2CVKA

Crystal structure of thermus thermophilus thioredoxin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
b'KPIEVTDQNFDETLGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYEGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAQPKRNYQAKIEKHLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Crystal Structure of a Reduced Thioredoxin from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Electron transport
total genus 31
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2005-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2cvkA00
4F0BA 2N5BA 2LJAA 1TJDA 3C73A 3DVXA 3RPPA 3QFBC 4NXIA 2HYXA 5DJLA 3BD2A 1QK8A 4IQ1A 2NBSA 4RI7A 1A24A 1U87A 2H74A 2L59A 1E2YA 3HCZA 3TKSA 4TRXA 3HYPA 2VOCA 3QMXA 3VWUA 5D9WA 5EL8A 2JZRA 3KEBA 4DSQA 2HLSA 3QDNA 4NV2A 4F82A 1Z7RA 2DJ0A 4PQHA 3GH9A 5B8BA 7GSSA 1T1VA 5G2ZA 2XPDA 1F37A 1B8XA 3IR4A 3A2WA 4I8BA 4IP1A 3TJBA 4EO3A 3W6GA 1BJXA 5A4UA 2CT6A 3L9UA 3IV4A 1M2AA 1GTAA 4V1Ag 3CXGA 3F3RA 2IFQB 3MDKA 1CQGA 1XVWA 1FVJA 4GSSA 2VCWA 4L0WA 1TU8A 3FR9A 4MH3A 3UBLA 2B1KA 5IMDA 4V1Ap 3IXRA 2MMNA 1XIYA 2B5YA 3HXSA 4HUAA 1Z5YE 3ERFA 3M1GA 1OVNA 3QAGA 4BVXA 2LUSA 1M99A 8GSSA 4ECJA 4K9ZA 4ZB9A 1ABAA 3L0HA 3KTBA 4OWYA 5EY6A 4X43A 4P3YB 1R7HA 4KCEA 2C3QA 3F9UA 1ST9A 2C0DA 4JBBA 2QKEA 1R4WA 1PN9A 4XRAA 3ZYWA 2PVQA 1AW9A 2F3MA 1JZDA 1FB0A 2VL3A 3N5OA 4Z7XA 2K8VA 4IW9A 2C3NA 5ECRB 5HR3A 1M7TA 5CNWA 3ED3A 3KH9A 2LNSA 2YZUA 4GCIA 5IOWA 1XVQA 3A5WA 3P90A 6GSYA 5AGYA 3EYTA 2PERA 5CRWA 4NMUA 2X8CA 4OCFA 1X9WB 1R5AA 1O81A 3QFAC 1PX7A 1JZRA 2R5GA 4ZBAA 3ZVJD 2XBIA 1XWBA 3ZFBA 3SWLA 1VRSD 4ID0A 2PGTA 3F8UA 2XPEA 1ZYQB 4TW5A 3FZ4A 2DIZA 1EEJA 1PX6A 2WZ9A 1V98A 1USBA 2H6ZA 4JE1A 3KM6A 1PL1A 3TRQA 1K0MA 2MMOA 1ZGNA 5J9BA 2K9FA 1PA3A 1HNCA 3ZRDA 1QQ2A 4IJ3A 2JZSA 4HZ4A 2HFDA 4DVCA 1RW1A 2YN1A 1VF1A 4MPGA 4EDYA 2OJLA 4POMA 4XS4A 4RQXA 1J0FA 2M80A 4O92A 3VPTA 3BBYA 3F0IA 4L5LA 3ZTLA 1YEXA 2RLIA 1K3LA 3H1NA 1FHEA 3DVWA 3GL5A 4ZXGA 4K7NA 1ML6A 4WKWA 4LL1B 1EV4A 1XZOA 4MJCA 3EC3A 3LFLA 2K18A 5G5FA 1S3DA 2JZTA 1XOAA 5E59A 3TDGA 4QQ7A 2VUPA 5J4UA 4EF0A 2WULA 4AF2A 2ZUPA 1AIUA 1BG5A 3U5RE 1XFLA 2YPMA 1E6BA 2V1MA 2LRCA 4RQRA 5IMVA 1LBKA 3MWHA 4K1FA 3HJMA 5B7CA 1GTUA 4BPYA 3FK8A 2O7KA 2VLVA 1TTZA 1SKWB 2OE3A 3O76A 1FG4A 1QMVA 3FY7A 1TP9A 1Z6NA 1A8YA 1GNWA 5JWQB 3ZIJA 3KTLA 4HJ2A 3G7JA 1THXA 5IPHA 3IA1A 1SKSB 4KCAA 4NWYA 5HQPA 2MYGA 3LG6A 3WGXA 3ZITA 2FUG2 1B9XC 3GN3A 1UC7A 4BWSA 1PKWA 4BVYA 1YF1A 4KE3A 3TRXA 3C71A 2HT9A 5DALA 2E0QA 2I9HA 3PINA 2YWOA 13GSA 5G1KA 1G6YA 3LWAA 3OR5A 1TXXA 2JACA 3E3EA 4PQIA 3PH9A 4AJ6A 1TRSA 2VLUA 1EEMA 1HNAA 4TKYA 3VWXA 1YF0A 2VD1A 1YDKA 3HD5A 2FD3A 4JR4A 4HZ2A 3QD9A 4FYUA 1J08A 4GQFA 3ERWA 5ECKB 4PQ1A 5KN3A 2F8FA 2IJYA 3UVHA 4GTUA 1LJRA 3C1SA 4TR1A 4KW6A 2ON5A 1R5PA 1GL8A 4MP4A 3W8SA 3W8JA 3EU4A 1ERTA 3VWWA 1EZKA 5JWOB 3C8EA 1OE8A 1SL0B 2DJKA 4YQUA 3G9BA 3U6VA 1BYEA 2FWGA 5ENUA 4ECIA 2IIYA 3FR3A 2HZEA 5DCHA 3LXZA 5HR2A 2KLXA 3CMIA 2GT6A 2WDUA 3GHAA 2H1AA 3CSHA 2GZPA 4DSRA 1QFNA 2L57A 3D4TA 4TR4A 4L0UA 3APOA 1A0FA 1Q4JA 4JU5A 2GSTA 5FHIA 4AJ8A 2EIRA 3GKKA 2MMAA 4FH8A 3LGCA 2O87A 2N5AA 4RI6A 4MDCA 4Q5FA 3TKQA 3CYNA 3GMFA 2WCIA 5DAKA 3TOUA 1GULA 1U88A 2YCDA 4JZQA 1A23A 1WWJA 3ZIVA 1AC1A 4K6XA 2DMLA 2L5OA 2B5XA 1RK4A 3CRUA 2AHEA 4MCUA 4J56E 3L9VA 3DYRA 4QL9A 4I5QA 3P2AA 2IMFA 16GSA 1A2JA 2IN3A 1AXDA 5F05A 3S9FA 4IELA 4JRRA 5J5NA 4MZCA 1EOGA 3E9JB 2RM6A 4POBA 2LKUA 4O7HA 3ZREA 4AJ7A 3I43A 4D73B 1SU9A 3L78A 4LMWA 2EIOA 4HQSA 4OMVA 2H01A 3KIJA 1GLPA 2VD0A 4K7OA 3RAZA 4IP6A 4MJEA 4JR6A 3IHQA 1NM3A 3HVVA 2YP6A 4WR5A 5ECLB 3O6TA 1K3OA 5GSSA 1WE0A 2C0FA 2P0GA 5AISA 3EINA 2GVPA 1ZYEA 2I3YA 1MDJA 2L4QA 1M9AA 3VURA 6GSTA 4J57E 1X9MB 2FCHA 1YJ6A 3UEMA 3HVXA 4OO4A 3DXBA 2B1LA 3QR6A 2B3SA 2DMMA 3IK7A 1SYRA 3F3QA 1IYHA 4ACSA 3GIXA 5ECPB 3GRXA 5F8BA 2B7JA 3EWLA 1GSSA 1K3YA 1EV9A 2JSYA 2YOIA 5CREA 2ALBA 2A2SA 1J9BA 2YANA 3N9JA 2EC4A 1U3IA 3PR8A 3FW2A 2EIQA 3HJOA 3HZ4A 2H6XA 1EWXA 1GWCA 3C7MA 1TOFA 1M9BA 1SK1A 5ECOB 5A5KA 2YJHA 5INYA 19GSA 4Q5QA 2QGVA 5E4WA 3LORA 2I1UA 2XBQA 4KH7A 2H6YA 4KDXA 3UOMA 4BA7A 1HNBA 2MZCA 1ERUA 1A8LA 3CTFA 1YZXA 2PMTA 2H73A 1XWKA 5G5EA 1YKCA 2QSIA 2IMKA 2YWIA 4LL4B 4J2FA 3IC4A 4TXOA 5G30A 3BCKA 4TVEA 4EE0A 3KP8A 3PGTA 4HU9A 4MJBA 1K0BA 5COHA 3CSIA 3D21A 4ECCA 5DDLA 3F6FA 4EL1A 2B6MA 3GV1A 3HDCA 3KH7A 3M8NA 4GLTA 2H1BA 4L8EA 2DSAA 1X9SB 2H1DA 4K0GA 1B48A 2TRXA 2H70A 3TKSE 2IL3A 5ECNB 2XC2A 3TJJA 3VK9A 3FRCA 2FWHA 1T7PB 4TR0A 1IYIA 2WB9A 2KHPA 1KNGA 2YV9A 3ME8A 2CA8A 4YH2A 1XWGA 5AIXA 2L6DA 2YWNA 4PGTA 4KB3A 2L4CA 1OKTA 1O6JA 4KUNA 4XTSA 2TRCP 3D5JA 3VI7A 3AY8A 3J7Yk 2B5EA 1TKDB 2P5QA 2IPAA 4ML1A 5ELAA 1SENA 1QGVA 2FHEA 3US3A 4XS4B 5ECQB 1GSFA 4HI7A 3VLNA 1WJKA 2H0IA 3TKPA 2KP1A 2RUFA 2AYTA 1GSUA 4ZIJA 4WXTA 2CQ9A 1ERVA 3I9V2 5A4VA 2RM5A 2TIRA 3TCOA 1M2DA 2DJJA 2F8AA 2VAFA 3UBKA 3SBCA 4YQVA 3GKNA 2ZCTA 2M46A 1ZZYA 2GSRA 1EP7A 1AQXA 1WOUA 3FHKA 3KCMA 1SJZA 2OACA 2GQMA 4KDUA 2GT5A 4OFTA 1Z9HA 1PL2A 4IQAA 4IKHA 2H8LA 2X8GA 3CRTA 3M3MA 1SK2A 5F0GA 5ID2A 1U3AA 2OKAA 4PX1A 2H72A 3EMXA 4K8MA 2MMZA 1K0DA 3F6DA 3HA9A 5IM9A 1FO5A 5CYYA 1WIKA 1X0RA 4KSOA 3GSTA 4NHWA 4G2EA 1T8EB 1GSQA 4HQZA 5CO3A 2WS2A 3Q18A 4KDYA 4K0NA 4F9ZA 3MNGA 1U6TA 2F9SA 1VGLA 4I6XA 1TRWA 1PRXA 4I2TA 3GUSA 2DIYA 4ECBA 1A0RP 3WYWA 5IMCA 2VM2A 1ACVA 3UJ1A 5ABRA 1MEKA 5DALB 4GWRA 3KXOA 3O3TA 3LJRA 1C72A 1R26A 3WGDA 4MABA 3WT2A 5IPGA 4DSSA 1M0UA 1WMJA 3HHVA 3LSZA 2O85A 1VF4A 2D2ZA 4V2LA 1KTEA 1DUGA 4F03A 5HFKA 5IQYA 2XHFA 3EU3A 2PBJA 1V2AA 3NZNA 1QUWA 1WPIA 1DE1A 3VFIA 4G19A 4WR4A 1JFUA 2VM1A 2NPBA 1A2MA 4X0XA 1G7EA 5A4WA 3UAPA 2R4VA 2P5RA 1X5DA 2WGRA 4EC0A 1AQVA 4RUVA 3DKSA 2FGXA 4TR1B 2LV3A 2H0GA 4GXZA 4YQMA 2CZ2A 2HRNA 3EVIA 3RDWA 5GZZB 2LEGA 3D6IA 3HZ8A 4ZBDA 3G7IA 3TJFA 1TK5B 3R2QA 1XWCA 3HKRA 3M9KA 1M2BA 1XWAA 3H79A 3TOTA 2OBKA 4MF7A 4ZBBA 4DEJA 2G2QA 3Q6OA 2AUVA 1XPVA 17GSA 2MBTA 4N0ZA 4I97A 3DWVA 3GNJA 3GTUA 4MJAA 2HZEB 3KJYA 2NTOA 2QC7A 1B4QA 3KGKA 2HI7A 2LJKA 2ON7A 1OC8A 3FEUA 4IGJA 1T3BA 4TN8A 4LMVA 2VIMA 3P8WA 5DQYA 5JWRB 4NAXA 3A2VA 3KMNA 18GSA 3K8NA 1ZCPA 4V2MA 5GSTA 3TKSC 2CVKA 4NPBA 1OC9A 1GLQA 4N10A 3ERGA 1TRVA 4ZB6A 2WFCA 2CX4A 5ECSA 2CVBA 3IOSA 2A2RA 1Y6EA 2AV4A 2K6VA 3RHCA 1B9YC 2P31A 1VF3A 4BL7A 1PMTA 2IWTA 3BOAA 3IE3A 2H1GA 1FOVA 2C1YA 1NSWA 2GS3A 5DVBA 4TXVA 1ZL9A 5F07A 2GTUA 1X5EA 3QAVA 1WP0A 2VL9A 2LS5A 2E7PA 4IVFA 3FYGA 3Q74A 2AJQB 3FKFA 5D9TA 3IAM2 2I4AA 1F3BA 2N5FA 3ZLPA 1O7UA 3QAWA 3KMOA 2FLSA 2WJUA 3ZZXA 1OKDA 5JCGA 4XIHA 4OFNA 3VI5A 1TK0B 2LTKA 1YKAA 3IBHA 2JADA 3LQ7A 2HZFA 3H8QA 4MH2A 1K0NA 5LNKe 1X5CA 2IMIA 5C04A 4XRDA 5LD0A 3ZMKA 3CBUA 1RQMA 1EGOA 3WT1A 4CHSA 1Z6MA 2PU9C 3GH6A 2DBCA 5EVOA 2X99A 4KSMA 5B6MA 3GL3A 2VCTA 2J23A 5HR1A 3CTGA 5GAPD 1W4VA 2HXKA 1XW5A 1SL2B 3GX0A 22GSA 5D73A 4ML6A 1URMA 4WBRD 3TJGA 4N30A 1K0CA 1SL1B 3FR6A 3GKXA 1KEBA 4GF0A 3FZAA 1OE7A 2CAQA 2M72A 1T4YA 2C4JA 1AUCA 2C3TA 3LXTA 1N2AA 5IMZA 2F51A 1H75A 4FIWA 2GQKA 5IIZA 1SJ6A 4GSTA 3HJPA 3RPNA 2JU5A 2YV7A 3DRNA 2GGTA 5IMFA 3DGQA 4POKA 1JZWA 5KN1A 1TI3A 1EGRA 1DBYA 2H76A 2C80A 2G0FA 5CRGA 3MSZA 4XHMA 4XS1A 4POLA 3WGEA 2DC5A 4OO5A 2X64A 6GSSA 4TR3A 2CAIA 1YQ1A 1ERWA 2V6KA 3G7YA 3E0UA 4OCEA 2E2GA 2PVOC 4HEA2 2HSYA 1SK0A 3BJ5A 2V2GA 4OD7A 1O8WA 5AN1A 2H66A 4MZWA 3ZFLA 5KEJA 2FWFA 1SD8A 4OFMA 1S3AA 3APSA 1F9MA 4ZL7A 4GRFA 3D22A 2GZZA 2DLXA 4PXOA 2H30A 4TXOB 3GURA 1CQHA 4MK3A 1S3CA 2GSQA 4PURA 4ZL8A 5B8AA 4O5RA 1MDKA 2J9HA 2KP2A 2PWJA 3QPMA 1MDIA 5G1LA 2YWMA 2IFQA 2NVLA 2V32A 5J41A 3I6AA 2OE0A 1H4OA 2VCQA 3ME7A 2OE1A 4K2DA 4CW9A 2JSZA 4N0VA 5L71A 4KAEA 1JZOA 2KUCA 1WRYA 4LA1A 3C1RA 1VF2A 1BQ7A 4IS0A 3J7Yb 3IRAA 5ECMB 1UA5A 1XBSA 3M9JA 4IN0A 1G6WA 5H5QA 4O32A 4IBPA 4BWQA 4HOJA 2BMXA 4GSNA 1Z7PA 4NV5A 1HYUA 2PUKC 2R2JA 2O8VB 5AIVA 1SKRB 4ILFA 3CSJA 2LQQA 3F63A 2NDOA 1G7OA 2X8HA 3FZ5A 4E8HA 2KOKA 3MAKA 5CP1A 3UIWA 1V9WA 1UVZA 4MPFA 3GKMA 2FWEA 6GSWA 1GUKA 1TDIA 5DBQA 5C00A 3H4KA 2A4VA 3RHBA 2FNOA 4NHZA 5F06A 5EPFA 1HD2A 1LU4A 1JLVA 4IHUA 1XCCA 4ZILA 1TU7A 2CV4A 1N8JA 1GUHA 2O89A 2DJ1A 1DE2A 2VLTA 1GSDA 4L5OA 4ZB8A 3P7XA 6GSXA 20GSA 5JCWA 2LNTA 1V40A 3TGZA 1AQWA 2FA8A 4PNFA 3IK9A 3EE2A 2OA7A 4MF6A 3KZQA 3A2XA 5H5RA 4KNDA 4FYBA 1F3AA 1B4PA 1I5GA 4KX4A 1SYXA 1YEPA 2WRTA 2DJ3A 2YNXA 2H19A 2VCZA 3JCML 1PKZA 5ID2B 1GTBA 1ILOA 3FZ9A 5HFGA 2BJXA 3UARA 1ON4A 2GLRA 2I81A 1DSBA 2GZYA 3D4MA 3GFKA 4EVMA 1I9DA 2LRTA 2REMA 3TRPA 1G0TA 2C8UA 6GSUA 1GNEA 2CX3A 4LLRA 3M0FA 1QXHA 3LYPA 5CRDA 2H75A 1GP1A 4Q5NA 1GSYA 3I69A 2HSHA 1GUMA 2V6OA 4IJIA 2LSTA 2GDRA 3F4SA 4MMMA 2PPTA 2GSSA 4WEYA 4MF5A 3GA4A 2FY6A 1K0OA 1XOBA 2C0GA 5GAND 2RIIA 3D0ZA 4H86A 2E2MA 3Q19A 2ES7A 5IO0A 6GSVA 4DSSB 2BTOT 2RUEA 1TK8B 4G10A 3GX8A 2R37A 4WF5A 5KN0A 5IMAA 1BEDA 3KD0A 2YJ7A 1SD9A 1GH2A 3LEFA 3UL3A 1PD21 3APQA 3F4TA 4K7IA 1OYJA 2H0HA 3L4NA 2FA4A 1NHOA 11GSA 1V57A 3DMLA 2LQOA 4WBJA 4XS6A 1NHYA 5J9CA 5D9VA 4HS1A 3IAS2 2AAWA 3ZVJA 1SJIA 3HY2A 2V41A 4N11A 2CZ3A 1UN2A 4WF4A 3F4RA 4EXJA 1TRUA 1KBNA 4ISDA 1ZOFA 2H71A 3DEXA 1YY7A 5JCUA 2VCXA 4V2NA 2K8SA 4G9HA 1O73A 1AAZA 3ZMLA 3DIEA 1OC3A 3WD6A 3UVTA 1MD4A 3H93A 4HDEA 4MLYA 1A2LA 4MZBA 5D8IA 5DJMA 5B6NA 3HVSA 1F2EA 3GTUB 2R3XA 1FAAA 2HE3A 1ZMAA 3EMPA 5HR0A 3ISOA 2VL2C 1FVKA 4KA0A 1EP8A 4MA9A 3ZL5A 1Q98A 4X1UA 4QL7A 2MBSA 3DD3A 1GSEA 1V58A 1OC9B 4FO5A 4E8EA 4HU7A 2LJRA 5IO2A 4PNGA 1K0AA 2CVDA 1MD3A 1W89A 1XW9A 3NOFA 1BAYA 1BX9A 2IMEA 1JHBA 4F0CA 2DJ2A 2ZNMA 12GSA 2AB6A 3BCIA 2GQLA 5DCGA 1GRXA 2Z9SA 4HJMA 5H5SA 2B7KA 4EKZA 2OADA 4KGIA 4FYCA 3QOUA 5DAKB 1TW9A 4EUYA 5KN2A 5D9XA 2OBIA 5D96A 3LYKA 3TB2A 4F2IA 1TI1A 2JL4A 3GSSA 4CDOA 5ECIB 3NIVA 2C0EA 5FT3A 1GTIA 1HQOA 5FWGA 2YZHA 4TOPA 3QCPA 1PQNA 1JLWA 3TUEA 1F6MC 4PUFC 2LRNA 2R6KA 2L6CA 4YAPA 4GQCA 1OAZA 5CRHA 1O8XA 2IMDA 5D93A 1NW2A 2L5LA 1T4ZA 3KP9A 1XW6A 3L9SA 3A3TA 4ZL9A 4WETA 1FB6A 1MTCA 4YAVA 5ECHB 3V1WA 2VO4A 1PSQA 3UMAA 4Q5RA 3GYKA 5ELGA 4XCSA 1Z3EA 3TKRA 1FW1A 3VWVA 2VCVA 4EDZA 4ULXA 1EOHA 4AGSA 1THOA 5LCZA 3TJKA 3IPZA 2HNLA 3RBTA 3EURA 5IOXA 4I2UA 2PN8A 5HFIA 3IDVA 1O85A 2HRFA 4PUAA 2VL2A 1PGTA 5G31A 4JEDA 9GSSA 5DQSA 5J3RA 1T00A 4D73A 10GSA 14GSA 1Y25A 3VPQA 5CAXA 1XXUA
chains in the Genus database with same CATH superfamily
4F0BA 2N5BA 2LJAA 1TJDA 3C73A 3DVXA 3RPPA 3QFBC 4NXIA 2HYXA 5DJLA 3BD2A 1QK8A 4IQ1A 2NBSA 4RI7A 1A24A 1U87A 2QA2A 2H74A 2L59A 1E2YA 3HCZA 3TKSA 4TRXA 3HYPA 2VOCA 3QMXA 3VWUA 5D9WA 5EL8A 2JZRA 3KEBA 4DSQA 2HLSA 3QDNA 4NV2A 4F82A 1Z7RA 2DJ0A 4PQHA 3GH9A 5B8BA 7GSSA 1T1VA 5G2ZA 2XPDA 1F37A 3IC8A 1B8XA 3IR4A 3A2WA 4I8BA 2A2PA 4IP1A 3TJBA 4EO3A 3W6GA 1BJXA 5A4UA 2CT6A 3L9UA 3IV4A 1M2AA 1GTAA 4V1Ag 3CXGA 3F3RA 2IFQB 3MDKA 1CQGA 1XVWA 1FVJA 4GSSA 2VCWA 4L0WA 1TU8A 3FR9A 4MH3A 3UBLA 2B1KA 5IMDA 4V1Ap 3IXRA 2MMNA 1XIYA 2B5YA 3HXSA 4HUAA 1Z5YE 3ERFA 3M1GA 1OVNA 3QAGA 4BVXA 2LUSA 1M99A 8GSSA 4ECJA 4K9ZA 4ZB9A 1ABAA 3L0HA 3CQFA 3KTBA 4OWYA 5EY6A 4X43A 4P3YB 1R7HA 4KCEA 2C3QA 3F9UA 1ST9A 2C0DA 4JBBA 2QKEA 1R4WA 1PN9A 4XRAA 3ZYWA 2PVQA 1AW9A 2F3MA 1JZDA 2R0CA 1FB0A 2VL3A 3N5OA 4Z7XA 2K8VA 4IW9A 2C3NA 2DKHA 4ICYA 5ECRB 5HR3A 1M7TA 5CNWA 3ED3A 3KH9A 2LNSA 2YZUA 4GCIA 5IOWA 1XVQA 3A5WA 3P90A 6GSYA 5AGYA 3EYTA 2PERA 5CRWA 4NMUA 2X8CA 4OCFA 1X9WB 1R5AA 1O81A 3QFAC 1PX7A 1JZRA 2R5GA 4ZBAA 3ZVJD 2XBIA 1XWBA 3ZFBA 3SWLA 1VRSD 3FMWA 4ID0A 2PGTA 3F8UA 2XPEA 1ZYQB 2A4HA 4TW5A 3FZ4A 2DIZA 1EEJA 1PX6A 2WZ9A 1V98A 1USBA 2H6ZA 4JE1A 3KM6A 1PL1A 3TRQA 1K0MA 2MMOA 1ZGNA 5J9BA 2K9FA 1PA3A 1HNCA 3ZRDA 1QQ2A 4IJ3A 2JZSA 4HZ4A 2HFDA 4DVCA 1RW1A 2YN1A 1VF1A 4MPGA 4EDYA 2OJLA 4POMA 4XS4A 4RQXA 1J0FA 2M80A 4O92A 3VPTA 3BBYA 3F0IA 4L5LA 3ZTLA 1YEXA 2QA1A 2RLIA 1K3LA 3H1NA 1FHEA 4Z2TA 3DVWA 3GL5A 4ZXGA 4K7NA 1ML6A 4WKWA 4LL1B 1EV4A 1XZOA 4MJCA 3EC3A 3LFLA 2K18A 5G5FA 1S3DA 2JZTA 1XOAA 5E59A 3TDGA 4QQ7A 2VUPA 5J4UA 4EF0A 2WULA 4AF2A 2ZUPA 1AIUA 1BG5A 3U5RE 1XFLA 2YPMA 1E6BA 2V1MA 2LRCA 4RQRA 5IMVA 1LBKA 3MWHA 4K1FA 3HJMA 5B7CA 1GTUA 4BPYA 5KOWA 3FK8A 2O7KA 2VLVA 1TTZA 1SKWB 2OE3A 3O76A 1FG4A 1QMVA 3FY7A 1TP9A 1Z6NA 1A8YA 1GNWA 5JWQB 3ZIJA 3KTLA 4HJ2A 3G7JA 1THXA 5IPHA 5BRTA 1ZYNA 3IA1A 1SKSB 4KCAA 4NWYA 5HQPA 2MYGA 3LG6A 3WGXA 3ZITA 2FUG2 1B9XC 3GN3A 1UC7A 4BWSA 1PKWA 4BVYA 1YF1A 4KE3A 3TRXA 3C71A 2HT9A 5DALA 2E0QA 2I9HA 3PINA 2YWOA 4CY8A 13GSA 5G1KA 1G6YA 3LWAA 3OR5A 1TXXA 4G0IA 2JACA 3E3EA 4PQIA 3PH9A 4AJ6A 1TRSA 2VLUA 1EEMA 1HNAA 4TKYA 3VWXA 1YF0A 2VD1A 1YDKA 3HD5A 2FD3A 4JR4A 4HZ2A 3QD9A 4FYUA 1J08A 4GQFA 3ERWA 5ECKB 4PQ1A 5KN3A 2F8FA 2IJYA 3UVHA 4GTUA 1LJRA 3C1SA 4TR1A 4KW6A 2ON5A 1R5PA 1GL8A 4MP4A 3W8SA 3W8JA 3EU4A 1ERTA 3VWWA 1EZKA 5JWOB 3C8EA 1OE8A 1SL0B 2DJKA 4YQUA 3G9BA 3U6VA 1BYEA 2FWGA 5ENUA 4ECIA 2IIYA 3FR3A 2R0GA 2HZEA 5DCHA 3LXZA 5HR2A 2KLXA 3CMIA 2GT6A 2WDUA 3GHAA 2H1AA 3CSHA 2GZPA 4DSRA 1QFNA 5KOXA 2L57A 3D4TA 4TR4A 4L0UA 3APOA 1A0FA 1Q4JA 4JU5A 2GSTA 5FHIA 4AJ8A 2EIRA 3GKKA 2X4AA 2MMAA 4FH8A 3LGCA 2O87A 2N5AA 4RI6A 5BMUA 4MDCA 4Q5FA 3TKQA 2DKIA 3CYNA 3GMFA 2WCIA 5DAKA 3TOUA 1GULA 1U88A 2YCDA 4JZQA 1A23A 1WWJA 3ZIVA 1AC1A 4K6XA 2DMLA 2L5OA 2B5XA 1RK4A 4O5UA 3CRUA 2AHEA 4MCUA 4J56E 3L9VA 3DYRA 4QL9A 4I5QA 2HRKA 3P2AA 2IMFA 16GSA 1A2JA 2IN3A 1AXDA 5F05A 3S9FA 4IELA 4JRRA 5J5NA 4MZCA 1EOGA 3E9JB 2RM6A 4POBA 2LKUA 4O7HA 3ZREA 4AJ7A 3I43A 4D73B 1SU9A 3L78A 4LMWA 2EIOA 4HQSA 4OMVA 2H01A 3KIJA 1GLPA 2VD0A 4K7OA 3RAZA 4IP6A 4MJEA 4JR6A 3IHQA 1NM3A 3HVVA 2YP6A 4WR5A 5ECLB 3O6TA 1K3OA 5GSSA 1WE0A 2C0FA 2P0GA 5AISA 3EINA 2GVPA 1ZYEA 2I3YA 1MDJA 2L4QA 1M9AA 3VURA 6GSTA 4J57E 1X9MB 2FCHA 1YJ6A 3UEMA 3HVXA 4OO4A 3DXBA 2B1LA 3QR6A 2B3SA 2DMMA 3IK7A 1SYRA 3F3QA 1IYHA 4ACSA 3GIXA 5ECPB 3GRXA 5F8BA 2B7JA 3EWLA 1GSSA 1K3YA 1EV9A 2JSYA 2YOIA 5CREA 2ALBA 2A2SA 1J9BA 2YANA 3N9JA 2EC4A 1U3IA 3PR8A 3FW2A 2EIQA 3HJOA 4BVXB 3HZ4A 2H6XA 1EWXA 1GWCA 3C7MA 1TOFA 1M9BA 1SK1A 5ECOB 5A5KA 2YJHA 5INYA 19GSA 4Q5QA 2QGVA 5E4WA 3LORA 2I1UA 2XBQA 4KH7A 2H6YA 4KDXA 3UOMA 4BA7A 1HNBA 2MZCA 1ERUA 1A8LA 3CTFA 1YZXA 2PMTA 2H73A 1XWKA 5G5EA 1YKCA 2QSIA 2IMKA 2YWIA 4LL4B 4J2FA 3IC4A 4TXOA 5G30A 3BCKA 4TVEA 4EE0A 3KP8A 3PGTA 4HU9A 4MJBA 1K0BA 4MNNA 5COHA 3CSIA 3D21A 4ECCA 5DDLA 3F6FA 4K5SA 4CY6A 4EL1A 2B6MA 3GV1A 3HDCA 3KH7A 3M8NA 4GLTA 2H1BA 4L8EA 2DSAA 1X9SB 2H1DA 4K0GA 1B48A 2TRXA 2H70A 3TKSE 2IL3A 5ECNB 2XC2A 3TJJA 3VK9A 3FRCA 2FWHA 1T7PB 4TR0A 1IYIA 2WB9A 2KHPA 1KNGA 2YV9A 1PN0A 3ME8A 2CA8A 4YH2A 1XWGA 5AIXA 2L6DA 2YWNA 4PGTA 4KB3A 2L4CA 1OKTA 1O6JA 4KUNA 4XTSA 2TRCP 3D5JA 3VI7A 3EPTA 3AY8A 3J7Yk 2B5EA 1TKDB 2P5QA 2IPAA 3MIXA 4ML1A 5ELAA 1SENA 1QGVA 2FHEA 3US3A 4XS4B 5ECQB 1GSFA 4HI7A 3VLNA 1WJKA 2H0IA 3TKPA 4Z2UA 2KP1A 2RUFA 2AYTA 1GSUA 4ZIJA 4WXTA 2UZ8A 2CQ9A 1ERVA 3I9V2 5A4VA 2RM5A 2TIRA 3TCOA 1M2DA 2DJJA 2F8AA 2VAFA 3UBKA 3SBCA 4YQVA 3GKNA 2ZCTA 2M46A 1ZZYA 2GSRA 1EP7A 1AQXA 1WOUA 3FHKA 3KCMA 1SJZA 2OACA 2GQMA 4KDUA 2GT5A 4OFTA 1Z9HA 1PL2A 4IQAA 4IKHA 2H8LA 2X8GA 3CRTA 3M3MA 1SK2A 5F0GA 5ID2A 1U3AA 2OKAA 4PX1A 2H72A 1FOHA 2HRAA 3EMXA 4K8MA 2MMZA 1K0DA 3F6DA 3HA9A 5IM9A 1FO5A 5CYYA 1WIKA 1X0RA 4KSOA 3GSTA 4NHWA 4G2EA 1T8EB 1GSQA 4HQZA 5CO3A 2WS2A 3Q18A 4KDYA 4K0NA 4F9ZA 3MNGA 1U6TA 2F9SA 1VGLA 4I6XA 1TRWA 1PRXA 4I2TA 3GUSA 2DIYA 4ECBA 1A0RP 3WYWA 4BVYB 5IMCA 2VM2A 1ACVA 3UJ1A 5ABRA 1MEKA 5DALB 4GWRA 3KXOA 3O3TA 3LJRA 1C72A 1R26A 3WGDA 4MABA 3WT2A 5IPGA 4DSSA 1PFOA 1M0UA 1WMJA 3HHVA 3LSZA 2O85A 1VF4A 2D2ZA 3LW9A 4V2LA 1KTEA 1DUGA 4F03A 5HFKA 5IQYA 2XHFA 3EU3A 2PBJA 1V2AA 3NZNA 1QUWA 1WPIA 1DE1A 3VFIA 4G19A 4WR4A 1JFUA 2VM1A 2NPBA 1A2MA 4X0XA 1G7EA 5A4WA 3UAPA 2R4VA 2P5RA 1X5DA 2WGRA 4EC0A 1AQVA 4RUVA 3DKSA 2FGXA 4TR1B 2LV3A 2H0GA 4GXZA 4YQMA 2CZ2A 2HRNA 3EVIA 3A5IA 3RDWA 5GZZB 2LEGA 3D6IA 3HZ8A 4ZBDA 3G7IA 3TJFA 1TK5B 3R2QA 1XWCA 3HKRA 4YKFA 3M9KA 1M2BA 4HSCX 1XWAA 3H79A 3TOTA 2OBKA 4MF7A 4ZBBA 4DEJA 2G2QA 3Q6OA 2AUVA 1XPVA 17GSA 2MBTA 4N0ZA 4I97A 3DWVA 3GNJA 3GTUA 4MJAA 2HZEB 3KJYA 2NTOA 2QC7A 1B4QA 3KGKA 2HI7A 2LJKA 2ON7A 1OC8A 3FEUA 4IGJA 1T3BA 4TN8A 4LMVA 2VIMA 3P8WA 5DQYA 5JWRB 4NAXA 3A2VA 3KMNA 18GSA 3K8NA 1ZCPA 4V2MA 5GSTA 3TKSC 2CVKA 4NPBA 1OC9A 1GLQA 4N10A 3ERGA 1TRVA 4ZB6A 2WFCA 2CX4A 5ECSA 2CVBA 3IOSA 2A2RA 1Y6EA 2AV4A 2K6VA 3RHCA 1B9YC 2P31A 1VF3A 4BL7A 1PMTA 2IWTA 3BOAA 3IE3A 2H1GA 1FOVA 2C1YA 1NSWA 2GS3A 5DVBA 4TXVA 1ZL9A 5F07A 2GTUA 1X5EA 3QAVA 1WP0A 2VL9A 2LS5A 2E7PA 4IVFA 3FYGA 3Q74A 2AJQB 3FKFA 5D9TA 3IAM2 2I4AA 1F3BA 2N5FA 3ZLPA 1O7UA 3R3EA 3QAWA 3KMOA 2FLSA 2WJUA 3ZZXA 1OKDA 5JCGA 4XIHA 4OFNA 3VI5A 1TK0B 2LTKA 1YKAA 3IBHA 2JADA 3LQ7A 2HZFA 3H8QA 4MH2A 1K0NA 5LNKe 1X5CA 2IMIA 5C04A 4XRDA 5LD0A 3ZMKA 3CBUA 1RQMA 1EGOA 3WT1A 4CHSA 1Z6MA 2PU9C 3GH6A 2DBCA 5EVOA 2X99A 4KSMA 5B6MA 3GL3A 2VCTA 2J23A 5HR1A 3CTGA 5GAPD 1W4VA 2HXKA 1XW5A 1SL2B 3GX0A 22GSA 5D73A 4ML6A 1URMA 4WBRD 3TJGA 4N30A 1K0CA 1SL1B 3FR6A 3GKXA 1KEBA 4GF0A 3FZAA 1OE7A 2CAQA 2M72A 1T4YA 4FQUA 2C4JA 1AUCA 2C3TA 3LXTA 1N2AA 5IMZA 2F51A 1H75A 4FIWA 2GQKA 5IIZA 1SJ6A 4GSTA 3HJPA 3RPNA 2JU5A 2YV7A 3DRNA 2GGTA 5IMFA 3DGQA 4PTSA 1S3RA 4POKA 1JZWA 5KN1A 1TI3A 1EGRA 1DBYA 2H76A 2C80A 2G0FA 5CRGA 3IHGA 3MSZA 4XHMA 4XS1A 4POLA 3WGEA 2DC5A 4OO5A 2X64A 6GSSA 1M3IA 4TR3A 2CAIA 1YQ1A 1ERWA 2V6KA 3G7YA 3E0UA 4OCEA 2E2GA 2PVOC 4G0KA 4HEA2 2HSYA 1SK0A 3BJ5A 2V2GA 4OD7A 1O8WA 5AN1A 2H66A 4MZWA 3ZFLA 5KEJA 2FWFA 1SD8A 4OFMA 1S3AA 3APSA 1F9MA 4ZL7A 4GRFA 3D22A 2GZZA 2DLXA 4PXOA 2H30A 4TXOB 3GURA 1CQHA 4MK3A 1S3CA 2GSQA 4PURA 4ZL8A 5B8AA 4O5RA 1MDKA 2J9HA 2KP2A 2PWJA 4G0LA 3QPMA 1MDIA 5G1LA 2YWMA 2IFQA 1XG8A 2NVLA 2V32A 5J41A 3I6AA 2OE0A 1H4OA 2VCQA 3ME7A 2HSMA 2OE1A 4K2DA 4CW9A 2JSZA 4N0VA 5L71A 4KAEA 1JZOA 2KUCA 1WRYA 4LA1A 3C1RA 1VF2A 1BQ7A 4IS0A 3J7Yb 3IRAA 5ECMB 1ZYPA 1UA5A 1XBSA 3M9JA 4IN0A 1G6WA 5H5QA 4O32A 4IBPA 4BWQA 4HOJA 2BMXA 4GSNA 1Z7PA 4NV5A 1HYUA 2PUKC 2R2JA 2O8VB 5AIVA 1SKRB 2R0PA 4ILFA 3CSJA 2LQQA 3F63A 2NDOA 1G7OA 2X8HA 3FZ5A 4E8HA 2KOKA 3MAKA 5CP1A 3UIWA 1V9WA 1UVZA 4MPFA 3GKMA 2FWEA 6GSWA 1GUKA 1TDIA 5DBQA 5C00A 4KF9A 4K5RA 3H4KA 2A4VA 3RHBA 2FNOA 4NHZA 3HVNA 5F06A 4BIKA 5EPFA 1HD2A 1LU4A 1JLVA 4IHUA 1XCCA 4ZILA 1TU7A 2CV4A 1N8JA 1GUHA 2O89A 2DJ1A 3MYDA 1DE2A 2VLTA 1GSDA 4L5OA 4ZB8A 3P7XA 6GSXA 20GSA 5JCWA 2LNTA 1V40A 3TGZA 1AQWA 2FA8A 4PNFA 3IK9A 3EE2A 2OA7A 4MF6A 3KZQA 3A2XA 5H5RA 4KNDA 4FYBA 1F3AA 1B4PA 1I5GA 4KX4A 4K2XA 1SYXA 1YEPA 2WRTA 2DJ3A 2YNXA 2H19A 2VCZA 3JCML 1PKZA 5ID2B 1GTBA 1ILOA 3FZ9A 5HFGA 2BJXA 3UARA 1ON4A 2GLRA 2I81A 1DSBA 2GZYA 3D4MA 3GFKA 4EVMA 1I9DA 2LRTA 2REMA 3TRPA 1G0TA 2C8UA 6GSUA 1GNEA 2CX3A 4LLRA 3M0FA 1QXHA 3LYPA 5CRDA 2H75A 1GP1A 4Q5NA 1GSYA 3I69A 2HSHA 1GUMA 2V6OA 4IJIA 2LSTA 2GDRA 3F4SA 4EIQA 4O5QA 4MMMA 2PPTA 2GSSA 4WEYA 4MF5A 3GA4A 2FY6A 1K0OA 1XOBA 2C0GA 5GAND 2RIIA 3D0ZA 4H86A 2E2MA 3Q19A 4USSA 2ES7A 5IO0A 6GSVA 4DSSB 2BTOT 2RUEA 1TK8B 4G10A 3GX8A 2R37A 4WF5A 5KN0A 5IMAA 1BEDA 3KD0A 2YJ7A 1SD9A 1GH2A 3LEFA 3UL3A 1PD21 3APQA 3F4TA 4K7IA 1OYJA 2H0HA 3L4NA 2FA4A 1NHOA 11GSA 1V57A 3DMLA 2LQOA 4WBJA 4XS6A 1NHYA 5J9CA 5D9VA 4HS1A 3IAS2 2AAWA 3ZVJA 1SJIA 3HY2A 2V41A 4N11A 2CZ3A 1UN2A 4WF4A 3F4RA 4EXJA 1TRUA 1KBNA 4ISDA 1ZOFA 2H71A 3DEXA 1YY7A 5JCUA 2VCXA 4V2NA 2K8SA 4G9HA 1O73A 1AAZA 4EIPA 3ZMLA 3DIEA 1OC3A 3WD6A 3UVTA 1MD4A 4YKGA 3H93A 4HDEA 4MLYA 1A2LA 4MZBA 5D8IA 5DJMA 5B6NA 3HVSA 1F2EA 3GTUB 2R3XA 1FAAA 2HE3A 1ZMAA 3EMPA 5HR0A 3ISOA 2VL2C 1FVKA 4X4JA 4KA0A 1EP8A 4MA9A 3ZL5A 1Q98A 4X1UA 4QL7A 2MBSA 3DD3A 1GSEA 1V58A 1OC9B 4FO5A 4E8EA 4HU7A 2LJRA 5IO2A 4PNGA 1K0AA 2CVDA 1MD3A 3PPUA 1W89A 1XW9A 3NOFA 4BL7B 1BAYA 1BX9A 2X49A 2IMEA 1JHBA 4F0CA 2DJ2A 2ZNMA 12GSA 2AB6A 3BCIA 2GQLA 5DCGA 1GRXA 2Z9SA 4HJMA 5H5SA 2B7KA 4EKZA 2OADA 4KGIA 4FYCA 3QOUA 5DAKB 1TW9A 4EUYA 5KN2A 5D9XA 2OBIA 5D96A 3LYKA 3TB2A 4F2IA 1TI1A 2JL4A 3GSSA 4CDOA 5ECIB 3NIVA 2C0EA 5FT3A 1GTIA 1HQOA 5FWGA 4Z2RA 2YZHA 4TOPA 3QCPA 1PQNA 1JLWA 3TUEA 1F6MC 4PUFC 2LRNA 2R6KA 2L6CA 4YAPA 4GQCA 1OAZA 5CRHA 1O8XA 2IMDA 5D93A 1NW2A 2L5LA 1T4ZA 3KP9A 1XW6A 3L9SA 3A3TA 4ZL9A 4WETA 1FB6A 1MTCA 4YAVA 5ECHB 3V1WA 2VO4A 1PSQA 3UMAA 4A5PA 4Q5RA 3GYKA 5ELGA 4XCSA 1Z3EA 3TKRA 1FW1A 3VWVA 2VCVA 4EDZA 4ULXA 1EOHA 4AGSA 1THOA 5LCZA 3TJKA 3IPZA 2HNLA 3RBTA 3EURA 5IOXA 4I2UA 2PN8A 5HFIA 3IDVA 1O85A 2HRFA 4PUAA 2VL2A 1PGTA 5G31A 4JEDA 9GSSA 5DQSA 5J3RA 1T00A 4D73A 10GSA 14GSA 1Y25A 3VPQA 5CAXA 1XXUA 1M3JA
chains in the Genus database with same CATH topology
4F0BA 2N5BA 2LJAA 1TJDA 3C73A 3DVXA 3RPPA 3QFBC 4NXIA 2HYXA 5DJLA 3BD2A 1QK8A 4IQ1A 2NBSA 4RI7A 1A24A 1U87A 2QA2A 2H74A 2L59A 1E2YA 3HCZA 3TKSA 4TRXA 3HYPA 2VOCA 3QMXA 3VWUA 5D9WA 5EL8A 2JZRA 3KEBA 4DSQA 2HLSA 3QDNA 4NV2A 4F82A 1Z7RA 2DJ0A 4PQHA 3GH9A 5B8BA 7GSSA 1T1VA 5G2ZA 2XPDA 1F37A 3IC8A 1B8XA 3IR4A 3A2WA 4I8BA 2A2PA 4IP1A 3TJBA 4EO3A 3W6GA 1BJXA 5A4UA 2CT6A 3L9UA 3IV4A 1M2AA 1GTAA 4V1Ag 3CXGA 3F3RA 2IFQB 3MDKA 1CQGA 1XVWA 1FVJA 4GSSA 2VCWA 4L0WA 1TU8A 3FR9A 4MH3A 3UBLA 2B1KA 5IMDA 4V1Ap 3IXRA 2MMNA 1XIYA 2B5YA 3HXSA 4HUAA 1Z5YE 3ERFA 3M1GA 1OVNA 3QAGA 4BVXA 2LUSA 1M99A 8GSSA 4ECJA 4K9ZA 4ZB9A 1ABAA 3L0HA 3KTBA 4OWYA 5EY6A 4X43A 4P3YB 1R7HA 4KCEA 2C3QA 3F9UA 1ST9A 2C0DA 4JBBA 2QKEA 1R4WA 1PN9A 4XRAA 3ZYWA 2PVQA 1AW9A 2F3MA 1JZDA 2R0CA 1FB0A 2VL3A 3N5OA 4Z7XA 2K8VA 4IW9A 2C3NA 2DKHA 4ICYA 5ECRB 5HR3A 1M7TA 5CNWA 3ED3A 3KH9A 2LNSA 2YZUA 4GCIA 5IOWA 1XVQA 3A5WA 3P90A 6GSYA 5AGYA 3EYTA 2PERA 5CRWA 4NMUA 2X8CA 4OCFA 1X9WB 1R5AA 1O81A 3QFAC 1PX7A 1JZRA 2R5GA 4ZBAA 3ZVJD 2XBIA 1XWBA 3ZFBA 3SWLA 1VRSD 3FMWA 4ID0A 2PGTA 3F8UA 2XPEA 1ZYQB 2A4HA 4TW5A 3FZ4A 2DIZA 1EEJA 1PX6A 2WZ9A 1V98A 1USBA 2H6ZA 4JE1A 3KM6A 1PL1A 3TRQA 1K0MA 2MMOA 1ZGNA 5J9BA 2K9FA 1PA3A 1HNCA 3ZRDA 1QQ2A 4IJ3A 2JZSA 4HZ4A 2HFDA 4DVCA 1RW1A 2YN1A 1VF1A 4MPGA 4EDYA 2OJLA 4POMA 4XS4A 4RQXA 1J0FA 2M80A 4O92A 3VPTA 3BBYA 3F0IA 4L5LA 3ZTLA 1YEXA 2QA1A 2RLIA 1K3LA 3H1NA 1FHEA 4Z2TA 3DVWA 3GL5A 4ZXGA 4K7NA 1ML6A 4WKWA 4LL1B 1EV4A 1XZOA 4MJCA 3EC3A 3LFLA 2K18A 5G5FA 1S3DA 2JZTA 1XOAA 5E59A 3TDGA 4QQ7A 2VUPA 5J4UA 4EF0A 2WULA 4AF2A 2ZUPA 1AIUA 1BG5A 3U5RE 1XFLA 2YPMA 1E6BA 2V1MA 2LRCA 4RQRA 5IMVA 1LBKA 3MWHA 4K1FA 3HJMA 5B7CA 1GTUA 4BPYA 5KOWA 3FK8A 2O7KA 2VLVA 1TTZA 1SKWB 2OE3A 3O76A 1FG4A 1QMVA 3FY7A 1TP9A 1Z6NA 1A8YA 1GNWA 5JWQB 3ZIJA 3KTLA 4HJ2A 3G7JA 1THXA 5IPHA 5BRTA 1ZYNA 3IA1A 1SKSB 4KCAA 4NWYA 5HQPA 2MYGA 3LG6A 3WGXA 3ZITA 2FUG2 1B9XC 3GN3A 1UC7A 4BWSA 1PKWA 4BVYA 1YF1A 4KE3A 3TRXA 3C71A 2HT9A 5DALA 2E0QA 2I9HA 3PINA 2YWOA 4CY8A 13GSA 5G1KA 1G6YA 3LWAA 3OR5A 1TXXA 4G0IA 2JACA 3E3EA 4PQIA 3PH9A 4AJ6A 1TRSA 2VLUA 1EEMA 1HNAA 4TKYA 3VWXA 1YF0A 2VD1A 1YDKA 3HD5A 2FD3A 4JR4A 4HZ2A 3QD9A 4FYUA 1J08A 4GQFA 3ERWA 5ECKB 4PQ1A 5KN3A 2F8FA 2IJYA 3UVHA 4GTUA 1LJRA 3C1SA 4TR1A 4KW6A 2ON5A 1R5PA 1GL8A 4MP4A 3W8SA 3W8JA 3EU4A 1ERTA 3VWWA 1EZKA 5JWOB 3C8EA 1OE8A 1SL0B 2DJKA 4YQUA 3G9BA 3U6VA 1BYEA 2FWGA 5ENUA 4ECIA 2IIYA 3FR3A 2R0GA 2HZEA 5DCHA 3LXZA 5HR2A 2KLXA 3CMIA 2GT6A 2WDUA 3GHAA 2H1AA 3CSHA 2GZPA 4DSRA 1QFNA 5KOXA 2L57A 3D4TA 4TR4A 4L0UA 3APOA 1A0FA 1Q4JA 4JU5A 2GSTA 5FHIA 4AJ8A 2EIRA 3GKKA 2X4AA 2MMAA 4FH8A 3LGCA 2O87A 2N5AA 4RI6A 5BMUA 4MDCA 4Q5FA 3TKQA 2DKIA 3CYNA 3GMFA 2WCIA 5DAKA 3TOUA 1GULA 1U88A 2YCDA 4JZQA 1A23A 1WWJA 3ZIVA 1AC1A 4K6XA 2DMLA 2L5OA 2B5XA 1RK4A 4O5UA 3CRUA 2AHEA 4MCUA 4J56E 3L9VA 3DYRA 4QL9A 4I5QA 2HRKA 3P2AA 2IMFA 16GSA 1A2JA 2IN3A 1AXDA 5F05A 3S9FA 4IELA 4JRRA 5J5NA 4MZCA 1EOGA 3E9JB 2RM6A 4POBA 2LKUA 4O7HA 3ZREA 4AJ7A 3I43A 4D73B 1SU9A 3L78A 4LMWA 2EIOA 4HQSA 4OMVA 2H01A 3KIJA 1GLPA 2VD0A 4K7OA 3RAZA 4IP6A 4MJEA 4JR6A 3IHQA 1NM3A 3HVVA 2YP6A 4WR5A 5ECLB 3O6TA 1K3OA 5GSSA 1WE0A 2C0FA 2P0GA 5AISA 3EINA 2GVPA 1ZYEA 2I3YA 1MDJA 2L4QA 1M9AA 3VURA 6GSTA 4J57E 1X9MB 2FCHA 1YJ6A 3UEMA 3HVXA 4OO4A 3DXBA 2B1LA 3QR6A 2B3SA 2DMMA 3IK7A 1SYRA 3F3QA 1IYHA 4ACSA 3GIXA 5ECPB 3GRXA 5F8BA 2B7JA 3EWLA 1GSSA 1K3YA 1EV9A 2JSYA 2YOIA 5CREA 2ALBA 2A2SA 1J9BA 2YANA 3N9JA 2EC4A 1U3IA 3PR8A 3FW2A 2EIQA 3HJOA 4BVXB 3HZ4A 2H6XA 1EWXA 1GWCA 3C7MA 1TOFA 1M9BA 1SK1A 5ECOB 5A5KA 2YJHA 5INYA 19GSA 4Q5QA 2QGVA 5E4WA 3LORA 2I1UA 2XBQA 4KH7A 2H6YA 4KDXA 3UOMA 4BA7A 1HNBA 2MZCA 1ERUA 1A8LA 3CTFA 1YZXA 2PMTA 2H73A 1XWKA 5G5EA 1YKCA 2QSIA 2IMKA 2YWIA 4LL4B 4J2FA 3IC4A 4TXOA 5G30A 3BCKA 4TVEA 4EE0A 3KP8A 3PGTA 4HU9A 4MJBA 1K0BA 4MNNA 5COHA 3CSIA 3D21A 4ECCA 5DDLA 3F6FA 4K5SA 4CY6A 4EL1A 2B6MA 3GV1A 3HDCA 3KH7A 3M8NA 4GLTA 2H1BA 4L8EA 2DSAA 1X9SB 2H1DA 4K0GA 1B48A 2TRXA 2H70A 3TKSE 2IL3A 5ECNB 2XC2A 3TJJA 3VK9A 3FRCA 2FWHA 1T7PB 4TR0A 1IYIA 2WB9A 2KHPA 1KNGA 2YV9A 1PN0A 3ME8A 2CA8A 4YH2A 1XWGA 5AIXA 2L6DA 2YWNA 4PGTA 4KB3A 2L4CA 1OKTA 1O6JA 4KUNA 4XTSA 2TRCP 3D5JA 3VI7A 3EPTA 3AY8A 3J7Yk 2B5EA 1TKDB 2P5QA 2IPAA 3MIXA 4ML1A 5ELAA 1SENA 1QGVA 2FHEA 3US3A 4XS4B 5ECQB 1GSFA 4HI7A 3VLNA 1WJKA 2H0IA 3TKPA 4Z2UA 2KP1A 2RUFA 2AYTA 1GSUA 4ZIJA 4WXTA 2UZ8A 2CQ9A 1ERVA 3I9V2 5A4VA 2RM5A 2TIRA 3TCOA 1M2DA 2DJJA 2F8AA 2VAFA 3UBKA 3SBCA 4YQVA 3GKNA 2ZCTA 2M46A 1ZZYA 2GSRA 1EP7A 1AQXA 1WOUA 3FHKA 3KCMA 1SJZA 2OACA 2GQMA 4KDUA 2GT5A 4OFTA 1Z9HA 1PL2A 4IQAA 4IKHA 2H8LA 2X8GA 3CRTA 3M3MA 1SK2A 5F0GA 5ID2A 1U3AA 2OKAA 4PX1A 2H72A 1FOHA 2HRAA 3EMXA 4K8MA 2MMZA 1K0DA 3F6DA 3HA9A 5IM9A 1FO5A 5CYYA 1WIKA 1X0RA 4KSOA 3GSTA 4NHWA 4G2EA 1T8EB 1GSQA 4HQZA 5CO3A 2WS2A 3Q18A 4KDYA 4K0NA 4F9ZA 3MNGA 1U6TA 2F9SA 1VGLA 4I6XA 1TRWA 1PRXA 4I2TA 3GUSA 2DIYA 4ECBA 1A0RP 3WYWA 4BVYB 5IMCA 2VM2A 1ACVA 3UJ1A 5ABRA 1MEKA 5DALB 4GWRA 3KXOA 3O3TA 3LJRA 1C72A 1R26A 3WGDA 4MABA 3WT2A 5IPGA 4DSSA 1M0UA 1WMJA 3HHVA 3LSZA 2O85A 1VF4A 2D2ZA 3LW9A 4V2LA 1KTEA 1DUGA 4F03A 5HFKA 5IQYA 2XHFA 3EU3A 2PBJA 1V2AA 3NZNA 1QUWA 1WPIA 1DE1A 3VFIA 4G19A 4WR4A 1JFUA 2VM1A 2NPBA 1A2MA 4X0XA 1G7EA 5A4WA 3UAPA 2R4VA 2P5RA 1X5DA 2WGRA 4EC0A 1AQVA 4RUVA 3DKSA 2FGXA 4TR1B 2LV3A 2H0GA 4GXZA 4YQMA 2CZ2A 2HRNA 3EVIA 3A5IA 3RDWA 5GZZB 2LEGA 3D6IA 3HZ8A 4ZBDA 3G7IA 3TJFA 1TK5B 3R2QA 1XWCA 3HKRA 4YKFA 3M9KA 1M2BA 1XWAA 3H79A 3TOTA 2OBKA 4MF7A 4ZBBA 4DEJA 2G2QA 3Q6OA 2AUVA 1XPVA 17GSA 2MBTA 4N0ZA 4I97A 3DWVA 3GNJA 3GTUA 4MJAA 2HZEB 3KJYA 2NTOA 2QC7A 1B4QA 3KGKA 2HI7A 2LJKA 2ON7A 1OC8A 3FEUA 4IGJA 1T3BA 4TN8A 4LMVA 2VIMA 3P8WA 5DQYA 5JWRB 4NAXA 3A2VA 3KMNA 18GSA 3K8NA 1ZCPA 4V2MA 5GSTA 3TKSC 2CVKA 4NPBA 1OC9A 1GLQA 4N10A 3ERGA 1TRVA 4ZB6A 2WFCA 2CX4A 5ECSA 2CVBA 3IOSA 2A2RA 1Y6EA 2AV4A 2K6VA 3RHCA 1B9YC 2P31A 1VF3A 4BL7A 1PMTA 2IWTA 3BOAA 3IE3A 2H1GA 1FOVA 2C1YA 1NSWA 2GS3A 5DVBA 4TXVA 1ZL9A 5F07A 2GTUA 1X5EA 3QAVA 1WP0A 2VL9A 2LS5A 2E7PA 4IVFA 3FYGA 3Q74A 2AJQB 3FKFA 5D9TA 3IAM2 2I4AA 1F3BA 2N5FA 3ZLPA 1O7UA 3R3EA 3QAWA 3KMOA 2FLSA 2WJUA 3ZZXA 1OKDA 5JCGA 4XIHA 4OFNA 3VI5A 1TK0B 2LTKA 1YKAA 3IBHA 2JADA 3LQ7A 2HZFA 3H8QA 4MH2A 1K0NA 5LNKe 1X5CA 2IMIA 5C04A 4XRDA 5LD0A 3ZMKA 3CBUA 1RQMA 1EGOA 3WT1A 4CHSA 1Z6MA 2PU9C 3GH6A 2DBCA 5EVOA 2X99A 4KSMA 5B6MA 3GL3A 2VCTA 2J23A 5HR1A 3CTGA 5GAPD 1W4VA 2HXKA 1XW5A 1SL2B 3GX0A 22GSA 5D73A 4ML6A 1URMA 4WBRD 3TJGA 4N30A 1K0CA 1SL1B 3FR6A 3GKXA 1KEBA 4GF0A 3FZAA 1OE7A 2CAQA 2M72A 1T4YA 4FQUA 2C4JA 1AUCA 2C3TA 3LXTA 1N2AA 5IMZA 2F51A 1H75A 4FIWA 2GQKA 5IIZA 1SJ6A 4GSTA 3HJPA 3RPNA 2JU5A 2YV7A 3DRNA 2GGTA 5IMFA 3DGQA 4PTSA 4POKA 1JZWA 5KN1A 1TI3A 1EGRA 1DBYA 2H76A 2C80A 2G0FA 5CRGA 3IHGA 3MSZA 4XHMA 4XS1A 4POLA 3WGEA 2DC5A 4OO5A 2X64A 6GSSA 4TR3A 2CAIA 1YQ1A 1ERWA 2V6KA 3G7YA 3E0UA 4OCEA 2E2GA 2PVOC 4G0KA 4HEA2 2HSYA 1SK0A 3BJ5A 2V2GA 4OD7A 1O8WA 5AN1A 2H66A 4MZWA 3ZFLA 5KEJA 2FWFA 1SD8A 4OFMA 1S3AA 3APSA 1F9MA 4ZL7A 4GRFA 3D22A 2GZZA 2DLXA 4PXOA 2H30A 4TXOB 3GURA 1CQHA 4MK3A 1S3CA 2GSQA 4PURA 4ZL8A 5B8AA 4O5RA 1MDKA 2J9HA 2KP2A 2PWJA 4G0LA 3QPMA 1MDIA 5G1LA 2YWMA 2IFQA 2NVLA 2V32A 5J41A 3I6AA 2OE0A 1H4OA 2VCQA 3ME7A 2HSMA 2OE1A 4K2DA 4CW9A 2JSZA 4N0VA 5L71A 4KAEA 1JZOA 2KUCA 1WRYA 4LA1A 3C1RA 1VF2A 1BQ7A 4IS0A 3J7Yb 3IRAA 5ECMB 1ZYPA 1UA5A 1XBSA 3M9JA 4IN0A 1G6WA 5H5QA 4O32A 4IBPA 4BWQA 4HOJA 2BMXA 4GSNA 1Z7PA 4NV5A 1HYUA 2PUKC 2R2JA 2O8VB 5AIVA 1SKRB 2R0PA 4ILFA 3CSJA 2LQQA 3F63A 2NDOA 1G7OA 2X8HA 3FZ5A 4E8HA 2KOKA 3MAKA 5CP1A 3UIWA 1V9WA 1UVZA 4MPFA 3GKMA 2FWEA 6GSWA 1GUKA 1TDIA 5DBQA 5C00A 4KF9A 4K5RA 3H4KA 2A4VA 3RHBA 2FNOA 4NHZA 5F06A 5EPFA 1HD2A 1LU4A 1JLVA 4IHUA 1XCCA 4ZILA 1TU7A 2CV4A 1N8JA 1GUHA 2O89A 2DJ1A 3MYDA 1DE2A 2VLTA 1GSDA 4L5OA 4ZB8A 3P7XA 6GSXA 20GSA 5JCWA 2LNTA 1V40A 3TGZA 1AQWA 2FA8A 4PNFA 3IK9A 3EE2A 2OA7A 4MF6A 3KZQA 3A2XA 5H5RA 4KNDA 4FYBA 1F3AA 1B4PA 1I5GA 4KX4A 4K2XA 1SYXA 1YEPA 2WRTA 2DJ3A 2YNXA 2H19A 2VCZA 3JCML 1PKZA 5ID2B 1GTBA 1ILOA 3FZ9A 5HFGA 2BJXA 3UARA 1ON4A 2GLRA 2I81A 1DSBA 2GZYA 3D4MA 3GFKA 4EVMA 1I9DA 2LRTA 2REMA 3TRPA 1G0TA 2C8UA 6GSUA 1GNEA 2CX3A 4LLRA 3M0FA 1QXHA 3LYPA 5CRDA 2H75A 1GP1A 4Q5NA 1GSYA 3I69A 2HSHA 1GUMA 2V6OA 4IJIA 2LSTA 2GDRA 3F4SA 4EIQA 4O5QA 4MMMA 2PPTA 2GSSA 4WEYA 4MF5A 3GA4A 2FY6A 1K0OA 1XOBA 2C0GA 5GAND 2RIIA 3D0ZA 4H86A 2E2MA 3Q19A 4USSA 2ES7A 5IO0A 6GSVA 4DSSB 2BTOT 2RUEA 1TK8B 4G10A 3GX8A 2R37A 4WF5A 5KN0A 5IMAA 1BEDA 3KD0A 2YJ7A 1SD9A 1GH2A 3LEFA 3UL3A 1PD21 3APQA 3F4TA 4K7IA 1OYJA 2H0HA 3L4NA 2FA4A 1NHOA 11GSA 1V57A 3DMLA 2LQOA 4WBJA 4XS6A 1NHYA 5J9CA 5D9VA 4HS1A 3IAS2 2AAWA 3ZVJA 1SJIA 3HY2A 2V41A 4N11A 2CZ3A 1UN2A 4WF4A 3F4RA 4EXJA 1TRUA 1KBNA 4ISDA 1ZOFA 2H71A 3DEXA 1YY7A 5JCUA 2VCXA 4V2NA 2K8SA 4G9HA 1O73A 1AAZA 4EIPA 3ZMLA 3DIEA 1OC3A 3WD6A 3UVTA 1MD4A 4YKGA 3H93A 4HDEA 4MLYA 1A2LA 4MZBA 5D8IA 5DJMA 5B6NA 3HVSA 1F2EA 3GTUB 2R3XA 1FAAA 2HE3A 1ZMAA 3EMPA 5HR0A 3ISOA 2VL2C 1FVKA 4X4JA 4KA0A 1EP8A 4MA9A 3ZL5A 1Q98A 4X1UA 4QL7A 2MBSA 3DD3A 1GSEA 1V58A 1OC9B 4FO5A 4E8EA 4HU7A 2LJRA 5IO2A 4PNGA 1K0AA 2CVDA 1MD3A 3PPUA 1W89A 1XW9A 3NOFA 4BL7B 1BAYA 1BX9A 2X49A 2IMEA 1JHBA 4F0CA 2DJ2A 2ZNMA 12GSA 2AB6A 3BCIA 2GQLA 5DCGA 1GRXA 2Z9SA 4HJMA 5H5SA 2B7KA 4EKZA 2OADA 4KGIA 4FYCA 3QOUA 5DAKB 1TW9A 4EUYA 5KN2A 5D9XA 2OBIA 5D96A 3LYKA 3TB2A 4F2IA 1TI1A 2JL4A 3GSSA 4CDOA 5ECIB 3NIVA 2C0EA 5FT3A 1GTIA 1HQOA 5FWGA 4Z2RA 2YZHA 4TOPA 3QCPA 1PQNA 1JLWA 3TUEA 1F6MC 4PUFC 2LRNA 2R6KA 2L6CA 4YAPA 4GQCA 1OAZA 5CRHA 1O8XA 2IMDA 5D93A 1NW2A 2L5LA 1T4ZA 3KP9A 1XW6A 3L9SA 3A3TA 4ZL9A 4WETA 1FB6A 1MTCA 4YAVA 5ECHB 3V1WA 2VO4A 1PSQA 3UMAA 4A5PA 4Q5RA 3GYKA 5ELGA 4XCSA 1Z3EA 3TKRA 1FW1A 3VWVA 2VCVA 4EDZA 4ULXA 1EOHA 4AGSA 1THOA 5LCZA 3TJKA 3IPZA 2HNLA 3RBTA 3EURA 5IOXA 4I2UA 2PN8A 5HFIA 3IDVA 1O85A 2HRFA 4PUAA 2VL2A 1PGTA 5G31A 4JEDA 9GSSA 5DQSA 5J3RA 1T00A 4D73A 10GSA 14GSA 1Y25A 3VPQA 5CAXA 1XXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F0B A;  2N5B A;  2LJA A;  1TJD A;  3C73 A;  3DVX A;  3RPP A;  3QFB C;  4NXI A;  2HYX A;  5DJL A;  3BD2 A;  1QK8 A;  4IQ1 A;  2NBS A;  4RI7 A;  1A24 A;  1U87 A;  2H74 A;  2L59 A;  1E2Y A;  3HCZ A;  3TKS A;  4TRX A;  3HYP A;  2VOC A;  3QMX A;  3VWU A;  5D9W A;  5EL8 A;  2JZR A;  3KEB A;  4DSQ A;  2HLS A;  3QDN A;  4NV2 A;  4F82 A;  1Z7R A;  2DJ0 A;  4PQH A;  3GH9 A;  5B8B A;  7GSS A;  1T1V A;  5G2Z A;  2XPD A;  1F37 A;  1B8X A;  3IR4 A;  3A2W A;  4I8B A;  4IP1 A;  3TJB A;  4EO3 A;  3W6G A;  1BJX A;  5A4U A;  2CT6 A;  3L9U A;  3IV4 A;  1M2A A;  1GTA A;  4V1A g;  3CXG A;  3F3R A;  2IFQ B;  3MDK A;  1CQG A;  1XVW A;  1FVJ A;  4GSS A;  2VCW A;  4L0W A;  1TU8 A;  3FR9 A;  4MH3 A;  3UBL A;  2B1K A;  5IMD A;  4V1A p;  3IXR A;  2MMN A;  1XIY A;  2B5Y A;  3HXS A;  4HUA A;  1Z5Y E;  3ERF A;  3M1G A;  1OVN A;  3QAG A;  4BVX A;  2LUS A;  1M99 A;  8GSS A;  4ECJ A;  4K9Z A;  4ZB9 A;  1ABA A;  3L0H A;  3KTB A;  4OWY A;  5EY6 A;  4X43 A;  4P3Y B;  1R7H A;  4KCE A;  2C3Q A;  3F9U A;  1ST9 A;  2C0D A;  4JBB A;  2QKE A;  1R4W A;  1PN9 A;  4XRA A;  3ZYW A;  2PVQ A;  1AW9 A;  2F3M A;  1JZD A;  1FB0 A;  2VL3 A;  3N5O A;  4Z7X A;  2K8V A;  4IW9 A;  2C3N A;  5ECR B;  5HR3 A;  1M7T A;  5CNW A;  3ED3 A;  3KH9 A;  2LNS A;  2YZU A;  4GCI A;  5IOW A;  1XVQ A;  3A5W A;  3P90 A;  6GSY A;  5AGY A;  3EYT A;  2PER A;  5CRW A;  4NMU A;  2X8C A;  4OCF A;  1X9W B;  1R5A A;  1O81 A;  3QFA C;  1PX7 A;  1JZR A;  2R5G A;  4ZBA A;  3ZVJ D;  2XBI A;  1XWB A;  3ZFB A;  3SWL A;  1VRS D;  4ID0 A;  2PGT A;  3F8U A;  2XPE A;  1ZYQ B;  4TW5 A;  3FZ4 A;  2DIZ A;  1EEJ A;  1PX6 A;  2WZ9 A;  1V98 A;  1USB A;  2H6Z A;  4JE1 A;  3KM6 A;  1PL1 A;  3TRQ A;  1K0M A;  2MMO A;  1ZGN A;  5J9B A;  2K9F A;  1PA3 A;  1HNC A;  3ZRD A;  1QQ2 A;  4IJ3 A;  2JZS A;  4HZ4 A;  2HFD A;  4DVC A;  1RW1 A;  2YN1 A;  1VF1 A;  4MPG A;  4EDY A;  2OJL A;  4POM A;  4XS4 A;  4RQX A;  1J0F A;  2M80 A;  4O92 A;  3VPT A;  3BBY A;  3F0I A;  4L5L A;  3ZTL A;  1YEX A;  2RLI A;  1K3L A;  3H1N A;  1FHE A;  3DVW A;  3GL5 A;  4ZXG A;  4K7N A;  1ML6 A;  4WKW A;  4LL1 B;  1EV4 A;  1XZO A;  4MJC A;  3EC3 A;  3LFL A;  2K18 A;  5G5F A;  1S3D A;  2JZT A;  1XOA A;  5E59 A;  3TDG A;  4QQ7 A;  2VUP A;  5J4U A;  4EF0 A;  2WUL A;  4AF2 A;  2ZUP A;  1AIU A;  1BG5 A;  3U5R E;  1XFL A;  2YPM A;  1E6B A;  2V1M A;  2LRC A;  4RQR A;  5IMV A;  1LBK A;  3MWH A;  4K1F A;  3HJM A;  5B7C A;  1GTU A;  4BPY A;  3FK8 A;  2O7K A;  2VLV A;  1TTZ A;  1SKW B;  2OE3 A;  3O76 A;  1FG4 A;  1QMV A;  3FY7 A;  1TP9 A;  1Z6N A;  1A8Y A;  1GNW A;  5JWQ B;  3ZIJ A;  3KTL A;  4HJ2 A;  3G7J A;  1THX A;  5IPH A;  3IA1 A;  1SKS B;  4KCA A;  4NWY A;  5HQP A;  2MYG A;  3LG6 A;  3WGX A;  3ZIT A;  2FUG 2;  1B9X C;  3GN3 A;  1UC7 A;  4BWS A;  1PKW A;  4BVY A;  1YF1 A;  4KE3 A;  3TRX A;  3C71 A;  2HT9 A;  5DAL A;  2E0Q A;  2I9H A;  3PIN A;  2YWO A;  13GS A;  5G1K A;  1G6Y A;  3LWA A;  3OR5 A;  1TXX A;  2JAC A;  3E3E A;  4PQI A;  3PH9 A;  4AJ6 A;  1TRS A;  2VLU A;  1EEM A;  1HNA A;  4TKY A;  3VWX A;  1YF0 A;  2VD1 A;  1YDK A;  3HD5 A;  2FD3 A;  4JR4 A;  4HZ2 A;  3QD9 A;  4FYU A;  1J08 A;  4GQF A;  3ERW A;  5ECK B;  4PQ1 A;  5KN3 A;  2F8F A;  2IJY A;  3UVH A;  4GTU A;  1LJR A;  3C1S A;  4TR1 A;  4KW6 A;  2ON5 A;  1R5P A;  1GL8 A;  4MP4 A;  3W8S A;  3W8J A;  3EU4 A;  1ERT A;  3VWW A;  1EZK A;  5JWO B;  3C8E A;  1OE8 A;  1SL0 B;  2DJK A;  4YQU A;  3G9B A;  3U6V A;  1BYE A;  2FWG A;  5ENU A;  4ECI A;  2IIY A;  3FR3 A;  2HZE A;  5DCH A;  3LXZ A;  5HR2 A;  2KLX A;  3CMI A;  2GT6 A;  2WDU A;  3GHA A;  2H1A A;  3CSH A;  2GZP A;  4DSR A;  1QFN A;  2L57 A;  3D4T A;  4TR4 A;  4L0U A;  3APO A;  1A0F A;  1Q4J A;  4JU5 A;  2GST A;  5FHI A;  4AJ8 A;  2EIR A;  3GKK A;  2MMA A;  4FH8 A;  3LGC A;  2O87 A;  2N5A A;  4RI6 A;  4MDC A;  4Q5F A;  3TKQ A;  3CYN A;  3GMF A;  2WCI A;  5DAK A;  3TOU A;  1GUL A;  1U88 A;  2YCD A;  4JZQ A;  1A23 A;  1WWJ A;  3ZIV A;  1AC1 A;  4K6X A;  2DML A;  2L5O A;  2B5X A;  1RK4 A;  3CRU A;  2AHE A;  4MCU A;  4J56 E;  3L9V A;  3DYR A;  4QL9 A;  4I5Q A;  3P2A A;  2IMF A;  16GS A;  1A2J A;  2IN3 A;  1AXD A;  5F05 A;  3S9F A;  4IEL A;  4JRR A;  5J5N A;  4MZC A;  1EOG A;  3E9J B;  2RM6 A;  4POB A;  2LKU A;  4O7H A;  3ZRE A;  4AJ7 A;  3I43 A;  4D73 B;  1SU9 A;  3L78 A;  4LMW A;  2EIO A;  4HQS A;  4OMV A;  2H01 A;  3KIJ A;  1GLP A;  2VD0 A;  4K7O A;  3RAZ A;  4IP6 A;  4MJE A;  4JR6 A;  3IHQ A;  1NM3 A;  3HVV A;  2YP6 A;  4WR5 A;  5ECL B;  3O6T A;  1K3O A;  5GSS A;  1WE0 A;  2C0F A;  2P0G A;  5AIS A;  3EIN A;  2GVP A;  1ZYE A;  2I3Y A;  1MDJ A;  2L4Q A;  1M9A A;  3VUR A;  6GST A;  4J57 E;  1X9M B;  2FCH A;  1YJ6 A;  3UEM A;  3HVX A;  4OO4 A;  3DXB A;  2B1L A;  3QR6 A;  2B3S A;  2DMM A;  3IK7 A;  1SYR A;  3F3Q A;  1IYH A;  4ACS A;  3GIX A;  5ECP B;  3GRX A;  5F8B A;  2B7J A;  3EWL A;  1GSS A;  1K3Y A;  1EV9 A;  2JSY A;  2YOI A;  5CRE A;  2ALB A;  2A2S A;  1J9B A;  2YAN A;  3N9J A;  2EC4 A;  1U3I A;  3PR8 A;  3FW2 A;  2EIQ A;  3HJO A;  3HZ4 A;  2H6X A;  1EWX A;  1GWC A;  3C7M A;  1TOF A;  1M9B A;  1SK1 A;  5ECO B;  5A5K A;  2YJH A;  5INY A;  19GS A;  4Q5Q A;  2QGV A;  5E4W A;  3LOR A;  2I1U A;  2XBQ A;  4KH7 A;  2H6Y A;  4KDX A;  3UOM A;  4BA7 A;  1HNB A;  2MZC A;  1ERU A;  1A8L A;  3CTF A;  1YZX A;  2PMT A;  2H73 A;  1XWK A;  5G5E A;  1YKC A;  2QSI A;  2IMK A;  2YWI A;  4LL4 B;  4J2F A;  3IC4 A;  4TXO A;  5G30 A;  3BCK A;  4TVE A;  4EE0 A;  3KP8 A;  3PGT A;  4HU9 A;  4MJB A;  1K0B A;  5COH A;  3CSI A;  3D21 A;  4ECC A;  5DDL A;  3F6F A;  4EL1 A;  2B6M A;  3GV1 A;  3HDC A;  3KH7 A;  3M8N A;  4GLT A;  2H1B A;  4L8E A;  2DSA A;  1X9S B;  2H1D A;  4K0G A;  1B48 A;  2TRX A;  2H70 A;  3TKS E;  2IL3 A;  5ECN B;  2XC2 A;  3TJJ A;  3VK9 A;  3FRC A;  2FWH A;  1T7P B;  4TR0 A;  1IYI A;  2WB9 A;  2KHP A;  1KNG A;  2YV9 A;  3ME8 A;  2CA8 A;  4YH2 A;  1XWG A;  5AIX A;  2L6D A;  2YWN A;  4PGT A;  4KB3 A;  2L4C A;  1OKT A;  1O6J A;  4KUN A;  4XTS A;  2TRC P;  3D5J A;  3VI7 A;  3AY8 A;  3J7Y k;  2B5E A;  1TKD B;  2P5Q A;  2IPA A;  4ML1 A;  5ELA A;  1SEN A;  1QGV A;  2FHE A;  3US3 A;  4XS4 B;  5ECQ B;  1GSF A;  4HI7 A;  3VLN A;  1WJK A;  2H0I A;  3TKP A;  2KP1 A;  2RUF A;  2AYT A;  1GSU A;  4ZIJ A;  4WXT A;  2CQ9 A;  1ERV A;  3I9V 2;  5A4V A;  2RM5 A;  2TIR A;  3TCO A;  1M2D A;  2DJJ A;  2F8A A;  2VAF A;  3UBK A;  3SBC A;  4YQV A;  3GKN A;  2ZCT A;  2M46 A;  1ZZY A;  2GSR A;  1EP7 A;  1AQX A;  1WOU A;  3FHK A;  3KCM A;  1SJZ A;  2OAC A;  2GQM A;  4KDU A;  2GT5 A;  4OFT A;  1Z9H A;  1PL2 A;  4IQA A;  4IKH A;  2H8L A;  2X8G A;  3CRT A;  3M3M A;  1SK2 A;  5F0G A;  5ID2 A;  1U3A A;  2OKA A;  4PX1 A;  2H72 A;  3EMX A;  4K8M A;  2MMZ A;  1K0D A;  3F6D A;  3HA9 A;  5IM9 A;  1FO5 A;  5CYY A;  1WIK A;  1X0R A;  4KSO A;  3GST A;  4NHW A;  4G2E A;  1T8E B;  1GSQ A;  4HQZ A;  5CO3 A;  2WS2 A;  3Q18 A;  4KDY A;  4K0N A;  4F9Z A;  3MNG A;  1U6T A;  2F9S A;  1VGL A;  4I6X A;  1TRW A;  1PRX A;  4I2T A;  3GUS A;  2DIY A;  4ECB A;  1A0R P;  3WYW A;  5IMC A;  2VM2 A;  1ACV A;  3UJ1 A;  5ABR A;  1MEK A;  5DAL B;  4GWR A;  3KXO A;  3O3T A;  3LJR A;  1C72 A;  1R26 A;  3WGD A;  4MAB A;  3WT2 A;  5IPG A;  4DSS A;  1M0U A;  1WMJ A;  3HHV A;  3LSZ A;  2O85 A;  1VF4 A;  2D2Z A;  4V2L A;  1KTE A;  1DUG A;  4F03 A;  5HFK A;  5IQY A;  2XHF A;  3EU3 A;  2PBJ A;  1V2A A;  3NZN A;  1QUW A;  1WPI A;  1DE1 A;  3VFI A;  4G19 A;  4WR4 A;  1JFU A;  2VM1 A;  2NPB A;  1A2M A;  4X0X A;  1G7E A;  5A4W A;  3UAP A;  2R4V A;  2P5R A;  1X5D A;  2WGR A;  4EC0 A;  1AQV A;  4RUV A;  3DKS A;  2FGX A;  4TR1 B;  2LV3 A;  2H0G A;  4GXZ A;  4YQM A;  2CZ2 A;  2HRN A;  3EVI A;  3RDW A;  5GZZ B;  2LEG A;  3D6I A;  3HZ8 A;  4ZBD A;  3G7I A;  3TJF A;  1TK5 B;  3R2Q A;  1XWC A;  3HKR A;  3M9K A;  1M2B A;  1XWA A;  3H79 A;  3TOT A;  2OBK A;  4MF7 A;  4ZBB A;  4DEJ A;  2G2Q A;  3Q6O A;  2AUV A;  1XPV A;  17GS A;  2MBT A;  4N0Z A;  4I97 A;  3DWV A;  3GNJ A;  3GTU A;  4MJA A;  2HZE B;  3KJY A;  2NTO A;  2QC7 A;  1B4Q A;  3KGK A;  2HI7 A;  2LJK A;  2ON7 A;  1OC8 A;  3FEU A;  4IGJ A;  1T3B A;  4TN8 A;  4LMV A;  2VIM A;  3P8W A;  5DQY A;  5JWR B;  4NAX A;  3A2V A;  3KMN A;  18GS A;  3K8N A;  1ZCP A;  4V2M A;  5GST A;  3TKS C;  2CVK A;  4NPB A;  1OC9 A;  1GLQ A;  4N10 A;  3ERG A;  1TRV A;  4ZB6 A;  2WFC A;  2CX4 A;  5ECS A;  2CVB A;  3IOS A;  2A2R A;  1Y6E A;  2AV4 A;  2K6V A;  3RHC A;  1B9Y C;  2P31 A;  1VF3 A;  4BL7 A;  1PMT A;  2IWT A;  3BOA A;  3IE3 A;  2H1G A;  1FOV A;  2C1Y A;  1NSW A;  2GS3 A;  5DVB A;  4TXV A;  1ZL9 A;  5F07 A;  2GTU A;  1X5E A;  3QAV A;  1WP0 A;  2VL9 A;  2LS5 A;  2E7P A;  4IVF A;  3FYG A;  3Q74 A;  2AJQ B;  3FKF A;  5D9T A;  3IAM 2;  2I4A A;  1F3B A;  2N5F A;  3ZLP A;  1O7U A;  3QAW A;  3KMO A;  2FLS A;  2WJU A;  3ZZX A;  1OKD A;  5JCG A;  4XIH A;  4OFN A;  3VI5 A;  1TK0 B;  2LTK A;  1YKA A;  3IBH A;  2JAD A;  3LQ7 A;  2HZF A;  3H8Q A;  4MH2 A;  1K0N A;  5LNK e;  1X5C A;  2IMI A;  5C04 A;  4XRD A;  5LD0 A;  3ZMK A;  3CBU A;  1RQM A;  1EGO A;  3WT1 A;  4CHS A;  1Z6M A;  2PU9 C;  3GH6 A;  2DBC A;  5EVO A;  2X99 A;  4KSM A;  5B6M A;  3GL3 A;  2VCT A;  2J23 A;  5HR1 A;  3CTG A;  5GAP D;  1W4V A;  2HXK A;  1XW5 A;  1SL2 B;  3GX0 A;  22GS A;  5D73 A;  4ML6 A;  1URM A;  4WBR D;  3TJG A;  4N30 A;  1K0C A;  1SL1 B;  3FR6 A;  3GKX A;  1KEB A;  4GF0 A;  3FZA A;  1OE7 A;  2CAQ A;  2M72 A;  1T4Y A;  2C4J A;  1AUC A;  2C3T A;  3LXT A;  1N2A A;  5IMZ A;  2F51 A;  1H75 A;  4FIW A;  2GQK A;  5IIZ A;  1SJ6 A;  4GST A;  3HJP A;  3RPN A;  2JU5 A;  2YV7 A;  3DRN A;  2GGT A;  5IMF A;  3DGQ A;  4POK A;  1JZW A;  5KN1 A;  1TI3 A;  1EGR A;  1DBY A;  2H76 A;  2C80 A;  2G0F A;  5CRG A;  3MSZ A;  4XHM A;  4XS1 A;  4POL A;  3WGE A;  2DC5 A;  4OO5 A;  2X64 A;  6GSS A;  4TR3 A;  2CAI A;  1YQ1 A;  1ERW A;  2V6K A;  3G7Y A;  3E0U A;  4OCE A;  2E2G A;  2PVO C;  4HEA 2;  2HSY A;  1SK0 A;  3BJ5 A;  2V2G A;  4OD7 A;  1O8W A;  5AN1 A;  2H66 A;  4MZW A;  3ZFL A;  5KEJ A;  2FWF A;  1SD8 A;  4OFM A;  1S3A A;  3APS A;  1F9M A;  4ZL7 A;  4GRF A;  3D22 A;  2GZZ A;  2DLX A;  4PXO A;  2H30 A;  4TXO B;  3GUR A;  1CQH A;  4MK3 A;  1S3C A;  2GSQ A;  4PUR A;  4ZL8 A;  5B8A A;  4O5R A;  1MDK A;  2J9H A;  2KP2 A;  2PWJ A;  3QPM A;  1MDI A;  5G1L A;  2YWM A;  2IFQ A;  2NVL A;  2V32 A;  5J41 A;  3I6A A;  2OE0 A;  1H4O A;  2VCQ A;  3ME7 A;  2OE1 A;  4K2D A;  4CW9 A;  2JSZ A;  4N0V A;  5L71 A;  4KAE A;  1JZO A;  2KUC A;  1WRY A;  4LA1 A;  3C1R A;  1VF2 A;  1BQ7 A;  4IS0 A;  3J7Y b;  3IRA A;  5ECM B;  1UA5 A;  1XBS A;  3M9J A;  4IN0 A;  1G6W A;  5H5Q A;  4O32 A;  4IBP A;  4BWQ A;  4HOJ A;  2BMX A;  4GSN A;  1Z7P A;  4NV5 A;  1HYU A;  2PUK C;  2R2J A;  2O8V B;  5AIV A;  1SKR B;  4ILF A;  3CSJ A;  2LQQ A;  3F63 A;  2NDO A;  1G7O A;  2X8H A;  3FZ5 A;  4E8H A;  2KOK A;  3MAK A;  5CP1 A;  3UIW A;  1V9W A;  1UVZ A;  4MPF A;  3GKM A;  2FWE A;  6GSW A;  1GUK A;  1TDI A;  5DBQ A;  5C00 A;  3H4K A;  2A4V A;  3RHB A;  2FNO A;  4NHZ A;  5F06 A;  5EPF A;  1HD2 A;  1LU4 A;  1JLV A;  4IHU A;  1XCC A;  4ZIL A;  1TU7 A;  2CV4 A;  1N8J A;  1GUH A;  2O89 A;  2DJ1 A;  1DE2 A;  2VLT A;  1GSD A;  4L5O A;  4ZB8 A;  3P7X A;  6GSX A;  20GS A;  5JCW A;  2LNT A;  1V40 A;  3TGZ A;  1AQW A;  2FA8 A;  4PNF A;  3IK9 A;  3EE2 A;  2OA7 A;  4MF6 A;  3KZQ A;  3A2X A;  5H5R A;  4KND A;  4FYB A;  1F3A A;  1B4P A;  1I5G A;  4KX4 A;  1SYX A;  1YEP A;  2WRT A;  2DJ3 A;  2YNX A;  2H19 A;  2VCZ A;  3JCM L;  1PKZ A;  5ID2 B;  1GTB A;  1ILO A;  3FZ9 A;  5HFG A;  2BJX A;  3UAR A;  1ON4 A;  2GLR A;  2I81 A;  1DSB A;  2GZY A;  3D4M A;  3GFK A;  4EVM A;  1I9D A;  2LRT A;  2REM A;  3TRP A;  1G0T A;  2C8U A;  6GSU A;  1GNE A;  2CX3 A;  4LLR A;  3M0F A;  1QXH A;  3LYP A;  5CRD A;  2H75 A;  1GP1 A;  4Q5N A;  1GSY A;  3I69 A;  2HSH A;  1GUM A;  2V6O A;  4IJI A;  2LST A;  2GDR A;  3F4S A;  4MMM A;  2PPT A;  2GSS A;  4WEY A;  4MF5 A;  3GA4 A;  2FY6 A;  1K0O A;  1XOB A;  2C0G A;  5GAN D;  2RII A;  3D0Z A;  4H86 A;  2E2M A;  3Q19 A;  2ES7 A;  5IO0 A;  6GSV A;  4DSS B;  2BTO T;  2RUE A;  1TK8 B;  4G10 A;  3GX8 A;  2R37 A;  4WF5 A;  5KN0 A;  5IMA A;  1BED A;  3KD0 A;  2YJ7 A;  1SD9 A;  1GH2 A;  3LEF A;  3UL3 A;  1PD2 1;  3APQ A;  3F4T A;  4K7I A;  1OYJ A;  2H0H A;  3L4N A;  2FA4 A;  1NHO A;  11GS A;  1V57 A;  3DML A;  2LQO A;  4WBJ A;  4XS6 A;  1NHY A;  5J9C A;  5D9V A;  4HS1 A;  3IAS 2;  2AAW A;  3ZVJ A;  1SJI A;  3HY2 A;  2V41 A;  4N11 A;  2CZ3 A;  1UN2 A;  4WF4 A;  3F4R A;  4EXJ A;  1TRU A;  1KBN A;  4ISD A;  1ZOF A;  2H71 A;  3DEX A;  1YY7 A;  5JCU A;  2VCX A;  4V2N A;  2K8S A;  4G9H A;  1O73 A;  1AAZ A;  3ZML A;  3DIE A;  1OC3 A;  3WD6 A;  3UVT A;  1MD4 A;  3H93 A;  4HDE A;  4MLY A;  1A2L A;  4MZB A;  5D8I A;  5DJM A;  5B6N A;  3HVS A;  1F2E A;  3GTU B;  2R3X A;  1FAA A;  2HE3 A;  1ZMA A;  3EMP A;  5HR0 A;  3ISO A;  2VL2 C;  1FVK A;  4KA0 A;  1EP8 A;  4MA9 A;  3ZL5 A;  1Q98 A;  4X1U A;  4QL7 A;  2MBS A;  3DD3 A;  1GSE A;  1V58 A;  1OC9 B;  4FO5 A;  4E8E A;  4HU7 A;  2LJR A;  5IO2 A;  4PNG A;  1K0A A;  2CVD A;  1MD3 A;  1W89 A;  1XW9 A;  3NOF A;  1BAY A;  1BX9 A;  2IME A;  1JHB A;  4F0C A;  2DJ2 A;  2ZNM A;  12GS A;  2AB6 A;  3BCI A;  2GQL A;  5DCG A;  1GRX A;  2Z9S A;  4HJM A;  5H5S A;  2B7K A;  4EKZ A;  2OAD A;  4KGI A;  4FYC A;  3QOU A;  5DAK B;  1TW9 A;  4EUY A;  5KN2 A;  5D9X A;  2OBI A;  5D96 A;  3LYK A;  3TB2 A;  4F2I A;  1TI1 A;  2JL4 A;  3GSS A;  4CDO A;  5ECI B;  3NIV A;  2C0E A;  5FT3 A;  1GTI A;  1HQO A;  5FWG A;  2YZH A;  4TOP A;  3QCP A;  1PQN A;  1JLW A;  3TUE A;  1F6M C;  4PUF C;  2LRN A;  2R6K A;  2L6C A;  4YAP A;  4GQC A;  1OAZ A;  5CRH A;  1O8X A;  2IMD A;  5D93 A;  1NW2 A;  2L5L A;  1T4Z A;  3KP9 A;  1XW6 A;  3L9S A;  3A3T A;  4ZL9 A;  4WET A;  1FB6 A;  1MTC A;  4YAV A;  5ECH B;  3V1W A;  2VO4 A;  1PSQ A;  3UMA A;  4Q5R A;  3GYK A;  5ELG A;  4XCS A;  1Z3E A;  3TKR A;  1FW1 A;  3VWV A;  2VCV A;  4EDZ A;  4ULX A;  1EOH A;  4AGS A;  1THO A;  5LCZ A;  3TJK A;  3IPZ A;  2HNL A;  3RBT A;  3EUR A;  5IOX A;  4I2U A;  2PN8 A;  5HFI A;  3IDV A;  1O85 A;  2HRF A;  4PUA A;  2VL2 A;  1PGT A;  5G31 A;  4JED A;  9GSS A;  5DQS A;  5J3R A;  1T00 A;  4D73 A;  10GS A;  14GS A;  1Y25 A;  3VPQ A;  5CAX A;  1XXU A; 
#chains in the Genus database with same CATH topology
 4F0B A;  2N5B A;  2LJA A;  1TJD A;  3C73 A;  3DVX A;  3RPP A;  3QFB C;  4NXI A;  2HYX A;  5DJL A;  3BD2 A;  1QK8 A;  4IQ1 A;  2NBS A;  4RI7 A;  1A24 A;  1U87 A;  2QA2 A;  2H74 A;  2L59 A;  1E2Y A;  3HCZ A;  3TKS A;  4TRX A;  3HYP A;  2VOC A;  3QMX A;  3VWU A;  5D9W A;  5EL8 A;  2JZR A;  3KEB A;  4DSQ A;  2HLS A;  3QDN A;  4NV2 A;  4F82 A;  1Z7R A;  2DJ0 A;  4PQH A;  3GH9 A;  5B8B A;  7GSS A;  1T1V A;  5G2Z A;  2XPD A;  1F37 A;  3IC8 A;  1B8X A;  3IR4 A;  3A2W A;  4I8B A;  2A2P A;  4IP1 A;  3TJB A;  4EO3 A;  3W6G A;  1BJX A;  5A4U A;  2CT6 A;  3L9U A;  3IV4 A;  1M2A A;  1GTA A;  4V1A g;  3CXG A;  3F3R A;  2IFQ B;  3MDK A;  1CQG A;  1XVW A;  1FVJ A;  4GSS A;  2VCW A;  4L0W A;  1TU8 A;  3FR9 A;  4MH3 A;  3UBL A;  2B1K A;  5IMD A;  4V1A p;  3IXR A;  2MMN A;  1XIY A;  2B5Y A;  3HXS A;  4HUA A;  1Z5Y E;  3ERF A;  3M1G A;  1OVN A;  3QAG A;  4BVX A;  2LUS A;  1M99 A;  8GSS A;  4ECJ A;  4K9Z A;  4ZB9 A;  1ABA A;  3L0H A;  3CQF A;  3KTB A;  4OWY A;  5EY6 A;  4X43 A;  4P3Y B;  1R7H A;  4KCE A;  2C3Q A;  3F9U A;  1ST9 A;  2C0D A;  4JBB A;  2QKE A;  1R4W A;  1PN9 A;  4XRA A;  3ZYW A;  2PVQ A;  1AW9 A;  2F3M A;  1JZD A;  2R0C A;  1FB0 A;  2VL3 A;  3N5O A;  4Z7X A;  2K8V A;  4IW9 A;  2C3N A;  2DKH A;  4ICY A;  5ECR B;  5HR3 A;  1M7T A;  5CNW A;  3ED3 A;  3KH9 A;  2LNS A;  2YZU A;  4GCI A;  5IOW A;  1XVQ A;  3A5W A;  3P90 A;  6GSY A;  5AGY A;  3EYT A;  2PER A;  5CRW A;  4NMU A;  2X8C A;  4OCF A;  1X9W B;  1R5A A;  1O81 A;  3QFA C;  1PX7 A;  1JZR A;  2R5G A;  4ZBA A;  3ZVJ D;  2XBI A;  1XWB A;  3ZFB A;  3SWL A;  1VRS D;  3FMW A;  4ID0 A;  2PGT A;  3F8U A;  2XPE A;  1ZYQ B;  2A4H A;  4TW5 A;  3FZ4 A;  2DIZ A;  1EEJ A;  1PX6 A;  2WZ9 A;  1V98 A;  1USB A;  2H6Z A;  4JE1 A;  3KM6 A;  1PL1 A;  3TRQ A;  1K0M A;  2MMO A;  1ZGN A;  5J9B A;  2K9F A;  1PA3 A;  1HNC A;  3ZRD A;  1QQ2 A;  4IJ3 A;  2JZS A;  4HZ4 A;  2HFD A;  4DVC A;  1RW1 A;  2YN1 A;  1VF1 A;  4MPG A;  4EDY A;  2OJL A;  4POM A;  4XS4 A;  4RQX A;  1J0F A;  2M80 A;  4O92 A;  3VPT A;  3BBY A;  3F0I A;  4L5L A;  3ZTL A;  1YEX A;  2QA1 A;  2RLI A;  1K3L A;  3H1N A;  1FHE A;  4Z2T A;  3DVW A;  3GL5 A;  4ZXG A;  4K7N A;  1ML6 A;  4WKW A;  4LL1 B;  1EV4 A;  1XZO A;  4MJC A;  3EC3 A;  3LFL A;  2K18 A;  5G5F A;  1S3D A;  2JZT A;  1XOA A;  5E59 A;  3TDG A;  4QQ7 A;  2VUP A;  5J4U A;  4EF0 A;  2WUL A;  4AF2 A;  2ZUP A;  1AIU A;  1BG5 A;  3U5R E;  1XFL A;  2YPM A;  1E6B A;  2V1M A;  2LRC A;  4RQR A;  5IMV A;  1LBK A;  3MWH A;  4K1F A;  3HJM A;  5B7C A;  1GTU A;  4BPY A;  5KOW A;  3FK8 A;  2O7K A;  2VLV A;  1TTZ A;  1SKW B;  2OE3 A;  3O76 A;  1FG4 A;  1QMV A;  3FY7 A;  1TP9 A;  1Z6N A;  1A8Y A;  1GNW A;  5JWQ B;  3ZIJ A;  3KTL A;  4HJ2 A;  3G7J A;  1THX A;  5IPH A;  5BRT A;  1ZYN A;  3IA1 A;  1SKS B;  4KCA A;  4NWY A;  5HQP A;  2MYG A;  3LG6 A;  3WGX A;  3ZIT A;  2FUG 2;  1B9X C;  3GN3 A;  1UC7 A;  4BWS A;  1PKW A;  4BVY A;  1YF1 A;  4KE3 A;  3TRX A;  3C71 A;  2HT9 A;  5DAL A;  2E0Q A;  2I9H A;  3PIN A;  2YWO A;  4CY8 A;  13GS A;  5G1K A;  1G6Y A;  3LWA A;  3OR5 A;  1TXX A;  4G0I A;  2JAC A;  3E3E A;  4PQI A;  3PH9 A;  4AJ6 A;  1TRS A;  2VLU A;  1EEM A;  1HNA A;  4TKY A;  3VWX A;  1YF0 A;  2VD1 A;  1YDK A;  3HD5 A;  2FD3 A;  4JR4 A;  4HZ2 A;  3QD9 A;  4FYU A;  1J08 A;  4GQF A;  3ERW A;  5ECK B;  4PQ1 A;  5KN3 A;  2F8F A;  2IJY A;  3UVH A;  4GTU A;  1LJR A;  3C1S A;  4TR1 A;  4KW6 A;  2ON5 A;  1R5P A;  1GL8 A;  4MP4 A;  3W8S A;  3W8J A;  3EU4 A;  1ERT A;  3VWW A;  1EZK A;  5JWO B;  3C8E A;  1OE8 A;  1SL0 B;  2DJK A;  4YQU A;  3G9B A;  3U6V A;  1BYE A;  2FWG A;  5ENU A;  4ECI A;  2IIY A;  3FR3 A;  2R0G A;  2HZE A;  5DCH A;  3LXZ A;  5HR2 A;  2KLX A;  3CMI A;  2GT6 A;  2WDU A;  3GHA A;  2H1A A;  3CSH A;  2GZP A;  4DSR A;  1QFN A;  5KOX A;  2L57 A;  3D4T A;  4TR4 A;  4L0U A;  3APO A;  1A0F A;  1Q4J A;  4JU5 A;  2GST A;  5FHI A;  4AJ8 A;  2EIR A;  3GKK A;  2X4A A;  2MMA A;  4FH8 A;  3LGC A;  2O87 A;  2N5A A;  4RI6 A;  5BMU A;  4MDC A;  4Q5F A;  3TKQ A;  2DKI A;  3CYN A;  3GMF A;  2WCI A;  5DAK A;  3TOU A;  1GUL A;  1U88 A;  2YCD A;  4JZQ A;  1A23 A;  1WWJ A;  3ZIV A;  1AC1 A;  4K6X A;  2DML A;  2L5O A;  2B5X A;  1RK4 A;  4O5U A;  3CRU A;  2AHE A;  4MCU A;  4J56 E;  3L9V A;  3DYR A;  4QL9 A;  4I5Q A;  2HRK A;  3P2A A;  2IMF A;  16GS A;  1A2J A;  2IN3 A;  1AXD A;  5F05 A;  3S9F A;  4IEL A;  4JRR A;  5J5N A;  4MZC A;  1EOG A;  3E9J B;  2RM6 A;  4POB A;  2LKU A;  4O7H A;  3ZRE A;  4AJ7 A;  3I43 A;  4D73 B;  1SU9 A;  3L78 A;  4LMW A;  2EIO A;  4HQS A;  4OMV A;  2H01 A;  3KIJ A;  1GLP A;  2VD0 A;  4K7O A;  3RAZ A;  4IP6 A;  4MJE A;  4JR6 A;  3IHQ A;  1NM3 A;  3HVV A;  2YP6 A;  4WR5 A;  5ECL B;  3O6T A;  1K3O A;  5GSS A;  1WE0 A;  2C0F A;  2P0G A;  5AIS A;  3EIN A;  2GVP A;  1ZYE A;  2I3Y A;  1MDJ A;  2L4Q A;  1M9A A;  3VUR A;  6GST A;  4J57 E;  1X9M B;  2FCH A;  1YJ6 A;  3UEM A;  3HVX A;  4OO4 A;  3DXB A;  2B1L A;  3QR6 A;  2B3S A;  2DMM A;  3IK7 A;  1SYR A;  3F3Q A;  1IYH A;  4ACS A;  3GIX A;  5ECP B;  3GRX A;  5F8B A;  2B7J A;  3EWL A;  1GSS A;  1K3Y A;  1EV9 A;  2JSY A;  2YOI A;  5CRE A;  2ALB A;  2A2S A;  1J9B A;  2YAN A;  3N9J A;  2EC4 A;  1U3I A;  3PR8 A;  3FW2 A;  2EIQ A;  3HJO A;  4BVX B;  3HZ4 A;  2H6X A;  1EWX A;  1GWC A;  3C7M A;  1TOF A;  1M9B A;  1SK1 A;  5ECO B;  5A5K A;  2YJH A;  5INY A;  19GS A;  4Q5Q A;  2QGV A;  5E4W A;  3LOR A;  2I1U A;  2XBQ A;  4KH7 A;  2H6Y A;  4KDX A;  3UOM A;  4BA7 A;  1HNB A;  2MZC A;  1ERU A;  1A8L A;  3CTF A;  1YZX A;  2PMT A;  2H73 A;  1XWK A;  5G5E A;  1YKC A;  2QSI A;  2IMK A;  2YWI A;  4LL4 B;  4J2F A;  3IC4 A;  4TXO A;  5G30 A;  3BCK A;  4TVE A;  4EE0 A;  3KP8 A;  3PGT A;  4HU9 A;  4MJB A;  1K0B A;  4MNN A;  5COH A;  3CSI A;  3D21 A;  4ECC A;  5DDL A;  3F6F A;  4K5S A;  4CY6 A;  4EL1 A;  2B6M A;  3GV1 A;  3HDC A;  3KH7 A;  3M8N A;  4GLT A;  2H1B A;  4L8E A;  2DSA A;  1X9S B;  2H1D A;  4K0G A;  1B48 A;  2TRX A;  2H70 A;  3TKS E;  2IL3 A;  5ECN B;  2XC2 A;  3TJJ A;  3VK9 A;  3FRC A;  2FWH A;  1T7P B;  4TR0 A;  1IYI A;  2WB9 A;  2KHP A;  1KNG A;  2YV9 A;  1PN0 A;  3ME8 A;  2CA8 A;  4YH2 A;  1XWG A;  5AIX A;  2L6D A;  2YWN A;  4PGT A;  4KB3 A;  2L4C A;  1OKT A;  1O6J A;  4KUN A;  4XTS A;  2TRC P;  3D5J A;  3VI7 A;  3EPT A;  3AY8 A;  3J7Y k;  2B5E A;  1TKD B;  2P5Q A;  2IPA A;  3MIX A;  4ML1 A;  5ELA A;  1SEN A;  1QGV A;  2FHE A;  3US3 A;  4XS4 B;  5ECQ B;  1GSF A;  4HI7 A;  3VLN A;  1WJK A;  2H0I A;  3TKP A;  4Z2U A;  2KP1 A;  2RUF A;  2AYT A;  1GSU A;  4ZIJ A;  4WXT A;  2UZ8 A;  2CQ9 A;  1ERV A;  3I9V 2;  5A4V A;  2RM5 A;  2TIR A;  3TCO A;  1M2D A;  2DJJ A;  2F8A A;  2VAF A;  3UBK A;  3SBC A;  4YQV A;  3GKN A;  2ZCT A;  2M46 A;  1ZZY A;  2GSR A;  1EP7 A;  1AQX A;  1WOU A;  3FHK A;  3KCM A;  1SJZ A;  2OAC A;  2GQM A;  4KDU A;  2GT5 A;  4OFT A;  1Z9H A;  1PL2 A;  4IQA A;  4IKH A;  2H8L A;  2X8G A;  3CRT A;  3M3M A;  1SK2 A;  5F0G A;  5ID2 A;  1U3A A;  2OKA A;  4PX1 A;  2H72 A;  1FOH A;  2HRA A;  3EMX A;  4K8M A;  2MMZ A;  1K0D A;  3F6D A;  3HA9 A;  5IM9 A;  1FO5 A;  5CYY A;  1WIK A;  1X0R A;  4KSO A;  3GST A;  4NHW A;  4G2E A;  1T8E B;  1GSQ A;  4HQZ A;  5CO3 A;  2WS2 A;  3Q18 A;  4KDY A;  4K0N A;  4F9Z A;  3MNG A;  1U6T A;  2F9S A;  1VGL A;  4I6X A;  1TRW A;  1PRX A;  4I2T A;  3GUS A;  2DIY A;  4ECB A;  1A0R P;  3WYW A;  4BVY B;  5IMC A;  2VM2 A;  1ACV A;  3UJ1 A;  5ABR A;  1MEK A;  5DAL B;  4GWR A;  3KXO A;  3O3T A;  3LJR A;  1C72 A;  1R26 A;  3WGD A;  4MAB A;  3WT2 A;  5IPG A;  4DSS A;  1PFO A;  1M0U A;  1WMJ A;  3HHV A;  3LSZ A;  2O85 A;  1VF4 A;  2D2Z A;  3LW9 A;  4V2L A;  1KTE A;  1DUG A;  4F03 A;  5HFK A;  5IQY A;  2XHF A;  3EU3 A;  2PBJ A;  1V2A A;  3NZN A;  1QUW A;  1WPI A;  1DE1 A;  3VFI A;  4G19 A;  4WR4 A;  1JFU A;  2VM1 A;  2NPB A;  1A2M A;  4X0X A;  1G7E A;  5A4W A;  3UAP A;  2R4V A;  2P5R A;  1X5D A;  2WGR A;  4EC0 A;  1AQV A;  4RUV A;  3DKS A;  2FGX A;  4TR1 B;  2LV3 A;  2H0G A;  4GXZ A;  4YQM A;  2CZ2 A;  2HRN A;  3EVI A;  3A5I A;  3RDW A;  5GZZ B;  2LEG A;  3D6I A;  3HZ8 A;  4ZBD A;  3G7I A;  3TJF A;  1TK5 B;  3R2Q A;  1XWC A;  3HKR A;  4YKF A;  3M9K A;  1M2B A;  4HSC X;  1XWA A;  3H79 A;  3TOT A;  2OBK A;  4MF7 A;  4ZBB A;  4DEJ A;  2G2Q A;  3Q6O A;  2AUV A;  1XPV A;  17GS A;  2MBT A;  4N0Z A;  4I97 A;  3DWV A;  3GNJ A;  3GTU A;  4MJA A;  2HZE B;  3KJY A;  2NTO A;  2QC7 A;  1B4Q A;  3KGK A;  2HI7 A;  2LJK A;  2ON7 A;  1OC8 A;  3FEU A;  4IGJ A;  1T3B A;  4TN8 A;  4LMV A;  2VIM A;  3P8W A;  5DQY A;  5JWR B;  4NAX A;  3A2V A;  3KMN A;  18GS A;  3K8N A;  1ZCP A;  4V2M A;  5GST A;  3TKS C;  2CVK A;  4NPB A;  1OC9 A;  1GLQ A;  4N10 A;  3ERG A;  1TRV A;  4ZB6 A;  2WFC A;  2CX4 A;  5ECS A;  2CVB A;  3IOS A;  2A2R A;  1Y6E A;  2AV4 A;  2K6V A;  3RHC A;  1B9Y C;  2P31 A;  1VF3 A;  4BL7 A;  1PMT A;  2IWT A;  3BOA A;  3IE3 A;  2H1G A;  1FOV A;  2C1Y A;  1NSW A;  2GS3 A;  5DVB A;  4TXV A;  1ZL9 A;  5F07 A;  2GTU A;  1X5E A;  3QAV A;  1WP0 A;  2VL9 A;  2LS5 A;  2E7P A;  4IVF A;  3FYG A;  3Q74 A;  2AJQ B;  3FKF A;  5D9T A;  3IAM 2;  2I4A A;  1F3B A;  2N5F A;  3ZLP A;  1O7U A;  3R3E A;  3QAW A;  3KMO A;  2FLS A;  2WJU A;  3ZZX A;  1OKD A;  5JCG A;  4XIH A;  4OFN A;  3VI5 A;  1TK0 B;  2LTK A;  1YKA A;  3IBH A;  2JAD A;  3LQ7 A;  2HZF A;  3H8Q A;  4MH2 A;  1K0N A;  5LNK e;  1X5C A;  2IMI A;  5C04 A;  4XRD A;  5LD0 A;  3ZMK A;  3CBU A;  1RQM A;  1EGO A;  3WT1 A;  4CHS A;  1Z6M A;  2PU9 C;  3GH6 A;  2DBC A;  5EVO A;  2X99 A;  4KSM A;  5B6M A;  3GL3 A;  2VCT A;  2J23 A;  5HR1 A;  3CTG A;  5GAP D;  1W4V A;  2HXK A;  1XW5 A;  1SL2 B;  3GX0 A;  22GS A;  5D73 A;  4ML6 A;  1URM A;  4WBR D;  3TJG A;  4N30 A;  1K0C A;  1SL1 B;  3FR6 A;  3GKX A;  1KEB A;  4GF0 A;  3FZA A;  1OE7 A;  2CAQ A;  2M72 A;  1T4Y A;  4FQU A;  2C4J A;  1AUC A;  2C3T A;  3LXT A;  1N2A A;  5IMZ A;  2F51 A;  1H75 A;  4FIW A;  2GQK A;  5IIZ A;  1SJ6 A;  4GST A;  3HJP A;  3RPN A;  2JU5 A;  2YV7 A;  3DRN A;  2GGT A;  5IMF A;  3DGQ A;  4PTS A;  1S3R A;  4POK A;  1JZW A;  5KN1 A;  1TI3 A;  1EGR A;  1DBY A;  2H76 A;  2C80 A;  2G0F A;  5CRG A;  3IHG A;  3MSZ A;  4XHM A;  4XS1 A;  4POL A;  3WGE A;  2DC5 A;  4OO5 A;  2X64 A;  6GSS A;  1M3I A;  4TR3 A;  2CAI A;  1YQ1 A;  1ERW A;  2V6K A;  3G7Y A;  3E0U A;  4OCE A;  2E2G A;  2PVO C;  4G0K A;  4HEA 2;  2HSY A;  1SK0 A;  3BJ5 A;  2V2G A;  4OD7 A;  1O8W A;  5AN1 A;  2H66 A;  4MZW A;  3ZFL A;  5KEJ A;  2FWF A;  1SD8 A;  4OFM A;  1S3A A;  3APS A;  1F9M A;  4ZL7 A;  4GRF A;  3D22 A;  2GZZ A;  2DLX A;  4PXO A;  2H30 A;  4TXO B;  3GUR A;  1CQH A;  4MK3 A;  1S3C A;  2GSQ A;  4PUR A;  4ZL8 A;  5B8A A;  4O5R A;  1MDK A;  2J9H A;  2KP2 A;  2PWJ A;  4G0L A;  3QPM A;  1MDI A;  5G1L A;  2YWM A;  2IFQ A;  1XG8 A;  2NVL A;  2V32 A;  5J41 A;  3I6A A;  2OE0 A;  1H4O A;  2VCQ A;  3ME7 A;  2HSM A;  2OE1 A;  4K2D A;  4CW9 A;  2JSZ A;  4N0V A;  5L71 A;  4KAE A;  1JZO A;  2KUC A;  1WRY A;  4LA1 A;  3C1R A;  1VF2 A;  1BQ7 A;  4IS0 A;  3J7Y b;  3IRA A;  5ECM B;  1ZYP A;  1UA5 A;  1XBS A;  3M9J A;  4IN0 A;  1G6W A;  5H5Q A;  4O32 A;  4IBP A;  4BWQ A;  4HOJ A;  2BMX A;  4GSN A;  1Z7P A;  4NV5 A;  1HYU A;  2PUK C;  2R2J A;  2O8V B;  5AIV A;  1SKR B;  2R0P A;  4ILF A;  3CSJ A;  2LQQ A;  3F63 A;  2NDO A;  1G7O A;  2X8H A;  3FZ5 A;  4E8H A;  2KOK A;  3MAK A;  5CP1 A;  3UIW A;  1V9W A;  1UVZ A;  4MPF A;  3GKM A;  2FWE A;  6GSW A;  1GUK A;  1TDI A;  5DBQ A;  5C00 A;  4KF9 A;  4K5R A;  3H4K A;  2A4V A;  3RHB A;  2FNO A;  4NHZ A;  3HVN A;  5F06 A;  4BIK A;  5EPF A;  1HD2 A;  1LU4 A;  1JLV A;  4IHU A;  1XCC A;  4ZIL A;  1TU7 A;  2CV4 A;  1N8J A;  1GUH A;  2O89 A;  2DJ1 A;  3MYD A;  1DE2 A;  2VLT A;  1GSD A;  4L5O A;  4ZB8 A;  3P7X A;  6GSX A;  20GS A;  5JCW A;  2LNT A;  1V40 A;  3TGZ A;  1AQW A;  2FA8 A;  4PNF A;  3IK9 A;  3EE2 A;  2OA7 A;  4MF6 A;  3KZQ A;  3A2X A;  5H5R A;  4KND A;  4FYB A;  1F3A A;  1B4P A;  1I5G A;  4KX4 A;  4K2X A;  1SYX A;  1YEP A;  2WRT A;  2DJ3 A;  2YNX A;  2H19 A;  2VCZ A;  3JCM L;  1PKZ A;  5ID2 B;  1GTB A;  1ILO A;  3FZ9 A;  5HFG A;  2BJX A;  3UAR A;  1ON4 A;  2GLR A;  2I81 A;  1DSB A;  2GZY A;  3D4M A;  3GFK A;  4EVM A;  1I9D A;  2LRT A;  2REM A;  3TRP A;  1G0T A;  2C8U A;  6GSU A;  1GNE A;  2CX3 A;  4LLR A;  3M0F A;  1QXH A;  3LYP A;  5CRD A;  2H75 A;  1GP1 A;  4Q5N A;  1GSY A;  3I69 A;  2HSH A;  1GUM A;  2V6O A;  4IJI A;  2LST A;  2GDR A;  3F4S A;  4EIQ A;  4O5Q A;  4MMM A;  2PPT A;  2GSS A;  4WEY A;  4MF5 A;  3GA4 A;  2FY6 A;  1K0O A;  1XOB A;  2C0G A;  5GAN D;  2RII A;  3D0Z A;  4H86 A;  2E2M A;  3Q19 A;  4USS A;  2ES7 A;  5IO0 A;  6GSV A;  4DSS B;  2BTO T;  2RUE A;  1TK8 B;  4G10 A;  3GX8 A;  2R37 A;  4WF5 A;  5KN0 A;  5IMA A;  1BED A;  3KD0 A;  2YJ7 A;  1SD9 A;  1GH2 A;  3LEF A;  3UL3 A;  1PD2 1;  3APQ A;  3F4T A;  4K7I A;  1OYJ A;  2H0H A;  3L4N A;  2FA4 A;  1NHO A;  11GS A;  1V57 A;  3DML A;  2LQO A;  4WBJ A;  4XS6 A;  1NHY A;  5J9C A;  5D9V A;  4HS1 A;  3IAS 2;  2AAW A;  3ZVJ A;  1SJI A;  3HY2 A;  2V41 A;  4N11 A;  2CZ3 A;  1UN2 A;  4WF4 A;  3F4R A;  4EXJ A;  1TRU A;  1KBN A;  4ISD A;  1ZOF A;  2H71 A;  3DEX A;  1YY7 A;  5JCU A;  2VCX A;  4V2N A;  2K8S A;  4G9H A;  1O73 A;  1AAZ A;  4EIP A;  3ZML A;  3DIE A;  1OC3 A;  3WD6 A;  3UVT A;  1MD4 A;  4YKG A;  3H93 A;  4HDE A;  4MLY A;  1A2L A;  4MZB A;  5D8I A;  5DJM A;  5B6N A;  3HVS A;  1F2E A;  3GTU B;  2R3X A;  1FAA A;  2HE3 A;  1ZMA A;  3EMP A;  5HR0 A;  3ISO A;  2VL2 C;  1FVK A;  4X4J A;  4KA0 A;  1EP8 A;  4MA9 A;  3ZL5 A;  1Q98 A;  4X1U A;  4QL7 A;  2MBS A;  3DD3 A;  1GSE A;  1V58 A;  1OC9 B;  4FO5 A;  4E8E A;  4HU7 A;  2LJR A;  5IO2 A;  4PNG A;  1K0A A;  2CVD A;  1MD3 A;  3PPU A;  1W89 A;  1XW9 A;  3NOF A;  4BL7 B;  1BAY A;  1BX9 A;  2X49 A;  2IME A;  1JHB A;  4F0C A;  2DJ2 A;  2ZNM A;  12GS A;  2AB6 A;  3BCI A;  2GQL A;  5DCG A;  1GRX A;  2Z9S A;  4HJM A;  5H5S A;  2B7K A;  4EKZ A;  2OAD A;  4KGI A;  4FYC A;  3QOU A;  5DAK B;  1TW9 A;  4EUY A;  5KN2 A;  5D9X A;  2OBI A;  5D96 A;  3LYK A;  3TB2 A;  4F2I A;  1TI1 A;  2JL4 A;  3GSS A;  4CDO A;  5ECI B;  3NIV A;  2C0E A;  5FT3 A;  1GTI A;  1HQO A;  5FWG A;  4Z2R A;  2YZH A;  4TOP A;  3QCP A;  1PQN A;  1JLW A;  3TUE A;  1F6M C;  4PUF C;  2LRN A;  2R6K A;  2L6C A;  4YAP A;  4GQC A;  1OAZ A;  5CRH A;  1O8X A;  2IMD A;  5D93 A;  1NW2 A;  2L5L A;  1T4Z A;  3KP9 A;  1XW6 A;  3L9S A;  3A3T A;  4ZL9 A;  4WET A;  1FB6 A;  1MTC A;  4YAV A;  5ECH B;  3V1W A;  2VO4 A;  1PSQ A;  3UMA A;  4A5P A;  4Q5R A;  3GYK A;  5ELG A;  4XCS A;  1Z3E A;  3TKR A;  1FW1 A;  3VWV A;  2VCV A;  4EDZ A;  4ULX A;  1EOH A;  4AGS A;  1THO A;  5LCZ A;  3TJK A;  3IPZ A;  2HNL A;  3RBT A;  3EUR A;  5IOX A;  4I2U A;  2PN8 A;  5HFI A;  3IDV A;  1O85 A;  2HRF A;  4PUA A;  2VL2 A;  1PGT A;  5G31 A;  4JED A;  9GSS A;  5DQS A;  5J3R A;  1T00 A;  4D73 A;  10GS A;  14GS A;  1Y25 A;  3VPQ A;  5CAX A;  1XXU A;  1M3J A; 
#chains in the Genus database with same CATH homology
 4F0B A;  2N5B A;  2LJA A;  1TJD A;  3C73 A;  3DVX A;  3RPP A;  3QFB C;  4NXI A;  2HYX A;  5DJL A;  3BD2 A;  1QK8 A;  4IQ1 A;  2NBS A;  4RI7 A;  1A24 A;  1U87 A;  2QA2 A;  2H74 A;  2L59 A;  1E2Y A;  3HCZ A;  3TKS A;  4TRX A;  3HYP A;  2VOC A;  3QMX A;  3VWU A;  5D9W A;  5EL8 A;  2JZR A;  3KEB A;  4DSQ A;  2HLS A;  3QDN A;  4NV2 A;  4F82 A;  1Z7R A;  2DJ0 A;  4PQH A;  3GH9 A;  5B8B A;  7GSS A;  1T1V A;  5G2Z A;  2XPD A;  1F37 A;  3IC8 A;  1B8X A;  3IR4 A;  3A2W A;  4I8B A;  2A2P A;  4IP1 A;  3TJB A;  4EO3 A;  3W6G A;  1BJX A;  5A4U A;  2CT6 A;  3L9U A;  3IV4 A;  1M2A A;  1GTA A;  4V1A g;  3CXG A;  3F3R A;  2IFQ B;  3MDK A;  1CQG A;  1XVW A;  1FVJ A;  4GSS A;  2VCW A;  4L0W A;  1TU8 A;  3FR9 A;  4MH3 A;  3UBL A;  2B1K A;  5IMD A;  4V1A p;  3IXR A;  2MMN A;  1XIY A;  2B5Y A;  3HXS A;  4HUA A;  1Z5Y E;  3ERF A;  3M1G A;  1OVN A;  3QAG A;  4BVX A;  2LUS A;  1M99 A;  8GSS A;  4ECJ A;  4K9Z A;  4ZB9 A;  1ABA A;  3L0H A;  3KTB A;  4OWY A;  5EY6 A;  4X43 A;  4P3Y B;  1R7H A;  4KCE A;  2C3Q A;  3F9U A;  1ST9 A;  2C0D A;  4JBB A;  2QKE A;  1R4W A;  1PN9 A;  4XRA A;  3ZYW A;  2PVQ A;  1AW9 A;  2F3M A;  1JZD A;  2R0C A;  1FB0 A;  2VL3 A;  3N5O A;  4Z7X A;  2K8V A;  4IW9 A;  2C3N A;  2DKH A;  4ICY A;  5ECR B;  5HR3 A;  1M7T A;  5CNW A;  3ED3 A;  3KH9 A;  2LNS A;  2YZU A;  4GCI A;  5IOW A;  1XVQ A;  3A5W A;  3P90 A;  6GSY A;  5AGY A;  3EYT A;  2PER A;  5CRW A;  4NMU A;  2X8C A;  4OCF A;  1X9W B;  1R5A A;  1O81 A;  3QFA C;  1PX7 A;  1JZR A;  2R5G A;  4ZBA A;  3ZVJ D;  2XBI A;  1XWB A;  3ZFB A;  3SWL A;  1VRS D;  3FMW A;  4ID0 A;  2PGT A;  3F8U A;  2XPE A;  1ZYQ B;  2A4H A;  4TW5 A;  3FZ4 A;  2DIZ A;  1EEJ A;  1PX6 A;  2WZ9 A;  1V98 A;  1USB A;  2H6Z A;  4JE1 A;  3KM6 A;  1PL1 A;  3TRQ A;  1K0M A;  2MMO A;  1ZGN A;  5J9B A;  2K9F A;  1PA3 A;  1HNC A;  3ZRD A;  1QQ2 A;  4IJ3 A;  2JZS A;  4HZ4 A;  2HFD A;  4DVC A;  1RW1 A;  2YN1 A;  1VF1 A;  4MPG A;  4EDY A;  2OJL A;  4POM A;  4XS4 A;  4RQX A;  1J0F A;  2M80 A;  4O92 A;  3VPT A;  3BBY A;  3F0I A;  4L5L A;  3ZTL A;  1YEX A;  2QA1 A;  2RLI A;  1K3L A;  3H1N A;  1FHE A;  4Z2T A;  3DVW A;  3GL5 A;  4ZXG A;  4K7N A;  1ML6 A;  4WKW A;  4LL1 B;  1EV4 A;  1XZO A;  4MJC A;  3EC3 A;  3LFL A;  2K18 A;  5G5F A;  1S3D A;  2JZT A;  1XOA A;  5E59 A;  3TDG A;  4QQ7 A;  2VUP A;  5J4U A;  4EF0 A;  2WUL A;  4AF2 A;  2ZUP A;  1AIU A;  1BG5 A;  3U5R E;  1XFL A;  2YPM A;  1E6B A;  2V1M A;  2LRC A;  4RQR A;  5IMV A;  1LBK A;  3MWH A;  4K1F A;  3HJM A;  5B7C A;  1GTU A;  4BPY A;  5KOW A;  3FK8 A;  2O7K A;  2VLV A;  1TTZ A;  1SKW B;  2OE3 A;  3O76 A;  1FG4 A;  1QMV A;  3FY7 A;  1TP9 A;  1Z6N A;  1A8Y A;  1GNW A;  5JWQ B;  3ZIJ A;  3KTL A;  4HJ2 A;  3G7J A;  1THX A;  5IPH A;  5BRT A;  1ZYN A;  3IA1 A;  1SKS B;  4KCA A;  4NWY A;  5HQP A;  2MYG A;  3LG6 A;  3WGX A;  3ZIT A;  2FUG 2;  1B9X C;  3GN3 A;  1UC7 A;  4BWS A;  1PKW A;  4BVY A;  1YF1 A;  4KE3 A;  3TRX A;  3C71 A;  2HT9 A;  5DAL A;  2E0Q A;  2I9H A;  3PIN A;  2YWO A;  4CY8 A;  13GS A;  5G1K A;  1G6Y A;  3LWA A;  3OR5 A;  1TXX A;  4G0I A;  2JAC A;  3E3E A;  4PQI A;  3PH9 A;  4AJ6 A;  1TRS A;  2VLU A;  1EEM A;  1HNA A;  4TKY A;  3VWX A;  1YF0 A;  2VD1 A;  1YDK A;  3HD5 A;  2FD3 A;  4JR4 A;  4HZ2 A;  3QD9 A;  4FYU A;  1J08 A;  4GQF A;  3ERW A;  5ECK B;  4PQ1 A;  5KN3 A;  2F8F A;  2IJY A;  3UVH A;  4GTU A;  1LJR A;  3C1S A;  4TR1 A;  4KW6 A;  2ON5 A;  1R5P A;  1GL8 A;  4MP4 A;  3W8S A;  3W8J A;  3EU4 A;  1ERT A;  3VWW A;  1EZK A;  5JWO B;  3C8E A;  1OE8 A;  1SL0 B;  2DJK A;  4YQU A;  3G9B A;  3U6V A;  1BYE A;  2FWG A;  5ENU A;  4ECI A;  2IIY A;  3FR3 A;  2R0G A;  2HZE A;  5DCH A;  3LXZ A;  5HR2 A;  2KLX A;  3CMI A;  2GT6 A;  2WDU A;  3GHA A;  2H1A A;  3CSH A;  2GZP A;  4DSR A;  1QFN A;  5KOX A;  2L57 A;  3D4T A;  4TR4 A;  4L0U A;  3APO A;  1A0F A;  1Q4J A;  4JU5 A;  2GST A;  5FHI A;  4AJ8 A;  2EIR A;  3GKK A;  2X4A A;  2MMA A;  4FH8 A;  3LGC A;  2O87 A;  2N5A A;  4RI6 A;  5BMU A;  4MDC A;  4Q5F A;  3TKQ A;  2DKI A;  3CYN A;  3GMF A;  2WCI A;  5DAK A;  3TOU A;  1GUL A;  1U88 A;  2YCD A;  4JZQ A;  1A23 A;  1WWJ A;  3ZIV A;  1AC1 A;  4K6X A;  2DML A;  2L5O A;  2B5X A;  1RK4 A;  4O5U A;  3CRU A;  2AHE A;  4MCU A;  4J56 E;  3L9V A;  3DYR A;  4QL9 A;  4I5Q A;  2HRK A;  3P2A A;  2IMF A;  16GS A;  1A2J A;  2IN3 A;  1AXD A;  5F05 A;  3S9F A;  4IEL A;  4JRR A;  5J5N A;  4MZC A;  1EOG A;  3E9J B;  2RM6 A;  4POB A;  2LKU A;  4O7H A;  3ZRE A;  4AJ7 A;  3I43 A;  4D73 B;  1SU9 A;  3L78 A;  4LMW A;  2EIO A;  4HQS A;  4OMV A;  2H01 A;  3KIJ A;  1GLP A;  2VD0 A;  4K7O A;  3RAZ A;  4IP6 A;  4MJE A;  4JR6 A;  3IHQ A;  1NM3 A;  3HVV A;  2YP6 A;  4WR5 A;  5ECL B;  3O6T A;  1K3O A;  5GSS A;  1WE0 A;  2C0F A;  2P0G A;  5AIS A;  3EIN A;  2GVP A;  1ZYE A;  2I3Y A;  1MDJ A;  2L4Q A;  1M9A A;  3VUR A;  6GST A;  4J57 E;  1X9M B;  2FCH A;  1YJ6 A;  3UEM A;  3HVX A;  4OO4 A;  3DXB A;  2B1L A;  3QR6 A;  2B3S A;  2DMM A;  3IK7 A;  1SYR A;  3F3Q A;  1IYH A;  4ACS A;  3GIX A;  5ECP B;  3GRX A;  5F8B A;  2B7J A;  3EWL A;  1GSS A;  1K3Y A;  1EV9 A;  2JSY A;  2YOI A;  5CRE A;  2ALB A;  2A2S A;  1J9B A;  2YAN A;  3N9J A;  2EC4 A;  1U3I A;  3PR8 A;  3FW2 A;  2EIQ A;  3HJO A;  4BVX B;  3HZ4 A;  2H6X A;  1EWX A;  1GWC A;  3C7M A;  1TOF A;  1M9B A;  1SK1 A;  5ECO B;  5A5K A;  2YJH A;  5INY A;  19GS A;  4Q5Q A;  2QGV A;  5E4W A;  3LOR A;  2I1U A;  2XBQ A;  4KH7 A;  2H6Y A;  4KDX A;  3UOM A;  4BA7 A;  1HNB A;  2MZC A;  1ERU A;  1A8L A;  3CTF A;  1YZX A;  2PMT A;  2H73 A;  1XWK A;  5G5E A;  1YKC A;  2QSI A;  2IMK A;  2YWI A;  4LL4 B;  4J2F A;  3IC4 A;  4TXO A;  5G30 A;  3BCK A;  4TVE A;  4EE0 A;  3KP8 A;  3PGT A;  4HU9 A;  4MJB A;  1K0B A;  4MNN A;  5COH A;  3CSI A;  3D21 A;  4ECC A;  5DDL A;  3F6F A;  4K5S A;  4CY6 A;  4EL1 A;  2B6M A;  3GV1 A;  3HDC A;  3KH7 A;  3M8N A;  4GLT A;  2H1B A;  4L8E A;  2DSA A;  1X9S B;  2H1D A;  4K0G A;  1B48 A;  2TRX A;  2H70 A;  3TKS E;  2IL3 A;  5ECN B;  2XC2 A;  3TJJ A;  3VK9 A;  3FRC A;  2FWH A;  1T7P B;  4TR0 A;  1IYI A;  2WB9 A;  2KHP A;  1KNG A;  2YV9 A;  1PN0 A;  3ME8 A;  2CA8 A;  4YH2 A;  1XWG A;  5AIX A;  2L6D A;  2YWN A;  4PGT A;  4KB3 A;  2L4C A;  1OKT A;  1O6J A;  4KUN A;  4XTS A;  2TRC P;  3D5J A;  3VI7 A;  3EPT A;  3AY8 A;  3J7Y k;  2B5E A;  1TKD B;  2P5Q A;  2IPA A;  3MIX A;  4ML1 A;  5ELA A;  1SEN A;  1QGV A;  2FHE A;  3US3 A;  4XS4 B;  5ECQ B;  1GSF A;  4HI7 A;  3VLN A;  1WJK A;  2H0I A;  3TKP A;  4Z2U A;  2KP1 A;  2RUF A;  2AYT A;  1GSU A;  4ZIJ A;  4WXT A;  2UZ8 A;  2CQ9 A;  1ERV A;  3I9V 2;  5A4V A;  2RM5 A;  2TIR A;  3TCO A;  1M2D A;  2DJJ A;  2F8A A;  2VAF A;  3UBK A;  3SBC A;  4YQV A;  3GKN A;  2ZCT A;  2M46 A;  1ZZY A;  2GSR A;  1EP7 A;  1AQX A;  1WOU A;  3FHK A;  3KCM A;  1SJZ A;  2OAC A;  2GQM A;  4KDU A;  2GT5 A;  4OFT A;  1Z9H A;  1PL2 A;  4IQA A;  4IKH A;  2H8L A;  2X8G A;  3CRT A;  3M3M A;  1SK2 A;  5F0G A;  5ID2 A;  1U3A A;  2OKA A;  4PX1 A;  2H72 A;  1FOH A;  2HRA A;  3EMX A;  4K8M A;  2MMZ A;  1K0D A;  3F6D A;  3HA9 A;  5IM9 A;  1FO5 A;  5CYY A;  1WIK A;  1X0R A;  4KSO A;  3GST A;  4NHW A;  4G2E A;  1T8E B;  1GSQ A;  4HQZ A;  5CO3 A;  2WS2 A;  3Q18 A;  4KDY A;  4K0N A;  4F9Z A;  3MNG A;  1U6T A;  2F9S A;  1VGL A;  4I6X A;  1TRW A;  1PRX A;  4I2T A;  3GUS A;  2DIY A;  4ECB A;  1A0R P;  3WYW A;  4BVY B;  5IMC A;  2VM2 A;  1ACV A;  3UJ1 A;  5ABR A;  1MEK A;  5DAL B;  4GWR A;  3KXO A;  3O3T A;  3LJR A;  1C72 A;  1R26 A;  3WGD A;  4MAB A;  3WT2 A;  5IPG A;  4DSS A;  1M0U A;  1WMJ A;  3HHV A;  3LSZ A;  2O85 A;  1VF4 A;  2D2Z A;  3LW9 A;  4V2L A;  1KTE A;  1DUG A;  4F03 A;  5HFK A;  5IQY A;  2XHF A;  3EU3 A;  2PBJ A;  1V2A A;  3NZN A;  1QUW A;  1WPI A;  1DE1 A;  3VFI A;  4G19 A;  4WR4 A;  1JFU A;  2VM1 A;  2NPB A;  1A2M A;  4X0X A;  1G7E A;  5A4W A;  3UAP A;  2R4V A;  2P5R A;  1X5D A;  2WGR A;  4EC0 A;  1AQV A;  4RUV A;  3DKS A;  2FGX A;  4TR1 B;  2LV3 A;  2H0G A;  4GXZ A;  4YQM A;  2CZ2 A;  2HRN A;  3EVI A;  3A5I A;  3RDW A;  5GZZ B;  2LEG A;  3D6I A;  3HZ8 A;  4ZBD A;  3G7I A;  3TJF A;  1TK5 B;  3R2Q A;  1XWC A;  3HKR A;  4YKF A;  3M9K A;  1M2B A;  1XWA A;  3H79 A;  3TOT A;  2OBK A;  4MF7 A;  4ZBB A;  4DEJ A;  2G2Q A;  3Q6O A;  2AUV A;  1XPV A;  17GS A;  2MBT A;  4N0Z A;  4I97 A;  3DWV A;  3GNJ A;  3GTU A;  4MJA A;  2HZE B;  3KJY A;  2NTO A;  2QC7 A;  1B4Q A;  3KGK A;  2HI7 A;  2LJK A;  2ON7 A;  1OC8 A;  3FEU A;  4IGJ A;  1T3B A;  4TN8 A;  4LMV A;  2VIM A;  3P8W A;  5DQY A;  5JWR B;  4NAX A;  3A2V A;  3KMN A;  18GS A;  3K8N A;  1ZCP A;  4V2M A;  5GST A;  3TKS C;  2CVK A;  4NPB A;  1OC9 A;  1GLQ A;  4N10 A;  3ERG A;  1TRV A;  4ZB6 A;  2WFC A;  2CX4 A;  5ECS A;  2CVB A;  3IOS A;  2A2R A;  1Y6E A;  2AV4 A;  2K6V A;  3RHC A;  1B9Y C;  2P31 A;  1VF3 A;  4BL7 A;  1PMT A;  2IWT A;  3BOA A;  3IE3 A;  2H1G A;  1FOV A;  2C1Y A;  1NSW A;  2GS3 A;  5DVB A;  4TXV A;  1ZL9 A;  5F07 A;  2GTU A;  1X5E A;  3QAV A;  1WP0 A;  2VL9 A;  2LS5 A;  2E7P A;  4IVF A;  3FYG A;  3Q74 A;  2AJQ B;  3FKF A;  5D9T A;  3IAM 2;  2I4A A;  1F3B A;  2N5F A;  3ZLP A;  1O7U A;  3R3E A;  3QAW A;  3KMO A;  2FLS A;  2WJU A;  3ZZX A;  1OKD A;  5JCG A;  4XIH A;  4OFN A;  3VI5 A;  1TK0 B;  2LTK A;  1YKA A;  3IBH A;  2JAD A;  3LQ7 A;  2HZF A;  3H8Q A;  4MH2 A;  1K0N A;  5LNK e;  1X5C A;  2IMI A;  5C04 A;  4XRD A;  5LD0 A;  3ZMK A;  3CBU A;  1RQM A;  1EGO A;  3WT1 A;  4CHS A;  1Z6M A;  2PU9 C;  3GH6 A;  2DBC A;  5EVO A;  2X99 A;  4KSM A;  5B6M A;  3GL3 A;  2VCT A;  2J23 A;  5HR1 A;  3CTG A;  5GAP D;  1W4V A;  2HXK A;  1XW5 A;  1SL2 B;  3GX0 A;  22GS A;  5D73 A;  4ML6 A;  1URM A;  4WBR D;  3TJG A;  4N30 A;  1K0C A;  1SL1 B;  3FR6 A;  3GKX A;  1KEB A;  4GF0 A;  3FZA A;  1OE7 A;  2CAQ A;  2M72 A;  1T4Y A;  4FQU A;  2C4J A;  1AUC A;  2C3T A;  3LXT A;  1N2A A;  5IMZ A;  2F51 A;  1H75 A;  4FIW A;  2GQK A;  5IIZ A;  1SJ6 A;  4GST A;  3HJP A;  3RPN A;  2JU5 A;  2YV7 A;  3DRN A;  2GGT A;  5IMF A;  3DGQ A;  4PTS A;  4POK A;  1JZW A;  5KN1 A;  1TI3 A;  1EGR A;  1DBY A;  2H76 A;  2C80 A;  2G0F A;  5CRG A;  3IHG A;  3MSZ A;  4XHM A;  4XS1 A;  4POL A;  3WGE A;  2DC5 A;  4OO5 A;  2X64 A;  6GSS A;  4TR3 A;  2CAI A;  1YQ1 A;  1ERW A;  2V6K A;  3G7Y A;  3E0U A;  4OCE A;  2E2G A;  2PVO C;  4G0K A;  4HEA 2;  2HSY A;  1SK0 A;  3BJ5 A;  2V2G A;  4OD7 A;  1O8W A;  5AN1 A;  2H66 A;  4MZW A;  3ZFL A;  5KEJ A;  2FWF A;  1SD8 A;  4OFM A;  1S3A A;  3APS A;  1F9M A;  4ZL7 A;  4GRF A;  3D22 A;  2GZZ A;  2DLX A;  4PXO A;  2H30 A;  4TXO B;  3GUR A;  1CQH A;  4MK3 A;  1S3C A;  2GSQ A;  4PUR A;  4ZL8 A;  5B8A A;  4O5R A;  1MDK A;  2J9H A;  2KP2 A;  2PWJ A;  4G0L A;  3QPM A;  1MDI A;  5G1L A;  2YWM A;  2IFQ A;  2NVL A;  2V32 A;  5J41 A;  3I6A A;  2OE0 A;  1H4O A;  2VCQ A;  3ME7 A;  2HSM A;  2OE1 A;  4K2D A;  4CW9 A;  2JSZ A;  4N0V A;  5L71 A;  4KAE A;  1JZO A;  2KUC A;  1WRY A;  4LA1 A;  3C1R A;  1VF2 A;  1BQ7 A;  4IS0 A;  3J7Y b;  3IRA A;  5ECM B;  1ZYP A;  1UA5 A;  1XBS A;  3M9J A;  4IN0 A;  1G6W A;  5H5Q A;  4O32 A;  4IBP A;  4BWQ A;  4HOJ A;  2BMX A;  4GSN A;  1Z7P A;  4NV5 A;  1HYU A;  2PUK C;  2R2J A;  2O8V B;  5AIV A;  1SKR B;  2R0P A;  4ILF A;  3CSJ A;  2LQQ A;  3F63 A;  2NDO A;  1G7O A;  2X8H A;  3FZ5 A;  4E8H A;  2KOK A;  3MAK A;  5CP1 A;  3UIW A;  1V9W A;  1UVZ A;  4MPF A;  3GKM A;  2FWE A;  6GSW A;  1GUK A;  1TDI A;  5DBQ A;  5C00 A;  4KF9 A;  4K5R A;  3H4K A;  2A4V A;  3RHB A;  2FNO A;  4NHZ A;  5F06 A;  5EPF A;  1HD2 A;  1LU4 A;  1JLV A;  4IHU A;  1XCC A;  4ZIL A;  1TU7 A;  2CV4 A;  1N8J A;  1GUH A;  2O89 A;  2DJ1 A;  3MYD A;  1DE2 A;  2VLT A;  1GSD A;  4L5O A;  4ZB8 A;  3P7X A;  6GSX A;  20GS A;  5JCW A;  2LNT A;  1V40 A;  3TGZ A;  1AQW A;  2FA8 A;  4PNF A;  3IK9 A;  3EE2 A;  2OA7 A;  4MF6 A;  3KZQ A;  3A2X A;  5H5R A;  4KND A;  4FYB A;  1F3A A;  1B4P A;  1I5G A;  4KX4 A;  4K2X A;  1SYX A;  1YEP A;  2WRT A;  2DJ3 A;  2YNX A;  2H19 A;  2VCZ A;  3JCM L;  1PKZ A;  5ID2 B;  1GTB A;  1ILO A;  3FZ9 A;  5HFG A;  2BJX A;  3UAR A;  1ON4 A;  2GLR A;  2I81 A;  1DSB A;  2GZY A;  3D4M A;  3GFK A;  4EVM A;  1I9D A;  2LRT A;  2REM A;  3TRP A;  1G0T A;  2C8U A;  6GSU A;  1GNE A;  2CX3 A;  4LLR A;  3M0F A;  1QXH A;  3LYP A;  5CRD A;  2H75 A;  1GP1 A;  4Q5N A;  1GSY A;  3I69 A;  2HSH A;  1GUM A;  2V6O A;  4IJI A;  2LST A;  2GDR A;  3F4S A;  4EIQ A;  4O5Q A;  4MMM A;  2PPT A;  2GSS A;  4WEY A;  4MF5 A;  3GA4 A;  2FY6 A;  1K0O A;  1XOB A;  2C0G A;  5GAN D;  2RII A;  3D0Z A;  4H86 A;  2E2M A;  3Q19 A;  4USS A;  2ES7 A;  5IO0 A;  6GSV A;  4DSS B;  2BTO T;  2RUE A;  1TK8 B;  4G10 A;  3GX8 A;  2R37 A;  4WF5 A;  5KN0 A;  5IMA A;  1BED A;  3KD0 A;  2YJ7 A;  1SD9 A;  1GH2 A;  3LEF A;  3UL3 A;  1PD2 1;  3APQ A;  3F4T A;  4K7I A;  1OYJ A;  2H0H A;  3L4N A;  2FA4 A;  1NHO A;  11GS A;  1V57 A;  3DML A;  2LQO A;  4WBJ A;  4XS6 A;  1NHY A;  5J9C A;  5D9V A;  4HS1 A;  3IAS 2;  2AAW A;  3ZVJ A;  1SJI A;  3HY2 A;  2V41 A;  4N11 A;  2CZ3 A;  1UN2 A;  4WF4 A;  3F4R A;  4EXJ A;  1TRU A;  1KBN A;  4ISD A;  1ZOF A;  2H71 A;  3DEX A;  1YY7 A;  5JCU A;  2VCX A;  4V2N A;  2K8S A;  4G9H A;  1O73 A;  1AAZ A;  4EIP A;  3ZML A;  3DIE A;  1OC3 A;  3WD6 A;  3UVT A;  1MD4 A;  4YKG A;  3H93 A;  4HDE A;  4MLY A;  1A2L A;  4MZB A;  5D8I A;  5DJM A;  5B6N A;  3HVS A;  1F2E A;  3GTU B;  2R3X A;  1FAA A;  2HE3 A;  1ZMA A;  3EMP A;  5HR0 A;  3ISO A;  2VL2 C;  1FVK A;  4X4J A;  4KA0 A;  1EP8 A;  4MA9 A;  3ZL5 A;  1Q98 A;  4X1U A;  4QL7 A;  2MBS A;  3DD3 A;  1GSE A;  1V58 A;  1OC9 B;  4FO5 A;  4E8E A;  4HU7 A;  2LJR A;  5IO2 A;  4PNG A;  1K0A A;  2CVD A;  1MD3 A;  3PPU A;  1W89 A;  1XW9 A;  3NOF A;  4BL7 B;  1BAY A;  1BX9 A;  2X49 A;  2IME A;  1JHB A;  4F0C A;  2DJ2 A;  2ZNM A;  12GS A;  2AB6 A;  3BCI A;  2GQL A;  5DCG A;  1GRX A;  2Z9S A;  4HJM A;  5H5S A;  2B7K A;  4EKZ A;  2OAD A;  4KGI A;  4FYC A;  3QOU A;  5DAK B;  1TW9 A;  4EUY A;  5KN2 A;  5D9X A;  2OBI A;  5D96 A;  3LYK A;  3TB2 A;  4F2I A;  1TI1 A;  2JL4 A;  3GSS A;  4CDO A;  5ECI B;  3NIV A;  2C0E A;  5FT3 A;  1GTI A;  1HQO A;  5FWG A;  4Z2R A;  2YZH A;  4TOP A;  3QCP A;  1PQN A;  1JLW A;  3TUE A;  1F6M C;  4PUF C;  2LRN A;  2R6K A;  2L6C A;  4YAP A;  4GQC A;  1OAZ A;  5CRH A;  1O8X A;  2IMD A;  5D93 A;  1NW2 A;  2L5L A;  1T4Z A;  3KP9 A;  1XW6 A;  3L9S A;  3A3T A;  4ZL9 A;  4WET A;  1FB6 A;  1MTC A;  4YAV A;  5ECH B;  3V1W A;  2VO4 A;  1PSQ A;  3UMA A;  4A5P A;  4Q5R A;  3GYK A;  5ELG A;  4XCS A;  1Z3E A;  3TKR A;  1FW1 A;  3VWV A;  2VCV A;  4EDZ A;  4ULX A;  1EOH A;  4AGS A;  1THO A;  5LCZ A;  3TJK A;  3IPZ A;  2HNL A;  3RBT A;  3EUR A;  5IOX A;  4I2U A;  2PN8 A;  5HFI A;  3IDV A;  1O85 A;  2HRF A;  4PUA A;  2VL2 A;  1PGT A;  5G31 A;  4JED A;  9GSS A;  5DQS A;  5J3R A;  1T00 A;  4D73 A;  10GS A;  14GS A;  1Y25 A;  3VPQ A;  5CAX A;  1XXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...