1A2JA

Oxidized dsba crystal form ii
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
188
structure length
188
Chain Sequence
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DISULFIDE BOND FORMATION PROTEIN
publication title Crystal structures of reduced and oxidized DsbA: investigation of domain motion and thiolate stabilization.
pubmed doi rcsb
total genus 69
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 1998-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1a2jA00
3IC4A 4MK3A 1Y6EA 4OCFA 4GSTA 1HNCA 3HJOA 2WJUA 1N2AA 1GSUA 4K7IA 1R5AA 2GDRA 2M46A 1YDKA 3H1NA 3KEBA 3DGQA 4JRRA 2LRTA 3CRTA 4TR4A 2DJKA 5CNWA 5F06A 5KN2A 1DE1A 2CVBA 4MCUA 1DE2A 4IGJA 2O7KA 1TI3A 4XHMA 4IKHA 2IFQA 2R37A 2WRTA 1J9BA 1T00A 2ZNMA 4IS0A 2EIRA 2FNOA 3O3TA 1JLWA 3IA1A 1GSSA 1ZMAA 2JU5A 3TGZA 4KX4A 5FWGA 4WR5A 1YKAA 1Z6NA 3MSZA 3UVHA 2C8UA 1G6WA 4JR4A 1ERWA 3ED3A 2YJHA 1VF1A 3M0FA 4K0NA 2FWGA 1Z6MA 3M9KA 5CRWA 3FR3A 5G1LA 2GT5A 2YV7A 4HS1A 3F4SA 3WGXA 4N11A 3VK9A 3FZAA 5LNKe 2FD3A 5J9BA 1E6BA 3LQ7A 2GSSA 1A8LA 4I2UA 4MF7A 2C1YA 1GSEA 3UBKA 2QSIA 1PL2A 4IQ1A 2LSTA 1YKCA 2GQKA 3ME8A 3J7Yb 3QDNA 2JZSA 3RHCA 1ABAA 1RK4A 4HJMA 1A8YA 2DIZA 2GTUA 2VCZA 4NXIA 2P5RA 3RHBA 4LMWA 2YOIA 3PINA 4O92A 1TXXA 2RLIA 5ECMB 1GNWA 4G9HA 4O7HA 2XHFA 4XTSA 3WYWA 4TR3A 4IJ3A 4Q5NA 3TJJA 5ELGA 3FW2A 3HVSA 3HZ4A 1T4ZA 4FIWA 2LKUA 4BWSA 2IJYA 4V2LA 3ZL5A 5AGYA 3DRNA 4K2DA 3KGKA 2A2SA 1GTUA 2GT6A 3TRQA 1WJKA 2MZCA 1AC1A 2XBIA 2ON7A 1PQNA 4JZQA 3J7Yk 3CXGA 3APOA 5JWRB 2O85A 3LYPA 2WFCA 3JCML 2PN8A 4ULXA 4EUYA 2V6OA 3NOFA 3UMAA 2L5LA 6GSWA 1EEJA 3ME7A 4KDXA 3H4KA 1BX9A 5J41A 1FO5A 1PRXA 4WKWA 1UA5A 3DVXA 4EVMA 4DVCA 2I4AA 2GSTA 3RPNA 1X9SB 2IL3A 2WCIA 1GLQA 1YY7A 3TRPA 1G7EA 4TKYA 2B1KA 1H4OA 4FYBA 1A2LA 2K8SA 4XRAA 2AHEA 3D21A 3TDGA 3GTUB 3GMFA 4XS1A 2VUPA 4NPBA 2OACA 1K3OA 3E0UA 2FA4A 4ACSA 1JHBA 2G2QA 2C3TA 3SWLA 2H76A 3K8NA 3ZVJA 2YV9A 2HYXA 5KN3A 2K6VA 3P7XA 5LD0A 3RBTA 5DBQA 1Y25A 3HKRA 1WRYA 2F9SA 3H93A 3GYKA 3Q74A 1XVQA 3GSTA 4HOJA 1ZOFA 3CMIA 2X64A 1Q98A 3P8WA 1GULA 1WOUA 2H74A 1O81A 3GL3A 3D0ZA 4NV5A 3M1GA 3KCMA 4HUAA 5B7CA 2L59A 4GTUA 4I97A 3LXZA 2P31A 4XS4B 3QMXA 2VLVA 4EO3A 2L4QA 3QOUA 1K0MA 4EKZA 2GSRA 3BBYA 5HFGA 1SJZA 3F6FA 1VF2A 3D22A 4IQAA 1VRSD 2B5YA 3ZTLA 4TVEA 13GSA 1XBSA 4GQFA 4OFTA 4N30A 4EL1A 3CSIA 1KEBA 4PNFA 3HCZA 2LTKA 1PMTA 5EY6A 5HR1A 4GF0A 1ZZYA 3IXRA 3KH9A 1U3AA 5G30A 2H70A 1TTZA 4JEDA 1FG4A 5IMZA 4X43A 14GSA 2AV4A 2LNTA 1X5CA 2H1AA 4F2IA 2F8FA 5B6MA 1M2BA 3IK7A 4XS6A 2H1GA 2OE0A 1J0FA 1XVWA 5IIZA 3EURA 1AW9A 5JWOB 3V1WA 3LEFA 2HNLA 3EYTA 1TDIA 3HY2A 1F2EA 3US3A 4LL4B 1X9WB 2OJLA 2CVDA 2OE3A 4TR1A 4L5OA 1YEPA 2NPBA 3FZ4A 2H71A 3SBCA 20GSA 1TRVA 1B4PA 1THXA 1Q4JA 5KEJA 3BJ5A 4H86A 4GWRA 1NW2A 1ILOA 2I9HA 2VCTA 1THOA 3L9VA 4MH2A 2BMXA 4ISDA 2HRFA 1XWBA 2VL2C 4ILFA 5CYYA 4TXOB 2XBQA 5IPGA 2LJRA 1TP9A 2L4CA 1V9WA 1K0CA 3CTFA 3TKSE 4MZBA 3LXTA 3ERFA 5JCUA 3C1SA 3TRXA 4F0BA 4HQZA 2ALBA 1ZCPA 2DC5A 2B1LA 2H30A 2K18A 2F8AA 4V2NA 4RI6A 4FO5A 4F03A 2FY6A 1SU9A 1KBNA 1UN2A 4OD7A 1B4QA 4V2MA 4TRXA 1S3AA 2AB6A 1U88A 2HZEB 1BYEA 5DVBA 4HQSA 1EWXA 4WR4A 1NM3A 4BWQA 1WP0A 4Q5QA 4MLYA 4MH3A 2YANA 1B48A 3GTUA 4K0GA 5B6NA 4TN8A 1F37A 1H75A 5ECIB 4QQ7A 2YZUA 1FB0A 4IELA 2EIQA 3IR4A 1YF0A 3MWHA 3EVIA 4PNGA 3TOUA 1YJ6A 3CYNA 4POKA 1XIYA 2VCQA 3A3TA 4ZILA 3UOMA 3GN3A 2H6XA 3NIVA 4EF0A 3G7IA 1QUWA 4AJ8A 5KN1A 3ZLPA 3FHKA 3QFAC 2FGXA 1W89A 4KCEA 4FH8A 4XCSA 5KN0A 2YJ7A 3BOAA 3N5OA 2F3MA 1GTBA 3IK9A 4FYUA 2CX4A 3FEUA 3HVVA 2GS3A 2FWEA 4AGSA 5LCZA 1AIUA 4XS4A 1GTAA 4RUVA 1XOAA 1NHOA 3UJ1A 4OFMA 1M99A 1XZOA 1HYUA 1FVJA 1CQGA 5J9CA 1B8XA 3I9V2 1OAZA 4NHZA 4TR0A 1FHEA 1Z7PA 3H79A 3Q6OA 3EE2A 4KCAA 3GUSA 3LWAA 4ZB9A 2NTOA 3PGTA 1AQWA 1ERTA 1N8JA 2VLTA 2PGTA 4BL7A 2PVOC 2YWMA 3GKXA 5CRHA 2ZCTA 1SYXA 4K7NA 3KD0A 2FCHA 5EVOA 2KHPA 1I9DA 4ZBDA 2OKAA 1LU4A 2DMLA 4D73B 1G7OA 3WT1A 3HJMA 4PGTA 5IMVA 5DQYA 2DJ0A 12GSA 2O87A 4I8BA 3CBUA 1MDKA 3ERWA 4KSOA 5COHA 3ERGA 3GSSA 1QK8A 1O7UA 1R7HA 2IPAA 4HJ2A 5CRGA 1ON4A 2X8HA 1EGRA 2IWTA 1GSYA 1U87A 5IOXA 3DVWA 3IBHA 2WULA 3RAZA 3ZFBA 1XOBA 1QXHA 1E2YA 2LS5A 4KW6A 2VM2A 3KJYA 1PA3A 3L9SA 3IHQA 4TR1B 4RQRA 5GSSA 3ZVJD 6GSUA 4IBPA 4XRDA 3P90A 3L9UA 1XXUA 5B8BA 1PN9A 4HDEA 2H75A 2LJAA 4HU7A 2KOKA 2X8CA 5D8IA 1CQHA 1V98A 1WPIA 2H8LA 4DSQA 5GSTA 2YP6A 3RPPA 2IMKA 2GQMA 4IJIA 4TXOA 1K0OA 2DIYA 4ZB6A 2YWIA 3D4MA 2H72A 2L6DA 5D9TA 1PD21 3HJPA 1WMJA 2TRXA 4LMVA 5DJLA 2BTOT 2HRNA 3C71A 3TUEA 1XW5A 3G7YA 5F07A 5IQYA 1MTCA 2IMEA 1MD4A 1Z9HA 3GHAA 5ECNB 5G1KA 4OO4A 4TOPA 1Z7RA 1F3BA 5A4VA 5IO2A 1GTIA 4GSNA 1SD8A 2M80A 2HZEA 1TJDA 6GSXA 1XCCA 2GVPA 2K8VA 1GH2A 11GSA 2JSZA 3FY7A 1SL0B 3IRAA 3L4NA 2VCVA 4V1Ap 4WF5A 1HNBA 2IN3A 1BEDA 2ZUPA 5HR2A 1SJIA 2E2GA 1V40A 3TJFA 4GSSA 1TRWA 3UARA 5C00A 2LNSA 3ZMKA 17GSA 2PMTA 3VPQA 2C4JA 1SKWB 2B5EA 3WT2A 1TKDB 1ML6A 1SKSB 2H73A 2NBSA 3FR9A 3LG6A 4K6XA 2MMZA 1PSQA 2H66A 4YQVA 4L0WA 1M0UA 4OFNA 3QFBC 4CHSA 3IE3A 3EMPA 4N0VA 2R2JA 4AF2A 4NHWA 4I2TA 3EMXA 5H5QA 1A2MA 2DJ3A 4GCIA 2RIIA 2PWJA 2GZYA 4YAVA 4KDUA 2B7JA 3UAPA 5J4UA 2DJ1A 4G2EA 4O5RA 1TK5B 1FW1A 3Q19A 4E8HA 4CW9A 3MAKA 5DCHA 3QR6A 4MDCA 1QFNA 1ACVA 1K0NA 5F05A 3DWVA 2IMDA 2OE1A 3KP8A 3HA9A 1HQOA 2DLXA 2CT6A 3HHVA 2O89A 2X8GA 1QMVA 1J08A 5F8BA 1SL2B 2LRCA 3ZMLA 5ECQB 2ON5A 2H1BA 5ENUA 3IOSA 2RM5A 3C1RA 1T1VA 1UC7A 5GZZB 3F4TA 3L0HA 1TOFA 4D73A 1GWCA 1SL1B 2WDUA 4ZBBA 3KIJA 2P0GA 4HI7A 3DXBA 4OWYA 2J9HA 4MMMA 4F82A 2TRCP 1HNAA 3KTLA 3EWLA 4KDYA 4ZBAA 5E59A 4KAEA 6GSYA 2I3YA 5H5SA 5B8AA 3HYPA 3M8NA 1A2JA 3FYGA 2C0DA 3TKSC 5ECLB 1ZGNA 2N5AA 4ZL7A 4OMVA 2MYGA 5HR0A 2K9FA 1R26A 2PUKC 2RM6A 4ML1A 3LYKA 1BJXA 4WEYA 1EP7A 2CV4A 4PQIA 1V57A 2MBTA 3UEMA 2N5FA 3CTGA 2CAIA 4K1FA 5DCGA 1UVZA 4IN0A 2JZTA 1W4VA 3I69A 2AYTA 4V1Ag 5HFKA 1MDJA 2X99A 4JR6A 1EP8A 3HZ8A 3KZQA 4K9ZA 1EZKA 2PVQA 4K8MA 3I6AA 4IHUA 3VFIA 4MJCA 1OE8A 2QGVA 2H0HA 5JWQB 1S3DA 1TRSA 3KH7A 4WXTA 5ECRB 2ES7A 1JZDA 2VCWA 1SK0A 2I1UA 2C3NA 1K3YA 4HEA2 5D9VA 1B9YC 3BCIA 4LA1A 4CDOA 5DJMA 3G9BA 1U6TA 3G7JA 4DSRA 2C80A 2FLSA 4BPYA 3WGDA 2HT9A 4G19A 2VL2A 1GUMA 2V6KA 3GH6A 3DIEA 1SK2A 4HZ4A 4I5QA 4PQHA 3ZZXA 4IW9A 3NZNA 4ECIA 4ZIJA 3LORA 2IMFA 4MA9A 2LRNA 3GNJA 3D6IA 3GL5A 2J23A 2WB9A 2KP1A 1OC9B 4J56E 1TU8A 1GSQA 3Q18A 3VPTA 2FA8A 3D5JA 3VI7A 1SD9A 5EPFA 2AUVA 3UVTA 3LGCA 1RW1A 4KSMA 1GL8A 4F9ZA 4E8EA 1BG5A 1AUCA 4POMA 5AIXA 2L5OA 1GRXA 2MBSA 2VCXA 4JBBA 4HZ2A 1M2DA 4ZB8A 5G2ZA 3QD9A 4HU9A 5L71A 5ECHB 1PGTA 1EOHA 1K0BA 1FOVA 1R4WA 1TI1A 3IV4A 2FHEA 2FUG2 4RI7A 2N5BA 4MJAA 2VLUA 2CA8A 3F0IA 3W6GA 1T3BA 1V2AA 2YWOA 1A0FA 1AQXA 3L78A 4WBJA 3C8EA 5ECSA 1JZRA 2RUFA 5A4UA 2E0QA 1F3AA 6GSVA 4GXZA 1XWKA 2HLSA 3EC3A 1MD3A 3QAGA 3ZREA 4MZCA 2E7PA 3EU4A 2XPEA 5DQSA 6GSTA 1XPVA 2JSYA 3U5RE 1OKDA 2VM1A 3ZIJA 5CREA 2VL9A 2CX3A 5IMCA 4WETA 5ABRA 3TB2A 3WD6A 1XW6A 1TK8B 2HSHA 4JE1A 4ECBA 4EXJA 5J3RA 4PXOA 1DBYA 22GSA 1SJ6A 2G0FA 5IM9A 1KTEA 3IPZA 4KH7A 1IYHA 3ZITA 2L6CA 4MPFA 3LJRA 4BA7A 3CRUA 5A4WA 4DSSB 3A2XA 2H0IA 1A24A 4TXVA 1X5DA 2YPMA 3H8QA 2YWNA 3HDCA 5HR3A 3GFKA 1GLPA 1YF1A 5DALB 3TJKA 5D93A 2HXKA 2NDOA 3N9JA 1EOGA 4LL1B 4MJBA 4MJEA 3APSA 5GAPD 2AJQB 5IMFA 4IVFA 2IMIA 4LLRA 3LFLA 3PR8A 3TJGA 2EIOA 3GIXA 1RQMA 2M72A 1X0RA 2XC2A 4MABA 1YQ1A 4PQ1A 1M9AA 1WE0A 2R3XA 1JLVA 5ELAA 1IYIA 2R4VA 1M9BA 2REMA 3HXSA 5IPHA 1KNGA 4L0UA 1GSFA 2YN1A 3O6TA 2F51A 1X9MB 2GLRA 1O8XA 1NHYA 2VO4A 4EC0A 4ZXGA 3CSHA 3KM6A 1DUGA 1USBA 5JCGA 1OC3A 4Q5RA 2LEGA 3I43A 5AISA 2JZRA 2JADA 1NSWA 16GSA 4YH2A 1SENA 4BVXA 5ECOB 4I6XA 5IMAA 1BAYA 2H6ZA 4QL9A 3VWVA 3GKNA 3F8UA 2MMNA 5E4WA 1S3CA 1U3IA 2VAFA 2QKEA 3QPMA 3VWXA 2XPDA 3VWUA 3A2WA 2L57A 3W8JA 3TCOA 2LQQA 1V58A 5ID2A 2I81A 4POBA 3GURA 1OC9A 4EDZA 2B5XA 3ZRDA 1OKTA 2MMAA 3IAS2 3P2AA 3EINA 18GSA 3UIWA 3WGEA 1T4YA 4KB3A 3TKRA 4O32A 4IP1A 5FHIA 2JL4A 2LV3A 3DKSA 3GRXA 2DBCA 2OBIA 4K7OA 1LJRA 4EE0A 2CVKA 2RUEA 1GUHA 3PH9A 3RDWA 2NVLA 3DYRA 4QL7A 2VD1A 3GV1A 5D73A 2MMOA 5EL8A 1ST9A 3VLNA 4Z7XA 3F3QA 3KMOA 4ECCA 2DJJA 2PPTA 1AQVA 3CSJA 4MZWA 4AJ6A 1SYRA 9GSSA 4MPGA 1TW9A 3AY8A 3IDVA 3GH9A 2VOCA 3GA4A 5IMDA 1VGLA 4ZL9A 1O6JA 1JZWA 2CZ2A 3VI5A 3APQA 4NV2A 2YZHA 1BQ7A 5DAKB 2B3SA 1GSDA 3M9JA 2FWFA 4N10A 1PKZA 1OVNA 5GAND 3VURA 4PURA 3GX0A 2KP2A 4GRFA 2PBJA 3F3RA 1MDIA 2DSAA 4AJ7A 3GKMA 2DMMA 2B7KA 3LSZA 4POLA 3A2VA 1PL1A 2LUSA 2HZFA 3QAVA 3TOTA 2YCDA 4YAPA 4FYCA 2HFDA 2QC7A 2V41A 2O8VB 2HI7A 2B6MA 1SK1A 4MP4A 4OCEA 3IAM2 3MNGA 4J2FA 2JACA 3F4RA 3HD5A 2C0FA 3TJBA 2FWHA 3OR5A 2H1DA 4PUAA 4TW5A 5HQPA 3ZYWA 4NMUA 3R2QA 2H0GA 1AXDA 3F6DA 1A23A 4P3YB 2V2GA 3DMLA 19GSA 1AAZA 1QGVA 2E2MA 2PU9C 4DSSA 4L8EA 5IOWA 4KGIA 2C0EA 5CRDA 4GLTA 2V32A 3FZ9A 4X1UA 5DALA 3UL3A 3EU3A 1Z3EA 2D2ZA 1YZXA 4IP6A 2IFQB 3D4TA 5AN1A 1MEKA 4KA0A 2CQ9A 3F9UA 3FKFA 4XIHA 5G5EA 2LJKA 1PX7A 1FVKA 2Z9SA 4ML6A 1K0AA 3S9FA 4DEJA 8GSSA 1JZOA 4BVYA 3ZIVA 5A5KA 2EC4A 2OBKA 5J5NA 4WF4A 3U6VA 2IIYA 4OO5A 1M7TA 3TKSA 1C72A 2KLXA 3ISOA 3BCKA 5H5RA 2VIMA 3FR6A 3FRCA 2GGTA 1T7PB 1JFUA 1PX6A 1O73A 2C3QA 3BD2A 5FT3A 2P5QA 4GQCA 4L5LA 1T8EB 4WBRD 3FK8A 5CAXA 4MF6A 2DJ2A 3DEXA 4PUFC 1YEXA 1ZYQB 1F6MC 3M3MA 2H19A 1OC8A 2R6KA 1F9MA 1G6YA 10GSA 2GQLA 3E3EA 3QCPA 3VWWA 5AIVA 2A4VA 2V1MA 3F63A 5CP1A 1EV4A 1EEMA 3E9JB 1XFLA 1URMA 3MDKA 2GZZA 1A0RP 1PKWA 1I5GA 2OA7A 1Z5YE 5ECKB 1R5PA 4YQMA 2VL3A 1TK0B 1ZYEA 4NWYA 3GX8A 2CZ3A 1LBKA 5D9WA 2HE3A 1G0TA 5INYA 3UBLA 5ID2B 2KUCA 1O8WA 1VF4A 2WS2A 1M2AA 2WGRA 5F0GA 1ZL9A 2GZPA 2TIRA 2VD0A 4KE3A 1FAAA 2H6YA 1GNEA 1EGOA 5IO0A 3KMNA 2CAQA 2C0GA 1VF3A 4ID0A 1K3LA 2H01A 3DD3A 1OE7A 4N0ZA 3KP9A 6GSSA 1HD2A 3A5WA 5ECPB 3C73A 3FZ5A 2GSQA 1ERUA 5D96A 4KNDA 1XWAA 3TKPA 1XW9A 2PERA 4NAXA 2LQOA 1O85A 4ZL8A 4G10A 1QQ2A 1B9XC 1SKRB 3HVXA 1FB6A 1ERVA 2BJXA 3GKKA 4PX1A 3O76A 5DAKA 3KTBA 1X5EA 3ZFLA 5DDLA 1WIKA 4J57E 4JU5A 3TKQA 1DSBA 3W8SA 1XWGA 2OADA 3QAWA 1EV9A 5G5FA 2AAWA 4Q5FA 2R5GA 4F0CA 7GSSA 2HSYA 5C04A 1GP1A 1TRUA 2WZ9A 1XWCA 5CO3A 2YNXA 1OYJA 1TU7A 4EDYA 1GUKA 4X0XA 5JCWA 4ECJA 4MF5A 4KUNA 1WWJA 3KXOA 3C7MA 4YQUA 1K0DA 2A2RA 5HFIA 4RQXA 5G31A 5D9XA
chains in the Genus database with same CATH superfamily
3IC4A 4MK3A 1Y6EA 4OCFA 4GSTA 1HNCA 3HJOA 2WJUA 1N2AA 1GSUA 4K7IA 1R5AA 2GDRA 2M46A 1YDKA 3H1NA 3KEBA 3DGQA 4JRRA 2LRTA 3LW9A 3CRTA 4TR4A 3HVNA 2DJKA 5CNWA 5F06A 5KN2A 1DE1A 2CVBA 4MCUA 1DE2A 4IGJA 2O7KA 1TI3A 4XHMA 4IKHA 2IFQA 2R37A 5KOWA 2WRTA 1J9BA 1T00A 2ZNMA 4IS0A 2EIRA 2FNOA 3O3TA 1JLWA 3IA1A 1GSSA 1ZMAA 2JU5A 3TGZA 4KX4A 5FWGA 4WR5A 1YKAA 1Z6NA 3MSZA 3UVHA 2C8UA 1G6WA 4JR4A 1ERWA 3ED3A 2YJHA 1VF1A 3M0FA 4K0NA 2FWGA 1Z6MA 3M9KA 5CRWA 3FR3A 5G1LA 2GT5A 2YV7A 1PN0A 4HS1A 4BVYB 3F4SA 3WGXA 4N11A 3VK9A 3FZAA 5LNKe 2FD3A 5J9BA 1E6BA 3LQ7A 2GSSA 1A8LA 4I2UA 4MF7A 2C1YA 5KOXA 1GSEA 3UBKA 2QSIA 1PL2A 4IQ1A 2LSTA 1YKCA 2GQKA 3ME8A 3J7Yb 3QDNA 2JZSA 3RHCA 1ABAA 1RK4A 4G0KA 4HJMA 1A8YA 2DIZA 2GTUA 2VCZA 4NXIA 2P5RA 3RHBA 5BMUA 4LMWA 2YOIA 3PINA 4O92A 1TXXA 2RLIA 5ECMB 1GNWA 4G9HA 4O7HA 2XHFA 4XTSA 3WYWA 4TR3A 4IJ3A 4Q5NA 3TJJA 5ELGA 3FW2A 3HVSA 3HZ4A 1T4ZA 4FIWA 2LKUA 4BWSA 2IJYA 4V2LA 3ZL5A 5AGYA 3DRNA 4K2DA 3KGKA 2A2SA 1GTUA 2GT6A 3TRQA 1WJKA 2MZCA 1AC1A 2XBIA 2ON7A 1PQNA 4JZQA 3J7Yk 3CXGA 3APOA 5JWRB 2O85A 3LYPA 2WFCA 3JCML 2PN8A 4ULXA 4EUYA 2V6OA 3IHGA 3NOFA 3UMAA 2L5LA 6GSWA 1EEJA 2DKHA 3ME7A 4KDXA 3H4KA 1BX9A 5J41A 1FO5A 1PRXA 4WKWA 1UA5A 3DVXA 4EVMA 4EIQA 4DVCA 2I4AA 2GSTA 3RPNA 1X9SB 2IL3A 2WCIA 1GLQA 1YY7A 3TRPA 1G7EA 4K2XA 4TKYA 2B1KA 1H4OA 4FYBA 1A2LA 2K8SA 4XRAA 2AHEA 3D21A 3TDGA 3GTUB 3GMFA 4XS1A 2VUPA 4NPBA 2OACA 1K3OA 3E0UA 2FA4A 4K5SA 4ACSA 1JHBA 2G2QA 2C3TA 3SWLA 2H76A 3K8NA 3ZVJA 2YV9A 2HYXA 4KF9A 5KN3A 2K6VA 3P7XA 5LD0A 3RBTA 5DBQA 1Y25A 3HKRA 1WRYA 2F9SA 3H93A 3GYKA 3Q74A 1XVQA 3GSTA 4HOJA 1ZOFA 3CMIA 4K5RA 2X64A 1Q98A 3P8WA 1GULA 1WOUA 2H74A 1O81A 3GL3A 3D0ZA 3R3EA 4NV5A 3M1GA 3KCMA 4HUAA 5B7CA 2L59A 4GTUA 4I97A 3LXZA 4MNNA 2P31A 4XS4B 3QMXA 2VLVA 4EO3A 2L4QA 3QOUA 1K0MA 4EKZA 2GSRA 3BBYA 5HFGA 1SJZA 3F6FA 1VF2A 3D22A 4IQAA 1VRSD 2B5YA 3A5IA 2R0CA 3ZTLA 4TVEA 13GSA 1XBSA 4GQFA 4BL7B 4OFTA 4N30A 4EL1A 3CSIA 1KEBA 4PNFA 3HCZA 2LTKA 4A5PA 1PMTA 5EY6A 5HR1A 4GF0A 1ZZYA 3IXRA 3KH9A 1U3AA 5G30A 2H70A 1TTZA 4JEDA 1FG4A 5IMZA 4X43A 14GSA 2AV4A 2LNTA 1X5CA 2H1AA 4F2IA 2F8FA 5B6MA 1M2BA 3IK7A 4XS6A 2H1GA 2OE0A 1J0FA 1XVWA 5IIZA 3EURA 1AW9A 5JWOB 3V1WA 3LEFA 2HNLA 3EYTA 1TDIA 4G0LA 3HY2A 1F2EA 3US3A 4LL4B 1X9WB 2OJLA 2CVDA 2OE3A 4TR1A 4L5OA 1YEPA 2NPBA 3FZ4A 2H71A 3SBCA 20GSA 1TRVA 1B4PA 1THXA 1Q4JA 5KEJA 3BJ5A 4H86A 4GWRA 1NW2A 1ILOA 2I9HA 2VCTA 4G0IA 4MH2A 1THOA 3L9VA 2BMXA 4ISDA 2HRFA 1XWBA 2VL2C 4ILFA 5CYYA 4TXOB 4BIKA 2XBQA 5IPGA 2LJRA 1TP9A 2L4CA 1V9WA 1K0CA 3CTFA 3TKSE 4MZBA 3LXTA 3ERFA 5JCUA 3C1SA 3TRXA 4F0BA 4HQZA 2ALBA 1ZCPA 2DC5A 2B1LA 1M3IA 2H30A 2K18A 2F8AA 4V2NA 4RI6A 4FO5A 4F03A 2FY6A 1SU9A 1S3RA 1KBNA 1UN2A 4OD7A 1B4QA 4V2MA 2HRKA 4TRXA 1S3AA 2AB6A 3PPUA 1U88A 2HZEB 1BYEA 5DVBA 4HQSA 1EWXA 4WR4A 1NM3A 4BWQA 1WP0A 4Q5QA 4MLYA 4MH3A 2YANA 1B48A 3GTUA 4K0GA 5B6NA 4TN8A 1XG8A 1F37A 1H75A 5ECIB 4QQ7A 2YZUA 1FB0A 4IELA 2EIQA 3IR4A 1M3JA 1YF0A 3MWHA 3EVIA 4PNGA 3MIXA 3TOUA 1YJ6A 3CYNA 4POKA 1XIYA 2VCQA 3A3TA 4ZILA 3UOMA 3GN3A 2H6XA 3NIVA 4EF0A 3G7IA 1QUWA 4AJ8A 5KN1A 3ZLPA 3FHKA 3QFAC 2FGXA 1W89A 4FQUA 4KCEA 4FH8A 4XCSA 5KN0A 2YJ7A 3BOAA 3N5OA 2F3MA 1GTBA 4HSCX 3IK9A 4FYUA 2CX4A 3FEUA 3HVVA 2GS3A 2FWEA 4AGSA 5LCZA 1AIUA 4XS4A 1GTAA 4RUVA 1XOAA 1NHOA 3UJ1A 4OFMA 1M99A 1XZOA 1HYUA 1FVJA 1CQGA 5J9CA 1B8XA 3I9V2 1OAZA 4O5QA 4NHZA 4TR0A 1FHEA 1Z7PA 3H79A 3Q6OA 3EE2A 4KCAA 3GUSA 3LWAA 4ZB9A 2NTOA 3PGTA 1AQWA 1ERTA 1N8JA 2VLTA 2PGTA 4BL7A 2PVOC 2YWMA 3GKXA 5CRHA 2R0PA 2ZCTA 1SYXA 4K7NA 3KD0A 2FCHA 5EVOA 2KHPA 1I9DA 4ZBDA 2OKAA 1LU4A 2DMLA 4D73B 1G7OA 3EPTA 3WT1A 3HJMA 4PGTA 5IMVA 5DQYA 2DJ0A 12GSA 2O87A 4I8BA 3CBUA 1MDKA 3ERWA 4KSOA 5COHA 3ERGA 3GSSA 1QK8A 1O7UA 1R7HA 2IPAA 4HJ2A 5CRGA 1ON4A 2X8HA 1EGRA 2IWTA 1GSYA 1U87A 5IOXA 3DVWA 3IBHA 2WULA 3RAZA 3ZFBA 1XOBA 1QXHA 1E2YA 2LS5A 4KW6A 2VM2A 3KJYA 1PA3A 2UZ8A 3L9SA 3IHQA 4TR1B 4RQRA 5GSSA 3ZVJD 6GSUA 4IBPA 4XRDA 3P90A 3L9UA 1XXUA 5B8BA 1PN9A 4HDEA 2H75A 2LJAA 4HU7A 2KOKA 2X8CA 5D8IA 1CQHA 1V98A 1WPIA 2H8LA 4DSQA 5GSTA 2YP6A 3RPPA 2IMKA 2GQMA 4IJIA 4TXOA 1K0OA 2DIYA 4ZB6A 2YWIA 3D4MA 2H72A 2L6DA 5D9TA 4PTSA 1PD21 3HJPA 1WMJA 2TRXA 4LMVA 5DJLA 2BTOT 2HRNA 3C71A 3TUEA 1XW5A 3G7YA 5F07A 5IQYA 1MTCA 2IMEA 1MD4A 1Z9HA 3GHAA 5ECNB 5G1KA 4OO4A 4TOPA 1Z7RA 1F3BA 5A4VA 5IO2A 1GTIA 4GSNA 1SD8A 2M80A 2HZEA 1TJDA 6GSXA 1XCCA 2GVPA 3IC8A 2K8VA 1GH2A 11GSA 2JSZA 3FY7A 1SL0B 3IRAA 3L4NA 2VCVA 4V1Ap 4WF5A 1HNBA 2IN3A 1BEDA 2ZUPA 5HR2A 1SJIA 2E2GA 1V40A 3TJFA 4GSSA 1TRWA 3UARA 5C00A 2LNSA 3ZMKA 17GSA 2PMTA 3VPQA 2C4JA 1SKWB 2B5EA 4Z2UA 3WT2A 1TKDB 1ML6A 1SKSB 2H73A 2NBSA 3FR9A 3LG6A 4K6XA 2MMZA 2QA1A 1PSQA 2H66A 4YQVA 4L0WA 1M0UA 1ZYPA 2X49A 4OFNA 3QFBC 4CHSA 3IE3A 3EMPA 4N0VA 2R2JA 4AF2A 4NHWA 4I2TA 3EMXA 5H5QA 1A2MA 2DJ3A 4GCIA 2RIIA 2PWJA 2GZYA 4YAVA 4KDUA 2B7JA 3UAPA 5J4UA 2DJ1A 4G2EA 4O5RA 1TK5B 1FW1A 3Q19A 4E8HA 4CW9A 3MAKA 5DCHA 3QR6A 4MDCA 1QFNA 1ACVA 1K0NA 5F05A 3DWVA 2IMDA 2OE1A 3KP8A 3HA9A 1HQOA 3CQFA 2DLXA 2CT6A 3HHVA 2O89A 2X8GA 1QMVA 1J08A 5F8BA 1SL2B 2LRCA 3ZMLA 5ECQB 2ON5A 2H1BA 5ENUA 3IOSA 2RM5A 4EIPA 3C1RA 1T1VA 1UC7A 5GZZB 3F4TA 3L0HA 1TOFA 4D73A 1GWCA 1SL1B 2WDUA 4ZBBA 3KIJA 2P0GA 4HI7A 3DXBA 4OWYA 2J9HA 4MMMA 4F82A 2TRCP 1HNAA 3KTLA 3EWLA 4KDYA 4ZBAA 5E59A 4KAEA 6GSYA 2I3YA 5H5SA 5B8AA 3HYPA 3M8NA 1A2JA 3FYGA 2C0DA 3TKSC 5ECLB 1ZGNA 2N5AA 4ZL7A 4OMVA 2MYGA 5HR0A 2K9FA 1R26A 2PUKC 4YKFA 2RM6A 4ML1A 3LYKA 1BJXA 4WEYA 1EP7A 2CV4A 4PQIA 1V57A 2MBTA 3UEMA 2N5FA 3CTGA 2CAIA 4K1FA 5DCGA 1UVZA 4IN0A 2JZTA 1W4VA 3I69A 2AYTA 4V1Ag 5HFKA 1MDJA 2X99A 4JR6A 1EP8A 3HZ8A 3KZQA 4K9ZA 1EZKA 2PVQA 4K8MA 3I6AA 4IHUA 3VFIA 4MJCA 1OE8A 2QGVA 2H0HA 2QA2A 5JWQB 1S3DA 1TRSA 3KH7A 4WXTA 5ECRB 2ES7A 1JZDA 2VCWA 1SK0A 2HSMA 2I1UA 2C3NA 1K3YA 4HEA2 5D9VA 1B9YC 1FOHA 3BCIA 4LA1A 4CDOA 5DJMA 3G9BA 4BVXB 1U6TA 3G7JA 4DSRA 2C80A 2FLSA 4BPYA 3WGDA 2HT9A 4G19A 2VL2A 1GUMA 2V6KA 3GH6A 3DIEA 1SK2A 4HZ4A 4I5QA 4PQHA 3ZZXA 1ZYNA 4IW9A 3NZNA 4ECIA 4ZIJA 4CY8A 3LORA 2IMFA 4MA9A 2LRNA 3GNJA 3D6IA 3GL5A 2J23A 2WB9A 2KP1A 1OC9B 4J56E 1TU8A 1GSQA 3Q18A 3VPTA 2FA8A 3D5JA 3VI7A 1SD9A 5EPFA 2AUVA 3UVTA 3LGCA 1RW1A 4KSMA 1GL8A 4F9ZA 4E8EA 1BG5A 1AUCA 4POMA 5AIXA 2L5OA 1GRXA 2MBSA 2VCXA 4JBBA 4HZ2A 1M2DA 4ZB8A 5G2ZA 3QD9A 4HU9A 5L71A 5ECHB 1PGTA 1EOHA 1K0BA 1FOVA 1R4WA 1TI1A 3IV4A 2FHEA 2FUG2 4RI7A 2N5BA 4MJAA 2VLUA 2CA8A 3F0IA 3W6GA 1T3BA 1V2AA 2YWOA 1A0FA 1AQXA 3L78A 4WBJA 3C8EA 5ECSA 1JZRA 4X4JA 5BRTA 2RUFA 5A4UA 2E0QA 1F3AA 6GSVA 4GXZA 4USSA 1XWKA 2HLSA 3EC3A 1MD3A 3QAGA 3ZREA 4MZCA 2E7PA 3EU4A 2XPEA 5DQSA 6GSTA 1XPVA 2JSYA 3U5RE 1OKDA 2VM1A 3ZIJA 5CREA 2VL9A 2CX3A 5IMCA 4WETA 5ABRA 3TB2A 3WD6A 1XW6A 1TK8B 2HSHA 4JE1A 4ECBA 4EXJA 5J3RA 4PXOA 1DBYA 22GSA 1SJ6A 2G0FA 5IM9A 1KTEA 3IPZA 4KH7A 1IYHA 3ZITA 2L6CA 4MPFA 3LJRA 4BA7A 3CRUA 5A4WA 4DSSB 3A2XA 2H0IA 1A24A 4TXVA 1X5DA 2YPMA 3H8QA 2YWNA 3HDCA 5HR3A 3GFKA 1GLPA 1YF1A 5DALB 3TJKA 5D93A 2HXKA 2NDOA 3N9JA 1EOGA 4LL1B 4MJBA 4MJEA 3APSA 5GAPD 2AJQB 5IMFA 4IVFA 2IMIA 4LLRA 3LFLA 3PR8A 2A4HA 3TJGA 2EIOA 3GIXA 1RQMA 2M72A 1X0RA 2XC2A 4MABA 1YQ1A 4PQ1A 1M9AA 1WE0A 2R3XA 1JLVA 5ELAA 3MYDA 1IYIA 4Z2RA 2R4VA 1M9BA 2REMA 3HXSA 5IPHA 1KNGA 4L0UA 1GSFA 2YN1A 3O6TA 2F51A 1X9MB 2GLRA 1O8XA 1NHYA 2VO4A 4EC0A 4ZXGA 3CSHA 3KM6A 1DUGA 1USBA 5JCGA 1OC3A 3FMWA 4Q5RA 2LEGA 3I43A 5AISA 4ICYA 2JZRA 2JADA 1NSWA 16GSA 4YH2A 1SENA 4BVXA 5ECOB 4I6XA 5IMAA 1BAYA 2HRAA 2H6ZA 4QL9A 3VWVA 3GKNA 3F8UA 2MMNA 5E4WA 1S3CA 1U3IA 2VAFA 2QKEA 3QPMA 3VWXA 2XPDA 3VWUA 3A2WA 2L57A 3W8JA 3TCOA 2LQQA 1V58A 5ID2A 2I81A 4POBA 3GURA 1OC9A 4EDZA 2B5XA 3ZRDA 1OKTA 2MMAA 3IAS2 2R0GA 3P2AA 3EINA 18GSA 4O5UA 3UIWA 3WGEA 1T4YA 4KB3A 3TKRA 4O32A 4IP1A 5FHIA 2JL4A 2X4AA 2LV3A 3DKSA 3GRXA 2DBCA 2OBIA 4K7OA 1LJRA 4EE0A 2CVKA 2RUEA 1GUHA 3PH9A 4CY6A 3RDWA 2NVLA 3DYRA 4QL7A 2VD1A 3GV1A 5D73A 2MMOA 5EL8A 1ST9A 3VLNA 4Z7XA 3F3QA 3KMOA 4ECCA 2DJJA 2PPTA 1AQVA 3CSJA 4MZWA 4AJ6A 1SYRA 9GSSA 4MPGA 1TW9A 3AY8A 3IDVA 3GH9A 2VOCA 3GA4A 5IMDA 1VGLA 4ZL9A 1O6JA 1JZWA 2CZ2A 3VI5A 3APQA 4NV2A 2YZHA 1BQ7A 5DAKB 2B3SA 1GSDA 3M9JA 2FWFA 4N10A 1PKZA 1OVNA 5GAND 3VURA 4PURA 3GX0A 2KP2A 4GRFA 2PBJA 3F3RA 1MDIA 2DSAA 4AJ7A 3GKMA 2DMMA 2B7KA 3LSZA 4POLA 3A2VA 1PL1A 2LUSA 2HZFA 3QAVA 3TOTA 2YCDA 4YAPA 4FYCA 2HFDA 2QC7A 2V41A 2O8VB 2HI7A 2B6MA 1SK1A 4MP4A 4OCEA 3IAM2 3MNGA 4J2FA 2JACA 3F4RA 3HD5A 1PFOA 2C0FA 3TJBA 2FWHA 3OR5A 2H1DA 4PUAA 4TW5A 5HQPA 3ZYWA 4NMUA 3R2QA 2H0GA 1AXDA 3F6DA 1A23A 4P3YB 2A2PA 2V2GA 3DMLA 19GSA 1AAZA 1QGVA 2E2MA 2PU9C 4DSSA 4L8EA 5IOWA 4KGIA 2C0EA 5CRDA 4GLTA 2V32A 3FZ9A 2DKIA 4X1UA 5DALA 3UL3A 3EU3A 1Z3EA 2D2ZA 1YZXA 4IP6A 2IFQB 3D4TA 5AN1A 1MEKA 4KA0A 2CQ9A 3F9UA 3FKFA 4XIHA 5G5EA 2LJKA 1PX7A 1FVKA 2Z9SA 4ML6A 1K0AA 3S9FA 4DEJA 8GSSA 1JZOA 4BVYA 3ZIVA 5A5KA 2EC4A 2OBKA 5J5NA 4WF4A 3U6VA 2IIYA 4OO5A 1M7TA 3TKSA 1C72A 2KLXA 3ISOA 3BCKA 5H5RA 2VIMA 3FR6A 3FRCA 2GGTA 1T7PB 1JFUA 1PX6A 1O73A 2C3QA 3BD2A 5FT3A 2P5QA 4GQCA 4L5LA 1T8EB 4WBRD 3FK8A 5CAXA 4MF6A 2DJ2A 3DEXA 4PUFC 1YEXA 1ZYQB 1F6MC 3M3MA 2H19A 1OC8A 2R6KA 1F9MA 1G6YA 4Z2TA 10GSA 2GQLA 3E3EA 3QCPA 3VWWA 5AIVA 2A4VA 2V1MA 3F63A 5CP1A 1EV4A 1EEMA 3E9JB 1XFLA 1URMA 3MDKA 2GZZA 1A0RP 1PKWA 1I5GA 2OA7A 1Z5YE 5ECKB 1R5PA 4YQMA 2VL3A 4YKGA 1TK0B 1ZYEA 4NWYA 3GX8A 2CZ3A 1LBKA 5D9WA 2HE3A 1G0TA 5INYA 3UBLA 5ID2B 2KUCA 1O8WA 1VF4A 2WS2A 1M2AA 2WGRA 5F0GA 1ZL9A 2GZPA 2TIRA 2VD0A 4KE3A 1FAAA 2H6YA 1GNEA 1EGOA 5IO0A 3KMNA 2CAQA 2C0GA 1VF3A 4ID0A 1K3LA 2H01A 3DD3A 1OE7A 4N0ZA 3KP9A 6GSSA 1HD2A 3A5WA 5ECPB 3C73A 3FZ5A 2GSQA 1ERUA 5D96A 4KNDA 1XWAA 3TKPA 1XW9A 2PERA 4NAXA 2LQOA 1O85A 4ZL8A 4G10A 1QQ2A 1B9XC 1SKRB 3HVXA 1FB6A 1ERVA 2BJXA 3GKKA 4PX1A 3O76A 5DAKA 3KTBA 1X5EA 3ZFLA 5DDLA 4JU5A 1WIKA 4J57E 3TKQA 1DSBA 3W8SA 1XWGA 2OADA 3QAWA 1EV9A 5G5FA 2AAWA 4Q5FA 2R5GA 4F0CA 7GSSA 2HSYA 5C04A 1GP1A 1TRUA 2WZ9A 1XWCA 5CO3A 2YNXA 1OYJA 1TU7A 4EDYA 1GUKA 4X0XA 5JCWA 4ECJA 4MF5A 4KUNA 1WWJA 3KXOA 3C7MA 4YQUA 1K0DA 2A2RA 5HFIA 4RQXA 5G31A 5D9XA
chains in the Genus database with same CATH topology
3IC4A 4MK3A 1Y6EA 4OCFA 4GSTA 1HNCA 3HJOA 2WJUA 1N2AA 1GSUA 4K7IA 1R5AA 2GDRA 2M46A 1YDKA 3H1NA 3KEBA 3DGQA 4JRRA 2LRTA 3LW9A 3CRTA 4TR4A 2DJKA 5CNWA 5F06A 5KN2A 1DE1A 2CVBA 4MCUA 1DE2A 4IGJA 2O7KA 1TI3A 4XHMA 4IKHA 2IFQA 2R37A 5KOWA 2WRTA 1J9BA 1T00A 2ZNMA 4IS0A 2EIRA 2FNOA 3O3TA 1JLWA 3IA1A 1GSSA 1ZMAA 2JU5A 3TGZA 4KX4A 5FWGA 4WR5A 1YKAA 1Z6NA 3MSZA 3UVHA 2C8UA 1G6WA 4JR4A 1ERWA 3ED3A 2YJHA 1VF1A 3M0FA 4K0NA 2FWGA 1Z6MA 3M9KA 5CRWA 3FR3A 5G1LA 2GT5A 2YV7A 1PN0A 4HS1A 4BVYB 3F4SA 3WGXA 4N11A 3VK9A 3FZAA 5LNKe 2FD3A 5J9BA 1E6BA 3LQ7A 2GSSA 1A8LA 4I2UA 4MF7A 2C1YA 5KOXA 1GSEA 3UBKA 2QSIA 1PL2A 4IQ1A 2LSTA 1YKCA 2GQKA 3ME8A 3J7Yb 3QDNA 2JZSA 3RHCA 1ABAA 1RK4A 4G0KA 4HJMA 1A8YA 2DIZA 2GTUA 2VCZA 4NXIA 2P5RA 3RHBA 5BMUA 4LMWA 2YOIA 3PINA 4O92A 1TXXA 2RLIA 5ECMB 1GNWA 4G9HA 4O7HA 2XHFA 4XTSA 3WYWA 4TR3A 4IJ3A 4Q5NA 3TJJA 5ELGA 3FW2A 3HVSA 3HZ4A 1T4ZA 4FIWA 2LKUA 4BWSA 2IJYA 4V2LA 3ZL5A 5AGYA 3DRNA 4K2DA 3KGKA 2A2SA 1GTUA 2GT6A 3TRQA 1WJKA 2MZCA 1AC1A 2XBIA 2ON7A 1PQNA 4JZQA 3J7Yk 3CXGA 3APOA 5JWRB 2O85A 3LYPA 2WFCA 3JCML 2PN8A 4ULXA 4EUYA 2V6OA 3IHGA 3NOFA 3UMAA 2L5LA 6GSWA 1EEJA 2DKHA 3ME7A 4KDXA 3H4KA 1BX9A 5J41A 1FO5A 1PRXA 4WKWA 1UA5A 3DVXA 4EVMA 4EIQA 4DVCA 2I4AA 2GSTA 3RPNA 1X9SB 2IL3A 2WCIA 1GLQA 1YY7A 3TRPA 1G7EA 4K2XA 4TKYA 2B1KA 1H4OA 4FYBA 1A2LA 2K8SA 4XRAA 2AHEA 3D21A 3TDGA 3GTUB 3GMFA 4XS1A 2VUPA 4NPBA 2OACA 1K3OA 3E0UA 2FA4A 4K5SA 4ACSA 1JHBA 2G2QA 2C3TA 3SWLA 2H76A 3K8NA 3ZVJA 2YV9A 2HYXA 4KF9A 5KN3A 2K6VA 3P7XA 5LD0A 3RBTA 5DBQA 1Y25A 3HKRA 1WRYA 2F9SA 3H93A 3GYKA 3Q74A 1XVQA 3GSTA 4HOJA 1ZOFA 3CMIA 4K5RA 2X64A 1Q98A 3P8WA 1GULA 1WOUA 2H74A 1O81A 3GL3A 3D0ZA 3R3EA 4NV5A 3M1GA 3KCMA 4HUAA 5B7CA 2L59A 4GTUA 4I97A 3LXZA 4MNNA 2P31A 4XS4B 3QMXA 2VLVA 4EO3A 2L4QA 3QOUA 1K0MA 4EKZA 2GSRA 3BBYA 5HFGA 1SJZA 3F6FA 1VF2A 3D22A 4IQAA 1VRSD 2B5YA 3A5IA 2R0CA 3ZTLA 4TVEA 13GSA 1XBSA 4GQFA 4BL7B 4OFTA 4N30A 4EL1A 3CSIA 1KEBA 4PNFA 3HCZA 2LTKA 4A5PA 1PMTA 5EY6A 5HR1A 4GF0A 1ZZYA 3IXRA 3KH9A 1U3AA 5G30A 2H70A 1TTZA 4JEDA 1FG4A 5IMZA 4X43A 14GSA 2AV4A 2LNTA 1X5CA 2H1AA 4F2IA 2F8FA 5B6MA 1M2BA 3IK7A 4XS6A 2H1GA 2OE0A 1J0FA 1XVWA 5IIZA 3EURA 1AW9A 5JWOB 3V1WA 3LEFA 2HNLA 3EYTA 1TDIA 4G0LA 3HY2A 1F2EA 3US3A 4LL4B 1X9WB 2OJLA 2CVDA 2OE3A 4TR1A 4L5OA 1YEPA 2NPBA 3FZ4A 2H71A 3SBCA 20GSA 1TRVA 1B4PA 1THXA 1Q4JA 5KEJA 3BJ5A 4H86A 4GWRA 1NW2A 1ILOA 2I9HA 2VCTA 4G0IA 4MH2A 1THOA 3L9VA 2BMXA 4ISDA 2HRFA 1XWBA 2VL2C 4ILFA 5CYYA 4TXOB 2XBQA 5IPGA 2LJRA 1TP9A 2L4CA 1V9WA 1K0CA 3CTFA 3TKSE 4MZBA 3LXTA 3ERFA 5JCUA 3C1SA 3TRXA 4F0BA 4HQZA 2ALBA 1ZCPA 2DC5A 2B1LA 2H30A 2K18A 2F8AA 4V2NA 4RI6A 4FO5A 4F03A 2FY6A 1SU9A 1KBNA 1UN2A 4OD7A 1B4QA 4V2MA 2HRKA 4TRXA 1S3AA 2AB6A 3PPUA 1U88A 2HZEB 1BYEA 5DVBA 4HQSA 1EWXA 4WR4A 1NM3A 4BWQA 1WP0A 4Q5QA 4MLYA 4MH3A 2YANA 1B48A 3GTUA 4K0GA 5B6NA 4TN8A 1F37A 1H75A 5ECIB 4QQ7A 2YZUA 1FB0A 4IELA 2EIQA 3IR4A 1YF0A 3MWHA 3EVIA 4PNGA 3MIXA 3TOUA 1YJ6A 3CYNA 4POKA 1XIYA 2VCQA 3A3TA 4ZILA 3UOMA 3GN3A 2H6XA 3NIVA 4EF0A 3G7IA 1QUWA 4AJ8A 5KN1A 3ZLPA 3FHKA 3QFAC 2FGXA 1W89A 4FQUA 4KCEA 4FH8A 4XCSA 5KN0A 2YJ7A 3BOAA 3N5OA 2F3MA 1GTBA 3IK9A 4FYUA 2CX4A 3FEUA 3HVVA 2GS3A 2FWEA 4AGSA 5LCZA 1AIUA 4XS4A 1GTAA 4RUVA 1XOAA 1NHOA 3UJ1A 4OFMA 1M99A 1XZOA 1HYUA 1FVJA 1CQGA 5J9CA 1B8XA 3I9V2 1OAZA 4O5QA 4NHZA 4TR0A 1FHEA 1Z7PA 3H79A 3Q6OA 3EE2A 4KCAA 3GUSA 3LWAA 4ZB9A 2NTOA 3PGTA 1AQWA 1ERTA 1N8JA 2VLTA 2PGTA 4BL7A 2PVOC 2YWMA 3GKXA 5CRHA 2R0PA 2ZCTA 1SYXA 4K7NA 3KD0A 2FCHA 5EVOA 2KHPA 1I9DA 4ZBDA 2OKAA 1LU4A 2DMLA 4D73B 1G7OA 3EPTA 3WT1A 3HJMA 4PGTA 5IMVA 5DQYA 2DJ0A 12GSA 2O87A 4I8BA 3CBUA 1MDKA 3ERWA 4KSOA 5COHA 3ERGA 3GSSA 1QK8A 1O7UA 1R7HA 2IPAA 4HJ2A 5CRGA 1ON4A 2X8HA 1EGRA 2IWTA 1GSYA 1U87A 5IOXA 3DVWA 3IBHA 2WULA 3RAZA 3ZFBA 1XOBA 1QXHA 1E2YA 2LS5A 4KW6A 2VM2A 3KJYA 1PA3A 2UZ8A 3L9SA 3IHQA 4TR1B 4RQRA 5GSSA 3ZVJD 6GSUA 4IBPA 4XRDA 3P90A 3L9UA 1XXUA 5B8BA 1PN9A 4HDEA 2H75A 2LJAA 4HU7A 2KOKA 2X8CA 5D8IA 1CQHA 1V98A 1WPIA 2H8LA 4DSQA 5GSTA 2YP6A 3RPPA 2IMKA 2GQMA 4IJIA 4TXOA 1K0OA 2DIYA 4ZB6A 2YWIA 3D4MA 2H72A 2L6DA 5D9TA 4PTSA 1PD21 3HJPA 1WMJA 2TRXA 4LMVA 5DJLA 2BTOT 2HRNA 3C71A 3TUEA 1XW5A 3G7YA 5F07A 5IQYA 1MTCA 2IMEA 1MD4A 1Z9HA 3GHAA 5ECNB 5G1KA 4OO4A 4TOPA 1Z7RA 1F3BA 5A4VA 5IO2A 1GTIA 4GSNA 1SD8A 2M80A 2HZEA 1TJDA 6GSXA 1XCCA 2GVPA 3IC8A 2K8VA 1GH2A 11GSA 2JSZA 3FY7A 1SL0B 3IRAA 3L4NA 2VCVA 4V1Ap 4WF5A 1HNBA 2IN3A 1BEDA 2ZUPA 5HR2A 1SJIA 2E2GA 1V40A 3TJFA 4GSSA 1TRWA 3UARA 5C00A 2LNSA 3ZMKA 17GSA 2PMTA 3VPQA 2C4JA 1SKWB 2B5EA 4Z2UA 3WT2A 1TKDB 1ML6A 1SKSB 2H73A 2NBSA 3FR9A 3LG6A 4K6XA 2MMZA 2QA1A 1PSQA 2H66A 4YQVA 4L0WA 1M0UA 1ZYPA 2X49A 4OFNA 3QFBC 4CHSA 3IE3A 3EMPA 4N0VA 2R2JA 4AF2A 4NHWA 4I2TA 3EMXA 5H5QA 1A2MA 2DJ3A 4GCIA 2RIIA 2PWJA 2GZYA 4YAVA 4KDUA 2B7JA 3UAPA 5J4UA 2DJ1A 4G2EA 4O5RA 1TK5B 1FW1A 3Q19A 4E8HA 4CW9A 3MAKA 5DCHA 3QR6A 4MDCA 1QFNA 1ACVA 1K0NA 5F05A 3DWVA 2IMDA 2OE1A 3KP8A 3HA9A 1HQOA 2DLXA 2CT6A 3HHVA 2O89A 2X8GA 1QMVA 1J08A 5F8BA 1SL2B 2LRCA 3ZMLA 5ECQB 2ON5A 2H1BA 5ENUA 3IOSA 2RM5A 4EIPA 3C1RA 1T1VA 1UC7A 5GZZB 3F4TA 3L0HA 1TOFA 4D73A 1GWCA 1SL1B 2WDUA 4ZBBA 3KIJA 2P0GA 4HI7A 3DXBA 4OWYA 2J9HA 4MMMA 4F82A 2TRCP 1HNAA 3KTLA 3EWLA 4KDYA 4ZBAA 5E59A 4KAEA 6GSYA 2I3YA 5H5SA 5B8AA 3HYPA 3M8NA 1A2JA 3FYGA 2C0DA 3TKSC 5ECLB 1ZGNA 2N5AA 4ZL7A 4OMVA 2MYGA 5HR0A 2K9FA 1R26A 2PUKC 4YKFA 2RM6A 4ML1A 3LYKA 1BJXA 4WEYA 1EP7A 2CV4A 4PQIA 1V57A 2MBTA 3UEMA 2N5FA 3CTGA 2CAIA 4K1FA 5DCGA 1UVZA 4IN0A 2JZTA 1W4VA 3I69A 2AYTA 4V1Ag 5HFKA 1MDJA 2X99A 4JR6A 1EP8A 3HZ8A 3KZQA 4K9ZA 1EZKA 2PVQA 4K8MA 3I6AA 4IHUA 3VFIA 4MJCA 1OE8A 2QGVA 2H0HA 2QA2A 5JWQB 1S3DA 1TRSA 3KH7A 4WXTA 5ECRB 2ES7A 1JZDA 2VCWA 1SK0A 2HSMA 2I1UA 2C3NA 1K3YA 4HEA2 5D9VA 1B9YC 1FOHA 3BCIA 4LA1A 4CDOA 5DJMA 3G9BA 4BVXB 1U6TA 3G7JA 4DSRA 2C80A 2FLSA 4BPYA 3WGDA 2HT9A 4G19A 2VL2A 1GUMA 2V6KA 3GH6A 3DIEA 1SK2A 4HZ4A 4I5QA 4PQHA 3ZZXA 1ZYNA 4IW9A 3NZNA 4ECIA 4ZIJA 4CY8A 3LORA 2IMFA 4MA9A 2LRNA 3GNJA 3D6IA 3GL5A 2J23A 2WB9A 2KP1A 1OC9B 4J56E 1TU8A 1GSQA 3Q18A 3VPTA 2FA8A 3D5JA 3VI7A 1SD9A 5EPFA 2AUVA 3UVTA 3LGCA 1RW1A 4KSMA 1GL8A 4F9ZA 4E8EA 1BG5A 1AUCA 4POMA 5AIXA 2L5OA 1GRXA 2MBSA 2VCXA 4JBBA 4HZ2A 1M2DA 4ZB8A 5G2ZA 3QD9A 4HU9A 5L71A 5ECHB 1PGTA 1EOHA 1K0BA 1FOVA 1R4WA 1TI1A 3IV4A 2FHEA 2FUG2 4RI7A 2N5BA 4MJAA 2VLUA 2CA8A 3F0IA 3W6GA 1T3BA 1V2AA 2YWOA 1A0FA 1AQXA 3L78A 4WBJA 3C8EA 5ECSA 1JZRA 4X4JA 5BRTA 2RUFA 5A4UA 2E0QA 1F3AA 6GSVA 4GXZA 4USSA 1XWKA 2HLSA 3EC3A 1MD3A 3QAGA 3ZREA 4MZCA 2E7PA 3EU4A 2XPEA 5DQSA 6GSTA 1XPVA 2JSYA 3U5RE 1OKDA 2VM1A 3ZIJA 5CREA 2VL9A 2CX3A 5IMCA 4WETA 5ABRA 3TB2A 3WD6A 1XW6A 1TK8B 2HSHA 4JE1A 4ECBA 4EXJA 5J3RA 4PXOA 1DBYA 22GSA 1SJ6A 2G0FA 5IM9A 1KTEA 3IPZA 4KH7A 1IYHA 3ZITA 2L6CA 4MPFA 3LJRA 4BA7A 3CRUA 5A4WA 4DSSB 3A2XA 2H0IA 1A24A 4TXVA 1X5DA 2YPMA 3H8QA 2YWNA 3HDCA 5HR3A 3GFKA 1GLPA 1YF1A 5DALB 3TJKA 5D93A 2HXKA 2NDOA 3N9JA 1EOGA 4LL1B 4MJBA 4MJEA 3APSA 5GAPD 2AJQB 5IMFA 4IVFA 2IMIA 4LLRA 3LFLA 3PR8A 2A4HA 3TJGA 2EIOA 3GIXA 1RQMA 2M72A 1X0RA 2XC2A 4MABA 1YQ1A 4PQ1A 1M9AA 1WE0A 2R3XA 1JLVA 5ELAA 3MYDA 1IYIA 4Z2RA 2R4VA 1M9BA 2REMA 3HXSA 5IPHA 1KNGA 4L0UA 1GSFA 2YN1A 3O6TA 2F51A 1X9MB 2GLRA 1O8XA 1NHYA 2VO4A 4EC0A 4ZXGA 3CSHA 3KM6A 1DUGA 1USBA 5JCGA 1OC3A 3FMWA 4Q5RA 2LEGA 3I43A 5AISA 4ICYA 2JZRA 2JADA 1NSWA 16GSA 4YH2A 1SENA 4BVXA 5ECOB 4I6XA 5IMAA 1BAYA 2HRAA 2H6ZA 4QL9A 3VWVA 3GKNA 3F8UA 2MMNA 5E4WA 1S3CA 1U3IA 2VAFA 2QKEA 3QPMA 3VWXA 2XPDA 3VWUA 3A2WA 2L57A 3W8JA 3TCOA 2LQQA 1V58A 5ID2A 2I81A 4POBA 3GURA 1OC9A 4EDZA 2B5XA 3ZRDA 1OKTA 2MMAA 3IAS2 2R0GA 3P2AA 3EINA 18GSA 4O5UA 3UIWA 3WGEA 1T4YA 4KB3A 3TKRA 4O32A 4IP1A 5FHIA 2JL4A 2X4AA 2LV3A 3DKSA 3GRXA 2DBCA 2OBIA 4K7OA 1LJRA 4EE0A 2CVKA 2RUEA 1GUHA 3PH9A 4CY6A 3RDWA 2NVLA 3DYRA 4QL7A 2VD1A 3GV1A 5D73A 2MMOA 5EL8A 1ST9A 3VLNA 4Z7XA 3F3QA 3KMOA 4ECCA 2DJJA 2PPTA 1AQVA 3CSJA 4MZWA 4AJ6A 1SYRA 9GSSA 4MPGA 1TW9A 3AY8A 3IDVA 3GH9A 2VOCA 3GA4A 5IMDA 1VGLA 4ZL9A 1O6JA 1JZWA 2CZ2A 3VI5A 3APQA 4NV2A 2YZHA 1BQ7A 5DAKB 2B3SA 1GSDA 3M9JA 2FWFA 4N10A 1PKZA 1OVNA 5GAND 3VURA 4PURA 3GX0A 2KP2A 4GRFA 2PBJA 3F3RA 1MDIA 2DSAA 4AJ7A 3GKMA 2DMMA 2B7KA 3LSZA 4POLA 3A2VA 1PL1A 2LUSA 2HZFA 3QAVA 3TOTA 2YCDA 4YAPA 4FYCA 2HFDA 2QC7A 2V41A 2O8VB 2HI7A 2B6MA 1SK1A 4MP4A 4OCEA 3IAM2 3MNGA 4J2FA 2JACA 3F4RA 3HD5A 2C0FA 3TJBA 2FWHA 3OR5A 2H1DA 4PUAA 4TW5A 5HQPA 3ZYWA 4NMUA 3R2QA 2H0GA 1AXDA 3F6DA 1A23A 4P3YB 2A2PA 2V2GA 3DMLA 19GSA 1AAZA 1QGVA 2E2MA 2PU9C 4DSSA 4L8EA 5IOWA 4KGIA 2C0EA 5CRDA 4GLTA 2V32A 3FZ9A 2DKIA 4X1UA 5DALA 3UL3A 3EU3A 1Z3EA 2D2ZA 1YZXA 4IP6A 2IFQB 3D4TA 5AN1A 1MEKA 4KA0A 2CQ9A 3F9UA 3FKFA 4XIHA 5G5EA 2LJKA 1PX7A 1FVKA 2Z9SA 4ML6A 1K0AA 3S9FA 4DEJA 8GSSA 1JZOA 4BVYA 3ZIVA 5A5KA 2EC4A 2OBKA 5J5NA 4WF4A 3U6VA 2IIYA 4OO5A 1M7TA 3TKSA 1C72A 2KLXA 3ISOA 3BCKA 5H5RA 2VIMA 3FR6A 3FRCA 2GGTA 1T7PB 1JFUA 1PX6A 1O73A 2C3QA 3BD2A 5FT3A 2P5QA 4GQCA 4L5LA 1T8EB 4WBRD 3FK8A 5CAXA 4MF6A 2DJ2A 3DEXA 4PUFC 1YEXA 1ZYQB 1F6MC 3M3MA 2H19A 1OC8A 2R6KA 1F9MA 1G6YA 4Z2TA 10GSA 2GQLA 3E3EA 3QCPA 3VWWA 5AIVA 2A4VA 2V1MA 3F63A 5CP1A 1EV4A 1EEMA 3E9JB 1XFLA 1URMA 3MDKA 2GZZA 1A0RP 1PKWA 1I5GA 2OA7A 1Z5YE 5ECKB 1R5PA 4YQMA 2VL3A 4YKGA 1TK0B 1ZYEA 4NWYA 3GX8A 2CZ3A 1LBKA 5D9WA 2HE3A 1G0TA 5INYA 3UBLA 5ID2B 2KUCA 1O8WA 1VF4A 2WS2A 1M2AA 2WGRA 5F0GA 1ZL9A 2GZPA 2TIRA 2VD0A 4KE3A 1FAAA 2H6YA 1GNEA 1EGOA 5IO0A 3KMNA 2CAQA 2C0GA 1VF3A 4ID0A 1K3LA 2H01A 3DD3A 1OE7A 4N0ZA 3KP9A 6GSSA 1HD2A 3A5WA 5ECPB 3C73A 3FZ5A 2GSQA 1ERUA 5D96A 4KNDA 1XWAA 3TKPA 1XW9A 2PERA 4NAXA 2LQOA 1O85A 4ZL8A 4G10A 1QQ2A 1B9XC 1SKRB 3HVXA 1FB6A 1ERVA 2BJXA 3GKKA 4PX1A 3O76A 5DAKA 3KTBA 1X5EA 3ZFLA 5DDLA 4JU5A 1WIKA 4J57E 3TKQA 1DSBA 3W8SA 1XWGA 2OADA 3QAWA 1EV9A 5G5FA 2AAWA 4Q5FA 2R5GA 4F0CA 7GSSA 2HSYA 5C04A 1GP1A 1TRUA 2WZ9A 1XWCA 5CO3A 2YNXA 1OYJA 1TU7A 4EDYA 1GUKA 4X0XA 5JCWA 4ECJA 4MF5A 4KUNA 1WWJA 3KXOA 3C7MA 4YQUA 1K0DA 2A2RA 5HFIA 4RQXA 5G31A 5D9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IC4 A;  4MK3 A;  1Y6E A;  4OCF A;  4GST A;  1HNC A;  3HJO A;  2WJU A;  1N2A A;  1GSU A;  4K7I A;  1R5A A;  2GDR A;  2M46 A;  1YDK A;  3H1N A;  3KEB A;  3DGQ A;  4JRR A;  2LRT A;  3CRT A;  4TR4 A;  2DJK A;  5CNW A;  5F06 A;  5KN2 A;  1DE1 A;  2CVB A;  4MCU A;  1DE2 A;  4IGJ A;  2O7K A;  1TI3 A;  4XHM A;  4IKH A;  2IFQ A;  2R37 A;  2WRT A;  1J9B A;  1T00 A;  2ZNM A;  4IS0 A;  2EIR A;  2FNO A;  3O3T A;  1JLW A;  3IA1 A;  1GSS A;  1ZMA A;  2JU5 A;  3TGZ A;  4KX4 A;  5FWG A;  4WR5 A;  1YKA A;  1Z6N A;  3MSZ A;  3UVH A;  2C8U A;  1G6W A;  4JR4 A;  1ERW A;  3ED3 A;  2YJH A;  1VF1 A;  3M0F A;  4K0N A;  2FWG A;  1Z6M A;  3M9K A;  5CRW A;  3FR3 A;  5G1L A;  2GT5 A;  2YV7 A;  4HS1 A;  3F4S A;  3WGX A;  4N11 A;  3VK9 A;  3FZA A;  5LNK e;  2FD3 A;  5J9B A;  1E6B A;  3LQ7 A;  2GSS A;  1A8L A;  4I2U A;  4MF7 A;  2C1Y A;  1GSE A;  3UBK A;  2QSI A;  1PL2 A;  4IQ1 A;  2LST A;  1YKC A;  2GQK A;  3ME8 A;  3J7Y b;  3QDN A;  2JZS A;  3RHC A;  1ABA A;  1RK4 A;  4HJM A;  1A8Y A;  2DIZ A;  2GTU A;  2VCZ A;  4NXI A;  2P5R A;  3RHB A;  4LMW A;  2YOI A;  3PIN A;  4O92 A;  1TXX A;  2RLI A;  5ECM B;  1GNW A;  4G9H A;  4O7H A;  2XHF A;  4XTS A;  3WYW A;  4TR3 A;  4IJ3 A;  4Q5N A;  3TJJ A;  5ELG A;  3FW2 A;  3HVS A;  3HZ4 A;  1T4Z A;  4FIW A;  2LKU A;  4BWS A;  2IJY A;  4V2L A;  3ZL5 A;  5AGY A;  3DRN A;  4K2D A;  3KGK A;  2A2S A;  1GTU A;  2GT6 A;  3TRQ A;  1WJK A;  2MZC A;  1AC1 A;  2XBI A;  2ON7 A;  1PQN A;  4JZQ A;  3J7Y k;  3CXG A;  3APO A;  5JWR B;  2O85 A;  3LYP A;  2WFC A;  3JCM L;  2PN8 A;  4ULX A;  4EUY A;  2V6O A;  3NOF A;  3UMA A;  2L5L A;  6GSW A;  1EEJ A;  3ME7 A;  4KDX A;  3H4K A;  1BX9 A;  5J41 A;  1FO5 A;  1PRX A;  4WKW A;  1UA5 A;  3DVX A;  4EVM A;  4DVC A;  2I4A A;  2GST A;  3RPN A;  1X9S B;  2IL3 A;  2WCI A;  1GLQ A;  1YY7 A;  3TRP A;  1G7E A;  4TKY A;  2B1K A;  1H4O A;  4FYB A;  1A2L A;  2K8S A;  4XRA A;  2AHE A;  3D21 A;  3TDG A;  3GTU B;  3GMF A;  4XS1 A;  2VUP A;  4NPB A;  2OAC A;  1K3O A;  3E0U A;  2FA4 A;  4ACS A;  1JHB A;  2G2Q A;  2C3T A;  3SWL A;  2H76 A;  3K8N A;  3ZVJ A;  2YV9 A;  2HYX A;  5KN3 A;  2K6V A;  3P7X A;  5LD0 A;  3RBT A;  5DBQ A;  1Y25 A;  3HKR A;  1WRY A;  2F9S A;  3H93 A;  3GYK A;  3Q74 A;  1XVQ A;  3GST A;  4HOJ A;  1ZOF A;  3CMI A;  2X64 A;  1Q98 A;  3P8W A;  1GUL A;  1WOU A;  2H74 A;  1O81 A;  3GL3 A;  3D0Z A;  4NV5 A;  3M1G A;  3KCM A;  4HUA A;  5B7C A;  2L59 A;  4GTU A;  4I97 A;  3LXZ A;  2P31 A;  4XS4 B;  3QMX A;  2VLV A;  4EO3 A;  2L4Q A;  3QOU A;  1K0M A;  4EKZ A;  2GSR A;  3BBY A;  5HFG A;  1SJZ A;  3F6F A;  1VF2 A;  3D22 A;  4IQA A;  1VRS D;  2B5Y A;  3ZTL A;  4TVE A;  13GS A;  1XBS A;  4GQF A;  4OFT A;  4N30 A;  4EL1 A;  3CSI A;  1KEB A;  4PNF A;  3HCZ A;  2LTK A;  1PMT A;  5EY6 A;  5HR1 A;  4GF0 A;  1ZZY A;  3IXR A;  3KH9 A;  1U3A A;  5G30 A;  2H70 A;  1TTZ A;  4JED A;  1FG4 A;  5IMZ A;  4X43 A;  14GS A;  2AV4 A;  2LNT A;  1X5C A;  2H1A A;  4F2I A;  2F8F A;  5B6M A;  1M2B A;  3IK7 A;  4XS6 A;  2H1G A;  2OE0 A;  1J0F A;  1XVW A;  5IIZ A;  3EUR A;  1AW9 A;  5JWO B;  3V1W A;  3LEF A;  2HNL A;  3EYT A;  1TDI A;  3HY2 A;  1F2E A;  3US3 A;  4LL4 B;  1X9W B;  2OJL A;  2CVD A;  2OE3 A;  4TR1 A;  4L5O A;  1YEP A;  2NPB A;  3FZ4 A;  2H71 A;  3SBC A;  20GS A;  1TRV A;  1B4P A;  1THX A;  1Q4J A;  5KEJ A;  3BJ5 A;  4H86 A;  4GWR A;  1NW2 A;  1ILO A;  2I9H A;  2VCT A;  1THO A;  3L9V A;  4MH2 A;  2BMX A;  4ISD A;  2HRF A;  1XWB A;  2VL2 C;  4ILF A;  5CYY A;  4TXO B;  2XBQ A;  5IPG A;  2LJR A;  1TP9 A;  2L4C A;  1V9W A;  1K0C A;  3CTF A;  3TKS E;  4MZB A;  3LXT A;  3ERF A;  5JCU A;  3C1S A;  3TRX A;  4F0B A;  4HQZ A;  2ALB A;  1ZCP A;  2DC5 A;  2B1L A;  2H30 A;  2K18 A;  2F8A A;  4V2N A;  4RI6 A;  4FO5 A;  4F03 A;  2FY6 A;  1SU9 A;  1KBN A;  1UN2 A;  4OD7 A;  1B4Q A;  4V2M A;  4TRX A;  1S3A A;  2AB6 A;  1U88 A;  2HZE B;  1BYE A;  5DVB A;  4HQS A;  1EWX A;  4WR4 A;  1NM3 A;  4BWQ A;  1WP0 A;  4Q5Q A;  4MLY A;  4MH3 A;  2YAN A;  1B48 A;  3GTU A;  4K0G A;  5B6N A;  4TN8 A;  1F37 A;  1H75 A;  5ECI B;  4QQ7 A;  2YZU A;  1FB0 A;  4IEL A;  2EIQ A;  3IR4 A;  1YF0 A;  3MWH A;  3EVI A;  4PNG A;  3TOU A;  1YJ6 A;  3CYN A;  4POK A;  1XIY A;  2VCQ A;  3A3T A;  4ZIL A;  3UOM A;  3GN3 A;  2H6X A;  3NIV A;  4EF0 A;  3G7I A;  1QUW A;  4AJ8 A;  5KN1 A;  3ZLP A;  3FHK A;  3QFA C;  2FGX A;  1W89 A;  4KCE A;  4FH8 A;  4XCS A;  5KN0 A;  2YJ7 A;  3BOA A;  3N5O A;  2F3M A;  1GTB A;  3IK9 A;  4FYU A;  2CX4 A;  3FEU A;  3HVV A;  2GS3 A;  2FWE A;  4AGS A;  5LCZ A;  1AIU A;  4XS4 A;  1GTA A;  4RUV A;  1XOA A;  1NHO A;  3UJ1 A;  4OFM A;  1M99 A;  1XZO A;  1HYU A;  1FVJ A;  1CQG A;  5J9C A;  1B8X A;  3I9V 2;  1OAZ A;  4NHZ A;  4TR0 A;  1FHE A;  1Z7P A;  3H79 A;  3Q6O A;  3EE2 A;  4KCA A;  3GUS A;  3LWA A;  4ZB9 A;  2NTO A;  3PGT A;  1AQW A;  1ERT A;  1N8J A;  2VLT A;  2PGT A;  4BL7 A;  2PVO C;  2YWM A;  3GKX A;  5CRH A;  2ZCT A;  1SYX A;  4K7N A;  3KD0 A;  2FCH A;  5EVO A;  2KHP A;  1I9D A;  4ZBD A;  2OKA A;  1LU4 A;  2DML A;  4D73 B;  1G7O A;  3WT1 A;  3HJM A;  4PGT A;  5IMV A;  5DQY A;  2DJ0 A;  12GS A;  2O87 A;  4I8B A;  3CBU A;  1MDK A;  3ERW A;  4KSO A;  5COH A;  3ERG A;  3GSS A;  1QK8 A;  1O7U A;  1R7H A;  2IPA A;  4HJ2 A;  5CRG A;  1ON4 A;  2X8H A;  1EGR A;  2IWT A;  1GSY A;  1U87 A;  5IOX A;  3DVW A;  3IBH A;  2WUL A;  3RAZ A;  3ZFB A;  1XOB A;  1QXH A;  1E2Y A;  2LS5 A;  4KW6 A;  2VM2 A;  3KJY A;  1PA3 A;  3L9S A;  3IHQ A;  4TR1 B;  4RQR A;  5GSS A;  3ZVJ D;  6GSU A;  4IBP A;  4XRD A;  3P90 A;  3L9U A;  1XXU A;  5B8B A;  1PN9 A;  4HDE A;  2H75 A;  2LJA A;  4HU7 A;  2KOK A;  2X8C A;  5D8I A;  1CQH A;  1V98 A;  1WPI A;  2H8L A;  4DSQ A;  5GST A;  2YP6 A;  3RPP A;  2IMK A;  2GQM A;  4IJI A;  4TXO A;  1K0O A;  2DIY A;  4ZB6 A;  2YWI A;  3D4M A;  2H72 A;  2L6D A;  5D9T A;  1PD2 1;  3HJP A;  1WMJ A;  2TRX A;  4LMV A;  5DJL A;  2BTO T;  2HRN A;  3C71 A;  3TUE A;  1XW5 A;  3G7Y A;  5F07 A;  5IQY A;  1MTC A;  2IME A;  1MD4 A;  1Z9H A;  3GHA A;  5ECN B;  5G1K A;  4OO4 A;  4TOP A;  1Z7R A;  1F3B A;  5A4V A;  5IO2 A;  1GTI A;  4GSN A;  1SD8 A;  2M80 A;  2HZE A;  1TJD A;  6GSX A;  1XCC A;  2GVP A;  2K8V A;  1GH2 A;  11GS A;  2JSZ A;  3FY7 A;  1SL0 B;  3IRA A;  3L4N A;  2VCV A;  4V1A p;  4WF5 A;  1HNB A;  2IN3 A;  1BED A;  2ZUP A;  5HR2 A;  1SJI A;  2E2G A;  1V40 A;  3TJF A;  4GSS A;  1TRW A;  3UAR A;  5C00 A;  2LNS A;  3ZMK A;  17GS A;  2PMT A;  3VPQ A;  2C4J A;  1SKW B;  2B5E A;  3WT2 A;  1TKD B;  1ML6 A;  1SKS B;  2H73 A;  2NBS A;  3FR9 A;  3LG6 A;  4K6X A;  2MMZ A;  1PSQ A;  2H66 A;  4YQV A;  4L0W A;  1M0U A;  4OFN A;  3QFB C;  4CHS A;  3IE3 A;  3EMP A;  4N0V A;  2R2J A;  4AF2 A;  4NHW A;  4I2T A;  3EMX A;  5H5Q A;  1A2M A;  2DJ3 A;  4GCI A;  2RII A;  2PWJ A;  2GZY A;  4YAV A;  4KDU A;  2B7J A;  3UAP A;  5J4U A;  2DJ1 A;  4G2E A;  4O5R A;  1TK5 B;  1FW1 A;  3Q19 A;  4E8H A;  4CW9 A;  3MAK A;  5DCH A;  3QR6 A;  4MDC A;  1QFN A;  1ACV A;  1K0N A;  5F05 A;  3DWV A;  2IMD A;  2OE1 A;  3KP8 A;  3HA9 A;  1HQO A;  2DLX A;  2CT6 A;  3HHV A;  2O89 A;  2X8G A;  1QMV A;  1J08 A;  5F8B A;  1SL2 B;  2LRC A;  3ZML A;  5ECQ B;  2ON5 A;  2H1B A;  5ENU A;  3IOS A;  2RM5 A;  3C1R A;  1T1V A;  1UC7 A;  5GZZ B;  3F4T A;  3L0H A;  1TOF A;  4D73 A;  1GWC A;  1SL1 B;  2WDU A;  4ZBB A;  3KIJ A;  2P0G A;  4HI7 A;  3DXB A;  4OWY A;  2J9H A;  4MMM A;  4F82 A;  2TRC P;  1HNA A;  3KTL A;  3EWL A;  4KDY A;  4ZBA A;  5E59 A;  4KAE A;  6GSY A;  2I3Y A;  5H5S A;  5B8A A;  3HYP A;  3M8N A;  1A2J A;  3FYG A;  2C0D A;  3TKS C;  5ECL B;  1ZGN A;  2N5A A;  4ZL7 A;  4OMV A;  2MYG A;  5HR0 A;  2K9F A;  1R26 A;  2PUK C;  2RM6 A;  4ML1 A;  3LYK A;  1BJX A;  4WEY A;  1EP7 A;  2CV4 A;  4PQI A;  1V57 A;  2MBT A;  3UEM A;  2N5F A;  3CTG A;  2CAI A;  4K1F A;  5DCG A;  1UVZ A;  4IN0 A;  2JZT A;  1W4V A;  3I69 A;  2AYT A;  4V1A g;  5HFK A;  1MDJ A;  2X99 A;  4JR6 A;  1EP8 A;  3HZ8 A;  3KZQ A;  4K9Z A;  1EZK A;  2PVQ A;  4K8M A;  3I6A A;  4IHU A;  3VFI A;  4MJC A;  1OE8 A;  2QGV A;  2H0H A;  5JWQ B;  1S3D A;  1TRS A;  3KH7 A;  4WXT A;  5ECR B;  2ES7 A;  1JZD A;  2VCW A;  1SK0 A;  2I1U A;  2C3N A;  1K3Y A;  4HEA 2;  5D9V A;  1B9Y C;  3BCI A;  4LA1 A;  4CDO A;  5DJM A;  3G9B A;  1U6T A;  3G7J A;  4DSR A;  2C80 A;  2FLS A;  4BPY A;  3WGD A;  2HT9 A;  4G19 A;  2VL2 A;  1GUM A;  2V6K A;  3GH6 A;  3DIE A;  1SK2 A;  4HZ4 A;  4I5Q A;  4PQH A;  3ZZX A;  4IW9 A;  3NZN A;  4ECI A;  4ZIJ A;  3LOR A;  2IMF A;  4MA9 A;  2LRN A;  3GNJ A;  3D6I A;  3GL5 A;  2J23 A;  2WB9 A;  2KP1 A;  1OC9 B;  4J56 E;  1TU8 A;  1GSQ A;  3Q18 A;  3VPT A;  2FA8 A;  3D5J A;  3VI7 A;  1SD9 A;  5EPF A;  2AUV A;  3UVT A;  3LGC A;  1RW1 A;  4KSM A;  1GL8 A;  4F9Z A;  4E8E A;  1BG5 A;  1AUC A;  4POM A;  5AIX A;  2L5O A;  1GRX A;  2MBS A;  2VCX A;  4JBB A;  4HZ2 A;  1M2D A;  4ZB8 A;  5G2Z A;  3QD9 A;  4HU9 A;  5L71 A;  5ECH B;  1PGT A;  1EOH A;  1K0B A;  1FOV A;  1R4W A;  1TI1 A;  3IV4 A;  2FHE A;  2FUG 2;  4RI7 A;  2N5B A;  4MJA A;  2VLU A;  2CA8 A;  3F0I A;  3W6G A;  1T3B A;  1V2A A;  2YWO A;  1A0F A;  1AQX A;  3L78 A;  4WBJ A;  3C8E A;  5ECS A;  1JZR A;  2RUF A;  5A4U A;  2E0Q A;  1F3A A;  6GSV A;  4GXZ A;  1XWK A;  2HLS A;  3EC3 A;  1MD3 A;  3QAG A;  3ZRE A;  4MZC A;  2E7P A;  3EU4 A;  2XPE A;  5DQS A;  6GST A;  1XPV A;  2JSY A;  3U5R E;  1OKD A;  2VM1 A;  3ZIJ A;  5CRE A;  2VL9 A;  2CX3 A;  5IMC A;  4WET A;  5ABR A;  3TB2 A;  3WD6 A;  1XW6 A;  1TK8 B;  2HSH A;  4JE1 A;  4ECB A;  4EXJ A;  5J3R A;  4PXO A;  1DBY A;  22GS A;  1SJ6 A;  2G0F A;  5IM9 A;  1KTE A;  3IPZ A;  4KH7 A;  1IYH A;  3ZIT A;  2L6C A;  4MPF A;  3LJR A;  4BA7 A;  3CRU A;  5A4W A;  4DSS B;  3A2X A;  2H0I A;  1A24 A;  4TXV A;  1X5D A;  2YPM A;  3H8Q A;  2YWN A;  3HDC A;  5HR3 A;  3GFK A;  1GLP A;  1YF1 A;  5DAL B;  3TJK A;  5D93 A;  2HXK A;  2NDO A;  3N9J A;  1EOG A;  4LL1 B;  4MJB A;  4MJE A;  3APS A;  5GAP D;  2AJQ B;  5IMF A;  4IVF A;  2IMI A;  4LLR A;  3LFL A;  3PR8 A;  3TJG A;  2EIO A;  3GIX A;  1RQM A;  2M72 A;  1X0R A;  2XC2 A;  4MAB A;  1YQ1 A;  4PQ1 A;  1M9A A;  1WE0 A;  2R3X A;  1JLV A;  5ELA A;  1IYI A;  2R4V A;  1M9B A;  2REM A;  3HXS A;  5IPH A;  1KNG A;  4L0U A;  1GSF A;  2YN1 A;  3O6T A;  2F51 A;  1X9M B;  2GLR A;  1O8X A;  1NHY A;  2VO4 A;  4EC0 A;  4ZXG A;  3CSH A;  3KM6 A;  1DUG A;  1USB A;  5JCG A;  1OC3 A;  4Q5R A;  2LEG A;  3I43 A;  5AIS A;  2JZR A;  2JAD A;  1NSW A;  16GS A;  4YH2 A;  1SEN A;  4BVX A;  5ECO B;  4I6X A;  5IMA A;  1BAY A;  2H6Z A;  4QL9 A;  3VWV A;  3GKN A;  3F8U A;  2MMN A;  5E4W A;  1S3C A;  1U3I A;  2VAF A;  2QKE A;  3QPM A;  3VWX A;  2XPD A;  3VWU A;  3A2W A;  2L57 A;  3W8J A;  3TCO A;  2LQQ A;  1V58 A;  5ID2 A;  2I81 A;  4POB A;  3GUR A;  1OC9 A;  4EDZ A;  2B5X A;  3ZRD A;  1OKT A;  2MMA A;  3IAS 2;  3P2A A;  3EIN A;  18GS A;  3UIW A;  3WGE A;  1T4Y A;  4KB3 A;  3TKR A;  4O32 A;  4IP1 A;  5FHI A;  2JL4 A;  2LV3 A;  3DKS A;  3GRX A;  2DBC A;  2OBI A;  4K7O A;  1LJR A;  4EE0 A;  2CVK A;  2RUE A;  1GUH A;  3PH9 A;  3RDW A;  2NVL A;  3DYR A;  4QL7 A;  2VD1 A;  3GV1 A;  5D73 A;  2MMO A;  5EL8 A;  1ST9 A;  3VLN A;  4Z7X A;  3F3Q A;  3KMO A;  4ECC A;  2DJJ A;  2PPT A;  1AQV A;  3CSJ A;  4MZW A;  4AJ6 A;  1SYR A;  9GSS A;  4MPG A;  1TW9 A;  3AY8 A;  3IDV A;  3GH9 A;  2VOC A;  3GA4 A;  5IMD A;  1VGL A;  4ZL9 A;  1O6J A;  1JZW A;  2CZ2 A;  3VI5 A;  3APQ A;  4NV2 A;  2YZH A;  1BQ7 A;  5DAK B;  2B3S A;  1GSD A;  3M9J A;  2FWF A;  4N10 A;  1PKZ A;  1OVN A;  5GAN D;  3VUR A;  4PUR A;  3GX0 A;  2KP2 A;  4GRF A;  2PBJ A;  3F3R A;  1MDI A;  2DSA A;  4AJ7 A;  3GKM A;  2DMM A;  2B7K A;  3LSZ A;  4POL A;  3A2V A;  1PL1 A;  2LUS A;  2HZF A;  3QAV A;  3TOT A;  2YCD A;  4YAP A;  4FYC A;  2HFD A;  2QC7 A;  2V41 A;  2O8V B;  2HI7 A;  2B6M A;  1SK1 A;  4MP4 A;  4OCE A;  3IAM 2;  3MNG A;  4J2F A;  2JAC A;  3F4R A;  3HD5 A;  2C0F A;  3TJB A;  2FWH A;  3OR5 A;  2H1D A;  4PUA A;  4TW5 A;  5HQP A;  3ZYW A;  4NMU A;  3R2Q A;  2H0G A;  1AXD A;  3F6D A;  1A23 A;  4P3Y B;  2V2G A;  3DML A;  19GS A;  1AAZ A;  1QGV A;  2E2M A;  2PU9 C;  4DSS A;  4L8E A;  5IOW A;  4KGI A;  2C0E A;  5CRD A;  4GLT A;  2V32 A;  3FZ9 A;  4X1U A;  5DAL A;  3UL3 A;  3EU3 A;  1Z3E A;  2D2Z A;  1YZX A;  4IP6 A;  2IFQ B;  3D4T A;  5AN1 A;  1MEK A;  4KA0 A;  2CQ9 A;  3F9U A;  3FKF A;  4XIH A;  5G5E A;  2LJK A;  1PX7 A;  1FVK A;  2Z9S A;  4ML6 A;  1K0A A;  3S9F A;  4DEJ A;  8GSS A;  1JZO A;  4BVY A;  3ZIV A;  5A5K A;  2EC4 A;  2OBK A;  5J5N A;  4WF4 A;  3U6V A;  2IIY A;  4OO5 A;  1M7T A;  3TKS A;  1C72 A;  2KLX A;  3ISO A;  3BCK A;  5H5R A;  2VIM A;  3FR6 A;  3FRC A;  2GGT A;  1T7P B;  1JFU A;  1PX6 A;  1O73 A;  2C3Q A;  3BD2 A;  5FT3 A;  2P5Q A;  4GQC A;  4L5L A;  1T8E B;  4WBR D;  3FK8 A;  5CAX A;  4MF6 A;  2DJ2 A;  3DEX A;  4PUF C;  1YEX A;  1ZYQ B;  1F6M C;  3M3M A;  2H19 A;  1OC8 A;  2R6K A;  1F9M A;  1G6Y A;  10GS A;  2GQL A;  3E3E A;  3QCP A;  3VWW A;  5AIV A;  2A4V A;  2V1M A;  3F63 A;  5CP1 A;  1EV4 A;  1EEM A;  3E9J B;  1XFL A;  1URM A;  3MDK A;  2GZZ A;  1A0R P;  1PKW A;  1I5G A;  2OA7 A;  1Z5Y E;  5ECK B;  1R5P A;  4YQM A;  2VL3 A;  1TK0 B;  1ZYE A;  4NWY A;  3GX8 A;  2CZ3 A;  1LBK A;  5D9W A;  2HE3 A;  1G0T A;  5INY A;  3UBL A;  5ID2 B;  2KUC A;  1O8W A;  1VF4 A;  2WS2 A;  1M2A A;  2WGR A;  5F0G A;  1ZL9 A;  2GZP A;  2TIR A;  2VD0 A;  4KE3 A;  1FAA A;  2H6Y A;  1GNE A;  1EGO A;  5IO0 A;  3KMN A;  2CAQ A;  2C0G A;  1VF3 A;  4ID0 A;  1K3L A;  2H01 A;  3DD3 A;  1OE7 A;  4N0Z A;  3KP9 A;  6GSS A;  1HD2 A;  3A5W A;  5ECP B;  3C73 A;  3FZ5 A;  2GSQ A;  1ERU A;  5D96 A;  4KND A;  1XWA A;  3TKP A;  1XW9 A;  2PER A;  4NAX A;  2LQO A;  1O85 A;  4ZL8 A;  4G10 A;  1QQ2 A;  1B9X C;  1SKR B;  3HVX A;  1FB6 A;  1ERV A;  2BJX A;  3GKK A;  4PX1 A;  3O76 A;  5DAK A;  3KTB A;  1X5E A;  3ZFL A;  5DDL A;  1WIK A;  4J57 E;  4JU5 A;  3TKQ A;  1DSB A;  3W8S A;  1XWG A;  2OAD A;  3QAW A;  1EV9 A;  5G5F A;  2AAW A;  4Q5F A;  2R5G A;  4F0C A;  7GSS A;  2HSY A;  5C04 A;  1GP1 A;  1TRU A;  2WZ9 A;  1XWC A;  5CO3 A;  2YNX A;  1OYJ A;  1TU7 A;  4EDY A;  1GUK A;  4X0X A;  5JCW A;  4ECJ A;  4MF5 A;  4KUN A;  1WWJ A;  3KXO A;  3C7M A;  4YQU A;  1K0D A;  2A2R A;  5HFI A;  4RQX A;  5G31 A;  5D9X A; 
#chains in the Genus database with same CATH topology
 3IC4 A;  4MK3 A;  1Y6E A;  4OCF A;  4GST A;  1HNC A;  3HJO A;  2WJU A;  1N2A A;  1GSU A;  4K7I A;  1R5A A;  2GDR A;  2M46 A;  1YDK A;  3H1N A;  3KEB A;  3DGQ A;  4JRR A;  2LRT A;  3LW9 A;  3CRT A;  4TR4 A;  3HVN A;  2DJK A;  5CNW A;  5F06 A;  5KN2 A;  1DE1 A;  2CVB A;  4MCU A;  1DE2 A;  4IGJ A;  2O7K A;  1TI3 A;  4XHM A;  4IKH A;  2IFQ A;  2R37 A;  5KOW A;  2WRT A;  1J9B A;  1T00 A;  2ZNM A;  4IS0 A;  2EIR A;  2FNO A;  3O3T A;  1JLW A;  3IA1 A;  1GSS A;  1ZMA A;  2JU5 A;  3TGZ A;  4KX4 A;  5FWG A;  4WR5 A;  1YKA A;  1Z6N A;  3MSZ A;  3UVH A;  2C8U A;  1G6W A;  4JR4 A;  1ERW A;  3ED3 A;  2YJH A;  1VF1 A;  3M0F A;  4K0N A;  2FWG A;  1Z6M A;  3M9K A;  5CRW A;  3FR3 A;  5G1L A;  2GT5 A;  2YV7 A;  1PN0 A;  4HS1 A;  4BVY B;  3F4S A;  3WGX A;  4N11 A;  3VK9 A;  3FZA A;  5LNK e;  2FD3 A;  5J9B A;  1E6B A;  3LQ7 A;  2GSS A;  1A8L A;  4I2U A;  4MF7 A;  2C1Y A;  5KOX A;  1GSE A;  3UBK A;  2QSI A;  1PL2 A;  4IQ1 A;  2LST A;  1YKC A;  2GQK A;  3ME8 A;  3J7Y b;  3QDN A;  2JZS A;  3RHC A;  1ABA A;  1RK4 A;  4G0K A;  4HJM A;  1A8Y A;  2DIZ A;  2GTU A;  2VCZ A;  4NXI A;  2P5R A;  3RHB A;  5BMU A;  4LMW A;  2YOI A;  3PIN A;  4O92 A;  1TXX A;  2RLI A;  5ECM B;  1GNW A;  4G9H A;  4O7H A;  2XHF A;  4XTS A;  3WYW A;  4TR3 A;  4IJ3 A;  4Q5N A;  3TJJ A;  5ELG A;  3FW2 A;  3HVS A;  3HZ4 A;  1T4Z A;  4FIW A;  2LKU A;  4BWS A;  2IJY A;  4V2L A;  3ZL5 A;  5AGY A;  3DRN A;  4K2D A;  3KGK A;  2A2S A;  1GTU A;  2GT6 A;  3TRQ A;  1WJK A;  2MZC A;  1AC1 A;  2XBI A;  2ON7 A;  1PQN A;  4JZQ A;  3J7Y k;  3CXG A;  3APO A;  5JWR B;  2O85 A;  3LYP A;  2WFC A;  3JCM L;  2PN8 A;  4ULX A;  4EUY A;  2V6O A;  3IHG A;  3NOF A;  3UMA A;  2L5L A;  6GSW A;  1EEJ A;  2DKH A;  3ME7 A;  4KDX A;  3H4K A;  1BX9 A;  5J41 A;  1FO5 A;  1PRX A;  4WKW A;  1UA5 A;  3DVX A;  4EVM A;  4EIQ A;  4DVC A;  2I4A A;  2GST A;  3RPN A;  1X9S B;  2IL3 A;  2WCI A;  1GLQ A;  1YY7 A;  3TRP A;  1G7E A;  4K2X A;  4TKY A;  2B1K A;  1H4O A;  4FYB A;  1A2L A;  2K8S A;  4XRA A;  2AHE A;  3D21 A;  3TDG A;  3GTU B;  3GMF A;  4XS1 A;  2VUP A;  4NPB A;  2OAC A;  1K3O A;  3E0U A;  2FA4 A;  4K5S A;  4ACS A;  1JHB A;  2G2Q A;  2C3T A;  3SWL A;  2H76 A;  3K8N A;  3ZVJ A;  2YV9 A;  2HYX A;  4KF9 A;  5KN3 A;  2K6V A;  3P7X A;  5LD0 A;  3RBT A;  5DBQ A;  1Y25 A;  3HKR A;  1WRY A;  2F9S A;  3H93 A;  3GYK A;  3Q74 A;  1XVQ A;  3GST A;  4HOJ A;  1ZOF A;  3CMI A;  4K5R A;  2X64 A;  1Q98 A;  3P8W A;  1GUL A;  1WOU A;  2H74 A;  1O81 A;  3GL3 A;  3D0Z A;  3R3E A;  4NV5 A;  3M1G A;  3KCM A;  4HUA A;  5B7C A;  2L59 A;  4GTU A;  4I97 A;  3LXZ A;  4MNN A;  2P31 A;  4XS4 B;  3QMX A;  2VLV A;  4EO3 A;  2L4Q A;  3QOU A;  1K0M A;  4EKZ A;  2GSR A;  3BBY A;  5HFG A;  1SJZ A;  3F6F A;  1VF2 A;  3D22 A;  4IQA A;  1VRS D;  2B5Y A;  3A5I A;  2R0C A;  3ZTL A;  4TVE A;  13GS A;  1XBS A;  4GQF A;  4BL7 B;  4OFT A;  4N30 A;  4EL1 A;  3CSI A;  1KEB A;  4PNF A;  3HCZ A;  2LTK A;  4A5P A;  1PMT A;  5EY6 A;  5HR1 A;  4GF0 A;  1ZZY A;  3IXR A;  3KH9 A;  1U3A A;  5G30 A;  2H70 A;  1TTZ A;  4JED A;  1FG4 A;  5IMZ A;  4X43 A;  14GS A;  2AV4 A;  2LNT A;  1X5C A;  2H1A A;  4F2I A;  2F8F A;  5B6M A;  1M2B A;  3IK7 A;  4XS6 A;  2H1G A;  2OE0 A;  1J0F A;  1XVW A;  5IIZ A;  3EUR A;  1AW9 A;  5JWO B;  3V1W A;  3LEF A;  2HNL A;  3EYT A;  1TDI A;  4G0L A;  3HY2 A;  1F2E A;  3US3 A;  4LL4 B;  1X9W B;  2OJL A;  2CVD A;  2OE3 A;  4TR1 A;  4L5O A;  1YEP A;  2NPB A;  3FZ4 A;  2H71 A;  3SBC A;  20GS A;  1TRV A;  1B4P A;  1THX A;  1Q4J A;  5KEJ A;  3BJ5 A;  4H86 A;  4GWR A;  1NW2 A;  1ILO A;  2I9H A;  2VCT A;  4G0I A;  4MH2 A;  1THO A;  3L9V A;  2BMX A;  4ISD A;  2HRF A;  1XWB A;  2VL2 C;  4ILF A;  5CYY A;  4TXO B;  4BIK A;  2XBQ A;  5IPG A;  2LJR A;  1TP9 A;  2L4C A;  1V9W A;  1K0C A;  3CTF A;  3TKS E;  4MZB A;  3LXT A;  3ERF A;  5JCU A;  3C1S A;  3TRX A;  4F0B A;  4HQZ A;  2ALB A;  1ZCP A;  2DC5 A;  2B1L A;  1M3I A;  2H30 A;  2K18 A;  2F8A A;  4V2N A;  4RI6 A;  4FO5 A;  4F03 A;  2FY6 A;  1SU9 A;  1S3R A;  1KBN A;  1UN2 A;  4OD7 A;  1B4Q A;  4V2M A;  2HRK A;  4TRX A;  1S3A A;  2AB6 A;  3PPU A;  1U88 A;  2HZE B;  1BYE A;  5DVB A;  4HQS A;  1EWX A;  4WR4 A;  1NM3 A;  4BWQ A;  1WP0 A;  4Q5Q A;  4MLY A;  4MH3 A;  2YAN A;  1B48 A;  3GTU A;  4K0G A;  5B6N A;  4TN8 A;  1XG8 A;  1F37 A;  1H75 A;  5ECI B;  4QQ7 A;  2YZU A;  1FB0 A;  4IEL A;  2EIQ A;  3IR4 A;  1M3J A;  1YF0 A;  3MWH A;  3EVI A;  4PNG A;  3MIX A;  3TOU A;  1YJ6 A;  3CYN A;  4POK A;  1XIY A;  2VCQ A;  3A3T A;  4ZIL A;  3UOM A;  3GN3 A;  2H6X A;  3NIV A;  4EF0 A;  3G7I A;  1QUW A;  4AJ8 A;  5KN1 A;  3ZLP A;  3FHK A;  3QFA C;  2FGX A;  1W89 A;  4FQU A;  4KCE A;  4FH8 A;  4XCS A;  5KN0 A;  2YJ7 A;  3BOA A;  3N5O A;  2F3M A;  1GTB A;  4HSC X;  3IK9 A;  4FYU A;  2CX4 A;  3FEU A;  3HVV A;  2GS3 A;  2FWE A;  4AGS A;  5LCZ A;  1AIU A;  4XS4 A;  1GTA A;  4RUV A;  1XOA A;  1NHO A;  3UJ1 A;  4OFM A;  1M99 A;  1XZO A;  1HYU A;  1FVJ A;  1CQG A;  5J9C A;  1B8X A;  3I9V 2;  1OAZ A;  4O5Q A;  4NHZ A;  4TR0 A;  1FHE A;  1Z7P A;  3H79 A;  3Q6O A;  3EE2 A;  4KCA A;  3GUS A;  3LWA A;  4ZB9 A;  2NTO A;  3PGT A;  1AQW A;  1ERT A;  1N8J A;  2VLT A;  2PGT A;  4BL7 A;  2PVO C;  2YWM A;  3GKX A;  5CRH A;  2R0P A;  2ZCT A;  1SYX A;  4K7N A;  3KD0 A;  2FCH A;  5EVO A;  2KHP A;  1I9D A;  4ZBD A;  2OKA A;  1LU4 A;  2DML A;  4D73 B;  1G7O A;  3EPT A;  3WT1 A;  3HJM A;  4PGT A;  5IMV A;  5DQY A;  2DJ0 A;  12GS A;  2O87 A;  4I8B A;  3CBU A;  1MDK A;  3ERW A;  4KSO A;  5COH A;  3ERG A;  3GSS A;  1QK8 A;  1O7U A;  1R7H A;  2IPA A;  4HJ2 A;  5CRG A;  1ON4 A;  2X8H A;  1EGR A;  2IWT A;  1GSY A;  1U87 A;  5IOX A;  3DVW A;  3IBH A;  2WUL A;  3RAZ A;  3ZFB A;  1XOB A;  1QXH A;  1E2Y A;  2LS5 A;  4KW6 A;  2VM2 A;  3KJY A;  1PA3 A;  2UZ8 A;  3L9S A;  3IHQ A;  4TR1 B;  4RQR A;  5GSS A;  3ZVJ D;  6GSU A;  4IBP A;  4XRD A;  3P90 A;  3L9U A;  1XXU A;  5B8B A;  1PN9 A;  4HDE A;  2H75 A;  2LJA A;  4HU7 A;  2KOK A;  2X8C A;  5D8I A;  1CQH A;  1V98 A;  1WPI A;  2H8L A;  4DSQ A;  5GST A;  2YP6 A;  3RPP A;  2IMK A;  2GQM A;  4IJI A;  4TXO A;  1K0O A;  2DIY A;  4ZB6 A;  2YWI A;  3D4M A;  2H72 A;  2L6D A;  5D9T A;  4PTS A;  1PD2 1;  3HJP A;  1WMJ A;  2TRX A;  4LMV A;  5DJL A;  2BTO T;  2HRN A;  3C71 A;  3TUE A;  1XW5 A;  3G7Y A;  5F07 A;  5IQY A;  1MTC A;  2IME A;  1MD4 A;  1Z9H A;  3GHA A;  5ECN B;  5G1K A;  4OO4 A;  4TOP A;  1Z7R A;  1F3B A;  5A4V A;  5IO2 A;  1GTI A;  4GSN A;  1SD8 A;  2M80 A;  2HZE A;  1TJD A;  6GSX A;  1XCC A;  2GVP A;  3IC8 A;  2K8V A;  1GH2 A;  11GS A;  2JSZ A;  3FY7 A;  1SL0 B;  3IRA A;  3L4N A;  2VCV A;  4V1A p;  4WF5 A;  1HNB A;  2IN3 A;  1BED A;  2ZUP A;  5HR2 A;  1SJI A;  2E2G A;  1V40 A;  3TJF A;  4GSS A;  1TRW A;  3UAR A;  5C00 A;  2LNS A;  3ZMK A;  17GS A;  2PMT A;  3VPQ A;  2C4J A;  1SKW B;  2B5E A;  4Z2U A;  3WT2 A;  1TKD B;  1ML6 A;  1SKS B;  2H73 A;  2NBS A;  3FR9 A;  3LG6 A;  4K6X A;  2MMZ A;  2QA1 A;  1PSQ A;  2H66 A;  4YQV A;  4L0W A;  1M0U A;  1ZYP A;  2X49 A;  4OFN A;  3QFB C;  4CHS A;  3IE3 A;  3EMP A;  4N0V A;  2R2J A;  4AF2 A;  4NHW A;  4I2T A;  3EMX A;  5H5Q A;  1A2M A;  2DJ3 A;  4GCI A;  2RII A;  2PWJ A;  2GZY A;  4YAV A;  4KDU A;  2B7J A;  3UAP A;  5J4U A;  2DJ1 A;  4G2E A;  4O5R A;  1TK5 B;  1FW1 A;  3Q19 A;  4E8H A;  4CW9 A;  3MAK A;  5DCH A;  3QR6 A;  4MDC A;  1QFN A;  1ACV A;  1K0N A;  5F05 A;  3DWV A;  2IMD A;  2OE1 A;  3KP8 A;  3HA9 A;  1HQO A;  3CQF A;  2DLX A;  2CT6 A;  3HHV A;  2O89 A;  2X8G A;  1QMV A;  1J08 A;  5F8B A;  1SL2 B;  2LRC A;  3ZML A;  5ECQ B;  2ON5 A;  2H1B A;  5ENU A;  3IOS A;  2RM5 A;  4EIP A;  3C1R A;  1T1V A;  1UC7 A;  5GZZ B;  3F4T A;  3L0H A;  1TOF A;  4D73 A;  1GWC A;  1SL1 B;  2WDU A;  4ZBB A;  3KIJ A;  2P0G A;  4HI7 A;  3DXB A;  4OWY A;  2J9H A;  4MMM A;  4F82 A;  2TRC P;  1HNA A;  3KTL A;  3EWL A;  4KDY A;  4ZBA A;  5E59 A;  4KAE A;  6GSY A;  2I3Y A;  5H5S A;  5B8A A;  3HYP A;  3M8N A;  1A2J A;  3FYG A;  2C0D A;  3TKS C;  5ECL B;  1ZGN A;  2N5A A;  4ZL7 A;  4OMV A;  2MYG A;  5HR0 A;  2K9F A;  1R26 A;  2PUK C;  4YKF A;  2RM6 A;  4ML1 A;  3LYK A;  1BJX A;  4WEY A;  1EP7 A;  2CV4 A;  4PQI A;  1V57 A;  2MBT A;  3UEM A;  2N5F A;  3CTG A;  2CAI A;  4K1F A;  5DCG A;  1UVZ A;  4IN0 A;  2JZT A;  1W4V A;  3I69 A;  2AYT A;  4V1A g;  5HFK A;  1MDJ A;  2X99 A;  4JR6 A;  1EP8 A;  3HZ8 A;  3KZQ A;  4K9Z A;  1EZK A;  2PVQ A;  4K8M A;  3I6A A;  4IHU A;  3VFI A;  4MJC A;  1OE8 A;  2QGV A;  2H0H A;  2QA2 A;  5JWQ B;  1S3D A;  1TRS A;  3KH7 A;  4WXT A;  5ECR B;  2ES7 A;  1JZD A;  2VCW A;  1SK0 A;  2HSM A;  2I1U A;  2C3N A;  1K3Y A;  4HEA 2;  5D9V A;  1B9Y C;  1FOH A;  3BCI A;  4LA1 A;  4CDO A;  5DJM A;  3G9B A;  4BVX B;  1U6T A;  3G7J A;  4DSR A;  2C80 A;  2FLS A;  4BPY A;  3WGD A;  2HT9 A;  4G19 A;  2VL2 A;  1GUM A;  2V6K A;  3GH6 A;  3DIE A;  1SK2 A;  4HZ4 A;  4I5Q A;  4PQH A;  3ZZX A;  1ZYN A;  4IW9 A;  3NZN A;  4ECI A;  4ZIJ A;  4CY8 A;  3LOR A;  2IMF A;  4MA9 A;  2LRN A;  3GNJ A;  3D6I A;  3GL5 A;  2J23 A;  2WB9 A;  2KP1 A;  1OC9 B;  4J56 E;  1TU8 A;  1GSQ A;  3Q18 A;  3VPT A;  2FA8 A;  3D5J A;  3VI7 A;  1SD9 A;  5EPF A;  2AUV A;  3UVT A;  3LGC A;  1RW1 A;  4KSM A;  1GL8 A;  4F9Z A;  4E8E A;  1BG5 A;  1AUC A;  4POM A;  5AIX A;  2L5O A;  1GRX A;  2MBS A;  2VCX A;  4JBB A;  4HZ2 A;  1M2D A;  4ZB8 A;  5G2Z A;  3QD9 A;  4HU9 A;  5L71 A;  5ECH B;  1PGT A;  1EOH A;  1K0B A;  1FOV A;  1R4W A;  1TI1 A;  3IV4 A;  2FHE A;  2FUG 2;  4RI7 A;  2N5B A;  4MJA A;  2VLU A;  2CA8 A;  3F0I A;  3W6G A;  1T3B A;  1V2A A;  2YWO A;  1A0F A;  1AQX A;  3L78 A;  4WBJ A;  3C8E A;  5ECS A;  1JZR A;  4X4J A;  5BRT A;  2RUF A;  5A4U A;  2E0Q A;  1F3A A;  6GSV A;  4GXZ A;  4USS A;  1XWK A;  2HLS A;  3EC3 A;  1MD3 A;  3QAG A;  3ZRE A;  4MZC A;  2E7P A;  3EU4 A;  2XPE A;  5DQS A;  6GST A;  1XPV A;  2JSY A;  3U5R E;  1OKD A;  2VM1 A;  3ZIJ A;  5CRE A;  2VL9 A;  2CX3 A;  5IMC A;  4WET A;  5ABR A;  3TB2 A;  3WD6 A;  1XW6 A;  1TK8 B;  2HSH A;  4JE1 A;  4ECB A;  4EXJ A;  5J3R A;  4PXO A;  1DBY A;  22GS A;  1SJ6 A;  2G0F A;  5IM9 A;  1KTE A;  3IPZ A;  4KH7 A;  1IYH A;  3ZIT A;  2L6C A;  4MPF A;  3LJR A;  4BA7 A;  3CRU A;  5A4W A;  4DSS B;  3A2X A;  2H0I A;  1A24 A;  4TXV A;  1X5D A;  2YPM A;  3H8Q A;  2YWN A;  3HDC A;  5HR3 A;  3GFK A;  1GLP A;  1YF1 A;  5DAL B;  3TJK A;  5D93 A;  2HXK A;  2NDO A;  3N9J A;  1EOG A;  4LL1 B;  4MJB A;  4MJE A;  3APS A;  5GAP D;  2AJQ B;  5IMF A;  4IVF A;  2IMI A;  4LLR A;  3LFL A;  3PR8 A;  2A4H A;  3TJG A;  2EIO A;  3GIX A;  1RQM A;  2M72 A;  1X0R A;  2XC2 A;  4MAB A;  1YQ1 A;  4PQ1 A;  1M9A A;  1WE0 A;  2R3X A;  1JLV A;  5ELA A;  3MYD A;  1IYI A;  4Z2R A;  2R4V A;  1M9B A;  2REM A;  3HXS A;  5IPH A;  1KNG A;  4L0U A;  1GSF A;  2YN1 A;  3O6T A;  2F51 A;  1X9M B;  2GLR A;  1O8X A;  1NHY A;  2VO4 A;  4EC0 A;  4ZXG A;  3CSH A;  3KM6 A;  1DUG A;  1USB A;  5JCG A;  1OC3 A;  3FMW A;  4Q5R A;  2LEG A;  3I43 A;  5AIS A;  4ICY A;  2JZR A;  2JAD A;  1NSW A;  16GS A;  4YH2 A;  1SEN A;  4BVX A;  5ECO B;  4I6X A;  5IMA A;  1BAY A;  2HRA A;  2H6Z A;  4QL9 A;  3VWV A;  3GKN A;  3F8U A;  2MMN A;  5E4W A;  1S3C A;  1U3I A;  2VAF A;  2QKE A;  3QPM A;  3VWX A;  2XPD A;  3VWU A;  3A2W A;  2L57 A;  3W8J A;  3TCO A;  2LQQ A;  1V58 A;  5ID2 A;  2I81 A;  4POB A;  3GUR A;  1OC9 A;  4EDZ A;  2B5X A;  3ZRD A;  1OKT A;  2MMA A;  3IAS 2;  2R0G A;  3P2A A;  3EIN A;  18GS A;  4O5U A;  3UIW A;  3WGE A;  1T4Y A;  4KB3 A;  3TKR A;  4O32 A;  4IP1 A;  5FHI A;  2JL4 A;  2X4A A;  2LV3 A;  3DKS A;  3GRX A;  2DBC A;  2OBI A;  4K7O A;  1LJR A;  4EE0 A;  2CVK A;  2RUE A;  1GUH A;  3PH9 A;  4CY6 A;  3RDW A;  2NVL A;  3DYR A;  4QL7 A;  2VD1 A;  3GV1 A;  5D73 A;  2MMO A;  5EL8 A;  1ST9 A;  3VLN A;  4Z7X A;  3F3Q A;  3KMO A;  4ECC A;  2DJJ A;  2PPT A;  1AQV A;  3CSJ A;  4MZW A;  4AJ6 A;  1SYR A;  9GSS A;  4MPG A;  1TW9 A;  3AY8 A;  3IDV A;  3GH9 A;  2VOC A;  3GA4 A;  5IMD A;  1VGL A;  4ZL9 A;  1O6J A;  1JZW A;  2CZ2 A;  3VI5 A;  3APQ A;  4NV2 A;  2YZH A;  1BQ7 A;  5DAK B;  2B3S A;  1GSD A;  3M9J A;  2FWF A;  4N10 A;  1PKZ A;  1OVN A;  5GAN D;  3VUR A;  4PUR A;  3GX0 A;  2KP2 A;  4GRF A;  2PBJ A;  3F3R A;  1MDI A;  2DSA A;  4AJ7 A;  3GKM A;  2DMM A;  2B7K A;  3LSZ A;  4POL A;  3A2V A;  1PL1 A;  2LUS A;  2HZF A;  3QAV A;  3TOT A;  2YCD A;  4YAP A;  4FYC A;  2HFD A;  2QC7 A;  2V41 A;  2O8V B;  2HI7 A;  2B6M A;  1SK1 A;  4MP4 A;  4OCE A;  3IAM 2;  3MNG A;  4J2F A;  2JAC A;  3F4R A;  3HD5 A;  1PFO A;  2C0F A;  3TJB A;  2FWH A;  3OR5 A;  2H1D A;  4PUA A;  4TW5 A;  5HQP A;  3ZYW A;  4NMU A;  3R2Q A;  2H0G A;  1AXD A;  3F6D A;  1A23 A;  4P3Y B;  2A2P A;  2V2G A;  3DML A;  19GS A;  1AAZ A;  1QGV A;  2E2M A;  2PU9 C;  4DSS A;  4L8E A;  5IOW A;  4KGI A;  2C0E A;  5CRD A;  4GLT A;  2V32 A;  3FZ9 A;  2DKI A;  4X1U A;  5DAL A;  3UL3 A;  3EU3 A;  1Z3E A;  2D2Z A;  1YZX A;  4IP6 A;  2IFQ B;  3D4T A;  5AN1 A;  1MEK A;  4KA0 A;  2CQ9 A;  3F9U A;  3FKF A;  4XIH A;  5G5E A;  2LJK A;  1PX7 A;  1FVK A;  2Z9S A;  4ML6 A;  1K0A A;  3S9F A;  4DEJ A;  8GSS A;  1JZO A;  4BVY A;  3ZIV A;  5A5K A;  2EC4 A;  2OBK A;  5J5N A;  4WF4 A;  3U6V A;  2IIY A;  4OO5 A;  1M7T A;  3TKS A;  1C72 A;  2KLX A;  3ISO A;  3BCK A;  5H5R A;  2VIM A;  3FR6 A;  3FRC A;  2GGT A;  1T7P B;  1JFU A;  1PX6 A;  1O73 A;  2C3Q A;  3BD2 A;  5FT3 A;  2P5Q A;  4GQC A;  4L5L A;  1T8E B;  4WBR D;  3FK8 A;  5CAX A;  4MF6 A;  2DJ2 A;  3DEX A;  4PUF C;  1YEX A;  1ZYQ B;  1F6M C;  3M3M A;  2H19 A;  1OC8 A;  2R6K A;  1F9M A;  1G6Y A;  4Z2T A;  10GS A;  2GQL A;  3E3E A;  3QCP A;  3VWW A;  5AIV A;  2A4V A;  2V1M A;  3F63 A;  5CP1 A;  1EV4 A;  1EEM A;  3E9J B;  1XFL A;  1URM A;  3MDK A;  2GZZ A;  1A0R P;  1PKW A;  1I5G A;  2OA7 A;  1Z5Y E;  5ECK B;  1R5P A;  4YQM A;  2VL3 A;  4YKG A;  1TK0 B;  1ZYE A;  4NWY A;  3GX8 A;  2CZ3 A;  1LBK A;  5D9W A;  2HE3 A;  1G0T A;  5INY A;  3UBL A;  5ID2 B;  2KUC A;  1O8W A;  1VF4 A;  2WS2 A;  1M2A A;  2WGR A;  5F0G A;  1ZL9 A;  2GZP A;  2TIR A;  2VD0 A;  4KE3 A;  1FAA A;  2H6Y A;  1GNE A;  1EGO A;  5IO0 A;  3KMN A;  2CAQ A;  2C0G A;  1VF3 A;  4ID0 A;  1K3L A;  2H01 A;  3DD3 A;  1OE7 A;  4N0Z A;  3KP9 A;  6GSS A;  1HD2 A;  3A5W A;  5ECP B;  3C73 A;  3FZ5 A;  2GSQ A;  1ERU A;  5D96 A;  4KND A;  1XWA A;  3TKP A;  1XW9 A;  2PER A;  4NAX A;  2LQO A;  1O85 A;  4ZL8 A;  4G10 A;  1QQ2 A;  1B9X C;  1SKR B;  3HVX A;  1FB6 A;  1ERV A;  2BJX A;  3GKK A;  4PX1 A;  3O76 A;  5DAK A;  3KTB A;  1X5E A;  3ZFL A;  5DDL A;  4JU5 A;  1WIK A;  4J57 E;  3TKQ A;  1DSB A;  3W8S A;  1XWG A;  2OAD A;  3QAW A;  1EV9 A;  5G5F A;  2AAW A;  4Q5F A;  2R5G A;  4F0C A;  7GSS A;  2HSY A;  5C04 A;  1GP1 A;  1TRU A;  2WZ9 A;  1XWC A;  5CO3 A;  2YNX A;  1OYJ A;  1TU7 A;  4EDY A;  1GUK A;  4X0X A;  5JCW A;  4ECJ A;  4MF5 A;  4KUN A;  1WWJ A;  3KXO A;  3C7M A;  4YQU A;  1K0D A;  2A2R A;  5HFI A;  4RQX A;  5G31 A;  5D9X A; 
#chains in the Genus database with same CATH homology
 3IC4 A;  4MK3 A;  1Y6E A;  4OCF A;  4GST A;  1HNC A;  3HJO A;  2WJU A;  1N2A A;  1GSU A;  4K7I A;  1R5A A;  2GDR A;  2M46 A;  1YDK A;  3H1N A;  3KEB A;  3DGQ A;  4JRR A;  2LRT A;  3LW9 A;  3CRT A;  4TR4 A;  2DJK A;  5CNW A;  5F06 A;  5KN2 A;  1DE1 A;  2CVB A;  4MCU A;  1DE2 A;  4IGJ A;  2O7K A;  1TI3 A;  4XHM A;  4IKH A;  2IFQ A;  2R37 A;  5KOW A;  2WRT A;  1J9B A;  1T00 A;  2ZNM A;  4IS0 A;  2EIR A;  2FNO A;  3O3T A;  1JLW A;  3IA1 A;  1GSS A;  1ZMA A;  2JU5 A;  3TGZ A;  4KX4 A;  5FWG A;  4WR5 A;  1YKA A;  1Z6N A;  3MSZ A;  3UVH A;  2C8U A;  1G6W A;  4JR4 A;  1ERW A;  3ED3 A;  2YJH A;  1VF1 A;  3M0F A;  4K0N A;  2FWG A;  1Z6M A;  3M9K A;  5CRW A;  3FR3 A;  5G1L A;  2GT5 A;  2YV7 A;  1PN0 A;  4HS1 A;  4BVY B;  3F4S A;  3WGX A;  4N11 A;  3VK9 A;  3FZA A;  5LNK e;  2FD3 A;  5J9B A;  1E6B A;  3LQ7 A;  2GSS A;  1A8L A;  4I2U A;  4MF7 A;  2C1Y A;  5KOX A;  1GSE A;  3UBK A;  2QSI A;  1PL2 A;  4IQ1 A;  2LST A;  1YKC A;  2GQK A;  3ME8 A;  3J7Y b;  3QDN A;  2JZS A;  3RHC A;  1ABA A;  1RK4 A;  4G0K A;  4HJM A;  1A8Y A;  2DIZ A;  2GTU A;  2VCZ A;  4NXI A;  2P5R A;  3RHB A;  5BMU A;  4LMW A;  2YOI A;  3PIN A;  4O92 A;  1TXX A;  2RLI A;  5ECM B;  1GNW A;  4G9H A;  4O7H A;  2XHF A;  4XTS A;  3WYW A;  4TR3 A;  4IJ3 A;  4Q5N A;  3TJJ A;  5ELG A;  3FW2 A;  3HVS A;  3HZ4 A;  1T4Z A;  4FIW A;  2LKU A;  4BWS A;  2IJY A;  4V2L A;  3ZL5 A;  5AGY A;  3DRN A;  4K2D A;  3KGK A;  2A2S A;  1GTU A;  2GT6 A;  3TRQ A;  1WJK A;  2MZC A;  1AC1 A;  2XBI A;  2ON7 A;  1PQN A;  4JZQ A;  3J7Y k;  3CXG A;  3APO A;  5JWR B;  2O85 A;  3LYP A;  2WFC A;  3JCM L;  2PN8 A;  4ULX A;  4EUY A;  2V6O A;  3IHG A;  3NOF A;  3UMA A;  2L5L A;  6GSW A;  1EEJ A;  2DKH A;  3ME7 A;  4KDX A;  3H4K A;  1BX9 A;  5J41 A;  1FO5 A;  1PRX A;  4WKW A;  1UA5 A;  3DVX A;  4EVM A;  4EIQ A;  4DVC A;  2I4A A;  2GST A;  3RPN A;  1X9S B;  2IL3 A;  2WCI A;  1GLQ A;  1YY7 A;  3TRP A;  1G7E A;  4K2X A;  4TKY A;  2B1K A;  1H4O A;  4FYB A;  1A2L A;  2K8S A;  4XRA A;  2AHE A;  3D21 A;  3TDG A;  3GTU B;  3GMF A;  4XS1 A;  2VUP A;  4NPB A;  2OAC A;  1K3O A;  3E0U A;  2FA4 A;  4K5S A;  4ACS A;  1JHB A;  2G2Q A;  2C3T A;  3SWL A;  2H76 A;  3K8N A;  3ZVJ A;  2YV9 A;  2HYX A;  4KF9 A;  5KN3 A;  2K6V A;  3P7X A;  5LD0 A;  3RBT A;  5DBQ A;  1Y25 A;  3HKR A;  1WRY A;  2F9S A;  3H93 A;  3GYK A;  3Q74 A;  1XVQ A;  3GST A;  4HOJ A;  1ZOF A;  3CMI A;  4K5R A;  2X64 A;  1Q98 A;  3P8W A;  1GUL A;  1WOU A;  2H74 A;  1O81 A;  3GL3 A;  3D0Z A;  3R3E A;  4NV5 A;  3M1G A;  3KCM A;  4HUA A;  5B7C A;  2L59 A;  4GTU A;  4I97 A;  3LXZ A;  4MNN A;  2P31 A;  4XS4 B;  3QMX A;  2VLV A;  4EO3 A;  2L4Q A;  3QOU A;  1K0M A;  4EKZ A;  2GSR A;  3BBY A;  5HFG A;  1SJZ A;  3F6F A;  1VF2 A;  3D22 A;  4IQA A;  1VRS D;  2B5Y A;  3A5I A;  2R0C A;  3ZTL A;  4TVE A;  13GS A;  1XBS A;  4GQF A;  4BL7 B;  4OFT A;  4N30 A;  4EL1 A;  3CSI A;  1KEB A;  4PNF A;  3HCZ A;  2LTK A;  4A5P A;  1PMT A;  5EY6 A;  5HR1 A;  4GF0 A;  1ZZY A;  3IXR A;  3KH9 A;  1U3A A;  5G30 A;  2H70 A;  1TTZ A;  4JED A;  1FG4 A;  5IMZ A;  4X43 A;  14GS A;  2AV4 A;  2LNT A;  1X5C A;  2H1A A;  4F2I A;  2F8F A;  5B6M A;  1M2B A;  3IK7 A;  4XS6 A;  2H1G A;  2OE0 A;  1J0F A;  1XVW A;  5IIZ A;  3EUR A;  1AW9 A;  5JWO B;  3V1W A;  3LEF A;  2HNL A;  3EYT A;  1TDI A;  4G0L A;  3HY2 A;  1F2E A;  3US3 A;  4LL4 B;  1X9W B;  2OJL A;  2CVD A;  2OE3 A;  4TR1 A;  4L5O A;  1YEP A;  2NPB A;  3FZ4 A;  2H71 A;  3SBC A;  20GS A;  1TRV A;  1B4P A;  1THX A;  1Q4J A;  5KEJ A;  3BJ5 A;  4H86 A;  4GWR A;  1NW2 A;  1ILO A;  2I9H A;  2VCT A;  4G0I A;  4MH2 A;  1THO A;  3L9V A;  2BMX A;  4ISD A;  2HRF A;  1XWB A;  2VL2 C;  4ILF A;  5CYY A;  4TXO B;  2XBQ A;  5IPG A;  2LJR A;  1TP9 A;  2L4C A;  1V9W A;  1K0C A;  3CTF A;  3TKS E;  4MZB A;  3LXT A;  3ERF A;  5JCU A;  3C1S A;  3TRX A;  4F0B A;  4HQZ A;  2ALB A;  1ZCP A;  2DC5 A;  2B1L A;  2H30 A;  2K18 A;  2F8A A;  4V2N A;  4RI6 A;  4FO5 A;  4F03 A;  2FY6 A;  1SU9 A;  1KBN A;  1UN2 A;  4OD7 A;  1B4Q A;  4V2M A;  2HRK A;  4TRX A;  1S3A A;  2AB6 A;  3PPU A;  1U88 A;  2HZE B;  1BYE A;  5DVB A;  4HQS A;  1EWX A;  4WR4 A;  1NM3 A;  4BWQ A;  1WP0 A;  4Q5Q A;  4MLY A;  4MH3 A;  2YAN A;  1B48 A;  3GTU A;  4K0G A;  5B6N A;  4TN8 A;  1F37 A;  1H75 A;  5ECI B;  4QQ7 A;  2YZU A;  1FB0 A;  4IEL A;  2EIQ A;  3IR4 A;  1YF0 A;  3MWH A;  3EVI A;  4PNG A;  3MIX A;  3TOU A;  1YJ6 A;  3CYN A;  4POK A;  1XIY A;  2VCQ A;  3A3T A;  4ZIL A;  3UOM A;  3GN3 A;  2H6X A;  3NIV A;  4EF0 A;  3G7I A;  1QUW A;  4AJ8 A;  5KN1 A;  3ZLP A;  3FHK A;  3QFA C;  2FGX A;  1W89 A;  4FQU A;  4KCE A;  4FH8 A;  4XCS A;  5KN0 A;  2YJ7 A;  3BOA A;  3N5O A;  2F3M A;  1GTB A;  3IK9 A;  4FYU A;  2CX4 A;  3FEU A;  3HVV A;  2GS3 A;  2FWE A;  4AGS A;  5LCZ A;  1AIU A;  4XS4 A;  1GTA A;  4RUV A;  1XOA A;  1NHO A;  3UJ1 A;  4OFM A;  1M99 A;  1XZO A;  1HYU A;  1FVJ A;  1CQG A;  5J9C A;  1B8X A;  3I9V 2;  1OAZ A;  4O5Q A;  4NHZ A;  4TR0 A;  1FHE A;  1Z7P A;  3H79 A;  3Q6O A;  3EE2 A;  4KCA A;  3GUS A;  3LWA A;  4ZB9 A;  2NTO A;  3PGT A;  1AQW A;  1ERT A;  1N8J A;  2VLT A;  2PGT A;  4BL7 A;  2PVO C;  2YWM A;  3GKX A;  5CRH A;  2R0P A;  2ZCT A;  1SYX A;  4K7N A;  3KD0 A;  2FCH A;  5EVO A;  2KHP A;  1I9D A;  4ZBD A;  2OKA A;  1LU4 A;  2DML A;  4D73 B;  1G7O A;  3EPT A;  3WT1 A;  3HJM A;  4PGT A;  5IMV A;  5DQY A;  2DJ0 A;  12GS A;  2O87 A;  4I8B A;  3CBU A;  1MDK A;  3ERW A;  4KSO A;  5COH A;  3ERG A;  3GSS A;  1QK8 A;  1O7U A;  1R7H A;  2IPA A;  4HJ2 A;  5CRG A;  1ON4 A;  2X8H A;  1EGR A;  2IWT A;  1GSY A;  1U87 A;  5IOX A;  3DVW A;  3IBH A;  2WUL A;  3RAZ A;  3ZFB A;  1XOB A;  1QXH A;  1E2Y A;  2LS5 A;  4KW6 A;  2VM2 A;  3KJY A;  1PA3 A;  2UZ8 A;  3L9S A;  3IHQ A;  4TR1 B;  4RQR A;  5GSS A;  3ZVJ D;  6GSU A;  4IBP A;  4XRD A;  3P90 A;  3L9U A;  1XXU A;  5B8B A;  1PN9 A;  4HDE A;  2H75 A;  2LJA A;  4HU7 A;  2KOK A;  2X8C A;  5D8I A;  1CQH A;  1V98 A;  1WPI A;  2H8L A;  4DSQ A;  5GST A;  2YP6 A;  3RPP A;  2IMK A;  2GQM A;  4IJI A;  4TXO A;  1K0O A;  2DIY A;  4ZB6 A;  2YWI A;  3D4M A;  2H72 A;  2L6D A;  5D9T A;  4PTS A;  1PD2 1;  3HJP A;  1WMJ A;  2TRX A;  4LMV A;  5DJL A;  2BTO T;  2HRN A;  3C71 A;  3TUE A;  1XW5 A;  3G7Y A;  5F07 A;  5IQY A;  1MTC A;  2IME A;  1MD4 A;  1Z9H A;  3GHA A;  5ECN B;  5G1K A;  4OO4 A;  4TOP A;  1Z7R A;  1F3B A;  5A4V A;  5IO2 A;  1GTI A;  4GSN A;  1SD8 A;  2M80 A;  2HZE A;  1TJD A;  6GSX A;  1XCC A;  2GVP A;  3IC8 A;  2K8V A;  1GH2 A;  11GS A;  2JSZ A;  3FY7 A;  1SL0 B;  3IRA A;  3L4N A;  2VCV A;  4V1A p;  4WF5 A;  1HNB A;  2IN3 A;  1BED A;  2ZUP A;  5HR2 A;  1SJI A;  2E2G A;  1V40 A;  3TJF A;  4GSS A;  1TRW A;  3UAR A;  5C00 A;  2LNS A;  3ZMK A;  17GS A;  2PMT A;  3VPQ A;  2C4J A;  1SKW B;  2B5E A;  4Z2U A;  3WT2 A;  1TKD B;  1ML6 A;  1SKS B;  2H73 A;  2NBS A;  3FR9 A;  3LG6 A;  4K6X A;  2MMZ A;  2QA1 A;  1PSQ A;  2H66 A;  4YQV A;  4L0W A;  1M0U A;  1ZYP A;  2X49 A;  4OFN A;  3QFB C;  4CHS A;  3IE3 A;  3EMP A;  4N0V A;  2R2J A;  4AF2 A;  4NHW A;  4I2T A;  3EMX A;  5H5Q A;  1A2M A;  2DJ3 A;  4GCI A;  2RII A;  2PWJ A;  2GZY A;  4YAV A;  4KDU A;  2B7J A;  3UAP A;  5J4U A;  2DJ1 A;  4G2E A;  4O5R A;  1TK5 B;  1FW1 A;  3Q19 A;  4E8H A;  4CW9 A;  3MAK A;  5DCH A;  3QR6 A;  4MDC A;  1QFN A;  1ACV A;  1K0N A;  5F05 A;  3DWV A;  2IMD A;  2OE1 A;  3KP8 A;  3HA9 A;  1HQO A;  2DLX A;  2CT6 A;  3HHV A;  2O89 A;  2X8G A;  1QMV A;  1J08 A;  5F8B A;  1SL2 B;  2LRC A;  3ZML A;  5ECQ B;  2ON5 A;  2H1B A;  5ENU A;  3IOS A;  2RM5 A;  4EIP A;  3C1R A;  1T1V A;  1UC7 A;  5GZZ B;  3F4T A;  3L0H A;  1TOF A;  4D73 A;  1GWC A;  1SL1 B;  2WDU A;  4ZBB A;  3KIJ A;  2P0G A;  4HI7 A;  3DXB A;  4OWY A;  2J9H A;  4MMM A;  4F82 A;  2TRC P;  1HNA A;  3KTL A;  3EWL A;  4KDY A;  4ZBA A;  5E59 A;  4KAE A;  6GSY A;  2I3Y A;  5H5S A;  5B8A A;  3HYP A;  3M8N A;  1A2J A;  3FYG A;  2C0D A;  3TKS C;  5ECL B;  1ZGN A;  2N5A A;  4ZL7 A;  4OMV A;  2MYG A;  5HR0 A;  2K9F A;  1R26 A;  2PUK C;  4YKF A;  2RM6 A;  4ML1 A;  3LYK A;  1BJX A;  4WEY A;  1EP7 A;  2CV4 A;  4PQI A;  1V57 A;  2MBT A;  3UEM A;  2N5F A;  3CTG A;  2CAI A;  4K1F A;  5DCG A;  1UVZ A;  4IN0 A;  2JZT A;  1W4V A;  3I69 A;  2AYT A;  4V1A g;  5HFK A;  1MDJ A;  2X99 A;  4JR6 A;  1EP8 A;  3HZ8 A;  3KZQ A;  4K9Z A;  1EZK A;  2PVQ A;  4K8M A;  3I6A A;  4IHU A;  3VFI A;  4MJC A;  1OE8 A;  2QGV A;  2H0H A;  2QA2 A;  5JWQ B;  1S3D A;  1TRS A;  3KH7 A;  4WXT A;  5ECR B;  2ES7 A;  1JZD A;  2VCW A;  1SK0 A;  2HSM A;  2I1U A;  2C3N A;  1K3Y A;  4HEA 2;  5D9V A;  1B9Y C;  1FOH A;  3BCI A;  4LA1 A;  4CDO A;  5DJM A;  3G9B A;  4BVX B;  1U6T A;  3G7J A;  4DSR A;  2C80 A;  2FLS A;  4BPY A;  3WGD A;  2HT9 A;  4G19 A;  2VL2 A;  1GUM A;  2V6K A;  3GH6 A;  3DIE A;  1SK2 A;  4HZ4 A;  4I5Q A;  4PQH A;  3ZZX A;  1ZYN A;  4IW9 A;  3NZN A;  4ECI A;  4ZIJ A;  4CY8 A;  3LOR A;  2IMF A;  4MA9 A;  2LRN A;  3GNJ A;  3D6I A;  3GL5 A;  2J23 A;  2WB9 A;  2KP1 A;  1OC9 B;  4J56 E;  1TU8 A;  1GSQ A;  3Q18 A;  3VPT A;  2FA8 A;  3D5J A;  3VI7 A;  1SD9 A;  5EPF A;  2AUV A;  3UVT A;  3LGC A;  1RW1 A;  4KSM A;  1GL8 A;  4F9Z A;  4E8E A;  1BG5 A;  1AUC A;  4POM A;  5AIX A;  2L5O A;  1GRX A;  2MBS A;  2VCX A;  4JBB A;  4HZ2 A;  1M2D A;  4ZB8 A;  5G2Z A;  3QD9 A;  4HU9 A;  5L71 A;  5ECH B;  1PGT A;  1EOH A;  1K0B A;  1FOV A;  1R4W A;  1TI1 A;  3IV4 A;  2FHE A;  2FUG 2;  4RI7 A;  2N5B A;  4MJA A;  2VLU A;  2CA8 A;  3F0I A;  3W6G A;  1T3B A;  1V2A A;  2YWO A;  1A0F A;  1AQX A;  3L78 A;  4WBJ A;  3C8E A;  5ECS A;  1JZR A;  4X4J A;  5BRT A;  2RUF A;  5A4U A;  2E0Q A;  1F3A A;  6GSV A;  4GXZ A;  4USS A;  1XWK A;  2HLS A;  3EC3 A;  1MD3 A;  3QAG A;  3ZRE A;  4MZC A;  2E7P A;  3EU4 A;  2XPE A;  5DQS A;  6GST A;  1XPV A;  2JSY A;  3U5R E;  1OKD A;  2VM1 A;  3ZIJ A;  5CRE A;  2VL9 A;  2CX3 A;  5IMC A;  4WET A;  5ABR A;  3TB2 A;  3WD6 A;  1XW6 A;  1TK8 B;  2HSH A;  4JE1 A;  4ECB A;  4EXJ A;  5J3R A;  4PXO A;  1DBY A;  22GS A;  1SJ6 A;  2G0F A;  5IM9 A;  1KTE A;  3IPZ A;  4KH7 A;  1IYH A;  3ZIT A;  2L6C A;  4MPF A;  3LJR A;  4BA7 A;  3CRU A;  5A4W A;  4DSS B;  3A2X A;  2H0I A;  1A24 A;  4TXV A;  1X5D A;  2YPM A;  3H8Q A;  2YWN A;  3HDC A;  5HR3 A;  3GFK A;  1GLP A;  1YF1 A;  5DAL B;  3TJK A;  5D93 A;  2HXK A;  2NDO A;  3N9J A;  1EOG A;  4LL1 B;  4MJB A;  4MJE A;  3APS A;  5GAP D;  2AJQ B;  5IMF A;  4IVF A;  2IMI A;  4LLR A;  3LFL A;  3PR8 A;  2A4H A;  3TJG A;  2EIO A;  3GIX A;  1RQM A;  2M72 A;  1X0R A;  2XC2 A;  4MAB A;  1YQ1 A;  4PQ1 A;  1M9A A;  1WE0 A;  2R3X A;  1JLV A;  5ELA A;  3MYD A;  1IYI A;  4Z2R A;  2R4V A;  1M9B A;  2REM A;  3HXS A;  5IPH A;  1KNG A;  4L0U A;  1GSF A;  2YN1 A;  3O6T A;  2F51 A;  1X9M B;  2GLR A;  1O8X A;  1NHY A;  2VO4 A;  4EC0 A;  4ZXG A;  3CSH A;  3KM6 A;  1DUG A;  1USB A;  5JCG A;  1OC3 A;  3FMW A;  4Q5R A;  2LEG A;  3I43 A;  5AIS A;  4ICY A;  2JZR A;  2JAD A;  1NSW A;  16GS A;  4YH2 A;  1SEN A;  4BVX A;  5ECO B;  4I6X A;  5IMA A;  1BAY A;  2HRA A;  2H6Z A;  4QL9 A;  3VWV A;  3GKN A;  3F8U A;  2MMN A;  5E4W A;  1S3C A;  1U3I A;  2VAF A;  2QKE A;  3QPM A;  3VWX A;  2XPD A;  3VWU A;  3A2W A;  2L57 A;  3W8J A;  3TCO A;  2LQQ A;  1V58 A;  5ID2 A;  2I81 A;  4POB A;  3GUR A;  1OC9 A;  4EDZ A;  2B5X A;  3ZRD A;  1OKT A;  2MMA A;  3IAS 2;  2R0G A;  3P2A A;  3EIN A;  18GS A;  4O5U A;  3UIW A;  3WGE A;  1T4Y A;  4KB3 A;  3TKR A;  4O32 A;  4IP1 A;  5FHI A;  2JL4 A;  2X4A A;  2LV3 A;  3DKS A;  3GRX A;  2DBC A;  2OBI A;  4K7O A;  1LJR A;  4EE0 A;  2CVK A;  2RUE A;  1GUH A;  3PH9 A;  4CY6 A;  3RDW A;  2NVL A;  3DYR A;  4QL7 A;  2VD1 A;  3GV1 A;  5D73 A;  2MMO A;  5EL8 A;  1ST9 A;  3VLN A;  4Z7X A;  3F3Q A;  3KMO A;  4ECC A;  2DJJ A;  2PPT A;  1AQV A;  3CSJ A;  4MZW A;  4AJ6 A;  1SYR A;  9GSS A;  4MPG A;  1TW9 A;  3AY8 A;  3IDV A;  3GH9 A;  2VOC A;  3GA4 A;  5IMD A;  1VGL A;  4ZL9 A;  1O6J A;  1JZW A;  2CZ2 A;  3VI5 A;  3APQ A;  4NV2 A;  2YZH A;  1BQ7 A;  5DAK B;  2B3S A;  1GSD A;  3M9J A;  2FWF A;  4N10 A;  1PKZ A;  1OVN A;  5GAN D;  3VUR A;  4PUR A;  3GX0 A;  2KP2 A;  4GRF A;  2PBJ A;  3F3R A;  1MDI A;  2DSA A;  4AJ7 A;  3GKM A;  2DMM A;  2B7K A;  3LSZ A;  4POL A;  3A2V A;  1PL1 A;  2LUS A;  2HZF A;  3QAV A;  3TOT A;  2YCD A;  4YAP A;  4FYC A;  2HFD A;  2QC7 A;  2V41 A;  2O8V B;  2HI7 A;  2B6M A;  1SK1 A;  4MP4 A;  4OCE A;  3IAM 2;  3MNG A;  4J2F A;  2JAC A;  3F4R A;  3HD5 A;  2C0F A;  3TJB A;  2FWH A;  3OR5 A;  2H1D A;  4PUA A;  4TW5 A;  5HQP A;  3ZYW A;  4NMU A;  3R2Q A;  2H0G A;  1AXD A;  3F6D A;  1A23 A;  4P3Y B;  2A2P A;  2V2G A;  3DML A;  19GS A;  1AAZ A;  1QGV A;  2E2M A;  2PU9 C;  4DSS A;  4L8E A;  5IOW A;  4KGI A;  2C0E A;  5CRD A;  4GLT A;  2V32 A;  3FZ9 A;  2DKI A;  4X1U A;  5DAL A;  3UL3 A;  3EU3 A;  1Z3E A;  2D2Z A;  1YZX A;  4IP6 A;  2IFQ B;  3D4T A;  5AN1 A;  1MEK A;  4KA0 A;  2CQ9 A;  3F9U A;  3FKF A;  4XIH A;  5G5E A;  2LJK A;  1PX7 A;  1FVK A;  2Z9S A;  4ML6 A;  1K0A A;  3S9F A;  4DEJ A;  8GSS A;  1JZO A;  4BVY A;  3ZIV A;  5A5K A;  2EC4 A;  2OBK A;  5J5N A;  4WF4 A;  3U6V A;  2IIY A;  4OO5 A;  1M7T A;  3TKS A;  1C72 A;  2KLX A;  3ISO A;  3BCK A;  5H5R A;  2VIM A;  3FR6 A;  3FRC A;  2GGT A;  1T7P B;  1JFU A;  1PX6 A;  1O73 A;  2C3Q A;  3BD2 A;  5FT3 A;  2P5Q A;  4GQC A;  4L5L A;  1T8E B;  4WBR D;  3FK8 A;  5CAX A;  4MF6 A;  2DJ2 A;  3DEX A;  4PUF C;  1YEX A;  1ZYQ B;  1F6M C;  3M3M A;  2H19 A;  1OC8 A;  2R6K A;  1F9M A;  1G6Y A;  4Z2T A;  10GS A;  2GQL A;  3E3E A;  3QCP A;  3VWW A;  5AIV A;  2A4V A;  2V1M A;  3F63 A;  5CP1 A;  1EV4 A;  1EEM A;  3E9J B;  1XFL A;  1URM A;  3MDK A;  2GZZ A;  1A0R P;  1PKW A;  1I5G A;  2OA7 A;  1Z5Y E;  5ECK B;  1R5P A;  4YQM A;  2VL3 A;  4YKG A;  1TK0 B;  1ZYE A;  4NWY A;  3GX8 A;  2CZ3 A;  1LBK A;  5D9W A;  2HE3 A;  1G0T A;  5INY A;  3UBL A;  5ID2 B;  2KUC A;  1O8W A;  1VF4 A;  2WS2 A;  1M2A A;  2WGR A;  5F0G A;  1ZL9 A;  2GZP A;  2TIR A;  2VD0 A;  4KE3 A;  1FAA A;  2H6Y A;  1GNE A;  1EGO A;  5IO0 A;  3KMN A;  2CAQ A;  2C0G A;  1VF3 A;  4ID0 A;  1K3L A;  2H01 A;  3DD3 A;  1OE7 A;  4N0Z A;  3KP9 A;  6GSS A;  1HD2 A;  3A5W A;  5ECP B;  3C73 A;  3FZ5 A;  2GSQ A;  1ERU A;  5D96 A;  4KND A;  1XWA A;  3TKP A;  1XW9 A;  2PER A;  4NAX A;  2LQO A;  1O85 A;  4ZL8 A;  4G10 A;  1QQ2 A;  1B9X C;  1SKR B;  3HVX A;  1FB6 A;  1ERV A;  2BJX A;  3GKK A;  4PX1 A;  3O76 A;  5DAK A;  3KTB A;  1X5E A;  3ZFL A;  5DDL A;  4JU5 A;  1WIK A;  4J57 E;  3TKQ A;  1DSB A;  3W8S A;  1XWG A;  2OAD A;  3QAW A;  1EV9 A;  5G5F A;  2AAW A;  4Q5F A;  2R5G A;  4F0C A;  7GSS A;  2HSY A;  5C04 A;  1GP1 A;  1TRU A;  2WZ9 A;  1XWC A;  5CO3 A;  2YNX A;  1OYJ A;  1TU7 A;  4EDY A;  1GUK A;  4X0X A;  5JCW A;  4ECJ A;  4MF5 A;  4KUN A;  1WWJ A;  3KXO A;  3C7M A;  4YQU A;  1K0D A;  2A2R A;  5HFI A;  4RQX A;  5G31 A;  5D9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...