1A2JA

Oxidized dsba crystal form ii
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
188
structure length
188
Chain Sequence
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISULFIDE BOND FORMATION PROTEIN
publication title Crystal structures of reduced and oxidized DsbA: investigation of domain motion and thiolate stabilization.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 69
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 1998-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1a2jA00
3TKSA 3VFIA 3RHBA 5JWRB 1OE7A 2HZEA 4POMA 5G31A 4RUVA 4BVYA 1VRSD 4EXJA 2QC7A 4TR4A 5ECMB 4ZL9A 4ISDA 1U3AA 1OVNA 4D73B 1A8YA 2DJ2A 4PUFC 2LS5A 1EV9A 2V41A 3GKNA 1PKWA 1RK4A 4K0NA 2RIIA 2VAFA 1GWCA 2LEGA 2F8FA 2GVPA 3I69A 2F51A 3IOSA 1T8EB 2G0FA 1WJKA 1OYJA 1YEPA 4F9ZA 1BG5A 2C3NA 1YQ1A 3M9JA 3ZL5A 2Z9SA 13GSA 3VI5A 2AAWA 1O73A 1U3IA 1OAZA 2B5EA 5FWGA 4FYBA 5CRDA 1SK2A 3TRQA 4MF6A 3E0UA 3VPQA 4PURA 1J9BA 2CVBA 1M99A 4GWRA 4TVEA 3EWLA 3D22A 4PUAA 3M1GA 4Q5QA 2EC4A 4I97A 1GSDA 4OMVA 2VCWA 2C1YA 1SL2B 1K3OA 4FYCA 3VWUA 2C0EA 4O32A 1BQ7A 1LJRA 2YNXA 3IR4A 4K2DA 4E8EA 2WGRA 3EMXA 5HR1A 3GL3A 3D0ZA 3RPNA 3TOTA 4MJBA 3TCOA 2FY6A 3P90A 3GX8A 1EP7A 2F8AA 4G9HA 5F0GA 1G7OA 5C00A 4NMUA 2GZZA 3FHKA 3DD3A 2OADA 5G1LA 4HI7A 3WGXA 5JCGA 5DALB 2H76A 3BD2A 3EC3A 1FO5A 3GKKA 6GSTA 5KN2A 1AW9A 5HFKA 4OD7A 1EGRA 2H66A 8GSSA 4WXTA 3BCIA 3HYPA 2EIRA 4RI6A 2KHPA 2R5GA 1TI3A 4JEDA 3KZQA 3IK7A 5FT3A 4J2FA 2HSYA 1T3BA 3LXTA 1ON4A 2ON7A 3CRUA 5FHIA 1G0TA 2I4AA 1TU7A 4POKA 3E9JB 3RDWA 1PSQA 1MD4A 2K8SA 5IMZA 2CZ2A 1F6MC 3CSHA 2EIQA 3N9JA 2B5YA 4OFNA 3FZAA 3H93A 2GT5A 4ZIJA 1GUMA 1XVQA 2CX3A 5B7CA 4DSSB 2DC5A 2LNTA 1W89A 4MZBA 3F3QA 2BMXA 4GLTA 3EINA 3DXBA 4N11A 4X43A 2OE1A 2VD0A 4KDYA 1WIKA 4K7OA 2LQQA 3O76A 2J9HA 3RPPA 4DSQA 3DEXA 1PN9A 1A2LA 3DWVA 3CRTA 4ECCA 3PH9A 1K0AA 1ZGNA 5CAXA 4YQVA 3IAS2 5B8AA 4N0VA 3KP9A 2GGTA 1Z6MA 2YWNA 4NAXA 3GH6A 1JFUA 4ECBA 1B48A 1TU8A 2F3MA 1AAZA 5D9WA 5ECRB 1T7PB 3QPMA 5D9TA 1R5PA 1ACVA 1RW1A 4Z7XA 3HZ8A 3MDKA 3TKPA 3G7IA 1YKAA 2MMNA 5B6NA 3FY7A 3QFAC 2WDUA 4HOJA 4POBA 3GHAA 4AJ6A 3IK9A 3KXOA 4GQFA 4HJ2A 1Z3EA 4J57E 1GH2A 4F0BA 2VIMA 1TOFA 2KOKA 2K8VA 1SK1A 1J0FA 5A5KA 5D9VA 5G5EA 3TKSC 4XRAA 2AYTA 1K0DA 3GA4A 5IOWA 2WFCA 2KLXA 2HNLA 5JWQB 4HEA2 1NHYA 3IE3A 5DCHA 1ERVA 2LTKA 2N5FA 2B6MA 2F9SA 2H19A 3C71A 3PGTA 2E2MA 5GSTA 1R5AA 2H01A 1QQ2A 5C04A 5EPFA 3ZFLA 3HKRA 5A4VA 5KN0A 5LD0A 5IMFA 1VGLA 2H1BA 2JZSA 3FRCA 3KMOA 1AQXA 1XW5A 5ABRA 4KA0A 4GQCA 4EE0A 2IMDA 1A0FA 5ID2A 3J7Yk 3HJPA 1PGTA 3R2QA 5COHA 2L57A 3LWAA 6GSXA 4IW9A 1K0MA 2IMIA 4PX1A 2HFDA 1G7EA 2O85A 3ZITA 4X1UA 3Q6OA 1GSSA 4K9ZA 4TKYA 2CX4A 4MJAA 3FZ9A 2AJQB 2PMTA 2HSHA 1A24A 5EL8A 3W8SA 5ELAA 2NPBA 3FW2A 5DALA 3V1WA 2VM2A 1E2YA 3H1NA 3UEMA 2A2RA 4ECJA 1Z7PA 3TKSE 1YZXA 2VO4A 1KTEA 1AQWA 2FUG2 3ZRDA 4WF4A 4YQUA 3QAVA 1WOUA 3FEUA 4TR1A 3U6VA 2ES7A 1SENA 2JACA 1F2EA 3VWVA 1XXUA 19GSA 1XVWA 4PNFA 1V2AA 1GTUA 5ELGA 3Q18A 3DIEA 4NHZA 3GFKA 1QXHA 4OCEA 2FD3A 2LKUA 1W4VA 2V2GA 2YWIA 3U5RE 5ENUA 2PPTA 1Q4JA 4GTUA 4ML6A 1GSYA 6GSUA 1XPVA 3TJGA 3CMIA 1AXDA 5INYA 1M0UA 1SK0A 18GSA 2LRCA 3JCML 2ON5A 3M9KA 3FZ5A 4XIHA 4XTSA 1ST9A 1OC8A 1GLPA 2LRTA 1X0RA 3FR9A 1DE1A 5DDLA 1HNCA 3DVXA 2LSTA 4KW6A 3KP8A 3LYKA 4YAVA 3F63A 1JLVA 3LXZA 5F07A 3UBLA 2I3YA 2XBIA 3RBTA 2B1KA 4BPYA 1I5GA 5ECIB 2R4VA 1SD8A 4KDXA 4KAEA 4IKHA 2E0QA 2VCVA 2H71A 1DSBA 5CNWA 3IAM2 1RQMA 4OFMA 3F3RA 3GH9A 3L9UA 1K3YA 1YEXA 4POLA 2FWHA 1Q98A 2VM1A 3P8WA 4L0UA 4WKWA 2JU5A 5IO2A 2R6KA 5J9BA 4KUNA 2E2GA 5F8BA 3QR6A 2MBTA 3MSZA 2GT6A 2HT9A 1GULA 3F4TA 4XCSA 3HVXA 1B8XA 2HXKA 2JSZA 4TOPA 3KTLA 4ZB9A 1OKDA 5AIVA 2RM6A 3IA1A 3GMFA 1Z6NA 2C8UA 4AGSA 4EDYA 3RHCA 3TJBA 3E3EA 1YDKA 3APOA 3TRPA 2AV4A 1PX6A 3M0FA 3CBUA 2M46A 2GZPA 4PNGA 5ECLB 1GRXA 4YAPA 4MZCA 5ECHB 1GSFA 5CP1A 3WGDA 4MABA 5HR0A 5EY6A 3ZREA 1WPIA 3EURA 2IMKA 4FYUA 3CXGA 2JSYA 3LGCA 2IMFA 3VWXA 3L4NA 1VF4A 2P5QA 1BJXA 5GSSA 4F0CA 2YCDA 4KDUA 3ZLPA 4KH7A 1QFNA 2V1MA 2VCTA 1TDIA 2HRNA 5D9XA 1JZWA 5A4UA 3F8UA 5CRWA 3TKQA 2K9FA 1E6BA 4HZ2A 4KGIA 4V1Ap 2X8GA 5J3RA 1SYXA 4MJCA 3TRXA 3C8EA 4ZILA 3G9BA 2GLRA 5ID2B 4V2LA 2B3SA 3LSZA 2H6ZA 1X9MB 4JZQA 4HQSA 1GSEA 2PVOC 2REMA 2CZ3A 3TB2A 1A0RP 4TXOB 1ERTA 4KCAA 3J7Yb 3GUSA 3TGZA 5HR3A 1K0BA 2A2SA 2CQ9A 1TK0B 2VL2A 2DIYA 3KM6A 4F2IA 3RAZA 4FO5A 1EOGA 3A2WA 3H79A 3PINA 4ZB6A 2L5LA 2L4CA 3GTUA 2C3QA 5KEJA 4FH8A 3NIVA 1MDKA 3L78A 4WBRD 3LORA 6GSVA 3ZIJA 1A23A 2XC2A 2DJJA 1XWCA 4TR1B 3DGQA 4Q5RA 2O7KA 3TJJA 1HYUA 5GAND 4BVXA 3TUEA 2FWEA 1F3AA 3DKSA 3G7JA 2IMEA 2B5XA 1VF1A 2YWOA 2XPEA 2GSTA 4BWSA 5JWOB 1HQOA 2K18A 5L71A 4HQZA 2B7JA 4GXZA 1GSQA 4N0ZA 2JZTA 7GSSA 2VUPA 1M9AA 2WB9A 3HVVA 3QOUA 2GQKA 2I9HA 2JZRA 4CHSA 1SKSB 1B4PA 4PQHA 5AGYA 2JADA 5G1KA 1TK8B 2LJKA 3IV4A 1R4WA 2EIOA 1ZL9A 4ML1A 1CQHA 1F3BA 4NXIA 4LLRA 2WS2A 3HD5A 5G5FA 2PWJA 1V9WA 2DSAA 2M80A 4ECIA 2P31A 2H0GA 3BCKA 1OKTA 3UAPA 3WD6A 1ERWA 3IPZA 4YQMA 1FB6A 3IHQA 1H75A 5IMCA 1PL1A 2YOIA 1XW9A 5CRGA 3KD0A 4WF5A 3G7YA 1TKDB 1FB0A 4EDZA 2IN3A 3UIWA 4JR4A 1V57A 2YZUA 3TOUA 4E8HA 1WP0A 5DJLA 1FVKA 1WE0A 4GRFA 2BTOT 2VL9A 2GZYA 1M7TA 5IQYA 4ID0A 3LFLA 1LU4A 3VWWA 2DBCA 1SKWB 4G19A 1AIUA 2H72A 1VF3A 1I9DA 1X9WB 4K7IA 4NHWA 3W8JA 4YH2A 2YP6A 2H1DA 1FHEA 1GUHA 4BWQA 3LYPA 4IJ3A 2FNOA 3HXSA 4QL9A 4KSMA 3FR6A 5E4WA 1FW1A 4ACSA 4JBBA 4L5OA 3QCPA 2PN8A 3PR8A 4XS4B 4WR4A 1ZZYA 3W6GA 4PXOA 3SWLA 2YJ7A 4LA1A 1T1VA 4TXVA 3GURA 5H5SA 1U6TA 2DLXA 2MMZA 2LV3A 4ZBBA 2QKEA 5H5QA 4TN8A 1B9XC 2YV7A 4WR5A 5F05A 1HNBA 1PA3A 1O6JA 1YJ6A 2DJ0A 14GSA 4MJEA 4EKZA 1K3LA 3P7XA 3I43A 2VOCA 1KEBA 3GN3A 1DE2A 1XBSA 1XWBA 1QUWA 4I2UA 2FLSA 4L0WA 1Z9HA 4V2MA 3ME7A 5CO3A 2KUCA 2RUEA 1QK8A 2PGTA 3IBHA 4IBPA 1ERUA 4J56E 3GKMA 3P2AA 2C0DA 3CYNA 4HUAA 1GP1A 1T00A 5H5RA 3I9V2 3F6DA 4TXOA 4QQ7A 3A5WA 2OE0A 1PQNA 3ERFA 4I2TA 5DJMA 3FK8A 3GKXA 2ZCTA 4WETA 1XWAA 3EE2A 4GSNA 5B8BA 1ML6A 2WULA 4LMVA 2PVQA 5G2ZA 5IMVA 1TRSA 4HU7A 5J4UA 3L0HA 1TXXA 2KP1A 5D73A 1PKZA 4MH2A 4TR0A 4IGJA 5DAKB 1WMJA 4XS1A 4K8MA 1GNWA 1MDIA 4IS0A 3FZ4A 1PL2A 3QDNA 4KX4A 4N10A 5ECPB 2PU9C 2XPDA 2OA7A 1TP9A 3Q74A 1TW9A 2XBQA 2CT6A 2V32A 4LL4B 2VL2C 1O8WA 2MZCA 4EF0A 4XRDA 2H1AA 3ME8A 2NTOA 3M3MA 1JHBA 3ZVJD 5GAPD 3C73A 2JL4A 2X8CA 4DVCA 3GTUB 1R26A 1EZKA 3D4MA 1XWGA 1TRUA 1WWJA 5CRHA 1BX9A 1TRVA 1XZOA 3O6TA 1V58A 2PUKC 4OWYA 1HNAA 1T4YA 4HJMA 2ALBA 3TDGA 4CW9A 5HQPA 5HR2A 3C7MA 4ILFA 3GSTA 2LQOA 1A2JA 1XOBA 1XIYA 2VD1A 5J9CA 4MCUA 3N5OA 1H4OA 3HJMA 2LJAA 1G6WA 2H0HA 2DMMA 1HD2A 1AQVA 4NWYA 3EU3A 2RM5A 2AUVA 1FVJA 2WCIA 4RQRA 3WGEA 1Z5YE 3F4RA 4O7HA 1USBA 1Y25A 4PQ1A 4HDEA 4AJ8A 4XS6A 2B1LA 1PX7A 2O87A 3FYGA 3QFBC 4RI7A 5AISA 3ZFBA 3D4TA 4ZBAA 4BA7A 1JLWA 1MD3A 1R7HA 2L5OA 3KH7A 4MZWA 2H1GA 1XWKA 3KIJA 1BEDA 2H30A 1G6YA 1LBKA 4KNDA 2H73A 2V6KA 3HY2A 2ZUPA 1GTAA 2NDOA 1YY7A 1SJZA 4GF0A 1MEKA 1YF1A 2H6YA 3KCMA 4IQ1A 3BJ5A 2GTUA 1VF2A 2VL3A 1A2MA 3F6FA 4EC0A 1N8JA 3M8NA 1UC7A 2TRCP 2GQMA 2B7KA 2HZFA 2AHEA 2RLIA 3L9SA 4P3YB 3KEBA 4JRRA 3HDCA 2OACA 3TJKA 1SL0B 1K0CA 1KNGA 2BJXA 4KB3A 3CSIA 4XS4A 3BBYA 4KE3A 4TRXA 4G10A 4MDCA 1EOHA 5IOXA 5EVOA 3GL5A 2FWFA 3MWHA 12GSA 5IPGA 2LNSA 4V2NA 4K6XA 1DUGA 1K0OA 1ZYEA 3EYTA 5ECNB 3ISOA 2R2JA 5D96A 5ECKB 2HI7A 1DBYA 2R3XA 2R37A 2FA4A 4WBJA 2OE3A 1OE8A 1EWXA 1SD9A 4O92A 2L6DA 2CAIA 2IWTA 3DVWA 3NOFA 4EL1A 2H8LA 2WJUA 3IC4A 2LRNA 4QL7A 1S3CA 4H86A 3QAWA 1K0NA 4OO5A 4MPGA 3OR5A 5J5NA 3KMNA 3IXRA 4K7NA 1X5EA 2YN1A 5IIZA 4L5LA 3GX0A 4RQXA 1TTZA 2DIZA 2VLUA 5HFIA 1A8LA 3DMLA 1THOA 2I1UA 4ULXA 4L8EA 1QGVA 1ZOFA 3CTFA 2C4JA 3GIXA 5DAKA 1AUCA 1B9YC 1FG4A 1XW6A 1YKCA 3LQ7A 1XFLA 5JCWA 3AY8A 2C80A 5GZZB 3TJFA 10GSA 5CYYA 3QD9A 2LUSA 1OC9B 1PD21 1TI1A 2V6OA 4LL1B 3ZMLA 5IO0A 2K6VA 1SL1B 1B4QA 3DYRA 1O7UA 4NV2A 2IFQA 3ERWA 17GSA 3HJOA 2QGVA 1JZDA 4GSSA 1V98A 3LEFA 1X9SB 1F37A 4MMMA 1M9BA 2PERA 2YANA 3ZIVA 1YF0A 22GSA 2MMAA 3L9VA 1Y6EA 3UOMA 4ZXGA 1IYIA 1JZRA 5IM9A 2QSIA 1X5CA 5AN1A 3C1RA 3QMXA 3WT1A 2N5BA 2GS3A 2FHEA 4F82A 3D21A 4MPFA 1O8XA 2X99A 2YWMA 2HLSA 4I5QA 2C3TA 2VLVA 1OC3A 2VLTA 3FKFA 3LG6A 5HFGA 5D93A 4EO3A 2IJYA 1CQGA 2MMOA 3APQA 4HU9A 2CAQA 3UBKA 1BAYA 5ECSA 6GSWA 2TRXA 4IN0A 3MNGA 1ZMAA 3UL3A 3TKRA 5DVBA 2A4VA 1BYEA 2IIYA 4MF7A 3ZVJA 16GSA 2N5AA 1ZCPA 1O85A 3ERGA 1ZYQB 3EU4A 2C0GA 4EVMA 2H75A 3KGKA 2IL3A 4LMWA 2H0IA 1SYRA 20GSA 4NV5A 1NHOA 2E7PA 1PMTA 3MAKA 1GSUA 6GSYA 3HZ4A 2OJLA 2WRTA 5KN1A 1GLQA 1GUKA 1M2AA 3GYKA 2DJ3A 3VPTA 4Q5FA 2FGXA 3H8QA 4KSOA 1SJIA 4N30A 1NW2A 1PRXA 1IYHA 3A3TA 5F06A 2DJ1A 4PQIA 5DBQA 1THXA 1SJ6A 4ZBDA 5JCUA 2M72A 4CDOA 2AB6A 2GSRA 2WZ9A 4MF5A 4TW5A 1Z7RA 5D8IA 3GV1A 4IQAA 4D73A 3A2VA 3IRAA 1NM3A 4K0GA 5A4WA 3ZTLA 5IMAA 2CA8A 4MLYA 4DEJA 1NSWA 3FR3A 2GDRA 5DCGA 3HCZA 2HZEB 1TJDA 4F03A 3UJ1A 5G30A 3DRNA 2X64A 3CTGA 3O3TA 2OBKA 1XOAA 4IHUA 2IPAA 1EV4A 1MDJA 3A2XA 1EEMA 5E59A 4G2EA 1EP8A 1MTCA 1S3AA 1GTBA 3ZMKA 3WYWA 1SU9A 4DSRA 11GSA 2C0FA 2H70A 2HRFA 2I81A 2PBJA 1GL8A 1V40A 2FCHA 2LJRA 5B6MA 2GSSA 3F4SA 4XHMA 2G2QA 1UVZA 4TR3A 1TK5B 1UN2A 3QAGA 4O5RA 2X8HA 1T4ZA 5IMDA 1OC9A 2FWGA 3VURA 2YPMA 3IDVA 5ECQB 1EEJA 4PGTA 4X0XA 1ILOA 2DMLA 3VK9A 5J41A 1UA5A 2KP2A 2MBSA 4IELA 4HS1A 3LJRA 2P5RA 2MYGA 1XCCA 2NVLA 1N2AA 5DQYA 4ZB8A 3UMAA 4KCEA 4MH3A 5KN3A 3HA9A 3K8NA 4MP4A 3HHVA 1SKRB 3NZNA 4HZ4A 5IPHA 1X5DA 1O81A 2IFQB 4I6XA 4FIWA 3HVSA 2CV4A 2O8VB 3GSSA 4IP6A 1WRYA 2P0GA 1J08A 3UVHA 4K1FA 3ZYWA 4GCIA 1JZOA 4ZL8A 1FAAA 2CVKA 3EVIA 4JU5A 1TRWA 3VI7A 4I8BA 2YV9A 2O89A 3KTBA 3UVTA 2OKAA 4OO4A 2VCZA 4IVFA 1URMA 4BL7A 3UARA 3GNJA 4GSTA 2ZNMA 3WT2A 2GQLA 3F0IA 2DJKA 1ABAA 4DSSA 1AC1A 2H74A 2D2ZA 1U88A 2TIRA 2VCQA 4Q5NA 2H6XA 2FA8A 4JE1A 1U87A 3Q19A 2CVDA 5DQSA 1GTIA 4JR6A 1GNEA 5LCZA 2L4QA 4MK3A 6GSSA 4IP1A 3KH9A 5CREA 2L59A 2YZHA 3US3A 3D5JA 3S9FA 3C1SA 4EUYA 2YJHA 4AJ7A 3CSJA 2XHFA 2GSQA 1F9MA 3GRXA 2VCXA 2L6CA 4OFTA 1S3DA 4NPBA 2RUFA 2HYXA 4OCFA 1M2BA 1QMVA 1FOVA 3I6AA 4WEYA 2HE3A 1EGOA 4ZL7A 5AIXA 3VLNA 9GSSA 5ECOB 3H4KA 3BOAA 3APSA 3D6IA 2NBSA 3ED3A 3EMPA 3F9UA 2OBIA 2J23A 1C72A 1KBNA 3KJYA 5LNKe 4IJIA 3ZZXA 4MA9A 1M2DA 4V1Ag 3SBCA 4AF2A
chains in the Genus database with same CATH superfamily
3TKSA 3VFIA 3RHBA 5JWRB 1OE7A 2HZEA 4POMA 5G31A 4RUVA 4BVYA 1VRSD 4EXJA 2QC7A 4TR4A 5ECMB 4ZL9A 4ISDA 1U3AA 1OVNA 4D73B 1A8YA 2DJ2A 4PUFC 2LS5A 1EV9A 2V41A 3GKNA 1PKWA 1RK4A 4K0NA 2RIIA 2VAFA 1GWCA 2LEGA 2F8FA 2GVPA 3I69A 2F51A 3IOSA 1T8EB 2G0FA 1WJKA 1OYJA 1YEPA 4F9ZA 1BG5A 2C3NA 1YQ1A 3M9JA 3ZL5A 2Z9SA 13GSA 3VI5A 2AAWA 1O73A 1U3IA 1OAZA 2B5EA 5FWGA 4FYBA 5CRDA 1SK2A 3TRQA 4MF6A 3E0UA 3VPQA 4PURA 1J9BA 2CVBA 1M99A 4GWRA 4TVEA 3EWLA 3D22A 4PUAA 3M1GA 4Q5QA 2EC4A 4I97A 1GSDA 4OMVA 2VCWA 2C1YA 1SL2B 1K3OA 4FYCA 3VWUA 2C0EA 4O32A 1BQ7A 1LJRA 2YNXA 3IR4A 4K2DA 4E8EA 2WGRA 3EMXA 5HR1A 3GL3A 3D0ZA 3RPNA 3TOTA 4MJBA 3TCOA 2FY6A 3P90A 3GX8A 1EP7A 4ICYA 2F8AA 4G9HA 5F0GA 1G7OA 5C00A 4NMUA 2GZZA 3FHKA 3DD3A 2OADA 5G1LA 4HI7A 3WGXA 5JCGA 5DALB 3A5IA 2H76A 3BD2A 3EC3A 1FO5A 3GKKA 6GSTA 5KN2A 1AW9A 5HFKA 4OD7A 1EGRA 2H66A 8GSSA 4WXTA 3BCIA 3HYPA 2EIRA 4RI6A 2KHPA 2R5GA 1TI3A 4JEDA 3KZQA 3IK7A 5FT3A 4J2FA 2HSYA 1T3BA 3LXTA 1ON4A 4A5PA 2ON7A 3CRUA 5FHIA 1G0TA 2I4AA 1TU7A 4POKA 3E9JB 3RDWA 1PSQA 1MD4A 2K8SA 5IMZA 2CZ2A 1F6MC 3CSHA 2EIQA 3N9JA 2B5YA 4OFNA 3FZAA 3H93A 2GT5A 4ZIJA 1GUMA 1XVQA 2CX3A 5B7CA 4DSSB 2DC5A 2LNTA 1W89A 4MZBA 3F3QA 2BMXA 4GLTA 3EINA 3DXBA 4N11A 4X43A 2OE1A 2VD0A 4KDYA 1WIKA 4K7OA 2LQQA 3O76A 2J9HA 3RPPA 4DSQA 3DEXA 1PN9A 1A2LA 3DWVA 3CRTA 4ECCA 3PH9A 3MIXA 1K0AA 1ZGNA 5CAXA 4YQVA 3IAS2 5B8AA 4N0VA 3KP9A 2GGTA 1Z6MA 2YWNA 4NAXA 3GH6A 1JFUA 4FQUA 4ECBA 1B48A 1TU8A 2F3MA 1AAZA 5D9WA 5ECRB 1T7PB 3QPMA 5D9TA 1R5PA 1ACVA 1RW1A 4Z7XA 3HZ8A 1M3JA 3MDKA 3TKPA 3G7IA 1YKAA 2MMNA 5B6NA 3FY7A 3QFAC 2WDUA 4HOJA 4POBA 3GHAA 4AJ6A 3IK9A 3KXOA 4GQFA 4HJ2A 1Z3EA 4J57E 1GH2A 4F0BA 2VIMA 1TOFA 2KOKA 2K8VA 1SK1A 1S3RA 1J0FA 5A5KA 3R3EA 5D9VA 5G5EA 3TKSC 4XRAA 2AYTA 1K0DA 3GA4A 4BVYB 4HSCX 5IOWA 2WFCA 2KLXA 2HNLA 5JWQB 4HEA2 1NHYA 3IE3A 5DCHA 1ERVA 2R0CA 2LTKA 2N5FA 2B6MA 2F9SA 2H19A 3C71A 3PGTA 2E2MA 5GSTA 1R5AA 2H01A 1QQ2A 5C04A 5EPFA 3ZFLA 1M3IA 3HKRA 5A4VA 5KN0A 5LD0A 5IMFA 1VGLA 4O5QA 2H1BA 2JZSA 3FRCA 3KMOA 1AQXA 1XW5A 5ABRA 4KA0A 4GQCA 1ZYPA 2QA2A 4EE0A 2IMDA 1A0FA 5ID2A 3J7Yk 3HJPA 1PGTA 3FMWA 3R2QA 5COHA 2L57A 3LWAA 6GSXA 4IW9A 1K0MA 2IMIA 4PX1A 2HFDA 1G7EA 2O85A 3ZITA 4X1UA 3Q6OA 1GSSA 4K9ZA 4TKYA 2CX4A 4MJAA 3FZ9A 2AJQB 2PMTA 2HSHA 1A24A 5EL8A 3W8SA 5ELAA 2NPBA 3FW2A 5DALA 3V1WA 2VM2A 1E2YA 3H1NA 3UEMA 2A2RA 4ECJA 1Z7PA 3TKSE 1YZXA 2VO4A 1KTEA 1AQWA 2FUG2 3ZRDA 4WF4A 4YQUA 3QAVA 1WOUA 3FEUA 4TR1A 3U6VA 2ES7A 1SENA 2JACA 2HSMA 1F2EA 3VWVA 1XXUA 19GSA 1XVWA 4PNFA 1V2AA 1GTUA 5ELGA 3Q18A 3DIEA 4NHZA 3GFKA 1QXHA 4OCEA 2FD3A 2LKUA 1W4VA 2V2GA 2YWIA 3U5RE 5ENUA 2PPTA 1Q4JA 4GTUA 4ML6A 1GSYA 6GSUA 1XPVA 3TJGA 3CMIA 4BVXB 1AXDA 5INYA 1M0UA 1SK0A 18GSA 2LRCA 3JCML 2ON5A 3M9KA 3FZ5A 4XIHA 4XTSA 1ST9A 1OC8A 1GLPA 2LRTA 1X0RA 3FR9A 1DE1A 5DDLA 1HNCA 3DVXA 2LSTA 4KW6A 3KP8A 3LYKA 4YAVA 3F63A 1JLVA 3LXZA 5F07A 3UBLA 2I3YA 2XBIA 3RBTA 2B1KA 4BPYA 1I5GA 5ECIB 2R4VA 1SD8A 4KDXA 4KAEA 4IKHA 2E0QA 2VCVA 2H71A 1DSBA 5CNWA 3IAM2 1RQMA 4OFMA 3F3RA 3GH9A 3L9UA 1K3YA 1YEXA 4POLA 2FWHA 1Q98A 4EIQA 2VM1A 3P8WA 4L0UA 4WKWA 2JU5A 5IO2A 2R6KA 5J9BA 4KUNA 2E2GA 5F8BA 3QR6A 2MBTA 3MSZA 2GT6A 2HT9A 1GULA 3F4TA 4XCSA 3HVXA 1B8XA 2HXKA 2JSZA 4TOPA 3KTLA 4ZB9A 1OKDA 5AIVA 2RM6A 3IA1A 3GMFA 1Z6NA 2C8UA 4AGSA 4EDYA 3RHCA 3TJBA 3E3EA 1YDKA 3APOA 3TRPA 2AV4A 1PX6A 3M0FA 3CBUA 2M46A 2GZPA 4CY8A 4PNGA 5ECLB 4K5RA 1GRXA 4YAPA 4MZCA 5ECHB 1GSFA 5CP1A 3WGDA 4MABA 5HR0A 2A4HA 4O5UA 4Z2TA 5EY6A 3ZREA 1WPIA 3EURA 2IMKA 4FYUA 3CXGA 2JSYA 3LGCA 2IMFA 3VWXA 3L4NA 1VF4A 2P5QA 1BJXA 5GSSA 4F0CA 2YCDA 4KDUA 3ZLPA 4KH7A 1QFNA 2V1MA 2VCTA 1TDIA 2HRNA 5D9XA 2DKHA 1JZWA 5A4UA 3F8UA 5CRWA 3TKQA 2K9FA 1E6BA 4HZ2A 4KGIA 4V1Ap 2X8GA 5J3RA 1SYXA 4MJCA 3TRXA 3C8EA 4ZILA 3G9BA 2GLRA 5ID2B 4V2LA 2B3SA 3LSZA 4X4JA 2H6ZA 1X9MB 4JZQA 4HQSA 1GSEA 2PVOC 2REMA 2CZ3A 3HVNA 3TB2A 5BRTA 1A0RP 4TXOB 1ERTA 4KCAA 3J7Yb 3GUSA 3TGZA 5HR3A 1K0BA 2A2SA 2CQ9A 1TK0B 2VL2A 2A2PA 2DIYA 2QA1A 3KM6A 4F2IA 3RAZA 4FO5A 1EOGA 3A2WA 3H79A 3PINA 4ZB6A 2L5LA 2L4CA 3GTUA 2C3QA 5KEJA 4FH8A 3NIVA 1MDKA 3L78A 4WBRD 3LORA 6GSVA 3ZIJA 1A23A 2XC2A 2DJJA 1XWCA 4TR1B 4G0IA 3DGQA 4Q5RA 2O7KA 3TJJA 1HYUA 5GAND 4BVXA 3TUEA 2FWEA 1F3AA 3DKSA 3G7JA 2IMEA 2B5XA 1VF1A 2YWOA 2XPEA 2GSTA 4BWSA 5JWOB 1HQOA 2K18A 5L71A 4HQZA 2B7JA 4GXZA 4N0ZA 1GSQA 2JZTA 7GSSA 2VUPA 1M9AA 2WB9A 3HVVA 3QOUA 2GQKA 1PFOA 2I9HA 2JZRA 4CHSA 1SKSB 1B4PA 2DKIA 4PQHA 5AGYA 2JADA 5G1KA 1TK8B 2LJKA 3IV4A 1R4WA 2EIOA 1ZL9A 4ML1A 1CQHA 1F3BA 4NXIA 4LLRA 2WS2A 3HD5A 5G5FA 2PWJA 1V9WA 2DSAA 2M80A 4ECIA 2P31A 2H0GA 3BCKA 1OKTA 3UAPA 3WD6A 1ERWA 3IPZA 4YQMA 1FB6A 3IHQA 1H75A 5IMCA 1PL1A 2YOIA 1XW9A 5CRGA 4KF9A 3KD0A 4WF5A 3G7YA 1TKDB 1FB0A 4EDZA 2IN3A 3UIWA 4JR4A 1V57A 2YZUA 3TOUA 4E8HA 2X49A 1WP0A 5DJLA 1FVKA 1WE0A 4GRFA 2BTOT 2VL9A 2GZYA 1M7TA 5IQYA 4ID0A 3LFLA 1LU4A 3VWWA 2DBCA 1SKWB 4G19A 3IHGA 1AIUA 2H72A 1VF3A 1I9DA 1X9WB 4K7IA 4Z2RA 4NHWA 3W8JA 4YH2A 2YP6A 2H1DA 1FHEA 1GUHA 4BWQA 3LYPA 4IJ3A 2FNOA 3HXSA 4QL9A 4KSMA 3FR6A 5E4WA 1FW1A 4ACSA 4JBBA 4L5OA 5KOWA 3QCPA 4CY6A 1FOHA 2PN8A 3PR8A 4XS4B 4WR4A 1ZZYA 4K5SA 3W6GA 4PXOA 3SWLA 2X4AA 2YJ7A 4LA1A 1T1VA 4TXVA 3GURA 5H5SA 1U6TA 2DLXA 2MMZA 2LV3A 4ZBBA 2QKEA 5H5QA 4TN8A 1B9XC 2YV7A 4WR5A 5F05A 1HNBA 1PA3A 1O6JA 1YJ6A 2DJ0A 14GSA 4MJEA 4EKZA 1K3LA 3P7XA 3I43A 2VOCA 1KEBA 3GN3A 1DE2A 1XBSA 1XWBA 1QUWA 4I2UA 2FLSA 4L0WA 1Z9HA 4V2MA 3ME7A 5CO3A 2KUCA 2RUEA 1QK8A 2PGTA 3IBHA 4IBPA 1ERUA 4J56E 3GKMA 3P2AA 2C0DA 3CYNA 4HUAA 1GP1A 1T00A 5H5RA 3I9V2 3F6DA 4TXOA 4QQ7A 3A5WA 4K2XA 3CQFA 2OE0A 1PQNA 3ERFA 4I2TA 5DJMA 3FK8A 3GKXA 2ZCTA 4WETA 1XWAA 3EE2A 4GSNA 5B8BA 1ML6A 2WULA 4LMVA 2PVQA 5G2ZA 5IMVA 1TRSA 4HU7A 5J4UA 3L0HA 1TXXA 2KP1A 5D73A 1PKZA 4MH2A 4TR0A 4IGJA 5DAKB 1WMJA 4XS1A 4K8MA 1GNWA 1MDIA 4IS0A 3FZ4A 1PL2A 3QDNA 4KX4A 4N10A 5ECPB 2PU9C 2XPDA 2OA7A 1TP9A 3Q74A 1TW9A 2XBQA 2CT6A 2V32A 4LL4B 2VL2C 1O8WA 2MZCA 4EF0A 4XRDA 2H1AA 3ME8A 2NTOA 3M3MA 1JHBA 3ZVJD 5GAPD 3C73A 2JL4A 2X8CA 4DVCA 3GTUB 1R26A 1EZKA 3D4MA 1XWGA 1TRUA 2R0GA 1WWJA 5CRHA 1BX9A 1TRVA 1XZOA 3O6TA 1V58A 2PUKC 4OWYA 1HNAA 1T4YA 4HJMA 2ALBA 3TDGA 4CW9A 5HQPA 5HR2A 3C7MA 2HRAA 4ILFA 3GSTA 2LQOA 1A2JA 1XOBA 4G0KA 4EIPA 1XIYA 2VD1A 5J9CA 4MCUA 3N5OA 1H4OA 3HJMA 2LJAA 1G6WA 2H0HA 2DMMA 1HD2A 1AQVA 4NWYA 3EU3A 2RM5A 2AUVA 1FVJA 2WCIA 4RQRA 3WGEA 1Z5YE 3F4RA 4O7HA 1USBA 1Y25A 4PQ1A 4HDEA 4AJ8A 4XS6A 2B1LA 1PX7A 2O87A 3FYGA 3QFBC 4RI7A 5AISA 3ZFBA 3D4TA 4ZBAA 1PN0A 4BA7A 1JLWA 1MD3A 1R7HA 2L5OA 3KH7A 4MZWA 2H1GA 1XWKA 3KIJA 1BEDA 2H30A 1G6YA 1LBKA 4KNDA 2H73A 2V6KA 3HY2A 2ZUPA 1GTAA 2NDOA 1YY7A 1SJZA 4GF0A 1MEKA 1YF1A 2H6YA 3KCMA 4IQ1A 3BJ5A 2GTUA 1VF2A 2VL3A 1A2MA 3F6FA 4EC0A 1N8JA 3M8NA 1UC7A 2TRCP 2GQMA 2B7KA 2HZFA 2AHEA 2RLIA 3L9SA 4P3YB 3KEBA 3EPTA 4JRRA 3HDCA 2OACA 3TJKA 1SL0B 1K0CA 1KNGA 2BJXA 4KB3A 3CSIA 4XS4A 3BBYA 4KE3A 4TRXA 4G10A 4MDCA 1EOHA 5IOXA 5EVOA 3GL5A 2FWFA 3MWHA 12GSA 5IPGA 2LNSA 4V2NA 4K6XA 1DUGA 1K0OA 1ZYEA 3EYTA 5ECNB 3ISOA 2R2JA 5D96A 4YKFA 5ECKB 4USSA 2HI7A 1DBYA 2R3XA 2R37A 2FA4A 4WBJA 2OE3A 1OE8A 1EWXA 1SD9A 4O92A 2L6DA 2CAIA 2IWTA 3DVWA 3NOFA 4EL1A 2H8LA 2WJUA 3IC4A 2LRNA 4QL7A 1S3CA 4H86A 3QAWA 1K0NA 4OO5A 4MPGA 3OR5A 5J5NA 3KMNA 3IXRA 2R0PA 4Z2UA 4K7NA 1X5EA 2YN1A 5IIZA 4L5LA 3GX0A 4RQXA 1TTZA 2DIZA 2VLUA 5HFIA 1A8LA 3DMLA 1THOA 2I1UA 4ULXA 4L8EA 1QGVA 3IC8A 1ZOFA 3CTFA 4PTSA 2C4JA 3GIXA 5DAKA 2HRKA 1AUCA 1B9YC 1FG4A 1XW6A 1YKCA 3LQ7A 1XFLA 5JCWA 3AY8A 2C80A 5GZZB 3TJFA 10GSA 5CYYA 3QD9A 2LUSA 1OC9B 1ZYNA 1PD21 1TI1A 2V6OA 4LL1B 3ZMLA 5IO0A 2K6VA 1SL1B 1B4QA 3DYRA 1O7UA 4NV2A 2IFQA 3ERWA 17GSA 3HJOA 2QGVA 1JZDA 4GSSA 1V98A 3LEFA 1X9SB 1F37A 4MMMA 1M9BA 2PERA 2YANA 3ZIVA 1YF0A 22GSA 2MMAA 3L9VA 1Y6EA 3UOMA 4ZXGA 1IYIA 1JZRA 5IM9A 2QSIA 1X5CA 5AN1A 3C1RA 3QMXA 3WT1A 2N5BA 2GS3A 2FHEA 4F82A 3D21A 4MPFA 1O8XA 2X99A 2YWMA 2HLSA 4I5QA 2C3TA 2VLVA 1OC3A 2VLTA 2UZ8A 3FKFA 3LG6A 5HFGA 5D93A 4EO3A 2IJYA 1CQGA 2MMOA 3APQA 4HU9A 2CAQA 3UBKA 1BAYA 5ECSA 6GSWA 2TRXA 4IN0A 3MNGA 1ZMAA 3UL3A 3TKRA 4BL7B 5DVBA 2A4VA 3MYDA 1BYEA 2IIYA 4MF7A 3ZVJA 16GSA 2N5AA 1ZCPA 1O85A 3ERGA 1ZYQB 3EU4A 2C0GA 4EVMA 2H75A 3KGKA 2IL3A 4LMWA 2H0IA 1SYRA 20GSA 4NV5A 1NHOA 2E7PA 1PMTA 3MAKA 1GSUA 6GSYA 3HZ4A 2OJLA 2WRTA 5KN1A 1GLQA 1GUKA 1M2AA 3GYKA 2DJ3A 3VPTA 4Q5FA 2FGXA 3H8QA 4KSOA 1SJIA 4N30A 1NW2A 1PRXA 1IYHA 3A3TA 5F06A 2DJ1A 4PQIA 5DBQA 1THXA 1SJ6A 4ZBDA 5JCUA 2M72A 4CDOA 2AB6A 2GSRA 2WZ9A 4MF5A 4TW5A 1Z7RA 5D8IA 3GV1A 4IQAA 4D73A 3A2VA 3IRAA 1NM3A 4K0GA 5A4WA 3ZTLA 5IMAA 5BMUA 2CA8A 4MLYA 4DEJA 1NSWA 3FR3A 2GDRA 5DCGA 3HCZA 2HZEB 1TJDA 4F03A 3UJ1A 5G30A 3DRNA 2X64A 3CTGA 3O3TA 2OBKA 1XOAA 4IHUA 2IPAA 1EV4A 1MDJA 3A2XA 1EEMA 5E59A 4G2EA 1EP8A 1MTCA 1S3AA 1GTBA 3ZMKA 3WYWA 1SU9A 4DSRA 11GSA 2C0FA 2H70A 2HRFA 2I81A 2PBJA 1GL8A 1V40A 2FCHA 2LJRA 5B6MA 2GSSA 3F4SA 4XHMA 2G2QA 1UVZA 4TR3A 1TK5B 1UN2A 3QAGA 4O5RA 2X8HA 1T4ZA 5IMDA 1OC9A 2FWGA 3VURA 2YPMA 3IDVA 5ECQB 1EEJA 4PGTA 4X0XA 1ILOA 2DMLA 3VK9A 4YKGA 5J41A 1UA5A 2KP2A 2MBSA 4IELA 4HS1A 3LJRA 2P5RA 2MYGA 1XCCA 2NVLA 1N2AA 5DQYA 4ZB8A 3UMAA 4KCEA 4MH3A 4G0LA 5KN3A 3HA9A 3K8NA 4MP4A 3HHVA 1SKRB 3NZNA 4HZ4A 4BIKA 5IPHA 1X5DA 1O81A 2IFQB 4I6XA 4FIWA 3HVSA 2CV4A 5KOXA 2O8VB 3GSSA 4IP6A 1WRYA 2P0GA 3PPUA 1J08A 3UVHA 4K1FA 3ZYWA 4GCIA 1JZOA 4ZL8A 1FAAA 2CVKA 3EVIA 4JU5A 1TRWA 3VI7A 4I8BA 2YV9A 2O89A 3KTBA 3UVTA 2OKAA 4OO4A 2VCZA 4IVFA 1URMA 4BL7A 3UARA 3GNJA 4GSTA 2ZNMA 3WT2A 2GQLA 3F0IA 2DJKA 1ABAA 4DSSA 1AC1A 2H74A 2D2ZA 1U88A 2TIRA 2VCQA 4Q5NA 2H6XA 2FA8A 4JE1A 1U87A 3Q19A 2CVDA 5DQSA 1GTIA 4JR6A 1GNEA 5LCZA 2L4QA 4MK3A 6GSSA 4IP1A 3KH9A 5CREA 2L59A 1XG8A 2YZHA 3US3A 3D5JA 3S9FA 3C1SA 4EUYA 2YJHA 4AJ7A 3CSJA 2XHFA 2GSQA 1F9MA 3GRXA 3LW9A 2VCXA 2L6CA 4OFTA 1S3DA 4NPBA 2RUFA 4MNNA 2HYXA 4OCFA 1M2BA 1QMVA 1FOVA 3I6AA 4WEYA 2HE3A 1EGOA 4ZL7A 5AIXA 3VLNA 9GSSA 5ECOB 3H4KA 3BOAA 3APSA 3D6IA 2NBSA 3ED3A 3EMPA 3F9UA 2OBIA 2J23A 1C72A 1KBNA 3KJYA 5LNKe 4IJIA 3ZZXA 4MA9A 1M2DA 4V1Ag 3SBCA 4AF2A
chains in the Genus database with same CATH topology
3TKSA 3VFIA 3RHBA 5JWRB 1OE7A 2HZEA 4POMA 5G31A 4RUVA 4BVYA 1VRSD 4EXJA 2QC7A 4TR4A 5ECMB 4ZL9A 4ISDA 1U3AA 1OVNA 4D73B 1A8YA 2DJ2A 4PUFC 2LS5A 1EV9A 2V41A 3GKNA 1PKWA 1RK4A 4K0NA 2RIIA 2VAFA 1GWCA 2LEGA 2F8FA 2GVPA 3I69A 2F51A 3IOSA 1T8EB 2G0FA 1WJKA 1OYJA 1YEPA 4F9ZA 1BG5A 2C3NA 1YQ1A 3M9JA 3ZL5A 2Z9SA 13GSA 3VI5A 2AAWA 1O73A 1U3IA 1OAZA 2B5EA 5FWGA 4FYBA 5CRDA 1SK2A 3TRQA 4MF6A 3E0UA 3VPQA 4PURA 1J9BA 2CVBA 1M99A 4GWRA 4TVEA 3EWLA 3D22A 4PUAA 3M1GA 4Q5QA 2EC4A 4I97A 1GSDA 4OMVA 2VCWA 2C1YA 1SL2B 1K3OA 4FYCA 3VWUA 2C0EA 4O32A 1BQ7A 1LJRA 2YNXA 3IR4A 4K2DA 4E8EA 2WGRA 3EMXA 5HR1A 3GL3A 3D0ZA 3RPNA 3TOTA 4MJBA 3TCOA 2FY6A 3P90A 3GX8A 1EP7A 4ICYA 2F8AA 4G9HA 5F0GA 1G7OA 5C00A 4NMUA 2GZZA 3FHKA 3DD3A 2OADA 5G1LA 4HI7A 3WGXA 5JCGA 5DALB 3A5IA 2H76A 3BD2A 3EC3A 1FO5A 3GKKA 6GSTA 5KN2A 1AW9A 5HFKA 4OD7A 1EGRA 2H66A 8GSSA 4WXTA 3BCIA 3HYPA 2EIRA 4RI6A 2KHPA 2R5GA 1TI3A 4JEDA 3KZQA 3IK7A 5FT3A 4J2FA 2HSYA 1T3BA 3LXTA 1ON4A 4A5PA 2ON7A 3CRUA 5FHIA 1G0TA 2I4AA 1TU7A 4POKA 3E9JB 3RDWA 1PSQA 1MD4A 2K8SA 5IMZA 2CZ2A 1F6MC 3CSHA 2EIQA 3N9JA 2B5YA 4OFNA 3FZAA 3H93A 2GT5A 4ZIJA 1GUMA 1XVQA 2CX3A 5B7CA 4DSSB 2DC5A 2LNTA 1W89A 4MZBA 3F3QA 2BMXA 4GLTA 3EINA 3DXBA 4N11A 4X43A 2OE1A 2VD0A 4KDYA 1WIKA 4K7OA 2LQQA 3O76A 2J9HA 3RPPA 4DSQA 3DEXA 1PN9A 1A2LA 3DWVA 3CRTA 4ECCA 3PH9A 3MIXA 1K0AA 1ZGNA 5CAXA 4YQVA 3IAS2 5B8AA 4N0VA 3KP9A 2GGTA 1Z6MA 2YWNA 4NAXA 3GH6A 1JFUA 4FQUA 4ECBA 1B48A 1TU8A 2F3MA 1AAZA 5D9WA 5ECRB 1T7PB 3QPMA 5D9TA 1R5PA 1ACVA 1RW1A 4Z7XA 3HZ8A 3MDKA 3TKPA 3G7IA 1YKAA 2MMNA 5B6NA 3FY7A 3QFAC 2WDUA 4HOJA 4POBA 3GHAA 4AJ6A 3IK9A 3KXOA 4GQFA 4HJ2A 1Z3EA 4J57E 1GH2A 4F0BA 2VIMA 1TOFA 2KOKA 2K8VA 1SK1A 1J0FA 5A5KA 3R3EA 5D9VA 5G5EA 3TKSC 4XRAA 2AYTA 1K0DA 3GA4A 4BVYB 5IOWA 2WFCA 2KLXA 2HNLA 5JWQB 4HEA2 1NHYA 3IE3A 5DCHA 1ERVA 2R0CA 2LTKA 2N5FA 2B6MA 2F9SA 2H19A 3C71A 3PGTA 2E2MA 5GSTA 1R5AA 2H01A 1QQ2A 5C04A 5EPFA 3ZFLA 3HKRA 5A4VA 5KN0A 5LD0A 5IMFA 1VGLA 4O5QA 2H1BA 2JZSA 3FRCA 3KMOA 1AQXA 1XW5A 5ABRA 4KA0A 4GQCA 1ZYPA 2QA2A 4EE0A 2IMDA 1A0FA 5ID2A 3J7Yk 3HJPA 1PGTA 3FMWA 3R2QA 5COHA 2L57A 3LWAA 6GSXA 4IW9A 1K0MA 2IMIA 4PX1A 2HFDA 1G7EA 2O85A 3ZITA 4X1UA 3Q6OA 1GSSA 4K9ZA 4TKYA 2CX4A 4MJAA 3FZ9A 2AJQB 2PMTA 2HSHA 1A24A 5EL8A 3W8SA 5ELAA 2NPBA 3FW2A 5DALA 3V1WA 2VM2A 1E2YA 3H1NA 3UEMA 2A2RA 4ECJA 1Z7PA 3TKSE 1YZXA 2VO4A 1KTEA 1AQWA 2FUG2 3ZRDA 4WF4A 4YQUA 3QAVA 1WOUA 3FEUA 4TR1A 3U6VA 2ES7A 1SENA 2JACA 2HSMA 1F2EA 3VWVA 1XXUA 19GSA 1XVWA 4PNFA 1V2AA 1GTUA 5ELGA 3Q18A 3DIEA 4NHZA 3GFKA 1QXHA 4OCEA 2FD3A 2LKUA 1W4VA 2V2GA 2YWIA 3U5RE 5ENUA 2PPTA 1Q4JA 4GTUA 4ML6A 1GSYA 6GSUA 1XPVA 3TJGA 3CMIA 4BVXB 1AXDA 5INYA 1M0UA 1SK0A 18GSA 2LRCA 3JCML 2ON5A 3M9KA 3FZ5A 4XIHA 4XTSA 1ST9A 1OC8A 1GLPA 2LRTA 1X0RA 3FR9A 1DE1A 5DDLA 1HNCA 3DVXA 2LSTA 4KW6A 3KP8A 3LYKA 4YAVA 3F63A 1JLVA 3LXZA 5F07A 3UBLA 2I3YA 2XBIA 3RBTA 2B1KA 4BPYA 1I5GA 5ECIB 2R4VA 1SD8A 4KDXA 4KAEA 4IKHA 2E0QA 2VCVA 2H71A 1DSBA 5CNWA 3IAM2 1RQMA 4OFMA 3F3RA 3GH9A 3L9UA 1K3YA 1YEXA 4POLA 2FWHA 1Q98A 4EIQA 2VM1A 3P8WA 4L0UA 4WKWA 2JU5A 5IO2A 2R6KA 5J9BA 4KUNA 2E2GA 5F8BA 3QR6A 2MBTA 3MSZA 2GT6A 2HT9A 1GULA 3F4TA 4XCSA 3HVXA 1B8XA 2HXKA 2JSZA 4TOPA 3KTLA 4ZB9A 1OKDA 5AIVA 2RM6A 3IA1A 3GMFA 1Z6NA 2C8UA 4AGSA 4EDYA 3RHCA 3TJBA 3E3EA 1YDKA 3APOA 3TRPA 2AV4A 1PX6A 3M0FA 3CBUA 2M46A 2GZPA 4CY8A 4PNGA 5ECLB 4K5RA 1GRXA 4YAPA 4MZCA 5ECHB 1GSFA 5CP1A 3WGDA 4MABA 5HR0A 2A4HA 4O5UA 4Z2TA 5EY6A 3ZREA 1WPIA 3EURA 2IMKA 4FYUA 3CXGA 2JSYA 3LGCA 2IMFA 3VWXA 3L4NA 1VF4A 2P5QA 1BJXA 5GSSA 4F0CA 2YCDA 4KDUA 3ZLPA 4KH7A 1QFNA 2V1MA 2VCTA 1TDIA 2HRNA 5D9XA 2DKHA 1JZWA 5A4UA 3F8UA 5CRWA 3TKQA 2K9FA 1E6BA 4HZ2A 4KGIA 4V1Ap 2X8GA 5J3RA 1SYXA 4MJCA 3TRXA 3C8EA 4ZILA 3G9BA 2GLRA 5ID2B 4V2LA 2B3SA 3LSZA 4X4JA 2H6ZA 1X9MB 4JZQA 4HQSA 1GSEA 2PVOC 2REMA 2CZ3A 3TB2A 5BRTA 1A0RP 4TXOB 1ERTA 4KCAA 3J7Yb 3GUSA 3TGZA 5HR3A 1K0BA 2A2SA 2CQ9A 1TK0B 2VL2A 2A2PA 2DIYA 2QA1A 3KM6A 4F2IA 3RAZA 4FO5A 1EOGA 3A2WA 3H79A 3PINA 4ZB6A 2L5LA 2L4CA 3GTUA 2C3QA 5KEJA 4FH8A 3NIVA 1MDKA 3L78A 4WBRD 3LORA 6GSVA 3ZIJA 1A23A 2XC2A 2DJJA 1XWCA 4TR1B 4G0IA 3DGQA 4Q5RA 2O7KA 3TJJA 1HYUA 5GAND 4BVXA 3TUEA 2FWEA 1F3AA 3DKSA 3G7JA 2IMEA 2B5XA 1VF1A 2YWOA 2XPEA 2GSTA 4BWSA 5JWOB 1HQOA 2K18A 5L71A 4HQZA 2B7JA 4GXZA 4N0ZA 1GSQA 2JZTA 7GSSA 2VUPA 1M9AA 2WB9A 3HVVA 3QOUA 2GQKA 2I9HA 2JZRA 4CHSA 1SKSB 1B4PA 2DKIA 4PQHA 5AGYA 2JADA 5G1KA 1TK8B 2LJKA 3IV4A 1R4WA 2EIOA 1ZL9A 4ML1A 1CQHA 1F3BA 4NXIA 4LLRA 2WS2A 3HD5A 5G5FA 2PWJA 1V9WA 2DSAA 2M80A 4ECIA 2P31A 2H0GA 3BCKA 1OKTA 3UAPA 3WD6A 1ERWA 3IPZA 4YQMA 1FB6A 3IHQA 1H75A 5IMCA 1PL1A 2YOIA 1XW9A 5CRGA 4KF9A 3KD0A 4WF5A 3G7YA 1TKDB 1FB0A 4EDZA 2IN3A 3UIWA 4JR4A 1V57A 2YZUA 3TOUA 4E8HA 2X49A 1WP0A 5DJLA 1FVKA 1WE0A 4GRFA 2BTOT 2VL9A 2GZYA 1M7TA 5IQYA 4ID0A 3LFLA 1LU4A 3VWWA 2DBCA 1SKWB 4G19A 3IHGA 1AIUA 2H72A 1VF3A 1I9DA 1X9WB 4K7IA 4Z2RA 4NHWA 3W8JA 4YH2A 2YP6A 2H1DA 1FHEA 1GUHA 4BWQA 3LYPA 4IJ3A 2FNOA 3HXSA 4QL9A 4KSMA 3FR6A 5E4WA 1FW1A 4ACSA 4JBBA 4L5OA 5KOWA 3QCPA 4CY6A 1FOHA 2PN8A 3PR8A 4XS4B 4WR4A 1ZZYA 4K5SA 3W6GA 4PXOA 3SWLA 2X4AA 2YJ7A 4LA1A 1T1VA 4TXVA 3GURA 5H5SA 1U6TA 2DLXA 2MMZA 2LV3A 4ZBBA 2QKEA 5H5QA 4TN8A 1B9XC 2YV7A 4WR5A 5F05A 1HNBA 1PA3A 1O6JA 1YJ6A 2DJ0A 14GSA 4MJEA 4EKZA 1K3LA 3P7XA 3I43A 2VOCA 1KEBA 3GN3A 1DE2A 1XBSA 1XWBA 1QUWA 4I2UA 2FLSA 4L0WA 1Z9HA 4V2MA 3ME7A 5CO3A 2KUCA 2RUEA 1QK8A 2PGTA 3IBHA 4IBPA 1ERUA 4J56E 3GKMA 3P2AA 2C0DA 3CYNA 4HUAA 1GP1A 1T00A 5H5RA 3I9V2 3F6DA 4TXOA 4QQ7A 3A5WA 4K2XA 2OE0A 1PQNA 3ERFA 4I2TA 5DJMA 3FK8A 3GKXA 2ZCTA 4WETA 1XWAA 3EE2A 4GSNA 5B8BA 1ML6A 2WULA 4LMVA 2PVQA 5G2ZA 5IMVA 1TRSA 4HU7A 5J4UA 3L0HA 1TXXA 2KP1A 5D73A 1PKZA 4MH2A 4TR0A 4IGJA 5DAKB 1WMJA 4XS1A 4K8MA 1GNWA 1MDIA 4IS0A 3FZ4A 1PL2A 3QDNA 4KX4A 4N10A 5ECPB 2PU9C 2XPDA 2OA7A 1TP9A 3Q74A 1TW9A 2XBQA 2CT6A 2V32A 4LL4B 2VL2C 1O8WA 2MZCA 4EF0A 4XRDA 2H1AA 3ME8A 2NTOA 3M3MA 1JHBA 3ZVJD 5GAPD 3C73A 2JL4A 2X8CA 4DVCA 3GTUB 1R26A 1EZKA 3D4MA 1XWGA 1TRUA 2R0GA 1WWJA 5CRHA 1BX9A 1TRVA 1XZOA 3O6TA 1V58A 2PUKC 4OWYA 1HNAA 1T4YA 4HJMA 2ALBA 3TDGA 4CW9A 5HQPA 5HR2A 3C7MA 2HRAA 4ILFA 3GSTA 2LQOA 1A2JA 1XOBA 4G0KA 4EIPA 1XIYA 2VD1A 5J9CA 4MCUA 3N5OA 1H4OA 3HJMA 2LJAA 1G6WA 2H0HA 2DMMA 1HD2A 1AQVA 4NWYA 3EU3A 2RM5A 2AUVA 1FVJA 2WCIA 4RQRA 3WGEA 1Z5YE 3F4RA 4O7HA 1USBA 1Y25A 4PQ1A 4HDEA 4AJ8A 4XS6A 2B1LA 1PX7A 2O87A 3FYGA 3QFBC 4RI7A 5AISA 3ZFBA 3D4TA 4ZBAA 1PN0A 4BA7A 1JLWA 1MD3A 1R7HA 2L5OA 3KH7A 4MZWA 2H1GA 1XWKA 3KIJA 1BEDA 2H30A 1G6YA 1LBKA 4KNDA 2H73A 2V6KA 3HY2A 2ZUPA 1GTAA 2NDOA 1YY7A 1SJZA 4GF0A 1MEKA 1YF1A 2H6YA 3KCMA 4IQ1A 3BJ5A 2GTUA 1VF2A 2VL3A 1A2MA 3F6FA 4EC0A 1N8JA 3M8NA 1UC7A 2TRCP 2GQMA 2B7KA 2HZFA 2AHEA 2RLIA 3L9SA 4P3YB 3KEBA 3EPTA 4JRRA 3HDCA 2OACA 3TJKA 1SL0B 1K0CA 1KNGA 2BJXA 4KB3A 3CSIA 4XS4A 3BBYA 4KE3A 4TRXA 4G10A 4MDCA 1EOHA 5IOXA 5EVOA 3GL5A 2FWFA 3MWHA 12GSA 5IPGA 2LNSA 4V2NA 4K6XA 1DUGA 1K0OA 1ZYEA 3EYTA 5ECNB 3ISOA 2R2JA 5D96A 4YKFA 5ECKB 4USSA 2HI7A 1DBYA 2R3XA 2R37A 2FA4A 4WBJA 2OE3A 1OE8A 1EWXA 1SD9A 4O92A 2L6DA 2CAIA 2IWTA 3DVWA 3NOFA 4EL1A 2H8LA 2WJUA 3IC4A 2LRNA 4QL7A 1S3CA 4H86A 3QAWA 1K0NA 4OO5A 4MPGA 3OR5A 5J5NA 3KMNA 3IXRA 2R0PA 4Z2UA 4K7NA 1X5EA 2YN1A 5IIZA 4L5LA 3GX0A 4RQXA 1TTZA 2DIZA 2VLUA 5HFIA 1A8LA 3DMLA 1THOA 2I1UA 4ULXA 4L8EA 1QGVA 3IC8A 1ZOFA 3CTFA 4PTSA 2C4JA 3GIXA 5DAKA 2HRKA 1AUCA 1B9YC 1FG4A 1XW6A 1YKCA 3LQ7A 1XFLA 5JCWA 3AY8A 2C80A 5GZZB 3TJFA 10GSA 5CYYA 3QD9A 2LUSA 1OC9B 1ZYNA 1PD21 1TI1A 2V6OA 4LL1B 3ZMLA 5IO0A 2K6VA 1SL1B 1B4QA 3DYRA 1O7UA 4NV2A 2IFQA 3ERWA 17GSA 3HJOA 2QGVA 1JZDA 4GSSA 1V98A 3LEFA 1X9SB 1F37A 4MMMA 1M9BA 2PERA 2YANA 3ZIVA 1YF0A 22GSA 2MMAA 3L9VA 1Y6EA 3UOMA 4ZXGA 1IYIA 1JZRA 5IM9A 2QSIA 1X5CA 5AN1A 3C1RA 3QMXA 3WT1A 2N5BA 2GS3A 2FHEA 4F82A 3D21A 4MPFA 1O8XA 2X99A 2YWMA 2HLSA 4I5QA 2C3TA 2VLVA 1OC3A 2VLTA 2UZ8A 3FKFA 3LG6A 5HFGA 5D93A 4EO3A 2IJYA 1CQGA 2MMOA 3APQA 4HU9A 2CAQA 3UBKA 1BAYA 5ECSA 6GSWA 2TRXA 4IN0A 3MNGA 1ZMAA 3UL3A 3TKRA 4BL7B 5DVBA 2A4VA 3MYDA 1BYEA 2IIYA 4MF7A 3ZVJA 16GSA 2N5AA 1ZCPA 1O85A 3ERGA 1ZYQB 3EU4A 2C0GA 4EVMA 2H75A 3KGKA 2IL3A 4LMWA 2H0IA 1SYRA 20GSA 4NV5A 1NHOA 2E7PA 1PMTA 3MAKA 1GSUA 6GSYA 3HZ4A 2OJLA 2WRTA 5KN1A 1GLQA 1GUKA 1M2AA 3GYKA 2DJ3A 3VPTA 4Q5FA 2FGXA 3H8QA 4KSOA 1SJIA 4N30A 1NW2A 1PRXA 1IYHA 3A3TA 5F06A 2DJ1A 4PQIA 5DBQA 1THXA 1SJ6A 4ZBDA 5JCUA 2M72A 4CDOA 2AB6A 2GSRA 2WZ9A 4MF5A 4TW5A 1Z7RA 5D8IA 3GV1A 4IQAA 4D73A 3A2VA 3IRAA 1NM3A 4K0GA 5A4WA 3ZTLA 5IMAA 5BMUA 2CA8A 4MLYA 4DEJA 1NSWA 3FR3A 2GDRA 5DCGA 3HCZA 2HZEB 1TJDA 4F03A 3UJ1A 5G30A 3DRNA 2X64A 3CTGA 3O3TA 2OBKA 1XOAA 4IHUA 2IPAA 1EV4A 1MDJA 3A2XA 1EEMA 5E59A 4G2EA 1EP8A 1MTCA 1S3AA 1GTBA 3ZMKA 3WYWA 1SU9A 4DSRA 11GSA 2C0FA 2H70A 2HRFA 2I81A 2PBJA 1GL8A 1V40A 2FCHA 2LJRA 5B6MA 2GSSA 3F4SA 4XHMA 2G2QA 1UVZA 4TR3A 1TK5B 1UN2A 3QAGA 4O5RA 2X8HA 1T4ZA 5IMDA 1OC9A 2FWGA 3VURA 2YPMA 3IDVA 5ECQB 1EEJA 4PGTA 4X0XA 1ILOA 2DMLA 3VK9A 4YKGA 5J41A 1UA5A 2KP2A 2MBSA 4IELA 4HS1A 3LJRA 2P5RA 2MYGA 1XCCA 2NVLA 1N2AA 5DQYA 4ZB8A 3UMAA 4KCEA 4MH3A 4G0LA 5KN3A 3HA9A 3K8NA 4MP4A 3HHVA 1SKRB 3NZNA 4HZ4A 5IPHA 1X5DA 1O81A 2IFQB 4I6XA 4FIWA 3HVSA 2CV4A 5KOXA 2O8VB 3GSSA 4IP6A 1WRYA 2P0GA 3PPUA 1J08A 3UVHA 4K1FA 3ZYWA 4GCIA 1JZOA 4ZL8A 1FAAA 2CVKA 3EVIA 4JU5A 1TRWA 3VI7A 4I8BA 2YV9A 2O89A 3KTBA 3UVTA 2OKAA 4OO4A 2VCZA 4IVFA 1URMA 4BL7A 3UARA 3GNJA 4GSTA 2ZNMA 3WT2A 2GQLA 3F0IA 2DJKA 1ABAA 4DSSA 1AC1A 2H74A 2D2ZA 1U88A 2TIRA 2VCQA 4Q5NA 2H6XA 2FA8A 4JE1A 1U87A 3Q19A 2CVDA 5DQSA 1GTIA 4JR6A 1GNEA 5LCZA 2L4QA 4MK3A 6GSSA 4IP1A 3KH9A 5CREA 2L59A 2YZHA 3US3A 3D5JA 3S9FA 3C1SA 4EUYA 2YJHA 4AJ7A 3CSJA 2XHFA 2GSQA 1F9MA 3GRXA 3LW9A 2VCXA 2L6CA 4OFTA 1S3DA 4NPBA 2RUFA 4MNNA 2HYXA 4OCFA 1M2BA 1QMVA 1FOVA 3I6AA 4WEYA 2HE3A 1EGOA 4ZL7A 5AIXA 3VLNA 9GSSA 5ECOB 3H4KA 3BOAA 3APSA 3D6IA 2NBSA 3ED3A 3EMPA 3F9UA 2OBIA 2J23A 1C72A 1KBNA 3KJYA 5LNKe 4IJIA 3ZZXA 4MA9A 1M2DA 4V1Ag 3SBCA 4AF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TKS A;  3VFI A;  3RHB A;  5JWR B;  1OE7 A;  2HZE A;  4POM A;  5G31 A;  4RUV A;  4BVY A;  1VRS D;  4EXJ A;  2QC7 A;  4TR4 A;  5ECM B;  4ZL9 A;  4ISD A;  1U3A A;  1OVN A;  4D73 B;  1A8Y A;  2DJ2 A;  4PUF C;  2LS5 A;  1EV9 A;  2V41 A;  3GKN A;  1PKW A;  1RK4 A;  4K0N A;  2RII A;  2VAF A;  1GWC A;  2LEG A;  2F8F A;  2GVP A;  3I69 A;  2F51 A;  3IOS A;  1T8E B;  2G0F A;  1WJK A;  1OYJ A;  1YEP A;  4F9Z A;  1BG5 A;  2C3N A;  1YQ1 A;  3M9J A;  3ZL5 A;  2Z9S A;  13GS A;  3VI5 A;  2AAW A;  1O73 A;  1U3I A;  1OAZ A;  2B5E A;  5FWG A;  4FYB A;  5CRD A;  1SK2 A;  3TRQ A;  4MF6 A;  3E0U A;  3VPQ A;  4PUR A;  1J9B A;  2CVB A;  1M99 A;  4GWR A;  4TVE A;  3EWL A;  3D22 A;  4PUA A;  3M1G A;  4Q5Q A;  2EC4 A;  4I97 A;  1GSD A;  4OMV A;  2VCW A;  2C1Y A;  1SL2 B;  1K3O A;  4FYC A;  3VWU A;  2C0E A;  4O32 A;  1BQ7 A;  1LJR A;  2YNX A;  3IR4 A;  4K2D A;  4E8E A;  2WGR A;  3EMX A;  5HR1 A;  3GL3 A;  3D0Z A;  3RPN A;  3TOT A;  4MJB A;  3TCO A;  2FY6 A;  3P90 A;  3GX8 A;  1EP7 A;  2F8A A;  4G9H A;  5F0G A;  1G7O A;  5C00 A;  4NMU A;  2GZZ A;  3FHK A;  3DD3 A;  2OAD A;  5G1L A;  4HI7 A;  3WGX A;  5JCG A;  5DAL B;  2H76 A;  3BD2 A;  3EC3 A;  1FO5 A;  3GKK A;  6GST A;  5KN2 A;  1AW9 A;  5HFK A;  4OD7 A;  1EGR A;  2H66 A;  8GSS A;  4WXT A;  3BCI A;  3HYP A;  2EIR A;  4RI6 A;  2KHP A;  2R5G A;  1TI3 A;  4JED A;  3KZQ A;  3IK7 A;  5FT3 A;  4J2F A;  2HSY A;  1T3B A;  3LXT A;  1ON4 A;  2ON7 A;  3CRU A;  5FHI A;  1G0T A;  2I4A A;  1TU7 A;  4POK A;  3E9J B;  3RDW A;  1PSQ A;  1MD4 A;  2K8S A;  5IMZ A;  2CZ2 A;  1F6M C;  3CSH A;  2EIQ A;  3N9J A;  2B5Y A;  4OFN A;  3FZA A;  3H93 A;  2GT5 A;  4ZIJ A;  1GUM A;  1XVQ A;  2CX3 A;  5B7C A;  4DSS B;  2DC5 A;  2LNT A;  1W89 A;  4MZB A;  3F3Q A;  2BMX A;  4GLT A;  3EIN A;  3DXB A;  4N11 A;  4X43 A;  2OE1 A;  2VD0 A;  4KDY A;  1WIK A;  4K7O A;  2LQQ A;  3O76 A;  2J9H A;  3RPP A;  4DSQ A;  3DEX A;  1PN9 A;  1A2L A;  3DWV A;  3CRT A;  4ECC A;  3PH9 A;  1K0A A;  1ZGN A;  5CAX A;  4YQV A;  3IAS 2;  5B8A A;  4N0V A;  3KP9 A;  2GGT A;  1Z6M A;  2YWN A;  4NAX A;  3GH6 A;  1JFU A;  4ECB A;  1B48 A;  1TU8 A;  2F3M A;  1AAZ A;  5D9W A;  5ECR B;  1T7P B;  3QPM A;  5D9T A;  1R5P A;  1ACV A;  1RW1 A;  4Z7X A;  3HZ8 A;  3MDK A;  3TKP A;  3G7I A;  1YKA A;  2MMN A;  5B6N A;  3FY7 A;  3QFA C;  2WDU A;  4HOJ A;  4POB A;  3GHA A;  4AJ6 A;  3IK9 A;  3KXO A;  4GQF A;  4HJ2 A;  1Z3E A;  4J57 E;  1GH2 A;  4F0B A;  2VIM A;  1TOF A;  2KOK A;  2K8V A;  1SK1 A;  1J0F A;  5A5K A;  5D9V A;  5G5E A;  3TKS C;  4XRA A;  2AYT A;  1K0D A;  3GA4 A;  5IOW A;  2WFC A;  2KLX A;  2HNL A;  5JWQ B;  4HEA 2;  1NHY A;  3IE3 A;  5DCH A;  1ERV A;  2LTK A;  2N5F A;  2B6M A;  2F9S A;  2H19 A;  3C71 A;  3PGT A;  2E2M A;  5GST A;  1R5A A;  2H01 A;  1QQ2 A;  5C04 A;  5EPF A;  3ZFL A;  3HKR A;  5A4V A;  5KN0 A;  5LD0 A;  5IMF A;  1VGL A;  2H1B A;  2JZS A;  3FRC A;  3KMO A;  1AQX A;  1XW5 A;  5ABR A;  4KA0 A;  4GQC A;  4EE0 A;  2IMD A;  1A0F A;  5ID2 A;  3J7Y k;  3HJP A;  1PGT A;  3R2Q A;  5COH A;  2L57 A;  3LWA A;  6GSX A;  4IW9 A;  1K0M A;  2IMI A;  4PX1 A;  2HFD A;  1G7E A;  2O85 A;  3ZIT A;  4X1U A;  3Q6O A;  1GSS A;  4K9Z A;  4TKY A;  2CX4 A;  4MJA A;  3FZ9 A;  2AJQ B;  2PMT A;  2HSH A;  1A24 A;  5EL8 A;  3W8S A;  5ELA A;  2NPB A;  3FW2 A;  5DAL A;  3V1W A;  2VM2 A;  1E2Y A;  3H1N A;  3UEM A;  2A2R A;  4ECJ A;  1Z7P A;  3TKS E;  1YZX A;  2VO4 A;  1KTE A;  1AQW A;  2FUG 2;  3ZRD A;  4WF4 A;  4YQU A;  3QAV A;  1WOU A;  3FEU A;  4TR1 A;  3U6V A;  2ES7 A;  1SEN A;  2JAC A;  1F2E A;  3VWV A;  1XXU A;  19GS A;  1XVW A;  4PNF A;  1V2A A;  1GTU A;  5ELG A;  3Q18 A;  3DIE A;  4NHZ A;  3GFK A;  1QXH A;  4OCE A;  2FD3 A;  2LKU A;  1W4V A;  2V2G A;  2YWI A;  3U5R E;  5ENU A;  2PPT A;  1Q4J A;  4GTU A;  4ML6 A;  1GSY A;  6GSU A;  1XPV A;  3TJG A;  3CMI A;  1AXD A;  5INY A;  1M0U A;  1SK0 A;  18GS A;  2LRC A;  3JCM L;  2ON5 A;  3M9K A;  3FZ5 A;  4XIH A;  4XTS A;  1ST9 A;  1OC8 A;  1GLP A;  2LRT A;  1X0R A;  3FR9 A;  1DE1 A;  5DDL A;  1HNC A;  3DVX A;  2LST A;  4KW6 A;  3KP8 A;  3LYK A;  4YAV A;  3F63 A;  1JLV A;  3LXZ A;  5F07 A;  3UBL A;  2I3Y A;  2XBI A;  3RBT A;  2B1K A;  4BPY A;  1I5G A;  5ECI B;  2R4V A;  1SD8 A;  4KDX A;  4KAE A;  4IKH A;  2E0Q A;  2VCV A;  2H71 A;  1DSB A;  5CNW A;  3IAM 2;  1RQM A;  4OFM A;  3F3R A;  3GH9 A;  3L9U A;  1K3Y A;  1YEX A;  4POL A;  2FWH A;  1Q98 A;  2VM1 A;  3P8W A;  4L0U A;  4WKW A;  2JU5 A;  5IO2 A;  2R6K A;  5J9B A;  4KUN A;  2E2G A;  5F8B A;  3QR6 A;  2MBT A;  3MSZ A;  2GT6 A;  2HT9 A;  1GUL A;  3F4T A;  4XCS A;  3HVX A;  1B8X A;  2HXK A;  2JSZ A;  4TOP A;  3KTL A;  4ZB9 A;  1OKD A;  5AIV A;  2RM6 A;  3IA1 A;  3GMF A;  1Z6N A;  2C8U A;  4AGS A;  4EDY A;  3RHC A;  3TJB A;  3E3E A;  1YDK A;  3APO A;  3TRP A;  2AV4 A;  1PX6 A;  3M0F A;  3CBU A;  2M46 A;  2GZP A;  4PNG A;  5ECL B;  1GRX A;  4YAP A;  4MZC A;  5ECH B;  1GSF A;  5CP1 A;  3WGD A;  4MAB A;  5HR0 A;  5EY6 A;  3ZRE A;  1WPI A;  3EUR A;  2IMK A;  4FYU A;  3CXG A;  2JSY A;  3LGC A;  2IMF A;  3VWX A;  3L4N A;  1VF4 A;  2P5Q A;  1BJX A;  5GSS A;  4F0C A;  2YCD A;  4KDU A;  3ZLP A;  4KH7 A;  1QFN A;  2V1M A;  2VCT A;  1TDI A;  2HRN A;  5D9X A;  1JZW A;  5A4U A;  3F8U A;  5CRW A;  3TKQ A;  2K9F A;  1E6B A;  4HZ2 A;  4KGI A;  4V1A p;  2X8G A;  5J3R A;  1SYX A;  4MJC A;  3TRX A;  3C8E A;  4ZIL A;  3G9B A;  2GLR A;  5ID2 B;  4V2L A;  2B3S A;  3LSZ A;  2H6Z A;  1X9M B;  4JZQ A;  4HQS A;  1GSE A;  2PVO C;  2REM A;  2CZ3 A;  3TB2 A;  1A0R P;  4TXO B;  1ERT A;  4KCA A;  3J7Y b;  3GUS A;  3TGZ A;  5HR3 A;  1K0B A;  2A2S A;  2CQ9 A;  1TK0 B;  2VL2 A;  2DIY A;  3KM6 A;  4F2I A;  3RAZ A;  4FO5 A;  1EOG A;  3A2W A;  3H79 A;  3PIN A;  4ZB6 A;  2L5L A;  2L4C A;  3GTU A;  2C3Q A;  5KEJ A;  4FH8 A;  3NIV A;  1MDK A;  3L78 A;  4WBR D;  3LOR A;  6GSV A;  3ZIJ A;  1A23 A;  2XC2 A;  2DJJ A;  1XWC A;  4TR1 B;  3DGQ A;  4Q5R A;  2O7K A;  3TJJ A;  1HYU A;  5GAN D;  4BVX A;  3TUE A;  2FWE A;  1F3A A;  3DKS A;  3G7J A;  2IME A;  2B5X A;  1VF1 A;  2YWO A;  2XPE A;  2GST A;  4BWS A;  5JWO B;  1HQO A;  2K18 A;  5L71 A;  4HQZ A;  2B7J A;  4GXZ A;  1GSQ A;  4N0Z A;  2JZT A;  7GSS A;  2VUP A;  1M9A A;  2WB9 A;  3HVV A;  3QOU A;  2GQK A;  2I9H A;  2JZR A;  4CHS A;  1SKS B;  1B4P A;  4PQH A;  5AGY A;  2JAD A;  5G1K A;  1TK8 B;  2LJK A;  3IV4 A;  1R4W A;  2EIO A;  1ZL9 A;  4ML1 A;  1CQH A;  1F3B A;  4NXI A;  4LLR A;  2WS2 A;  3HD5 A;  5G5F A;  2PWJ A;  1V9W A;  2DSA A;  2M80 A;  4ECI A;  2P31 A;  2H0G A;  3BCK A;  1OKT A;  3UAP A;  3WD6 A;  1ERW A;  3IPZ A;  4YQM A;  1FB6 A;  3IHQ A;  1H75 A;  5IMC A;  1PL1 A;  2YOI A;  1XW9 A;  5CRG A;  3KD0 A;  4WF5 A;  3G7Y A;  1TKD B;  1FB0 A;  4EDZ A;  2IN3 A;  3UIW A;  4JR4 A;  1V57 A;  2YZU A;  3TOU A;  4E8H A;  1WP0 A;  5DJL A;  1FVK A;  1WE0 A;  4GRF A;  2BTO T;  2VL9 A;  2GZY A;  1M7T A;  5IQY A;  4ID0 A;  3LFL A;  1LU4 A;  3VWW A;  2DBC A;  1SKW B;  4G19 A;  1AIU A;  2H72 A;  1VF3 A;  1I9D A;  1X9W B;  4K7I A;  4NHW A;  3W8J A;  4YH2 A;  2YP6 A;  2H1D A;  1FHE A;  1GUH A;  4BWQ A;  3LYP A;  4IJ3 A;  2FNO A;  3HXS A;  4QL9 A;  4KSM A;  3FR6 A;  5E4W A;  1FW1 A;  4ACS A;  4JBB A;  4L5O A;  3QCP A;  2PN8 A;  3PR8 A;  4XS4 B;  4WR4 A;  1ZZY A;  3W6G A;  4PXO A;  3SWL A;  2YJ7 A;  4LA1 A;  1T1V A;  4TXV A;  3GUR A;  5H5S A;  1U6T A;  2DLX A;  2MMZ A;  2LV3 A;  4ZBB A;  2QKE A;  5H5Q A;  4TN8 A;  1B9X C;  2YV7 A;  4WR5 A;  5F05 A;  1HNB A;  1PA3 A;  1O6J A;  1YJ6 A;  2DJ0 A;  14GS A;  4MJE A;  4EKZ A;  1K3L A;  3P7X A;  3I43 A;  2VOC A;  1KEB A;  3GN3 A;  1DE2 A;  1XBS A;  1XWB A;  1QUW A;  4I2U A;  2FLS A;  4L0W A;  1Z9H A;  4V2M A;  3ME7 A;  5CO3 A;  2KUC A;  2RUE A;  1QK8 A;  2PGT A;  3IBH A;  4IBP A;  1ERU A;  4J56 E;  3GKM A;  3P2A A;  2C0D A;  3CYN A;  4HUA A;  1GP1 A;  1T00 A;  5H5R A;  3I9V 2;  3F6D A;  4TXO A;  4QQ7 A;  3A5W A;  2OE0 A;  1PQN A;  3ERF A;  4I2T A;  5DJM A;  3FK8 A;  3GKX A;  2ZCT A;  4WET A;  1XWA A;  3EE2 A;  4GSN A;  5B8B A;  1ML6 A;  2WUL A;  4LMV A;  2PVQ A;  5G2Z A;  5IMV A;  1TRS A;  4HU7 A;  5J4U A;  3L0H A;  1TXX A;  2KP1 A;  5D73 A;  1PKZ A;  4MH2 A;  4TR0 A;  4IGJ A;  5DAK B;  1WMJ A;  4XS1 A;  4K8M A;  1GNW A;  1MDI A;  4IS0 A;  3FZ4 A;  1PL2 A;  3QDN A;  4KX4 A;  4N10 A;  5ECP B;  2PU9 C;  2XPD A;  2OA7 A;  1TP9 A;  3Q74 A;  1TW9 A;  2XBQ A;  2CT6 A;  2V32 A;  4LL4 B;  2VL2 C;  1O8W A;  2MZC A;  4EF0 A;  4XRD A;  2H1A A;  3ME8 A;  2NTO A;  3M3M A;  1JHB A;  3ZVJ D;  5GAP D;  3C73 A;  2JL4 A;  2X8C A;  4DVC A;  3GTU B;  1R26 A;  1EZK A;  3D4M A;  1XWG A;  1TRU A;  1WWJ A;  5CRH A;  1BX9 A;  1TRV A;  1XZO A;  3O6T A;  1V58 A;  2PUK C;  4OWY A;  1HNA A;  1T4Y A;  4HJM A;  2ALB A;  3TDG A;  4CW9 A;  5HQP A;  5HR2 A;  3C7M A;  4ILF A;  3GST A;  2LQO A;  1A2J A;  1XOB A;  1XIY A;  2VD1 A;  5J9C A;  4MCU A;  3N5O A;  1H4O A;  3HJM A;  2LJA A;  1G6W A;  2H0H A;  2DMM A;  1HD2 A;  1AQV A;  4NWY A;  3EU3 A;  2RM5 A;  2AUV A;  1FVJ A;  2WCI A;  4RQR A;  3WGE A;  1Z5Y E;  3F4R A;  4O7H A;  1USB A;  1Y25 A;  4PQ1 A;  4HDE A;  4AJ8 A;  4XS6 A;  2B1L A;  1PX7 A;  2O87 A;  3FYG A;  3QFB C;  4RI7 A;  5AIS A;  3ZFB A;  3D4T A;  4ZBA A;  4BA7 A;  1JLW A;  1MD3 A;  1R7H A;  2L5O A;  3KH7 A;  4MZW A;  2H1G A;  1XWK A;  3KIJ A;  1BED A;  2H30 A;  1G6Y A;  1LBK A;  4KND A;  2H73 A;  2V6K A;  3HY2 A;  2ZUP A;  1GTA A;  2NDO A;  1YY7 A;  1SJZ A;  4GF0 A;  1MEK A;  1YF1 A;  2H6Y A;  3KCM A;  4IQ1 A;  3BJ5 A;  2GTU A;  1VF2 A;  2VL3 A;  1A2M A;  3F6F A;  4EC0 A;  1N8J A;  3M8N A;  1UC7 A;  2TRC P;  2GQM A;  2B7K A;  2HZF A;  2AHE A;  2RLI A;  3L9S A;  4P3Y B;  3KEB A;  4JRR A;  3HDC A;  2OAC A;  3TJK A;  1SL0 B;  1K0C A;  1KNG A;  2BJX A;  4KB3 A;  3CSI A;  4XS4 A;  3BBY A;  4KE3 A;  4TRX A;  4G10 A;  4MDC A;  1EOH A;  5IOX A;  5EVO A;  3GL5 A;  2FWF A;  3MWH A;  12GS A;  5IPG A;  2LNS A;  4V2N A;  4K6X A;  1DUG A;  1K0O A;  1ZYE A;  3EYT A;  5ECN B;  3ISO A;  2R2J A;  5D96 A;  5ECK B;  2HI7 A;  1DBY A;  2R3X A;  2R37 A;  2FA4 A;  4WBJ A;  2OE3 A;  1OE8 A;  1EWX A;  1SD9 A;  4O92 A;  2L6D A;  2CAI A;  2IWT A;  3DVW A;  3NOF A;  4EL1 A;  2H8L A;  2WJU A;  3IC4 A;  2LRN A;  4QL7 A;  1S3C A;  4H86 A;  3QAW A;  1K0N A;  4OO5 A;  4MPG A;  3OR5 A;  5J5N A;  3KMN A;  3IXR A;  4K7N A;  1X5E A;  2YN1 A;  5IIZ A;  4L5L A;  3GX0 A;  4RQX A;  1TTZ A;  2DIZ A;  2VLU A;  5HFI A;  1A8L A;  3DML A;  1THO A;  2I1U A;  4ULX A;  4L8E A;  1QGV A;  1ZOF A;  3CTF A;  2C4J A;  3GIX A;  5DAK A;  1AUC A;  1B9Y C;  1FG4 A;  1XW6 A;  1YKC A;  3LQ7 A;  1XFL A;  5JCW A;  3AY8 A;  2C80 A;  5GZZ B;  3TJF A;  10GS A;  5CYY A;  3QD9 A;  2LUS A;  1OC9 B;  1PD2 1;  1TI1 A;  2V6O A;  4LL1 B;  3ZML A;  5IO0 A;  2K6V A;  1SL1 B;  1B4Q A;  3DYR A;  1O7U A;  4NV2 A;  2IFQ A;  3ERW A;  17GS A;  3HJO A;  2QGV A;  1JZD A;  4GSS A;  1V98 A;  3LEF A;  1X9S B;  1F37 A;  4MMM A;  1M9B A;  2PER A;  2YAN A;  3ZIV A;  1YF0 A;  22GS A;  2MMA A;  3L9V A;  1Y6E A;  3UOM A;  4ZXG A;  1IYI A;  1JZR A;  5IM9 A;  2QSI A;  1X5C A;  5AN1 A;  3C1R A;  3QMX A;  3WT1 A;  2N5B A;  2GS3 A;  2FHE A;  4F82 A;  3D21 A;  4MPF A;  1O8X A;  2X99 A;  2YWM A;  2HLS A;  4I5Q A;  2C3T A;  2VLV A;  1OC3 A;  2VLT A;  3FKF A;  3LG6 A;  5HFG A;  5D93 A;  4EO3 A;  2IJY A;  1CQG A;  2MMO A;  3APQ A;  4HU9 A;  2CAQ A;  3UBK A;  1BAY A;  5ECS A;  6GSW A;  2TRX A;  4IN0 A;  3MNG A;  1ZMA A;  3UL3 A;  3TKR A;  5DVB A;  2A4V A;  1BYE A;  2IIY A;  4MF7 A;  3ZVJ A;  16GS A;  2N5A A;  1ZCP A;  1O85 A;  3ERG A;  1ZYQ B;  3EU4 A;  2C0G A;  4EVM A;  2H75 A;  3KGK A;  2IL3 A;  4LMW A;  2H0I A;  1SYR A;  20GS A;  4NV5 A;  1NHO A;  2E7P A;  1PMT A;  3MAK A;  1GSU A;  6GSY A;  3HZ4 A;  2OJL A;  2WRT A;  5KN1 A;  1GLQ A;  1GUK A;  1M2A A;  3GYK A;  2DJ3 A;  3VPT A;  4Q5F A;  2FGX A;  3H8Q A;  4KSO A;  1SJI A;  4N30 A;  1NW2 A;  1PRX A;  1IYH A;  3A3T A;  5F06 A;  2DJ1 A;  4PQI A;  5DBQ A;  1THX A;  1SJ6 A;  4ZBD A;  5JCU A;  2M72 A;  4CDO A;  2AB6 A;  2GSR A;  2WZ9 A;  4MF5 A;  4TW5 A;  1Z7R A;  5D8I A;  3GV1 A;  4IQA A;  4D73 A;  3A2V A;  3IRA A;  1NM3 A;  4K0G A;  5A4W A;  3ZTL A;  5IMA A;  2CA8 A;  4MLY A;  4DEJ A;  1NSW A;  3FR3 A;  2GDR A;  5DCG A;  3HCZ A;  2HZE B;  1TJD A;  4F03 A;  3UJ1 A;  5G30 A;  3DRN A;  2X64 A;  3CTG A;  3O3T A;  2OBK A;  1XOA A;  4IHU A;  2IPA A;  1EV4 A;  1MDJ A;  3A2X A;  1EEM A;  5E59 A;  4G2E A;  1EP8 A;  1MTC A;  1S3A A;  1GTB A;  3ZMK A;  3WYW A;  1SU9 A;  4DSR A;  11GS A;  2C0F A;  2H70 A;  2HRF A;  2I81 A;  2PBJ A;  1GL8 A;  1V40 A;  2FCH A;  2LJR A;  5B6M A;  2GSS A;  3F4S A;  4XHM A;  2G2Q A;  1UVZ A;  4TR3 A;  1TK5 B;  1UN2 A;  3QAG A;  4O5R A;  2X8H A;  1T4Z A;  5IMD A;  1OC9 A;  2FWG A;  3VUR A;  2YPM A;  3IDV A;  5ECQ B;  1EEJ A;  4PGT A;  4X0X A;  1ILO A;  2DML A;  3VK9 A;  5J41 A;  1UA5 A;  2KP2 A;  2MBS A;  4IEL A;  4HS1 A;  3LJR A;  2P5R A;  2MYG A;  1XCC A;  2NVL A;  1N2A A;  5DQY A;  4ZB8 A;  3UMA A;  4KCE A;  4MH3 A;  5KN3 A;  3HA9 A;  3K8N A;  4MP4 A;  3HHV A;  1SKR B;  3NZN A;  4HZ4 A;  5IPH A;  1X5D A;  1O81 A;  2IFQ B;  4I6X A;  4FIW A;  3HVS A;  2CV4 A;  2O8V B;  3GSS A;  4IP6 A;  1WRY A;  2P0G A;  1J08 A;  3UVH A;  4K1F A;  3ZYW A;  4GCI A;  1JZO A;  4ZL8 A;  1FAA A;  2CVK A;  3EVI A;  4JU5 A;  1TRW A;  3VI7 A;  4I8B A;  2YV9 A;  2O89 A;  3KTB A;  3UVT A;  2OKA A;  4OO4 A;  2VCZ A;  4IVF A;  1URM A;  4BL7 A;  3UAR A;  3GNJ A;  4GST A;  2ZNM A;  3WT2 A;  2GQL A;  3F0I A;  2DJK A;  1ABA A;  4DSS A;  1AC1 A;  2H74 A;  2D2Z A;  1U88 A;  2TIR A;  2VCQ A;  4Q5N A;  2H6X A;  2FA8 A;  4JE1 A;  1U87 A;  3Q19 A;  2CVD A;  5DQS A;  1GTI A;  4JR6 A;  1GNE A;  5LCZ A;  2L4Q A;  4MK3 A;  6GSS A;  4IP1 A;  3KH9 A;  5CRE A;  2L59 A;  2YZH A;  3US3 A;  3D5J A;  3S9F A;  3C1S A;  4EUY A;  2YJH A;  4AJ7 A;  3CSJ A;  2XHF A;  2GSQ A;  1F9M A;  3GRX A;  2VCX A;  2L6C A;  4OFT A;  1S3D A;  4NPB A;  2RUF A;  2HYX A;  4OCF A;  1M2B A;  1QMV A;  1FOV A;  3I6A A;  4WEY A;  2HE3 A;  1EGO A;  4ZL7 A;  5AIX A;  3VLN A;  9GSS A;  5ECO B;  3H4K A;  3BOA A;  3APS A;  3D6I A;  2NBS A;  3ED3 A;  3EMP A;  3F9U A;  2OBI A;  2J23 A;  1C72 A;  1KBN A;  3KJY A;  5LNK e;  4IJI A;  3ZZX A;  4MA9 A;  1M2D A;  4V1A g;  3SBC A;  4AF2 A; 
#chains in the Genus database with same CATH topology
 3TKS A;  3VFI A;  3RHB A;  5JWR B;  1OE7 A;  2HZE A;  4POM A;  5G31 A;  4RUV A;  4BVY A;  1VRS D;  4EXJ A;  2QC7 A;  4TR4 A;  5ECM B;  4ZL9 A;  4ISD A;  1U3A A;  1OVN A;  4D73 B;  1A8Y A;  2DJ2 A;  4PUF C;  2LS5 A;  1EV9 A;  2V41 A;  3GKN A;  1PKW A;  1RK4 A;  4K0N A;  2RII A;  2VAF A;  1GWC A;  2LEG A;  2F8F A;  2GVP A;  3I69 A;  2F51 A;  3IOS A;  1T8E B;  2G0F A;  1WJK A;  1OYJ A;  1YEP A;  4F9Z A;  1BG5 A;  2C3N A;  1YQ1 A;  3M9J A;  3ZL5 A;  2Z9S A;  13GS A;  3VI5 A;  2AAW A;  1O73 A;  1U3I A;  1OAZ A;  2B5E A;  5FWG A;  4FYB A;  5CRD A;  1SK2 A;  3TRQ A;  4MF6 A;  3E0U A;  3VPQ A;  4PUR A;  1J9B A;  2CVB A;  1M99 A;  4GWR A;  4TVE A;  3EWL A;  3D22 A;  4PUA A;  3M1G A;  4Q5Q A;  2EC4 A;  4I97 A;  1GSD A;  4OMV A;  2VCW A;  2C1Y A;  1SL2 B;  1K3O A;  4FYC A;  3VWU A;  2C0E A;  4O32 A;  1BQ7 A;  1LJR A;  2YNX A;  3IR4 A;  4K2D A;  4E8E A;  2WGR A;  3EMX A;  5HR1 A;  3GL3 A;  3D0Z A;  3RPN A;  3TOT A;  4MJB A;  3TCO A;  2FY6 A;  3P90 A;  3GX8 A;  1EP7 A;  4ICY A;  2F8A A;  4G9H A;  5F0G A;  1G7O A;  5C00 A;  4NMU A;  2GZZ A;  3FHK A;  3DD3 A;  2OAD A;  5G1L A;  4HI7 A;  3WGX A;  5JCG A;  5DAL B;  3A5I A;  2H76 A;  3BD2 A;  3EC3 A;  1FO5 A;  3GKK A;  6GST A;  5KN2 A;  1AW9 A;  5HFK A;  4OD7 A;  1EGR A;  2H66 A;  8GSS A;  4WXT A;  3BCI A;  3HYP A;  2EIR A;  4RI6 A;  2KHP A;  2R5G A;  1TI3 A;  4JED A;  3KZQ A;  3IK7 A;  5FT3 A;  4J2F A;  2HSY A;  1T3B A;  3LXT A;  1ON4 A;  4A5P A;  2ON7 A;  3CRU A;  5FHI A;  1G0T A;  2I4A A;  1TU7 A;  4POK A;  3E9J B;  3RDW A;  1PSQ A;  1MD4 A;  2K8S A;  5IMZ A;  2CZ2 A;  1F6M C;  3CSH A;  2EIQ A;  3N9J A;  2B5Y A;  4OFN A;  3FZA A;  3H93 A;  2GT5 A;  4ZIJ A;  1GUM A;  1XVQ A;  2CX3 A;  5B7C A;  4DSS B;  2DC5 A;  2LNT A;  1W89 A;  4MZB A;  3F3Q A;  2BMX A;  4GLT A;  3EIN A;  3DXB A;  4N11 A;  4X43 A;  2OE1 A;  2VD0 A;  4KDY A;  1WIK A;  4K7O A;  2LQQ A;  3O76 A;  2J9H A;  3RPP A;  4DSQ A;  3DEX A;  1PN9 A;  1A2L A;  3DWV A;  3CRT A;  4ECC A;  3PH9 A;  3MIX A;  1K0A A;  1ZGN A;  5CAX A;  4YQV A;  3IAS 2;  5B8A A;  4N0V A;  3KP9 A;  2GGT A;  1Z6M A;  2YWN A;  4NAX A;  3GH6 A;  1JFU A;  4FQU A;  4ECB A;  1B48 A;  1TU8 A;  2F3M A;  1AAZ A;  5D9W A;  5ECR B;  1T7P B;  3QPM A;  5D9T A;  1R5P A;  1ACV A;  1RW1 A;  4Z7X A;  3HZ8 A;  1M3J A;  3MDK A;  3TKP A;  3G7I A;  1YKA A;  2MMN A;  5B6N A;  3FY7 A;  3QFA C;  2WDU A;  4HOJ A;  4POB A;  3GHA A;  4AJ6 A;  3IK9 A;  3KXO A;  4GQF A;  4HJ2 A;  1Z3E A;  4J57 E;  1GH2 A;  4F0B A;  2VIM A;  1TOF A;  2KOK A;  2K8V A;  1SK1 A;  1S3R A;  1J0F A;  5A5K A;  3R3E A;  5D9V A;  5G5E A;  3TKS C;  4XRA A;  2AYT A;  1K0D A;  3GA4 A;  4BVY B;  4HSC X;  5IOW A;  2WFC A;  2KLX A;  2HNL A;  5JWQ B;  4HEA 2;  1NHY A;  3IE3 A;  5DCH A;  1ERV A;  2R0C A;  2LTK A;  2N5F A;  2B6M A;  2F9S A;  2H19 A;  3C71 A;  3PGT A;  2E2M A;  5GST A;  1R5A A;  2H01 A;  1QQ2 A;  5C04 A;  5EPF A;  3ZFL A;  1M3I A;  3HKR A;  5A4V A;  5KN0 A;  5LD0 A;  5IMF A;  1VGL A;  4O5Q A;  2H1B A;  2JZS A;  3FRC A;  3KMO A;  1AQX A;  1XW5 A;  5ABR A;  4KA0 A;  4GQC A;  1ZYP A;  2QA2 A;  4EE0 A;  2IMD A;  1A0F A;  5ID2 A;  3J7Y k;  3HJP A;  1PGT A;  3FMW A;  3R2Q A;  5COH A;  2L57 A;  3LWA A;  6GSX A;  4IW9 A;  1K0M A;  2IMI A;  4PX1 A;  2HFD A;  1G7E A;  2O85 A;  3ZIT A;  4X1U A;  3Q6O A;  1GSS A;  4K9Z A;  4TKY A;  2CX4 A;  4MJA A;  3FZ9 A;  2AJQ B;  2PMT A;  2HSH A;  1A24 A;  5EL8 A;  3W8S A;  5ELA A;  2NPB A;  3FW2 A;  5DAL A;  3V1W A;  2VM2 A;  1E2Y A;  3H1N A;  3UEM A;  2A2R A;  4ECJ A;  1Z7P A;  3TKS E;  1YZX A;  2VO4 A;  1KTE A;  1AQW A;  2FUG 2;  3ZRD A;  4WF4 A;  4YQU A;  3QAV A;  1WOU A;  3FEU A;  4TR1 A;  3U6V A;  2ES7 A;  1SEN A;  2JAC A;  2HSM A;  1F2E A;  3VWV A;  1XXU A;  19GS A;  1XVW A;  4PNF A;  1V2A A;  1GTU A;  5ELG A;  3Q18 A;  3DIE A;  4NHZ A;  3GFK A;  1QXH A;  4OCE A;  2FD3 A;  2LKU A;  1W4V A;  2V2G A;  2YWI A;  3U5R E;  5ENU A;  2PPT A;  1Q4J A;  4GTU A;  4ML6 A;  1GSY A;  6GSU A;  1XPV A;  3TJG A;  3CMI A;  4BVX B;  1AXD A;  5INY A;  1M0U A;  1SK0 A;  18GS A;  2LRC A;  3JCM L;  2ON5 A;  3M9K A;  3FZ5 A;  4XIH A;  4XTS A;  1ST9 A;  1OC8 A;  1GLP A;  2LRT A;  1X0R A;  3FR9 A;  1DE1 A;  5DDL A;  1HNC A;  3DVX A;  2LST A;  4KW6 A;  3KP8 A;  3LYK A;  4YAV A;  3F63 A;  1JLV A;  3LXZ A;  5F07 A;  3UBL A;  2I3Y A;  2XBI A;  3RBT A;  2B1K A;  4BPY A;  1I5G A;  5ECI B;  2R4V A;  1SD8 A;  4KDX A;  4KAE A;  4IKH A;  2E0Q A;  2VCV A;  2H71 A;  1DSB A;  5CNW A;  3IAM 2;  1RQM A;  4OFM A;  3F3R A;  3GH9 A;  3L9U A;  1K3Y A;  1YEX A;  4POL A;  2FWH A;  1Q98 A;  4EIQ A;  2VM1 A;  3P8W A;  4L0U A;  4WKW A;  2JU5 A;  5IO2 A;  2R6K A;  5J9B A;  4KUN A;  2E2G A;  5F8B A;  3QR6 A;  2MBT A;  3MSZ A;  2GT6 A;  2HT9 A;  1GUL A;  3F4T A;  4XCS A;  3HVX A;  1B8X A;  2HXK A;  2JSZ A;  4TOP A;  3KTL A;  4ZB9 A;  1OKD A;  5AIV A;  2RM6 A;  3IA1 A;  3GMF A;  1Z6N A;  2C8U A;  4AGS A;  4EDY A;  3RHC A;  3TJB A;  3E3E A;  1YDK A;  3APO A;  3TRP A;  2AV4 A;  1PX6 A;  3M0F A;  3CBU A;  2M46 A;  2GZP A;  4CY8 A;  4PNG A;  5ECL B;  4K5R A;  1GRX A;  4YAP A;  4MZC A;  5ECH B;  1GSF A;  5CP1 A;  3WGD A;  4MAB A;  5HR0 A;  2A4H A;  4O5U A;  4Z2T A;  5EY6 A;  3ZRE A;  1WPI A;  3EUR A;  2IMK A;  4FYU A;  3CXG A;  2JSY A;  3LGC A;  2IMF A;  3VWX A;  3L4N A;  1VF4 A;  2P5Q A;  1BJX A;  5GSS A;  4F0C A;  2YCD A;  4KDU A;  3ZLP A;  4KH7 A;  1QFN A;  2V1M A;  2VCT A;  1TDI A;  2HRN A;  5D9X A;  2DKH A;  1JZW A;  5A4U A;  3F8U A;  5CRW A;  3TKQ A;  2K9F A;  1E6B A;  4HZ2 A;  4KGI A;  4V1A p;  2X8G A;  5J3R A;  1SYX A;  4MJC A;  3TRX A;  3C8E A;  4ZIL A;  3G9B A;  2GLR A;  5ID2 B;  4V2L A;  2B3S A;  3LSZ A;  4X4J A;  2H6Z A;  1X9M B;  4JZQ A;  4HQS A;  1GSE A;  2PVO C;  2REM A;  2CZ3 A;  3HVN A;  3TB2 A;  5BRT A;  1A0R P;  4TXO B;  1ERT A;  4KCA A;  3J7Y b;  3GUS A;  3TGZ A;  5HR3 A;  1K0B A;  2A2S A;  2CQ9 A;  1TK0 B;  2VL2 A;  2A2P A;  2DIY A;  2QA1 A;  3KM6 A;  4F2I A;  3RAZ A;  4FO5 A;  1EOG A;  3A2W A;  3H79 A;  3PIN A;  4ZB6 A;  2L5L A;  2L4C A;  3GTU A;  2C3Q A;  5KEJ A;  4FH8 A;  3NIV A;  1MDK A;  3L78 A;  4WBR D;  3LOR A;  6GSV A;  3ZIJ A;  1A23 A;  2XC2 A;  2DJJ A;  1XWC A;  4TR1 B;  4G0I A;  3DGQ A;  4Q5R A;  2O7K A;  3TJJ A;  1HYU A;  5GAN D;  4BVX A;  3TUE A;  2FWE A;  1F3A A;  3DKS A;  3G7J A;  2IME A;  2B5X A;  1VF1 A;  2YWO A;  2XPE A;  2GST A;  4BWS A;  5JWO B;  1HQO A;  2K18 A;  5L71 A;  4HQZ A;  2B7J A;  4GXZ A;  4N0Z A;  1GSQ A;  2JZT A;  7GSS A;  2VUP A;  1M9A A;  2WB9 A;  3HVV A;  3QOU A;  2GQK A;  1PFO A;  2I9H A;  2JZR A;  4CHS A;  1SKS B;  1B4P A;  2DKI A;  4PQH A;  5AGY A;  2JAD A;  5G1K A;  1TK8 B;  2LJK A;  3IV4 A;  1R4W A;  2EIO A;  1ZL9 A;  4ML1 A;  1CQH A;  1F3B A;  4NXI A;  4LLR A;  2WS2 A;  3HD5 A;  5G5F A;  2PWJ A;  1V9W A;  2DSA A;  2M80 A;  4ECI A;  2P31 A;  2H0G A;  3BCK A;  1OKT A;  3UAP A;  3WD6 A;  1ERW A;  3IPZ A;  4YQM A;  1FB6 A;  3IHQ A;  1H75 A;  5IMC A;  1PL1 A;  2YOI A;  1XW9 A;  5CRG A;  4KF9 A;  3KD0 A;  4WF5 A;  3G7Y A;  1TKD B;  1FB0 A;  4EDZ A;  2IN3 A;  3UIW A;  4JR4 A;  1V57 A;  2YZU A;  3TOU A;  4E8H A;  2X49 A;  1WP0 A;  5DJL A;  1FVK A;  1WE0 A;  4GRF A;  2BTO T;  2VL9 A;  2GZY A;  1M7T A;  5IQY A;  4ID0 A;  3LFL A;  1LU4 A;  3VWW A;  2DBC A;  1SKW B;  4G19 A;  3IHG A;  1AIU A;  2H72 A;  1VF3 A;  1I9D A;  1X9W B;  4K7I A;  4Z2R A;  4NHW A;  3W8J A;  4YH2 A;  2YP6 A;  2H1D A;  1FHE A;  1GUH A;  4BWQ A;  3LYP A;  4IJ3 A;  2FNO A;  3HXS A;  4QL9 A;  4KSM A;  3FR6 A;  5E4W A;  1FW1 A;  4ACS A;  4JBB A;  4L5O A;  5KOW A;  3QCP A;  4CY6 A;  1FOH A;  2PN8 A;  3PR8 A;  4XS4 B;  4WR4 A;  1ZZY A;  4K5S A;  3W6G A;  4PXO A;  3SWL A;  2X4A A;  2YJ7 A;  4LA1 A;  1T1V A;  4TXV A;  3GUR A;  5H5S A;  1U6T A;  2DLX A;  2MMZ A;  2LV3 A;  4ZBB A;  2QKE A;  5H5Q A;  4TN8 A;  1B9X C;  2YV7 A;  4WR5 A;  5F05 A;  1HNB A;  1PA3 A;  1O6J A;  1YJ6 A;  2DJ0 A;  14GS A;  4MJE A;  4EKZ A;  1K3L A;  3P7X A;  3I43 A;  2VOC A;  1KEB A;  3GN3 A;  1DE2 A;  1XBS A;  1XWB A;  1QUW A;  4I2U A;  2FLS A;  4L0W A;  1Z9H A;  4V2M A;  3ME7 A;  5CO3 A;  2KUC A;  2RUE A;  1QK8 A;  2PGT A;  3IBH A;  4IBP A;  1ERU A;  4J56 E;  3GKM A;  3P2A A;  2C0D A;  3CYN A;  4HUA A;  1GP1 A;  1T00 A;  5H5R A;  3I9V 2;  3F6D A;  4TXO A;  4QQ7 A;  3A5W A;  4K2X A;  3CQF A;  2OE0 A;  1PQN A;  3ERF A;  4I2T A;  5DJM A;  3FK8 A;  3GKX A;  2ZCT A;  4WET A;  1XWA A;  3EE2 A;  4GSN A;  5B8B A;  1ML6 A;  2WUL A;  4LMV A;  2PVQ A;  5G2Z A;  5IMV A;  1TRS A;  4HU7 A;  5J4U A;  3L0H A;  1TXX A;  2KP1 A;  5D73 A;  1PKZ A;  4MH2 A;  4TR0 A;  4IGJ A;  5DAK B;  1WMJ A;  4XS1 A;  4K8M A;  1GNW A;  1MDI A;  4IS0 A;  3FZ4 A;  1PL2 A;  3QDN A;  4KX4 A;  4N10 A;  5ECP B;  2PU9 C;  2XPD A;  2OA7 A;  1TP9 A;  3Q74 A;  1TW9 A;  2XBQ A;  2CT6 A;  2V32 A;  4LL4 B;  2VL2 C;  1O8W A;  2MZC A;  4EF0 A;  4XRD A;  2H1A A;  3ME8 A;  2NTO A;  3M3M A;  1JHB A;  3ZVJ D;  5GAP D;  3C73 A;  2JL4 A;  2X8C A;  4DVC A;  3GTU B;  1R26 A;  1EZK A;  3D4M A;  1XWG A;  1TRU A;  2R0G A;  1WWJ A;  5CRH A;  1BX9 A;  1TRV A;  1XZO A;  3O6T A;  1V58 A;  2PUK C;  4OWY A;  1HNA A;  1T4Y A;  4HJM A;  2ALB A;  3TDG A;  4CW9 A;  5HQP A;  5HR2 A;  3C7M A;  2HRA A;  4ILF A;  3GST A;  2LQO A;  1A2J A;  1XOB A;  4G0K A;  4EIP A;  1XIY A;  2VD1 A;  5J9C A;  4MCU A;  3N5O A;  1H4O A;  3HJM A;  2LJA A;  1G6W A;  2H0H A;  2DMM A;  1HD2 A;  1AQV A;  4NWY A;  3EU3 A;  2RM5 A;  2AUV A;  1FVJ A;  2WCI A;  4RQR A;  3WGE A;  1Z5Y E;  3F4R A;  4O7H A;  1USB A;  1Y25 A;  4PQ1 A;  4HDE A;  4AJ8 A;  4XS6 A;  2B1L A;  1PX7 A;  2O87 A;  3FYG A;  3QFB C;  4RI7 A;  5AIS A;  3ZFB A;  3D4T A;  4ZBA A;  1PN0 A;  4BA7 A;  1JLW A;  1MD3 A;  1R7H A;  2L5O A;  3KH7 A;  4MZW A;  2H1G A;  1XWK A;  3KIJ A;  1BED A;  2H30 A;  1G6Y A;  1LBK A;  4KND A;  2H73 A;  2V6K A;  3HY2 A;  2ZUP A;  1GTA A;  2NDO A;  1YY7 A;  1SJZ A;  4GF0 A;  1MEK A;  1YF1 A;  2H6Y A;  3KCM A;  4IQ1 A;  3BJ5 A;  2GTU A;  1VF2 A;  2VL3 A;  1A2M A;  3F6F A;  4EC0 A;  1N8J A;  3M8N A;  1UC7 A;  2TRC P;  2GQM A;  2B7K A;  2HZF A;  2AHE A;  2RLI A;  3L9S A;  4P3Y B;  3KEB A;  3EPT A;  4JRR A;  3HDC A;  2OAC A;  3TJK A;  1SL0 B;  1K0C A;  1KNG A;  2BJX A;  4KB3 A;  3CSI A;  4XS4 A;  3BBY A;  4KE3 A;  4TRX A;  4G10 A;  4MDC A;  1EOH A;  5IOX A;  5EVO A;  3GL5 A;  2FWF A;  3MWH A;  12GS A;  5IPG A;  2LNS A;  4V2N A;  4K6X A;  1DUG A;  1K0O A;  1ZYE A;  3EYT A;  5ECN B;  3ISO A;  2R2J A;  5D96 A;  4YKF A;  5ECK B;  4USS A;  2HI7 A;  1DBY A;  2R3X A;  2R37 A;  2FA4 A;  4WBJ A;  2OE3 A;  1OE8 A;  1EWX A;  1SD9 A;  4O92 A;  2L6D A;  2CAI A;  2IWT A;  3DVW A;  3NOF A;  4EL1 A;  2H8L A;  2WJU A;  3IC4 A;  2LRN A;  4QL7 A;  1S3C A;  4H86 A;  3QAW A;  1K0N A;  4OO5 A;  4MPG A;  3OR5 A;  5J5N A;  3KMN A;  3IXR A;  2R0P A;  4Z2U A;  4K7N A;  1X5E A;  2YN1 A;  5IIZ A;  4L5L A;  3GX0 A;  4RQX A;  1TTZ A;  2DIZ A;  2VLU A;  5HFI A;  1A8L A;  3DML A;  1THO A;  2I1U A;  4ULX A;  4L8E A;  1QGV A;  3IC8 A;  1ZOF A;  3CTF A;  4PTS A;  2C4J A;  3GIX A;  5DAK A;  2HRK A;  1AUC A;  1B9Y C;  1FG4 A;  1XW6 A;  1YKC A;  3LQ7 A;  1XFL A;  5JCW A;  3AY8 A;  2C80 A;  5GZZ B;  3TJF A;  10GS A;  5CYY A;  3QD9 A;  2LUS A;  1OC9 B;  1ZYN A;  1PD2 1;  1TI1 A;  2V6O A;  4LL1 B;  3ZML A;  5IO0 A;  2K6V A;  1SL1 B;  1B4Q A;  3DYR A;  1O7U A;  4NV2 A;  2IFQ A;  3ERW A;  17GS A;  3HJO A;  2QGV A;  1JZD A;  4GSS A;  1V98 A;  3LEF A;  1X9S B;  1F37 A;  4MMM A;  1M9B A;  2PER A;  2YAN A;  3ZIV A;  1YF0 A;  22GS A;  2MMA A;  3L9V A;  1Y6E A;  3UOM A;  4ZXG A;  1IYI A;  1JZR A;  5IM9 A;  2QSI A;  1X5C A;  5AN1 A;  3C1R A;  3QMX A;  3WT1 A;  2N5B A;  2GS3 A;  2FHE A;  4F82 A;  3D21 A;  4MPF A;  1O8X A;  2X99 A;  2YWM A;  2HLS A;  4I5Q A;  2C3T A;  2VLV A;  1OC3 A;  2VLT A;  2UZ8 A;  3FKF A;  3LG6 A;  5HFG A;  5D93 A;  4EO3 A;  2IJY A;  1CQG A;  2MMO A;  3APQ A;  4HU9 A;  2CAQ A;  3UBK A;  1BAY A;  5ECS A;  6GSW A;  2TRX A;  4IN0 A;  3MNG A;  1ZMA A;  3UL3 A;  3TKR A;  4BL7 B;  5DVB A;  2A4V A;  3MYD A;  1BYE A;  2IIY A;  4MF7 A;  3ZVJ A;  16GS A;  2N5A A;  1ZCP A;  1O85 A;  3ERG A;  1ZYQ B;  3EU4 A;  2C0G A;  4EVM A;  2H75 A;  3KGK A;  2IL3 A;  4LMW A;  2H0I A;  1SYR A;  20GS A;  4NV5 A;  1NHO A;  2E7P A;  1PMT A;  3MAK A;  1GSU A;  6GSY A;  3HZ4 A;  2OJL A;  2WRT A;  5KN1 A;  1GLQ A;  1GUK A;  1M2A A;  3GYK A;  2DJ3 A;  3VPT A;  4Q5F A;  2FGX A;  3H8Q A;  4KSO A;  1SJI A;  4N30 A;  1NW2 A;  1PRX A;  1IYH A;  3A3T A;  5F06 A;  2DJ1 A;  4PQI A;  5DBQ A;  1THX A;  1SJ6 A;  4ZBD A;  5JCU A;  2M72 A;  4CDO A;  2AB6 A;  2GSR A;  2WZ9 A;  4MF5 A;  4TW5 A;  1Z7R A;  5D8I A;  3GV1 A;  4IQA A;  4D73 A;  3A2V A;  3IRA A;  1NM3 A;  4K0G A;  5A4W A;  3ZTL A;  5IMA A;  5BMU A;  2CA8 A;  4MLY A;  4DEJ A;  1NSW A;  3FR3 A;  2GDR A;  5DCG A;  3HCZ A;  2HZE B;  1TJD A;  4F03 A;  3UJ1 A;  5G30 A;  3DRN A;  2X64 A;  3CTG A;  3O3T A;  2OBK A;  1XOA A;  4IHU A;  2IPA A;  1EV4 A;  1MDJ A;  3A2X A;  1EEM A;  5E59 A;  4G2E A;  1EP8 A;  1MTC A;  1S3A A;  1GTB A;  3ZMK A;  3WYW A;  1SU9 A;  4DSR A;  11GS A;  2C0F A;  2H70 A;  2HRF A;  2I81 A;  2PBJ A;  1GL8 A;  1V40 A;  2FCH A;  2LJR A;  5B6M A;  2GSS A;  3F4S A;  4XHM A;  2G2Q A;  1UVZ A;  4TR3 A;  1TK5 B;  1UN2 A;  3QAG A;  4O5R A;  2X8H A;  1T4Z A;  5IMD A;  1OC9 A;  2FWG A;  3VUR A;  2YPM A;  3IDV A;  5ECQ B;  1EEJ A;  4PGT A;  4X0X A;  1ILO A;  2DML A;  3VK9 A;  4YKG A;  5J41 A;  1UA5 A;  2KP2 A;  2MBS A;  4IEL A;  4HS1 A;  3LJR A;  2P5R A;  2MYG A;  1XCC A;  2NVL A;  1N2A A;  5DQY A;  4ZB8 A;  3UMA A;  4KCE A;  4MH3 A;  4G0L A;  5KN3 A;  3HA9 A;  3K8N A;  4MP4 A;  3HHV A;  1SKR B;  3NZN A;  4HZ4 A;  4BIK A;  5IPH A;  1X5D A;  1O81 A;  2IFQ B;  4I6X A;  4FIW A;  3HVS A;  2CV4 A;  5KOX A;  2O8V B;  3GSS A;  4IP6 A;  1WRY A;  2P0G A;  3PPU A;  1J08 A;  3UVH A;  4K1F A;  3ZYW A;  4GCI A;  1JZO A;  4ZL8 A;  1FAA A;  2CVK A;  3EVI A;  4JU5 A;  1TRW A;  3VI7 A;  4I8B A;  2YV9 A;  2O89 A;  3KTB A;  3UVT A;  2OKA A;  4OO4 A;  2VCZ A;  4IVF A;  1URM A;  4BL7 A;  3UAR A;  3GNJ A;  4GST A;  2ZNM A;  3WT2 A;  2GQL A;  3F0I A;  2DJK A;  1ABA A;  4DSS A;  1AC1 A;  2H74 A;  2D2Z A;  1U88 A;  2TIR A;  2VCQ A;  4Q5N A;  2H6X A;  2FA8 A;  4JE1 A;  1U87 A;  3Q19 A;  2CVD A;  5DQS A;  1GTI A;  4JR6 A;  1GNE A;  5LCZ A;  2L4Q A;  4MK3 A;  6GSS A;  4IP1 A;  3KH9 A;  5CRE A;  2L59 A;  1XG8 A;  2YZH A;  3US3 A;  3D5J A;  3S9F A;  3C1S A;  4EUY A;  2YJH A;  4AJ7 A;  3CSJ A;  2XHF A;  2GSQ A;  1F9M A;  3GRX A;  3LW9 A;  2VCX A;  2L6C A;  4OFT A;  1S3D A;  4NPB A;  2RUF A;  4MNN A;  2HYX A;  4OCF A;  1M2B A;  1QMV A;  1FOV A;  3I6A A;  4WEY A;  2HE3 A;  1EGO A;  4ZL7 A;  5AIX A;  3VLN A;  9GSS A;  5ECO B;  3H4K A;  3BOA A;  3APS A;  3D6I A;  2NBS A;  3ED3 A;  3EMP A;  3F9U A;  2OBI A;  2J23 A;  1C72 A;  1KBN A;  3KJY A;  5LNK e;  4IJI A;  3ZZX A;  4MA9 A;  1M2D A;  4V1A g;  3SBC A;  4AF2 A; 
#chains in the Genus database with same CATH homology
 3TKS A;  3VFI A;  3RHB A;  5JWR B;  1OE7 A;  2HZE A;  4POM A;  5G31 A;  4RUV A;  4BVY A;  1VRS D;  4EXJ A;  2QC7 A;  4TR4 A;  5ECM B;  4ZL9 A;  4ISD A;  1U3A A;  1OVN A;  4D73 B;  1A8Y A;  2DJ2 A;  4PUF C;  2LS5 A;  1EV9 A;  2V41 A;  3GKN A;  1PKW A;  1RK4 A;  4K0N A;  2RII A;  2VAF A;  1GWC A;  2LEG A;  2F8F A;  2GVP A;  3I69 A;  2F51 A;  3IOS A;  1T8E B;  2G0F A;  1WJK A;  1OYJ A;  1YEP A;  4F9Z A;  1BG5 A;  2C3N A;  1YQ1 A;  3M9J A;  3ZL5 A;  2Z9S A;  13GS A;  3VI5 A;  2AAW A;  1O73 A;  1U3I A;  1OAZ A;  2B5E A;  5FWG A;  4FYB A;  5CRD A;  1SK2 A;  3TRQ A;  4MF6 A;  3E0U A;  3VPQ A;  4PUR A;  1J9B A;  2CVB A;  1M99 A;  4GWR A;  4TVE A;  3EWL A;  3D22 A;  4PUA A;  3M1G A;  4Q5Q A;  2EC4 A;  4I97 A;  1GSD A;  4OMV A;  2VCW A;  2C1Y A;  1SL2 B;  1K3O A;  4FYC A;  3VWU A;  2C0E A;  4O32 A;  1BQ7 A;  1LJR A;  2YNX A;  3IR4 A;  4K2D A;  4E8E A;  2WGR A;  3EMX A;  5HR1 A;  3GL3 A;  3D0Z A;  3RPN A;  3TOT A;  4MJB A;  3TCO A;  2FY6 A;  3P90 A;  3GX8 A;  1EP7 A;  4ICY A;  2F8A A;  4G9H A;  5F0G A;  1G7O A;  5C00 A;  4NMU A;  2GZZ A;  3FHK A;  3DD3 A;  2OAD A;  5G1L A;  4HI7 A;  3WGX A;  5JCG A;  5DAL B;  3A5I A;  2H76 A;  3BD2 A;  3EC3 A;  1FO5 A;  3GKK A;  6GST A;  5KN2 A;  1AW9 A;  5HFK A;  4OD7 A;  1EGR A;  2H66 A;  8GSS A;  4WXT A;  3BCI A;  3HYP A;  2EIR A;  4RI6 A;  2KHP A;  2R5G A;  1TI3 A;  4JED A;  3KZQ A;  3IK7 A;  5FT3 A;  4J2F A;  2HSY A;  1T3B A;  3LXT A;  1ON4 A;  4A5P A;  2ON7 A;  3CRU A;  5FHI A;  1G0T A;  2I4A A;  1TU7 A;  4POK A;  3E9J B;  3RDW A;  1PSQ A;  1MD4 A;  2K8S A;  5IMZ A;  2CZ2 A;  1F6M C;  3CSH A;  2EIQ A;  3N9J A;  2B5Y A;  4OFN A;  3FZA A;  3H93 A;  2GT5 A;  4ZIJ A;  1GUM A;  1XVQ A;  2CX3 A;  5B7C A;  4DSS B;  2DC5 A;  2LNT A;  1W89 A;  4MZB A;  3F3Q A;  2BMX A;  4GLT A;  3EIN A;  3DXB A;  4N11 A;  4X43 A;  2OE1 A;  2VD0 A;  4KDY A;  1WIK A;  4K7O A;  2LQQ A;  3O76 A;  2J9H A;  3RPP A;  4DSQ A;  3DEX A;  1PN9 A;  1A2L A;  3DWV A;  3CRT A;  4ECC A;  3PH9 A;  3MIX A;  1K0A A;  1ZGN A;  5CAX A;  4YQV A;  3IAS 2;  5B8A A;  4N0V A;  3KP9 A;  2GGT A;  1Z6M A;  2YWN A;  4NAX A;  3GH6 A;  1JFU A;  4FQU A;  4ECB A;  1B48 A;  1TU8 A;  2F3M A;  1AAZ A;  5D9W A;  5ECR B;  1T7P B;  3QPM A;  5D9T A;  1R5P A;  1ACV A;  1RW1 A;  4Z7X A;  3HZ8 A;  3MDK A;  3TKP A;  3G7I A;  1YKA A;  2MMN A;  5B6N A;  3FY7 A;  3QFA C;  2WDU A;  4HOJ A;  4POB A;  3GHA A;  4AJ6 A;  3IK9 A;  3KXO A;  4GQF A;  4HJ2 A;  1Z3E A;  4J57 E;  1GH2 A;  4F0B A;  2VIM A;  1TOF A;  2KOK A;  2K8V A;  1SK1 A;  1J0F A;  5A5K A;  3R3E A;  5D9V A;  5G5E A;  3TKS C;  4XRA A;  2AYT A;  1K0D A;  3GA4 A;  4BVY B;  5IOW A;  2WFC A;  2KLX A;  2HNL A;  5JWQ B;  4HEA 2;  1NHY A;  3IE3 A;  5DCH A;  1ERV A;  2R0C A;  2LTK A;  2N5F A;  2B6M A;  2F9S A;  2H19 A;  3C71 A;  3PGT A;  2E2M A;  5GST A;  1R5A A;  2H01 A;  1QQ2 A;  5C04 A;  5EPF A;  3ZFL A;  3HKR A;  5A4V A;  5KN0 A;  5LD0 A;  5IMF A;  1VGL A;  4O5Q A;  2H1B A;  2JZS A;  3FRC A;  3KMO A;  1AQX A;  1XW5 A;  5ABR A;  4KA0 A;  4GQC A;  1ZYP A;  2QA2 A;  4EE0 A;  2IMD A;  1A0F A;  5ID2 A;  3J7Y k;  3HJP A;  1PGT A;  3FMW A;  3R2Q A;  5COH A;  2L57 A;  3LWA A;  6GSX A;  4IW9 A;  1K0M A;  2IMI A;  4PX1 A;  2HFD A;  1G7E A;  2O85 A;  3ZIT A;  4X1U A;  3Q6O A;  1GSS A;  4K9Z A;  4TKY A;  2CX4 A;  4MJA A;  3FZ9 A;  2AJQ B;  2PMT A;  2HSH A;  1A24 A;  5EL8 A;  3W8S A;  5ELA A;  2NPB A;  3FW2 A;  5DAL A;  3V1W A;  2VM2 A;  1E2Y A;  3H1N A;  3UEM A;  2A2R A;  4ECJ A;  1Z7P A;  3TKS E;  1YZX A;  2VO4 A;  1KTE A;  1AQW A;  2FUG 2;  3ZRD A;  4WF4 A;  4YQU A;  3QAV A;  1WOU A;  3FEU A;  4TR1 A;  3U6V A;  2ES7 A;  1SEN A;  2JAC A;  2HSM A;  1F2E A;  3VWV A;  1XXU A;  19GS A;  1XVW A;  4PNF A;  1V2A A;  1GTU A;  5ELG A;  3Q18 A;  3DIE A;  4NHZ A;  3GFK A;  1QXH A;  4OCE A;  2FD3 A;  2LKU A;  1W4V A;  2V2G A;  2YWI A;  3U5R E;  5ENU A;  2PPT A;  1Q4J A;  4GTU A;  4ML6 A;  1GSY A;  6GSU A;  1XPV A;  3TJG A;  3CMI A;  4BVX B;  1AXD A;  5INY A;  1M0U A;  1SK0 A;  18GS A;  2LRC A;  3JCM L;  2ON5 A;  3M9K A;  3FZ5 A;  4XIH A;  4XTS A;  1ST9 A;  1OC8 A;  1GLP A;  2LRT A;  1X0R A;  3FR9 A;  1DE1 A;  5DDL A;  1HNC A;  3DVX A;  2LST A;  4KW6 A;  3KP8 A;  3LYK A;  4YAV A;  3F63 A;  1JLV A;  3LXZ A;  5F07 A;  3UBL A;  2I3Y A;  2XBI A;  3RBT A;  2B1K A;  4BPY A;  1I5G A;  5ECI B;  2R4V A;  1SD8 A;  4KDX A;  4KAE A;  4IKH A;  2E0Q A;  2VCV A;  2H71 A;  1DSB A;  5CNW A;  3IAM 2;  1RQM A;  4OFM A;  3F3R A;  3GH9 A;  3L9U A;  1K3Y A;  1YEX A;  4POL A;  2FWH A;  1Q98 A;  4EIQ A;  2VM1 A;  3P8W A;  4L0U A;  4WKW A;  2JU5 A;  5IO2 A;  2R6K A;  5J9B A;  4KUN A;  2E2G A;  5F8B A;  3QR6 A;  2MBT A;  3MSZ A;  2GT6 A;  2HT9 A;  1GUL A;  3F4T A;  4XCS A;  3HVX A;  1B8X A;  2HXK A;  2JSZ A;  4TOP A;  3KTL A;  4ZB9 A;  1OKD A;  5AIV A;  2RM6 A;  3IA1 A;  3GMF A;  1Z6N A;  2C8U A;  4AGS A;  4EDY A;  3RHC A;  3TJB A;  3E3E A;  1YDK A;  3APO A;  3TRP A;  2AV4 A;  1PX6 A;  3M0F A;  3CBU A;  2M46 A;  2GZP A;  4CY8 A;  4PNG A;  5ECL B;  4K5R A;  1GRX A;  4YAP A;  4MZC A;  5ECH B;  1GSF A;  5CP1 A;  3WGD A;  4MAB A;  5HR0 A;  2A4H A;  4O5U A;  4Z2T A;  5EY6 A;  3ZRE A;  1WPI A;  3EUR A;  2IMK A;  4FYU A;  3CXG A;  2JSY A;  3LGC A;  2IMF A;  3VWX A;  3L4N A;  1VF4 A;  2P5Q A;  1BJX A;  5GSS A;  4F0C A;  2YCD A;  4KDU A;  3ZLP A;  4KH7 A;  1QFN A;  2V1M A;  2VCT A;  1TDI A;  2HRN A;  5D9X A;  2DKH A;  1JZW A;  5A4U A;  3F8U A;  5CRW A;  3TKQ A;  2K9F A;  1E6B A;  4HZ2 A;  4KGI A;  4V1A p;  2X8G A;  5J3R A;  1SYX A;  4MJC A;  3TRX A;  3C8E A;  4ZIL A;  3G9B A;  2GLR A;  5ID2 B;  4V2L A;  2B3S A;  3LSZ A;  4X4J A;  2H6Z A;  1X9M B;  4JZQ A;  4HQS A;  1GSE A;  2PVO C;  2REM A;  2CZ3 A;  3TB2 A;  5BRT A;  1A0R P;  4TXO B;  1ERT A;  4KCA A;  3J7Y b;  3GUS A;  3TGZ A;  5HR3 A;  1K0B A;  2A2S A;  2CQ9 A;  1TK0 B;  2VL2 A;  2A2P A;  2DIY A;  2QA1 A;  3KM6 A;  4F2I A;  3RAZ A;  4FO5 A;  1EOG A;  3A2W A;  3H79 A;  3PIN A;  4ZB6 A;  2L5L A;  2L4C A;  3GTU A;  2C3Q A;  5KEJ A;  4FH8 A;  3NIV A;  1MDK A;  3L78 A;  4WBR D;  3LOR A;  6GSV A;  3ZIJ A;  1A23 A;  2XC2 A;  2DJJ A;  1XWC A;  4TR1 B;  4G0I A;  3DGQ A;  4Q5R A;  2O7K A;  3TJJ A;  1HYU A;  5GAN D;  4BVX A;  3TUE A;  2FWE A;  1F3A A;  3DKS A;  3G7J A;  2IME A;  2B5X A;  1VF1 A;  2YWO A;  2XPE A;  2GST A;  4BWS A;  5JWO B;  1HQO A;  2K18 A;  5L71 A;  4HQZ A;  2B7J A;  4GXZ A;  4N0Z A;  1GSQ A;  2JZT A;  7GSS A;  2VUP A;  1M9A A;  2WB9 A;  3HVV A;  3QOU A;  2GQK A;  2I9H A;  2JZR A;  4CHS A;  1SKS B;  1B4P A;  2DKI A;  4PQH A;  5AGY A;  2JAD A;  5G1K A;  1TK8 B;  2LJK A;  3IV4 A;  1R4W A;  2EIO A;  1ZL9 A;  4ML1 A;  1CQH A;  1F3B A;  4NXI A;  4LLR A;  2WS2 A;  3HD5 A;  5G5F A;  2PWJ A;  1V9W A;  2DSA A;  2M80 A;  4ECI A;  2P31 A;  2H0G A;  3BCK A;  1OKT A;  3UAP A;  3WD6 A;  1ERW A;  3IPZ A;  4YQM A;  1FB6 A;  3IHQ A;  1H75 A;  5IMC A;  1PL1 A;  2YOI A;  1XW9 A;  5CRG A;  4KF9 A;  3KD0 A;  4WF5 A;  3G7Y A;  1TKD B;  1FB0 A;  4EDZ A;  2IN3 A;  3UIW A;  4JR4 A;  1V57 A;  2YZU A;  3TOU A;  4E8H A;  2X49 A;  1WP0 A;  5DJL A;  1FVK A;  1WE0 A;  4GRF A;  2BTO T;  2VL9 A;  2GZY A;  1M7T A;  5IQY A;  4ID0 A;  3LFL A;  1LU4 A;  3VWW A;  2DBC A;  1SKW B;  4G19 A;  3IHG A;  1AIU A;  2H72 A;  1VF3 A;  1I9D A;  1X9W B;  4K7I A;  4Z2R A;  4NHW A;  3W8J A;  4YH2 A;  2YP6 A;  2H1D A;  1FHE A;  1GUH A;  4BWQ A;  3LYP A;  4IJ3 A;  2FNO A;  3HXS A;  4QL9 A;  4KSM A;  3FR6 A;  5E4W A;  1FW1 A;  4ACS A;  4JBB A;  4L5O A;  5KOW A;  3QCP A;  4CY6 A;  1FOH A;  2PN8 A;  3PR8 A;  4XS4 B;  4WR4 A;  1ZZY A;  4K5S A;  3W6G A;  4PXO A;  3SWL A;  2X4A A;  2YJ7 A;  4LA1 A;  1T1V A;  4TXV A;  3GUR A;  5H5S A;  1U6T A;  2DLX A;  2MMZ A;  2LV3 A;  4ZBB A;  2QKE A;  5H5Q A;  4TN8 A;  1B9X C;  2YV7 A;  4WR5 A;  5F05 A;  1HNB A;  1PA3 A;  1O6J A;  1YJ6 A;  2DJ0 A;  14GS A;  4MJE A;  4EKZ A;  1K3L A;  3P7X A;  3I43 A;  2VOC A;  1KEB A;  3GN3 A;  1DE2 A;  1XBS A;  1XWB A;  1QUW A;  4I2U A;  2FLS A;  4L0W A;  1Z9H A;  4V2M A;  3ME7 A;  5CO3 A;  2KUC A;  2RUE A;  1QK8 A;  2PGT A;  3IBH A;  4IBP A;  1ERU A;  4J56 E;  3GKM A;  3P2A A;  2C0D A;  3CYN A;  4HUA A;  1GP1 A;  1T00 A;  5H5R A;  3I9V 2;  3F6D A;  4TXO A;  4QQ7 A;  3A5W A;  4K2X A;  2OE0 A;  1PQN A;  3ERF A;  4I2T A;  5DJM A;  3FK8 A;  3GKX A;  2ZCT A;  4WET A;  1XWA A;  3EE2 A;  4GSN A;  5B8B A;  1ML6 A;  2WUL A;  4LMV A;  2PVQ A;  5G2Z A;  5IMV A;  1TRS A;  4HU7 A;  5J4U A;  3L0H A;  1TXX A;  2KP1 A;  5D73 A;  1PKZ A;  4MH2 A;  4TR0 A;  4IGJ A;  5DAK B;  1WMJ A;  4XS1 A;  4K8M A;  1GNW A;  1MDI A;  4IS0 A;  3FZ4 A;  1PL2 A;  3QDN A;  4KX4 A;  4N10 A;  5ECP B;  2PU9 C;  2XPD A;  2OA7 A;  1TP9 A;  3Q74 A;  1TW9 A;  2XBQ A;  2CT6 A;  2V32 A;  4LL4 B;  2VL2 C;  1O8W A;  2MZC A;  4EF0 A;  4XRD A;  2H1A A;  3ME8 A;  2NTO A;  3M3M A;  1JHB A;  3ZVJ D;  5GAP D;  3C73 A;  2JL4 A;  2X8C A;  4DVC A;  3GTU B;  1R26 A;  1EZK A;  3D4M A;  1XWG A;  1TRU A;  2R0G A;  1WWJ A;  5CRH A;  1BX9 A;  1TRV A;  1XZO A;  3O6T A;  1V58 A;  2PUK C;  4OWY A;  1HNA A;  1T4Y A;  4HJM A;  2ALB A;  3TDG A;  4CW9 A;  5HQP A;  5HR2 A;  3C7M A;  2HRA A;  4ILF A;  3GST A;  2LQO A;  1A2J A;  1XOB A;  4G0K A;  4EIP A;  1XIY A;  2VD1 A;  5J9C A;  4MCU A;  3N5O A;  1H4O A;  3HJM A;  2LJA A;  1G6W A;  2H0H A;  2DMM A;  1HD2 A;  1AQV A;  4NWY A;  3EU3 A;  2RM5 A;  2AUV A;  1FVJ A;  2WCI A;  4RQR A;  3WGE A;  1Z5Y E;  3F4R A;  4O7H A;  1USB A;  1Y25 A;  4PQ1 A;  4HDE A;  4AJ8 A;  4XS6 A;  2B1L A;  1PX7 A;  2O87 A;  3FYG A;  3QFB C;  4RI7 A;  5AIS A;  3ZFB A;  3D4T A;  4ZBA A;  1PN0 A;  4BA7 A;  1JLW A;  1MD3 A;  1R7H A;  2L5O A;  3KH7 A;  4MZW A;  2H1G A;  1XWK A;  3KIJ A;  1BED A;  2H30 A;  1G6Y A;  1LBK A;  4KND A;  2H73 A;  2V6K A;  3HY2 A;  2ZUP A;  1GTA A;  2NDO A;  1YY7 A;  1SJZ A;  4GF0 A;  1MEK A;  1YF1 A;  2H6Y A;  3KCM A;  4IQ1 A;  3BJ5 A;  2GTU A;  1VF2 A;  2VL3 A;  1A2M A;  3F6F A;  4EC0 A;  1N8J A;  3M8N A;  1UC7 A;  2TRC P;  2GQM A;  2B7K A;  2HZF A;  2AHE A;  2RLI A;  3L9S A;  4P3Y B;  3KEB A;  3EPT A;  4JRR A;  3HDC A;  2OAC A;  3TJK A;  1SL0 B;  1K0C A;  1KNG A;  2BJX A;  4KB3 A;  3CSI A;  4XS4 A;  3BBY A;  4KE3 A;  4TRX A;  4G10 A;  4MDC A;  1EOH A;  5IOX A;  5EVO A;  3GL5 A;  2FWF A;  3MWH A;  12GS A;  5IPG A;  2LNS A;  4V2N A;  4K6X A;  1DUG A;  1K0O A;  1ZYE A;  3EYT A;  5ECN B;  3ISO A;  2R2J A;  5D96 A;  4YKF A;  5ECK B;  4USS A;  2HI7 A;  1DBY A;  2R3X A;  2R37 A;  2FA4 A;  4WBJ A;  2OE3 A;  1OE8 A;  1EWX A;  1SD9 A;  4O92 A;  2L6D A;  2CAI A;  2IWT A;  3DVW A;  3NOF A;  4EL1 A;  2H8L A;  2WJU A;  3IC4 A;  2LRN A;  4QL7 A;  1S3C A;  4H86 A;  3QAW A;  1K0N A;  4OO5 A;  4MPG A;  3OR5 A;  5J5N A;  3KMN A;  3IXR A;  2R0P A;  4Z2U A;  4K7N A;  1X5E A;  2YN1 A;  5IIZ A;  4L5L A;  3GX0 A;  4RQX A;  1TTZ A;  2DIZ A;  2VLU A;  5HFI A;  1A8L A;  3DML A;  1THO A;  2I1U A;  4ULX A;  4L8E A;  1QGV A;  3IC8 A;  1ZOF A;  3CTF A;  4PTS A;  2C4J A;  3GIX A;  5DAK A;  2HRK A;  1AUC A;  1B9Y C;  1FG4 A;  1XW6 A;  1YKC A;  3LQ7 A;  1XFL A;  5JCW A;  3AY8 A;  2C80 A;  5GZZ B;  3TJF A;  10GS A;  5CYY A;  3QD9 A;  2LUS A;  1OC9 B;  1ZYN A;  1PD2 1;  1TI1 A;  2V6O A;  4LL1 B;  3ZML A;  5IO0 A;  2K6V A;  1SL1 B;  1B4Q A;  3DYR A;  1O7U A;  4NV2 A;  2IFQ A;  3ERW A;  17GS A;  3HJO A;  2QGV A;  1JZD A;  4GSS A;  1V98 A;  3LEF A;  1X9S B;  1F37 A;  4MMM A;  1M9B A;  2PER A;  2YAN A;  3ZIV A;  1YF0 A;  22GS A;  2MMA A;  3L9V A;  1Y6E A;  3UOM A;  4ZXG A;  1IYI A;  1JZR A;  5IM9 A;  2QSI A;  1X5C A;  5AN1 A;  3C1R A;  3QMX A;  3WT1 A;  2N5B A;  2GS3 A;  2FHE A;  4F82 A;  3D21 A;  4MPF A;  1O8X A;  2X99 A;  2YWM A;  2HLS A;  4I5Q A;  2C3T A;  2VLV A;  1OC3 A;  2VLT A;  2UZ8 A;  3FKF A;  3LG6 A;  5HFG A;  5D93 A;  4EO3 A;  2IJY A;  1CQG A;  2MMO A;  3APQ A;  4HU9 A;  2CAQ A;  3UBK A;  1BAY A;  5ECS A;  6GSW A;  2TRX A;  4IN0 A;  3MNG A;  1ZMA A;  3UL3 A;  3TKR A;  4BL7 B;  5DVB A;  2A4V A;  3MYD A;  1BYE A;  2IIY A;  4MF7 A;  3ZVJ A;  16GS A;  2N5A A;  1ZCP A;  1O85 A;  3ERG A;  1ZYQ B;  3EU4 A;  2C0G A;  4EVM A;  2H75 A;  3KGK A;  2IL3 A;  4LMW A;  2H0I A;  1SYR A;  20GS A;  4NV5 A;  1NHO A;  2E7P A;  1PMT A;  3MAK A;  1GSU A;  6GSY A;  3HZ4 A;  2OJL A;  2WRT A;  5KN1 A;  1GLQ A;  1GUK A;  1M2A A;  3GYK A;  2DJ3 A;  3VPT A;  4Q5F A;  2FGX A;  3H8Q A;  4KSO A;  1SJI A;  4N30 A;  1NW2 A;  1PRX A;  1IYH A;  3A3T A;  5F06 A;  2DJ1 A;  4PQI A;  5DBQ A;  1THX A;  1SJ6 A;  4ZBD A;  5JCU A;  2M72 A;  4CDO A;  2AB6 A;  2GSR A;  2WZ9 A;  4MF5 A;  4TW5 A;  1Z7R A;  5D8I A;  3GV1 A;  4IQA A;  4D73 A;  3A2V A;  3IRA A;  1NM3 A;  4K0G A;  5A4W A;  3ZTL A;  5IMA A;  5BMU A;  2CA8 A;  4MLY A;  4DEJ A;  1NSW A;  3FR3 A;  2GDR A;  5DCG A;  3HCZ A;  2HZE B;  1TJD A;  4F03 A;  3UJ1 A;  5G30 A;  3DRN A;  2X64 A;  3CTG A;  3O3T A;  2OBK A;  1XOA A;  4IHU A;  2IPA A;  1EV4 A;  1MDJ A;  3A2X A;  1EEM A;  5E59 A;  4G2E A;  1EP8 A;  1MTC A;  1S3A A;  1GTB A;  3ZMK A;  3WYW A;  1SU9 A;  4DSR A;  11GS A;  2C0F A;  2H70 A;  2HRF A;  2I81 A;  2PBJ A;  1GL8 A;  1V40 A;  2FCH A;  2LJR A;  5B6M A;  2GSS A;  3F4S A;  4XHM A;  2G2Q A;  1UVZ A;  4TR3 A;  1TK5 B;  1UN2 A;  3QAG A;  4O5R A;  2X8H A;  1T4Z A;  5IMD A;  1OC9 A;  2FWG A;  3VUR A;  2YPM A;  3IDV A;  5ECQ B;  1EEJ A;  4PGT A;  4X0X A;  1ILO A;  2DML A;  3VK9 A;  4YKG A;  5J41 A;  1UA5 A;  2KP2 A;  2MBS A;  4IEL A;  4HS1 A;  3LJR A;  2P5R A;  2MYG A;  1XCC A;  2NVL A;  1N2A A;  5DQY A;  4ZB8 A;  3UMA A;  4KCE A;  4MH3 A;  4G0L A;  5KN3 A;  3HA9 A;  3K8N A;  4MP4 A;  3HHV A;  1SKR B;  3NZN A;  4HZ4 A;  5IPH A;  1X5D A;  1O81 A;  2IFQ B;  4I6X A;  4FIW A;  3HVS A;  2CV4 A;  5KOX A;  2O8V B;  3GSS A;  4IP6 A;  1WRY A;  2P0G A;  3PPU A;  1J08 A;  3UVH A;  4K1F A;  3ZYW A;  4GCI A;  1JZO A;  4ZL8 A;  1FAA A;  2CVK A;  3EVI A;  4JU5 A;  1TRW A;  3VI7 A;  4I8B A;  2YV9 A;  2O89 A;  3KTB A;  3UVT A;  2OKA A;  4OO4 A;  2VCZ A;  4IVF A;  1URM A;  4BL7 A;  3UAR A;  3GNJ A;  4GST A;  2ZNM A;  3WT2 A;  2GQL A;  3F0I A;  2DJK A;  1ABA A;  4DSS A;  1AC1 A;  2H74 A;  2D2Z A;  1U88 A;  2TIR A;  2VCQ A;  4Q5N A;  2H6X A;  2FA8 A;  4JE1 A;  1U87 A;  3Q19 A;  2CVD A;  5DQS A;  1GTI A;  4JR6 A;  1GNE A;  5LCZ A;  2L4Q A;  4MK3 A;  6GSS A;  4IP1 A;  3KH9 A;  5CRE A;  2L59 A;  2YZH A;  3US3 A;  3D5J A;  3S9F A;  3C1S A;  4EUY A;  2YJH A;  4AJ7 A;  3CSJ A;  2XHF A;  2GSQ A;  1F9M A;  3GRX A;  3LW9 A;  2VCX A;  2L6C A;  4OFT A;  1S3D A;  4NPB A;  2RUF A;  4MNN A;  2HYX A;  4OCF A;  1M2B A;  1QMV A;  1FOV A;  3I6A A;  4WEY A;  2HE3 A;  1EGO A;  4ZL7 A;  5AIX A;  3VLN A;  9GSS A;  5ECO B;  3H4K A;  3BOA A;  3APS A;  3D6I A;  2NBS A;  3ED3 A;  3EMP A;  3F9U A;  2OBI A;  2J23 A;  1C72 A;  1KBN A;  3KJY A;  5LNK e;  4IJI A;  3ZZX A;  4MA9 A;  1M2D A;  4V1A g;  3SBC A;  4AF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...