2CVKA

Crystal structure of thermus thermophilus thioredoxin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
KPIEVTDQNFDETLGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYEGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAQPKRNYQAKIEKHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin
publication title Crystal Structure of a Reduced Thioredoxin from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 31
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2005-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2cvkA00
4QL7A 4L8EA 2DC5A 5E59A 1FW1A 3CTFA 2QC7A 1JZOA 4ILFA 1GUKA 12GSA 2HLSA 2FA4A 2RM6A 2LNTA 3S9FA 5H5SA 1ZMAA 2WDUA 2JZSA 2GSQA 3UAPA 4TKYA 2H1GA 1V57A 4ZXGA 2HT9A 2LV3A 3C73A 2MBTA 4G9HA 3L4NA 6GSWA 1K0OA 1WWJA 2FWHA 4ZL7A 5IMZA 2NPBA 4MA9A 1YY7A 1R4WA 2CAQA 1S3CA 3JCML 4V1Ag 3WGDA 2PVOC 1GTIA 4HU7A 2JU5A 18GSA 2GVPA 1X9WB 2D2ZA 2GGTA 2R4VA 1Z7RA 3ZTLA 2VCVA 2EIRA 3DXBA 5D96A 1TRVA 4RI7A 5ECLB 4GTUA 4J2FA 4OCFA 4OFNA 3LORA 2G0FA 4KH7A 4MMMA 3IAS2 3D21A 2AV4A 3IA1A 3VWUA 1T4YA 2FA8A 5J41A 4TW5A 1T3BA 2XPEA 3VLNA 2ALBA 1EEMA 4HQSA 3ZRDA 4KW6A 5IOWA 2JSYA 3CBUA 4CHSA 4EUYA 2H01A 3GKMA 4TN8A 1EOHA 1OAZA 3VWVA 2EIQA 2CZ2A 2VLTA 2DMLA 3BCIA 1M0UA 2NBSA 4ZL8A 3Q19A 1PL1A 4GWRA 4EKZA 2CVBA 2VAFA 2WGRA 4KDXA 1GSFA 5C00A 3D6IA 3HDCA 3M0FA 4RQRA 3GX8A 4IHUA 3TOUA 1PQNA 1U88A 2DJJA 3ERGA 3FR3A 1YKAA 4Z7XA 5IIZA 2H0IA 5D9VA 2QSIA 5IO2A 2GZYA 3L9VA 4D73B 2JL4A 3CSIA 3GURA 3IR4A 1HNBA 4EL1A 3KTLA 3N9JA 2E2MA 4X0XA 2WFCA 3EINA 2OE0A 5DALB 1O7UA 5H5QA 3TKPA 1B4QA 1GSUA 2IJYA 5IM9A 2B5YA 3GFKA 1OC8A 1R7HA 5CO3A 4JBBA 3EVIA 4HZ2A 5DQYA 3APSA 2IN3A 3UMAA 2R3XA 1LJRA 4AF2A 1SU9A 1TW9A 4V2NA 3QR6A 5JWQB 3L9SA 1VF3A 3F8UA 2CQ9A 1JLWA 4WR4A 5DBQA 4HJ2A 3US3A 2CV4A 4EC0A 2VCWA 3RBTA 1ERVA 2IFQB 3FZ5A 2XHFA 3GMFA 3FKFA 1YKCA 1WE0A 4HS1A 1K0NA 2L6DA 4EO3A 4PXOA 1GTUA 3Q18A 4GSSA 2LJRA 2R5GA 2CZ3A 1U87A 1HD2A 3F4SA 1SJ6A 3OR5A 3KP9A 2TRCP 2O85A 2YJ7A 2HZEB 2WCIA 1Q4JA 3HHVA 2B1LA 2XC2A 4PNFA 2N5FA 4POLA 2OBKA 1F9MA 4HDEA 2PUKC 5EVOA 1O8XA 2YWOA 5JCWA 2LJAA 2XBIA 1AIUA 3CMIA 1PL2A 5ID2A 2F51A 5DAKA 4DSSB 2KOKA 1XFLA 3GH9A 4WF5A 3HD5A 1VRSD 2YNXA 1F2EA 4WKWA 4GRFA 1MDJA 2C1YA 4K2DA 4GF0A 1DSBA 4FH8A 4JU5A 2OJLA 1ERTA 3C71A 3FHKA 3G7IA 3ZREA 1Z6NA 4EF0A 4IP1A 3LGCA 4BWQA 4DEJA 3HA9A 3TCOA 2TRXA 5DCGA 1TDIA 2RUEA 4KCEA 5G1KA 3TKSA 3VI5A 1XW9A 1E6BA 1OC9B 2A2SA 5J9BA 2GQKA 5HQPA 2PN8A 2O7KA 5IOXA 1YF1A 4K7OA 3M1GA 2I1UA 2H19A 1FAAA 1SL0B 1WRYA 4PQHA 1NHOA 2CVKA 4N11A 1PN9A 1YDKA 4AJ7A 3A2XA 1XIYA 1WJKA 6GSYA 3TRPA 1MD4A 5IMVA 3F0IA 1A2JA 3FZAA 5DVBA 4ZBBA 3HZ8A 1UA5A 2VL9A 4GQFA 3KD0A 6GSVA 3E3EA 4BL7A 2N5BA 2VCXA 5JCGA 6GSTA 3IAM2 3VFIA 2A2RA 1EP7A 3UBKA 3UIWA 4ECJA 2OE1A 1NW2A 3GNJA 1GP1A 4HU9A 4G19A 3DEXA 3M9JA 2ON7A 1THXA 3QAVA 4KNDA 3F4RA 4K9ZA 3F4TA 5DJMA 3KMNA 2WS2A 2H72A 5HR0A 3H79A 17GSA 3VPQA 3QDNA 2KP2A 2HSYA 1AC1A 2YOIA 1BYEA 5CRGA 1AQVA 3C8EA 5HFIA 3F3RA 2LTKA 5CRDA 1TXXA 1V2AA 1ERWA 5JCUA 1ILOA 5G2ZA 4IBPA 1PKWA 1M2DA 2PMTA 5CRWA 3ZMKA 2K8VA 2E2GA 2OADA 2F3MA 1GUHA 1QFNA 1GSEA 2VCQA 1ACVA 4LMWA 1J9BA 4TR0A 1A8YA 5J3RA 3CSJA 3F63A 4NV5A 4XS4A 2YV9A 1ZCPA 3IOSA 1KEBA 1Z3EA 1GTBA 2L5LA 2YCDA 1PD21 3ZMLA 2VIMA 4WXTA 2FWEA 2FLSA 1YEPA 3HCZA 4EDYA 2ON5A 5GSSA 1QMVA 1XWAA 4EXJA 3ZVJA 1FHEA 1M7TA 2IMFA 2LKUA 1PRXA 3F9UA 2V41A 4RUVA 1TRWA 4KSMA 1XCCA 3WYWA 1NHYA 3UOMA 5AN1A 1XOAA 4FYUA 3LG6A 4DVCA 5KN3A 5IMFA 1H4OA 4TR3A 2MZCA 4JZQA 2B1KA 3L78A 2AHEA 1RQMA 2C80A 1WMJA 4ECCA 2OKAA 1SJZA 2B3SA 5IQYA 2I9HA 3HVVA 1JHBA 2ZUPA 6GSXA 2FCHA 2JSZA 3WT2A 2DMMA 2LQQA 2RUFA 4PUFC 1EZKA 1Z9HA 3DGQA 4N30A 2B7KA 1SKWB 4HZ4A 5GZZB 5IMDA 1K0MA 3TKRA 2R6KA 1HNCA 2DJ0A 1ZL9A 4F0BA 2IMDA 4IGJA 2YV7A 3VI7A 2C8UA 5FHIA 1SD8A 2PPTA 1FVKA 3TKSC 3PH9A 5JWRB 1XXUA 1GSQA 5AISA 2EIOA 3ME8A 2YJHA 3GA4A 4DSRA 3G9BA 2C3TA 2O89A 4L5OA 4WBRD 3LWAA 3ZL5A 2KUCA 3TJGA 2HI7A 2YANA 2EC4A 3KXOA 2H1AA 4MABA 4FO5A 5D9TA 3GX0A 3DKSA 5ECMB 3CRUA 4JR6A 2YZUA 2B6MA 3KJYA 2DJ2A 4TR1B 1K3LA 4IW9A 2H71A 3EU4A 4F2IA 1C72A 3G7JA 3I69A 14GSA 3QCPA 5D93A 3ERFA 4J56E 4ZBDA 2GT6A 3U5RE 3KZQA 5E4WA 1K0AA 5INYA 1A2MA 1FVJA 3GTUB 2X8HA 1R5PA 3KMOA 3W8JA 3HJOA 4TXVA 1T7PB 1O81A 3QFBC 2PGTA 2YWNA 3H4KA 4BVXA 3ZITA 2IFQA 1LU4A 3IK9A 2IWTA 2VL2A 2PU9C 1THOA 2HE3A 1S3AA 5KN0A 1BAYA 2VM2A 3M8NA 1EOGA 4I2UA 2HYXA 2L5OA 3FY7A 2ZNMA 4F82A 1J08A 1R26A 3QPMA 5ELAA 4FYBA 2M46A 4TXOB 4HQZA 4PURA 4BA7A 2YWMA 4I97A 2NVLA 4BPYA 1OKDA 3ZLPA 4F9ZA 3KEBA 4O5RA 3UVHA 2HZEA 5G1LA 2NTOA 2I81A 1EEJA 5G5EA 3LXTA 2H6XA 4MZCA 4P3YB 1T1VA 1XW5A 4TOPA 3LXZA 4GSNA 1SKSB 3TJKA 2Z9SA 2WJUA 5F06A 5DDLA 4IN0A 4I6XA 2TIRA 4XRAA 4HEA2 4DSSA 2GLRA 4PGTA 1SL2B 1ERUA 1XBSA 3KGKA 2XPDA 1ZOFA 3EC3A 4I5QA 4V2LA 5GSTA 4AJ6A 2GDRA 5B7CA 4MZWA 4NPBA 3PGTA 2CA8A 2H6ZA 3QMXA 4WR5A 3P8WA 2GT5A 3C1SA 1XWBA 3LQ7A 3QOUA 3FW2A 1YZXA 5CAXA 1HYUA 3NZNA 1YJ6A 5ECIB 1GUMA 1TI3A 3DVWA 1OC9A 1JZWA 2LEGA 3LFLA 4Q5FA 2YN1A 2P31A 4F03A 4N0VA 1A23A 2AJQB 3KH7A 3MNGA 3E9JB 3P7XA 3FK8A 3ME7A 2X99A 4HOJA 1MDIA 1TU7A 2O87A 4KGIA 2NDOA 1G6YA 2V6KA 5DQSA 3IDVA 1ABAA 3VWXA 2VCZA 1OE8A 1TKDB 1XVQA 3BBYA 2REMA 4HJMA 4KE3A 3TJBA 1EGOA 1NM3A 2CVDA 2F9SA 4NHZA 3EMPA 4PNGA 4POMA 2GZZA 2IMEA 2C0DA 3GHAA 3TRXA 2VD1A 3ZYWA 2GSRA 3C7MA 4ML6A 4XRDA 2K8SA 1PX6A 4KDUA 3F6DA 4FYCA 2B7JA 3GN3A 3H8QA 2V2GA 2H6YA 1TK8B 4WF4A 1GRXA 4O92A 2H1DA 1M2AA 3SBCA 4LMVA 4HUAA 1A24A 3WD6A 5AIXA 4GLTA 4J57E 3UL3A 5F0GA 3PR8A 1O8WA 5HFKA 4CW9A 2A4VA 3AY8A 1SJIA 2H73A 1FG4A 4ZB6A 4K0GA 1K0BA 1T8EB 1VF4A 2K9FA 4K7IA 3A3TA 1Z7PA 5KN1A 2IPAA 4O7HA 1MEKA 4GQCA 16GSA 1TRSA 2DJ1A 2VL2C 2LJKA 1BX9A 2VD0A 4RQXA 1MTCA 3O76A 1B9XC 1PKZA 3Q74A 3GSTA 3TKQA 4IS0A 4QL9A 1G7OA 3P90A 4Q5QA 5ABRA 2WULA 2C0FA 2PVQA 1QUWA 1E2YA 1K0CA 2L57A 22GSA 3R2QA 4IQAA 3TJJA 1UN2A 1EGRA 2FHEA 3BD2A 2H0GA 3KCMA 1UC7A 3M9KA 2YPMA 2IMKA 3EU3A 2PBJA 3IK7A 5IMAA 3M3MA 1KTEA 4XIHA 2VO4A 10GSA 4H86A 2FD3A 4EE0A 3CTGA 3TDGA 2L59A 5B8AA 1DUGA 3DWVA 2OACA 5IO0A 4OCEA 2DSAA 4YQMA 2H30A 3BOAA 2GSSA 4I2TA 2LRTA 2H75A 1PA3A 4ULXA 1A8LA 1X0RA 3J7Yk 2J9HA 1IYHA 1WOUA 4JEDA 5G31A 2M80A 5A5KA 1PGTA 5HR1A 1MD3A 4ZB8A 3QD9A 2L6CA 1Z6MA 1Y25A 3IHQA 5FWGA 3DMLA 3FRCA 1EV4A 3CXGA 2DLXA 1AXDA 3W8SA 1JZRA 4E8HA 1TTZA 2X64A 3TOTA 4L0WA 5H5RA 1HNAA 3O6TA 4MH3A 2O8VB 1V98A 2CX4A 1XPVA 3G7YA 4KA0A 4OO4A 2JZTA 3GV1A 3GL5A 1XW6A 3LYPA 1MDKA 2L4CA 5ECPB 4L0UA 2H70A 4HI7A 2LSTA 3UEMA 2LS5A 2J23A 4OO5A 4TR1A 5EPFA 4IJ3A 3NOFA 4BVYA 4ZB9A 4JRRA 1XWCA 1YEXA 5CP1A 4POKA 3V1WA 4XS6A 2OE3A 1S3DA 1FB6A 3HKRA 2V32A 1O6JA 3LYKA 4PUAA 2E7PA 3D22A 3D4MA 3BCKA 2AYTA 5JWOB 4RI6A 2HFDA 5GAPD 3GTUA 4IKHA 1ON4A 3HVSA 2C3NA 1GWCA 3NIVA 1SYRA 3LSZA 4ACSA 2GSTA 2H0HA 1SD9A 2PERA 4QQ7A 3DIEA 1OVNA 2JACA 1QXHA 4LLRA 2IMIA 4MZBA 3FZ9A 1JZDA 2YZHA 2XBQA 1EP8A 4K1FA 1XOBA 2B5EA 2WZ9A 1U3AA 2WRTA 2OA7A 2PWJA 2BMXA 1M9BA 3RPPA 3FYGA 1SL1B 1RK4A 2K18A 3GSSA 4TXOA 5J5NA 4MH2A 4NMUA 2LRCA 4MF5A 5J9CA 3IC4A 3KH9A 1ZZYA 4K6XA 1X5DA 3GH6A 3GKXA 3WGXA 2DJ3A 1GSDA 5CREA 1J0FA 1EV9A 2CT6A 1SKRB 2CAIA 3IXRA 3TRQA 19GSA 1U6TA 1SK2A 4X43A 4IJIA 5GAND 2X8CA 4ID0A 1TOFA 2VL3A 3TUEA 1B8XA 1GLPA 1FO5A 4V1Ap 4D73A 1GL8A 1XZOA 3I43A 4NWYA 5D9XA 5LNKe 1O73A 2VM1A 5FT3A 1TP9A 1SENA 2GQMA 5F8BA 20GSA 5DALA 5ECQB 3TKSE 4WBJA 4NAXA 3HJMA 4F0CA 5G30A 4XS4B 2F8AA 5A4VA 2GTUA 3DRNA 3IRAA 2VUPA 1G6WA 2VLVA 3LEFA 1SK0A 1NSWA 2HNLA 3SWLA 5A4WA 4GSTA 2ES7A 4MK3A 3DYRA 1WIKA 5ECNB 1O85A 3F6FA 4MCUA 4MJCA 4LL1B 4DSQA 1OC3A 5IPHA 2C3QA 4MPFA 4ZL9A 1PMTA 2V1MA 1T00A 3EYTA 3HVXA 4G2EA 1KBNA 1W89A 13GSA 2X8GA 1I9DA 4IVFA 1K0DA 2I4AA 2F8FA 5ENUA 1IYIA 1BEDA 4MDCA 1N2AA 1BQ7A 6GSSA 4PQ1A 4AGSA 3HYPA 3ISOA 4G10A 1Y6EA 4ISDA 2MMNA 3EURA 1OYJA 3GUSA 3UBLA 3D0ZA 3KM6A 3KTBA 3MDKA 4XTSA 3C1RA 1AQWA 1F3AA 1QQ2A 1VF2A 4ECBA 4YQUA 1ST9A 2LUSA 1A0RP 3FEUA 1KNGA 4K8MA 1GSYA 2H66A 5C04A 2C0EA 3WGEA 3A2VA 4X1UA 2VCTA 3H93A 8GSSA 3MAKA 1Z5YE 5ECHB 1SK1A 4MLYA 1TU8A 1QK8A 2RLIA 5HR2A 1AW9A 2BJXA 4Q5RA 2GS3A 5COHA 1LBKA 3D5JA 3RPNA 1V9WA 3D4TA 3VPTA 1GSSA 3ZZXA 1GULA 5F07A 1G7EA 2JADA 3KIJA 1TK5B 3MWHA 1B4PA 5G5FA 3K8NA 2I3YA 2H1BA 4EDZA 1ML6A 1B9YC 3FR6A 5CNWA 4NHWA 3IV4A 2RM5A 1JFUA 1WPIA 2MMZA 2HRNA 3ZFBA 3WT1A 1GH2A 3QAGA 1XWKA 3APOA 5IPGA 4YAVA 1GLQA 4GCIA 4PX1A 1PX7A 2P5RA 5ECSA 1X5EA 2E0QA 1RW1A 5AGYA 2C4JA 3KP8A 2RIIA 2ZCTA 3P2AA 3APQA 3QAWA 1FOVA 3MSZA 4WEYA 1TRUA 5J4UA 4MJEA 2CX3A 4YAPA 1X9MB 2AAWA 4L5LA 2WB9A 7GSSA 4EVMA 1JLVA 4MP4A 3DVXA 3L9UA 3RAZA 3W6GA 4KAEA 4KCAA 5KEJA 3TGZA 3BJ5A 3EE2A 2JZRA 5HR3A 3FR9A 1ZYQB 4IELA 4POBA 1OE7A 2B5XA 4PQIA 1I5GA 1F3BA 5DJLA 4OWYA 1B48A 1X9SB 2FUG2 5LD0A 3GYKA 4KX4A 2VOCA 2HZFA 3ED3A 2IL3A 2K6VA 5A4UA 3CYNA 2YWIA 1F6MC 1M99A 5D9WA 3CRTA 2LQOA 1Q98A 3UVTA 3CSHA 1OKTA 1GNEA 4Q5NA 2R37A 3IBHA 4LA1A 3HJPA 3U6VA 1EWXA 1ZGNA 4BWSA 2AB6A 4MPGA 3TB2A 4ZBAA 1HQOA 1TI1A 3VK9A 3GKNA 2H74A 5B8BA 4XS1A 4KSOA 2L4QA 1CQGA 3Q6OA 1URMA 5D8IA 2IIYA 4NXIA 5ELGA 1XWGA 11GSA 5DCHA 4WETA 1N8JA 4MJAA 4O32A 4I8BA 2H76A 2V6OA 3EMXA 4N10A 3EWLA 4TR4A 5AIVA 4IQ1A 1XVWA 3HZ4A 1W4VA 1T4ZA 4OD7A 3E0UA 3F3QA 3UARA 2GZPA 4YH2A 3RHCA 3I9V2 3RHBA 5IMCA 2HXKA 1M2BA 3L0HA 2KP1A 4K7NA 4YQVA 1YQ1A 1R5AA 1DE2A 1V40A 2FWGA 4KUNA 3PINA 4TVEA 1CQHA 2HRFA 3HXSA 4MF7A 3IE3A 3ZIJA 5ID2B 1WP0A 5DAKB 3H1NA 1AUCA 2FWFA 5ECRB 4JR4A 1A0FA 4OFMA 3HY2A 4MJBA 3GIXA 2G2QA 1UVZA 3RDWA 3ZIVA 4MF6A 1BG5A 2KLXA 4N0ZA 5CRHA 1PSQA 1AAZA 2QKEA 1K3YA 3A5WA 4E8EA 2DIYA 1U3IA 5CYYA 1VF1A 5L71A 4GXZA 4IP6A 3IPZA 2H8LA 2M72A 3J7Yb 3UJ1A 3ERWA 1V58A 1DBYA 5EL8A 2FGXA 4CDOA 2P0GA 5B6NA 2DBCA 4ECIA 2MMOA 2P5QA 4XHMA 2KHPA 3ZFLA 1M9AA 3VURA 1ZYEA 4KB3A 1X5CA 2DJKA 3ZVJD 1K3OA 4LL4B 3A2WA 2QGVA 3GKKA 5EY6A 4OFTA 1DE1A 1GTAA 1A2LA 3GRXA 4V2MA 1AQXA 1VGLA 2FY6A 5B6MA 4NV2A 2MBSA 4ZILA 1H75A 4OMVA 2LNSA 2YP6A 5ECOB 2VLUA 1YF0A 9GSSA 3I6AA 1QGVA 5ECKB 4XCSA 3GL3A 4TRXA 3QFAC 2GQLA 1TJDA 2LRNA 2R2JA 4ZIJA 4FIWA 1FB0A 2OBIA 3TJFA 2BTOT 2HSHA 2C0GA 4K0NA 5D73A 2DIZA 3VWWA 4ML1A 2MMAA 3N5OA 2N5AA 3FZ4A 3LJRA 1TK0B 1G0TA 1GNWA 6GSUA 5HFGA 4JE1A 1SYXA 5F05A 2FNOA 1USBA 4AJ8A 5LCZA 3DD3A 1BJXA 2MYGA 2AUVA 3O3TA 1F37A 4KDYA 5KN2A
chains in the Genus database with same CATH superfamily
4QL7A 5BRTA 4L8EA 2DC5A 5E59A 1FW1A 3CTFA 2QC7A 1JZOA 4ILFA 1GUKA 12GSA 2HLSA 2FA4A 2RM6A 2LNTA 3S9FA 5H5SA 1ZMAA 2WDUA 3MIXA 2JZSA 2GSQA 3UAPA 4TKYA 2H1GA 1ZYPA 1V57A 4ZXGA 2HT9A 2LV3A 3C73A 2MBTA 4G9HA 3L4NA 6GSWA 1K0OA 1WWJA 2FWHA 4ZL7A 5IMZA 2NPBA 4MA9A 1YY7A 1R4WA 2CAQA 1S3CA 3JCML 4V1Ag 3WGDA 4CY6A 2PVOC 1GTIA 4HU7A 2JU5A 18GSA 2GVPA 1X9WB 2D2ZA 2GGTA 2R4VA 1Z7RA 3ZTLA 2VCVA 2EIRA 3DXBA 5D96A 1TRVA 4RI7A 5ECLB 4GTUA 4J2FA 4OCFA 4OFNA 3LORA 2G0FA 4KH7A 1M3JA 4MMMA 3IAS2 4PTSA 3D21A 2AV4A 3IA1A 3VWUA 1T4YA 2FA8A 5J41A 4TW5A 1T3BA 2XPEA 3VLNA 2ALBA 1EEMA 4HQSA 3ZRDA 4KW6A 5IOWA 2JSYA 4EIPA 3CBUA 4CHSA 4EUYA 2H01A 3GKMA 4TN8A 1EOHA 1OAZA 3VWVA 2EIQA 2CZ2A 2VLTA 2DMLA 3BCIA 1M0UA 2NBSA 4ZL8A 3Q19A 1PL1A 4GWRA 4EKZA 2CVBA 1PN0A 2VAFA 2WGRA 4KDXA 1GSFA 5C00A 3D6IA 3HDCA 3M0FA 4RQRA 3GX8A 4IHUA 3TOUA 1PQNA 1U88A 2DJJA 3ERGA 3FR3A 1YKAA 4Z7XA 5IIZA 2H0IA 5D9VA 2QSIA 5IO2A 2GZYA 3L9VA 4D73B 2JL4A 3CSIA 3GURA 3IR4A 1HNBA 4EL1A 3KTLA 1S3RA 3N9JA 2E2MA 4X0XA 2WFCA 3EINA 2OE0A 5DALB 1O7UA 5H5QA 3TKPA 1B4QA 1GSUA 2IJYA 5IM9A 3R3EA 2B5YA 3GFKA 1OC8A 1R7HA 4YKGA 5CO3A 4JBBA 3EVIA 4HZ2A 5DQYA 3APSA 2IN3A 3UMAA 2R3XA 1LJRA 4AF2A 1SU9A 1TW9A 4V2NA 3QR6A 5JWQB 3L9SA 1VF3A 3F8UA 4Z2TA 2CQ9A 1JLWA 4WR4A 5DBQA 4HJ2A 3US3A 2R0CA 2CV4A 4EC0A 2VCWA 3RBTA 3IC8A 1ERVA 2IFQB 3FZ5A 2XHFA 3GMFA 3FKFA 1YKCA 1WE0A 4HS1A 1K0NA 2L6DA 4EO3A 4PXOA 4K2XA 1GTUA 3Q18A 4GSSA 2LJRA 2R5GA 2CZ3A 1U87A 1HD2A 1M3IA 3F4SA 4O5UA 1SJ6A 3OR5A 3KP9A 2TRCP 2O85A 2YJ7A 2HZEB 2WCIA 1Q4JA 3HHVA 2B1LA 2XC2A 4PNFA 2N5FA 4POLA 2OBKA 1F9MA 4HDEA 2PUKC 5EVOA 1O8XA 2A2PA 2YWOA 5JCWA 2LJAA 2XBIA 1AIUA 3CMIA 1PL2A 5ID2A 2F51A 5DAKA 4DSSB 2KOKA 1XFLA 3GH9A 4WF5A 3HD5A 1VRSD 2YNXA 1F2EA 4WKWA 4GRFA 1MDJA 2C1YA 4K2DA 4GF0A 1DSBA 4FH8A 4JU5A 2OJLA 1ERTA 3C71A 3FHKA 3G7IA 3ZREA 1Z6NA 4EF0A 4IP1A 3LGCA 4BWQA 4DEJA 3HA9A 3TCOA 2TRXA 5DCGA 1TDIA 2RUEA 4KCEA 5G1KA 3TKSA 3VI5A 1XW9A 1E6BA 1OC9B 2A2SA 5J9BA 2GQKA 5HQPA 4O5QA 2PN8A 2O7KA 5IOXA 1YF1A 4K7OA 3M1GA 2I1UA 2H19A 1FAAA 1SL0B 1WRYA 4PQHA 1NHOA 2CVKA 4N11A 1PN9A 1YDKA 4AJ7A 3A2XA 1XIYA 3HVNA 1WJKA 6GSYA 3TRPA 1MD4A 5IMVA 3F0IA 1A2JA 3FZAA 5DVBA 4ZBBA 3HZ8A 1UA5A 3PPUA 2VL9A 4GQFA 3KD0A 6GSVA 3E3EA 4BL7A 2N5BA 2VCXA 5JCGA 6GSTA 3IAM2 3VFIA 2A2RA 1EP7A 3UBKA 3UIWA 4ECJA 2OE1A 1NW2A 3GNJA 1GP1A 4HU9A 4G19A 3DEXA 3M9JA 2ON7A 1THXA 3QAVA 4KNDA 3F4RA 4K9ZA 3F4TA 5DJMA 3KMNA 2WS2A 2H72A 5HR0A 3H79A 17GSA 3VPQA 3QDNA 2KP2A 2HSYA 1AC1A 2YOIA 1BYEA 5CRGA 1AQVA 3C8EA 5HFIA 3F3RA 2LTKA 5CRDA 1TXXA 1V2AA 1ERWA 5JCUA 1ILOA 5G2ZA 4IBPA 1PKWA 1M2DA 2PMTA 5CRWA 3ZMKA 2K8VA 2E2GA 2OADA 2F3MA 1GUHA 1QFNA 1GSEA 2VCQA 1ACVA 4LMWA 1J9BA 5BMUA 4TR0A 1A8YA 5J3RA 3CSJA 3F63A 4NV5A 4XS4A 2YV9A 1ZCPA 3IOSA 1KEBA 1Z3EA 1GTBA 2X49A 2L5LA 2YCDA 1PD21 3ZMLA 2VIMA 4WXTA 2FWEA 2FLSA 1YEPA 3HCZA 4EDYA 2ON5A 5GSSA 1QMVA 1XWAA 4EXJA 3ZVJA 1FHEA 1M7TA 2IMFA 2LKUA 1PRXA 3F9UA 2V41A 4RUVA 1TRWA 4KSMA 1XCCA 3WYWA 1NHYA 3UOMA 5AN1A 1XOAA 4FYUA 3LG6A 4DVCA 5KN3A 5IMFA 1H4OA 4TR3A 2MZCA 4JZQA 2B1KA 3L78A 2AHEA 4KF9A 1RQMA 2C80A 1WMJA 4ECCA 2OKAA 1SJZA 2B3SA 5IQYA 2I9HA 3HVVA 1JHBA 4G0KA 2ZUPA 6GSXA 2FCHA 2JSZA 3WT2A 2DMMA 2LQQA 2RUFA 1ZYNA 4PUFC 1EZKA 1Z9HA 3DGQA 4N30A 2B7KA 1SKWB 4HZ4A 5GZZB 5IMDA 1K0MA 5KOWA 3TKRA 2R6KA 1HNCA 2DJ0A 1ZL9A 4F0BA 2IMDA 2R0PA 4IGJA 2YV7A 3VI7A 2C8UA 5FHIA 1SD8A 2PPTA 1FVKA 3TKSC 3PH9A 5JWRB 1XXUA 1GSQA 5AISA 2EIOA 3ME8A 2YJHA 3GA4A 4DSRA 3G9BA 2C3TA 2O89A 4L5OA 4WBRD 3LWAA 3ZL5A 2KUCA 3TJGA 2HI7A 2YANA 2EC4A 3KXOA 2H1AA 4MABA 4FO5A 5D9TA 3GX0A 3DKSA 5ECMB 3CRUA 4JR6A 2YZUA 2B6MA 3KJYA 2DJ2A 4TR1B 1K3LA 4BVYB 3IHGA 4IW9A 2H71A 3EU4A 4F2IA 1C72A 3G7JA 3I69A 14GSA 2A4HA 3QCPA 5D93A 3ERFA 4J56E 4ZBDA 2GT6A 3U5RE 3KZQA 5E4WA 1K0AA 5INYA 1A2MA 1FVJA 3GTUB 2X8HA 1R5PA 3KMOA 3W8JA 3HJOA 4TXVA 1T7PB 1O81A 3QFBC 2PGTA 2YWNA 3H4KA 4BVXA 3ZITA 2IFQA 1LU4A 3IK9A 2IWTA 2VL2A 2PU9C 1THOA 2HE3A 1S3AA 5KN0A 1BAYA 2VM2A 3M8NA 1EOGA 4I2UA 2HYXA 4G0IA 2L5OA 3FY7A 2ZNMA 4F82A 1J08A 1R26A 3QPMA 5ELAA 4FYBA 2M46A 3FMWA 4TXOB 4HQZA 4PURA 4BA7A 2YWMA 4I97A 2NVLA 4BPYA 1OKDA 3ZLPA 4F9ZA 3KEBA 4O5RA 3UVHA 2HZEA 5G1LA 2NTOA 2I81A 1EEJA 5G5EA 3LXTA 2H6XA 4MZCA 4USSA 4P3YB 1T1VA 1XW5A 4TOPA 3LXZA 4GSNA 1SKSB 3TJKA 2Z9SA 2WJUA 5F06A 5DDLA 4IN0A 4I6XA 2TIRA 4XRAA 4HEA2 4DSSA 2GLRA 4PGTA 1SL2B 1ERUA 1XBSA 3KGKA 2XPDA 1ZOFA 3EC3A 4I5QA 4V2LA 5GSTA 4AJ6A 2GDRA 5B7CA 4MZWA 4NPBA 3PGTA 2CA8A 2H6ZA 4HSCX 3QMXA 4WR5A 3P8WA 2GT5A 3C1SA 1XWBA 3LQ7A 3QOUA 3FW2A 1YZXA 5CAXA 1HYUA 3NZNA 1YJ6A 5ECIB 1GUMA 1TI3A 3DVWA 4G0LA 1OC9A 1JZWA 2LEGA 3LFLA 4Q5FA 2YN1A 2P31A 4F03A 4N0VA 1A23A 2AJQB 3KH7A 3MNGA 3E9JB 3P7XA 3FK8A 3ME7A 2X99A 4HOJA 1MDIA 1TU7A 2O87A 4KGIA 2NDOA 1G6YA 2V6KA 5DQSA 3IDVA 1ABAA 3VWXA 2VCZA 1OE8A 1TKDB 1XVQA 3BBYA 2REMA 4HJMA 4KE3A 3TJBA 1EGOA 1NM3A 2CVDA 2F9SA 4NHZA 3EMPA 4PNGA 5KOXA 4POMA 2GZZA 2IMEA 2C0DA 3GHAA 1PFOA 3TRXA 2VD1A 3ZYWA 2GSRA 3C7MA 4ML6A 4XRDA 2K8SA 1PX6A 4KDUA 3F6DA 4FYCA 2B7JA 3GN3A 3H8QA 2V2GA 2H6YA 1TK8B 4WF4A 1GRXA 4O92A 2H1DA 1M2AA 3SBCA 4LMVA 4HUAA 1A24A 3WD6A 5AIXA 4GLTA 4J57E 3UL3A 5F0GA 3PR8A 1O8WA 5HFKA 4CW9A 2A4VA 3AY8A 1SJIA 2H73A 1FG4A 4ZB6A 4K0GA 1K0BA 1T8EB 1VF4A 2K9FA 4K7IA 3A3TA 1Z7PA 5KN1A 2IPAA 4O7HA 1MEKA 4GQCA 16GSA 1TRSA 2DJ1A 2VL2C 2LJKA 1BX9A 2VD0A 4RQXA 1MTCA 3O76A 1B9XC 1PKZA 3Q74A 3GSTA 3TKQA 4IS0A 4EIQA 4QL9A 1G7OA 3P90A 2HSMA 4Q5QA 4K5RA 5ABRA 2WULA 2C0FA 2PVQA 1QUWA 1E2YA 1K0CA 2L57A 22GSA 3R2QA 4IQAA 3TJJA 1UN2A 1EGRA 2FHEA 3BD2A 2H0GA 3KCMA 1UC7A 3M9KA 2YPMA 2IMKA 3EU3A 2PBJA 3IK7A 5IMAA 3M3MA 1KTEA 4XIHA 2VO4A 10GSA 3CQFA 4H86A 2FD3A 4EE0A 3CTGA 3TDGA 2L59A 5B8AA 1DUGA 3DWVA 2OACA 5IO0A 4OCEA 2DSAA 4YQMA 2H30A 3BOAA 2GSSA 4I2TA 2LRTA 2H75A 1PA3A 1FOHA 4ULXA 1A8LA 1X0RA 3J7Yk 2J9HA 1IYHA 1WOUA 4JEDA 5G31A 2M80A 5A5KA 1PGTA 5HR1A 1MD3A 4ZB8A 3QD9A 2L6CA 1Z6MA 1Y25A 3IHQA 5FWGA 3DMLA 3FRCA 4X4JA 1EV4A 3CXGA 2DLXA 1AXDA 3W8SA 1JZRA 4E8HA 1TTZA 2X64A 3TOTA 4L0WA 5H5RA 1HNAA 3O6TA 4MH3A 2O8VB 1V98A 2CX4A 1XPVA 3G7YA 4KA0A 4OO4A 2JZTA 3GV1A 3GL5A 1XW6A 3LYPA 1MDKA 2L4CA 5ECPB 4L0UA 2H70A 4HI7A 2LSTA 3UEMA 2LS5A 2J23A 4OO5A 4TR1A 5EPFA 4IJ3A 3NOFA 4BVYA 4ZB9A 4JRRA 1XWCA 1YEXA 5CP1A 4POKA 3V1WA 4XS6A 2OE3A 1S3DA 3MYDA 1FB6A 3HKRA 2V32A 1O6JA 3LYKA 4PUAA 2E7PA 3D22A 3D4MA 4MNNA 3BCKA 2AYTA 5JWOB 4RI6A 2HFDA 5GAPD 3GTUA 4IKHA 1ON4A 3HVSA 2C3NA 1GWCA 3NIVA 1SYRA 3LSZA 4ACSA 2GSTA 2H0HA 1SD9A 2PERA 4QQ7A 3DIEA 1OVNA 2JACA 1QXHA 4LLRA 2IMIA 4MZBA 3FZ9A 1JZDA 2YZHA 2XBQA 1EP8A 4K1FA 1XOBA 2B5EA 2WZ9A 1U3AA 2WRTA 2OA7A 2PWJA 2BMXA 1M9BA 3RPPA 3FYGA 1SL1B 1RK4A 2K18A 3GSSA 4TXOA 5J5NA 4MH2A 4NMUA 2LRCA 4MF5A 5J9CA 3IC4A 3KH9A 1ZZYA 4K6XA 1X5DA 3GH6A 3GKXA 3WGXA 2DJ3A 3LW9A 3EPTA 1GSDA 5CREA 1J0FA 1EV9A 2CT6A 1SKRB 2CAIA 3IXRA 3TRQA 19GSA 1U6TA 1SK2A 4X43A 4IJIA 5GAND 2X8CA 4ID0A 1TOFA 2VL3A 3TUEA 1B8XA 1GLPA 1FO5A 4V1Ap 4D73A 1GL8A 1XZOA 3I43A 4NWYA 5D9XA 5LNKe 1O73A 2VM1A 5FT3A 1TP9A 1SENA 2GQMA 5F8BA 20GSA 5DALA 5ECQB 3TKSE 4WBJA 4NAXA 3HJMA 4F0CA 5G30A 4XS4B 2F8AA 5A4VA 2GTUA 3DRNA 3IRAA 2VUPA 1G6WA 2VLVA 3LEFA 1SK0A 1NSWA 2HNLA 3SWLA 5A4WA 4GSTA 2ES7A 4MK3A 3DYRA 1WIKA 5ECNB 1O85A 3F6FA 4K5SA 4MCUA 4MJCA 4LL1B 4DSQA 1OC3A 5IPHA 2C3QA 4MPFA 4ZL9A 1PMTA 2V1MA 1T00A 3EYTA 3HVXA 4G2EA 1KBNA 1W89A 13GSA 2X8GA 1I9DA 4IVFA 1K0DA 2I4AA 2F8FA 5ENUA 1IYIA 2UZ8A 1BEDA 4MDCA 1N2AA 1BQ7A 6GSSA 4PQ1A 4AGSA 3HYPA 3ISOA 4G10A 1Y6EA 4ISDA 2MMNA 3EURA 1OYJA 3GUSA 3UBLA 3D0ZA 3KM6A 3KTBA 3MDKA 4XTSA 3C1RA 4Z2RA 1AQWA 1F3AA 1QQ2A 1VF2A 4YKFA 4ECBA 4YQUA 1ST9A 2LUSA 1A0RP 3FEUA 1KNGA 4K8MA 1GSYA 2H66A 5C04A 2C0EA 3WGEA 3A2VA 4X1UA 2VCTA 3H93A 8GSSA 3MAKA 1Z5YE 5ECHB 1SK1A 4MLYA 1TU8A 4FQUA 2QA2A 1QK8A 2RLIA 5HR2A 4CY8A 1AW9A 2BJXA 4Q5RA 2GS3A 5COHA 1LBKA 3D5JA 3RPNA 1V9WA 3D4TA 3VPTA 1GSSA 3ZZXA 1GULA 5F07A 1G7EA 2JADA 3KIJA 1TK5B 3MWHA 1B4PA 5G5FA 3K8NA 2I3YA 2H1BA 4EDZA 1ML6A 1B9YC 3FR6A 5CNWA 4NHWA 3IV4A 2RM5A 1JFUA 1WPIA 2MMZA 2HRNA 3ZFBA 3WT1A 1GH2A 3QAGA 1XWKA 3APOA 4A5PA 4BVXB 5IPGA 4YAVA 1GLQA 4GCIA 4PX1A 1PX7A 2P5RA 5ECSA 1X5EA 2E0QA 1RW1A 5AGYA 2C4JA 3KP8A 2RIIA 2ZCTA 3P2AA 3APQA 3QAWA 1FOVA 3MSZA 4WEYA 1TRUA 3A5IA 5J4UA 4MJEA 2CX3A 4YAPA 1X9MB 2AAWA 4L5LA 2WB9A 7GSSA 4EVMA 1JLVA 4MP4A 3DVXA 3L9UA 3RAZA 3W6GA 4KAEA 4KCAA 5KEJA 3TGZA 3BJ5A 3EE2A 2JZRA 5HR3A 3FR9A 1ZYQB 4ICYA 4IELA 4POBA 1OE7A 2B5XA 4PQIA 1I5GA 1F3BA 5DJLA 4OWYA 1B48A 1X9SB 2FUG2 5LD0A 3GYKA 4KX4A 2VOCA 2HZFA 3ED3A 2IL3A 2K6VA 5A4UA 3CYNA 2YWIA 1F6MC 1M99A 5D9WA 3CRTA 2LQOA 1Q98A 3UVTA 3CSHA 1OKTA 1GNEA 4Q5NA 2HRAA 2R37A 3IBHA 4LA1A 3HJPA 3U6VA 1EWXA 1ZGNA 4BWSA 2AB6A 4MPGA 3TB2A 4ZBAA 1HQOA 1TI1A 3VK9A 3GKNA 2H74A 5B8BA 4XS1A 4KSOA 2L4QA 1CQGA 3Q6OA 1URMA 5D8IA 2IIYA 4NXIA 5ELGA 1XWGA 11GSA 5DCHA 4WETA 1N8JA 4MJAA 4O32A 4I8BA 4BIKA 2H76A 2V6OA 3EMXA 4N10A 3EWLA 4TR4A 5AIVA 4IQ1A 1XVWA 3HZ4A 1W4VA 1T4ZA 4OD7A 3E0UA 3F3QA 3UARA 2GZPA 4YH2A 3RHCA 3I9V2 3RHBA 5IMCA 2HXKA 1M2BA 3L0HA 2KP1A 4K7NA 4YQVA 1YQ1A 1R5AA 1DE2A 1V40A 2FWGA 4KUNA 3PINA 4TVEA 1CQHA 2HRFA 3HXSA 4MF7A 3IE3A 3ZIJA 5ID2B 1WP0A 2X4AA 5DAKB 3H1NA 1AUCA 2FWFA 5ECRB 4JR4A 1A0FA 4OFMA 3HY2A 4MJBA 3GIXA 2DKIA 2G2QA 1UVZA 3RDWA 3ZIVA 4MF6A 1BG5A 2KLXA 4N0ZA 5CRHA 1PSQA 1AAZA 2QKEA 1K3YA 3A5WA 4E8EA 2DIYA 1U3IA 5CYYA 1VF1A 5L71A 4GXZA 4IP6A 3IPZA 2H8LA 2M72A 3J7Yb 3UJ1A 3ERWA 1V58A 1DBYA 5EL8A 2FGXA 4CDOA 2P0GA 5B6NA 2DBCA 4ECIA 2MMOA 2P5QA 4XHMA 2KHPA 3ZFLA 1M9AA 3VURA 1ZYEA 4KB3A 1X5CA 2DJKA 3ZVJD 1XG8A 1K3OA 4LL4B 3A2WA 2QGVA 3GKKA 5EY6A 4OFTA 1DE1A 1GTAA 1A2LA 3GRXA 4V2MA 1AQXA 1VGLA 2FY6A 5B6MA 2R0GA 4NV2A 4BL7B 2MBSA 4ZILA 1H75A 4OMVA 2LNSA 2YP6A 5ECOB 2DKHA 2VLUA 1YF0A 9GSSA 3I6AA 1QGVA 5ECKB 4XCSA 3GL3A 4TRXA 3QFAC 2GQLA 1TJDA 2LRNA 2R2JA 4ZIJA 4FIWA 2QA1A 1FB0A 2OBIA 3TJFA 2BTOT 2HRKA 2HSHA 2C0GA 4K0NA 5D73A 2DIZA 3VWWA 4ML1A 2MMAA 3N5OA 2N5AA 3FZ4A 3LJRA 1TK0B 1G0TA 1GNWA 6GSUA 5HFGA 4JE1A 1SYXA 5F05A 2FNOA 1USBA 4AJ8A 4Z2UA 5LCZA 3DD3A 1BJXA 2MYGA 2AUVA 3O3TA 1F37A 4KDYA 5KN2A
chains in the Genus database with same CATH topology
4QL7A 5BRTA 4L8EA 2DC5A 5E59A 1FW1A 3CTFA 2QC7A 1JZOA 4ILFA 1GUKA 12GSA 2HLSA 2FA4A 2RM6A 2LNTA 3S9FA 5H5SA 1ZMAA 2WDUA 3MIXA 2JZSA 2GSQA 3UAPA 4TKYA 2H1GA 1ZYPA 1V57A 4ZXGA 2HT9A 2LV3A 3C73A 2MBTA 4G9HA 3L4NA 6GSWA 1K0OA 1WWJA 2FWHA 4ZL7A 5IMZA 2NPBA 4MA9A 1YY7A 1R4WA 2CAQA 1S3CA 3JCML 4V1Ag 3WGDA 4CY6A 2PVOC 1GTIA 4HU7A 2JU5A 18GSA 2GVPA 1X9WB 2D2ZA 2GGTA 2R4VA 1Z7RA 3ZTLA 2VCVA 2EIRA 3DXBA 5D96A 1TRVA 4RI7A 5ECLB 4GTUA 4J2FA 4OCFA 4OFNA 3LORA 2G0FA 4KH7A 4MMMA 3IAS2 4PTSA 3D21A 2AV4A 3IA1A 3VWUA 1T4YA 2FA8A 5J41A 4TW5A 1T3BA 2XPEA 3VLNA 2ALBA 1EEMA 4HQSA 3ZRDA 4KW6A 5IOWA 2JSYA 4EIPA 3CBUA 4CHSA 4EUYA 2H01A 3GKMA 4TN8A 1EOHA 1OAZA 3VWVA 2EIQA 2CZ2A 2VLTA 2DMLA 3BCIA 1M0UA 2NBSA 4ZL8A 3Q19A 1PL1A 4GWRA 4EKZA 2CVBA 1PN0A 2VAFA 2WGRA 4KDXA 1GSFA 5C00A 3D6IA 3HDCA 3M0FA 4RQRA 3GX8A 4IHUA 3TOUA 1PQNA 1U88A 2DJJA 3ERGA 3FR3A 1YKAA 4Z7XA 5IIZA 2H0IA 5D9VA 2QSIA 5IO2A 2GZYA 3L9VA 4D73B 2JL4A 3CSIA 3GURA 3IR4A 1HNBA 4EL1A 3KTLA 3N9JA 2E2MA 4X0XA 2WFCA 3EINA 2OE0A 5DALB 1O7UA 5H5QA 3TKPA 1B4QA 1GSUA 2IJYA 5IM9A 3R3EA 2B5YA 3GFKA 1OC8A 1R7HA 4YKGA 5CO3A 4JBBA 3EVIA 4HZ2A 5DQYA 3APSA 2IN3A 3UMAA 2R3XA 1LJRA 4AF2A 1SU9A 1TW9A 4V2NA 3QR6A 5JWQB 3L9SA 1VF3A 3F8UA 4Z2TA 2CQ9A 1JLWA 4WR4A 5DBQA 4HJ2A 3US3A 2R0CA 2CV4A 4EC0A 2VCWA 3RBTA 3IC8A 1ERVA 2IFQB 3FZ5A 2XHFA 3GMFA 3FKFA 1YKCA 1WE0A 4HS1A 1K0NA 2L6DA 4EO3A 4PXOA 4K2XA 1GTUA 3Q18A 4GSSA 2LJRA 2R5GA 2CZ3A 1U87A 1HD2A 3F4SA 4O5UA 1SJ6A 3OR5A 3KP9A 2TRCP 2O85A 2YJ7A 2HZEB 2WCIA 1Q4JA 3HHVA 2B1LA 2XC2A 4PNFA 2N5FA 4POLA 2OBKA 1F9MA 4HDEA 2PUKC 5EVOA 1O8XA 2A2PA 2YWOA 5JCWA 2LJAA 2XBIA 1AIUA 3CMIA 1PL2A 5ID2A 2F51A 5DAKA 4DSSB 2KOKA 1XFLA 3GH9A 4WF5A 3HD5A 1VRSD 2YNXA 1F2EA 4WKWA 4GRFA 1MDJA 2C1YA 4K2DA 4GF0A 1DSBA 4FH8A 4JU5A 2OJLA 1ERTA 3C71A 3FHKA 3G7IA 3ZREA 1Z6NA 4EF0A 4IP1A 3LGCA 4BWQA 4DEJA 3HA9A 3TCOA 2TRXA 5DCGA 1TDIA 2RUEA 4KCEA 5G1KA 3TKSA 3VI5A 1XW9A 1E6BA 1OC9B 2A2SA 5J9BA 2GQKA 5HQPA 4O5QA 2PN8A 2O7KA 5IOXA 1YF1A 4K7OA 3M1GA 2I1UA 2H19A 1FAAA 1SL0B 1WRYA 4PQHA 1NHOA 2CVKA 4N11A 1PN9A 1YDKA 4AJ7A 3A2XA 1XIYA 1WJKA 6GSYA 3TRPA 1MD4A 5IMVA 3F0IA 1A2JA 3FZAA 5DVBA 4ZBBA 3HZ8A 1UA5A 3PPUA 2VL9A 4GQFA 3KD0A 6GSVA 3E3EA 4BL7A 2N5BA 2VCXA 5JCGA 6GSTA 3IAM2 3VFIA 2A2RA 1EP7A 3UBKA 3UIWA 4ECJA 2OE1A 1NW2A 3GNJA 1GP1A 4HU9A 4G19A 3DEXA 3M9JA 2ON7A 1THXA 3QAVA 4KNDA 3F4RA 4K9ZA 3F4TA 5DJMA 3KMNA 2WS2A 2H72A 5HR0A 3H79A 17GSA 3VPQA 3QDNA 2KP2A 2HSYA 1AC1A 2YOIA 1BYEA 5CRGA 1AQVA 3C8EA 5HFIA 3F3RA 2LTKA 5CRDA 1TXXA 1V2AA 1ERWA 5JCUA 1ILOA 5G2ZA 4IBPA 1PKWA 1M2DA 2PMTA 5CRWA 3ZMKA 2K8VA 2E2GA 2OADA 2F3MA 1GUHA 1QFNA 1GSEA 2VCQA 1ACVA 4LMWA 1J9BA 5BMUA 4TR0A 1A8YA 5J3RA 3CSJA 3F63A 4NV5A 4XS4A 2YV9A 1ZCPA 3IOSA 1KEBA 1Z3EA 1GTBA 2X49A 2L5LA 2YCDA 1PD21 3ZMLA 2VIMA 4WXTA 2FWEA 2FLSA 1YEPA 3HCZA 4EDYA 2ON5A 5GSSA 1QMVA 1XWAA 4EXJA 3ZVJA 1FHEA 1M7TA 2IMFA 2LKUA 1PRXA 3F9UA 2V41A 4RUVA 1TRWA 4KSMA 1XCCA 3WYWA 1NHYA 3UOMA 5AN1A 1XOAA 4FYUA 3LG6A 4DVCA 5KN3A 5IMFA 1H4OA 4TR3A 2MZCA 4JZQA 2B1KA 3L78A 2AHEA 4KF9A 1RQMA 2C80A 1WMJA 4ECCA 2OKAA 1SJZA 2B3SA 5IQYA 2I9HA 3HVVA 1JHBA 4G0KA 2ZUPA 6GSXA 2FCHA 2JSZA 3WT2A 2DMMA 2LQQA 2RUFA 1ZYNA 4PUFC 1EZKA 1Z9HA 3DGQA 4N30A 2B7KA 1SKWB 4HZ4A 5GZZB 5IMDA 1K0MA 5KOWA 3TKRA 2R6KA 1HNCA 2DJ0A 1ZL9A 4F0BA 2IMDA 2R0PA 4IGJA 2YV7A 3VI7A 2C8UA 5FHIA 1SD8A 2PPTA 1FVKA 3TKSC 3PH9A 5JWRB 1XXUA 1GSQA 5AISA 2EIOA 3ME8A 2YJHA 3GA4A 4DSRA 3G9BA 2C3TA 2O89A 4L5OA 4WBRD 3LWAA 3ZL5A 2KUCA 3TJGA 2HI7A 2YANA 2EC4A 3KXOA 2H1AA 4MABA 4FO5A 5D9TA 3GX0A 3DKSA 5ECMB 3CRUA 4JR6A 2YZUA 2B6MA 3KJYA 2DJ2A 4TR1B 1K3LA 4BVYB 3IHGA 4IW9A 2H71A 3EU4A 4F2IA 1C72A 3G7JA 3I69A 14GSA 2A4HA 3QCPA 5D93A 3ERFA 4J56E 4ZBDA 2GT6A 3U5RE 3KZQA 5E4WA 1K0AA 5INYA 1A2MA 1FVJA 3GTUB 2X8HA 1R5PA 3KMOA 3W8JA 3HJOA 4TXVA 1T7PB 1O81A 3QFBC 2PGTA 2YWNA 3H4KA 4BVXA 3ZITA 2IFQA 1LU4A 3IK9A 2IWTA 2VL2A 2PU9C 1THOA 2HE3A 1S3AA 5KN0A 1BAYA 2VM2A 3M8NA 1EOGA 4I2UA 2HYXA 4G0IA 2L5OA 3FY7A 2ZNMA 4F82A 1J08A 1R26A 3QPMA 5ELAA 4FYBA 2M46A 3FMWA 4TXOB 4HQZA 4PURA 4BA7A 2YWMA 4I97A 2NVLA 4BPYA 1OKDA 3ZLPA 4F9ZA 3KEBA 4O5RA 3UVHA 2HZEA 5G1LA 2NTOA 2I81A 1EEJA 5G5EA 3LXTA 2H6XA 4MZCA 4USSA 4P3YB 1T1VA 1XW5A 4TOPA 3LXZA 4GSNA 1SKSB 3TJKA 2Z9SA 2WJUA 5F06A 5DDLA 4IN0A 4I6XA 2TIRA 4XRAA 4HEA2 4DSSA 2GLRA 4PGTA 1SL2B 1ERUA 1XBSA 3KGKA 2XPDA 1ZOFA 3EC3A 4I5QA 4V2LA 5GSTA 4AJ6A 2GDRA 5B7CA 4MZWA 4NPBA 3PGTA 2CA8A 2H6ZA 3QMXA 4WR5A 3P8WA 2GT5A 3C1SA 1XWBA 3LQ7A 3QOUA 3FW2A 1YZXA 5CAXA 1HYUA 3NZNA 1YJ6A 5ECIB 1GUMA 1TI3A 3DVWA 4G0LA 1OC9A 1JZWA 2LEGA 3LFLA 4Q5FA 2YN1A 2P31A 4F03A 4N0VA 1A23A 2AJQB 3KH7A 3MNGA 3E9JB 3P7XA 3FK8A 3ME7A 2X99A 4HOJA 1MDIA 1TU7A 2O87A 4KGIA 2NDOA 1G6YA 2V6KA 5DQSA 3IDVA 1ABAA 3VWXA 2VCZA 1OE8A 1TKDB 1XVQA 3BBYA 2REMA 4HJMA 4KE3A 3TJBA 1EGOA 1NM3A 2CVDA 2F9SA 4NHZA 3EMPA 4PNGA 5KOXA 4POMA 2GZZA 2IMEA 2C0DA 3GHAA 3TRXA 2VD1A 3ZYWA 2GSRA 3C7MA 4ML6A 4XRDA 2K8SA 1PX6A 4KDUA 3F6DA 4FYCA 2B7JA 3GN3A 3H8QA 2V2GA 2H6YA 1TK8B 4WF4A 1GRXA 4O92A 2H1DA 1M2AA 3SBCA 4LMVA 4HUAA 1A24A 3WD6A 5AIXA 4GLTA 4J57E 3UL3A 5F0GA 3PR8A 1O8WA 5HFKA 4CW9A 2A4VA 3AY8A 1SJIA 2H73A 1FG4A 4ZB6A 4K0GA 1K0BA 1T8EB 1VF4A 2K9FA 4K7IA 3A3TA 1Z7PA 5KN1A 2IPAA 4O7HA 1MEKA 4GQCA 16GSA 1TRSA 2DJ1A 2VL2C 2LJKA 1BX9A 2VD0A 4RQXA 1MTCA 3O76A 1B9XC 1PKZA 3Q74A 3GSTA 3TKQA 4IS0A 4EIQA 4QL9A 1G7OA 3P90A 2HSMA 4Q5QA 4K5RA 5ABRA 2WULA 2C0FA 2PVQA 1QUWA 1E2YA 1K0CA 2L57A 22GSA 3R2QA 4IQAA 3TJJA 1UN2A 1EGRA 2FHEA 3BD2A 2H0GA 3KCMA 1UC7A 3M9KA 2YPMA 2IMKA 3EU3A 2PBJA 3IK7A 5IMAA 3M3MA 1KTEA 4XIHA 2VO4A 10GSA 4H86A 2FD3A 4EE0A 3CTGA 3TDGA 2L59A 5B8AA 1DUGA 3DWVA 2OACA 5IO0A 4OCEA 2DSAA 4YQMA 2H30A 3BOAA 2GSSA 4I2TA 2LRTA 2H75A 1PA3A 1FOHA 4ULXA 1A8LA 1X0RA 3J7Yk 2J9HA 1IYHA 1WOUA 4JEDA 5G31A 2M80A 5A5KA 1PGTA 5HR1A 1MD3A 4ZB8A 3QD9A 2L6CA 1Z6MA 1Y25A 3IHQA 5FWGA 3DMLA 3FRCA 4X4JA 1EV4A 3CXGA 2DLXA 1AXDA 3W8SA 1JZRA 4E8HA 1TTZA 2X64A 3TOTA 4L0WA 5H5RA 1HNAA 3O6TA 4MH3A 2O8VB 1V98A 2CX4A 1XPVA 3G7YA 4KA0A 4OO4A 2JZTA 3GV1A 3GL5A 1XW6A 3LYPA 1MDKA 2L4CA 5ECPB 4L0UA 2H70A 4HI7A 2LSTA 3UEMA 2LS5A 2J23A 4OO5A 4TR1A 5EPFA 4IJ3A 3NOFA 4BVYA 4ZB9A 4JRRA 1XWCA 1YEXA 5CP1A 4POKA 3V1WA 4XS6A 2OE3A 1S3DA 3MYDA 1FB6A 3HKRA 2V32A 1O6JA 3LYKA 4PUAA 2E7PA 3D22A 3D4MA 4MNNA 3BCKA 2AYTA 5JWOB 4RI6A 2HFDA 5GAPD 3GTUA 4IKHA 1ON4A 3HVSA 2C3NA 1GWCA 3NIVA 1SYRA 3LSZA 4ACSA 2GSTA 2H0HA 1SD9A 2PERA 4QQ7A 3DIEA 1OVNA 2JACA 1QXHA 4LLRA 2IMIA 4MZBA 3FZ9A 1JZDA 2YZHA 2XBQA 1EP8A 4K1FA 1XOBA 2B5EA 2WZ9A 1U3AA 2WRTA 2OA7A 2PWJA 2BMXA 1M9BA 3RPPA 3FYGA 1SL1B 1RK4A 2K18A 3GSSA 4TXOA 5J5NA 4MH2A 4NMUA 2LRCA 4MF5A 5J9CA 3IC4A 3KH9A 1ZZYA 4K6XA 1X5DA 3GH6A 3GKXA 3WGXA 2DJ3A 3LW9A 3EPTA 1GSDA 5CREA 1J0FA 1EV9A 2CT6A 1SKRB 2CAIA 3IXRA 3TRQA 19GSA 1U6TA 1SK2A 4X43A 4IJIA 5GAND 2X8CA 4ID0A 1TOFA 2VL3A 3TUEA 1B8XA 1GLPA 1FO5A 4V1Ap 4D73A 1GL8A 1XZOA 3I43A 4NWYA 5D9XA 5LNKe 1O73A 2VM1A 5FT3A 1TP9A 1SENA 2GQMA 5F8BA 20GSA 5DALA 5ECQB 3TKSE 4WBJA 4NAXA 3HJMA 4F0CA 5G30A 4XS4B 2F8AA 5A4VA 2GTUA 3DRNA 3IRAA 2VUPA 1G6WA 2VLVA 3LEFA 1SK0A 1NSWA 2HNLA 3SWLA 5A4WA 4GSTA 2ES7A 4MK3A 3DYRA 1WIKA 5ECNB 1O85A 3F6FA 4K5SA 4MCUA 4MJCA 4LL1B 4DSQA 1OC3A 5IPHA 2C3QA 4MPFA 4ZL9A 1PMTA 2V1MA 1T00A 3EYTA 3HVXA 4G2EA 1KBNA 1W89A 13GSA 2X8GA 1I9DA 4IVFA 1K0DA 2I4AA 2F8FA 5ENUA 1IYIA 2UZ8A 1BEDA 4MDCA 1N2AA 1BQ7A 6GSSA 4PQ1A 4AGSA 3HYPA 3ISOA 4G10A 1Y6EA 4ISDA 2MMNA 3EURA 1OYJA 3GUSA 3UBLA 3D0ZA 3KM6A 3KTBA 3MDKA 4XTSA 3C1RA 4Z2RA 1AQWA 1F3AA 1QQ2A 1VF2A 4YKFA 4ECBA 4YQUA 1ST9A 2LUSA 1A0RP 3FEUA 1KNGA 4K8MA 1GSYA 2H66A 5C04A 2C0EA 3WGEA 3A2VA 4X1UA 2VCTA 3H93A 8GSSA 3MAKA 1Z5YE 5ECHB 1SK1A 4MLYA 1TU8A 4FQUA 2QA2A 1QK8A 2RLIA 5HR2A 4CY8A 1AW9A 2BJXA 4Q5RA 2GS3A 5COHA 1LBKA 3D5JA 3RPNA 1V9WA 3D4TA 3VPTA 1GSSA 3ZZXA 1GULA 5F07A 1G7EA 2JADA 3KIJA 1TK5B 3MWHA 1B4PA 5G5FA 3K8NA 2I3YA 2H1BA 4EDZA 1ML6A 1B9YC 3FR6A 5CNWA 4NHWA 3IV4A 2RM5A 1JFUA 1WPIA 2MMZA 2HRNA 3ZFBA 3WT1A 1GH2A 3QAGA 1XWKA 3APOA 4A5PA 4BVXB 5IPGA 4YAVA 1GLQA 4GCIA 4PX1A 1PX7A 2P5RA 5ECSA 1X5EA 2E0QA 1RW1A 5AGYA 2C4JA 3KP8A 2RIIA 2ZCTA 3P2AA 3APQA 3QAWA 1FOVA 3MSZA 4WEYA 1TRUA 3A5IA 5J4UA 4MJEA 2CX3A 4YAPA 1X9MB 2AAWA 4L5LA 2WB9A 7GSSA 4EVMA 1JLVA 4MP4A 3DVXA 3L9UA 3RAZA 3W6GA 4KAEA 4KCAA 5KEJA 3TGZA 3BJ5A 3EE2A 2JZRA 5HR3A 3FR9A 1ZYQB 4ICYA 4IELA 4POBA 1OE7A 2B5XA 4PQIA 1I5GA 1F3BA 5DJLA 4OWYA 1B48A 1X9SB 2FUG2 5LD0A 3GYKA 4KX4A 2VOCA 2HZFA 3ED3A 2IL3A 2K6VA 5A4UA 3CYNA 2YWIA 1F6MC 1M99A 5D9WA 3CRTA 2LQOA 1Q98A 3UVTA 3CSHA 1OKTA 1GNEA 4Q5NA 2HRAA 2R37A 3IBHA 4LA1A 3HJPA 3U6VA 1EWXA 1ZGNA 4BWSA 2AB6A 4MPGA 3TB2A 4ZBAA 1HQOA 1TI1A 3VK9A 3GKNA 2H74A 5B8BA 4XS1A 4KSOA 2L4QA 1CQGA 3Q6OA 1URMA 5D8IA 2IIYA 4NXIA 5ELGA 1XWGA 11GSA 5DCHA 4WETA 1N8JA 4MJAA 4O32A 4I8BA 2H76A 2V6OA 3EMXA 4N10A 3EWLA 4TR4A 5AIVA 4IQ1A 1XVWA 3HZ4A 1W4VA 1T4ZA 4OD7A 3E0UA 3F3QA 3UARA 2GZPA 4YH2A 3RHCA 3I9V2 3RHBA 5IMCA 2HXKA 1M2BA 3L0HA 2KP1A 4K7NA 4YQVA 1YQ1A 1R5AA 1DE2A 1V40A 2FWGA 4KUNA 3PINA 4TVEA 1CQHA 2HRFA 3HXSA 4MF7A 3IE3A 3ZIJA 5ID2B 1WP0A 2X4AA 5DAKB 3H1NA 1AUCA 2FWFA 5ECRB 4JR4A 1A0FA 4OFMA 3HY2A 4MJBA 3GIXA 2DKIA 2G2QA 1UVZA 3RDWA 3ZIVA 4MF6A 1BG5A 2KLXA 4N0ZA 5CRHA 1PSQA 1AAZA 2QKEA 1K3YA 3A5WA 4E8EA 2DIYA 1U3IA 5CYYA 1VF1A 5L71A 4GXZA 4IP6A 3IPZA 2H8LA 2M72A 3J7Yb 3UJ1A 3ERWA 1V58A 1DBYA 5EL8A 2FGXA 4CDOA 2P0GA 5B6NA 2DBCA 4ECIA 2MMOA 2P5QA 4XHMA 2KHPA 3ZFLA 1M9AA 3VURA 1ZYEA 4KB3A 1X5CA 2DJKA 3ZVJD 1K3OA 4LL4B 3A2WA 2QGVA 3GKKA 5EY6A 4OFTA 1DE1A 1GTAA 1A2LA 3GRXA 4V2MA 1AQXA 1VGLA 2FY6A 5B6MA 2R0GA 4NV2A 4BL7B 2MBSA 4ZILA 1H75A 4OMVA 2LNSA 2YP6A 5ECOB 2DKHA 2VLUA 1YF0A 9GSSA 3I6AA 1QGVA 5ECKB 4XCSA 3GL3A 4TRXA 3QFAC 2GQLA 1TJDA 2LRNA 2R2JA 4ZIJA 4FIWA 2QA1A 1FB0A 2OBIA 3TJFA 2BTOT 2HRKA 2HSHA 2C0GA 4K0NA 5D73A 2DIZA 3VWWA 4ML1A 2MMAA 3N5OA 2N5AA 3FZ4A 3LJRA 1TK0B 1G0TA 1GNWA 6GSUA 5HFGA 4JE1A 1SYXA 5F05A 2FNOA 1USBA 4AJ8A 4Z2UA 5LCZA 3DD3A 1BJXA 2MYGA 2AUVA 3O3TA 1F37A 4KDYA 5KN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QL7 A;  4L8E A;  2DC5 A;  5E59 A;  1FW1 A;  3CTF A;  2QC7 A;  1JZO A;  4ILF A;  1GUK A;  12GS A;  2HLS A;  2FA4 A;  2RM6 A;  2LNT A;  3S9F A;  5H5S A;  1ZMA A;  2WDU A;  2JZS A;  2GSQ A;  3UAP A;  4TKY A;  2H1G A;  1V57 A;  4ZXG A;  2HT9 A;  2LV3 A;  3C73 A;  2MBT A;  4G9H A;  3L4N A;  6GSW A;  1K0O A;  1WWJ A;  2FWH A;  4ZL7 A;  5IMZ A;  2NPB A;  4MA9 A;  1YY7 A;  1R4W A;  2CAQ A;  1S3C A;  3JCM L;  4V1A g;  3WGD A;  2PVO C;  1GTI A;  4HU7 A;  2JU5 A;  18GS A;  2GVP A;  1X9W B;  2D2Z A;  2GGT A;  2R4V A;  1Z7R A;  3ZTL A;  2VCV A;  2EIR A;  3DXB A;  5D96 A;  1TRV A;  4RI7 A;  5ECL B;  4GTU A;  4J2F A;  4OCF A;  4OFN A;  3LOR A;  2G0F A;  4KH7 A;  4MMM A;  3IAS 2;  3D21 A;  2AV4 A;  3IA1 A;  3VWU A;  1T4Y A;  2FA8 A;  5J41 A;  4TW5 A;  1T3B A;  2XPE A;  3VLN A;  2ALB A;  1EEM A;  4HQS A;  3ZRD A;  4KW6 A;  5IOW A;  2JSY A;  3CBU A;  4CHS A;  4EUY A;  2H01 A;  3GKM A;  4TN8 A;  1EOH A;  1OAZ A;  3VWV A;  2EIQ A;  2CZ2 A;  2VLT A;  2DML A;  3BCI A;  1M0U A;  2NBS A;  4ZL8 A;  3Q19 A;  1PL1 A;  4GWR A;  4EKZ A;  2CVB A;  2VAF A;  2WGR A;  4KDX A;  1GSF A;  5C00 A;  3D6I A;  3HDC A;  3M0F A;  4RQR A;  3GX8 A;  4IHU A;  3TOU A;  1PQN A;  1U88 A;  2DJJ A;  3ERG A;  3FR3 A;  1YKA A;  4Z7X A;  5IIZ A;  2H0I A;  5D9V A;  2QSI A;  5IO2 A;  2GZY A;  3L9V A;  4D73 B;  2JL4 A;  3CSI A;  3GUR A;  3IR4 A;  1HNB A;  4EL1 A;  3KTL A;  3N9J A;  2E2M A;  4X0X A;  2WFC A;  3EIN A;  2OE0 A;  5DAL B;  1O7U A;  5H5Q A;  3TKP A;  1B4Q A;  1GSU A;  2IJY A;  5IM9 A;  2B5Y A;  3GFK A;  1OC8 A;  1R7H A;  5CO3 A;  4JBB A;  3EVI A;  4HZ2 A;  5DQY A;  3APS A;  2IN3 A;  3UMA A;  2R3X A;  1LJR A;  4AF2 A;  1SU9 A;  1TW9 A;  4V2N A;  3QR6 A;  5JWQ B;  3L9S A;  1VF3 A;  3F8U A;  2CQ9 A;  1JLW A;  4WR4 A;  5DBQ A;  4HJ2 A;  3US3 A;  2CV4 A;  4EC0 A;  2VCW A;  3RBT A;  1ERV A;  2IFQ B;  3FZ5 A;  2XHF A;  3GMF A;  3FKF A;  1YKC A;  1WE0 A;  4HS1 A;  1K0N A;  2L6D A;  4EO3 A;  4PXO A;  1GTU A;  3Q18 A;  4GSS A;  2LJR A;  2R5G A;  2CZ3 A;  1U87 A;  1HD2 A;  3F4S A;  1SJ6 A;  3OR5 A;  3KP9 A;  2TRC P;  2O85 A;  2YJ7 A;  2HZE B;  2WCI A;  1Q4J A;  3HHV A;  2B1L A;  2XC2 A;  4PNF A;  2N5F A;  4POL A;  2OBK A;  1F9M A;  4HDE A;  2PUK C;  5EVO A;  1O8X A;  2YWO A;  5JCW A;  2LJA A;  2XBI A;  1AIU A;  3CMI A;  1PL2 A;  5ID2 A;  2F51 A;  5DAK A;  4DSS B;  2KOK A;  1XFL A;  3GH9 A;  4WF5 A;  3HD5 A;  1VRS D;  2YNX A;  1F2E A;  4WKW A;  4GRF A;  1MDJ A;  2C1Y A;  4K2D A;  4GF0 A;  1DSB A;  4FH8 A;  4JU5 A;  2OJL A;  1ERT A;  3C71 A;  3FHK A;  3G7I A;  3ZRE A;  1Z6N A;  4EF0 A;  4IP1 A;  3LGC A;  4BWQ A;  4DEJ A;  3HA9 A;  3TCO A;  2TRX A;  5DCG A;  1TDI A;  2RUE A;  4KCE A;  5G1K A;  3TKS A;  3VI5 A;  1XW9 A;  1E6B A;  1OC9 B;  2A2S A;  5J9B A;  2GQK A;  5HQP A;  2PN8 A;  2O7K A;  5IOX A;  1YF1 A;  4K7O A;  3M1G A;  2I1U A;  2H19 A;  1FAA A;  1SL0 B;  1WRY A;  4PQH A;  1NHO A;  2CVK A;  4N11 A;  1PN9 A;  1YDK A;  4AJ7 A;  3A2X A;  1XIY A;  1WJK A;  6GSY A;  3TRP A;  1MD4 A;  5IMV A;  3F0I A;  1A2J A;  3FZA A;  5DVB A;  4ZBB A;  3HZ8 A;  1UA5 A;  2VL9 A;  4GQF A;  3KD0 A;  6GSV A;  3E3E A;  4BL7 A;  2N5B A;  2VCX A;  5JCG A;  6GST A;  3IAM 2;  3VFI A;  2A2R A;  1EP7 A;  3UBK A;  3UIW A;  4ECJ A;  2OE1 A;  1NW2 A;  3GNJ A;  1GP1 A;  4HU9 A;  4G19 A;  3DEX A;  3M9J A;  2ON7 A;  1THX A;  3QAV A;  4KND A;  3F4R A;  4K9Z A;  3F4T A;  5DJM A;  3KMN A;  2WS2 A;  2H72 A;  5HR0 A;  3H79 A;  17GS A;  3VPQ A;  3QDN A;  2KP2 A;  2HSY A;  1AC1 A;  2YOI A;  1BYE A;  5CRG A;  1AQV A;  3C8E A;  5HFI A;  3F3R A;  2LTK A;  5CRD A;  1TXX A;  1V2A A;  1ERW A;  5JCU A;  1ILO A;  5G2Z A;  4IBP A;  1PKW A;  1M2D A;  2PMT A;  5CRW A;  3ZMK A;  2K8V A;  2E2G A;  2OAD A;  2F3M A;  1GUH A;  1QFN A;  1GSE A;  2VCQ A;  1ACV A;  4LMW A;  1J9B A;  4TR0 A;  1A8Y A;  5J3R A;  3CSJ A;  3F63 A;  4NV5 A;  4XS4 A;  2YV9 A;  1ZCP A;  3IOS A;  1KEB A;  1Z3E A;  1GTB A;  2L5L A;  2YCD A;  1PD2 1;  3ZML A;  2VIM A;  4WXT A;  2FWE A;  2FLS A;  1YEP A;  3HCZ A;  4EDY A;  2ON5 A;  5GSS A;  1QMV A;  1XWA A;  4EXJ A;  3ZVJ A;  1FHE A;  1M7T A;  2IMF A;  2LKU A;  1PRX A;  3F9U A;  2V41 A;  4RUV A;  1TRW A;  4KSM A;  1XCC A;  3WYW A;  1NHY A;  3UOM A;  5AN1 A;  1XOA A;  4FYU A;  3LG6 A;  4DVC A;  5KN3 A;  5IMF A;  1H4O A;  4TR3 A;  2MZC A;  4JZQ A;  2B1K A;  3L78 A;  2AHE A;  1RQM A;  2C80 A;  1WMJ A;  4ECC A;  2OKA A;  1SJZ A;  2B3S A;  5IQY A;  2I9H A;  3HVV A;  1JHB A;  2ZUP A;  6GSX A;  2FCH A;  2JSZ A;  3WT2 A;  2DMM A;  2LQQ A;  2RUF A;  4PUF C;  1EZK A;  1Z9H A;  3DGQ A;  4N30 A;  2B7K A;  1SKW B;  4HZ4 A;  5GZZ B;  5IMD A;  1K0M A;  3TKR A;  2R6K A;  1HNC A;  2DJ0 A;  1ZL9 A;  4F0B A;  2IMD A;  4IGJ A;  2YV7 A;  3VI7 A;  2C8U A;  5FHI A;  1SD8 A;  2PPT A;  1FVK A;  3TKS C;  3PH9 A;  5JWR B;  1XXU A;  1GSQ A;  5AIS A;  2EIO A;  3ME8 A;  2YJH A;  3GA4 A;  4DSR A;  3G9B A;  2C3T A;  2O89 A;  4L5O A;  4WBR D;  3LWA A;  3ZL5 A;  2KUC A;  3TJG A;  2HI7 A;  2YAN A;  2EC4 A;  3KXO A;  2H1A A;  4MAB A;  4FO5 A;  5D9T A;  3GX0 A;  3DKS A;  5ECM B;  3CRU A;  4JR6 A;  2YZU A;  2B6M A;  3KJY A;  2DJ2 A;  4TR1 B;  1K3L A;  4IW9 A;  2H71 A;  3EU4 A;  4F2I A;  1C72 A;  3G7J A;  3I69 A;  14GS A;  3QCP A;  5D93 A;  3ERF A;  4J56 E;  4ZBD A;  2GT6 A;  3U5R E;  3KZQ A;  5E4W A;  1K0A A;  5INY A;  1A2M A;  1FVJ A;  3GTU B;  2X8H A;  1R5P A;  3KMO A;  3W8J A;  3HJO A;  4TXV A;  1T7P B;  1O81 A;  3QFB C;  2PGT A;  2YWN A;  3H4K A;  4BVX A;  3ZIT A;  2IFQ A;  1LU4 A;  3IK9 A;  2IWT A;  2VL2 A;  2PU9 C;  1THO A;  2HE3 A;  1S3A A;  5KN0 A;  1BAY A;  2VM2 A;  3M8N A;  1EOG A;  4I2U A;  2HYX A;  2L5O A;  3FY7 A;  2ZNM A;  4F82 A;  1J08 A;  1R26 A;  3QPM A;  5ELA A;  4FYB A;  2M46 A;  4TXO B;  4HQZ A;  4PUR A;  4BA7 A;  2YWM A;  4I97 A;  2NVL A;  4BPY A;  1OKD A;  3ZLP A;  4F9Z A;  3KEB A;  4O5R A;  3UVH A;  2HZE A;  5G1L A;  2NTO A;  2I81 A;  1EEJ A;  5G5E A;  3LXT A;  2H6X A;  4MZC A;  4P3Y B;  1T1V A;  1XW5 A;  4TOP A;  3LXZ A;  4GSN A;  1SKS B;  3TJK A;  2Z9S A;  2WJU A;  5F06 A;  5DDL A;  4IN0 A;  4I6X A;  2TIR A;  4XRA A;  4HEA 2;  4DSS A;  2GLR A;  4PGT A;  1SL2 B;  1ERU A;  1XBS A;  3KGK A;  2XPD A;  1ZOF A;  3EC3 A;  4I5Q A;  4V2L A;  5GST A;  4AJ6 A;  2GDR A;  5B7C A;  4MZW A;  4NPB A;  3PGT A;  2CA8 A;  2H6Z A;  3QMX A;  4WR5 A;  3P8W A;  2GT5 A;  3C1S A;  1XWB A;  3LQ7 A;  3QOU A;  3FW2 A;  1YZX A;  5CAX A;  1HYU A;  3NZN A;  1YJ6 A;  5ECI B;  1GUM A;  1TI3 A;  3DVW A;  1OC9 A;  1JZW A;  2LEG A;  3LFL A;  4Q5F A;  2YN1 A;  2P31 A;  4F03 A;  4N0V A;  1A23 A;  2AJQ B;  3KH7 A;  3MNG A;  3E9J B;  3P7X A;  3FK8 A;  3ME7 A;  2X99 A;  4HOJ A;  1MDI A;  1TU7 A;  2O87 A;  4KGI A;  2NDO A;  1G6Y A;  2V6K A;  5DQS A;  3IDV A;  1ABA A;  3VWX A;  2VCZ A;  1OE8 A;  1TKD B;  1XVQ A;  3BBY A;  2REM A;  4HJM A;  4KE3 A;  3TJB A;  1EGO A;  1NM3 A;  2CVD A;  2F9S A;  4NHZ A;  3EMP A;  4PNG A;  4POM A;  2GZZ A;  2IME A;  2C0D A;  3GHA A;  3TRX A;  2VD1 A;  3ZYW A;  2GSR A;  3C7M A;  4ML6 A;  4XRD A;  2K8S A;  1PX6 A;  4KDU A;  3F6D A;  4FYC A;  2B7J A;  3GN3 A;  3H8Q A;  2V2G A;  2H6Y A;  1TK8 B;  4WF4 A;  1GRX A;  4O92 A;  2H1D A;  1M2A A;  3SBC A;  4LMV A;  4HUA A;  1A24 A;  3WD6 A;  5AIX A;  4GLT A;  4J57 E;  3UL3 A;  5F0G A;  3PR8 A;  1O8W A;  5HFK A;  4CW9 A;  2A4V A;  3AY8 A;  1SJI A;  2H73 A;  1FG4 A;  4ZB6 A;  4K0G A;  1K0B A;  1T8E B;  1VF4 A;  2K9F A;  4K7I A;  3A3T A;  1Z7P A;  5KN1 A;  2IPA A;  4O7H A;  1MEK A;  4GQC A;  16GS A;  1TRS A;  2DJ1 A;  2VL2 C;  2LJK A;  1BX9 A;  2VD0 A;  4RQX A;  1MTC A;  3O76 A;  1B9X C;  1PKZ A;  3Q74 A;  3GST A;  3TKQ A;  4IS0 A;  4QL9 A;  1G7O A;  3P90 A;  4Q5Q A;  5ABR A;  2WUL A;  2C0F A;  2PVQ A;  1QUW A;  1E2Y A;  1K0C A;  2L57 A;  22GS A;  3R2Q A;  4IQA A;  3TJJ A;  1UN2 A;  1EGR A;  2FHE A;  3BD2 A;  2H0G A;  3KCM A;  1UC7 A;  3M9K A;  2YPM A;  2IMK A;  3EU3 A;  2PBJ A;  3IK7 A;  5IMA A;  3M3M A;  1KTE A;  4XIH A;  2VO4 A;  10GS A;  4H86 A;  2FD3 A;  4EE0 A;  3CTG A;  3TDG A;  2L59 A;  5B8A A;  1DUG A;  3DWV A;  2OAC A;  5IO0 A;  4OCE A;  2DSA A;  4YQM A;  2H30 A;  3BOA A;  2GSS A;  4I2T A;  2LRT A;  2H75 A;  1PA3 A;  4ULX A;  1A8L A;  1X0R A;  3J7Y k;  2J9H A;  1IYH A;  1WOU A;  4JED A;  5G31 A;  2M80 A;  5A5K A;  1PGT A;  5HR1 A;  1MD3 A;  4ZB8 A;  3QD9 A;  2L6C A;  1Z6M A;  1Y25 A;  3IHQ A;  5FWG A;  3DML A;  3FRC A;  1EV4 A;  3CXG A;  2DLX A;  1AXD A;  3W8S A;  1JZR A;  4E8H A;  1TTZ A;  2X64 A;  3TOT A;  4L0W A;  5H5R A;  1HNA A;  3O6T A;  4MH3 A;  2O8V B;  1V98 A;  2CX4 A;  1XPV A;  3G7Y A;  4KA0 A;  4OO4 A;  2JZT A;  3GV1 A;  3GL5 A;  1XW6 A;  3LYP A;  1MDK A;  2L4C A;  5ECP B;  4L0U A;  2H70 A;  4HI7 A;  2LST A;  3UEM A;  2LS5 A;  2J23 A;  4OO5 A;  4TR1 A;  5EPF A;  4IJ3 A;  3NOF A;  4BVY A;  4ZB9 A;  4JRR A;  1XWC A;  1YEX A;  5CP1 A;  4POK A;  3V1W A;  4XS6 A;  2OE3 A;  1S3D A;  1FB6 A;  3HKR A;  2V32 A;  1O6J A;  3LYK A;  4PUA A;  2E7P A;  3D22 A;  3D4M A;  3BCK A;  2AYT A;  5JWO B;  4RI6 A;  2HFD A;  5GAP D;  3GTU A;  4IKH A;  1ON4 A;  3HVS A;  2C3N A;  1GWC A;  3NIV A;  1SYR A;  3LSZ A;  4ACS A;  2GST A;  2H0H A;  1SD9 A;  2PER A;  4QQ7 A;  3DIE A;  1OVN A;  2JAC A;  1QXH A;  4LLR A;  2IMI A;  4MZB A;  3FZ9 A;  1JZD A;  2YZH A;  2XBQ A;  1EP8 A;  4K1F A;  1XOB A;  2B5E A;  2WZ9 A;  1U3A A;  2WRT A;  2OA7 A;  2PWJ A;  2BMX A;  1M9B A;  3RPP A;  3FYG A;  1SL1 B;  1RK4 A;  2K18 A;  3GSS A;  4TXO A;  5J5N A;  4MH2 A;  4NMU A;  2LRC A;  4MF5 A;  5J9C A;  3IC4 A;  3KH9 A;  1ZZY A;  4K6X A;  1X5D A;  3GH6 A;  3GKX A;  3WGX A;  2DJ3 A;  1GSD A;  5CRE A;  1J0F A;  1EV9 A;  2CT6 A;  1SKR B;  2CAI A;  3IXR A;  3TRQ A;  19GS A;  1U6T A;  1SK2 A;  4X43 A;  4IJI A;  5GAN D;  2X8C A;  4ID0 A;  1TOF A;  2VL3 A;  3TUE A;  1B8X A;  1GLP A;  1FO5 A;  4V1A p;  4D73 A;  1GL8 A;  1XZO A;  3I43 A;  4NWY A;  5D9X A;  5LNK e;  1O73 A;  2VM1 A;  5FT3 A;  1TP9 A;  1SEN A;  2GQM A;  5F8B A;  20GS A;  5DAL A;  5ECQ B;  3TKS E;  4WBJ A;  4NAX A;  3HJM A;  4F0C A;  5G30 A;  4XS4 B;  2F8A A;  5A4V A;  2GTU A;  3DRN A;  3IRA A;  2VUP A;  1G6W A;  2VLV A;  3LEF A;  1SK0 A;  1NSW A;  2HNL A;  3SWL A;  5A4W A;  4GST A;  2ES7 A;  4MK3 A;  3DYR A;  1WIK A;  5ECN B;  1O85 A;  3F6F A;  4MCU A;  4MJC A;  4LL1 B;  4DSQ A;  1OC3 A;  5IPH A;  2C3Q A;  4MPF A;  4ZL9 A;  1PMT A;  2V1M A;  1T00 A;  3EYT A;  3HVX A;  4G2E A;  1KBN A;  1W89 A;  13GS A;  2X8G A;  1I9D A;  4IVF A;  1K0D A;  2I4A A;  2F8F A;  5ENU A;  1IYI A;  1BED A;  4MDC A;  1N2A A;  1BQ7 A;  6GSS A;  4PQ1 A;  4AGS A;  3HYP A;  3ISO A;  4G10 A;  1Y6E A;  4ISD A;  2MMN A;  3EUR A;  1OYJ A;  3GUS A;  3UBL A;  3D0Z A;  3KM6 A;  3KTB A;  3MDK A;  4XTS A;  3C1R A;  1AQW A;  1F3A A;  1QQ2 A;  1VF2 A;  4ECB A;  4YQU A;  1ST9 A;  2LUS A;  1A0R P;  3FEU A;  1KNG A;  4K8M A;  1GSY A;  2H66 A;  5C04 A;  2C0E A;  3WGE A;  3A2V A;  4X1U A;  2VCT A;  3H93 A;  8GSS A;  3MAK A;  1Z5Y E;  5ECH B;  1SK1 A;  4MLY A;  1TU8 A;  1QK8 A;  2RLI A;  5HR2 A;  1AW9 A;  2BJX A;  4Q5R A;  2GS3 A;  5COH A;  1LBK A;  3D5J A;  3RPN A;  1V9W A;  3D4T A;  3VPT A;  1GSS A;  3ZZX A;  1GUL A;  5F07 A;  1G7E A;  2JAD A;  3KIJ A;  1TK5 B;  3MWH A;  1B4P A;  5G5F A;  3K8N A;  2I3Y A;  2H1B A;  4EDZ A;  1ML6 A;  1B9Y C;  3FR6 A;  5CNW A;  4NHW A;  3IV4 A;  2RM5 A;  1JFU A;  1WPI A;  2MMZ A;  2HRN A;  3ZFB A;  3WT1 A;  1GH2 A;  3QAG A;  1XWK A;  3APO A;  5IPG A;  4YAV A;  1GLQ A;  4GCI A;  4PX1 A;  1PX7 A;  2P5R A;  5ECS A;  1X5E A;  2E0Q A;  1RW1 A;  5AGY A;  2C4J A;  3KP8 A;  2RII A;  2ZCT A;  3P2A A;  3APQ A;  3QAW A;  1FOV A;  3MSZ A;  4WEY A;  1TRU A;  5J4U A;  4MJE A;  2CX3 A;  4YAP A;  1X9M B;  2AAW A;  4L5L A;  2WB9 A;  7GSS A;  4EVM A;  1JLV A;  4MP4 A;  3DVX A;  3L9U A;  3RAZ A;  3W6G A;  4KAE A;  4KCA A;  5KEJ A;  3TGZ A;  3BJ5 A;  3EE2 A;  2JZR A;  5HR3 A;  3FR9 A;  1ZYQ B;  4IEL A;  4POB A;  1OE7 A;  2B5X A;  4PQI A;  1I5G A;  1F3B A;  5DJL A;  4OWY A;  1B48 A;  1X9S B;  2FUG 2;  5LD0 A;  3GYK A;  4KX4 A;  2VOC A;  2HZF A;  3ED3 A;  2IL3 A;  2K6V A;  5A4U A;  3CYN A;  2YWI A;  1F6M C;  1M99 A;  5D9W A;  3CRT A;  2LQO A;  1Q98 A;  3UVT A;  3CSH A;  1OKT A;  1GNE A;  4Q5N A;  2R37 A;  3IBH A;  4LA1 A;  3HJP A;  3U6V A;  1EWX A;  1ZGN A;  4BWS A;  2AB6 A;  4MPG A;  3TB2 A;  4ZBA A;  1HQO A;  1TI1 A;  3VK9 A;  3GKN A;  2H74 A;  5B8B A;  4XS1 A;  4KSO A;  2L4Q A;  1CQG A;  3Q6O A;  1URM A;  5D8I A;  2IIY A;  4NXI A;  5ELG A;  1XWG A;  11GS A;  5DCH A;  4WET A;  1N8J A;  4MJA A;  4O32 A;  4I8B A;  2H76 A;  2V6O A;  3EMX A;  4N10 A;  3EWL A;  4TR4 A;  5AIV A;  4IQ1 A;  1XVW A;  3HZ4 A;  1W4V A;  1T4Z A;  4OD7 A;  3E0U A;  3F3Q A;  3UAR A;  2GZP A;  4YH2 A;  3RHC A;  3I9V 2;  3RHB A;  5IMC A;  2HXK A;  1M2B A;  3L0H A;  2KP1 A;  4K7N A;  4YQV A;  1YQ1 A;  1R5A A;  1DE2 A;  1V40 A;  2FWG A;  4KUN A;  3PIN A;  4TVE A;  1CQH A;  2HRF A;  3HXS A;  4MF7 A;  3IE3 A;  3ZIJ A;  5ID2 B;  1WP0 A;  5DAK B;  3H1N A;  1AUC A;  2FWF A;  5ECR B;  4JR4 A;  1A0F A;  4OFM A;  3HY2 A;  4MJB A;  3GIX A;  2G2Q A;  1UVZ A;  3RDW A;  3ZIV A;  4MF6 A;  1BG5 A;  2KLX A;  4N0Z A;  5CRH A;  1PSQ A;  1AAZ A;  2QKE A;  1K3Y A;  3A5W A;  4E8E A;  2DIY A;  1U3I A;  5CYY A;  1VF1 A;  5L71 A;  4GXZ A;  4IP6 A;  3IPZ A;  2H8L A;  2M72 A;  3J7Y b;  3UJ1 A;  3ERW A;  1V58 A;  1DBY A;  5EL8 A;  2FGX A;  4CDO A;  2P0G A;  5B6N A;  2DBC A;  4ECI A;  2MMO A;  2P5Q A;  4XHM A;  2KHP A;  3ZFL A;  1M9A A;  3VUR A;  1ZYE A;  4KB3 A;  1X5C A;  2DJK A;  3ZVJ D;  1K3O A;  4LL4 B;  3A2W A;  2QGV A;  3GKK A;  5EY6 A;  4OFT A;  1DE1 A;  1GTA A;  1A2L A;  3GRX A;  4V2M A;  1AQX A;  1VGL A;  2FY6 A;  5B6M A;  4NV2 A;  2MBS A;  4ZIL A;  1H75 A;  4OMV A;  2LNS A;  2YP6 A;  5ECO B;  2VLU A;  1YF0 A;  9GSS A;  3I6A A;  1QGV A;  5ECK B;  4XCS A;  3GL3 A;  4TRX A;  3QFA C;  2GQL A;  1TJD A;  2LRN A;  2R2J A;  4ZIJ A;  4FIW A;  1FB0 A;  2OBI A;  3TJF A;  2BTO T;  2HSH A;  2C0G A;  4K0N A;  5D73 A;  2DIZ A;  3VWW A;  4ML1 A;  2MMA A;  3N5O A;  2N5A A;  3FZ4 A;  3LJR A;  1TK0 B;  1G0T A;  1GNW A;  6GSU A;  5HFG A;  4JE1 A;  1SYX A;  5F05 A;  2FNO A;  1USB A;  4AJ8 A;  5LCZ A;  3DD3 A;  1BJX A;  2MYG A;  2AUV A;  3O3T A;  1F37 A;  4KDY A;  5KN2 A; 
#chains in the Genus database with same CATH topology
 4QL7 A;  5BRT A;  4L8E A;  2DC5 A;  5E59 A;  1FW1 A;  3CTF A;  2QC7 A;  1JZO A;  4ILF A;  1GUK A;  12GS A;  2HLS A;  2FA4 A;  2RM6 A;  2LNT A;  3S9F A;  5H5S A;  1ZMA A;  2WDU A;  3MIX A;  2JZS A;  2GSQ A;  3UAP A;  4TKY A;  2H1G A;  1ZYP A;  1V57 A;  4ZXG A;  2HT9 A;  2LV3 A;  3C73 A;  2MBT A;  4G9H A;  3L4N A;  6GSW A;  1K0O A;  1WWJ A;  2FWH A;  4ZL7 A;  5IMZ A;  2NPB A;  4MA9 A;  1YY7 A;  1R4W A;  2CAQ A;  1S3C A;  3JCM L;  4V1A g;  3WGD A;  4CY6 A;  2PVO C;  1GTI A;  4HU7 A;  2JU5 A;  18GS A;  2GVP A;  1X9W B;  2D2Z A;  2GGT A;  2R4V A;  1Z7R A;  3ZTL A;  2VCV A;  2EIR A;  3DXB A;  5D96 A;  1TRV A;  4RI7 A;  5ECL B;  4GTU A;  4J2F A;  4OCF A;  4OFN A;  3LOR A;  2G0F A;  4KH7 A;  1M3J A;  4MMM A;  3IAS 2;  4PTS A;  3D21 A;  2AV4 A;  3IA1 A;  3VWU A;  1T4Y A;  2FA8 A;  5J41 A;  4TW5 A;  1T3B A;  2XPE A;  3VLN A;  2ALB A;  1EEM A;  4HQS A;  3ZRD A;  4KW6 A;  5IOW A;  2JSY A;  4EIP A;  3CBU A;  4CHS A;  4EUY A;  2H01 A;  3GKM A;  4TN8 A;  1EOH A;  1OAZ A;  3VWV A;  2EIQ A;  2CZ2 A;  2VLT A;  2DML A;  3BCI A;  1M0U A;  2NBS A;  4ZL8 A;  3Q19 A;  1PL1 A;  4GWR A;  4EKZ A;  2CVB A;  1PN0 A;  2VAF A;  2WGR A;  4KDX A;  1GSF A;  5C00 A;  3D6I A;  3HDC A;  3M0F A;  4RQR A;  3GX8 A;  4IHU A;  3TOU A;  1PQN A;  1U88 A;  2DJJ A;  3ERG A;  3FR3 A;  1YKA A;  4Z7X A;  5IIZ A;  2H0I A;  5D9V A;  2QSI A;  5IO2 A;  2GZY A;  3L9V A;  4D73 B;  2JL4 A;  3CSI A;  3GUR A;  3IR4 A;  1HNB A;  4EL1 A;  3KTL A;  1S3R A;  3N9J A;  2E2M A;  4X0X A;  2WFC A;  3EIN A;  2OE0 A;  5DAL B;  1O7U A;  5H5Q A;  3TKP A;  1B4Q A;  1GSU A;  2IJY A;  5IM9 A;  3R3E A;  2B5Y A;  3GFK A;  1OC8 A;  1R7H A;  4YKG A;  5CO3 A;  4JBB A;  3EVI A;  4HZ2 A;  5DQY A;  3APS A;  2IN3 A;  3UMA A;  2R3X A;  1LJR A;  4AF2 A;  1SU9 A;  1TW9 A;  4V2N A;  3QR6 A;  5JWQ B;  3L9S A;  1VF3 A;  3F8U A;  4Z2T A;  2CQ9 A;  1JLW A;  4WR4 A;  5DBQ A;  4HJ2 A;  3US3 A;  2R0C A;  2CV4 A;  4EC0 A;  2VCW A;  3RBT A;  3IC8 A;  1ERV A;  2IFQ B;  3FZ5 A;  2XHF A;  3GMF A;  3FKF A;  1YKC A;  1WE0 A;  4HS1 A;  1K0N A;  2L6D A;  4EO3 A;  4PXO A;  4K2X A;  1GTU A;  3Q18 A;  4GSS A;  2LJR A;  2R5G A;  2CZ3 A;  1U87 A;  1HD2 A;  1M3I A;  3F4S A;  4O5U A;  1SJ6 A;  3OR5 A;  3KP9 A;  2TRC P;  2O85 A;  2YJ7 A;  2HZE B;  2WCI A;  1Q4J A;  3HHV A;  2B1L A;  2XC2 A;  4PNF A;  2N5F A;  4POL A;  2OBK A;  1F9M A;  4HDE A;  2PUK C;  5EVO A;  1O8X A;  2A2P A;  2YWO A;  5JCW A;  2LJA A;  2XBI A;  1AIU A;  3CMI A;  1PL2 A;  5ID2 A;  2F51 A;  5DAK A;  4DSS B;  2KOK A;  1XFL A;  3GH9 A;  4WF5 A;  3HD5 A;  1VRS D;  2YNX A;  1F2E A;  4WKW A;  4GRF A;  1MDJ A;  2C1Y A;  4K2D A;  4GF0 A;  1DSB A;  4FH8 A;  4JU5 A;  2OJL A;  1ERT A;  3C71 A;  3FHK A;  3G7I A;  3ZRE A;  1Z6N A;  4EF0 A;  4IP1 A;  3LGC A;  4BWQ A;  4DEJ A;  3HA9 A;  3TCO A;  2TRX A;  5DCG A;  1TDI A;  2RUE A;  4KCE A;  5G1K A;  3TKS A;  3VI5 A;  1XW9 A;  1E6B A;  1OC9 B;  2A2S A;  5J9B A;  2GQK A;  5HQP A;  4O5Q A;  2PN8 A;  2O7K A;  5IOX A;  1YF1 A;  4K7O A;  3M1G A;  2I1U A;  2H19 A;  1FAA A;  1SL0 B;  1WRY A;  4PQH A;  1NHO A;  2CVK A;  4N11 A;  1PN9 A;  1YDK A;  4AJ7 A;  3A2X A;  1XIY A;  3HVN A;  1WJK A;  6GSY A;  3TRP A;  1MD4 A;  5IMV A;  3F0I A;  1A2J A;  3FZA A;  5DVB A;  4ZBB A;  3HZ8 A;  1UA5 A;  3PPU A;  2VL9 A;  4GQF A;  3KD0 A;  6GSV A;  3E3E A;  4BL7 A;  2N5B A;  2VCX A;  5JCG A;  6GST A;  3IAM 2;  3VFI A;  2A2R A;  1EP7 A;  3UBK A;  3UIW A;  4ECJ A;  2OE1 A;  1NW2 A;  3GNJ A;  1GP1 A;  4HU9 A;  4G19 A;  3DEX A;  3M9J A;  2ON7 A;  1THX A;  3QAV A;  4KND A;  3F4R A;  4K9Z A;  3F4T A;  5DJM A;  3KMN A;  2WS2 A;  2H72 A;  5HR0 A;  3H79 A;  17GS A;  3VPQ A;  3QDN A;  2KP2 A;  2HSY A;  1AC1 A;  2YOI A;  1BYE A;  5CRG A;  1AQV A;  3C8E A;  5HFI A;  3F3R A;  2LTK A;  5CRD A;  1TXX A;  1V2A A;  1ERW A;  5JCU A;  1ILO A;  5G2Z A;  4IBP A;  1PKW A;  1M2D A;  2PMT A;  5CRW A;  3ZMK A;  2K8V A;  2E2G A;  2OAD A;  2F3M A;  1GUH A;  1QFN A;  1GSE A;  2VCQ A;  1ACV A;  4LMW A;  1J9B A;  5BMU A;  4TR0 A;  1A8Y A;  5J3R A;  3CSJ A;  3F63 A;  4NV5 A;  4XS4 A;  2YV9 A;  1ZCP A;  3IOS A;  1KEB A;  1Z3E A;  1GTB A;  2X49 A;  2L5L A;  2YCD A;  1PD2 1;  3ZML A;  2VIM A;  4WXT A;  2FWE A;  2FLS A;  1YEP A;  3HCZ A;  4EDY A;  2ON5 A;  5GSS A;  1QMV A;  1XWA A;  4EXJ A;  3ZVJ A;  1FHE A;  1M7T A;  2IMF A;  2LKU A;  1PRX A;  3F9U A;  2V41 A;  4RUV A;  1TRW A;  4KSM A;  1XCC A;  3WYW A;  1NHY A;  3UOM A;  5AN1 A;  1XOA A;  4FYU A;  3LG6 A;  4DVC A;  5KN3 A;  5IMF A;  1H4O A;  4TR3 A;  2MZC A;  4JZQ A;  2B1K A;  3L78 A;  2AHE A;  4KF9 A;  1RQM A;  2C80 A;  1WMJ A;  4ECC A;  2OKA A;  1SJZ A;  2B3S A;  5IQY A;  2I9H A;  3HVV A;  1JHB A;  4G0K A;  2ZUP A;  6GSX A;  2FCH A;  2JSZ A;  3WT2 A;  2DMM A;  2LQQ A;  2RUF A;  1ZYN A;  4PUF C;  1EZK A;  1Z9H A;  3DGQ A;  4N30 A;  2B7K A;  1SKW B;  4HZ4 A;  5GZZ B;  5IMD A;  1K0M A;  5KOW A;  3TKR A;  2R6K A;  1HNC A;  2DJ0 A;  1ZL9 A;  4F0B A;  2IMD A;  2R0P A;  4IGJ A;  2YV7 A;  3VI7 A;  2C8U A;  5FHI A;  1SD8 A;  2PPT A;  1FVK A;  3TKS C;  3PH9 A;  5JWR B;  1XXU A;  1GSQ A;  5AIS A;  2EIO A;  3ME8 A;  2YJH A;  3GA4 A;  4DSR A;  3G9B A;  2C3T A;  2O89 A;  4L5O A;  4WBR D;  3LWA A;  3ZL5 A;  2KUC A;  3TJG A;  2HI7 A;  2YAN A;  2EC4 A;  3KXO A;  2H1A A;  4MAB A;  4FO5 A;  5D9T A;  3GX0 A;  3DKS A;  5ECM B;  3CRU A;  4JR6 A;  2YZU A;  2B6M A;  3KJY A;  2DJ2 A;  4TR1 B;  1K3L A;  4BVY B;  3IHG A;  4IW9 A;  2H71 A;  3EU4 A;  4F2I A;  1C72 A;  3G7J A;  3I69 A;  14GS A;  2A4H A;  3QCP A;  5D93 A;  3ERF A;  4J56 E;  4ZBD A;  2GT6 A;  3U5R E;  3KZQ A;  5E4W A;  1K0A A;  5INY A;  1A2M A;  1FVJ A;  3GTU B;  2X8H A;  1R5P A;  3KMO A;  3W8J A;  3HJO A;  4TXV A;  1T7P B;  1O81 A;  3QFB C;  2PGT A;  2YWN A;  3H4K A;  4BVX A;  3ZIT A;  2IFQ A;  1LU4 A;  3IK9 A;  2IWT A;  2VL2 A;  2PU9 C;  1THO A;  2HE3 A;  1S3A A;  5KN0 A;  1BAY A;  2VM2 A;  3M8N A;  1EOG A;  4I2U A;  2HYX A;  4G0I A;  2L5O A;  3FY7 A;  2ZNM A;  4F82 A;  1J08 A;  1R26 A;  3QPM A;  5ELA A;  4FYB A;  2M46 A;  3FMW A;  4TXO B;  4HQZ A;  4PUR A;  4BA7 A;  2YWM A;  4I97 A;  2NVL A;  4BPY A;  1OKD A;  3ZLP A;  4F9Z A;  3KEB A;  4O5R A;  3UVH A;  2HZE A;  5G1L A;  2NTO A;  2I81 A;  1EEJ A;  5G5E A;  3LXT A;  2H6X A;  4MZC A;  4USS A;  4P3Y B;  1T1V A;  1XW5 A;  4TOP A;  3LXZ A;  4GSN A;  1SKS B;  3TJK A;  2Z9S A;  2WJU A;  5F06 A;  5DDL A;  4IN0 A;  4I6X A;  2TIR A;  4XRA A;  4HEA 2;  4DSS A;  2GLR A;  4PGT A;  1SL2 B;  1ERU A;  1XBS A;  3KGK A;  2XPD A;  1ZOF A;  3EC3 A;  4I5Q A;  4V2L A;  5GST A;  4AJ6 A;  2GDR A;  5B7C A;  4MZW A;  4NPB A;  3PGT A;  2CA8 A;  2H6Z A;  4HSC X;  3QMX A;  4WR5 A;  3P8W A;  2GT5 A;  3C1S A;  1XWB A;  3LQ7 A;  3QOU A;  3FW2 A;  1YZX A;  5CAX A;  1HYU A;  3NZN A;  1YJ6 A;  5ECI B;  1GUM A;  1TI3 A;  3DVW A;  4G0L A;  1OC9 A;  1JZW A;  2LEG A;  3LFL A;  4Q5F A;  2YN1 A;  2P31 A;  4F03 A;  4N0V A;  1A23 A;  2AJQ B;  3KH7 A;  3MNG A;  3E9J B;  3P7X A;  3FK8 A;  3ME7 A;  2X99 A;  4HOJ A;  1MDI A;  1TU7 A;  2O87 A;  4KGI A;  2NDO A;  1G6Y A;  2V6K A;  5DQS A;  3IDV A;  1ABA A;  3VWX A;  2VCZ A;  1OE8 A;  1TKD B;  1XVQ A;  3BBY A;  2REM A;  4HJM A;  4KE3 A;  3TJB A;  1EGO A;  1NM3 A;  2CVD A;  2F9S A;  4NHZ A;  3EMP A;  4PNG A;  5KOX A;  4POM A;  2GZZ A;  2IME A;  2C0D A;  3GHA A;  1PFO A;  3TRX A;  2VD1 A;  3ZYW A;  2GSR A;  3C7M A;  4ML6 A;  4XRD A;  2K8S A;  1PX6 A;  4KDU A;  3F6D A;  4FYC A;  2B7J A;  3GN3 A;  3H8Q A;  2V2G A;  2H6Y A;  1TK8 B;  4WF4 A;  1GRX A;  4O92 A;  2H1D A;  1M2A A;  3SBC A;  4LMV A;  4HUA A;  1A24 A;  3WD6 A;  5AIX A;  4GLT A;  4J57 E;  3UL3 A;  5F0G A;  3PR8 A;  1O8W A;  5HFK A;  4CW9 A;  2A4V A;  3AY8 A;  1SJI A;  2H73 A;  1FG4 A;  4ZB6 A;  4K0G A;  1K0B A;  1T8E B;  1VF4 A;  2K9F A;  4K7I A;  3A3T A;  1Z7P A;  5KN1 A;  2IPA A;  4O7H A;  1MEK A;  4GQC A;  16GS A;  1TRS A;  2DJ1 A;  2VL2 C;  2LJK A;  1BX9 A;  2VD0 A;  4RQX A;  1MTC A;  3O76 A;  1B9X C;  1PKZ A;  3Q74 A;  3GST A;  3TKQ A;  4IS0 A;  4EIQ A;  4QL9 A;  1G7O A;  3P90 A;  2HSM A;  4Q5Q A;  4K5R A;  5ABR A;  2WUL A;  2C0F A;  2PVQ A;  1QUW A;  1E2Y A;  1K0C A;  2L57 A;  22GS A;  3R2Q A;  4IQA A;  3TJJ A;  1UN2 A;  1EGR A;  2FHE A;  3BD2 A;  2H0G A;  3KCM A;  1UC7 A;  3M9K A;  2YPM A;  2IMK A;  3EU3 A;  2PBJ A;  3IK7 A;  5IMA A;  3M3M A;  1KTE A;  4XIH A;  2VO4 A;  10GS A;  3CQF A;  4H86 A;  2FD3 A;  4EE0 A;  3CTG A;  3TDG A;  2L59 A;  5B8A A;  1DUG A;  3DWV A;  2OAC A;  5IO0 A;  4OCE A;  2DSA A;  4YQM A;  2H30 A;  3BOA A;  2GSS A;  4I2T A;  2LRT A;  2H75 A;  1PA3 A;  1FOH A;  4ULX A;  1A8L A;  1X0R A;  3J7Y k;  2J9H A;  1IYH A;  1WOU A;  4JED A;  5G31 A;  2M80 A;  5A5K A;  1PGT A;  5HR1 A;  1MD3 A;  4ZB8 A;  3QD9 A;  2L6C A;  1Z6M A;  1Y25 A;  3IHQ A;  5FWG A;  3DML A;  3FRC A;  4X4J A;  1EV4 A;  3CXG A;  2DLX A;  1AXD A;  3W8S A;  1JZR A;  4E8H A;  1TTZ A;  2X64 A;  3TOT A;  4L0W A;  5H5R A;  1HNA A;  3O6T A;  4MH3 A;  2O8V B;  1V98 A;  2CX4 A;  1XPV A;  3G7Y A;  4KA0 A;  4OO4 A;  2JZT A;  3GV1 A;  3GL5 A;  1XW6 A;  3LYP A;  1MDK A;  2L4C A;  5ECP B;  4L0U A;  2H70 A;  4HI7 A;  2LST A;  3UEM A;  2LS5 A;  2J23 A;  4OO5 A;  4TR1 A;  5EPF A;  4IJ3 A;  3NOF A;  4BVY A;  4ZB9 A;  4JRR A;  1XWC A;  1YEX A;  5CP1 A;  4POK A;  3V1W A;  4XS6 A;  2OE3 A;  1S3D A;  3MYD A;  1FB6 A;  3HKR A;  2V32 A;  1O6J A;  3LYK A;  4PUA A;  2E7P A;  3D22 A;  3D4M A;  4MNN A;  3BCK A;  2AYT A;  5JWO B;  4RI6 A;  2HFD A;  5GAP D;  3GTU A;  4IKH A;  1ON4 A;  3HVS A;  2C3N A;  1GWC A;  3NIV A;  1SYR A;  3LSZ A;  4ACS A;  2GST A;  2H0H A;  1SD9 A;  2PER A;  4QQ7 A;  3DIE A;  1OVN A;  2JAC A;  1QXH A;  4LLR A;  2IMI A;  4MZB A;  3FZ9 A;  1JZD A;  2YZH A;  2XBQ A;  1EP8 A;  4K1F A;  1XOB A;  2B5E A;  2WZ9 A;  1U3A A;  2WRT A;  2OA7 A;  2PWJ A;  2BMX A;  1M9B A;  3RPP A;  3FYG A;  1SL1 B;  1RK4 A;  2K18 A;  3GSS A;  4TXO A;  5J5N A;  4MH2 A;  4NMU A;  2LRC A;  4MF5 A;  5J9C A;  3IC4 A;  3KH9 A;  1ZZY A;  4K6X A;  1X5D A;  3GH6 A;  3GKX A;  3WGX A;  2DJ3 A;  3LW9 A;  3EPT A;  1GSD A;  5CRE A;  1J0F A;  1EV9 A;  2CT6 A;  1SKR B;  2CAI A;  3IXR A;  3TRQ A;  19GS A;  1U6T A;  1SK2 A;  4X43 A;  4IJI A;  5GAN D;  2X8C A;  4ID0 A;  1TOF A;  2VL3 A;  3TUE A;  1B8X A;  1GLP A;  1FO5 A;  4V1A p;  4D73 A;  1GL8 A;  1XZO A;  3I43 A;  4NWY A;  5D9X A;  5LNK e;  1O73 A;  2VM1 A;  5FT3 A;  1TP9 A;  1SEN A;  2GQM A;  5F8B A;  20GS A;  5DAL A;  5ECQ B;  3TKS E;  4WBJ A;  4NAX A;  3HJM A;  4F0C A;  5G30 A;  4XS4 B;  2F8A A;  5A4V A;  2GTU A;  3DRN A;  3IRA A;  2VUP A;  1G6W A;  2VLV A;  3LEF A;  1SK0 A;  1NSW A;  2HNL A;  3SWL A;  5A4W A;  4GST A;  2ES7 A;  4MK3 A;  3DYR A;  1WIK A;  5ECN B;  1O85 A;  3F6F A;  4K5S A;  4MCU A;  4MJC A;  4LL1 B;  4DSQ A;  1OC3 A;  5IPH A;  2C3Q A;  4MPF A;  4ZL9 A;  1PMT A;  2V1M A;  1T00 A;  3EYT A;  3HVX A;  4G2E A;  1KBN A;  1W89 A;  13GS A;  2X8G A;  1I9D A;  4IVF A;  1K0D A;  2I4A A;  2F8F A;  5ENU A;  1IYI A;  2UZ8 A;  1BED A;  4MDC A;  1N2A A;  1BQ7 A;  6GSS A;  4PQ1 A;  4AGS A;  3HYP A;  3ISO A;  4G10 A;  1Y6E A;  4ISD A;  2MMN A;  3EUR A;  1OYJ A;  3GUS A;  3UBL A;  3D0Z A;  3KM6 A;  3KTB A;  3MDK A;  4XTS A;  3C1R A;  4Z2R A;  1AQW A;  1F3A A;  1QQ2 A;  1VF2 A;  4YKF A;  4ECB A;  4YQU A;  1ST9 A;  2LUS A;  1A0R P;  3FEU A;  1KNG A;  4K8M A;  1GSY A;  2H66 A;  5C04 A;  2C0E A;  3WGE A;  3A2V A;  4X1U A;  2VCT A;  3H93 A;  8GSS A;  3MAK A;  1Z5Y E;  5ECH B;  1SK1 A;  4MLY A;  1TU8 A;  4FQU A;  2QA2 A;  1QK8 A;  2RLI A;  5HR2 A;  4CY8 A;  1AW9 A;  2BJX A;  4Q5R A;  2GS3 A;  5COH A;  1LBK A;  3D5J A;  3RPN A;  1V9W A;  3D4T A;  3VPT A;  1GSS A;  3ZZX A;  1GUL A;  5F07 A;  1G7E A;  2JAD A;  3KIJ A;  1TK5 B;  3MWH A;  1B4P A;  5G5F A;  3K8N A;  2I3Y A;  2H1B A;  4EDZ A;  1ML6 A;  1B9Y C;  3FR6 A;  5CNW A;  4NHW A;  3IV4 A;  2RM5 A;  1JFU A;  1WPI A;  2MMZ A;  2HRN A;  3ZFB A;  3WT1 A;  1GH2 A;  3QAG A;  1XWK A;  3APO A;  4A5P A;  4BVX B;  5IPG A;  4YAV A;  1GLQ A;  4GCI A;  4PX1 A;  1PX7 A;  2P5R A;  5ECS A;  1X5E A;  2E0Q A;  1RW1 A;  5AGY A;  2C4J A;  3KP8 A;  2RII A;  2ZCT A;  3P2A A;  3APQ A;  3QAW A;  1FOV A;  3MSZ A;  4WEY A;  1TRU A;  3A5I A;  5J4U A;  4MJE A;  2CX3 A;  4YAP A;  1X9M B;  2AAW A;  4L5L A;  2WB9 A;  7GSS A;  4EVM A;  1JLV A;  4MP4 A;  3DVX A;  3L9U A;  3RAZ A;  3W6G A;  4KAE A;  4KCA A;  5KEJ A;  3TGZ A;  3BJ5 A;  3EE2 A;  2JZR A;  5HR3 A;  3FR9 A;  1ZYQ B;  4ICY A;  4IEL A;  4POB A;  1OE7 A;  2B5X A;  4PQI A;  1I5G A;  1F3B A;  5DJL A;  4OWY A;  1B48 A;  1X9S B;  2FUG 2;  5LD0 A;  3GYK A;  4KX4 A;  2VOC A;  2HZF A;  3ED3 A;  2IL3 A;  2K6V A;  5A4U A;  3CYN A;  2YWI A;  1F6M C;  1M99 A;  5D9W A;  3CRT A;  2LQO A;  1Q98 A;  3UVT A;  3CSH A;  1OKT A;  1GNE A;  4Q5N A;  2HRA A;  2R37 A;  3IBH A;  4LA1 A;  3HJP A;  3U6V A;  1EWX A;  1ZGN A;  4BWS A;  2AB6 A;  4MPG A;  3TB2 A;  4ZBA A;  1HQO A;  1TI1 A;  3VK9 A;  3GKN A;  2H74 A;  5B8B A;  4XS1 A;  4KSO A;  2L4Q A;  1CQG A;  3Q6O A;  1URM A;  5D8I A;  2IIY A;  4NXI A;  5ELG A;  1XWG A;  11GS A;  5DCH A;  4WET A;  1N8J A;  4MJA A;  4O32 A;  4I8B A;  4BIK A;  2H76 A;  2V6O A;  3EMX A;  4N10 A;  3EWL A;  4TR4 A;  5AIV A;  4IQ1 A;  1XVW A;  3HZ4 A;  1W4V A;  1T4Z A;  4OD7 A;  3E0U A;  3F3Q A;  3UAR A;  2GZP A;  4YH2 A;  3RHC A;  3I9V 2;  3RHB A;  5IMC A;  2HXK A;  1M2B A;  3L0H A;  2KP1 A;  4K7N A;  4YQV A;  1YQ1 A;  1R5A A;  1DE2 A;  1V40 A;  2FWG A;  4KUN A;  3PIN A;  4TVE A;  1CQH A;  2HRF A;  3HXS A;  4MF7 A;  3IE3 A;  3ZIJ A;  5ID2 B;  1WP0 A;  2X4A A;  5DAK B;  3H1N A;  1AUC A;  2FWF A;  5ECR B;  4JR4 A;  1A0F A;  4OFM A;  3HY2 A;  4MJB A;  3GIX A;  2DKI A;  2G2Q A;  1UVZ A;  3RDW A;  3ZIV A;  4MF6 A;  1BG5 A;  2KLX A;  4N0Z A;  5CRH A;  1PSQ A;  1AAZ A;  2QKE A;  1K3Y A;  3A5W A;  4E8E A;  2DIY A;  1U3I A;  5CYY A;  1VF1 A;  5L71 A;  4GXZ A;  4IP6 A;  3IPZ A;  2H8L A;  2M72 A;  3J7Y b;  3UJ1 A;  3ERW A;  1V58 A;  1DBY A;  5EL8 A;  2FGX A;  4CDO A;  2P0G A;  5B6N A;  2DBC A;  4ECI A;  2MMO A;  2P5Q A;  4XHM A;  2KHP A;  3ZFL A;  1M9A A;  3VUR A;  1ZYE A;  4KB3 A;  1X5C A;  2DJK A;  3ZVJ D;  1XG8 A;  1K3O A;  4LL4 B;  3A2W A;  2QGV A;  3GKK A;  5EY6 A;  4OFT A;  1DE1 A;  1GTA A;  1A2L A;  3GRX A;  4V2M A;  1AQX A;  1VGL A;  2FY6 A;  5B6M A;  2R0G A;  4NV2 A;  4BL7 B;  2MBS A;  4ZIL A;  1H75 A;  4OMV A;  2LNS A;  2YP6 A;  5ECO B;  2DKH A;  2VLU A;  1YF0 A;  9GSS A;  3I6A A;  1QGV A;  5ECK B;  4XCS A;  3GL3 A;  4TRX A;  3QFA C;  2GQL A;  1TJD A;  2LRN A;  2R2J A;  4ZIJ A;  4FIW A;  2QA1 A;  1FB0 A;  2OBI A;  3TJF A;  2BTO T;  2HRK A;  2HSH A;  2C0G A;  4K0N A;  5D73 A;  2DIZ A;  3VWW A;  4ML1 A;  2MMA A;  3N5O A;  2N5A A;  3FZ4 A;  3LJR A;  1TK0 B;  1G0T A;  1GNW A;  6GSU A;  5HFG A;  4JE1 A;  1SYX A;  5F05 A;  2FNO A;  1USB A;  4AJ8 A;  4Z2U A;  5LCZ A;  3DD3 A;  1BJX A;  2MYG A;  2AUV A;  3O3T A;  1F37 A;  4KDY A;  5KN2 A; 
#chains in the Genus database with same CATH homology
 4QL7 A;  5BRT A;  4L8E A;  2DC5 A;  5E59 A;  1FW1 A;  3CTF A;  2QC7 A;  1JZO A;  4ILF A;  1GUK A;  12GS A;  2HLS A;  2FA4 A;  2RM6 A;  2LNT A;  3S9F A;  5H5S A;  1ZMA A;  2WDU A;  3MIX A;  2JZS A;  2GSQ A;  3UAP A;  4TKY A;  2H1G A;  1ZYP A;  1V57 A;  4ZXG A;  2HT9 A;  2LV3 A;  3C73 A;  2MBT A;  4G9H A;  3L4N A;  6GSW A;  1K0O A;  1WWJ A;  2FWH A;  4ZL7 A;  5IMZ A;  2NPB A;  4MA9 A;  1YY7 A;  1R4W A;  2CAQ A;  1S3C A;  3JCM L;  4V1A g;  3WGD A;  4CY6 A;  2PVO C;  1GTI A;  4HU7 A;  2JU5 A;  18GS A;  2GVP A;  1X9W B;  2D2Z A;  2GGT A;  2R4V A;  1Z7R A;  3ZTL A;  2VCV A;  2EIR A;  3DXB A;  5D96 A;  1TRV A;  4RI7 A;  5ECL B;  4GTU A;  4J2F A;  4OCF A;  4OFN A;  3LOR A;  2G0F A;  4KH7 A;  4MMM A;  3IAS 2;  4PTS A;  3D21 A;  2AV4 A;  3IA1 A;  3VWU A;  1T4Y A;  2FA8 A;  5J41 A;  4TW5 A;  1T3B A;  2XPE A;  3VLN A;  2ALB A;  1EEM A;  4HQS A;  3ZRD A;  4KW6 A;  5IOW A;  2JSY A;  4EIP A;  3CBU A;  4CHS A;  4EUY A;  2H01 A;  3GKM A;  4TN8 A;  1EOH A;  1OAZ A;  3VWV A;  2EIQ A;  2CZ2 A;  2VLT A;  2DML A;  3BCI A;  1M0U A;  2NBS A;  4ZL8 A;  3Q19 A;  1PL1 A;  4GWR A;  4EKZ A;  2CVB A;  1PN0 A;  2VAF A;  2WGR A;  4KDX A;  1GSF A;  5C00 A;  3D6I A;  3HDC A;  3M0F A;  4RQR A;  3GX8 A;  4IHU A;  3TOU A;  1PQN A;  1U88 A;  2DJJ A;  3ERG A;  3FR3 A;  1YKA A;  4Z7X A;  5IIZ A;  2H0I A;  5D9V A;  2QSI A;  5IO2 A;  2GZY A;  3L9V A;  4D73 B;  2JL4 A;  3CSI A;  3GUR A;  3IR4 A;  1HNB A;  4EL1 A;  3KTL A;  3N9J A;  2E2M A;  4X0X A;  2WFC A;  3EIN A;  2OE0 A;  5DAL B;  1O7U A;  5H5Q A;  3TKP A;  1B4Q A;  1GSU A;  2IJY A;  5IM9 A;  3R3E A;  2B5Y A;  3GFK A;  1OC8 A;  1R7H A;  4YKG A;  5CO3 A;  4JBB A;  3EVI A;  4HZ2 A;  5DQY A;  3APS A;  2IN3 A;  3UMA A;  2R3X A;  1LJR A;  4AF2 A;  1SU9 A;  1TW9 A;  4V2N A;  3QR6 A;  5JWQ B;  3L9S A;  1VF3 A;  3F8U A;  4Z2T A;  2CQ9 A;  1JLW A;  4WR4 A;  5DBQ A;  4HJ2 A;  3US3 A;  2R0C A;  2CV4 A;  4EC0 A;  2VCW A;  3RBT A;  3IC8 A;  1ERV A;  2IFQ B;  3FZ5 A;  2XHF A;  3GMF A;  3FKF A;  1YKC A;  1WE0 A;  4HS1 A;  1K0N A;  2L6D A;  4EO3 A;  4PXO A;  4K2X A;  1GTU A;  3Q18 A;  4GSS A;  2LJR A;  2R5G A;  2CZ3 A;  1U87 A;  1HD2 A;  3F4S A;  4O5U A;  1SJ6 A;  3OR5 A;  3KP9 A;  2TRC P;  2O85 A;  2YJ7 A;  2HZE B;  2WCI A;  1Q4J A;  3HHV A;  2B1L A;  2XC2 A;  4PNF A;  2N5F A;  4POL A;  2OBK A;  1F9M A;  4HDE A;  2PUK C;  5EVO A;  1O8X A;  2A2P A;  2YWO A;  5JCW A;  2LJA A;  2XBI A;  1AIU A;  3CMI A;  1PL2 A;  5ID2 A;  2F51 A;  5DAK A;  4DSS B;  2KOK A;  1XFL A;  3GH9 A;  4WF5 A;  3HD5 A;  1VRS D;  2YNX A;  1F2E A;  4WKW A;  4GRF A;  1MDJ A;  2C1Y A;  4K2D A;  4GF0 A;  1DSB A;  4FH8 A;  4JU5 A;  2OJL A;  1ERT A;  3C71 A;  3FHK A;  3G7I A;  3ZRE A;  1Z6N A;  4EF0 A;  4IP1 A;  3LGC A;  4BWQ A;  4DEJ A;  3HA9 A;  3TCO A;  2TRX A;  5DCG A;  1TDI A;  2RUE A;  4KCE A;  5G1K A;  3TKS A;  3VI5 A;  1XW9 A;  1E6B A;  1OC9 B;  2A2S A;  5J9B A;  2GQK A;  5HQP A;  4O5Q A;  2PN8 A;  2O7K A;  5IOX A;  1YF1 A;  4K7O A;  3M1G A;  2I1U A;  2H19 A;  1FAA A;  1SL0 B;  1WRY A;  4PQH A;  1NHO A;  2CVK A;  4N11 A;  1PN9 A;  1YDK A;  4AJ7 A;  3A2X A;  1XIY A;  1WJK A;  6GSY A;  3TRP A;  1MD4 A;  5IMV A;  3F0I A;  1A2J A;  3FZA A;  5DVB A;  4ZBB A;  3HZ8 A;  1UA5 A;  3PPU A;  2VL9 A;  4GQF A;  3KD0 A;  6GSV A;  3E3E A;  4BL7 A;  2N5B A;  2VCX A;  5JCG A;  6GST A;  3IAM 2;  3VFI A;  2A2R A;  1EP7 A;  3UBK A;  3UIW A;  4ECJ A;  2OE1 A;  1NW2 A;  3GNJ A;  1GP1 A;  4HU9 A;  4G19 A;  3DEX A;  3M9J A;  2ON7 A;  1THX A;  3QAV A;  4KND A;  3F4R A;  4K9Z A;  3F4T A;  5DJM A;  3KMN A;  2WS2 A;  2H72 A;  5HR0 A;  3H79 A;  17GS A;  3VPQ A;  3QDN A;  2KP2 A;  2HSY A;  1AC1 A;  2YOI A;  1BYE A;  5CRG A;  1AQV A;  3C8E A;  5HFI A;  3F3R A;  2LTK A;  5CRD A;  1TXX A;  1V2A A;  1ERW A;  5JCU A;  1ILO A;  5G2Z A;  4IBP A;  1PKW A;  1M2D A;  2PMT A;  5CRW A;  3ZMK A;  2K8V A;  2E2G A;  2OAD A;  2F3M A;  1GUH A;  1QFN A;  1GSE A;  2VCQ A;  1ACV A;  4LMW A;  1J9B A;  5BMU A;  4TR0 A;  1A8Y A;  5J3R A;  3CSJ A;  3F63 A;  4NV5 A;  4XS4 A;  2YV9 A;  1ZCP A;  3IOS A;  1KEB A;  1Z3E A;  1GTB A;  2X49 A;  2L5L A;  2YCD A;  1PD2 1;  3ZML A;  2VIM A;  4WXT A;  2FWE A;  2FLS A;  1YEP A;  3HCZ A;  4EDY A;  2ON5 A;  5GSS A;  1QMV A;  1XWA A;  4EXJ A;  3ZVJ A;  1FHE A;  1M7T A;  2IMF A;  2LKU A;  1PRX A;  3F9U A;  2V41 A;  4RUV A;  1TRW A;  4KSM A;  1XCC A;  3WYW A;  1NHY A;  3UOM A;  5AN1 A;  1XOA A;  4FYU A;  3LG6 A;  4DVC A;  5KN3 A;  5IMF A;  1H4O A;  4TR3 A;  2MZC A;  4JZQ A;  2B1K A;  3L78 A;  2AHE A;  4KF9 A;  1RQM A;  2C80 A;  1WMJ A;  4ECC A;  2OKA A;  1SJZ A;  2B3S A;  5IQY A;  2I9H A;  3HVV A;  1JHB A;  4G0K A;  2ZUP A;  6GSX A;  2FCH A;  2JSZ A;  3WT2 A;  2DMM A;  2LQQ A;  2RUF A;  1ZYN A;  4PUF C;  1EZK A;  1Z9H A;  3DGQ A;  4N30 A;  2B7K A;  1SKW B;  4HZ4 A;  5GZZ B;  5IMD A;  1K0M A;  5KOW A;  3TKR A;  2R6K A;  1HNC A;  2DJ0 A;  1ZL9 A;  4F0B A;  2IMD A;  2R0P A;  4IGJ A;  2YV7 A;  3VI7 A;  2C8U A;  5FHI A;  1SD8 A;  2PPT A;  1FVK A;  3TKS C;  3PH9 A;  5JWR B;  1XXU A;  1GSQ A;  5AIS A;  2EIO A;  3ME8 A;  2YJH A;  3GA4 A;  4DSR A;  3G9B A;  2C3T A;  2O89 A;  4L5O A;  4WBR D;  3LWA A;  3ZL5 A;  2KUC A;  3TJG A;  2HI7 A;  2YAN A;  2EC4 A;  3KXO A;  2H1A A;  4MAB A;  4FO5 A;  5D9T A;  3GX0 A;  3DKS A;  5ECM B;  3CRU A;  4JR6 A;  2YZU A;  2B6M A;  3KJY A;  2DJ2 A;  4TR1 B;  1K3L A;  4BVY B;  3IHG A;  4IW9 A;  2H71 A;  3EU4 A;  4F2I A;  1C72 A;  3G7J A;  3I69 A;  14GS A;  2A4H A;  3QCP A;  5D93 A;  3ERF A;  4J56 E;  4ZBD A;  2GT6 A;  3U5R E;  3KZQ A;  5E4W A;  1K0A A;  5INY A;  1A2M A;  1FVJ A;  3GTU B;  2X8H A;  1R5P A;  3KMO A;  3W8J A;  3HJO A;  4TXV A;  1T7P B;  1O81 A;  3QFB C;  2PGT A;  2YWN A;  3H4K A;  4BVX A;  3ZIT A;  2IFQ A;  1LU4 A;  3IK9 A;  2IWT A;  2VL2 A;  2PU9 C;  1THO A;  2HE3 A;  1S3A A;  5KN0 A;  1BAY A;  2VM2 A;  3M8N A;  1EOG A;  4I2U A;  2HYX A;  4G0I A;  2L5O A;  3FY7 A;  2ZNM A;  4F82 A;  1J08 A;  1R26 A;  3QPM A;  5ELA A;  4FYB A;  2M46 A;  3FMW A;  4TXO B;  4HQZ A;  4PUR A;  4BA7 A;  2YWM A;  4I97 A;  2NVL A;  4BPY A;  1OKD A;  3ZLP A;  4F9Z A;  3KEB A;  4O5R A;  3UVH A;  2HZE A;  5G1L A;  2NTO A;  2I81 A;  1EEJ A;  5G5E A;  3LXT A;  2H6X A;  4MZC A;  4USS A;  4P3Y B;  1T1V A;  1XW5 A;  4TOP A;  3LXZ A;  4GSN A;  1SKS B;  3TJK A;  2Z9S A;  2WJU A;  5F06 A;  5DDL A;  4IN0 A;  4I6X A;  2TIR A;  4XRA A;  4HEA 2;  4DSS A;  2GLR A;  4PGT A;  1SL2 B;  1ERU A;  1XBS A;  3KGK A;  2XPD A;  1ZOF A;  3EC3 A;  4I5Q A;  4V2L A;  5GST A;  4AJ6 A;  2GDR A;  5B7C A;  4MZW A;  4NPB A;  3PGT A;  2CA8 A;  2H6Z A;  3QMX A;  4WR5 A;  3P8W A;  2GT5 A;  3C1S A;  1XWB A;  3LQ7 A;  3QOU A;  3FW2 A;  1YZX A;  5CAX A;  1HYU A;  3NZN A;  1YJ6 A;  5ECI B;  1GUM A;  1TI3 A;  3DVW A;  4G0L A;  1OC9 A;  1JZW A;  2LEG A;  3LFL A;  4Q5F A;  2YN1 A;  2P31 A;  4F03 A;  4N0V A;  1A23 A;  2AJQ B;  3KH7 A;  3MNG A;  3E9J B;  3P7X A;  3FK8 A;  3ME7 A;  2X99 A;  4HOJ A;  1MDI A;  1TU7 A;  2O87 A;  4KGI A;  2NDO A;  1G6Y A;  2V6K A;  5DQS A;  3IDV A;  1ABA A;  3VWX A;  2VCZ A;  1OE8 A;  1TKD B;  1XVQ A;  3BBY A;  2REM A;  4HJM A;  4KE3 A;  3TJB A;  1EGO A;  1NM3 A;  2CVD A;  2F9S A;  4NHZ A;  3EMP A;  4PNG A;  5KOX A;  4POM A;  2GZZ A;  2IME A;  2C0D A;  3GHA A;  3TRX A;  2VD1 A;  3ZYW A;  2GSR A;  3C7M A;  4ML6 A;  4XRD A;  2K8S A;  1PX6 A;  4KDU A;  3F6D A;  4FYC A;  2B7J A;  3GN3 A;  3H8Q A;  2V2G A;  2H6Y A;  1TK8 B;  4WF4 A;  1GRX A;  4O92 A;  2H1D A;  1M2A A;  3SBC A;  4LMV A;  4HUA A;  1A24 A;  3WD6 A;  5AIX A;  4GLT A;  4J57 E;  3UL3 A;  5F0G A;  3PR8 A;  1O8W A;  5HFK A;  4CW9 A;  2A4V A;  3AY8 A;  1SJI A;  2H73 A;  1FG4 A;  4ZB6 A;  4K0G A;  1K0B A;  1T8E B;  1VF4 A;  2K9F A;  4K7I A;  3A3T A;  1Z7P A;  5KN1 A;  2IPA A;  4O7H A;  1MEK A;  4GQC A;  16GS A;  1TRS A;  2DJ1 A;  2VL2 C;  2LJK A;  1BX9 A;  2VD0 A;  4RQX A;  1MTC A;  3O76 A;  1B9X C;  1PKZ A;  3Q74 A;  3GST A;  3TKQ A;  4IS0 A;  4EIQ A;  4QL9 A;  1G7O A;  3P90 A;  2HSM A;  4Q5Q A;  4K5R A;  5ABR A;  2WUL A;  2C0F A;  2PVQ A;  1QUW A;  1E2Y A;  1K0C A;  2L57 A;  22GS A;  3R2Q A;  4IQA A;  3TJJ A;  1UN2 A;  1EGR A;  2FHE A;  3BD2 A;  2H0G A;  3KCM A;  1UC7 A;  3M9K A;  2YPM A;  2IMK A;  3EU3 A;  2PBJ A;  3IK7 A;  5IMA A;  3M3M A;  1KTE A;  4XIH A;  2VO4 A;  10GS A;  4H86 A;  2FD3 A;  4EE0 A;  3CTG A;  3TDG A;  2L59 A;  5B8A A;  1DUG A;  3DWV A;  2OAC A;  5IO0 A;  4OCE A;  2DSA A;  4YQM A;  2H30 A;  3BOA A;  2GSS A;  4I2T A;  2LRT A;  2H75 A;  1PA3 A;  1FOH A;  4ULX A;  1A8L A;  1X0R A;  3J7Y k;  2J9H A;  1IYH A;  1WOU A;  4JED A;  5G31 A;  2M80 A;  5A5K A;  1PGT A;  5HR1 A;  1MD3 A;  4ZB8 A;  3QD9 A;  2L6C A;  1Z6M A;  1Y25 A;  3IHQ A;  5FWG A;  3DML A;  3FRC A;  4X4J A;  1EV4 A;  3CXG A;  2DLX A;  1AXD A;  3W8S A;  1JZR A;  4E8H A;  1TTZ A;  2X64 A;  3TOT A;  4L0W A;  5H5R A;  1HNA A;  3O6T A;  4MH3 A;  2O8V B;  1V98 A;  2CX4 A;  1XPV A;  3G7Y A;  4KA0 A;  4OO4 A;  2JZT A;  3GV1 A;  3GL5 A;  1XW6 A;  3LYP A;  1MDK A;  2L4C A;  5ECP B;  4L0U A;  2H70 A;  4HI7 A;  2LST A;  3UEM A;  2LS5 A;  2J23 A;  4OO5 A;  4TR1 A;  5EPF A;  4IJ3 A;  3NOF A;  4BVY A;  4ZB9 A;  4JRR A;  1XWC A;  1YEX A;  5CP1 A;  4POK A;  3V1W A;  4XS6 A;  2OE3 A;  1S3D A;  3MYD A;  1FB6 A;  3HKR A;  2V32 A;  1O6J A;  3LYK A;  4PUA A;  2E7P A;  3D22 A;  3D4M A;  4MNN A;  3BCK A;  2AYT A;  5JWO B;  4RI6 A;  2HFD A;  5GAP D;  3GTU A;  4IKH A;  1ON4 A;  3HVS A;  2C3N A;  1GWC A;  3NIV A;  1SYR A;  3LSZ A;  4ACS A;  2GST A;  2H0H A;  1SD9 A;  2PER A;  4QQ7 A;  3DIE A;  1OVN A;  2JAC A;  1QXH A;  4LLR A;  2IMI A;  4MZB A;  3FZ9 A;  1JZD A;  2YZH A;  2XBQ A;  1EP8 A;  4K1F A;  1XOB A;  2B5E A;  2WZ9 A;  1U3A A;  2WRT A;  2OA7 A;  2PWJ A;  2BMX A;  1M9B A;  3RPP A;  3FYG A;  1SL1 B;  1RK4 A;  2K18 A;  3GSS A;  4TXO A;  5J5N A;  4MH2 A;  4NMU A;  2LRC A;  4MF5 A;  5J9C A;  3IC4 A;  3KH9 A;  1ZZY A;  4K6X A;  1X5D A;  3GH6 A;  3GKX A;  3WGX A;  2DJ3 A;  3LW9 A;  3EPT A;  1GSD A;  5CRE A;  1J0F A;  1EV9 A;  2CT6 A;  1SKR B;  2CAI A;  3IXR A;  3TRQ A;  19GS A;  1U6T A;  1SK2 A;  4X43 A;  4IJI A;  5GAN D;  2X8C A;  4ID0 A;  1TOF A;  2VL3 A;  3TUE A;  1B8X A;  1GLP A;  1FO5 A;  4V1A p;  4D73 A;  1GL8 A;  1XZO A;  3I43 A;  4NWY A;  5D9X A;  5LNK e;  1O73 A;  2VM1 A;  5FT3 A;  1TP9 A;  1SEN A;  2GQM A;  5F8B A;  20GS A;  5DAL A;  5ECQ B;  3TKS E;  4WBJ A;  4NAX A;  3HJM A;  4F0C A;  5G30 A;  4XS4 B;  2F8A A;  5A4V A;  2GTU A;  3DRN A;  3IRA A;  2VUP A;  1G6W A;  2VLV A;  3LEF A;  1SK0 A;  1NSW A;  2HNL A;  3SWL A;  5A4W A;  4GST A;  2ES7 A;  4MK3 A;  3DYR A;  1WIK A;  5ECN B;  1O85 A;  3F6F A;  4K5S A;  4MCU A;  4MJC A;  4LL1 B;  4DSQ A;  1OC3 A;  5IPH A;  2C3Q A;  4MPF A;  4ZL9 A;  1PMT A;  2V1M A;  1T00 A;  3EYT A;  3HVX A;  4G2E A;  1KBN A;  1W89 A;  13GS A;  2X8G A;  1I9D A;  4IVF A;  1K0D A;  2I4A A;  2F8F A;  5ENU A;  1IYI A;  2UZ8 A;  1BED A;  4MDC A;  1N2A A;  1BQ7 A;  6GSS A;  4PQ1 A;  4AGS A;  3HYP A;  3ISO A;  4G10 A;  1Y6E A;  4ISD A;  2MMN A;  3EUR A;  1OYJ A;  3GUS A;  3UBL A;  3D0Z A;  3KM6 A;  3KTB A;  3MDK A;  4XTS A;  3C1R A;  4Z2R A;  1AQW A;  1F3A A;  1QQ2 A;  1VF2 A;  4YKF A;  4ECB A;  4YQU A;  1ST9 A;  2LUS A;  1A0R P;  3FEU A;  1KNG A;  4K8M A;  1GSY A;  2H66 A;  5C04 A;  2C0E A;  3WGE A;  3A2V A;  4X1U A;  2VCT A;  3H93 A;  8GSS A;  3MAK A;  1Z5Y E;  5ECH B;  1SK1 A;  4MLY A;  1TU8 A;  4FQU A;  2QA2 A;  1QK8 A;  2RLI A;  5HR2 A;  4CY8 A;  1AW9 A;  2BJX A;  4Q5R A;  2GS3 A;  5COH A;  1LBK A;  3D5J A;  3RPN A;  1V9W A;  3D4T A;  3VPT A;  1GSS A;  3ZZX A;  1GUL A;  5F07 A;  1G7E A;  2JAD A;  3KIJ A;  1TK5 B;  3MWH A;  1B4P A;  5G5F A;  3K8N A;  2I3Y A;  2H1B A;  4EDZ A;  1ML6 A;  1B9Y C;  3FR6 A;  5CNW A;  4NHW A;  3IV4 A;  2RM5 A;  1JFU A;  1WPI A;  2MMZ A;  2HRN A;  3ZFB A;  3WT1 A;  1GH2 A;  3QAG A;  1XWK A;  3APO A;  4A5P A;  4BVX B;  5IPG A;  4YAV A;  1GLQ A;  4GCI A;  4PX1 A;  1PX7 A;  2P5R A;  5ECS A;  1X5E A;  2E0Q A;  1RW1 A;  5AGY A;  2C4J A;  3KP8 A;  2RII A;  2ZCT A;  3P2A A;  3APQ A;  3QAW A;  1FOV A;  3MSZ A;  4WEY A;  1TRU A;  3A5I A;  5J4U A;  4MJE A;  2CX3 A;  4YAP A;  1X9M B;  2AAW A;  4L5L A;  2WB9 A;  7GSS A;  4EVM A;  1JLV A;  4MP4 A;  3DVX A;  3L9U A;  3RAZ A;  3W6G A;  4KAE A;  4KCA A;  5KEJ A;  3TGZ A;  3BJ5 A;  3EE2 A;  2JZR A;  5HR3 A;  3FR9 A;  1ZYQ B;  4ICY A;  4IEL A;  4POB A;  1OE7 A;  2B5X A;  4PQI A;  1I5G A;  1F3B A;  5DJL A;  4OWY A;  1B48 A;  1X9S B;  2FUG 2;  5LD0 A;  3GYK A;  4KX4 A;  2VOC A;  2HZF A;  3ED3 A;  2IL3 A;  2K6V A;  5A4U A;  3CYN A;  2YWI A;  1F6M C;  1M99 A;  5D9W A;  3CRT A;  2LQO A;  1Q98 A;  3UVT A;  3CSH A;  1OKT A;  1GNE A;  4Q5N A;  2HRA A;  2R37 A;  3IBH A;  4LA1 A;  3HJP A;  3U6V A;  1EWX A;  1ZGN A;  4BWS A;  2AB6 A;  4MPG A;  3TB2 A;  4ZBA A;  1HQO A;  1TI1 A;  3VK9 A;  3GKN A;  2H74 A;  5B8B A;  4XS1 A;  4KSO A;  2L4Q A;  1CQG A;  3Q6O A;  1URM A;  5D8I A;  2IIY A;  4NXI A;  5ELG A;  1XWG A;  11GS A;  5DCH A;  4WET A;  1N8J A;  4MJA A;  4O32 A;  4I8B A;  2H76 A;  2V6O A;  3EMX A;  4N10 A;  3EWL A;  4TR4 A;  5AIV A;  4IQ1 A;  1XVW A;  3HZ4 A;  1W4V A;  1T4Z A;  4OD7 A;  3E0U A;  3F3Q A;  3UAR A;  2GZP A;  4YH2 A;  3RHC A;  3I9V 2;  3RHB A;  5IMC A;  2HXK A;  1M2B A;  3L0H A;  2KP1 A;  4K7N A;  4YQV A;  1YQ1 A;  1R5A A;  1DE2 A;  1V40 A;  2FWG A;  4KUN A;  3PIN A;  4TVE A;  1CQH A;  2HRF A;  3HXS A;  4MF7 A;  3IE3 A;  3ZIJ A;  5ID2 B;  1WP0 A;  2X4A A;  5DAK B;  3H1N A;  1AUC A;  2FWF A;  5ECR B;  4JR4 A;  1A0F A;  4OFM A;  3HY2 A;  4MJB A;  3GIX A;  2DKI A;  2G2Q A;  1UVZ A;  3RDW A;  3ZIV A;  4MF6 A;  1BG5 A;  2KLX A;  4N0Z A;  5CRH A;  1PSQ A;  1AAZ A;  2QKE A;  1K3Y A;  3A5W A;  4E8E A;  2DIY A;  1U3I A;  5CYY A;  1VF1 A;  5L71 A;  4GXZ A;  4IP6 A;  3IPZ A;  2H8L A;  2M72 A;  3J7Y b;  3UJ1 A;  3ERW A;  1V58 A;  1DBY A;  5EL8 A;  2FGX A;  4CDO A;  2P0G A;  5B6N A;  2DBC A;  4ECI A;  2MMO A;  2P5Q A;  4XHM A;  2KHP A;  3ZFL A;  1M9A A;  3VUR A;  1ZYE A;  4KB3 A;  1X5C A;  2DJK A;  3ZVJ D;  1K3O A;  4LL4 B;  3A2W A;  2QGV A;  3GKK A;  5EY6 A;  4OFT A;  1DE1 A;  1GTA A;  1A2L A;  3GRX A;  4V2M A;  1AQX A;  1VGL A;  2FY6 A;  5B6M A;  2R0G A;  4NV2 A;  4BL7 B;  2MBS A;  4ZIL A;  1H75 A;  4OMV A;  2LNS A;  2YP6 A;  5ECO B;  2DKH A;  2VLU A;  1YF0 A;  9GSS A;  3I6A A;  1QGV A;  5ECK B;  4XCS A;  3GL3 A;  4TRX A;  3QFA C;  2GQL A;  1TJD A;  2LRN A;  2R2J A;  4ZIJ A;  4FIW A;  2QA1 A;  1FB0 A;  2OBI A;  3TJF A;  2BTO T;  2HRK A;  2HSH A;  2C0G A;  4K0N A;  5D73 A;  2DIZ A;  3VWW A;  4ML1 A;  2MMA A;  3N5O A;  2N5A A;  3FZ4 A;  3LJR A;  1TK0 B;  1G0T A;  1GNW A;  6GSU A;  5HFG A;  4JE1 A;  1SYX A;  5F05 A;  2FNO A;  1USB A;  4AJ8 A;  4Z2U A;  5LCZ A;  3DD3 A;  1BJX A;  2MYG A;  2AUV A;  3O3T A;  1F37 A;  4KDY A;  5KN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...