL1A 3IHGA 1IYIA 2XBIA 2WFCA 3ME7A 1XWAA 3FY7A 4CW9A 4EUYA 2WJUA 2H6ZA 1GUHA 4WF5A 1XWBA 3HY2A 2FLSA 2B7KA 3HDCA 1EV9A 2LQOA 4MF7A 3TJGA 3EMXA 1K0BA 1ZYNA 1XXUA 4KF9A 3L9UA 1C72A 4MPGA 4JE1A 5IO2A 2L5OA 1J08A 1XWGA 4I5QA 3O6TA 2PVQA 3QOUA 4NAXA 1GSSA 3KTLA 4ZBAA 3ZL5A 4RI7A 2NPBA 1K0OA 5LNKe 1M9AA 4PUAA 1G6WA 2YWIA 4XTSA 3F4SA 1ZGNA 3DXBA 4Q5NA 3CTGA 4XHMA 4WETA 4I2TA 4JBBA 5J3RA 4JRRA 5EY6A 3EU4A 1WIKA 4NPBA 4YQUA 4KSOA 1XZOA 3G9BA 3KH7A 3Q6OA 3HXSA 4BVXB 4MNNA 2MBSA 2LJAA 4YH2A 2VD1A 3A2XA 2ZUPA 1M0UA 1JLVA 2H1AA 1J0FA 4ZB6A 3KD0A 1YDKA 3IV4A 3QD9A 5L71A 5E59A 2XC2A 1SK1A 1GUKA 4H86A 4XS1A 1OC8A 1PMTA 5IPHA 2LSTA 3UVHA 1EOHA 4PNFA 5GZZB 4KCEA 1V40A 1EZKA 3ZMLA 3WD6A 4WKWA 5COHA 1JLWA 4ZB8A 4K5SA 1GH2A 1S3DA 2YZUA 1TRUA 4ML6A 1PKWA 3ZMKA 6GSUA 3TOUA 2B5EA 2H1BA 4KA0A 4E8EA 1PN0A 3EU3A 5ELGA 3PINA 1O85A 2VO4A 3N9JA 1UA5A 2H66A 2G0FA 2G2QA 2QGVA 3C1RA 1QMVA 2IN3A 2PWJA 1GLPA 4Q5RA 4AJ8A 2FWEA 5KEJA 2XPEA 4P3YB 5ID2A 2MBTA 1RK4A 3U5RE 2WGRA 4DSQA 1I9DA 2C0EA 2PN8A 2GQMA 4IELA 2MMZA 3UAPA 3TKRA 4PQIA 3VWVA 3L9VA 2DMMA 2H6XA 2X99A 4G0LA 2JU5A 3IK7A 2DBCA 2GDRA 5ECNB 3TKQA 3GSTA 3ED3A 1AIUA 5EL8A 2MMAA 4QQ7A 11GSA 1XPVA 2MYGA 3ERGA 4N11A 2L6DA 1EP8A 2OKAA 1O8WA 3TGZA 1T4YA 2GT5A 2YWOA 3EMPA 2DIYA 1PQNA 4F0BA 1V98A 4CY6A 4POLA 4L5OA 3M9JA 4BL7B 4MZCA 4TR1A 4XRAA 4POBA 2HE3A 4ECJA 1ZCPA 5IOWA 1XVWA 1UC7A 3KM6A 3Q19A 3QPMA 2HRAA 3R3EA 4O7HA 4OFNA 1Z3EA 4PQ1A 5GAND 4LA1A 4BA7A 4G2EA 1YQ1A 1V9WA 3I9V2 4N0VA 3KH9A 1VF3A 2E0QA 4TN8A 3ZFLA 2OADA 4K0GA 1SL0B 1ERUA 1Z6NA 2K9FA 2MZCA 4ACSA 1E6BA 4V2LA 4CDOA 2VD0A 4GLTA 2HXKA 1KNGA 2L5LA 2DIZA 1ZOFA 1F6MC 3QAGA 2JZTA 5AIXA 2YWMA 2KHPA 3EE2A 1K3LA 2HNLA 2LJRA 2V6OA 3UBKA 2IJYA 3HJPA 1YEPA 2YPMA 4PNGA 2VM2A 3DVXA 2HRFA 1GSDA 1SENA 4WR4A 3LYPA 2OE0A 2IFQA 2H73A 3VWWA 2HSMA 5ECQB 2RIIA 2R0CA 1USBA 4N10A 1A2MA 5HFIA 4QL7A 5ECOB 3RPPA 2J23A 2MMOA 2B1KA 1MD4A 2VLTA 3KP9A 1BX9A 2L6CA 4ZBBA 2A4VA 4OO5A 3FR9A 2EIRA 5AIVA 1E2YA 2N5AA 3A5IA 3I6AA 4YAPA 4OCFA 2P31A 5D9VA 5JCUA 4Z7XA 2JSYA 3LWAA 5KN3A 4NMUA 2XBQA 3MYDA 2QKEA 4MH3A 1GRXA 3GHAA 1ABAA 3FKFA 4EIPA 4MCUA 4TR0A 4K7IA 4MJAA 2E7PA 1WOUA 2HSHA 2RM6A 1YF1A 1UN2A 4ZL9A 3VPQA 2H76A 1G0TA 3TOTA 5DALA 4DSRA 2C4JA 3GX8A 1ILOA 2C0GA 4K0NA 4IVFA 2IMKA 19GSA 5JCGA 3ZVJD 2VCXA 5D9TA 4FYBA 4Z2RA 4FIWA 4YQVA 3H4KA 5DAKB 1SD8A 4GCIA 2O85A 5IPGA 2HZFA 2M46A 4IJIA 3FEUA 2LEGA 4DSSB 4O5RA 4BWSA 4NXIA 3BJ5A 2OJLA 2O7KA 1R4WA 1OC9B 20GSA 3GNJA 3LORA 2WRTA 1M99A 4HZ4A 4MZWA 1XFLA 4I2UA 3ERFA 4JEDA 1ACVA 3C7MA 3UEMA 4O32A 4RUVA 3GN3A 3D0ZA 3QDNA 2IIYA 3HYPA 4HS1A 4EIQA 3A3TA 4HU9A 3W8JA 5F05A 5IMAA 2IMDA 5CP1A 1Z5YE 4KX4A 3WYWA 4ZIJA 4OFTA 3BCKA 3ZFBA 1PX6A 4FO5A 1AC1A 3F9UA 3KP8A 2CAIA 4X43A 2OBKA 4EVMA 4EKZA 1XOBA 1MD3A 1R7HA 3FR3A 3KMNA 4MA9A 1ON4A 2X8GA 4XS4B 3TJJA 4PGTA 2V2GA 2P5RA 3NIVA 5INYA 2BMXA 2JACA 1GTBA 2C1YA 3HZ4A 3D4MA 1M7TA 1K0CA 2HFDA 3M8NA 3IC8A 4MJBA 2RUEA 3KTBA 4O92A 4PURA 4MABA 5G1LA 3UL3A 2CVBA 4F0CA 2AJQB 4HQZA 4L8EA 1S3CA 3GX0A 1NHOA 2X64A 2H1DA 4V1Ap 2I81A 2C3QA 3WT2A 2LS5A 1EGOA 3SWLA 3C73A 4YAVA 1U6TA 5ECPB 4YQMA 5ENUA 3FZAA 2DJ2A 2VCTA 3N5OA 4MZBA 5H5RA 2NBSA 4AF2A 1B4QA 2GTUA 1SL2B 3P7XA 1O73A 3Q74A 1FG4A 1M9BA 4GRFA 4IKHA 5IOXA 4TXOA 4WR5A 5DJLA 1GNEA 1ZMAA 2A4HA 2BTOT 4FYUA 5G5FA 2LRNA 3MWHA 2Z9SA 2LNSA 2O89A 3FZ5A 2H01A 2P5QA 3UJ1A 4EDYA 4D73A 2OACA 8GSSA 3I69A 3LEFA 4ZL8A 1XCCA 3IC4A 5JWOB 5DCHA 5IO0A 1NW2A 1VGLA 1TJDA 2F9SA 3CSIA
chains in the Genus database with same CATH topology
4O5QA 2HZEB 3QAVA 6GSXA 2DLXA 3G7IA 3F3QA 5KN2A 2KUCA 5CRDA 1XW6A 1XIYA 1OKTA 1Z9HA 5ECIB 2H75A 4BWQA 3GTUA 2LRCA 3TKPA 3UMAA 3LGCA 3UARA 4N30A 4NHWA 2GSTA 2EIOA 2V6KA 3IPZA 1OE8A 3E9JB 3P90A 4LMVA 4NV2A 1TOFA 2NTOA 1HNCA 2A2SA 4JR4A 3C1SA 1FVKA 2YANA 4USSA 1GSUA 1X5DA 2YOIA 1EWXA 3P2AA 1X5CA 3CBUA 1VF2A 4X0XA 4TOPA 4XRDA 4KAEA 4O5UA 2P0GA 3RDWA 3HVVA 4GXZA 1W4VA 1XOAA 1HNBA 3LFLA 4ML1A 2FUG2 5J9BA 3HKRA 2DJ3A 4TR3A 1IYHA 1TKDB 2O87A 3IR4A 2DJ0A 3TRPA 2C3NA 3MNGA 2QSIA 1DE1A 2TRCP 4TKYA 1MTCA 3KCMA 3BBYA 1HD2A 4TXVA 2OA7A 2BJXA 2H6YA 1FAAA 4K5RA 1YF0A 1GP1A 2DKIA 1QK8A 3GIXA 5DQSA 5C04A 3WGXA 2KOKA 3M0FA 2DC5A 3GL3A 3GKKA 3EURA 4EF0A 3RPNA 3WT1A 4KSMA 1YKCA 3LXZA 4K7NA 2IMFA 3GUSA 2LRTA 2YWNA 1TU8A 4WBRD 3IRAA 2H70A 4JZQA 5D9WA 4Q5FA 3L4NA 1O8XA 3APOA 4MF5A 4AGSA 1U88A 4KDXA 3HVSA 2IMEA 1GWCA 4DVCA 4ID0A 3CMIA 3CSHA 4G9HA 3QCPA 2VUPA 4MMMA 2DJJA 1B4PA 5IMVA 2CQ9A 3GFKA 4HJMA 4KE3A 2H19A 4IBPA 2B7JA 2QA1A 4K2XA 1KTEA 4IJ3A 2K8SA 4GQCA 3CRUA 1TI1A 5LD0A 2X8HA 5H5SA 4OCEA 3GSSA 1FB0A 13GSA 2K8VA 1Y25A 4K8MA 3TRXA 3IHQA 1TRVA 1PD21 4ZILA 1Z7RA 4WBJA 3VPTA 5CO3A 2LJKA 2CA8A 4BVXA 1S3AA 3GRXA 4TW5A 1M2BA 1B9XC 2IPAA 4GQFA 5IMFA 3G7YA 18GSA 4V2MA 1B9YC 1TXXA 3TJBA 3FK8A 1JHBA 5CRGA 4ZB9A 4IP1A 3J7Yk 2GS3A 4IGJA 1GSYA 1SK2A 2ON7A 1RW1A 1PRXA 3ISOA 3DKSA 1TK0B 4N0ZA 3M1GA 2VLVA 3MIXA 3US3A 3TRQA 3CTFA 1TRSA 2YJHA 2JSZA 3GL5A 1ZYPA 3CYNA 3VFIA 1DBYA 4IN0A 2YNXA 1BQ7A 3FZ9A 1WRYA 1GTAA 2GQKA 5G5EA 3GURA 2IL3A 2HT9A 3ZIJA 2CX4A 2LQQA 3PGTA 2LKUA 2L4QA 1FB6A 3EWLA 5CRWA 4K7OA 1V2AA 1PGTA 5ECSA 6GSSA 1SKRB 4WEYA 5ECMB 4FH8A 3JCML 4I97A 5HR2A 4HJ2A 3S9FA 1FOVA 2C8UA 1EEJA 3AY8A 3KZQA 5IM9A 3DRNA 1GLQA 4MF6A 1T1VA 3VK9A 2C3TA 3VLNA 4MPFA 1OYJA 6GSYA 1XW5A 3EC3A 4AJ7A 4F9ZA 3M3MA 1B48A 2H30A 2KP2A 3FW2A 2YV9A 2YN1A 5AN1A 4F2IA 4NV5A 3HJMA 4ISDA 1OKDA 4ZBDA 4PX1A 4ECCA 2NVLA 2X49A 1NM3A 2X4AA 4BL7A 2PUKC 1BJXA 3G7JA 4MJEA 4HDEA 1A2JA 5D8IA 2XHFA 2R3XA 3EVIA 2YP6A 3IA1A 4X1UA 2JL4A 1TDIA 3E3EA 1LJRA 3CXGA 1JZDA 2C0DA 2GLRA 1R26A 5DJMA 1KBNA 1FW1A 3P8WA 5J9CA 3ZITA 3RBTA 1FO5A 2JADA 3TCOA 3TB2A 1H75A 4FYCA 3PPUA 5DBQA 2WCIA 4WXTA 7GSSA 5F06A 4BVYB 5F07A 3FHKA 1A8YA 5KOWA 1WWJA 1NHYA 2JZRA 2GZZA 2VIMA 3HVXA 4XCSA 2AV4A 5G31A 1PKZA 1A8LA 3ZYWA 4WF4A 2PGTA 1G7OA 1TI3A 5J5NA 1F3BA 2VCQA 3CRTA 1ST9A 4ZXGA 2R0GA 4KB3A 5D93A 3DWVA 2N5BA 1GL8A 3TKSE 2YCDA 5AISA 1PX7A 3D6IA 5CREA 1UVZA 3KXOA 4G0IA 4G0KA 5D73A 2OE3A 3IXRA 3L9SA 5HFGA 2RM5A 1T00A 4LL1B 5KN0A 4MLYA 2O8VB 3ZVJA 2F8AA 1Q98A 2VL9A 1M2DA 3APSA 1J9BA 3ERWA 1AQWA 2F8FA 4PTSA 3CSJA 3F3RA 1NSWA 2PMTA 2V41A 4LMWA 1U87A 3MSZA 2LNTA 4GF0A 3PR8A 1THOA 1AAZA 1DUGA 3UOMA 3BOAA 3C71A 4EC0A 1VF4A 2VOCA 1CQHA 2RUFA 5DAKA 5A4UA 2GSQA 4E8HA 2FA4A 4DSSA 3O76A 2KLXA 1SYXA 5DVBA 2H8LA 3IK9A 5DDLA 4QL9A 4POMA 3KJYA 1EGRA 1OC9A 4MDCA 5KOXA 1PL2A 3D4TA 1QUWA 1LBKA 4JR6A 1PL1A 2OE1A 12GSA 3IAM2 5F0GA 3C8EA 4HZ2A 2FD3A 2B5YA 4ECBA 4F82A 2H74A 4KUNA 1OE7A 2VCWA 3GYKA 5IMCA 3OR5A 3LQ7A 2GZYA 2YJ7A 2ZNMA 4PUFC 5HR0A 4RQRA 3HCZA 3D5JA 1EOGA 3VI7A 2HI7A 1F9MA 5CNWA 5KN1A 2PERA 3FMWA 4Q5QA 4GWRA 6GSWA 1I5GA 5IQYA 4X4JA 1T4ZA 2IMIA 2PPTA 1ZZYA 2ZCTA 3KIJA 4K9ZA 1H4OA 2H0HA 2ON5A 3MDKA 1R5PA 3KEBA 2V32A 3TKSC 2VCZA 4XS4A 5A4VA 4ULXA 2WS2A 1R5AA 2AAWA 3D21A 3BD2A 3F4RA 2HSYA 5F8BA 3QMXA 1GSQA 3UIWA 1VF1A 2GSSA 2X8CA 5J41A 3NZNA 4NHZA 1HQOA 5IMZA 5JCWA 1O81A 2QA2A 2VL3A 3QFAC 2UZ8A 2XPDA 4KH7A 1SKWB 1GTUA 3F6DA 1EV4A 1X5EA 3LW9A 3A2VA 2PVOC 3F4TA 4K6XA 1ERVA 3GA4A 1CQGA 5JWRB 3VURA 1X0RA 1GNWA 4MK3A 1KEBA 4KW6A 2FY6A 1AW9A 1BAYA 3GKXA 1XWKA 3ZLPA 2OBIA 2R5GA 3EYTA 2H0IA 4OO4A 4AJ6A 5ID2B 3TJKA 2GQLA 3KGKA 1K0MA 4IQAA 5G2ZA 1JZRA 2FHEA 3GV1A 3RAZA 5D9XA 3ZZXA 1K0AA 2VLUA 1TRWA 1K3YA 3HHVA 4GSTA 5FHIA 4L5LA 3HJOA 4KNDA 1YY7A 5HQPA 5AGYA 1AUCA 1RQMA 2CX3A 1Z6MA 4J56E 4DEJA 2HZEA 2FWGA 1N2AA 3LJRA 1G7EA 4PQHA 4EXJA 4I8BA 1HNAA 4TR1B 3HD5A 1YEXA 1PA3A 2L59A 17GSA 2M72A 5ECLB 1TW9A 2AB6A 3PH9A 1O7UA 4RI6A 2B5XA 2WB9A 3HA9A 2CV4A 4KDUA 5E4WA 5J4UA 1OC3A 3UVTA 4TR4A 3FR6A 1TTZA 2J9HA 4OFMA 3TKSA 4IHUA 4MH2A 2PBJA 1EP7A 3W8SA 3EPTA 4KDYA 4G19A 2HRKA 1QQ2A 3IAS2 1ZL9A 2FGXA 5HFKA 3GKMA 4J2FA 1K0DA 3V1WA 5C00A 2ES7A 2IFQB 2KP1A 1FOHA 1DSBA 5B6MA 1XW9A 3FYGA 1BYEA 5H5QA 1W89A 2VM1A 2VCVA 5B8BA 4HI7A 3ZREA 1M2AA 3ME8A 5B7CA 2FA8A 4V1Ag 4F03A 1QGVA 2LTKA 1AQXA 3H8QA 1YJ6A 2WULA 5EPFA 1JZWA 2H72A 1FHEA 2EIQA 1WMJA 5HR1A 4A5PA 4IW9A 2CZ3A 1SU9A 1VRSD 3L78A 5D96A 2R4VA 2DKHA 4G10A 2K18A 4BPYA 1WJKA 4RQXA 1WPIA 1U3AA 2DJ1A 5DALB 10GSA 3SBCA 2WDUA 2I1UA 1MEKA 5BRTA 4EDZA 2FWFA 3KMOA 3TUEA 5ELAA 5LCZA 2CAQA 2R6KA 1LU4A 2JZSA 1A0RP 4TVEA 5IMDA 1FVJA 2DSAA 2DMLA 3U6VA 3LG6A 3R2QA 5ABRA 3IE3A 1YKAA 1AXDA 2F3MA 4POKA 2IWTA 4HU7A 1GSEA 3D22A 2L4CA 3GKNA 4LL4B 5FT3A 4HUAA 3HZ8A 1TK5B 2NDOA 3DEXA 1F2EA 4CY8A 2C80A 3RHCA 4GSSA 1SL1B 1QXHA 3IDVA 2HRNA 3WGDA 1AQVA 2CVDA 1BG5A 4ICYA 5JWQB 2WZ9A 4OMVA 1TK8B 4YKGA 5B8AA 1THXA 14GSA 3DD3A 4CHSA 1N8JA 3QAWA 4J57E 1GSFA 4HQSA 1V58A 3EINA 2GVPA 1PN9A 2VAFA 2E2MA 3K8NA 2H0GA 2CVKA 5B6NA 3FZ4A 3DYRA 4KCAA 4ECIA 2R2JA 2R37A 2CZ2A 1T8EB 2B1LA 4PXOA 1K3OA 1XVQA 3NOFA 2AYTA 1T7PB 3F6FA 5GSTA 4EO3A 1Q4JA 1G6YA 2ALBA 1BEDA 4GTUA 4I6XA 5IIZA 4YKFA 2B6MA 3W6GA 4LLRA 5GAPD 2YV7A 4TRXA 2E2GA 2K6VA 5FWGA 1A23A 1DE2A 3O3TA 3DVWA 4V2NA 3TDGA 3DMLA 1PSQA 1QFNA 2VL2C 3L0HA 3APQA 5BMUA 22GSA 5ECRB 3LYKA 3LSZA 2A2RA 1Z7PA 1X9MB 3J7Yb 1MDKA 3A2WA 5HR3A 2GGTA 3F8UA 1TU7A 2LV3A 4Z2UA 3ZTLA 1MDIA 1WP0A 4HEA2 3Q18A 4KGIA 1XBSA 4OWYA 1WE0A 3VWXA 3F0IA 4ILFA 4L0WA 2QC7A 4NWYA 3M9KA 1A24A 1K0NA 3DIEA 1U3IA 4TXOB 3ZRDA 5EVOA 2I3YA 5A4WA 4MP4A 3GH6A 1MDJA 1ZYQB 1SJZA 1TP9A 4IP6A 3FRCA 5GSSA 3BCIA 3TJFA 1SK0A 4FQUA 5G1KA 1OVNA 1SYRA 2I4AA 4ZL7A 1B8XA 3GMFA 2M80A 2B3SA 4K1FA 3GH9A 4BVYA 4D73B 2GSRA 5CRHA 2FNOA 2LUSA 1ZYEA 2R0PA 1SJIA 3H79A 1F3AA 1ML6A 1YZXA 1X9SB 1F37A 2GZPA 16GSA 2L57A 1OAZA 3IOSA 1A2LA 1XWCA 3LXTA 2A2PA 3QFBC 1EEMA 4OD7A 5G30A 4IQ1A 3GTUB 2H71A 1SD9A 4XS6A 1GTIA 5ECHB 2REMA 2RLIA 4XIHA 4IS0A 3WGEA 3A5WA 2GT6A 1SKSB 3RHBA 2F51A 2H1GA 3VI5A 3MAKA 1A0FA 6GSTA 3IBHA 4JU5A 2N5FA 4Z2TA 2AHEA 4GSNA 1X9WB 2EC4A 2YZHA 2TIRA 2D2ZA 3H1NA 2HYXA 4L0UA 3UBLA 6GSVA 1GUMA 3H93A 2V1MA 2C0FA 3E0UA 1V57A 1Y6EA 1URMA 2CT6A 3F63A 2TRXA 2FCHA 1HYUA 1O6JA 3VWUA 3QR6A 3I43A 3DGQA 2MMNA 1JZOA 4EE0A 1JFUA 1GULA 4K2DA 2AUVA 1T3BA 1SJ6A 2I9HA 5ECKB 1ERWA 5CAXA 2VL2A 9GSSA 3ZIVA 5CYYA 4HOJA 4MJCA 5A5KA 5DCGA 2FWHA 2HLSA 2PU9C 2DJKA 5DQYA 1ERTA 4EL1A 3IHGA 1IYIA 2XBIA 2WFCA 3ME7A 1XWAA 3FY7A 4CW9A 4EUYA 2WJUA 2H6ZA 1GUHA 4WF5A 1XWBA 3HY2A 2FLSA 2B7KA 3HDCA 1EV9A 2LQOA 4MF7A 3TJGA 3EMXA 1K0BA 1ZYNA 1XXUA 4KF9A 3L9UA 1C72A 4MPGA 4JE1A 5IO2A 2L5OA 1J08A 1XWGA 4I5QA 3O6TA 2PVQA 3QOUA 4NAXA 1GSSA 3KTLA 4ZBAA 3ZL5A 4RI7A 2NPBA 1K0OA 5LNKe 1M9AA 4PUAA 1G6WA 2YWIA 4XTSA 3F4SA 1ZGNA 3DXBA 4Q5NA 3CTGA 4XHMA 4WETA 4I2TA 4JBBA 5J3RA 4JRRA 5EY6A 3EU4A 1WIKA 4NPBA 4YQUA 4KSOA 1XZOA 3G9BA 3KH7A 3Q6OA 3HXSA 4BVXB 4MNNA 2MBSA 2LJAA 4YH2A 2VD1A 3A2XA 2ZUPA 1M0UA 1JLVA 2H1AA 1J0FA 4ZB6A 3KD0A 1YDKA 3IV4A 3QD9A 5L71A 5E59A 2XC2A 1SK1A 1GUKA 4H86A 4XS1A 1OC8A 1PMTA 5IPHA 2LSTA 3UVHA 1EOHA 4PNFA 5GZZB 4KCEA 1V40A 1EZKA 3ZMLA 3WD6A 4WKWA 5COHA 1JLWA 4ZB8A 4K5SA 1GH2A 1S3DA 2YZUA 1TRUA 4ML6A 1PKWA 3ZMKA 6GSUA 3TOUA 2B5EA 2H1BA 4KA0A 4E8EA 1PN0A 3EU3A 5ELGA 3PINA 1O85A 2VO4A 3N9JA 1UA5A 2H66A 2G0FA 2G2QA 2QGVA 3C1RA 1QMVA 2IN3A 2PWJA 1GLPA 4Q5RA 4AJ8A 2FWEA 5KEJA 2XPEA 4P3YB 5ID2A 2MBTA 1RK4A 3U5RE 2WGRA 4DSQA 1I9DA 2C0EA 2PN8A 2GQMA 4IELA 2MMZA 3UAPA 3TKRA 4PQIA 3VWVA 3L9VA 2DMMA 2H6XA 2X99A 4G0LA 2JU5A 3IK7A 2DBCA 2GDRA 5ECNB 3TKQA 3GSTA 3ED3A 1AIUA 5EL8A 2MMAA 4QQ7A 11GSA 1XPVA 2MYGA 3ERGA 4N11A 2L6DA 1EP8A 2OKAA 1O8WA 3TGZA 1T4YA 2GT5A 2YWOA 3EMPA 2DIYA 1PQNA 4F0BA 1V98A 4CY6A 4POLA 4L5OA 3M9JA 4BL7B 4MZCA 4TR1A 4XRAA 4POBA 2HE3A 4ECJA 1ZCPA 5IOWA 1XVWA 1UC7A 3KM6A 3Q19A 3QPMA 2HRAA 3R3EA 4O7HA 4OFNA 1Z3EA 4PQ1A 5GAND 4LA1A 4BA7A 4G2EA 1YQ1A 1V9WA 3I9V2 4N0VA 3KH9A 1VF3A 2E0QA 4TN8A 3ZFLA 2OADA 4K0GA 1SL0B 1ERUA 1Z6NA 2K9FA 2MZCA 4ACSA 1E6BA 4V2LA 4CDOA 2VD0A 4GLTA 2HXKA 1KNGA 2L5LA 2DIZA 1ZOFA 1F6MC 3QAGA 2JZTA 5AIXA 2YWMA 2KHPA 3EE2A 1K3LA 2HNLA 2LJRA 2V6OA 3UBKA 2IJYA 3HJPA 1YEPA 2YPMA 4PNGA 2VM2A 3DVXA 2HRFA 1GSDA 1SENA 4WR4A 3LYPA 2OE0A 2IFQA 2H73A 3VWWA 2HSMA 5ECQB 2RIIA 2R0CA 1USBA 4N10A 1A2MA 5HFIA 4QL7A 5ECOB 3RPPA 2J23A 2MMOA 2B1KA 1MD4A 2VLTA 3KP9A 1BX9A 2L6CA 4ZBBA 2A4VA 4OO5A 3FR9A 2EIRA 5AIVA 1E2YA 2N5AA 3A5IA 3I6AA 4YAPA 4OCFA 2P31A 5D9VA 5JCUA 4Z7XA 2JSYA 3LWAA 5KN3A 4NMUA 2XBQA 3MYDA 2QKEA 4MH3A 1GRXA 3GHAA 1ABAA 3FKFA 4EIPA 4MCUA 4TR0A 4K7IA 4MJAA 2E7PA 1WOUA 2HSHA 2RM6A 1YF1A 1UN2A 4ZL9A 3VPQA 2H76A 1G0TA 3TOTA 5DALA 4DSRA 2C4JA 3GX8A 1ILOA 2C0GA 4K0NA 4IVFA 2IMKA 19GSA 5JCGA 3ZVJD 2VCXA 5D9TA 4FYBA 4Z2RA 4FIWA 4YQVA 3H4KA 5DAKB 1SD8A 4GCIA 2O85A 5IPGA 2HZFA 2M46A 4IJIA 3FEUA 2LEGA 4DSSB 4O5RA 4BWSA 4NXIA 3BJ5A 2OJLA 2O7KA 1R4WA 1OC9B 20GSA 3GNJA 3LORA 2WRTA 1M99A 4HZ4A 4MZWA 1XFLA 4I2UA 3ERFA 4JEDA 1ACVA 3C7MA 3UEMA 4O32A 4RUVA 3GN3A 3D0ZA 3QDNA 2IIYA 3HYPA 4HS1A 4EIQA 3A3TA 4HU9A 3W8JA 5F05A 5IMAA 2IMDA 5CP1A 1Z5YE 4KX4A 3WYWA 4ZIJA 4OFTA 3BCKA 3ZFBA 1PX6A 4FO5A 1AC1A 3F9UA 3KP8A 2CAIA 4X43A 2OBKA 4EVMA 4EKZA 1XOBA 1MD3A 1R7HA 3FR3A 3KMNA 4MA9A 1ON4A 2X8GA 4XS4B 3TJJA 4PGTA 2V2GA 2P5RA 3NIVA 5INYA 2BMXA 2JACA 1GTBA 2C1YA 3HZ4A 3D4MA 1M7TA 1K0CA 2HFDA 3M8NA 3IC8A 4MJBA 2RUEA 3KTBA 4O92A 4PURA 4MABA 5G1LA 3UL3A 2CVBA 4F0CA 2AJQB 4HQZA 4L8EA 1S3CA 3GX0A 1NHOA 2X64A 2H1DA 4V1Ap 2I81A 2C3QA 3WT2A 2LS5A 1EGOA 3SWLA 3C73A 4YAVA 1U6TA 5ECPB 4YQMA 5ENUA 3FZAA 2DJ2A 2VCTA 3N5OA 4MZBA 5H5RA 2NBSA 4AF2A 1B4QA 2GTUA 1SL2B 3P7XA 1O73A 3Q74A 1FG4A 1M9BA 4GRFA 4IKHA 5IOXA 4TXOA 4WR5A 5DJLA 1GNEA 1ZMAA 2A4HA 2BTOT 4FYUA 5G5FA 2LRNA 3MWHA 2Z9SA 2LNSA 2O89A 3FZ5A 2H01A 2P5QA 3UJ1A 4EDYA 4D73A 2OACA 8GSSA 3I69A 3LEFA 4ZL8A 1XCCA 3IC4A 5JWOB 5DCHA 5IO0A 1NW2A 1VGLA 1TJDA 2F9SA 3CSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZE B;  3QAV A;  6GSX A;  2DLX A;  3G7I A;  3F3Q A;  5KN2 A;  2KUC A;  5CRD A;  1XW6 A;  1XIY A;  1OKT A;  1Z9H A;  5ECI B;  2H75 A;  4BWQ A;  3GTU A;  2LRC A;  3TKP A;  3UMA A;  3LGC A;  3UAR A;  4N30 A;  4NHW A;  2GST A;  2EIO A;  2V6K A;  3IPZ A;  1OE8 A;  3E9J B;  3P90 A;  4LMV A;  4NV2 A;  1TOF A;  2NTO A;  1HNC A;  2A2S A;  4JR4 A;  3C1S A;  1FVK A;  2YAN A;  1GSU A;  1X5D A;  2YOI A;  1EWX A;  3P2A A;  1X5C A;  3CBU A;  1VF2 A;  4X0X A;  4TOP A;  4XRD A;  4KAE A;  2P0G A;  3RDW A;  3HVV A;  4GXZ A;  1W4V A;  1XOA A;  1HNB A;  3LFL A;  4ML1 A;  2FUG 2;  5J9B A;  3HKR A;  2DJ3 A;  4TR3 A;  1IYH A;  1TKD B;  2O87 A;  3IR4 A;  2DJ0 A;  3TRP A;  2C3N A;  3MNG A;  2QSI A;  1DE1 A;  2TRC P;  4TKY A;  1MTC A;  3KCM A;  3BBY A;  1HD2 A;  4TXV A;  2OA7 A;  2BJX A;  2H6Y A;  1FAA A;  1YF0 A;  1GP1 A;  1QK8 A;  3GIX A;  5DQS A;  5C04 A;  3WGX A;  2KOK A;  3M0F A;  2DC5 A;  3GL3 A;  3GKK A;  3EUR A;  4EF0 A;  3RPN A;  3WT1 A;  4KSM A;  1YKC A;  3LXZ A;  4K7N A;  2IMF A;  3GUS A;  2LRT A;  2YWN A;  1TU8 A;  4WBR D;  3IRA A;  2H70 A;  4JZQ A;  5D9W A;  4Q5F A;  3L4N A;  1O8X A;  3APO A;  4MF5 A;  4AGS A;  1U88 A;  4KDX A;  3HVS A;  2IME A;  1GWC A;  4DVC A;  4ID0 A;  3CMI A;  3CSH A;  4G9H A;  3QCP A;  2VUP A;  4MMM A;  2DJJ A;  1B4P A;  5IMV A;  2CQ9 A;  3GFK A;  4HJM A;  4KE3 A;  2H19 A;  4IBP A;  2B7J A;  1KTE A;  4IJ3 A;  2K8S A;  4GQC A;  3CRU A;  1TI1 A;  5LD0 A;  2X8H A;  5H5S A;  4OCE A;  3GSS A;  1FB0 A;  13GS A;  2K8V A;  1Y25 A;  4K8M A;  3TRX A;  3IHQ A;  1TRV A;  1PD2 1;  4ZIL A;  1Z7R A;  4WBJ A;  3VPT A;  5CO3 A;  2LJK A;  2CA8 A;  4BVX A;  1S3A A;  3GRX A;  4TW5 A;  1M2B A;  1B9X C;  2IPA A;  4GQF A;  5IMF A;  3G7Y A;  18GS A;  4V2M A;  1B9Y C;  1TXX A;  3TJB A;  3FK8 A;  1JHB A;  5CRG A;  4ZB9 A;  4IP1 A;  3J7Y k;  2GS3 A;  4IGJ A;  1GSY A;  1SK2 A;  2ON7 A;  1RW1 A;  1PRX A;  3ISO A;  3DKS A;  1TK0 B;  4N0Z A;  3M1G A;  2VLV A;  3US3 A;  3TRQ A;  3CTF A;  1TRS A;  2YJH A;  2JSZ A;  3GL5 A;  3CYN A;  3VFI A;  1DBY A;  4IN0 A;  2YNX A;  1BQ7 A;  3FZ9 A;  1WRY A;  1GTA A;  2GQK A;  5G5E A;  3GUR A;  2IL3 A;  2HT9 A;  3ZIJ A;  2CX4 A;  2LQQ A;  3PGT A;  2LKU A;  2L4Q A;  1FB6 A;  3EWL A;  5CRW A;  4K7O A;  1V2A A;  1PGT A;  5ECS A;  6GSS A;  1SKR B;  4WEY A;  5ECM B;  4FH8 A;  3JCM L;  4I97 A;  5HR2 A;  4HJ2 A;  3S9F A;  1FOV A;  2C8U A;  1EEJ A;  3AY8 A;  3KZQ A;  5IM9 A;  3DRN A;  1GLQ A;  4MF6 A;  1T1V A;  3VK9 A;  2C3T A;  3VLN A;  4MPF A;  1OYJ A;  6GSY A;  1XW5 A;  3EC3 A;  4AJ7 A;  4F9Z A;  3M3M A;  1B48 A;  2H30 A;  2KP2 A;  3FW2 A;  2YV9 A;  2YN1 A;  5AN1 A;  4F2I A;  4NV5 A;  3HJM A;  4ISD A;  1OKD A;  4ZBD A;  4PX1 A;  4ECC A;  2NVL A;  1NM3 A;  4BL7 A;  2PUK C;  1BJX A;  3G7J A;  4MJE A;  4HDE A;  1A2J A;  5D8I A;  2XHF A;  2R3X A;  3EVI A;  2YP6 A;  3IA1 A;  4X1U A;  2JL4 A;  1TDI A;  3E3E A;  1LJR A;  3CXG A;  1JZD A;  2C0D A;  2GLR A;  1R26 A;  5DJM A;  1KBN A;  1FW1 A;  3P8W A;  5J9C A;  3ZIT A;  3RBT A;  1FO5 A;  2JAD A;  3TCO A;  3TB2 A;  1H75 A;  4FYC A;  5DBQ A;  2WCI A;  4WXT A;  7GSS A;  5F06 A;  5F07 A;  3FHK A;  1A8Y A;  1WWJ A;  1NHY A;  2JZR A;  2GZZ A;  2VIM A;  3HVX A;  4XCS A;  2AV4 A;  5G31 A;  1PKZ A;  1A8L A;  3ZYW A;  4WF4 A;  2PGT A;  1G7O A;  1TI3 A;  5J5N A;  1F3B A;  2VCQ A;  3CRT A;  1ST9 A;  4ZXG A;  4KB3 A;  5D93 A;  3DWV A;  2N5B A;  1GL8 A;  3TKS E;  2YCD A;  5AIS A;  1PX7 A;  3D6I A;  5CRE A;  1UVZ A;  3KXO A;  5D73 A;  2OE3 A;  3IXR A;  3L9S A;  5HFG A;  2RM5 A;  1T00 A;  4LL1 B;  5KN0 A;  4MLY A;  2O8V B;  3ZVJ A;  2F8A A;  1Q98 A;  2VL9 A;  1M2D A;  3APS A;  1J9B A;  3ERW A;  1AQW A;  2F8F A;  3CSJ A;  3F3R A;  1NSW A;  2PMT A;  2V41 A;  4LMW A;  1U87 A;  3MSZ A;  2LNT A;  4GF0 A;  3PR8 A;  1THO A;  1AAZ A;  1DUG A;  3UOM A;  3BOA A;  3C71 A;  4EC0 A;  1VF4 A;  2VOC A;  1CQH A;  2RUF A;  5DAK A;  5A4U A;  2GSQ A;  4E8H A;  2FA4 A;  4DSS A;  3O76 A;  2KLX A;  1SYX A;  5DVB A;  2H8L A;  3IK9 A;  5DDL A;  4QL9 A;  4POM A;  3KJY A;  1EGR A;  1OC9 A;  4MDC A;  1PL2 A;  3D4T A;  1QUW A;  1LBK A;  4JR6 A;  1PL1 A;  2OE1 A;  12GS A;  3IAM 2;  5F0G A;  3C8E A;  4HZ2 A;  2FD3 A;  2B5Y A;  4ECB A;  4F82 A;  2H74 A;  4KUN A;  1OE7 A;  2VCW A;  3GYK A;  5IMC A;  3OR5 A;  3LQ7 A;  2GZY A;  2YJ7 A;  2ZNM A;  4PUF C;  5HR0 A;  4RQR A;  3HCZ A;  3D5J A;  1EOG A;  3VI7 A;  2HI7 A;  1F9M A;  5CNW A;  5KN1 A;  2PER A;  4Q5Q A;  4GWR A;  6GSW A;  1I5G A;  5IQY A;  1T4Z A;  2IMI A;  2PPT A;  1ZZY A;  2ZCT A;  3KIJ A;  4K9Z A;  1H4O A;  2H0H A;  2ON5 A;  3MDK A;  1R5P A;  3KEB A;  2V32 A;  3TKS C;  2VCZ A;  4XS4 A;  5A4V A;  4ULX A;  2WS2 A;  1R5A A;  2AAW A;  3D21 A;  3BD2 A;  3F4R A;  2HSY A;  5F8B A;  3QMX A;  1GSQ A;  3UIW A;  1VF1 A;  2GSS A;  2X8C A;  5J41 A;  3NZN A;  4NHZ A;  1HQO A;  5IMZ A;  5JCW A;  1O81 A;  2VL3 A;  3QFA C;  2XPD A;  4KH7 A;  1SKW B;  1GTU A;  3F6D A;  1EV4 A;  1X5E A;  3A2V A;  2PVO C;  3F4T A;  4K6X A;  1ERV A;  3GA4 A;  1CQG A;  5JWR B;  3VUR A;  1X0R A;  1GNW A;  4MK3 A;  1KEB A;  4KW6 A;  2FY6 A;  1AW9 A;  1BAY A;  3GKX A;  1XWK A;  3ZLP A;  2OBI A;  2R5G A;  3EYT A;  2H0I A;  4OO4 A;  4AJ6 A;  5ID2 B;  3TJK A;  2GQL A;  3KGK A;  1K0M A;  4IQA A;  5G2Z A;  1JZR A;  2FHE A;  3GV1 A;  3RAZ A;  5D9X A;  3ZZX A;  1K0A A;  2VLU A;  1TRW A;  1K3Y A;  3HHV A;  4GST A;  5FHI A;  4L5L A;  3HJO A;  4KND A;  1YY7 A;  5HQP A;  5AGY A;  1AUC A;  1RQM A;  2CX3 A;  1Z6M A;  4J56 E;  4DEJ A;  2HZE A;  2FWG A;  1N2A A;  3LJR A;  1G7E A;  4PQH A;  4EXJ A;  4I8B A;  1HNA A;  4TR1 B;  3HD5 A;  1YEX A;  1PA3 A;  2L59 A;  17GS A;  2M72 A;  5ECL B;  1TW9 A;  2AB6 A;  3PH9 A;  1O7U A;  4RI6 A;  2B5X A;  2WB9 A;  3HA9 A;  2CV4 A;  4KDU A;  5E4W A;  5J4U A;  1OC3 A;  3UVT A;  4TR4 A;  3FR6 A;  1TTZ A;  2J9H A;  4OFM A;  3TKS A;  4IHU A;  4MH2 A;  2PBJ A;  1EP7 A;  3W8S A;  4KDY A;  4G19 A;  1QQ2 A;  3IAS 2;  1ZL9 A;  2FGX A;  5HFK A;  3GKM A;  4J2F A;  1K0D A;  3V1W A;  5C00 A;  2ES7 A;  2IFQ B;  2KP1 A;  1DSB A;  5B6M A;  1XW9 A;  3FYG A;  1BYE A;  5H5Q A;  1W89 A;  2VM1 A;  2VCV A;  5B8B A;  4HI7 A;  3ZRE A;  1M2A A;  3ME8 A;  5B7C A;  2FA8 A;  4V1A g;  4F03 A;  1QGV A;  2LTK A;  1AQX A;  3H8Q A;  1YJ6 A;  2WUL A;  5EPF A;  1JZW A;  2H72 A;  1FHE A;  2EIQ A;  1WMJ A;  5HR1 A;  4IW9 A;  2CZ3 A;  1SU9 A;  1VRS D;  3L78 A;  5D96 A;  2R4V A;  4G10 A;  2K18 A;  4BPY A;  1WJK A;  4RQX A;  1WPI A;  1U3A A;  2DJ1 A;  5DAL B;  10GS A;  3SBC A;  2WDU A;  2I1U A;  1MEK A;  4EDZ A;  2FWF A;  3KMO A;  3TUE A;  5ELA A;  5LCZ A;  2CAQ A;  2R6K A;  1LU4 A;  2JZS A;  1A0R P;  4TVE A;  5IMD A;  1FVJ A;  2DSA A;  2DML A;  3U6V A;  3LG6 A;  3R2Q A;  5ABR A;  3IE3 A;  1YKA A;  1AXD A;  2F3M A;  4POK A;  2IWT A;  4HU7 A;  1GSE A;  3D22 A;  2L4C A;  3GKN A;  4LL4 B;  5FT3 A;  4HUA A;  3HZ8 A;  1TK5 B;  2NDO A;  3DEX A;  1F2E A;  2C80 A;  3RHC A;  4GSS A;  1SL1 B;  1QXH A;  3IDV A;  2HRN A;  3WGD A;  1AQV A;  2CVD A;  1BG5 A;  5JWQ B;  2WZ9 A;  4OMV A;  1TK8 B;  5B8A A;  1THX A;  14GS A;  3DD3 A;  4CHS A;  1N8J A;  3QAW A;  4J57 E;  1GSF A;  4HQS A;  1V58 A;  3EIN A;  2GVP A;  1PN9 A;  2VAF A;  2E2M A;  3K8N A;  2H0G A;  2CVK A;  5B6N A;  3FZ4 A;  3DYR A;  4KCA A;  4ECI A;  2R2J A;  2R37 A;  2CZ2 A;  1T8E B;  2B1L A;  4PXO A;  1K3O A;  1XVQ A;  3NOF A;  2AYT A;  1T7P B;  3F6F A;  5GST A;  4EO3 A;  1Q4J A;  1G6Y A;  2ALB A;  1BED A;  4GTU A;  4I6X A;  5IIZ A;  2B6M A;  3W6G A;  4LLR A;  5GAP D;  2YV7 A;  4TRX A;  2E2G A;  2K6V A;  5FWG A;  1A23 A;  1DE2 A;  3O3T A;  3DVW A;  4V2N A;  3TDG A;  3DML A;  1PSQ A;  1QFN A;  2VL2 C;  3L0H A;  3APQ A;  5ECR B;  22GS A;  3LYK A;  3LSZ A;  2A2R A;  1Z7P A;  1X9M B;  3J7Y b;  1MDK A;  3A2W A;  5HR3 A;  2GGT A;  3F8U A;  1TU7 A;  2LV3 A;  3ZTL A;  1MDI A;  1WP0 A;  4HEA 2;  3Q18 A;  4KGI A;  1XBS A;  4OWY A;  1WE0 A;  3VWX A;  3F0I A;  4ILF A;  4L0W A;  2QC7 A;  4NWY A;  3M9K A;  1A24 A;  1K0N A;  3DIE A;  1U3I A;  4TXO B;  3ZRD A;  5EVO A;  2I3Y A;  5A4W A;  4MP4 A;  3GH6 A;  1MDJ A;  1ZYQ B;  1SJZ A;  1TP9 A;  4IP6 A;  3FRC A;  5GSS A;  3BCI A;  3TJF A;  1SK0 A;  5G1K A;  1OVN A;  1SYR A;  2I4A A;  4ZL7 A;  1B8X A;  3GMF A;  2M80 A;  2B3S A;  4K1F A;  3GH9 A;  4BVY A;  4D73 B;  2GSR A;  5CRH A;  2FNO A;  2LUS A;  1ZYE A;  1SJI A;  3H79 A;  1F3A A;  1ML6 A;  1YZX A;  1X9S B;  1F37 A;  2GZP A;  16GS A;  2L57 A;  1OAZ A;  3IOS A;  1A2L A;  1XWC A;  3LXT A;  3QFB C;  1EEM A;  4OD7 A;  5G30 A;  4IQ1 A;  3GTU B;  2H71 A;  1SD9 A;  4XS6 A;  1GTI A;  5ECH B;  2REM A;  2RLI A;  4XIH A;  4IS0 A;  3WGE A;  3A5W A;  2GT6 A;  1SKS B;  3RHB A;  2F51 A;  2H1G A;  3VI5 A;  3MAK A;  1A0F A;  6GST A;  3IBH A;  4JU5 A;  2N5F A;  2AHE A;  4GSN A;  1X9W B;  2EC4 A;  2YZH A;  2TIR A;  2D2Z A;  3H1N A;  2HYX A;  4L0U A;  3UBL A;  6GSV A;  1GUM A;  3H93 A;  2V1M A;  2C0F A;  3E0U A;  1V57 A;  1Y6E A;  1URM A;  2CT6 A;  3F63 A;  2TRX A;  2FCH A;  1HYU A;  1O6J A;  3VWU A;  3QR6 A;  3I43 A;  3DGQ A;  2MMN A;  1JZO A;  4EE0 A;  1JFU A;  1GUL A;  4K2D A;  2AUV A;  1T3B A;  1SJ6 A;  2I9H A;  5ECK B;  1ERW A;  5CAX A;  2VL2 A;  9GSS A;  3ZIV A;  5CYY A;  4HOJ A;  4MJC A;  5A5K A;  5DCG A;  2FWH A;  2HLS A;  2PU9 C;  2DJK A;  5DQY A;  1ERT A;  4EL1 A;  1IYI A;  2XBI A;  2WFC A;  3ME7 A;  1XWA A;  3FY7 A;  4CW9 A;  4EUY A;  2WJU A;  2H6Z A;  1GUH A;  4WF5 A;  1XWB A;  3HY2 A;  2FLS A;  2B7K A;  3HDC A;  1EV9 A;  2LQO A;  4MF7 A;  3TJG A;  3EMX A;  1K0B A;  1XXU A;  3L9U A;  1C72 A;  4MPG A;  4JE1 A;  5IO2 A;  2L5O A;  1J08 A;  1XWG A;  4I5Q A;  3O6T A;  2PVQ A;  3QOU A;  4NAX A;  1GSS A;  3KTL A;  4ZBA A;  3ZL5 A;  4RI7 A;  2NPB A;  1K0O A;  5LNK e;  1M9A A;  4PUA A;  1G6W A;  2YWI A;  4XTS A;  3F4S A;  1ZGN A;  3DXB A;  4Q5N A;  3CTG A;  4XHM A;  4WET A;  4I2T A;  4JBB A;  5J3R A;  4JRR A;  5EY6 A;  3EU4 A;  1WIK A;  4NPB A;  4YQU A;  4KSO A;  1XZO A;  3G9B A;  3KH7 A;  3Q6O A;  3HXS A;  2MBS A;  2LJA A;  4YH2 A;  2VD1 A;  3A2X A;  2ZUP A;  1M0U A;  1JLV A;  2H1A A;  1J0F A;  4ZB6 A;  3KD0 A;  1YDK A;  3IV4 A;  3QD9 A;  5L71 A;  5E59 A;  2XC2 A;  1SK1 A;  1GUK A;  4H86 A;  4XS1 A;  1OC8 A;  1PMT A;  5IPH A;  2LST A;  3UVH A;  1EOH A;  4PNF A;  5GZZ B;  4KCE A;  1V40 A;  1EZK A;  3ZML A;  3WD6 A;  4WKW A;  5COH A;  1JLW A;  4ZB8 A;  1GH2 A;  1S3D A;  2YZU A;  1TRU A;  4ML6 A;  1PKW A;  3ZMK A;  6GSU A;  3TOU A;  2B5E A;  2H1B A;  4KA0 A;  4E8E A;  3EU3 A;  5ELG A;  3PIN A;  1O85 A;  2VO4 A;  3N9J A;  1UA5 A;  2H66 A;  2G0F A;  2G2Q A;  2QGV A;  3C1R A;  1QMV A;  2IN3 A;  2PWJ A;  1GLP A;  4Q5R A;  4AJ8 A;  2FWE A;  5KEJ A;  2XPE A;  4P3Y B;  5ID2 A;  2MBT A;  1RK4 A;  3U5R E;  2WGR A;  4DSQ A;  1I9D A;  2C0E A;  2PN8 A;  2GQM A;  4IEL A;  2MMZ A;  3UAP A;  3TKR A;  4PQI A;  3VWV A;  3L9V A;  2DMM A;  2H6X A;  2X99 A;  2JU5 A;  3IK7 A;  2DBC A;  2GDR A;  5ECN B;  3TKQ A;  3GST A;  3ED3 A;  1AIU A;  5EL8 A;  2MMA A;  4QQ7 A;  11GS A;  1XPV A;  2MYG A;  3ERG A;  4N11 A;  2L6D A;  1EP8 A;  2OKA A;  1O8W A;  3TGZ A;  1T4Y A;  2GT5 A;  2YWO A;  3EMP A;  2DIY A;  1PQN A;  4F0B A;  1V98 A;  4POL A;  4L5O A;  3M9J A;  4MZC A;  4TR1 A;  4XRA A;  4POB A;  2HE3 A;  4ECJ A;  1ZCP A;  5IOW A;  1XVW A;  1UC7 A;  3KM6 A;  3Q19 A;  3QPM A;  4O7H A;  4OFN A;  1Z3E A;  4PQ1 A;  5GAN D;  4LA1 A;  4BA7 A;  4G2E A;  1YQ1 A;  1V9W A;  3I9V 2;  4N0V A;  3KH9 A;  1VF3 A;  2E0Q A;  4TN8 A;  3ZFL A;  2OAD A;  4K0G A;  1SL0 B;  1ERU A;  1Z6N A;  2K9F A;  2MZC A;  4ACS A;  1E6B A;  4V2L A;  4CDO A;  2VD0 A;  4GLT A;  2HXK A;  1KNG A;  2L5L A;  2DIZ A;  1ZOF A;  1F6M C;  3QAG A;  2JZT A;  5AIX A;  2YWM A;  2KHP A;  3EE2 A;  1K3L A;  2HNL A;  2LJR A;  2V6O A;  3UBK A;  2IJY A;  3HJP A;  1YEP A;  2YPM A;  4PNG A;  2VM2 A;  3DVX A;  2HRF A;  1GSD A;  1SEN A;  4WR4 A;  3LYP A;  2OE0 A;  2IFQ A;  2H73 A;  3VWW A;  5ECQ B;  2RII A;  1USB A;  4N10 A;  1A2M A;  5HFI A;  4QL7 A;  5ECO B;  3RPP A;  2J23 A;  2MMO A;  2B1K A;  1MD4 A;  2VLT A;  3KP9 A;  1BX9 A;  2L6C A;  4ZBB A;  2A4V A;  4OO5 A;  3FR9 A;  2EIR A;  5AIV A;  1E2Y A;  2N5A A;  3I6A A;  4YAP A;  4OCF A;  2P31 A;  5D9V A;  5JCU A;  4Z7X A;  2JSY A;  3LWA A;  5KN3 A;  4NMU A;  2XBQ A;  2QKE A;  4MH3 A;  1GRX A;  3GHA A;  1ABA A;  3FKF A;  4MCU A;  4TR0 A;  4K7I A;  4MJA A;  2E7P A;  1WOU A;  2HSH A;  2RM6 A;  1YF1 A;  1UN2 A;  4ZL9 A;  3VPQ A;  2H76 A;  1G0T A;  3TOT A;  5DAL A;  4DSR A;  2C4J A;  3GX8 A;  1ILO A;  2C0G A;  4K0N A;  4IVF A;  2IMK A;  19GS A;  5JCG A;  3ZVJ D;  2VCX A;  5D9T A;  4FYB A;  4FIW A;  4YQV A;  3H4K A;  5DAK B;  1SD8 A;  4GCI A;  2O85 A;  5IPG A;  2HZF A;  2M46 A;  4IJI A;  3FEU A;  2LEG A;  4DSS B;  4O5R A;  4BWS A;  4NXI A;  3BJ5 A;  2OJL A;  2O7K A;  1R4W A;  1OC9 B;  20GS A;  3GNJ A;  3LOR A;  2WRT A;  1M99 A;  4HZ4 A;  4MZW A;  1XFL A;  4I2U A;  3ERF A;  4JED A;  1ACV A;  3C7M A;  3UEM A;  4O32 A;  4RUV A;  3GN3 A;  3D0Z A;  3QDN A;  2IIY A;  3HYP A;  4HS1 A;  3A3T A;  4HU9 A;  3W8J A;  5F05 A;  5IMA A;  2IMD A;  5CP1 A;  1Z5Y E;  4KX4 A;  3WYW A;  4ZIJ A;  4OFT A;  3BCK A;  3ZFB A;  1PX6 A;  4FO5 A;  1AC1 A;  3F9U A;  3KP8 A;  2CAI A;  4X43 A;  2OBK A;  4EVM A;  4EKZ A;  1XOB A;  1MD3 A;  1R7H A;  3FR3 A;  3KMN A;  4MA9 A;  1ON4 A;  2X8G A;  4XS4 B;  3TJJ A;  4PGT A;  2V2G A;  2P5R A;  3NIV A;  5INY A;  2BMX A;  2JAC A;  1GTB A;  2C1Y A;  3HZ4 A;  3D4M A;  1M7T A;  1K0C A;  2HFD A;  3M8N A;  4MJB A;  2RUE A;  3KTB A;  4O92 A;  4PUR A;  4MAB A;  5G1L A;  3UL3 A;  2CVB A;  4F0C A;  2AJQ B;  4HQZ A;  4L8E A;  1S3C A;  3GX0 A;  1NHO A;  2X64 A;  2H1D A;  4V1A p;  2I81 A;  2C3Q A;  3WT2 A;  2LS5 A;  1EGO A;  3SWL A;  3C73 A;  4YAV A;  1U6T A;  5ECP B;  4YQM A;  5ENU A;  3FZA A;  2DJ2 A;  2VCT A;  3N5O A;  4MZB A;  5H5R A;  2NBS A;  4AF2 A;  1B4Q A;  2GTU A;  1SL2 B;  3P7X A;  1O73 A;  3Q74 A;  1FG4 A;  1M9B A;  4GRF A;  4IKH A;  5IOX A;  4TXO A;  4WR5 A;  5DJL A;  1GNE A;  1ZMA A;  2BTO T;  4FYU A;  5G5F A;  2LRN A;  3MWH A;  2Z9S A;  2LNS A;  2O89 A;  3FZ5 A;  2H01 A;  2P5Q A;  3UJ1 A;  4EDY A;  4D73 A;  2OAC A;  8GSS A;  3I69 A;  3LEF A;  4ZL8 A;  1XCC A;  3IC4 A;  5JWO B;  5DCH A;  5IO0 A;  1NW2 A;  1VGL A;  1TJD A;  2F9S A;  3CSI A; 
#chains in the Genus database with same CATH topology
 4O5Q A;  2HZE B;  3QAV A;  6GSX A;  2DLX A;  3G7I A;  3F3Q A;  5KN2 A;  2KUC A;  5CRD A;  1XW6 A;  1XIY A;  1OKT A;  1Z9H A;  5ECI B;  2H75 A;  4BWQ A;  3GTU A;  2LRC A;  3TKP A;  3UMA A;  3LGC A;  3UAR A;  4N30 A;  4NHW A;  2GST A;  2EIO A;  2V6K A;  3IPZ A;  1OE8 A;  3E9J B;  3P90 A;  4LMV A;  4NV2 A;  1TOF A;  2NTO A;  1HNC A;  2A2S A;  4JR4 A;  3C1S A;  1FVK A;  2YAN A;  4USS A;  1GSU A;  1X5D A;  2YOI A;  1EWX A;  3P2A A;  1X5C A;  3CBU A;  1VF2 A;  4X0X A;  4TOP A;  4XRD A;  4KAE A;  4O5U A;  2P0G A;  3RDW A;  3HVV A;  4GXZ A;  1W4V A;  1XOA A;  1HNB A;  3LFL A;  4ML1 A;  1M3I A;  2FUG 2;  5J9B A;  3HKR A;  2DJ3 A;  4TR3 A;  1IYH A;  1TKD B;  2O87 A;  3IR4 A;  2DJ0 A;  3TRP A;  2C3N A;  3MNG A;  2QSI A;  1DE1 A;  2TRC P;  4TKY A;  1MTC A;  3KCM A;  3BBY A;  1HD2 A;  4TXV A;  2OA7 A;  2BJX A;  2H6Y A;  1FAA A;  4K5R A;  1YF0 A;  1GP1 A;  2DKI A;  1QK8 A;  3GIX A;  5DQS A;  5C04 A;  3WGX A;  2KOK A;  3M0F A;  2DC5 A;  3GL3 A;  3GKK A;  3EUR A;  4EF0 A;  3RPN A;  3WT1 A;  4KSM A;  1YKC A;  3LXZ A;  4K7N A;  2IMF A;  3GUS A;  2LRT A;  2YWN A;  1TU8 A;  4WBR D;  3IRA A;  2H70 A;  4JZQ A;  5D9W A;  4Q5F A;  3L4N A;  1O8X A;  3APO A;  4MF5 A;  4AGS A;  1U88 A;  4KDX A;  3HVS A;  2IME A;  1GWC A;  4DVC A;  4ID0 A;  3CMI A;  3CSH A;  4G9H A;  3QCP A;  2VUP A;  4MMM A;  2DJJ A;  1B4P A;  5IMV A;  2CQ9 A;  3GFK A;  4HJM A;  4KE3 A;  2H19 A;  4IBP A;  2B7J A;  2QA1 A;  4K2X A;  1KTE A;  4IJ3 A;  2K8S A;  4GQC A;  3CRU A;  1TI1 A;  5LD0 A;  2X8H A;  5H5S A;  4OCE A;  3GSS A;  1FB0 A;  13GS A;  2K8V A;  1Y25 A;  4K8M A;  3TRX A;  3IHQ A;  1TRV A;  1PD2 1;  4ZIL A;  1Z7R A;  4WBJ A;  3VPT A;  5CO3 A;  2LJK A;  2CA8 A;  4BVX A;  1S3A A;  3GRX A;  4TW5 A;  1M2B A;  1B9X C;  2IPA A;  4GQF A;  5IMF A;  3G7Y A;  18GS A;  4V2M A;  1B9Y C;  1TXX A;  3TJB A;  3FK8 A;  1JHB A;  5CRG A;  4ZB9 A;  4IP1 A;  3J7Y k;  2GS3 A;  4IGJ A;  1GSY A;  1SK2 A;  2ON7 A;  1RW1 A;  1PRX A;  3ISO A;  3DKS A;  1TK0 B;  4N0Z A;  4HSC X;  3M1G A;  2VLV A;  3MIX A;  3US3 A;  3TRQ A;  3CTF A;  1TRS A;  2YJH A;  2JSZ A;  3GL5 A;  1ZYP A;  3CYN A;  3VFI A;  1DBY A;  4IN0 A;  2YNX A;  3HVN A;  1BQ7 A;  3FZ9 A;  1WRY A;  1GTA A;  2GQK A;  5G5E A;  3GUR A;  2IL3 A;  2HT9 A;  3ZIJ A;  2CX4 A;  2LQQ A;  3PGT A;  2LKU A;  2L4Q A;  1FB6 A;  3EWL A;  5CRW A;  4K7O A;  1V2A A;  1PGT A;  5ECS A;  6GSS A;  1SKR B;  4WEY A;  5ECM B;  4FH8 A;  3JCM L;  4I97 A;  5HR2 A;  4HJ2 A;  3S9F A;  1FOV A;  2C8U A;  1EEJ A;  3AY8 A;  3KZQ A;  5IM9 A;  3DRN A;  1GLQ A;  4MF6 A;  1T1V A;  3VK9 A;  2C3T A;  3VLN A;  4MPF A;  1OYJ A;  6GSY A;  1XW5 A;  3EC3 A;  4AJ7 A;  4F9Z A;  3M3M A;  1B48 A;  2H30 A;  2KP2 A;  3FW2 A;  2YV9 A;  2YN1 A;  5AN1 A;  4F2I A;  4NV5 A;  3HJM A;  4ISD A;  1OKD A;  4ZBD A;  4PX1 A;  4ECC A;  2NVL A;  2X49 A;  1NM3 A;  2X4A A;  4BL7 A;  1S3R A;  2PUK C;  1BJX A;  3G7J A;  4MJE A;  4HDE A;  1A2J A;  5D8I A;  2XHF A;  2R3X A;  3EVI A;  2YP6 A;  3IA1 A;  4X1U A;  2JL4 A;  1TDI A;  3E3E A;  1LJR A;  3CXG A;  1JZD A;  2C0D A;  2GLR A;  1R26 A;  5DJM A;  1KBN A;  1FW1 A;  3P8W A;  5J9C A;  3ZIT A;  3RBT A;  1FO5 A;  2JAD A;  3TCO A;  3TB2 A;  1H75 A;  4FYC A;  3PPU A;  5DBQ A;  2WCI A;  4WXT A;  7GSS A;  5F06 A;  4BVY B;  5F07 A;  3FHK A;  1A8Y A;  5KOW A;  1WWJ A;  1NHY A;  2JZR A;  2GZZ A;  2VIM A;  3HVX A;  4XCS A;  2AV4 A;  5G31 A;  1PKZ A;  1A8L A;  3ZYW A;  4WF4 A;  2PGT A;  1G7O A;  1TI3 A;  3CQF A;  5J5N A;  1F3B A;  2VCQ A;  3CRT A;  1ST9 A;  4ZXG A;  2R0G A;  4KB3 A;  5D93 A;  3DWV A;  2N5B A;  1GL8 A;  3TKS E;  2YCD A;  5AIS A;  1PX7 A;  3D6I A;  5CRE A;  1UVZ A;  3KXO A;  4G0I A;  4G0K A;  5D73 A;  2OE3 A;  3IXR A;  3L9S A;  5HFG A;  2RM5 A;  1T00 A;  4LL1 B;  5KN0 A;  4MLY A;  2O8V B;  3ZVJ A;  2F8A A;  1Q98 A;  2VL9 A;  1M2D A;  3APS A;  1J9B A;  3ERW A;  1AQW A;  2F8F A;  4PTS A;  3CSJ A;  3F3R A;  1NSW A;  2PMT A;  2V41 A;  4LMW A;  1U87 A;  3MSZ A;  2LNT A;  4GF0 A;  3PR8 A;  1THO A;  1AAZ A;  1DUG A;  3UOM A;  3BOA A;  3C71 A;  4EC0 A;  1VF4 A;  2VOC A;  1CQH A;  2RUF A;  5DAK A;  5A4U A;  2GSQ A;  4E8H A;  2FA4 A;  4DSS A;  3O76 A;  2KLX A;  1SYX A;  5DVB A;  2H8L A;  3IK9 A;  5DDL A;  4QL9 A;  4POM A;  3KJY A;  1EGR A;  1OC9 A;  4MDC A;  5KOX A;  1PL2 A;  3D4T A;  1QUW A;  1LBK A;  4JR6 A;  1PL1 A;  2OE1 A;  12GS A;  3IAM 2;  5F0G A;  3C8E A;  4HZ2 A;  2FD3 A;  2B5Y A;  4ECB A;  4F82 A;  2H74 A;  4KUN A;  1OE7 A;  2VCW A;  3GYK A;  5IMC A;  3OR5 A;  3LQ7 A;  2GZY A;  2YJ7 A;  2ZNM A;  4PUF C;  5HR0 A;  4RQR A;  3HCZ A;  3D5J A;  1EOG A;  3VI7 A;  2HI7 A;  1F9M A;  5CNW A;  5KN1 A;  2PER A;  3FMW A;  4Q5Q A;  4GWR A;  6GSW A;  1I5G A;  5IQY A;  4X4J A;  1T4Z A;  2IMI A;  2PPT A;  1ZZY A;  2ZCT A;  3KIJ A;  4K9Z A;  1H4O A;  2H0H A;  2ON5 A;  3MDK A;  1R5P A;  3KEB A;  2V32 A;  3TKS C;  2VCZ A;  4XS4 A;  5A4V A;  4ULX A;  2WS2 A;  1R5A A;  2AAW A;  3D21 A;  3BD2 A;  3F4R A;  2HSY A;  5F8B A;  3QMX A;  1GSQ A;  3UIW A;  1VF1 A;  2GSS A;  2X8C A;  5J41 A;  3NZN A;  4NHZ A;  1HQO A;  5IMZ A;  5JCW A;  1O81 A;  2QA2 A;  2VL3 A;  3QFA C;  2UZ8 A;  2XPD A;  4KH7 A;  1SKW B;  1GTU A;  3F6D A;  1EV4 A;  1X5E A;  3LW9 A;  3A2V A;  2PVO C;  3F4T A;  4K6X A;  1ERV A;  3GA4 A;  1CQG A;  5JWR B;  3VUR A;  1X0R A;  1GNW A;  4MK3 A;  1KEB A;  1XG8 A;  4KW6 A;  2FY6 A;  1AW9 A;  1BAY A;  3GKX A;  1XWK A;  3ZLP A;  2OBI A;  2R5G A;  3EYT A;  2H0I A;  4OO4 A;  4AJ6 A;  5ID2 B;  3TJK A;  2GQL A;  3KGK A;  1K0M A;  4IQA A;  5G2Z A;  1JZR A;  2FHE A;  3GV1 A;  3RAZ A;  5D9X A;  3ZZX A;  1K0A A;  2VLU A;  1TRW A;  1K3Y A;  3HHV A;  4GST A;  5FHI A;  4L5L A;  3HJO A;  4KND A;  1YY7 A;  5HQP A;  5AGY A;  1AUC A;  1RQM A;  2CX3 A;  1Z6M A;  4J56 E;  4DEJ A;  2HZE A;  2FWG A;  1N2A A;  3LJR A;  1G7E A;  4PQH A;  4EXJ A;  4I8B A;  1HNA A;  4TR1 B;  3HD5 A;  1YEX A;  1PA3 A;  2L59 A;  17GS A;  2M72 A;  5ECL B;  1TW9 A;  2AB6 A;  3PH9 A;  1O7U A;  4RI6 A;  2B5X A;  2WB9 A;  3HA9 A;  2CV4 A;  4KDU A;  5E4W A;  5J4U A;  1OC3 A;  3UVT A;  4TR4 A;  3FR6 A;  1TTZ A;  2J9H A;  4OFM A;  3TKS A;  4IHU A;  4MH2 A;  2PBJ A;  1EP7 A;  3W8S A;  3EPT A;  4KDY A;  4G19 A;  2HRK A;  1QQ2 A;  3IAS 2;  1ZL9 A;  4BIK A;  2FGX A;  5HFK A;  3GKM A;  4J2F A;  1K0D A;  3V1W A;  5C00 A;  2ES7 A;  2IFQ B;  2KP1 A;  1FOH A;  1DSB A;  5B6M A;  1XW9 A;  3FYG A;  1BYE A;  5H5Q A;  1W89 A;  2VM1 A;  2VCV A;  5B8B A;  4HI7 A;  3ZRE A;  1M2A A;  3ME8 A;  5B7C A;  2FA8 A;  4V1A g;  4F03 A;  1QGV A;  2LTK A;  1AQX A;  3H8Q A;  1YJ6 A;  2WUL A;  5EPF A;  1JZW A;  2H72 A;  1FHE A;  2EIQ A;  1WMJ A;  5HR1 A;  4A5P A;  4IW9 A;  2CZ3 A;  1SU9 A;  1VRS D;  3L78 A;  5D96 A;  2R4V A;  2DKH A;  4G10 A;  2K18 A;  4BPY A;  1WJK A;  4RQX A;  1WPI A;  1U3A A;  2DJ1 A;  5DAL B;  10GS A;  3SBC A;  2WDU A;  2I1U A;  1MEK A;  5BRT A;  4EDZ A;  2FWF A;  3KMO A;  3TUE A;  5ELA A;  5LCZ A;  2CAQ A;  2R6K A;  1LU4 A;  2JZS A;  1A0R P;  4TVE A;  5IMD A;  1FVJ A;  2DSA A;  2DML A;  3U6V A;  3LG6 A;  3R2Q A;  5ABR A;  3IE3 A;  1YKA A;  1AXD A;  2F3M A;  4POK A;  2IWT A;  4HU7 A;  1GSE A;  3D22 A;  2L4C A;  3GKN A;  4LL4 B;  5FT3 A;  4HUA A;  3HZ8 A;  1TK5 B;  2NDO A;  3DEX A;  1F2E A;  4CY8 A;  2C80 A;  3RHC A;  4GSS A;  1SL1 B;  1QXH A;  3IDV A;  2HRN A;  3WGD A;  1AQV A;  2CVD A;  1BG5 A;  4ICY A;  5JWQ B;  2WZ9 A;  4OMV A;  1TK8 B;  1M3J A;  4YKG A;  5B8A A;  1THX A;  14GS A;  3DD3 A;  4CHS A;  1N8J A;  3QAW A;  4J57 E;  1GSF A;  4HQS A;  1V58 A;  3EIN A;  2GVP A;  1PN9 A;  2VAF A;  2E2M A;  3K8N A;  2H0G A;  2CVK A;  5B6N A;  3FZ4 A;  3DYR A;  4KCA A;  4ECI A;  2R2J A;  2R37 A;  2CZ2 A;  1T8E B;  2B1L A;  4PXO A;  1K3O A;  1XVQ A;  3NOF A;  2AYT A;  1T7P B;  3F6F A;  5GST A;  4EO3 A;  1Q4J A;  1G6Y A;  2ALB A;  1BED A;  4GTU A;  4I6X A;  5IIZ A;  4YKF A;  2B6M A;  3W6G A;  4LLR A;  5GAP D;  2YV7 A;  4TRX A;  2E2G A;  2K6V A;  5FWG A;  1A23 A;  1DE2 A;  3O3T A;  3DVW A;  4V2N A;  3TDG A;  3DML A;  1PSQ A;  1QFN A;  2VL2 C;  3L0H A;  3APQ A;  5BMU A;  22GS A;  5ECR B;  3LYK A;  3LSZ A;  2A2R A;  1Z7P A;  1X9M B;  3J7Y b;  1MDK A;  3A2W A;  5HR3 A;  2GGT A;  3F8U A;  1TU7 A;  2LV3 A;  4Z2U A;  3ZTL A;  1MDI A;  1WP0 A;  4HEA 2;  3Q18 A;  4KGI A;  1XBS A;  4OWY A;  1WE0 A;  3VWX A;  3F0I A;  4ILF A;  4L0W A;  2QC7 A;  4NWY A;  3M9K A;  1A24 A;  1K0N A;  3DIE A;  1U3I A;  4TXO B;  3ZRD A;  5EVO A;  2I3Y A;  5A4W A;  4MP4 A;  3GH6 A;  1MDJ A;  1ZYQ B;  1SJZ A;  1TP9 A;  4IP6 A;  3FRC A;  5GSS A;  3BCI A;  3TJF A;  1SK0 A;  4FQU A;  5G1K A;  1OVN A;  1SYR A;  2I4A A;  4ZL7 A;  1B8X A;  3GMF A;  2M80 A;  2B3S A;  4K1F A;  3GH9 A;  4BVY A;  4D73 B;  2GSR A;  5CRH A;  2FNO A;  2LUS A;  1ZYE A;  2R0P A;  1SJI A;  3H79 A;  1F3A A;  1ML6 A;  1YZX A;  1X9S B;  1F37 A;  2GZP A;  16GS A;  2L57 A;  1OAZ A;  3IOS A;  1A2L A;  1XWC A;  3LXT A;  2A2P A;  3QFB C;  1EEM A;  4OD7 A;  5G30 A;  4IQ1 A;  3GTU B;  2H71 A;  1SD9 A;  4XS6 A;  1GTI A;  5ECH B;  2REM A;  2RLI A;  4XIH A;  1PFO A;  4IS0 A;  3WGE A;  3A5W A;  2GT6 A;  1SKS B;  3RHB A;  2F51 A;  2H1G A;  3VI5 A;  3MAK A;  1A0F A;  6GST A;  3IBH A;  4JU5 A;  2N5F A;  4Z2T A;  2AHE A;  4GSN A;  1X9W B;  2EC4 A;  2YZH A;  2TIR A;  2D2Z A;  3H1N A;  2HYX A;  4L0U A;  3UBL A;  6GSV A;  1GUM A;  3H93 A;  2V1M A;  2C0F A;  3E0U A;  1V57 A;  1Y6E A;  1URM A;  2CT6 A;  3F63 A;  2TRX A;  2FCH A;  1HYU A;  1O6J A;  3VWU A;  3QR6 A;  3I43 A;  3DGQ A;  2MMN A;  1JZO A;  4EE0 A;  1JFU A;  1GUL A;  4K2D A;  2AUV A;  1T3B A;  1SJ6 A;  2I9H A;  5ECK B;  1ERW A;  5CAX A;  2VL2 A;  9GSS A;  3ZIV A;  5CYY A;  4HOJ A;  4MJC A;  5A5K A;  5DCG A;  2FWH A;  2HLS A;  2PU9 C;  2DJK A;  5DQY A;  1ERT A;  4EL1 A;  3IHG A;  1IYI A;  2XBI A;  2WFC A;  3ME7 A;  1XWA A;  3FY7 A;  4CW9 A;  4EUY A;  2WJU A;  2H6Z A;  1GUH A;  4WF5 A;  1XWB A;  3HY2 A;  2FLS A;  2B7K A;  3HDC A;  1EV9 A;  2LQO A;  4MF7 A;  3TJG A;  3EMX A;  1K0B A;  1ZYN A;  1XXU A;  4KF9 A;  3L9U A;  1C72 A;  4MPG A;  4JE1 A;  5IO2 A;  2L5O A;  1J08 A;  1XWG A;  4I5Q A;  3O6T A;  2PVQ A;  3QOU A;  4NAX A;  1GSS A;  3KTL A;  4ZBA A;  3ZL5 A;  4RI7 A;  2NPB A;  1K0O A;  5LNK e;  1M9A A;  4PUA A;  1G6W A;  2YWI A;  4XTS A;  3F4S A;  1ZGN A;  3DXB A;  4Q5N A;  3CTG A;  4XHM A;  4WET A;  4I2T A;  4JBB A;  5J3R A;  4JRR A;  5EY6 A;  3EU4 A;  1WIK A;  4NPB A;  4YQU A;  4KSO A;  1XZO A;  3G9B A;  3KH7 A;  3Q6O A;  3HXS A;  4BVX B;  4MNN A;  2MBS A;  2LJA A;  4YH2 A;  2VD1 A;  3A2X A;  2ZUP A;  1M0U A;  1JLV A;  2H1A A;  1J0F A;  4ZB6 A;  3KD0 A;  1YDK A;  3IV4 A;  3QD9 A;  5L71 A;  5E59 A;  2XC2 A;  1SK1 A;  1GUK A;  4H86 A;  4XS1 A;  1OC8 A;  1PMT A;  5IPH A;  2LST A;  3UVH A;  1EOH A;  4PNF A;  5GZZ B;  4KCE A;  1V40 A;  1EZK A;  3ZML A;  3WD6 A;  4WKW A;  5COH A;  1JLW A;  4ZB8 A;  4K5S A;  1GH2 A;  1S3D A;  2YZU A;  1TRU A;  4ML6 A;  1PKW A;  3ZMK A;  6GSU A;  3TOU A;  2B5E A;  2H1B A;  4KA0 A;  4E8E A;  1PN0 A;  3EU3 A;  5ELG A;  3PIN A;  1O85 A;  2VO4 A;  3N9J A;  1UA5 A;  2H66 A;  2G0F A;  2G2Q A;  2QGV A;  3C1R A;  1QMV A;  2IN3 A;  2PWJ A;  1GLP A;  4Q5R A;  4AJ8 A;  2FWE A;  5KEJ A;  2XPE A;  4P3Y B;  5ID2 A;  2MBT A;  1RK4 A;  3U5R E;  2WGR A;  4DSQ A;  1I9D A;  2C0E A;  2PN8 A;  2GQM A;  4IEL A;  2MMZ A;  3UAP A;  3TKR A;  4PQI A;  3VWV A;  3L9V A;  2DMM A;  2H6X A;  2X99 A;  4G0L A;  2JU5 A;  3IK7 A;  2DBC A;  2GDR A;  5ECN B;  3TKQ A;  3GST A;  3ED3 A;  1AIU A;  5EL8 A;  2MMA A;  4QQ7 A;  11GS A;  1XPV A;  2MYG A;  3ERG A;  4N11 A;  2L6D A;  1EP8 A;  2OKA A;  1O8W A;  3TGZ A;  1T4Y A;  2GT5 A;  2YWO A;  3EMP A;  2DIY A;  1PQN A;  4F0B A;  1V98 A;  4CY6 A;  4POL A;  4L5O A;  3M9J A;  4BL7 B;  4MZC A;  4TR1 A;  4XRA A;  4POB A;  2HE3 A;  4ECJ A;  1ZCP A;  5IOW A;  1XVW A;  1UC7 A;  3KM6 A;  3Q19 A;  3QPM A;  2HRA A;  3R3E A;  4O7H A;  4OFN A;  1Z3E A;  4PQ1 A;  5GAN D;  4LA1 A;  4BA7 A;  4G2E A;  1YQ1 A;  1V9W A;  3I9V 2;  4N0V A;  3KH9 A;  1VF3 A;  2E0Q A;  4TN8 A;  3ZFL A;  2OAD A;  4K0G A;  1SL0 B;  1ERU A;  1Z6N A;  2K9F A;  2MZC A;  4ACS A;  1E6B A;  4V2L A;  4CDO A;  2VD0 A;  4GLT A;  2HXK A;  1KNG A;  2L5L A;  2DIZ A;  1ZOF A;  1F6M C;  3QAG A;  2JZT A;  5AIX A;  2YWM A;  2KHP A;  3EE2 A;  1K3L A;  2HNL A;  2LJR A;  2V6O A;  3UBK A;  2IJY A;  3HJP A;  1YEP A;  2YPM A;  4PNG A;  2VM2 A;  3DVX A;  2HRF A;  1GSD A;  1SEN A;  4WR4 A;  3LYP A;  2OE0 A;  2IFQ A;  2H73 A;  3VWW A;  2HSM A;  5ECQ B;  2RII A;  2R0C A;  1USB A;  4N10 A;  1A2M A;  5HFI A;  4QL7 A;  5ECO B;  3RPP A;  2J23 A;  2MMO A;  2B1K A;  1MD4 A;  2VLT A;  3KP9 A;  1BX9 A;  2L6C A;  4ZBB A;  2A4V A;  4OO5 A;  3FR9 A;  2EIR A;  5AIV A;  1E2Y A;  2N5A A;  3A5I A;  3I6A A;  4YAP A;  4OCF A;  2P31 A;  5D9V A;  5JCU A;  4Z7X A;  2JSY A;  3LWA A;  5KN3 A;  4NMU A;  2XBQ A;  3MYD A;  2QKE A;  4MH3 A;  1GRX A;  3GHA A;  1ABA A;  3FKF A;  4EIP A;  4MCU A;  4TR0 A;  4K7I A;  4MJA A;  2E7P A;  1WOU A;  2HSH A;  2RM6 A;  1YF1 A;  1UN2 A;  4ZL9 A;  3VPQ A;  2H76 A;  1G0T A;  3TOT A;  5DAL A;  4DSR A;  2C4J A;  3GX8 A;  1ILO A;  2C0G A;  4K0N A;  4IVF A;  2IMK A;  19GS A;  5JCG A;  3ZVJ D;  2VCX A;  5D9T A;  4FYB A;  4Z2R A;  4FIW A;  4YQV A;  3H4K A;  5DAK B;  1SD8 A;  4GCI A;  2O85 A;  5IPG A;  2HZF A;  2M46 A;  4IJI A;  3FEU A;  2LEG A;  4DSS B;  4O5R A;  4BWS A;  4NXI A;  3BJ5 A;  2OJL A;  2O7K A;  1R4W A;  1OC9 B;  20GS A;  3GNJ A;  3LOR A;  2WRT A;  1M99 A;  4HZ4 A;  4MZW A;  1XFL A;  4I2U A;  3ERF A;  4JED A;  1ACV A;  3C7M A;  3UEM A;  4O32 A;  4RUV A;  3GN3 A;  3D0Z A;  3QDN A;  2IIY A;  3HYP A;  4HS1 A;  4EIQ A;  3A3T A;  4HU9 A;  3W8J A;  5F05 A;  5IMA A;  2IMD A;  5CP1 A;  1Z5Y E;  4KX4 A;  3WYW A;  4ZIJ A;  4OFT A;  3BCK A;  3ZFB A;  1PX6 A;  4FO5 A;  1AC1 A;  3F9U A;  3KP8 A;  2CAI A;  4X43 A;  2OBK A;  4EVM A;  4EKZ A;  1XOB A;  1MD3 A;  1R7H A;  3FR3 A;  3KMN A;  4MA9 A;  1ON4 A;  2X8G A;  4XS4 B;  3TJJ A;  4PGT A;  2V2G A;  2P5R A;  3NIV A;  5INY A;  2BMX A;  2JAC A;  1GTB A;  2C1Y A;  3HZ4 A;  3D4M A;  1M7T A;  1K0C A;  2HFD A;  3M8N A;  3IC8 A;  4MJB A;  2RUE A;  3KTB A;  4O92 A;  4PUR A;  4MAB A;  5G1L A;  3UL3 A;  2CVB A;  4F0C A;  2AJQ B;  4HQZ A;  4L8E A;  1S3C A;  3GX0 A;  1NHO A;  2X64 A;  2H1D A;  4V1A p;  2I81 A;  2C3Q A;  3WT2 A;  2LS5 A;  1EGO A;  3SWL A;  3C73 A;  4YAV A;  1U6T A;  5ECP B;  4YQM A;  5ENU A;  3FZA A;  2DJ2 A;  2VCT A;  3N5O A;  4MZB A;  5H5R A;  2NBS A;  4AF2 A;  1B4Q A;  2GTU A;  1SL2 B;  3P7X A;  1O73 A;  3Q74 A;  1FG4 A;  1M9B A;  4GRF A;  4IKH A;  5IOX A;  4TXO A;  4WR5 A;  5DJL A;  1GNE A;  1ZMA A;  2A4H A;  2BTO T;  4FYU A;  5G5F A;  2LRN A;  3MWH A;  2Z9S A;  2LNS A;  2O89 A;  3FZ5 A;  2H01 A;  2P5Q A;  3UJ1 A;  4EDY A;  4D73 A;  2OAC A;  8GSS A;  3I69 A;  3LEF A;  4ZL8 A;  1XCC A;  3IC4 A;  5JWO B;  5DCH A;  5IO0 A;  1NW2 A;  1VGL A;  1TJD A;  2F9S A;  3CSI A; 
#chains in the Genus database with same CATH homology
 4O5Q A;  2HZE B;  3QAV A;  6GSX A;  2DLX A;  3G7I A;  3F3Q A;  5KN2 A;  2KUC A;  5CRD A;  1XW6 A;  1XIY A;  1OKT A;  1Z9H A;  5ECI B;  2H75 A;  4BWQ A;  3GTU A;  2LRC A;  3TKP A;  3UMA A;  3LGC A;  3UAR A;  4N30 A;  4NHW A;  2GST A;  2EIO A;  2V6K A;  3IPZ A;  1OE8 A;  3E9J B;  3P90 A;  4LMV A;  4NV2 A;  1TOF A;  2NTO A;  1HNC A;  2A2S A;  4JR4 A;  3C1S A;  1FVK A;  2YAN A;  4USS A;  1GSU A;  1X5D A;  2YOI A;  1EWX A;  3P2A A;  1X5C A;  3CBU A;  1VF2 A;  4X0X A;  4TOP A;  4XRD A;  4KAE A;  4O5U A;  2P0G A;  3RDW A;  3HVV A;  4GXZ A;  1W4V A;  1XOA A;  1HNB A;  3LFL A;  4ML1 A;  2FUG 2;  5J9B A;  3HKR A;  2DJ3 A;  4TR3 A;  1IYH A;  1TKD B;  2O87 A;  3IR4 A;  2DJ0 A;  3TRP A;  2C3N A;  3MNG A;  2QSI A;  1DE1 A;  2TRC P;  4TKY A;  1MTC A;  3KCM A;  3BBY A;  1HD2 A;  4TXV A;  2OA7 A;  2BJX A;  2H6Y A;  1FAA A;  4K5R A;  1YF0 A;  1GP1 A;  2DKI A;  1QK8 A;  3GIX A;  5DQS A;  5C04 A;  3WGX A;  2KOK A;  3M0F A;  2DC5 A;  3GL3 A;  3GKK A;  3EUR A;  4EF0 A;  3RPN A;  3WT1 A;  4KSM A;  1YKC A;  3LXZ A;  4K7N A;  2IMF A;  3GUS A;  2LRT A;  2YWN A;  1TU8 A;  4WBR D;  3IRA A;  2H70 A;  4JZQ A;  5D9W A;  4Q5F A;  3L4N A;  1O8X A;  3APO A;  4MF5 A;  4AGS A;  1U88 A;  4KDX A;  3HVS A;  2IME A;  1GWC A;  4DVC A;  4ID0 A;  3CMI A;  3CSH A;  4G9H A;  3QCP A;  2VUP A;  4MMM A;  2DJJ A;  1B4P A;  5IMV A;  2CQ9 A;  3GFK A;  4HJM A;  4KE3 A;  2H19 A;  4IBP A;  2B7J A;  2QA1 A;  4K2X A;  1KTE A;  4IJ3 A;  2K8S A;  4GQC A;  3CRU A;  1TI1 A;  5LD0 A;  2X8H A;  5H5S A;  4OCE A;  3GSS A;  1FB0 A;  13GS A;  2K8V A;  1Y25 A;  4K8M A;  3TRX A;  3IHQ A;  1TRV A;  1PD2 1;  4ZIL A;  1Z7R A;  4WBJ A;  3VPT A;  5CO3 A;  2LJK A;  2CA8 A;  4BVX A;  1S3A A;  3GRX A;  4TW5 A;  1M2B A;  1B9X C;  2IPA A;  4GQF A;  5IMF A;  3G7Y A;  18GS A;  4V2M A;  1B9Y C;  1TXX A;  3TJB A;  3FK8 A;  1JHB A;  5CRG A;  4ZB9 A;  4IP1 A;  3J7Y k;  2GS3 A;  4IGJ A;  1GSY A;  1SK2 A;  2ON7 A;  1RW1 A;  1PRX A;  3ISO A;  3DKS A;  1TK0 B;  4N0Z A;  3M1G A;  2VLV A;  3MIX A;  3US3 A;  3TRQ A;  3CTF A;  1TRS A;  2YJH A;  2JSZ A;  3GL5 A;  1ZYP A;  3CYN A;  3VFI A;  1DBY A;  4IN0 A;  2YNX A;  1BQ7 A;  3FZ9 A;  1WRY A;  1GTA A;  2GQK A;  5G5E A;  3GUR A;  2IL3 A;  2HT9 A;  3ZIJ A;  2CX4 A;  2LQQ A;  3PGT A;  2LKU A;  2L4Q A;  1FB6 A;  3EWL A;  5CRW A;  4K7O A;  1V2A A;  1PGT A;  5ECS A;  6GSS A;  1SKR B;  4WEY A;  5ECM B;  4FH8 A;  3JCM L;  4I97 A;  5HR2 A;  4HJ2 A;  3S9F A;  1FOV A;  2C8U A;  1EEJ A;  3AY8 A;  3KZQ A;  5IM9 A;  3DRN A;  1GLQ A;  4MF6 A;  1T1V A;  3VK9 A;  2C3T A;  3VLN A;  4MPF A;  1OYJ A;  6GSY A;  1XW5 A;  3EC3 A;  4AJ7 A;  4F9Z A;  3M3M A;  1B48 A;  2H30 A;  2KP2 A;  3FW2 A;  2YV9 A;  2YN1 A;  5AN1 A;  4F2I A;  4NV5 A;  3HJM A;  4ISD A;  1OKD A;  4ZBD A;  4PX1 A;  4ECC A;  2NVL A;  2X49 A;  1NM3 A;  2X4A A;  4BL7 A;  2PUK C;  1BJX A;  3G7J A;  4MJE A;  4HDE A;  1A2J A;  5D8I A;  2XHF A;  2R3X A;  3EVI A;  2YP6 A;  3IA1 A;  4X1U A;  2JL4 A;  1TDI A;  3E3E A;  1LJR A;  3CXG A;  1JZD A;  2C0D A;  2GLR A;  1R26 A;  5DJM A;  1KBN A;  1FW1 A;  3P8W A;  5J9C A;  3ZIT A;  3RBT A;  1FO5 A;  2JAD A;  3TCO A;  3TB2 A;  1H75 A;  4FYC A;  3PPU A;  5DBQ A;  2WCI A;  4WXT A;  7GSS A;  5F06 A;  4BVY B;  5F07 A;  3FHK A;  1A8Y A;  5KOW A;  1WWJ A;  1NHY A;  2JZR A;  2GZZ A;  2VIM A;  3HVX A;  4XCS A;  2AV4 A;  5G31 A;  1PKZ A;  1A8L A;  3ZYW A;  4WF4 A;  2PGT A;  1G7O A;  1TI3 A;  5J5N A;  1F3B A;  2VCQ A;  3CRT A;  1ST9 A;  4ZXG A;  2R0G A;  4KB3 A;  5D93 A;  3DWV A;  2N5B A;  1GL8 A;  3TKS E;  2YCD A;  5AIS A;  1PX7 A;  3D6I A;  5CRE A;  1UVZ A;  3KXO A;  4G0I A;  4G0K A;  5D73 A;  2OE3 A;  3IXR A;  3L9S A;  5HFG A;  2RM5 A;  1T00 A;  4LL1 B;  5KN0 A;  4MLY A;  2O8V B;  3ZVJ A;  2F8A A;  1Q98 A;  2VL9 A;  1M2D A;  3APS A;  1J9B A;  3ERW A;  1AQW A;  2F8F A;  4PTS A;  3CSJ A;  3F3R A;  1NSW A;  2PMT A;  2V41 A;  4LMW A;  1U87 A;  3MSZ A;  2LNT A;  4GF0 A;  3PR8 A;  1THO A;  1AAZ A;  1DUG A;  3UOM A;  3BOA A;  3C71 A;  4EC0 A;  1VF4 A;  2VOC A;  1CQH A;  2RUF A;  5DAK A;  5A4U A;  2GSQ A;  4E8H A;  2FA4 A;  4DSS A;  3O76 A;  2KLX A;  1SYX A;  5DVB A;  2H8L A;  3IK9 A;  5DDL A;  4QL9 A;  4POM A;  3KJY A;  1EGR A;  1OC9 A;  4MDC A;  5KOX A;  1PL2 A;  3D4T A;  1QUW A;  1LBK A;  4JR6 A;  1PL1 A;  2OE1 A;  12GS A;  3IAM 2;  5F0G A;  3C8E A;  4HZ2 A;  2FD3 A;  2B5Y A;  4ECB A;  4F82 A;  2H74 A;  4KUN A;  1OE7 A;  2VCW A;  3GYK A;  5IMC A;  3OR5 A;  3LQ7 A;  2GZY A;  2YJ7 A;  2ZNM A;  4PUF C;  5HR0 A;  4RQR A;  3HCZ A;  3D5J A;  1EOG A;  3VI7 A;  2HI7 A;  1F9M A;  5CNW A;  5KN1 A;  2PER A;  3FMW A;  4Q5Q A;  4GWR A;  6GSW A;  1I5G A;  5IQY A;  4X4J A;  1T4Z A;  2IMI A;  2PPT A;  1ZZY A;  2ZCT A;  3KIJ A;  4K9Z A;  1H4O A;  2H0H A;  2ON5 A;  3MDK A;  1R5P A;  3KEB A;  2V32 A;  3TKS C;  2VCZ A;  4XS4 A;  5A4V A;  4ULX A;  2WS2 A;  1R5A A;  2AAW A;  3D21 A;  3BD2 A;  3F4R A;  2HSY A;  5F8B A;  3QMX A;  1GSQ A;  3UIW A;  1VF1 A;  2GSS A;  2X8C A;  5J41 A;  3NZN A;  4NHZ A;  1HQO A;  5IMZ A;  5JCW A;  1O81 A;  2QA2 A;  2VL3 A;  3QFA C;  2UZ8 A;  2XPD A;  4KH7 A;  1SKW B;  1GTU A;  3F6D A;  1EV4 A;  1X5E A;  3LW9 A;  3A2V A;  2PVO C;  3F4T A;  4K6X A;  1ERV A;  3GA4 A;  1CQG A;  5JWR B;  3VUR A;  1X0R A;  1GNW A;  4MK3 A;  1KEB A;  4KW6 A;  2FY6 A;  1AW9 A;  1BAY A;  3GKX A;  1XWK A;  3ZLP A;  2OBI A;  2R5G A;  3EYT A;  2H0I A;  4OO4 A;  4AJ6 A;  5ID2 B;  3TJK A;  2GQL A;  3KGK A;  1K0M A;  4IQA A;  5G2Z A;  1JZR A;  2FHE A;  3GV1 A;  3RAZ A;  5D9X A;  3ZZX A;  1K0A A;  2VLU A;  1TRW A;  1K3Y A;  3HHV A;  4GST A;  5FHI A;  4L5L A;  3HJO A;  4KND A;  1YY7 A;  5HQP A;  5AGY A;  1AUC A;  1RQM A;  2CX3 A;  1Z6M A;  4J56 E;  4DEJ A;  2HZE A;  2FWG A;  1N2A A;  3LJR A;  1G7E A;  4PQH A;  4EXJ A;  4I8B A;  1HNA A;  4TR1 B;  3HD5 A;  1YEX A;  1PA3 A;  2L59 A;  17GS A;  2M72 A;  5ECL B;  1TW9 A;  2AB6 A;  3PH9 A;  1O7U A;  4RI6 A;  2B5X A;  2WB9 A;  3HA9 A;  2CV4 A;  4KDU A;  5E4W A;  5J4U A;  1OC3 A;  3UVT A;  4TR4 A;  3FR6 A;  1TTZ A;  2J9H A;  4OFM A;  3TKS A;  4IHU A;  4MH2 A;  2PBJ A;  1EP7 A;  3W8S A;  3EPT A;  4KDY A;  4G19 A;  2HRK A;  1QQ2 A;  3IAS 2;  1ZL9 A;  2FGX A;  5HFK A;  3GKM A;  4J2F A;  1K0D A;  3V1W A;  5C00 A;  2ES7 A;  2IFQ B;  2KP1 A;  1FOH A;  1DSB A;  5B6M A;  1XW9 A;  3FYG A;  1BYE A;  5H5Q A;  1W89 A;  2VM1 A;  2VCV A;  5B8B A;  4HI7 A;  3ZRE A;  1M2A A;  3ME8 A;  5B7C A;  2FA8 A;  4V1A g;  4F03 A;  1QGV A;  2LTK A;  1AQX A;  3H8Q A;  1YJ6 A;  2WUL A;  5EPF A;  1JZW A;  2H72 A;  1FHE A;  2EIQ A;  1WMJ A;  5HR1 A;  4A5P A;  4IW9 A;  2CZ3 A;  1SU9 A;  1VRS D;  3L78 A;  5D96 A;  2R4V A;  2DKH A;  4G10 A;  2K18 A;  4BPY A;  1WJK A;  4RQX A;  1WPI A;  1U3A A;  2DJ1 A;  5DAL B;  10GS A;  3SBC A;  2WDU A;  2I1U A;  1MEK A;  5BRT A;  4EDZ A;  2FWF A;  3KMO A;  3TUE A;  5ELA A;  5LCZ A;  2CAQ A;  2R6K A;  1LU4 A;  2JZS A;  1A0R P;  4TVE A;  5IMD A;  1FVJ A;  2DSA A;  2DML A;  3U6V A;  3LG6 A;  3R2Q A;  5ABR A;  3IE3 A;  1YKA A;  1AXD A;  2F3M A;  4POK A;  2IWT A;  4HU7 A;  1GSE A;  3D22 A;  2L4C A;  3GKN A;  4LL4 B;  5FT3 A;  4HUA A;  3HZ8 A;  1TK5 B;  2NDO A;  3DEX A;  1F2E A;  4CY8 A;  2C80 A;  3RHC A;  4GSS A;  1SL1 B;  1QXH A;  3IDV A;  2HRN A;  3WGD A;  1AQV A;  2CVD A;  1BG5 A;  4ICY A;  5JWQ B;  2WZ9 A;  4OMV A;  1TK8 B;  4YKG A;  5B8A A;  1THX A;  14GS A;  3DD3 A;  4CHS A;  1N8J A;  3QAW A;  4J57 E;  1GSF A;  4HQS A;  1V58 A;  3EIN A;  2GVP A;  1PN9 A;  2VAF A;  2E2M A;  3K8N A;  2H0G A;  2CVK A;  5B6N A;  3FZ4 A;  3DYR A;  4KCA A;  4ECI A;  2R2J A;  2R37 A;  2CZ2 A;  1T8E B;  2B1L A;  4PXO A;  1K3O A;  1XVQ A;  3NOF A;  2AYT A;  1T7P B;  3F6F A;  5GST A;  4EO3 A;  1Q4J A;  1G6Y A;  2ALB A;  1BED A;  4GTU A;  4I6X A;  5IIZ A;  4YKF A;  2B6M A;  3W6G A;  4LLR A;  5GAP D;  2YV7 A;  4TRX A;  2E2G A;  2K6V A;  5FWG A;  1A23 A;  1DE2 A;  3O3T A;  3DVW A;  4V2N A;  3TDG A;  3DML A;  1PSQ A;  1QFN A;  2VL2 C;  3L0H A;  3APQ A;  5BMU A;  22GS A;  5ECR B;  3LYK A;  3LSZ A;  2A2R A;  1Z7P A;  1X9M B;  3J7Y b;  1MDK A;  3A2W A;  5HR3 A;  2GGT A;  3F8U A;  1TU7 A;  2LV3 A;  4Z2U A;  3ZTL A;  1MDI A;  1WP0 A;  4HEA 2;  3Q18 A;  4KGI A;  1XBS A;  4OWY A;  1WE0 A;  3VWX A;  3F0I A;  4ILF A;  4L0W A;  2QC7 A;  4NWY A;  3M9K A;  1A24 A;  1K0N A;  3DIE A;  1U3I A;  4TXO B;  3ZRD A;  5EVO A;  2I3Y A;  5A4W A;  4MP4 A;  3GH6 A;  1MDJ A;  1ZYQ B;  1SJZ A;  1TP9 A;  4IP6 A;  3FRC A;  5GSS A;  3BCI A;  3TJF A;  1SK0 A;  4FQU A;  5G1K A;  1OVN A;  1SYR A;  2I4A A;  4ZL7 A;  1B8X A;  3GMF A;  2M80 A;  2B3S A;  4K1F A;  3GH9 A;  4BVY A;  4D73 B;  2GSR A;  5CRH A;  2FNO A;  2LUS A;  1ZYE A;  2R0P A;  1SJI A;  3H79 A;  1F3A A;  1ML6 A;  1YZX A;  1X9S B;  1F37 A;  2GZP A;  16GS A;  2L57 A;  1OAZ A;  3IOS A;  1A2L A;  1XWC A;  3LXT A;  2A2P A;  3QFB C;  1EEM A;  4OD7 A;  5G30 A;  4IQ1 A;  3GTU B;  2H71 A;  1SD9 A;  4XS6 A;  1GTI A;  5ECH B;  2REM A;  2RLI A;  4XIH A;  4IS0 A;  3WGE A;  3A5W A;  2GT6 A;  1SKS B;  3RHB A;  2F51 A;  2H1G A;  3VI5 A;  3MAK A;  1A0F A;  6GST A;  3IBH A;  4JU5 A;  2N5F A;  4Z2T A;  2AHE A;  4GSN A;  1X9W B;  2EC4 A;  2YZH A;  2TIR A;  2D2Z A;  3H1N A;  2HYX A;  4L0U A;  3UBL A;  6GSV A;  1GUM A;  3H93 A;  2V1M A;  2C0F A;  3E0U A;  1V57 A;  1Y6E A;  1URM A;  2CT6 A;  3F63 A;  2TRX A;  2FCH A;  1HYU A;  1O6J A;  3VWU A;  3QR6 A;  3I43 A;  3DGQ A;  2MMN A;  1JZO A;  4EE0 A;  1JFU A;  1GUL A;  4K2D A;  2AUV A;  1T3B A;  1SJ6 A;  2I9H A;  5ECK B;  1ERW A;  5CAX A;  2VL2 A;  9GSS A;  3ZIV A;  5CYY A;  4HOJ A;  4MJC A;  5A5K A;  5DCG A;  2FWH A;  2HLS A;  2PU9 C;  2DJK A;  5DQY A;  1ERT A;  4EL1 A;  3IHG A;  1IYI A;  2XBI A;  2WFC A;  3ME7 A;  1XWA A;  3FY7 A;  4CW9 A;  4EUY A;  2WJU A;  2H6Z A;  1GUH A;  4WF5 A;  1XWB A;  3HY2 A;  2FLS A;  2B7K A;  3HDC A;  1EV9 A;  2LQO A;  4MF7 A;  3TJG A;  3EMX A;  1K0B A;  1ZYN A;  1XXU A;  4KF9 A;  3L9U A;  1C72 A;  4MPG A;  4JE1 A;  5IO2 A;  2L5O A;  1J08 A;  1XWG A;  4I5Q A;  3O6T A;  2PVQ A;  3QOU A;  4NAX A;  1GSS A;  3KTL A;  4ZBA A;  3ZL5 A;  4RI7 A;  2NPB A;  1K0O A;  5LNK e;  1M9A A;  4PUA A;  1G6W A;  2YWI A;  4XTS A;  3F4S A;  1ZGN A;  3DXB A;  4Q5N A;  3CTG A;  4XHM A;  4WET A;  4I2T A;  4JBB A;  5J3R A;  4JRR A;  5EY6 A;  3EU4 A;  1WIK A;  4NPB A;  4YQU A;  4KSO A;  1XZO A;  3G9B A;  3KH7 A;  3Q6O A;  3HXS A;  4BVX B;  4MNN A;  2MBS A;  2LJA A;  4YH2 A;  2VD1 A;  3A2X A;  2ZUP A;  1M0U A;  1JLV A;  2H1A A;  1J0F A;  4ZB6 A;  3KD0 A;  1YDK A;  3IV4 A;  3QD9 A;  5L71 A;  5E59 A;  2XC2 A;  1SK1 A;  1GUK A;  4H86 A;  4XS1 A;  1OC8 A;  1PMT A;  5IPH A;  2LST A;  3UVH A;  1EOH A;  4PNF A;  5GZZ B;  4KCE A;  1V40 A;  1EZK A;  3ZML A;  3WD6 A;  4WKW A;  5COH A;  1JLW A;  4ZB8 A;  4K5S A;  1GH2 A;  1S3D A;  2YZU A;  1TRU A;  4ML6 A;  1PKW A;  3ZMK A;  6GSU A;  3TOU A;  2B5E A;  2H1B A;  4KA0 A;  4E8E A;  1PN0 A;  3EU3 A;  5ELG A;  3PIN A;  1O85 A;  2VO4 A;  3N9J A;  1UA5 A;  2H66 A;  2G0F A;  2G2Q A;  2QGV A;  3C1R A;  1QMV A;  2IN3 A;  2PWJ A;  1GLP A;  4Q5R A;  4AJ8 A;  2FWE A;  5KEJ A;  2XPE A;  4P3Y B;  5ID2 A;  2MBT A;  1RK4 A;  3U5R E;  2WGR A;  4DSQ A;  1I9D A;  2C0E A;  2PN8 A;  2GQM A;  4IEL A;  2MMZ A;  3UAP A;  3TKR A;  4PQI A;  3VWV A;  3L9V A;  2DMM A;  2H6X A;  2X99 A;  4G0L A;  2JU5 A;  3IK7 A;  2DBC A;  2GDR A;  5ECN B;  3TKQ A;  3GST A;  3ED3 A;  1AIU A;  5EL8 A;  2MMA A;  4QQ7 A;  11GS A;  1XPV A;  2MYG A;  3ERG A;  4N11 A;  2L6D A;  1EP8 A;  2OKA A;  1O8W A;  3TGZ A;  1T4Y A;  2GT5 A;  2YWO A;  3EMP A;  2DIY A;  1PQN A;  4F0B A;  1V98 A;  4CY6 A;  4POL A;  4L5O A;  3M9J A;  4BL7 B;  4MZC A;  4TR1 A;  4XRA A;  4POB A;  2HE3 A;  4ECJ A;  1ZCP A;  5IOW A;  1XVW A;  1UC7 A;  3KM6 A;  3Q19 A;  3QPM A;  2HRA A;  3R3E A;  4O7H A;  4OFN A;  1Z3E A;  4PQ1 A;  5GAN D;  4LA1 A;  4BA7 A;  4G2E A;  1YQ1 A;  1V9W A;  3I9V 2;  4N0V A;  3KH9 A;  1VF3 A;  2E0Q A;  4TN8 A;  3ZFL A;  2OAD A;  4K0G A;  1SL0 B;  1ERU A;  1Z6N A;  2K9F A;  2MZC A;  4ACS A;  1E6B A;  4V2L A;  4CDO A;  2VD0 A;  4GLT A;  2HXK A;  1KNG A;  2L5L A;  2DIZ A;  1ZOF A;  1F6M C;  3QAG A;  2JZT A;  5AIX A;  2YWM A;  2KHP A;  3EE2 A;  1K3L A;  2HNL A;  2LJR A;  2V6O A;  3UBK A;  2IJY A;  3HJP A;  1YEP A;  2YPM A;  4PNG A;  2VM2 A;  3DVX A;  2HRF A;  1GSD A;  1SEN A;  4WR4 A;  3LYP A;  2OE0 A;  2IFQ A;  2H73 A;  3VWW A;  2HSM A;  5ECQ B;  2RII A;  2R0C A;  1USB A;  4N10 A;  1A2M A;  5HFI A;  4QL7 A;  5ECO B;  3RPP A;  2J23 A;  2MMO A;  2B1K A;  1MD4 A;  2VLT A;  3KP9 A;  1BX9 A;  2L6C A;  4ZBB A;  2A4V A;  4OO5 A;  3FR9 A;  2EIR A;  5AIV A;  1E2Y A;  2N5A A;  3A5I A;  3I6A A;  4YAP A;  4OCF A;  2P31 A;  5D9V A;  5JCU A;  4Z7X A;  2JSY A;  3LWA A;  5KN3 A;  4NMU A;  2XBQ A;  3MYD A;  2QKE A;  4MH3 A;  1GRX A;  3GHA A;  1ABA A;  3FKF A;  4EIP A;  4MCU A;  4TR0 A;  4K7I A;  4MJA A;  2E7P A;  1WOU A;  2HSH A;  2RM6 A;  1YF1 A;  1UN2 A;  4ZL9 A;  3VPQ A;  2H76 A;  1G0T A;  3TOT A;  5DAL A;  4DSR A;  2C4J A;  3GX8 A;  1ILO A;  2C0G A;  4K0N A;  4IVF A;  2IMK A;  19GS A;  5JCG A;  3ZVJ D;  2VCX A;  5D9T A;  4FYB A;  4Z2R A;  4FIW A;  4YQV A;  3H4K A;  5DAK B;  1SD8 A;  4GCI A;  2O85 A;  5IPG A;  2HZF A;  2M46 A;  4IJI A;  3FEU A;  2LEG A;  4DSS B;  4O5R A;  4BWS A;  4NXI A;  3BJ5 A;  2OJL A;  2O7K A;  1R4W A;  1OC9 B;  20GS A;  3GNJ A;  3LOR A;  2WRT A;  1M99 A;  4HZ4 A;  4MZW A;  1XFL A;  4I2U A;  3ERF A;  4JED A;  1ACV A;  3C7M A;  3UEM A;  4O32 A;  4RUV A;  3GN3 A;  3D0Z A;  3QDN A;  2IIY A;  3HYP A;  4HS1 A;  4EIQ A;  3A3T A;  4HU9 A;  3W8J A;  5F05 A;  5IMA A;  2IMD A;  5CP1 A;  1Z5Y E;  4KX4 A;  3WYW A;  4ZIJ A;  4OFT A;  3BCK A;  3ZFB A;  1PX6 A;  4FO5 A;  1AC1 A;  3F9U A;  3KP8 A;  2CAI A;  4X43 A;  2OBK A;  4EVM A;  4EKZ A;  1XOB A;  1MD3 A;  1R7H A;  3FR3 A;  3KMN A;  4MA9 A;  1ON4 A;  2X8G A;  4XS4 B;  3TJJ A;  4PGT A;  2V2G A;  2P5R A;  3NIV A;  5INY A;  2BMX A;  2JAC A;  1GTB A;  2C1Y A;  3HZ4 A;  3D4M A;  1M7T A;  1K0C A;  2HFD A;  3M8N A;  3IC8 A;  4MJB A;  2RUE A;  3KTB A;  4O92 A;  4PUR A;  4MAB A;  5G1L A;  3UL3 A;  2CVB A;  4F0C A;  2AJQ B;  4HQZ A;  4L8E A;  1S3C A;  3GX0 A;  1NHO A;  2X64 A;  2H1D A;  4V1A p;  2I81 A;  2C3Q A;  3WT2 A;  2LS5 A;  1EGO A;  3SWL A;  3C73 A;  4YAV A;  1U6T A;  5ECP B;  4YQM A;  5ENU A;  3FZA A;  2DJ2 A;  2VCT A;  3N5O A;  4MZB A;  5H5R A;  2NBS A;  4AF2 A;  1B4Q A;  2GTU A;  1SL2 B;  3P7X A;  1O73 A;  3Q74 A;  1FG4 A;  1M9B A;  4GRF A;  4IKH A;  5IOX A;  4TXO A;  4WR5 A;  5DJL A;  1GNE A;  1ZMA A;  2A4H A;  2BTO T;  4FYU A;  5G5F A;  2LRN A;  3MWH A;  2Z9S A;  2LNS A;  2O89 A;  3FZ5 A;  2H01 A;  2P5Q A;  3UJ1 A;  4EDY A;  4D73 A;  2OAC A;  8GSS A;  3I69 A;  3LEF A;  4ZL8 A;  1XCC A;  3IC4 A;  5JWO B;  5DCH A;  5IO0 A;  1NW2 A;  1VGL A;  1TJD A;  2F9S A;  3CSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...