1UN2A

Crystal structure of circularly permuted cpdsba_q100t99: preserved global fold and local structural adjustments
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
195
structure length
186
Chain Sequence
QTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOL-DISULFIDE INTERCHANGE PROTEIN
publication title Structure of Circularly Permuted Dsba(Q100T99): Preserved Global Fold and Local Structural Adjustments
pubmed doi rcsb
source organism Escherichia coli
total genus 59
structure length 186
sequence length 195
ec nomenclature
pdb deposition date 2003-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1un2A00
1SK1A 2GGTA 1YZXA 4TR1B 1CQGA 3GV1A 4J57E 4NXIA 3GKMA 1V9WA 4OCFA 2YP6A 5F07A 3Q19A 2MMNA 1XCCA 4MF5A 1K3YA 4ZXGA 2VOCA 2JZRA 1DE1A 3EINA 2LKUA 4CW9A 1K0BA 2K8SA 2AUVA 3L9VA 4BL7A 5G1LA 2VIMA 2CZ3A 2AAWA 1G0TA 4WF4A 3FZAA 3H79A 2CVDA 4ZILA 4K7IA 4PNGA 1QK8A 1PGTA 1O8XA 5IO2A 1AIUA 2A4VA 1SK0A 4WBRD 3FZ5A 5F8BA 4KGIA 3J7Yk 2J9HA 2DC5A 4QQ7A 2NPBA 3QOUA 4EF0A 1XVWA 2VL2C 4XS4B 5J41A 4NPBA 2FNOA 4XRDA 2JZTA 1QGVA 4NV2A 1KTEA 2WS2A 5COHA 3V1WA 3IC4A 1H4OA 2C0DA 1X5CA 2D2ZA 3HDCA 3KGKA 5FT3A 1NW2A 2PVQA 5A4WA 2QSIA 4WXTA 1HNCA 1BQ7A 4KNDA 2J23A 3QAGA 4AJ7A 2PN8A 3GH6A 1M0UA 3H1NA 3C73A 3OR5A 4V2NA 2I3YA 3FR9A 1DUGA 2IMIA 2YZHA 2C80A 1GUMA 1URMA 2VM2A 3ERWA 4GQCA 2VD1A 1TK0B 2HT9A 1M7TA 3VWXA 1X9MB 1THOA 3U5RE 1O6JA 4Q5RA 2VLVA 4GXZA 2H6YA 4HJMA 5EVOA 1QXHA 1ZMAA 2FWGA 2GVPA 2M80A 5AGYA 2OE3A 3FHKA 3A2XA 5DCHA 4MP4A 4MPFA 3IA1A 3TOTA 1GSSA 4PQ1A 1SJ6A 1YF0A 2X8GA 3CSHA 6GSXA 4YAVA 1KBNA 3F0IA 3O76A 1M2DA 4ID0A 2F3MA 5G5EA 1QMVA 2LTKA 3LJRA 4NAXA 2H1DA 3IK9A 2B6MA 1A8LA 5EY6A 2CV4A 5IO0A 3GKKA 13GSA 2RM6A 5ECHB 5HQPA 4BPYA 2R3XA 2WJUA 3HVVA 4GSTA 2GQKA 1G6WA 3PH9A 1GSDA 4O92A 5F06A 5CRWA 2H8LA 5CRHA 1TDIA 3DIEA 1EP7A 1WIKA 2YV7A 2HXKA 6GSSA 4KDXA 5GZZB 4ZB6A 3GKNA 2XHFA 3APQA 3ME7A 2XC2A 1GSUA 3E3EA 3EMPA 5KN0A 2YOIA 4K0NA 4EVMA 5B6NA 1XW9A 2O87A 5FWGA 4WR4A 5IMAA 2IPAA 1OE7A 11GSA 4POKA 4NHWA 4XRAA 1SK2A 2LQOA 3TJFA 4GWRA 5EPFA 1HNAA 3ZVJD 4IHUA 1GTUA 1X0RA 3CRTA 5DQYA 3DWVA 4MCUA 3TJJA 5CP1A 3P8WA 1H75A 1XPVA 2IMEA 3HYPA 4DSSA 2NDOA 3F9UA 1FHEA 2H1BA 4KCEA 2ZUPA 5EL8A 1J08A 3KEBA 4DSSB 2E2GA 2JL4A 3VURA 2GLRA 1T1VA 2DJKA 5HR2A 4AJ8A 4FO5A 2FA4A 4KDYA 1TJDA 4PGTA 4ML1A 1EP8A 3F6FA 1UC7A 2DJ2A 1BX9A 4XHMA 3LG6A 4EDYA 3UBLA 2HZEA 3KP9A 1KEBA 4GSNA 2V41A 3FR6A 3EURA 3IDVA 2HZEB 4WBJA 4ULXA 2O8VB 1R5AA 1XW6A 2ALBA 2L59A 5CRDA 1WWJA 2GSRA 2VLUA 1ST9A 2EIQA 3WT1A 4TR4A 3UMAA 3TKSC 18GSA 1C72A 1EEMA 1VGLA 2H1GA 2X8CA 3HZ4A 5JWOB 1YEPA 3RPPA 4N0ZA 4RI6A 3BOAA 1U87A 3UVTA 5IOWA 1A24A 2VCVA 4MZCA 5DJMA 5H5QA 4EC0A 2R2JA 2DJJA 2N5BA 5DDLA 1RQMA 2K8VA 1ZYEA 1G7EA 4N0VA 4AJ6A 2L57A 3IRAA 4KUNA 3D6IA 5A4VA 3GSSA 4KX4A 4YQUA 5B6MA 4NHZA 1XFLA 3IV4A 2WULA 1GLPA 4XTSA 1R5PA 3LSZA 2ES7A 1A8YA 5CNWA 4QL9A 1OKTA 3UEMA 5ABRA 1OKDA 3IE3A 1Y25A 5IMDA 5H5RA 3FW2A 3TJKA 3CTFA 2WRTA 1TU8A 3QAWA 3UIWA 1FAAA 1EGRA 1XWGA 4I5QA 3KH9A 3GRXA 3KMOA 3LYKA 1I5GA 1IYHA 3D0ZA 3TB2A 3H93A 4L8EA 2VL2A 3VLNA 4WR5A 3GUSA 4L0UA 3C1SA 4HS1A 1SKWB 4K8MA 1B48A 4K6XA 2XBQA 4K7NA 3I9V2 4ZBDA 1PX7A 1S3DA 3D5JA 16GSA 4AF2A 1IYIA 2YWMA 2M72A 3QR6A 2YWIA 5D73A 2HFDA 1F9MA 1USBA 1WRYA 2CZ2A 3MSZA 3EMXA 2PBJA 1E6BA 1JZDA 3GSTA 2QGVA 4EO3A 2K18A 1T00A 2CVKA 3KJYA 1ILOA 2GQMA 4JR4A 4EDZA 1HNBA 3CXGA 4PXOA 1X5DA 2KOKA 3WGXA 4L0WA 4L5LA 2EC4A 4MABA 3HZ8A 5LD0A 3D22A 2HSYA 3VK9A 3UVHA 5AISA 5AN1A 3A5WA 3A2VA 1O73A 3HA9A 4V1Ag 2AHEA 4TR3A 3L4NA 4G10A 4TXOA 2GT6A 1XWCA 1Z7PA 3ZFBA 5DAKA 4TXOB 2B5EA 1K0NA 2JACA 2G0FA 3IOSA 3IBHA 2DLXA 1V57A 2VCWA 1TI3A 4MF7A 5DALA 1A2LA 2MZCA 4EUYA 3GTUA 2FD3A 3FR3A 1Z3EA 3CMIA 3TKSE 3HVSA 3APSA 5DALB 4ZBAA 5G31A 4P3YB 3GTUB 4EL1A 5D96A 4H86A 3G9BA 2F8AA 2OACA 3ME8A 1RW1A 2CVBA 3E0UA 2VL3A 6GSYA 17GSA 4K9ZA 5B8BA 5AIXA 1YEXA 1K0CA 5B7CA 4I6XA 10GSA 1B4QA 5J9CA 4I97A 3CSIA 3Q6OA 2HRFA 4YH2A 2RM5A 1MDIA 1XIYA 3TRXA 4WKWA 4ZB9A 4CHSA 4OWYA 2VLTA 4IW9A 2C3TA 1T8EB 1EGOA 2BTOT 2R37A 3LXZA 2RLIA 2DMMA 3QCPA 1TRUA 1PQNA 3I43A 3DVWA 6GSTA 1EV9A 4TRXA 5CRGA 3NOFA 4GQFA 4HU7A 4ZL7A 1TRWA 2HSHA 1V58A 2HLSA 1K3LA 4JR6A 4IBPA 1ERWA 5H5SA 1S3CA 4POBA 4PX1A 1B4PA 5JCUA 1BEDA 3DYRA 4OCEA 1O7UA 1TU7A 3F4RA 1GP1A 1U3AA 1G7OA 1B9XC 1XBSA 1Z9HA 5ECLB 1A0RP 3H8QA 4OD7A 2B7JA 5DBQA 2C1YA 4KE3A 1SD9A 2OBKA 5JWQB 2ZCTA 1YJ6A 3J7Yb 1XWBA 4I8BA 1OC3A 1SL1B 4OO4A 2F51A 4K1FA 1F3AA 1T4YA 14GSA 2IL3A 2YPMA 1JFUA 1OAZA 2WDUA 2NTOA 3WYWA 3SWLA 4ML6A 3TKSA 4WF5A 2CAQA 1PL1A 4ECCA 2GZZA 2OA7A 1BJXA 4HI7A 2H71A 3IAM2 2LJKA 1ERUA 4FIWA 3TOUA 1YY7A 3ED3A 1A2MA 5LCZA 4OFTA 5J3RA 3EYTA 3KIJA 5JCGA 3QFBC 4MF6A 2FY6A 1R4WA 1YDKA 2ZNMA 3TJBA 3WGDA 2C4JA 3IHQA 2IMFA 4MPGA 3RHCA 4HUAA 4PUFC 22GSA 2H6XA 3EC3A 2H72A 1VF1A 1W4VA 4OO5A 3GN3A 2HNLA 3LORA 4OMVA 5ECQB 5DVBA 2FGXA 3Q74A 1OE8A 4TOPA 4FYUA 4IN0A 1ZGNA 3N9JA 2E2MA 3CBUA 3D4TA 4F0CA 3IPZA 3NIVA 1OVNA 1AC1A 1PD21 4MK3A 2JSYA 5A5KA 1QFNA 1J0FA 4MZBA 2YNXA 2I1UA 2C3QA 1OC9A 1X5EA 3KXOA 1FG4A 4O5RA 2B5YA 1R26A 1YQ1A 1OC9B 4FYBA 2RIIA 1R7HA 3ZZXA 1TK8B 1F6MC 3C71A 2PU9C 1GTIA 2P31A 4EKZA 4HQZA 2VAFA 1V2AA 4BA7A 5ECPB 3CRUA 4TKYA 1GH2A 2GQLA 3HJOA 1FB0A 4MDCA 1AUCA 3GNJA 2H66A 4GF0A 4QL7A 2F8FA 2EIRA 2WCIA 4IELA 4X0XA 2FA8A 2N5FA 5IIZA 4F82A 3QPMA 4NWYA 4MJAA 1K0AA 1ABAA 2GZYA 20GSA 5KN2A 3KD0A 2IMKA 1EOHA 3M3MA 3C8EA 2C8UA 1SYXA 4GCIA 1EZKA 4IP1A 2PUKC 3DXBA 1A0FA 4ACSA 2OE1A 2LQQA 1HQOA 1O8WA 1T7PB 1U3IA 4TXVA 3L9UA 8GSSA 3D21A 2VM1A 4I2TA 4NMUA 1LU4A 6GSWA 2VUPA 3IR4A 2B1LA 1DBYA 4G19A 4KSMA 5KN1A 3RDWA 1FVJA 1MEKA 3EWLA 2LJRA 1GSEA 3VWUA 3TUEA 5J9BA 1Z7RA 5J5NA 2C0FA 2HI7A 2LS5A 5D9WA 4X1UA 1ZCPA 5ECRB 1JHBA 1UN2A 3RHBA 5CO3A 1BAYA 3I69A 4POMA 1ZYQB 4HJ2A 4KCAA 1WPIA 3KTBA 1GTBA 1PSQA 3IXRA 4POLA 2TRCP 2IFQA 3ZFLA 3Q18A 3VI7A 1FB6A 1EOGA 1KNGA 3ZIVA 2IFQB 3UBKA 5GAPD 2AB6A 4I2UA 1RK4A 5CYYA 12GSA 2DBCA 3TGZA 3APOA 4IJIA 1TK5B 4KH7A 3FK8A 3W8JA 2H70A 1THXA 1XXUA 2H0IA 4Q5NA 4ECIA 1GUKA 1I9DA 2YV9A 2ON5A 1EWXA 5HFGA 5F05A 3KMNA 1JZRA 1U88A 4J2FA 1SL0B 3C7MA 3L0HA 4LMVA 2REMA 2FLSA 2G2QA 3UAPA 3UARA 5LNKe 1PRXA 5IOXA 1JZOA 4LL1B 5L71A 1VF2A 4MA9A 5DJLA 1B9YC 2WFCA 5IMZA 3G7IA 4J56E 3ZMLA 3MDKA 4ZL9A 4FYCA 4RI7A 1YKAA 4KB3A 3US3A 2OE0A 1GWCA 1MDKA 3WGEA 3TKPA 3LQ7A 3LGCA 4HEA2 4KW6A 4ECJA 2OKAA 5IPGA 3VWWA 2Z9SA 4PURA 3QAVA 2VL9A 1A2JA 2PGTA 5IMVA 4IJ3A 3GKXA 1DE2A 4HOJA 3GURA 1SKSB 3W8SA 1TW9A 4O32A 1GUHA 4ZIJA 5J4UA 1VRSD 3GH9A 2L6DA 3BD2A 2LNSA 4IQ1A 1N2AA 3EU3A 2K6VA 6GSUA 5C00A 2AJQB 1PL2A 1T4ZA 2GT5A 1F2EA 2BMXA 2B3SA 3C1RA 2MMOA 19GSA 2EIOA 4RQXA 5IQYA 3F63A 3IK7A 1XOBA 2MBTA 2X64A 5HFKA 4F9ZA 1XWKA 2YJHA 4V2LA 2KP2A 4WEYA 4MJEA 2CX4A 4TW5A 1BYEA 2C0EA 2XPDA 3ZRDA 2FHEA 2R6KA 5D8IA 4WETA 1GULA 3KM6A 4CDOA 5DAKB 2PPTA 3P90A 2LRNA 1YF1A 3VWVA 2H73A 2GZPA 2O89A 3PINA 9GSSA 2LJAA 3RPNA 5JWRB 5FHIA 1ML6A 3LYPA 5G30A 3TRPA 1VF4A 1X9WB 4DSQA 2X8HA 2CAIA 4HQSA 4KDUA 2H1AA 3TKQA 4TR1A 1VF3A 3PR8A 4PQIA 1TRSA 2XBIA 4GRFA 2H19A 2WGRA 2YJ7A 5DQSA 2RUFA 2A2SA 2QKEA 5CAXA 4L5OA 4YAPA 2YCDA 3KH7A 2LUSA 4PNFA 2K9FA 2P0GA 3GIXA 3BCKA 4BWQA 5HR1A 4IKHA 3NZNA 3K8NA 2OADA 1SJIA 1Z5YE 2DIZA 3ZTLA 3ERGA 3VPQA 4GLTA 3ZYWA 1S3AA 1WE0A 4BVXA 4G9HA 2O7KA 5ECKB 5IMFA 1JLVA 1W89A 2YZUA 1TRVA 4KSOA 2LRCA 1FO5A 1V40A 3BBYA 2CX3A 5ENUA 2GTUA 2FWEA 2MMAA 4XS4A 1NM3A 4V2MA 1M99A 4XCSA 4IS0A 4PUAA 2GDRA 4V1Ap 2NBSA 4N30A 4EXJA 1GLQA 5GSTA 5IPHA 3GX0A 3LWAA 5D9VA 2IIYA 4TVEA 3G7YA 5F0GA 4YQMA 2LRTA 2HE3A 1HD2A 1AXDA 2BJXA 5ELAA 1LJRA 3ZIJA 5KN3A 3M9KA 1B8XA 1XOAA 2L6CA 5B8AA 3HVXA 3VFIA 2H30A 2YN1A 3DD3A 3HHVA 2IN3A 3CTGA 1LBKA 3F3QA 5KEJA 4GTUA 1GL8A 2P5QA 5ELGA 2AV4A 3MWHA 2PWJA 3M0FA 3BJ5A 3H4KA 3U6VA 3FY7A 3FZ4A 4ZBBA 4K0GA 4YQVA 7GSSA 4ZB8A 1HYUA 1EV4A 3ERFA 2LEGA 1GRXA 3AY8A 2DJ0A 1Z6NA 4Z7XA 1MDJA 2VD0A 3ZL5A 3GA4A 3F4SA 3P2AA 1K0MA 1FW1A 3UL3A 1TXXA 2JZSA 4N11A 3DKSA 4EE0A 3EVIA 4HU9A 4RUVA 3KCMA 1UA5A 5HR0A 5GAND 4ZL8A 2TIRA 1K0OA 4OFNA 4OFMA 3QD9A 4TN8A 2MYGA 2I4AA 3GL5A 3LXTA 2LNTA 1XW5A 3TKRA 2H76A 3ISOA 1AQVA 3I6AA 2GSSA 3F6DA 2MMZA 2H75A 3KTLA 5E4WA 1SENA 4HDEA 2CA8A 3F8UA 2C0GA 4E8HA 1PN9A 1Q98A 2R5GA 5D93A 1AQXA 3VI5A 3DGQA 3M9JA 2IWTA 4HZ2A 3F3RA 3EE2A 3TDGA 3HXSA 1NHYA 1GNEA 4RQRA 1G6YA 4ECBA 5GSSA 1PKZA 1ZOFA 2B7KA 1MTCA 1PA3A 2FCHA 2GS3A 2L4QA 2WZ9A 5IMCA 3CSJA 1K0DA 1NSWA 1N8JA 4Q5FA 5ECNB 3FYGA 5ECMB 3HJPA 1SU9A 2FWHA 2H0GA 1FOVA 2CT6A 3S9FA 4NV5A 2PERA 1A23A 1GSQA 5ID2A 2HZFA 1SL2B 4MJCA 2WB9A 3L78A 5ID2B 3W6GA 2X99A 2V2GA 2B5XA 3DEXA 3MAKA 4HZ4A 1TOFA 2V6OA 3GL3A 4JRRA 1M9BA 3WT2A 1WP0A 2VCZA 4AGSA 4BWSA 4E8EA 2OBIA 5ECSA 1ERVA 2IMDA 1MD3A 2O85A 3A2WA 2V6KA 3IAS2 3F4TA 2V32A 2F9SA 4TR0A 1K3OA 2QC7A 3LEFA 4IQAA 3TJGA 1CQHA 3O3TA 3FZ9A 1XZOA 4LLRA 1GNWA 4XS1A 1O85A 3RBTA 3R2QA 4LL4B 1BG5A 1GTAA 1ERTA 2H0HA 1NHOA 1PMTA 1AQWA 1QUWA 1E2YA 1MD4A 2YANA 1OYJA 1PKWA 2OJLA 3DRNA 1GSYA 5IM9A 4IP6A 5HFIA 2I81A 3ZVJA 3EU4A 2C3NA 3SBCA 1M2BA 2L5OA 5CREA 2N5AA 4F2IA 2KUCA 2R4VA 5G1KA 4O7HA 2H74A 4PQHA 4XS6A 1ZZYA 4XIHA 3HCZA 3QDNA 2AYTA 4MH2A 1M2AA 2VO4A 1WOUA 4IVFA 1U6TA 3WD6A 4MZWA 4KA0A 1XVQA 1SYRA 3GMFA 4MJBA 2KP1A 1PX6A 1UVZA 4DVCA 4D73A 3TCOA 2FWFA 2H01A 4ISDA 5HR3A 1FVKA 2GSTA 4D73B 4MH3A 4LA1A 3UJ1A 1TKDB 1SKRB 2MBSA 4LMWA 3QFAC 4F0BA 3FKFA 3ZLPA 2LSTA 3ZMKA 3G7JA 1TI1A 1YKCA 1XWAA 2DIYA 4JBBA 1AW9A 1SD8A 1EEJA 2P5RA 3LFLA 4K2DA 4KAEA 2DSAA 4DEJA 1Q4JA 2E0QA 1ZL9A 2M46A 2E7PA 5ECIB 2V1MA 4MLYA 4ILFA 1J9BA 5E59A 1V98A 5G2ZA 2B1KA 3FEUA 2DJ1A 1ON4A 1X9SB 5DCGA 2GSQA 2H6ZA 2PVOC 2YWNA 4FH8A 4N10A 5INYA 2VCTA 4GSSA 3QMXA 1GSFA 3DMLA 2TRXA 3M1GA 4JU5A 3KZQA 3GX8A 2I9HA 2YWOA 2LV3A 2A2RA 5A4UA 1TP9A 1TTZA 2RUEA 1JZWA 2KHPA 1DSBA 2NVLA 3E9JB 4K7OA 4DSRA 4G2EA 1WMJA 2IJYA 1O81A 3FRCA 1F37A 3GHAA 2HYXA 4BVYA 5C04A 2DJ3A 2CQ9A 3DVXA 2DMLA 4IGJA 3TRQA 1Z6MA 4MMMA 5D9TA 5JCWA 3HKRA 3GYKA 2ON7A 3HJMA 2XPEA 4X43A 5D9XA 3HD5A 1WJKA 2PMTA 1T3BA 2JU5A 3L9SA 3D4MA 4Q5QA 2VCQA 3BCIA 3VPTA 3CYNA 2HRNA 2L4CA 3O6TA 3HY2A 3PGTA 3ZREA 3M8NA 4JE1A 5AIVA 5G5FA 6GSVA 1ACVA 1M9AA 3UOMA 3P7XA 1OC8A 3JCML 1JLWA 3N5OA 4JEDA 4JZQA 2FUG2 3A3TA 1Y6EA 4F03A 3GFKA 2L5LA 5ECOB 2JSZA 3ZITA 2VCXA 1F3BA 3RAZA 1QQ2A 2KLXA 1AAZA 1SJZA 3MNGA 2JADA 3KP8A
chains in the Genus database with same CATH superfamily
1SK1A 2GGTA 1YZXA 4TR1B 1CQGA 3GV1A 4J57E 4NXIA 3GKMA 1V9WA 4OCFA 2YP6A 5F07A 3Q19A 2MMNA 1XCCA 4MF5A 1K3YA 4ZXGA 2VOCA 2JZRA 1DE1A 3EINA 4O5UA 2LKUA 4CW9A 1K0BA 2K8SA 2AUVA 3L9VA 4BL7A 5G1LA 2VIMA 2CZ3A 2X49A 2AAWA 1G0TA 4BL7B 4WF4A 4BVXB 3FZAA 3H79A 2CVDA 4ZILA 4K7IA 4PNGA 1QK8A 1PGTA 1O8XA 1XG8A 5IO2A 1AIUA 2A4VA 1SK0A 4WBRD 3FZ5A 5F8BA 4KGIA 3J7Yk 2J9HA 2DC5A 4QQ7A 2NPBA 3QOUA 4EF0A 1XVWA 2VL2C 4XS4B 5J41A 4NPBA 2FNOA 4XRDA 2JZTA 1QGVA 4NV2A 1KTEA 2WS2A 5COHA 3V1WA 3IC4A 1H4OA 2C0DA 1X5CA 2D2ZA 3HDCA 3KGKA 5FT3A 1NW2A 2PVQA 5A4WA 2QSIA 4WXTA 4EIQA 1HNCA 1BQ7A 4KNDA 2J23A 3QAGA 4AJ7A 2PN8A 3GH6A 1M0UA 3H1NA 3C73A 3OR5A 4V2NA 2I3YA 3FR9A 1DUGA 2IMIA 2YZHA 2C80A 1GUMA 1URMA 2VM2A 3ERWA 4GQCA 2VD1A 1TK0B 2HT9A 1M7TA 3VWXA 1X9MB 1THOA 3U5RE 1O6JA 4Q5RA 1M3JA 2VLVA 4GXZA 2H6YA 4HJMA 5EVOA 1QXHA 1ZMAA 2FWGA 2GVPA 2M80A 5AGYA 2OE3A 3FHKA 3A2XA 5DCHA 4MP4A 2R0CA 4MPFA 3IA1A 3TOTA 1GSSA 4PQ1A 1SJ6A 1YF0A 2X8GA 3CSHA 6GSXA 4YAVA 1KBNA 3F0IA 3O76A 1M2DA 4ID0A 2F3MA 5G5EA 1QMVA 2LTKA 3LJRA 4NAXA 2H1DA 3CQFA 3IK9A 2B6MA 1A8LA 5EY6A 2CV4A 5IO0A 3GKKA 13GSA 2RM6A 1PN0A 5ECHB 4HSCX 5HQPA 4BPYA 2R3XA 2WJUA 3HVVA 4GSTA 2GQKA 1G6WA 3PH9A 1GSDA 4O92A 5F06A 5CRWA 4Z2RA 2H8LA 5CRHA 1TDIA 3DIEA 1EP7A 1WIKA 2YV7A 2HXKA 6GSSA 4KDXA 5GZZB 4ZB6A 3GKNA 2XHFA 3APQA 3ME7A 2XC2A 1GSUA 3E3EA 3EMPA 5KN0A 2YOIA 4K0NA 4EVMA 5B6NA 1FOHA 1XW9A 2O87A 5FWGA 4WR4A 5IMAA 2IPAA 1OE7A 11GSA 4POKA 4NHWA 4XRAA 1SK2A 2LQOA 3TJFA 4GWRA 5EPFA 1HNAA 3ZVJD 4IHUA 1GTUA 1X0RA 3CRTA 5DQYA 3DWVA 4MCUA 3TJJA 5CP1A 2HSMA 3P8WA 1H75A 1XPVA 2IMEA 3HYPA 4DSSA 2NDOA 3F9UA 1FHEA 2H1BA 4KCEA 2ZUPA 5EL8A 1J08A 3KEBA 4DSSB 2E2GA 2JL4A 3VURA 2GLRA 1T1VA 2DJKA 5HR2A 4AJ8A 4KF9A 4FO5A 2FA4A 4G0KA 4KDYA 1TJDA 4PGTA 4ML1A 1EP8A 3F6FA 1UC7A 2DJ2A 1BX9A 4XHMA 3LG6A 4EDYA 3UBLA 2HZEA 3MIXA 3KP9A 1KEBA 4GSNA 2V41A 3FR6A 3EURA 3IDVA 2HZEB 4WBJA 4EIPA 4ULXA 2O8VB 1R5AA 1XW6A 2ALBA 2L59A 5CRDA 1WWJA 2GSRA 2VLUA 1ST9A 2EIQA 3WT1A 4TR4A 3UMAA 3TKSC 18GSA 1C72A 1EEMA 1VGLA 2H1GA 1M3IA 2X8CA 3HZ4A 5JWOB 1YEPA 3RPPA 4N0ZA 4RI6A 3BOAA 1U87A 3UVTA 5IOWA 1A24A 2VCVA 4MZCA 5DJMA 5H5QA 4EC0A 2R2JA 2DJJA 2N5BA 5DDLA 1RQMA 2K8VA 1ZYEA 1G7EA 4N0VA 4AJ6A 2L57A 3IRAA 4KUNA 3D6IA 5A4VA 3GSSA 4KX4A 4YQUA 5B6MA 4NHZA 1XFLA 3IV4A 2WULA 1GLPA 4XTSA 1R5PA 3PPUA 3LSZA 2ES7A 1A8YA 5CNWA 4QL9A 1OKTA 3UEMA 5ABRA 1OKDA 3IE3A 1Y25A 5IMDA 5H5RA 3FW2A 3TJKA 3CTFA 2WRTA 1TU8A 3QAWA 3UIWA 1FAAA 1EGRA 1XWGA 4I5QA 3KH9A 3GRXA 3KMOA 3LYKA 1I5GA 1IYHA 3D0ZA 3TB2A 3H93A 4L8EA 2VL2A 3VLNA 4WR5A 3GUSA 4L0UA 3C1SA 4HS1A 1SKWB 4K8MA 1B48A 4K6XA 4K5SA 2XBQA 4K7NA 2A2PA 3I9V2 3LW9A 4ZBDA 1PX7A 1ZYNA 1S3DA 3D5JA 16GSA 4AF2A 1IYIA 2YWMA 2M72A 3QR6A 2YWIA 5D73A 2HFDA 1F9MA 1USBA 1WRYA 2CZ2A 3MSZA 3EMXA 2PBJA 1E6BA 1JZDA 3GSTA 2QGVA 4EO3A 2K18A 1T00A 2CVKA 3KJYA 1ILOA 2GQMA 4BVYB 4JR4A 4EDZA 1HNBA 3CXGA 4PXOA 1X5DA 2KOKA 3WGXA 4L0WA 4L5LA 2EC4A 4MABA 3HZ8A 5LD0A 3D22A 2HSYA 2DKHA 3VK9A 3UVHA 5AISA 5AN1A 3A5WA 3A2VA 1O73A 3HA9A 4V1Ag 2AHEA 4TR3A 3L4NA 4G10A 4TXOA 2GT6A 1XWCA 1Z7PA 3ZFBA 5DAKA 4TXOB 2B5EA 1K0NA 2JACA 2G0FA 3IOSA 3IBHA 2DLXA 1V57A 2VCWA 1TI3A 4MF7A 5DALA 1A2LA 2MZCA 4EUYA 3GTUA 2FD3A 3FR3A 1Z3EA 3FMWA 3CMIA 3TKSE 3HVSA 3APSA 5DALB 4YKGA 4ZBAA 5G31A 4P3YB 3GTUB 4EL1A 5D96A 4H86A 3G9BA 2F8AA 2OACA 3ME8A 1RW1A 2CVBA 3E0UA 2VL3A 6GSYA 17GSA 4K9ZA 5B8BA 5AIXA 1YEXA 1K0CA 4G0IA 5B7CA 4I6XA 10GSA 4MNNA 4CY8A 1B4QA 5J9CA 4I97A 3CSIA 3Q6OA 2HRFA 4YH2A 2RM5A 2A4HA 1MDIA 1XIYA 3TRXA 4WKWA 3MYDA 4ZB9A 4CHSA 4OWYA 2VLTA 4IW9A 2C3TA 1T8EB 1EGOA 2BTOT 2R37A 3LXZA 2RLIA 2DMMA 3QCPA 1TRUA 1PQNA 3I43A 3DVWA 6GSTA 1EV9A 4TRXA 5CRGA 3NOFA 4GQFA 4HU7A 4ZL7A 1TRWA 2HSHA 1V58A 2HLSA 1K3LA 4JR6A 4IBPA 1ERWA 5H5SA 1S3CA 4POBA 4PX1A 1B4PA 5JCUA 1BEDA 3DYRA 4OCEA 1O7UA 1TU7A 3F4RA 1GP1A 1U3AA 1G7OA 1B9XC 1XBSA 1Z9HA 5ECLB 1A0RP 3H8QA 4OD7A 2B7JA 5DBQA 2C1YA 4KE3A 1SD9A 2OBKA 5JWQB 2ZCTA 1YJ6A 3J7Yb 1XWBA 4I8BA 1OC3A 1SL1B 4OO4A 2F51A 4K1FA 1F3AA 1T4YA 14GSA 2IL3A 2YPMA 1JFUA 1OAZA 2WDUA 2NTOA 3WYWA 3SWLA 4ML6A 3TKSA 4WF5A 2CAQA 1PL1A 4ECCA 2GZZA 2OA7A 1BJXA 4HI7A 2H71A 3IAM2 2LJKA 1ERUA 4FIWA 3TOUA 1YY7A 3ED3A 1A2MA 5LCZA 4OFTA 5J3RA 3EYTA 3KIJA 5JCGA 3QFBC 4MF6A 3R3EA 5BMUA 2FY6A 1R4WA 1YDKA 2ZNMA 3TJBA 3WGDA 2C4JA 3IHQA 2IMFA 4MPGA 3RHCA 4HUAA 4PUFC 22GSA 2H6XA 3EC3A 2H72A 1VF1A 1W4VA 4OO5A 3GN3A 2HNLA 3LORA 4OMVA 5ECQB 5DVBA 2FGXA 3Q74A 1OE8A 2HRKA 4TOPA 4FYUA 4IN0A 1ZGNA 3N9JA 2E2MA 3CBUA 3D4TA 4F0CA 3IPZA 3NIVA 1OVNA 1AC1A 1PD21 4MK3A 2JSYA 5A5KA 1QFNA 1J0FA 4MZBA 2YNXA 2I1UA 2C3QA 1OC9A 1X5EA 3KXOA 1FG4A 4O5RA 2B5YA 1R26A 1YQ1A 1OC9B 4FYBA 2RIIA 1R7HA 3ZZXA 1TK8B 1F6MC 3C71A 2PU9C 1GTIA 2P31A 4EKZA 3IC8A 4HQZA 4A5PA 2VAFA 1V2AA 4BA7A 4BIKA 5ECPB 3CRUA 4TKYA 1GH2A 2GQLA 3HJOA 1FB0A 4MDCA 1AUCA 3GNJA 2H66A 4GF0A 4QL7A 2F8FA 2EIRA 2WCIA 4IELA 4X0XA 2FA8A 2N5FA 5IIZA 4F82A 3QPMA 4NWYA 4MJAA 1K0AA 1ABAA 2GZYA 4K2XA 20GSA 5KN2A 3KD0A 2IMKA 4X4JA 1EOHA 3M3MA 3C8EA 2C8UA 1SYXA 4GCIA 1EZKA 4IP1A 2PUKC 3DXBA 1A0FA 4ACSA 2OE1A 2LQQA 1HQOA 1O8WA 1T7PB 1U3IA 4TXVA 1S3RA 3L9UA 8GSSA 3D21A 2VM1A 4I2TA 4NMUA 1LU4A 6GSWA 2VUPA 3IR4A 2B1LA 1DBYA 4G19A 4KSMA 5KN1A 3RDWA 1FVJA 1MEKA 3EWLA 2LJRA 1GSEA 3VWUA 3TUEA 5J9BA 1Z7RA 5J5NA 2C0FA 2HI7A 2LS5A 5D9WA 4X1UA 1ZCPA 5ECRB 1JHBA 1UN2A 3RHBA 5CO3A 3EPTA 1BAYA 3I69A 4POMA 1ZYQB 4HJ2A 4KCAA 1WPIA 3KTBA 1GTBA 1PSQA 3IXRA 4POLA 2TRCP 2IFQA 3ZFLA 3Q18A 3VI7A 1FB6A 1EOGA 1KNGA 3ZIVA 2IFQB 3UBKA 5GAPD 2AB6A 4I2UA 1RK4A 5CYYA 12GSA 2DBCA 3TGZA 3APOA 4IJIA 1TK5B 4KH7A 3FK8A 3W8JA 2H70A 1THXA 1XXUA 2H0IA 4Q5NA 4ECIA 1GUKA 1I9DA 2YV9A 2ON5A 1EWXA 5HFGA 5F05A 3KMNA 1JZRA 1U88A 4J2FA 1SL0B 3C7MA 3L0HA 4LMVA 2REMA 2FLSA 2G2QA 3UAPA 3UARA 5LNKe 1PRXA 5IOXA 1JZOA 4LL1B 5L71A 1VF2A 4MA9A 5DJLA 1B9YC 2WFCA 5IMZA 3G7IA 4J56E 3ZMLA 3MDKA 4ZL9A 4FYCA 4RI7A 4PTSA 1YKAA 4KB3A 3US3A 2OE0A 1GWCA 1MDKA 3WGEA 3TKPA 3LQ7A 3LGCA 4Z2UA 4HEA2 4KW6A 4ECJA 2OKAA 5IPGA 3VWWA 2Z9SA 4PURA 3QAVA 2VL9A 1A2JA 2PGTA 5IMVA 4IJ3A 3GKXA 1DE2A 4HOJA 3GURA 1SKSB 3W8SA 1TW9A 4O32A 1GUHA 4ZIJA 5J4UA 1VRSD 3GH9A 2L6DA 1PFOA 3BD2A 2LNSA 4IQ1A 1N2AA 3EU3A 2K6VA 6GSUA 5C00A 2AJQB 1PL2A 1T4ZA 2GT5A 1F2EA 2BMXA 2X4AA 2B3SA 3C1RA 2MMOA 19GSA 2EIOA 4RQXA 5IQYA 3F63A 3IK7A 1XOBA 3HVNA 2MBTA 2X64A 5HFKA 4F9ZA 1XWKA 2YJHA 4V2LA 2KP2A 4WEYA 4MJEA 2CX4A 4TW5A 1BYEA 2C0EA 2XPDA 3ZRDA 2FHEA 2R6KA 5D8IA 4WETA 1GULA 3KM6A 4CDOA 5DAKB 2PPTA 3P90A 2LRNA 1YF1A 3VWVA 2H73A 2GZPA 2O89A 3PINA 9GSSA 2LJAA 3RPNA 2R0PA 5JWRB 5FHIA 1ML6A 3LYPA 5G30A 3TRPA 1VF4A 1X9WB 4DSQA 2X8HA 2CAIA 4HQSA 4KDUA 2H1AA 3TKQA 4TR1A 1VF3A 3PR8A 4PQIA 1TRSA 2XBIA 4GRFA 2H19A 2WGRA 2YJ7A 2UZ8A 5DQSA 2RUFA 2A2SA 2QKEA 5CAXA 4L5OA 4YAPA 2YCDA 3KH7A 2LUSA 4PNFA 2K9FA 2P0GA 3GIXA 3BCKA 4BWQA 5HR1A 4IKHA 3NZNA 3K8NA 2OADA 1SJIA 1Z5YE 2DIZA 3ZTLA 3ERGA 3VPQA 4GLTA 3ZYWA 1S3AA 1WE0A 4BVXA 4G9HA 2O7KA 5ECKB 5IMFA 1JLVA 1W89A 2YZUA 1TRVA 4KSOA 1ZYPA 2LRCA 1FO5A 1V40A 3BBYA 3A5IA 2CX3A 5ENUA 2GTUA 2FWEA 2MMAA 4XS4A 1NM3A 4V2MA 1M99A 4XCSA 4IS0A 4PUAA 2GDRA 4V1Ap 2NBSA 4N30A 4EXJA 1GLQA 5GSTA 5IPHA 4USSA 3GX0A 3LWAA 5D9VA 2IIYA 4TVEA 3G7YA 5F0GA 4YQMA 2LRTA 2HE3A 1HD2A 1AXDA 2BJXA 5ELAA 2DKIA 1LJRA 3ZIJA 5KN3A 3M9KA 1B8XA 1XOAA 2L6CA 5B8AA 3HVXA 3VFIA 2H30A 2YN1A 3DD3A 3HHVA 2IN3A 3CTGA 1LBKA 3F3QA 5KEJA 4GTUA 1GL8A 2P5QA 5ELGA 2AV4A 3MWHA 2PWJA 3M0FA 3BJ5A 3H4KA 3U6VA 3FY7A 3FZ4A 4ZBBA 4K0GA 4YQVA 7GSSA 4ZB8A 1HYUA 1EV4A 3ERFA 2LEGA 1GRXA 3AY8A 2DJ0A 1Z6NA 4Z7XA 1MDJA 2VD0A 3ZL5A 3GA4A 3F4SA 3P2AA 1K0MA 1FW1A 3UL3A 1TXXA 2JZSA 4N11A 3DKSA 4EE0A 3EVIA 4HU9A 4RUVA 3KCMA 1UA5A 5HR0A 5GAND 4ZL8A 2TIRA 1K0OA 4OFNA 4OFMA 3QD9A 4TN8A 2MYGA 2I4AA 3GL5A 3LXTA 2LNTA 1XW5A 3TKRA 2H76A 3ISOA 1AQVA 3I6AA 2GSSA 2R0GA 3F6DA 2MMZA 2H75A 3KTLA 5E4WA 1SENA 4HDEA 2CA8A 3F8UA 2C0GA 4E8HA 1PN9A 1Q98A 2R5GA 5D93A 1AQXA 3VI5A 3DGQA 3M9JA 2IWTA 4HZ2A 3F3RA 3EE2A 3TDGA 3HXSA 1NHYA 1GNEA 4RQRA 1G6YA 4ECBA 5GSSA 1PKZA 1ZOFA 2B7KA 2QA2A 1MTCA 1PA3A 2FCHA 2GS3A 2L4QA 2WZ9A 5IMCA 4K5RA 3CSJA 1K0DA 1NSWA 1N8JA 4Q5FA 5ECNB 3FYGA 5ECMB 3HJPA 1SU9A 2FWHA 2H0GA 1FOVA 2CT6A 4FQUA 3S9FA 4NV5A 2PERA 1A23A 1GSQA 5ID2A 2HZFA 1SL2B 4MJCA 2WB9A 4Z2TA 3L78A 5ID2B 3W6GA 2X99A 2V2GA 2B5XA 3DEXA 3MAKA 4HZ4A 1TOFA 2V6OA 3GL3A 4JRRA 1M9BA 3WT2A 3IHGA 1WP0A 2VCZA 4AGSA 4BWSA 4E8EA 2OBIA 5ECSA 2QA1A 1ERVA 2IMDA 1MD3A 2O85A 3A2WA 2V6KA 3IAS2 3F4TA 2V32A 2F9SA 4TR0A 1K3OA 2QC7A 3LEFA 4IQAA 3TJGA 1CQHA 3O3TA 3FZ9A 1XZOA 4LLRA 1GNWA 4G0LA 4CY6A 4XS1A 1O85A 3RBTA 3R2QA 4LL4B 1BG5A 1GTAA 5KOXA 1ERTA 2H0HA 1NHOA 1PMTA 1AQWA 1QUWA 1E2YA 1MD4A 2YANA 1OYJA 1PKWA 2OJLA 3DRNA 1GSYA 5IM9A 4IP6A 5HFIA 2I81A 3ZVJA 3EU4A 2C3NA 3SBCA 1M2BA 2HRAA 2L5OA 5CREA 2N5AA 4F2IA 2KUCA 2R4VA 5G1KA 4O7HA 2H74A 4PQHA 4XS6A 1ZZYA 4XIHA 3HCZA 3QDNA 2AYTA 4MH2A 1M2AA 2VO4A 1WOUA 4IVFA 1U6TA 3WD6A 4MZWA 4KA0A 1XVQA 1SYRA 3GMFA 4MJBA 2KP1A 1PX6A 1UVZA 4DVCA 4D73A 3TCOA 2FWFA 5BRTA 2H01A 4ISDA 5HR3A 1FVKA 4ICYA 2GSTA 4D73B 4MH3A 4LA1A 3UJ1A 1TKDB 1SKRB 2MBSA 4LMWA 3QFAC 4F0BA 3FKFA 4O5QA 3ZLPA 2LSTA 3ZMKA 3G7JA 1TI1A 1YKCA 1XWAA 2DIYA 4JBBA 1AW9A 1SD8A 1EEJA 2P5RA 3LFLA 4K2DA 4KAEA 2DSAA 4DEJA 1Q4JA 2E0QA 1ZL9A 2M46A 2E7PA 5ECIB 2V1MA 4MLYA 4ILFA 1J9BA 5E59A 1V98A 5G2ZA 4YKFA 2B1KA 3FEUA 2DJ1A 1ON4A 1X9SB 5DCGA 2GSQA 2H6ZA 2PVOC 2YWNA 5KOWA 4FH8A 4N10A 5INYA 2VCTA 4GSSA 3QMXA 1GSFA 3DMLA 2TRXA 3M1GA 4JU5A 3KZQA 3GX8A 2I9HA 2YWOA 2LV3A 2A2RA 5A4UA 1TP9A 1TTZA 2RUEA 1JZWA 2KHPA 1DSBA 2NVLA 3E9JB 4K7OA 4DSRA 4G2EA 1WMJA 2IJYA 1O81A 3FRCA 1F37A 3GHAA 2HYXA 4BVYA 5C04A 2DJ3A 2CQ9A 3DVXA 2DMLA 4IGJA 3TRQA 1Z6MA 4MMMA 5D9TA 5JCWA 3HKRA 3GYKA 2ON7A 3HJMA 2XPEA 4X43A 5D9XA 3HD5A 1WJKA 2PMTA 1T3BA 2JU5A 3L9SA 3D4MA 4Q5QA 2VCQA 3BCIA 3VPTA 3CYNA 2HRNA 2L4CA 3O6TA 3HY2A 3PGTA 3ZREA 3M8NA 4JE1A 5AIVA 5G5FA 6GSVA 1ACVA 1M9AA 3UOMA 3P7XA 1OC8A 3JCML 1JLWA 3N5OA 4JEDA 4JZQA 2FUG2 3A3TA 1Y6EA 4F03A 3GFKA 2L5LA 5ECOB 2JSZA 3ZITA 2VCXA 1F3BA 3RAZA 1QQ2A 2KLXA 1AAZA 1SJZA 3MNGA 2JADA 3KP8A
chains in the Genus database with same CATH topology
1SK1A 2GGTA 1YZXA 4TR1B 1CQGA 3GV1A 4J57E 4NXIA 3GKMA 1V9WA 4OCFA 2YP6A 5F07A 3Q19A 2MMNA 1XCCA 4MF5A 1K3YA 4ZXGA 2VOCA 2JZRA 1DE1A 3EINA 4O5UA 2LKUA 4CW9A 1K0BA 2K8SA 2AUVA 3L9VA 4BL7A 5G1LA 2VIMA 2CZ3A 2X49A 2AAWA 1G0TA 4BL7B 4WF4A 4BVXB 3FZAA 3H79A 2CVDA 4ZILA 4K7IA 4PNGA 1QK8A 1PGTA 1O8XA 5IO2A 1AIUA 2A4VA 1SK0A 4WBRD 3FZ5A 5F8BA 4KGIA 3J7Yk 2J9HA 2DC5A 4QQ7A 2NPBA 3QOUA 4EF0A 1XVWA 2VL2C 4XS4B 5J41A 4NPBA 2FNOA 4XRDA 2JZTA 1QGVA 4NV2A 1KTEA 2WS2A 5COHA 3V1WA 3IC4A 1H4OA 2C0DA 1X5CA 2D2ZA 3HDCA 3KGKA 5FT3A 1NW2A 2PVQA 5A4WA 2QSIA 4WXTA 4EIQA 1HNCA 1BQ7A 4KNDA 2J23A 3QAGA 4AJ7A 2PN8A 3GH6A 1M0UA 3H1NA 3C73A 3OR5A 4V2NA 2I3YA 3FR9A 1DUGA 2IMIA 2YZHA 2C80A 1GUMA 1URMA 2VM2A 3ERWA 4GQCA 2VD1A 1TK0B 2HT9A 1M7TA 3VWXA 1X9MB 1THOA 3U5RE 1O6JA 4Q5RA 2VLVA 4GXZA 2H6YA 4HJMA 5EVOA 1QXHA 1ZMAA 2FWGA 2GVPA 2M80A 5AGYA 2OE3A 3FHKA 3A2XA 5DCHA 4MP4A 2R0CA 4MPFA 3IA1A 3TOTA 1GSSA 4PQ1A 1SJ6A 1YF0A 2X8GA 3CSHA 6GSXA 4YAVA 1KBNA 3F0IA 3O76A 1M2DA 4ID0A 2F3MA 5G5EA 1QMVA 2LTKA 3LJRA 4NAXA 2H1DA 3IK9A 2B6MA 1A8LA 5EY6A 2CV4A 5IO0A 3GKKA 13GSA 2RM6A 1PN0A 5ECHB 5HQPA 4BPYA 2R3XA 2WJUA 3HVVA 4GSTA 2GQKA 1G6WA 3PH9A 1GSDA 4O92A 5F06A 5CRWA 4Z2RA 2H8LA 5CRHA 1TDIA 3DIEA 1EP7A 1WIKA 2YV7A 2HXKA 6GSSA 4KDXA 5GZZB 4ZB6A 3GKNA 2XHFA 3APQA 3ME7A 2XC2A 1GSUA 3E3EA 3EMPA 5KN0A 2YOIA 4K0NA 4EVMA 5B6NA 1FOHA 1XW9A 2O87A 5FWGA 4WR4A 5IMAA 2IPAA 1OE7A 11GSA 4POKA 4NHWA 4XRAA 1SK2A 2LQOA 3TJFA 4GWRA 5EPFA 1HNAA 3ZVJD 4IHUA 1GTUA 1X0RA 3CRTA 5DQYA 3DWVA 4MCUA 3TJJA 5CP1A 2HSMA 3P8WA 1H75A 1XPVA 2IMEA 3HYPA 4DSSA 2NDOA 3F9UA 1FHEA 2H1BA 4KCEA 2ZUPA 5EL8A 1J08A 3KEBA 4DSSB 2E2GA 2JL4A 3VURA 2GLRA 1T1VA 2DJKA 5HR2A 4AJ8A 4KF9A 4FO5A 2FA4A 4G0KA 4KDYA 1TJDA 4PGTA 4ML1A 1EP8A 3F6FA 1UC7A 2DJ2A 1BX9A 4XHMA 3LG6A 4EDYA 3UBLA 2HZEA 3MIXA 3KP9A 1KEBA 4GSNA 2V41A 3FR6A 3EURA 3IDVA 2HZEB 4WBJA 4EIPA 4ULXA 2O8VB 1R5AA 1XW6A 2ALBA 2L59A 5CRDA 1WWJA 2GSRA 2VLUA 1ST9A 2EIQA 3WT1A 4TR4A 3UMAA 3TKSC 18GSA 1C72A 1EEMA 1VGLA 2H1GA 2X8CA 3HZ4A 5JWOB 1YEPA 3RPPA 4N0ZA 4RI6A 3BOAA 1U87A 3UVTA 5IOWA 1A24A 2VCVA 4MZCA 5DJMA 5H5QA 4EC0A 2R2JA 2DJJA 2N5BA 5DDLA 1RQMA 2K8VA 1ZYEA 1G7EA 4N0VA 4AJ6A 2L57A 3IRAA 4KUNA 3D6IA 5A4VA 3GSSA 4KX4A 4YQUA 5B6MA 4NHZA 1XFLA 3IV4A 2WULA 1GLPA 4XTSA 1R5PA 3PPUA 3LSZA 2ES7A 1A8YA 5CNWA 4QL9A 1OKTA 3UEMA 5ABRA 1OKDA 3IE3A 1Y25A 5IMDA 5H5RA 3FW2A 3TJKA 3CTFA 2WRTA 1TU8A 3QAWA 3UIWA 1FAAA 1EGRA 1XWGA 4I5QA 3KH9A 3GRXA 3KMOA 3LYKA 1I5GA 1IYHA 3D0ZA 3TB2A 3H93A 4L8EA 2VL2A 3VLNA 4WR5A 3GUSA 4L0UA 3C1SA 4HS1A 1SKWB 4K8MA 1B48A 4K6XA 4K5SA 2XBQA 4K7NA 2A2PA 3I9V2 3LW9A 4ZBDA 1PX7A 1ZYNA 1S3DA 3D5JA 16GSA 4AF2A 1IYIA 2YWMA 2M72A 3QR6A 2YWIA 5D73A 2HFDA 1F9MA 1USBA 1WRYA 2CZ2A 3MSZA 3EMXA 2PBJA 1E6BA 1JZDA 3GSTA 2QGVA 4EO3A 2K18A 1T00A 2CVKA 3KJYA 1ILOA 2GQMA 4BVYB 4JR4A 4EDZA 1HNBA 3CXGA 4PXOA 1X5DA 2KOKA 3WGXA 4L0WA 4L5LA 2EC4A 4MABA 3HZ8A 5LD0A 3D22A 2HSYA 2DKHA 3VK9A 3UVHA 5AISA 5AN1A 3A5WA 3A2VA 1O73A 3HA9A 4V1Ag 2AHEA 4TR3A 3L4NA 4G10A 4TXOA 2GT6A 1XWCA 1Z7PA 3ZFBA 5DAKA 4TXOB 2B5EA 1K0NA 2JACA 2G0FA 3IOSA 3IBHA 2DLXA 1V57A 2VCWA 1TI3A 4MF7A 5DALA 1A2LA 2MZCA 4EUYA 3GTUA 2FD3A 3FR3A 1Z3EA 3FMWA 3CMIA 3TKSE 3HVSA 3APSA 5DALB 4YKGA 4ZBAA 5G31A 4P3YB 3GTUB 4EL1A 5D96A 4H86A 3G9BA 2F8AA 2OACA 3ME8A 1RW1A 2CVBA 3E0UA 2VL3A 6GSYA 17GSA 4K9ZA 5B8BA 5AIXA 1YEXA 1K0CA 4G0IA 5B7CA 4I6XA 10GSA 4MNNA 4CY8A 1B4QA 5J9CA 4I97A 3CSIA 3Q6OA 2HRFA 4YH2A 2RM5A 2A4HA 1MDIA 1XIYA 3TRXA 4WKWA 3MYDA 4ZB9A 4CHSA 4OWYA 2VLTA 4IW9A 2C3TA 1T8EB 1EGOA 2BTOT 2R37A 3LXZA 2RLIA 2DMMA 3QCPA 1TRUA 1PQNA 3I43A 3DVWA 6GSTA 1EV9A 4TRXA 5CRGA 3NOFA 4GQFA 4HU7A 4ZL7A 1TRWA 2HSHA 1V58A 2HLSA 1K3LA 4JR6A 4IBPA 1ERWA 5H5SA 1S3CA 4POBA 4PX1A 1B4PA 5JCUA 1BEDA 3DYRA 4OCEA 1O7UA 1TU7A 3F4RA 1GP1A 1U3AA 1G7OA 1B9XC 1XBSA 1Z9HA 5ECLB 1A0RP 3H8QA 4OD7A 2B7JA 5DBQA 2C1YA 4KE3A 1SD9A 2OBKA 5JWQB 2ZCTA 1YJ6A 3J7Yb 1XWBA 4I8BA 1OC3A 1SL1B 4OO4A 2F51A 4K1FA 1F3AA 1T4YA 14GSA 2IL3A 2YPMA 1JFUA 1OAZA 2WDUA 2NTOA 3WYWA 3SWLA 4ML6A 3TKSA 4WF5A 2CAQA 1PL1A 4ECCA 2GZZA 2OA7A 1BJXA 4HI7A 2H71A 3IAM2 2LJKA 1ERUA 4FIWA 3TOUA 1YY7A 3ED3A 1A2MA 5LCZA 4OFTA 5J3RA 3EYTA 3KIJA 5JCGA 3QFBC 4MF6A 3R3EA 5BMUA 2FY6A 1R4WA 1YDKA 2ZNMA 3TJBA 3WGDA 2C4JA 3IHQA 2IMFA 4MPGA 3RHCA 4HUAA 4PUFC 22GSA 2H6XA 3EC3A 2H72A 1VF1A 1W4VA 4OO5A 3GN3A 2HNLA 3LORA 4OMVA 5ECQB 5DVBA 2FGXA 3Q74A 1OE8A 2HRKA 4TOPA 4FYUA 4IN0A 1ZGNA 3N9JA 2E2MA 3CBUA 3D4TA 4F0CA 3IPZA 3NIVA 1OVNA 1AC1A 1PD21 4MK3A 2JSYA 5A5KA 1QFNA 1J0FA 4MZBA 2YNXA 2I1UA 2C3QA 1OC9A 1X5EA 3KXOA 1FG4A 4O5RA 2B5YA 1R26A 1YQ1A 1OC9B 4FYBA 2RIIA 1R7HA 3ZZXA 1TK8B 1F6MC 3C71A 2PU9C 1GTIA 2P31A 4EKZA 3IC8A 4HQZA 4A5PA 2VAFA 1V2AA 4BA7A 5ECPB 3CRUA 4TKYA 1GH2A 2GQLA 3HJOA 1FB0A 4MDCA 1AUCA 3GNJA 2H66A 4GF0A 4QL7A 2F8FA 2EIRA 2WCIA 4IELA 4X0XA 2FA8A 2N5FA 5IIZA 4F82A 3QPMA 4NWYA 4MJAA 1K0AA 1ABAA 2GZYA 4K2XA 20GSA 5KN2A 3KD0A 2IMKA 4X4JA 1EOHA 3M3MA 3C8EA 2C8UA 1SYXA 4GCIA 1EZKA 4IP1A 2PUKC 3DXBA 1A0FA 4ACSA 2OE1A 2LQQA 1HQOA 1O8WA 1T7PB 1U3IA 4TXVA 3L9UA 8GSSA 3D21A 2VM1A 4I2TA 4NMUA 1LU4A 6GSWA 2VUPA 3IR4A 2B1LA 1DBYA 4G19A 4KSMA 5KN1A 3RDWA 1FVJA 1MEKA 3EWLA 2LJRA 1GSEA 3VWUA 3TUEA 5J9BA 1Z7RA 5J5NA 2C0FA 2HI7A 2LS5A 5D9WA 4X1UA 1ZCPA 5ECRB 1JHBA 1UN2A 3RHBA 5CO3A 3EPTA 1BAYA 3I69A 4POMA 1ZYQB 4HJ2A 4KCAA 1WPIA 3KTBA 1GTBA 1PSQA 3IXRA 4POLA 2TRCP 2IFQA 3ZFLA 3Q18A 3VI7A 1FB6A 1EOGA 1KNGA 3ZIVA 2IFQB 3UBKA 5GAPD 2AB6A 4I2UA 1RK4A 5CYYA 12GSA 2DBCA 3TGZA 3APOA 4IJIA 1TK5B 4KH7A 3FK8A 3W8JA 2H70A 1THXA 1XXUA 2H0IA 4Q5NA 4ECIA 1GUKA 1I9DA 2YV9A 2ON5A 1EWXA 5HFGA 5F05A 3KMNA 1JZRA 1U88A 4J2FA 1SL0B 3C7MA 3L0HA 4LMVA 2REMA 2FLSA 2G2QA 3UAPA 3UARA 5LNKe 1PRXA 5IOXA 1JZOA 4LL1B 5L71A 1VF2A 4MA9A 5DJLA 1B9YC 2WFCA 5IMZA 3G7IA 4J56E 3ZMLA 3MDKA 4ZL9A 4FYCA 4RI7A 4PTSA 1YKAA 4KB3A 3US3A 2OE0A 1GWCA 1MDKA 3WGEA 3TKPA 3LQ7A 3LGCA 4Z2UA 4HEA2 4KW6A 4ECJA 2OKAA 5IPGA 3VWWA 2Z9SA 4PURA 3QAVA 2VL9A 1A2JA 2PGTA 5IMVA 4IJ3A 3GKXA 1DE2A 4HOJA 3GURA 1SKSB 3W8SA 1TW9A 4O32A 1GUHA 4ZIJA 5J4UA 1VRSD 3GH9A 2L6DA 3BD2A 2LNSA 4IQ1A 1N2AA 3EU3A 2K6VA 6GSUA 5C00A 2AJQB 1PL2A 1T4ZA 2GT5A 1F2EA 2BMXA 2X4AA 2B3SA 3C1RA 2MMOA 19GSA 2EIOA 4RQXA 5IQYA 3F63A 3IK7A 1XOBA 2MBTA 2X64A 5HFKA 4F9ZA 1XWKA 2YJHA 4V2LA 2KP2A 4WEYA 4MJEA 2CX4A 4TW5A 1BYEA 2C0EA 2XPDA 3ZRDA 2FHEA 2R6KA 5D8IA 4WETA 1GULA 3KM6A 4CDOA 5DAKB 2PPTA 3P90A 2LRNA 1YF1A 3VWVA 2H73A 2GZPA 2O89A 3PINA 9GSSA 2LJAA 3RPNA 2R0PA 5JWRB 5FHIA 1ML6A 3LYPA 5G30A 3TRPA 1VF4A 1X9WB 4DSQA 2X8HA 2CAIA 4HQSA 4KDUA 2H1AA 3TKQA 4TR1A 1VF3A 3PR8A 4PQIA 1TRSA 2XBIA 4GRFA 2H19A 2WGRA 2YJ7A 2UZ8A 5DQSA 2RUFA 2A2SA 2QKEA 5CAXA 4L5OA 4YAPA 2YCDA 3KH7A 2LUSA 4PNFA 2K9FA 2P0GA 3GIXA 3BCKA 4BWQA 5HR1A 4IKHA 3NZNA 3K8NA 2OADA 1SJIA 1Z5YE 2DIZA 3ZTLA 3ERGA 3VPQA 4GLTA 3ZYWA 1S3AA 1WE0A 4BVXA 4G9HA 2O7KA 5ECKB 5IMFA 1JLVA 1W89A 2YZUA 1TRVA 4KSOA 1ZYPA 2LRCA 1FO5A 1V40A 3BBYA 3A5IA 2CX3A 5ENUA 2GTUA 2FWEA 2MMAA 4XS4A 1NM3A 4V2MA 1M99A 4XCSA 4IS0A 4PUAA 2GDRA 4V1Ap 2NBSA 4N30A 4EXJA 1GLQA 5GSTA 5IPHA 4USSA 3GX0A 3LWAA 5D9VA 2IIYA 4TVEA 3G7YA 5F0GA 4YQMA 2LRTA 2HE3A 1HD2A 1AXDA 2BJXA 5ELAA 2DKIA 1LJRA 3ZIJA 5KN3A 3M9KA 1B8XA 1XOAA 2L6CA 5B8AA 3HVXA 3VFIA 2H30A 2YN1A 3DD3A 3HHVA 2IN3A 3CTGA 1LBKA 3F3QA 5KEJA 4GTUA 1GL8A 2P5QA 5ELGA 2AV4A 3MWHA 2PWJA 3M0FA 3BJ5A 3H4KA 3U6VA 3FY7A 3FZ4A 4ZBBA 4K0GA 4YQVA 7GSSA 4ZB8A 1HYUA 1EV4A 3ERFA 2LEGA 1GRXA 3AY8A 2DJ0A 1Z6NA 4Z7XA 1MDJA 2VD0A 3ZL5A 3GA4A 3F4SA 3P2AA 1K0MA 1FW1A 3UL3A 1TXXA 2JZSA 4N11A 3DKSA 4EE0A 3EVIA 4HU9A 4RUVA 3KCMA 1UA5A 5HR0A 5GAND 4ZL8A 2TIRA 1K0OA 4OFNA 4OFMA 3QD9A 4TN8A 2MYGA 2I4AA 3GL5A 3LXTA 2LNTA 1XW5A 3TKRA 2H76A 3ISOA 1AQVA 3I6AA 2GSSA 2R0GA 3F6DA 2MMZA 2H75A 3KTLA 5E4WA 1SENA 4HDEA 2CA8A 3F8UA 2C0GA 4E8HA 1PN9A 1Q98A 2R5GA 5D93A 1AQXA 3VI5A 3DGQA 3M9JA 2IWTA 4HZ2A 3F3RA 3EE2A 3TDGA 3HXSA 1NHYA 1GNEA 4RQRA 1G6YA 4ECBA 5GSSA 1PKZA 1ZOFA 2B7KA 2QA2A 1MTCA 1PA3A 2FCHA 2GS3A 2L4QA 2WZ9A 5IMCA 4K5RA 3CSJA 1K0DA 1NSWA 1N8JA 4Q5FA 5ECNB 3FYGA 5ECMB 3HJPA 1SU9A 2FWHA 2H0GA 1FOVA 2CT6A 4FQUA 3S9FA 4NV5A 2PERA 1A23A 1GSQA 5ID2A 2HZFA 1SL2B 4MJCA 2WB9A 4Z2TA 3L78A 5ID2B 3W6GA 2X99A 2V2GA 2B5XA 3DEXA 3MAKA 4HZ4A 1TOFA 2V6OA 3GL3A 4JRRA 1M9BA 3WT2A 3IHGA 1WP0A 2VCZA 4AGSA 4BWSA 4E8EA 2OBIA 5ECSA 2QA1A 1ERVA 2IMDA 1MD3A 2O85A 3A2WA 2V6KA 3IAS2 3F4TA 2V32A 2F9SA 4TR0A 1K3OA 2QC7A 3LEFA 4IQAA 3TJGA 1CQHA 3O3TA 3FZ9A 1XZOA 4LLRA 1GNWA 4G0LA 4CY6A 4XS1A 1O85A 3RBTA 3R2QA 4LL4B 1BG5A 1GTAA 5KOXA 1ERTA 2H0HA 1NHOA 1PMTA 1AQWA 1QUWA 1E2YA 1MD4A 2YANA 1OYJA 1PKWA 2OJLA 3DRNA 1GSYA 5IM9A 4IP6A 5HFIA 2I81A 3ZVJA 3EU4A 2C3NA 3SBCA 1M2BA 2HRAA 2L5OA 5CREA 2N5AA 4F2IA 2KUCA 2R4VA 5G1KA 4O7HA 2H74A 4PQHA 4XS6A 1ZZYA 4XIHA 3HCZA 3QDNA 2AYTA 4MH2A 1M2AA 2VO4A 1WOUA 4IVFA 1U6TA 3WD6A 4MZWA 4KA0A 1XVQA 1SYRA 3GMFA 4MJBA 2KP1A 1PX6A 1UVZA 4DVCA 4D73A 3TCOA 2FWFA 5BRTA 2H01A 4ISDA 5HR3A 1FVKA 4ICYA 2GSTA 4D73B 4MH3A 4LA1A 3UJ1A 1TKDB 1SKRB 2MBSA 4LMWA 3QFAC 4F0BA 3FKFA 4O5QA 3ZLPA 2LSTA 3ZMKA 3G7JA 1TI1A 1YKCA 1XWAA 2DIYA 4JBBA 1AW9A 1SD8A 1EEJA 2P5RA 3LFLA 4K2DA 4KAEA 2DSAA 4DEJA 1Q4JA 2E0QA 1ZL9A 2M46A 2E7PA 5ECIB 2V1MA 4MLYA 4ILFA 1J9BA 5E59A 1V98A 5G2ZA 4YKFA 2B1KA 3FEUA 2DJ1A 1ON4A 1X9SB 5DCGA 2GSQA 2H6ZA 2PVOC 2YWNA 5KOWA 4FH8A 4N10A 5INYA 2VCTA 4GSSA 3QMXA 1GSFA 3DMLA 2TRXA 3M1GA 4JU5A 3KZQA 3GX8A 2I9HA 2YWOA 2LV3A 2A2RA 5A4UA 1TP9A 1TTZA 2RUEA 1JZWA 2KHPA 1DSBA 2NVLA 3E9JB 4K7OA 4DSRA 4G2EA 1WMJA 2IJYA 1O81A 3FRCA 1F37A 3GHAA 2HYXA 4BVYA 5C04A 2DJ3A 2CQ9A 3DVXA 2DMLA 4IGJA 3TRQA 1Z6MA 4MMMA 5D9TA 5JCWA 3HKRA 3GYKA 2ON7A 3HJMA 2XPEA 4X43A 5D9XA 3HD5A 1WJKA 2PMTA 1T3BA 2JU5A 3L9SA 3D4MA 4Q5QA 2VCQA 3BCIA 3VPTA 3CYNA 2HRNA 2L4CA 3O6TA 3HY2A 3PGTA 3ZREA 3M8NA 4JE1A 5AIVA 5G5FA 6GSVA 1ACVA 1M9AA 3UOMA 3P7XA 1OC8A 3JCML 1JLWA 3N5OA 4JEDA 4JZQA 2FUG2 3A3TA 1Y6EA 4F03A 3GFKA 2L5LA 5ECOB 2JSZA 3ZITA 2VCXA 1F3BA 3RAZA 1QQ2A 2KLXA 1AAZA 1SJZA 3MNGA 2JADA 3KP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SK1 A;  2GGT A;  1YZX A;  4TR1 B;  1CQG A;  3GV1 A;  4J57 E;  4NXI A;  3GKM A;  1V9W A;  4OCF A;  2YP6 A;  5F07 A;  3Q19 A;  2MMN A;  1XCC A;  4MF5 A;  1K3Y A;  4ZXG A;  2VOC A;  2JZR A;  1DE1 A;  3EIN A;  2LKU A;  4CW9 A;  1K0B A;  2K8S A;  2AUV A;  3L9V A;  4BL7 A;  5G1L A;  2VIM A;  2CZ3 A;  2AAW A;  1G0T A;  4WF4 A;  3FZA A;  3H79 A;  2CVD A;  4ZIL A;  4K7I A;  4PNG A;  1QK8 A;  1PGT A;  1O8X A;  5IO2 A;  1AIU A;  2A4V A;  1SK0 A;  4WBR D;  3FZ5 A;  5F8B A;  4KGI A;  3J7Y k;  2J9H A;  2DC5 A;  4QQ7 A;  2NPB A;  3QOU A;  4EF0 A;  1XVW A;  2VL2 C;  4XS4 B;  5J41 A;  4NPB A;  2FNO A;  4XRD A;  2JZT A;  1QGV A;  4NV2 A;  1KTE A;  2WS2 A;  5COH A;  3V1W A;  3IC4 A;  1H4O A;  2C0D A;  1X5C A;  2D2Z A;  3HDC A;  3KGK A;  5FT3 A;  1NW2 A;  2PVQ A;  5A4W A;  2QSI A;  4WXT A;  1HNC A;  1BQ7 A;  4KND A;  2J23 A;  3QAG A;  4AJ7 A;  2PN8 A;  3GH6 A;  1M0U A;  3H1N A;  3C73 A;  3OR5 A;  4V2N A;  2I3Y A;  3FR9 A;  1DUG A;  2IMI A;  2YZH A;  2C80 A;  1GUM A;  1URM A;  2VM2 A;  3ERW A;  4GQC A;  2VD1 A;  1TK0 B;  2HT9 A;  1M7T A;  3VWX A;  1X9M B;  1THO A;  3U5R E;  1O6J A;  4Q5R A;  2VLV A;  4GXZ A;  2H6Y A;  4HJM A;  5EVO A;  1QXH A;  1ZMA A;  2FWG A;  2GVP A;  2M80 A;  5AGY A;  2OE3 A;  3FHK A;  3A2X A;  5DCH A;  4MP4 A;  4MPF A;  3IA1 A;  3TOT A;  1GSS A;  4PQ1 A;  1SJ6 A;  1YF0 A;  2X8G A;  3CSH A;  6GSX A;  4YAV A;  1KBN A;  3F0I A;  3O76 A;  1M2D A;  4ID0 A;  2F3M A;  5G5E A;  1QMV A;  2LTK A;  3LJR A;  4NAX A;  2H1D A;  3IK9 A;  2B6M A;  1A8L A;  5EY6 A;  2CV4 A;  5IO0 A;  3GKK A;  13GS A;  2RM6 A;  5ECH B;  5HQP A;  4BPY A;  2R3X A;  2WJU A;  3HVV A;  4GST A;  2GQK A;  1G6W A;  3PH9 A;  1GSD A;  4O92 A;  5F06 A;  5CRW A;  2H8L A;  5CRH A;  1TDI A;  3DIE A;  1EP7 A;  1WIK A;  2YV7 A;  2HXK A;  6GSS A;  4KDX A;  5GZZ B;  4ZB6 A;  3GKN A;  2XHF A;  3APQ A;  3ME7 A;  2XC2 A;  1GSU A;  3E3E A;  3EMP A;  5KN0 A;  2YOI A;  4K0N A;  4EVM A;  5B6N A;  1XW9 A;  2O87 A;  5FWG A;  4WR4 A;  5IMA A;  2IPA A;  1OE7 A;  11GS A;  4POK A;  4NHW A;  4XRA A;  1SK2 A;  2LQO A;  3TJF A;  4GWR A;  5EPF A;  1HNA A;  3ZVJ D;  4IHU A;  1GTU A;  1X0R A;  3CRT A;  5DQY A;  3DWV A;  4MCU A;  3TJJ A;  5CP1 A;  3P8W A;  1H75 A;  1XPV A;  2IME A;  3HYP A;  4DSS A;  2NDO A;  3F9U A;  1FHE A;  2H1B A;  4KCE A;  2ZUP A;  5EL8 A;  1J08 A;  3KEB A;  4DSS B;  2E2G A;  2JL4 A;  3VUR A;  2GLR A;  1T1V A;  2DJK A;  5HR2 A;  4AJ8 A;  4FO5 A;  2FA4 A;  4KDY A;  1TJD A;  4PGT A;  4ML1 A;  1EP8 A;  3F6F A;  1UC7 A;  2DJ2 A;  1BX9 A;  4XHM A;  3LG6 A;  4EDY A;  3UBL A;  2HZE A;  3KP9 A;  1KEB A;  4GSN A;  2V41 A;  3FR6 A;  3EUR A;  3IDV A;  2HZE B;  4WBJ A;  4ULX A;  2O8V B;  1R5A A;  1XW6 A;  2ALB A;  2L59 A;  5CRD A;  1WWJ A;  2GSR A;  2VLU A;  1ST9 A;  2EIQ A;  3WT1 A;  4TR4 A;  3UMA A;  3TKS C;  18GS A;  1C72 A;  1EEM A;  1VGL A;  2H1G A;  2X8C A;  3HZ4 A;  5JWO B;  1YEP A;  3RPP A;  4N0Z A;  4RI6 A;  3BOA A;  1U87 A;  3UVT A;  5IOW A;  1A24 A;  2VCV A;  4MZC A;  5DJM A;  5H5Q A;  4EC0 A;  2R2J A;  2DJJ A;  2N5B A;  5DDL A;  1RQM A;  2K8V A;  1ZYE A;  1G7E A;  4N0V A;  4AJ6 A;  2L57 A;  3IRA A;  4KUN A;  3D6I A;  5A4V A;  3GSS A;  4KX4 A;  4YQU A;  5B6M A;  4NHZ A;  1XFL A;  3IV4 A;  2WUL A;  1GLP A;  4XTS A;  1R5P A;  3LSZ A;  2ES7 A;  1A8Y A;  5CNW A;  4QL9 A;  1OKT A;  3UEM A;  5ABR A;  1OKD A;  3IE3 A;  1Y25 A;  5IMD A;  5H5R A;  3FW2 A;  3TJK A;  3CTF A;  2WRT A;  1TU8 A;  3QAW A;  3UIW A;  1FAA A;  1EGR A;  1XWG A;  4I5Q A;  3KH9 A;  3GRX A;  3KMO A;  3LYK A;  1I5G A;  1IYH A;  3D0Z A;  3TB2 A;  3H93 A;  4L8E A;  2VL2 A;  3VLN A;  4WR5 A;  3GUS A;  4L0U A;  3C1S A;  4HS1 A;  1SKW B;  4K8M A;  1B48 A;  4K6X A;  2XBQ A;  4K7N A;  3I9V 2;  4ZBD A;  1PX7 A;  1S3D A;  3D5J A;  16GS A;  4AF2 A;  1IYI A;  2YWM A;  2M72 A;  3QR6 A;  2YWI A;  5D73 A;  2HFD A;  1F9M A;  1USB A;  1WRY A;  2CZ2 A;  3MSZ A;  3EMX A;  2PBJ A;  1E6B A;  1JZD A;  3GST A;  2QGV A;  4EO3 A;  2K18 A;  1T00 A;  2CVK A;  3KJY A;  1ILO A;  2GQM A;  4JR4 A;  4EDZ A;  1HNB A;  3CXG A;  4PXO A;  1X5D A;  2KOK A;  3WGX A;  4L0W A;  4L5L A;  2EC4 A;  4MAB A;  3HZ8 A;  5LD0 A;  3D22 A;  2HSY A;  3VK9 A;  3UVH A;  5AIS A;  5AN1 A;  3A5W A;  3A2V A;  1O73 A;  3HA9 A;  4V1A g;  2AHE A;  4TR3 A;  3L4N A;  4G10 A;  4TXO A;  2GT6 A;  1XWC A;  1Z7P A;  3ZFB A;  5DAK A;  4TXO B;  2B5E A;  1K0N A;  2JAC A;  2G0F A;  3IOS A;  3IBH A;  2DLX A;  1V57 A;  2VCW A;  1TI3 A;  4MF7 A;  5DAL A;  1A2L A;  2MZC A;  4EUY A;  3GTU A;  2FD3 A;  3FR3 A;  1Z3E A;  3CMI A;  3TKS E;  3HVS A;  3APS A;  5DAL B;  4ZBA A;  5G31 A;  4P3Y B;  3GTU B;  4EL1 A;  5D96 A;  4H86 A;  3G9B A;  2F8A A;  2OAC A;  3ME8 A;  1RW1 A;  2CVB A;  3E0U A;  2VL3 A;  6GSY A;  17GS A;  4K9Z A;  5B8B A;  5AIX A;  1YEX A;  1K0C A;  5B7C A;  4I6X A;  10GS A;  1B4Q A;  5J9C A;  4I97 A;  3CSI A;  3Q6O A;  2HRF A;  4YH2 A;  2RM5 A;  1MDI A;  1XIY A;  3TRX A;  4WKW A;  4ZB9 A;  4CHS A;  4OWY A;  2VLT A;  4IW9 A;  2C3T A;  1T8E B;  1EGO A;  2BTO T;  2R37 A;  3LXZ A;  2RLI A;  2DMM A;  3QCP A;  1TRU A;  1PQN A;  3I43 A;  3DVW A;  6GST A;  1EV9 A;  4TRX A;  5CRG A;  3NOF A;  4GQF A;  4HU7 A;  4ZL7 A;  1TRW A;  2HSH A;  1V58 A;  2HLS A;  1K3L A;  4JR6 A;  4IBP A;  1ERW A;  5H5S A;  1S3C A;  4POB A;  4PX1 A;  1B4P A;  5JCU A;  1BED A;  3DYR A;  4OCE A;  1O7U A;  1TU7 A;  3F4R A;  1GP1 A;  1U3A A;  1G7O A;  1B9X C;  1XBS A;  1Z9H A;  5ECL B;  1A0R P;  3H8Q A;  4OD7 A;  2B7J A;  5DBQ A;  2C1Y A;  4KE3 A;  1SD9 A;  2OBK A;  5JWQ B;  2ZCT A;  1YJ6 A;  3J7Y b;  1XWB A;  4I8B A;  1OC3 A;  1SL1 B;  4OO4 A;  2F51 A;  4K1F A;  1F3A A;  1T4Y A;  14GS A;  2IL3 A;  2YPM A;  1JFU A;  1OAZ A;  2WDU A;  2NTO A;  3WYW A;  3SWL A;  4ML6 A;  3TKS A;  4WF5 A;  2CAQ A;  1PL1 A;  4ECC A;  2GZZ A;  2OA7 A;  1BJX A;  4HI7 A;  2H71 A;  3IAM 2;  2LJK A;  1ERU A;  4FIW A;  3TOU A;  1YY7 A;  3ED3 A;  1A2M A;  5LCZ A;  4OFT A;  5J3R A;  3EYT A;  3KIJ A;  5JCG A;  3QFB C;  4MF6 A;  2FY6 A;  1R4W A;  1YDK A;  2ZNM A;  3TJB A;  3WGD A;  2C4J A;  3IHQ A;  2IMF A;  4MPG A;  3RHC A;  4HUA A;  4PUF C;  22GS A;  2H6X A;  3EC3 A;  2H72 A;  1VF1 A;  1W4V A;  4OO5 A;  3GN3 A;  2HNL A;  3LOR A;  4OMV A;  5ECQ B;  5DVB A;  2FGX A;  3Q74 A;  1OE8 A;  4TOP A;  4FYU A;  4IN0 A;  1ZGN A;  3N9J A;  2E2M A;  3CBU A;  3D4T A;  4F0C A;  3IPZ A;  3NIV A;  1OVN A;  1AC1 A;  1PD2 1;  4MK3 A;  2JSY A;  5A5K A;  1QFN A;  1J0F A;  4MZB A;  2YNX A;  2I1U A;  2C3Q A;  1OC9 A;  1X5E A;  3KXO A;  1FG4 A;  4O5R A;  2B5Y A;  1R26 A;  1YQ1 A;  1OC9 B;  4FYB A;  2RII A;  1R7H A;  3ZZX A;  1TK8 B;  1F6M C;  3C71 A;  2PU9 C;  1GTI A;  2P31 A;  4EKZ A;  4HQZ A;  2VAF A;  1V2A A;  4BA7 A;  5ECP B;  3CRU A;  4TKY A;  1GH2 A;  2GQL A;  3HJO A;  1FB0 A;  4MDC A;  1AUC A;  3GNJ A;  2H66 A;  4GF0 A;  4QL7 A;  2F8F A;  2EIR A;  2WCI A;  4IEL A;  4X0X A;  2FA8 A;  2N5F A;  5IIZ A;  4F82 A;  3QPM A;  4NWY A;  4MJA A;  1K0A A;  1ABA A;  2GZY A;  20GS A;  5KN2 A;  3KD0 A;  2IMK A;  1EOH A;  3M3M A;  3C8E A;  2C8U A;  1SYX A;  4GCI A;  1EZK A;  4IP1 A;  2PUK C;  3DXB A;  1A0F A;  4ACS A;  2OE1 A;  2LQQ A;  1HQO A;  1O8W A;  1T7P B;  1U3I A;  4TXV A;  3L9U A;  8GSS A;  3D21 A;  2VM1 A;  4I2T A;  4NMU A;  1LU4 A;  6GSW A;  2VUP A;  3IR4 A;  2B1L A;  1DBY A;  4G19 A;  4KSM A;  5KN1 A;  3RDW A;  1FVJ A;  1MEK A;  3EWL A;  2LJR A;  1GSE A;  3VWU A;  3TUE A;  5J9B A;  1Z7R A;  5J5N A;  2C0F A;  2HI7 A;  2LS5 A;  5D9W A;  4X1U A;  1ZCP A;  5ECR B;  1JHB A;  1UN2 A;  3RHB A;  5CO3 A;  1BAY A;  3I69 A;  4POM A;  1ZYQ B;  4HJ2 A;  4KCA A;  1WPI A;  3KTB A;  1GTB A;  1PSQ A;  3IXR A;  4POL A;  2TRC P;  2IFQ A;  3ZFL A;  3Q18 A;  3VI7 A;  1FB6 A;  1EOG A;  1KNG A;  3ZIV A;  2IFQ B;  3UBK A;  5GAP D;  2AB6 A;  4I2U A;  1RK4 A;  5CYY A;  12GS A;  2DBC A;  3TGZ A;  3APO A;  4IJI A;  1TK5 B;  4KH7 A;  3FK8 A;  3W8J A;  2H70 A;  1THX A;  1XXU A;  2H0I A;  4Q5N A;  4ECI A;  1GUK A;  1I9D A;  2YV9 A;  2ON5 A;  1EWX A;  5HFG A;  5F05 A;  3KMN A;  1JZR A;  1U88 A;  4J2F A;  1SL0 B;  3C7M A;  3L0H A;  4LMV A;  2REM A;  2FLS A;  2G2Q A;  3UAP A;  3UAR A;  5LNK e;  1PRX A;  5IOX A;  1JZO A;  4LL1 B;  5L71 A;  1VF2 A;  4MA9 A;  5DJL A;  1B9Y C;  2WFC A;  5IMZ A;  3G7I A;  4J56 E;  3ZML A;  3MDK A;  4ZL9 A;  4FYC A;  4RI7 A;  1YKA A;  4KB3 A;  3US3 A;  2OE0 A;  1GWC A;  1MDK A;  3WGE A;  3TKP A;  3LQ7 A;  3LGC A;  4HEA 2;  4KW6 A;  4ECJ A;  2OKA A;  5IPG A;  3VWW A;  2Z9S A;  4PUR A;  3QAV A;  2VL9 A;  1A2J A;  2PGT A;  5IMV A;  4IJ3 A;  3GKX A;  1DE2 A;  4HOJ A;  3GUR A;  1SKS B;  3W8S A;  1TW9 A;  4O32 A;  1GUH A;  4ZIJ A;  5J4U A;  1VRS D;  3GH9 A;  2L6D A;  3BD2 A;  2LNS A;  4IQ1 A;  1N2A A;  3EU3 A;  2K6V A;  6GSU A;  5C00 A;  2AJQ B;  1PL2 A;  1T4Z A;  2GT5 A;  1F2E A;  2BMX A;  2B3S A;  3C1R A;  2MMO A;  19GS A;  2EIO A;  4RQX A;  5IQY A;  3F63 A;  3IK7 A;  1XOB A;  2MBT A;  2X64 A;  5HFK A;  4F9Z A;  1XWK A;  2YJH A;  4V2L A;  2KP2 A;  4WEY A;  4MJE A;  2CX4 A;  4TW5 A;  1BYE A;  2C0E A;  2XPD A;  3ZRD A;  2FHE A;  2R6K A;  5D8I A;  4WET A;  1GUL A;  3KM6 A;  4CDO A;  5DAK B;  2PPT A;  3P90 A;  2LRN A;  1YF1 A;  3VWV A;  2H73 A;  2GZP A;  2O89 A;  3PIN A;  9GSS A;  2LJA A;  3RPN A;  5JWR B;  5FHI A;  1ML6 A;  3LYP A;  5G30 A;  3TRP A;  1VF4 A;  1X9W B;  4DSQ A;  2X8H A;  2CAI A;  4HQS A;  4KDU A;  2H1A A;  3TKQ A;  4TR1 A;  1VF3 A;  3PR8 A;  4PQI A;  1TRS A;  2XBI A;  4GRF A;  2H19 A;  2WGR A;  2YJ7 A;  5DQS A;  2RUF A;  2A2S A;  2QKE A;  5CAX A;  4L5O A;  4YAP A;  2YCD A;  3KH7 A;  2LUS A;  4PNF A;  2K9F A;  2P0G A;  3GIX A;  3BCK A;  4BWQ A;  5HR1 A;  4IKH A;  3NZN A;  3K8N A;  2OAD A;  1SJI A;  1Z5Y E;  2DIZ A;  3ZTL A;  3ERG A;  3VPQ A;  4GLT A;  3ZYW A;  1S3A A;  1WE0 A;  4BVX A;  4G9H A;  2O7K A;  5ECK B;  5IMF A;  1JLV A;  1W89 A;  2YZU A;  1TRV A;  4KSO A;  2LRC A;  1FO5 A;  1V40 A;  3BBY A;  2CX3 A;  5ENU A;  2GTU A;  2FWE A;  2MMA A;  4XS4 A;  1NM3 A;  4V2M A;  1M99 A;  4XCS A;  4IS0 A;  4PUA A;  2GDR A;  4V1A p;  2NBS A;  4N30 A;  4EXJ A;  1GLQ A;  5GST A;  5IPH A;  3GX0 A;  3LWA A;  5D9V A;  2IIY A;  4TVE A;  3G7Y A;  5F0G A;  4YQM A;  2LRT A;  2HE3 A;  1HD2 A;  1AXD A;  2BJX A;  5ELA A;  1LJR A;  3ZIJ A;  5KN3 A;  3M9K A;  1B8X A;  1XOA A;  2L6C A;  5B8A A;  3HVX A;  3VFI A;  2H30 A;  2YN1 A;  3DD3 A;  3HHV A;  2IN3 A;  3CTG A;  1LBK A;  3F3Q A;  5KEJ A;  4GTU A;  1GL8 A;  2P5Q A;  5ELG A;  2AV4 A;  3MWH A;  2PWJ A;  3M0F A;  3BJ5 A;  3H4K A;  3U6V A;  3FY7 A;  3FZ4 A;  4ZBB A;  4K0G A;  4YQV A;  7GSS A;  4ZB8 A;  1HYU A;  1EV4 A;  3ERF A;  2LEG A;  1GRX A;  3AY8 A;  2DJ0 A;  1Z6N A;  4Z7X A;  1MDJ A;  2VD0 A;  3ZL5 A;  3GA4 A;  3F4S A;  3P2A A;  1K0M A;  1FW1 A;  3UL3 A;  1TXX A;  2JZS A;  4N11 A;  3DKS A;  4EE0 A;  3EVI A;  4HU9 A;  4RUV A;  3KCM A;  1UA5 A;  5HR0 A;  5GAN D;  4ZL8 A;  2TIR A;  1K0O A;  4OFN A;  4OFM A;  3QD9 A;  4TN8 A;  2MYG A;  2I4A A;  3GL5 A;  3LXT A;  2LNT A;  1XW5 A;  3TKR A;  2H76 A;  3ISO A;  1AQV A;  3I6A A;  2GSS A;  3F6D A;  2MMZ A;  2H75 A;  3KTL A;  5E4W A;  1SEN A;  4HDE A;  2CA8 A;  3F8U A;  2C0G A;  4E8H A;  1PN9 A;  1Q98 A;  2R5G A;  5D93 A;  1AQX A;  3VI5 A;  3DGQ A;  3M9J A;  2IWT A;  4HZ2 A;  3F3R A;  3EE2 A;  3TDG A;  3HXS A;  1NHY A;  1GNE A;  4RQR A;  1G6Y A;  4ECB A;  5GSS A;  1PKZ A;  1ZOF A;  2B7K A;  1MTC A;  1PA3 A;  2FCH A;  2GS3 A;  2L4Q A;  2WZ9 A;  5IMC A;  3CSJ A;  1K0D A;  1NSW A;  1N8J A;  4Q5F A;  5ECN B;  3FYG A;  5ECM B;  3HJP A;  1SU9 A;  2FWH A;  2H0G A;  1FOV A;  2CT6 A;  3S9F A;  4NV5 A;  2PER A;  1A23 A;  1GSQ A;  5ID2 A;  2HZF A;  1SL2 B;  4MJC A;  2WB9 A;  3L78 A;  5ID2 B;  3W6G A;  2X99 A;  2V2G A;  2B5X A;  3DEX A;  3MAK A;  4HZ4 A;  1TOF A;  2V6O A;  3GL3 A;  4JRR A;  1M9B A;  3WT2 A;  1WP0 A;  2VCZ A;  4AGS A;  4BWS A;  4E8E A;  2OBI A;  5ECS A;  1ERV A;  2IMD A;  1MD3 A;  2O85 A;  3A2W A;  2V6K A;  3IAS 2;  3F4T A;  2V32 A;  2F9S A;  4TR0 A;  1K3O A;  2QC7 A;  3LEF A;  4IQA A;  3TJG A;  1CQH A;  3O3T A;  3FZ9 A;  1XZO A;  4LLR A;  1GNW A;  4XS1 A;  1O85 A;  3RBT A;  3R2Q A;  4LL4 B;  1BG5 A;  1GTA A;  1ERT A;  2H0H A;  1NHO A;  1PMT A;  1AQW A;  1QUW A;  1E2Y A;  1MD4 A;  2YAN A;  1OYJ A;  1PKW A;  2OJL A;  3DRN A;  1GSY A;  5IM9 A;  4IP6 A;  5HFI A;  2I81 A;  3ZVJ A;  3EU4 A;  2C3N A;  3SBC A;  1M2B A;  2L5O A;  5CRE A;  2N5A A;  4F2I A;  2KUC A;  2R4V A;  5G1K A;  4O7H A;  2H74 A;  4PQH A;  4XS6 A;  1ZZY A;  4XIH A;  3HCZ A;  3QDN A;  2AYT A;  4MH2 A;  1M2A A;  2VO4 A;  1WOU A;  4IVF A;  1U6T A;  3WD6 A;  4MZW A;  4KA0 A;  1XVQ A;  1SYR A;  3GMF A;  4MJB A;  2KP1 A;  1PX6 A;  1UVZ A;  4DVC A;  4D73 A;  3TCO A;  2FWF A;  2H01 A;  4ISD A;  5HR3 A;  1FVK A;  2GST A;  4D73 B;  4MH3 A;  4LA1 A;  3UJ1 A;  1TKD B;  1SKR B;  2MBS A;  4LMW A;  3QFA C;  4F0B A;  3FKF A;  3ZLP A;  2LST A;  3ZMK A;  3G7J A;  1TI1 A;  1YKC A;  1XWA A;  2DIY A;  4JBB A;  1AW9 A;  1SD8 A;  1EEJ A;  2P5R A;  3LFL A;  4K2D A;  4KAE A;  2DSA A;  4DEJ A;  1Q4J A;  2E0Q A;  1ZL9 A;  2M46 A;  2E7P A;  5ECI B;  2V1M A;  4MLY A;  4ILF A;  1J9B A;  5E59 A;  1V98 A;  5G2Z A;  2B1K A;  3FEU A;  2DJ1 A;  1ON4 A;  1X9S B;  5DCG A;  2GSQ A;  2H6Z A;  2PVO C;  2YWN A;  4FH8 A;  4N10 A;  5INY A;  2VCT A;  4GSS A;  3QMX A;  1GSF A;  3DML A;  2TRX A;  3M1G A;  4JU5 A;  3KZQ A;  3GX8 A;  2I9H A;  2YWO A;  2LV3 A;  2A2R A;  5A4U A;  1TP9 A;  1TTZ A;  2RUE A;  1JZW A;  2KHP A;  1DSB A;  2NVL A;  3E9J B;  4K7O A;  4DSR A;  4G2E A;  1WMJ A;  2IJY A;  1O81 A;  3FRC A;  1F37 A;  3GHA A;  2HYX A;  4BVY A;  5C04 A;  2DJ3 A;  2CQ9 A;  3DVX A;  2DML A;  4IGJ A;  3TRQ A;  1Z6M A;  4MMM A;  5D9T A;  5JCW A;  3HKR A;  3GYK A;  2ON7 A;  3HJM A;  2XPE A;  4X43 A;  5D9X A;  3HD5 A;  1WJK A;  2PMT A;  1T3B A;  2JU5 A;  3L9S A;  3D4M A;  4Q5Q A;  2VCQ A;  3BCI A;  3VPT A;  3CYN A;  2HRN A;  2L4C A;  3O6T A;  3HY2 A;  3PGT A;  3ZRE A;  3M8N A;  4JE1 A;  5AIV A;  5G5F A;  6GSV A;  1ACV A;  1M9A A;  3UOM A;  3P7X A;  1OC8 A;  3JCM L;  1JLW A;  3N5O A;  4JED A;  4JZQ A;  2FUG 2;  3A3T A;  1Y6E A;  4F03 A;  3GFK A;  2L5L A;  5ECO B;  2JSZ A;  3ZIT A;  2VCX A;  1F3B A;  3RAZ A;  1QQ2 A;  2KLX A;  1AAZ A;  1SJZ A;  3MNG A;  2JAD A;  3KP8 A; 
#chains in the Genus database with same CATH topology
 1SK1 A;  2GGT A;  1YZX A;  4TR1 B;  1CQG A;  3GV1 A;  4J57 E;  4NXI A;  3GKM A;  1V9W A;  4OCF A;  2YP6 A;  5F07 A;  3Q19 A;  2MMN A;  1XCC A;  4MF5 A;  1K3Y A;  4ZXG A;  2VOC A;  2JZR A;  1DE1 A;  3EIN A;  4O5U A;  2LKU A;  4CW9 A;  1K0B A;  2K8S A;  2AUV A;  3L9V A;  4BL7 A;  5G1L A;  2VIM A;  2CZ3 A;  2X49 A;  2AAW A;  1G0T A;  4BL7 B;  4WF4 A;  4BVX B;  3FZA A;  3H79 A;  2CVD A;  4ZIL A;  4K7I A;  4PNG A;  1QK8 A;  1PGT A;  1O8X A;  1XG8 A;  5IO2 A;  1AIU A;  2A4V A;  1SK0 A;  4WBR D;  3FZ5 A;  5F8B A;  4KGI A;  3J7Y k;  2J9H A;  2DC5 A;  4QQ7 A;  2NPB A;  3QOU A;  4EF0 A;  1XVW A;  2VL2 C;  4XS4 B;  5J41 A;  4NPB A;  2FNO A;  4XRD A;  2JZT A;  1QGV A;  4NV2 A;  1KTE A;  2WS2 A;  5COH A;  3V1W A;  3IC4 A;  1H4O A;  2C0D A;  1X5C A;  2D2Z A;  3HDC A;  3KGK A;  5FT3 A;  1NW2 A;  2PVQ A;  5A4W A;  2QSI A;  4WXT A;  4EIQ A;  1HNC A;  1BQ7 A;  4KND A;  2J23 A;  3QAG A;  4AJ7 A;  2PN8 A;  3GH6 A;  1M0U A;  3H1N A;  3C73 A;  3OR5 A;  4V2N A;  2I3Y A;  3FR9 A;  1DUG A;  2IMI A;  2YZH A;  2C80 A;  1GUM A;  1URM A;  2VM2 A;  3ERW A;  4GQC A;  2VD1 A;  1TK0 B;  2HT9 A;  1M7T A;  3VWX A;  1X9M B;  1THO A;  3U5R E;  1O6J A;  4Q5R A;  1M3J A;  2VLV A;  4GXZ A;  2H6Y A;  4HJM A;  5EVO A;  1QXH A;  1ZMA A;  2FWG A;  2GVP A;  2M80 A;  5AGY A;  2OE3 A;  3FHK A;  3A2X A;  5DCH A;  4MP4 A;  2R0C A;  4MPF A;  3IA1 A;  3TOT A;  1GSS A;  4PQ1 A;  1SJ6 A;  1YF0 A;  2X8G A;  3CSH A;  6GSX A;  4YAV A;  1KBN A;  3F0I A;  3O76 A;  1M2D A;  4ID0 A;  2F3M A;  5G5E A;  1QMV A;  2LTK A;  3LJR A;  4NAX A;  2H1D A;  3CQF A;  3IK9 A;  2B6M A;  1A8L A;  5EY6 A;  2CV4 A;  5IO0 A;  3GKK A;  13GS A;  2RM6 A;  1PN0 A;  5ECH B;  4HSC X;  5HQP A;  4BPY A;  2R3X A;  2WJU A;  3HVV A;  4GST A;  2GQK A;  1G6W A;  3PH9 A;  1GSD A;  4O92 A;  5F06 A;  5CRW A;  4Z2R A;  2H8L A;  5CRH A;  1TDI A;  3DIE A;  1EP7 A;  1WIK A;  2YV7 A;  2HXK A;  6GSS A;  4KDX A;  5GZZ B;  4ZB6 A;  3GKN A;  2XHF A;  3APQ A;  3ME7 A;  2XC2 A;  1GSU A;  3E3E A;  3EMP A;  5KN0 A;  2YOI A;  4K0N A;  4EVM A;  5B6N A;  1FOH A;  1XW9 A;  2O87 A;  5FWG A;  4WR4 A;  5IMA A;  2IPA A;  1OE7 A;  11GS A;  4POK A;  4NHW A;  4XRA A;  1SK2 A;  2LQO A;  3TJF A;  4GWR A;  5EPF A;  1HNA A;  3ZVJ D;  4IHU A;  1GTU A;  1X0R A;  3CRT A;  5DQY A;  3DWV A;  4MCU A;  3TJJ A;  5CP1 A;  2HSM A;  3P8W A;  1H75 A;  1XPV A;  2IME A;  3HYP A;  4DSS A;  2NDO A;  3F9U A;  1FHE A;  2H1B A;  4KCE A;  2ZUP A;  5EL8 A;  1J08 A;  3KEB A;  4DSS B;  2E2G A;  2JL4 A;  3VUR A;  2GLR A;  1T1V A;  2DJK A;  5HR2 A;  4AJ8 A;  4KF9 A;  4FO5 A;  2FA4 A;  4G0K A;  4KDY A;  1TJD A;  4PGT A;  4ML1 A;  1EP8 A;  3F6F A;  1UC7 A;  2DJ2 A;  1BX9 A;  4XHM A;  3LG6 A;  4EDY A;  3UBL A;  2HZE A;  3MIX A;  3KP9 A;  1KEB A;  4GSN A;  2V41 A;  3FR6 A;  3EUR A;  3IDV A;  2HZE B;  4WBJ A;  4EIP A;  4ULX A;  2O8V B;  1R5A A;  1XW6 A;  2ALB A;  2L59 A;  5CRD A;  1WWJ A;  2GSR A;  2VLU A;  1ST9 A;  2EIQ A;  3WT1 A;  4TR4 A;  3UMA A;  3TKS C;  18GS A;  1C72 A;  1EEM A;  1VGL A;  2H1G A;  1M3I A;  2X8C A;  3HZ4 A;  5JWO B;  1YEP A;  3RPP A;  4N0Z A;  4RI6 A;  3BOA A;  1U87 A;  3UVT A;  5IOW A;  1A24 A;  2VCV A;  4MZC A;  5DJM A;  5H5Q A;  4EC0 A;  2R2J A;  2DJJ A;  2N5B A;  5DDL A;  1RQM A;  2K8V A;  1ZYE A;  1G7E A;  4N0V A;  4AJ6 A;  2L57 A;  3IRA A;  4KUN A;  3D6I A;  5A4V A;  3GSS A;  4KX4 A;  4YQU A;  5B6M A;  4NHZ A;  1XFL A;  3IV4 A;  2WUL A;  1GLP A;  4XTS A;  1R5P A;  3PPU A;  3LSZ A;  2ES7 A;  1A8Y A;  5CNW A;  4QL9 A;  1OKT A;  3UEM A;  5ABR A;  1OKD A;  3IE3 A;  1Y25 A;  5IMD A;  5H5R A;  3FW2 A;  3TJK A;  3CTF A;  2WRT A;  1TU8 A;  3QAW A;  3UIW A;  1FAA A;  1EGR A;  1XWG A;  4I5Q A;  3KH9 A;  3GRX A;  3KMO A;  3LYK A;  1I5G A;  1IYH A;  3D0Z A;  3TB2 A;  3H93 A;  4L8E A;  2VL2 A;  3VLN A;  4WR5 A;  3GUS A;  4L0U A;  3C1S A;  4HS1 A;  1SKW B;  4K8M A;  1B48 A;  4K6X A;  4K5S A;  2XBQ A;  4K7N A;  2A2P A;  3I9V 2;  3LW9 A;  4ZBD A;  1PX7 A;  1ZYN A;  1S3D A;  3D5J A;  16GS A;  4AF2 A;  1IYI A;  2YWM A;  2M72 A;  3QR6 A;  2YWI A;  5D73 A;  2HFD A;  1F9M A;  1USB A;  1WRY A;  2CZ2 A;  3MSZ A;  3EMX A;  2PBJ A;  1E6B A;  1JZD A;  3GST A;  2QGV A;  4EO3 A;  2K18 A;  1T00 A;  2CVK A;  3KJY A;  1ILO A;  2GQM A;  4BVY B;  4JR4 A;  4EDZ A;  1HNB A;  3CXG A;  4PXO A;  1X5D A;  2KOK A;  3WGX A;  4L0W A;  4L5L A;  2EC4 A;  4MAB A;  3HZ8 A;  5LD0 A;  3D22 A;  2HSY A;  2DKH A;  3VK9 A;  3UVH A;  5AIS A;  5AN1 A;  3A5W A;  3A2V A;  1O73 A;  3HA9 A;  4V1A g;  2AHE A;  4TR3 A;  3L4N A;  4G10 A;  4TXO A;  2GT6 A;  1XWC A;  1Z7P A;  3ZFB A;  5DAK A;  4TXO B;  2B5E A;  1K0N A;  2JAC A;  2G0F A;  3IOS A;  3IBH A;  2DLX A;  1V57 A;  2VCW A;  1TI3 A;  4MF7 A;  5DAL A;  1A2L A;  2MZC A;  4EUY A;  3GTU A;  2FD3 A;  3FR3 A;  1Z3E A;  3FMW A;  3CMI A;  3TKS E;  3HVS A;  3APS A;  5DAL B;  4YKG A;  4ZBA A;  5G31 A;  4P3Y B;  3GTU B;  4EL1 A;  5D96 A;  4H86 A;  3G9B A;  2F8A A;  2OAC A;  3ME8 A;  1RW1 A;  2CVB A;  3E0U A;  2VL3 A;  6GSY A;  17GS A;  4K9Z A;  5B8B A;  5AIX A;  1YEX A;  1K0C A;  4G0I A;  5B7C A;  4I6X A;  10GS A;  4MNN A;  4CY8 A;  1B4Q A;  5J9C A;  4I97 A;  3CSI A;  3Q6O A;  2HRF A;  4YH2 A;  2RM5 A;  2A4H A;  1MDI A;  1XIY A;  3TRX A;  4WKW A;  3MYD A;  4ZB9 A;  4CHS A;  4OWY A;  2VLT A;  4IW9 A;  2C3T A;  1T8E B;  1EGO A;  2BTO T;  2R37 A;  3LXZ A;  2RLI A;  2DMM A;  3QCP A;  1TRU A;  1PQN A;  3I43 A;  3DVW A;  6GST A;  1EV9 A;  4TRX A;  5CRG A;  3NOF A;  4GQF A;  4HU7 A;  4ZL7 A;  1TRW A;  2HSH A;  1V58 A;  2HLS A;  1K3L A;  4JR6 A;  4IBP A;  1ERW A;  5H5S A;  1S3C A;  4POB A;  4PX1 A;  1B4P A;  5JCU A;  1BED A;  3DYR A;  4OCE A;  1O7U A;  1TU7 A;  3F4R A;  1GP1 A;  1U3A A;  1G7O A;  1B9X C;  1XBS A;  1Z9H A;  5ECL B;  1A0R P;  3H8Q A;  4OD7 A;  2B7J A;  5DBQ A;  2C1Y A;  4KE3 A;  1SD9 A;  2OBK A;  5JWQ B;  2ZCT A;  1YJ6 A;  3J7Y b;  1XWB A;  4I8B A;  1OC3 A;  1SL1 B;  4OO4 A;  2F51 A;  4K1F A;  1F3A A;  1T4Y A;  14GS A;  2IL3 A;  2YPM A;  1JFU A;  1OAZ A;  2WDU A;  2NTO A;  3WYW A;  3SWL A;  4ML6 A;  3TKS A;  4WF5 A;  2CAQ A;  1PL1 A;  4ECC A;  2GZZ A;  2OA7 A;  1BJX A;  4HI7 A;  2H71 A;  3IAM 2;  2LJK A;  1ERU A;  4FIW A;  3TOU A;  1YY7 A;  3ED3 A;  1A2M A;  5LCZ A;  4OFT A;  5J3R A;  3EYT A;  3KIJ A;  5JCG A;  3QFB C;  4MF6 A;  3R3E A;  5BMU A;  2FY6 A;  1R4W A;  1YDK A;  2ZNM A;  3TJB A;  3WGD A;  2C4J A;  3IHQ A;  2IMF A;  4MPG A;  3RHC A;  4HUA A;  4PUF C;  22GS A;  2H6X A;  3EC3 A;  2H72 A;  1VF1 A;  1W4V A;  4OO5 A;  3GN3 A;  2HNL A;  3LOR A;  4OMV A;  5ECQ B;  5DVB A;  2FGX A;  3Q74 A;  1OE8 A;  2HRK A;  4TOP A;  4FYU A;  4IN0 A;  1ZGN A;  3N9J A;  2E2M A;  3CBU A;  3D4T A;  4F0C A;  3IPZ A;  3NIV A;  1OVN A;  1AC1 A;  1PD2 1;  4MK3 A;  2JSY A;  5A5K A;  1QFN A;  1J0F A;  4MZB A;  2YNX A;  2I1U A;  2C3Q A;  1OC9 A;  1X5E A;  3KXO A;  1FG4 A;  4O5R A;  2B5Y A;  1R26 A;  1YQ1 A;  1OC9 B;  4FYB A;  2RII A;  1R7H A;  3ZZX A;  1TK8 B;  1F6M C;  3C71 A;  2PU9 C;  1GTI A;  2P31 A;  4EKZ A;  3IC8 A;  4HQZ A;  4A5P A;  2VAF A;  1V2A A;  4BA7 A;  4BIK A;  5ECP B;  3CRU A;  4TKY A;  1GH2 A;  2GQL A;  3HJO A;  1FB0 A;  4MDC A;  1AUC A;  3GNJ A;  2H66 A;  4GF0 A;  4QL7 A;  2F8F A;  2EIR A;  2WCI A;  4IEL A;  4X0X A;  2FA8 A;  2N5F A;  5IIZ A;  4F82 A;  3QPM A;  4NWY A;  4MJA A;  1K0A A;  1ABA A;  2GZY A;  4K2X A;  20GS A;  5KN2 A;  3KD0 A;  2IMK A;  4X4J A;  1EOH A;  3M3M A;  3C8E A;  2C8U A;  1SYX A;  4GCI A;  1EZK A;  4IP1 A;  2PUK C;  3DXB A;  1A0F A;  4ACS A;  2OE1 A;  2LQQ A;  1HQO A;  1O8W A;  1T7P B;  1U3I A;  4TXV A;  1S3R A;  3L9U A;  8GSS A;  3D21 A;  2VM1 A;  4I2T A;  4NMU A;  1LU4 A;  6GSW A;  2VUP A;  3IR4 A;  2B1L A;  1DBY A;  4G19 A;  4KSM A;  5KN1 A;  3RDW A;  1FVJ A;  1MEK A;  3EWL A;  2LJR A;  1GSE A;  3VWU A;  3TUE A;  5J9B A;  1Z7R A;  5J5N A;  2C0F A;  2HI7 A;  2LS5 A;  5D9W A;  4X1U A;  1ZCP A;  5ECR B;  1JHB A;  1UN2 A;  3RHB A;  5CO3 A;  3EPT A;  1BAY A;  3I69 A;  4POM A;  1ZYQ B;  4HJ2 A;  4KCA A;  1WPI A;  3KTB A;  1GTB A;  1PSQ A;  3IXR A;  4POL A;  2TRC P;  2IFQ A;  3ZFL A;  3Q18 A;  3VI7 A;  1FB6 A;  1EOG A;  1KNG A;  3ZIV A;  2IFQ B;  3UBK A;  5GAP D;  2AB6 A;  4I2U A;  1RK4 A;  5CYY A;  12GS A;  2DBC A;  3TGZ A;  3APO A;  4IJI A;  1TK5 B;  4KH7 A;  3FK8 A;  3W8J A;  2H70 A;  1THX A;  1XXU A;  2H0I A;  4Q5N A;  4ECI A;  1GUK A;  1I9D A;  2YV9 A;  2ON5 A;  1EWX A;  5HFG A;  5F05 A;  3KMN A;  1JZR A;  1U88 A;  4J2F A;  1SL0 B;  3C7M A;  3L0H A;  4LMV A;  2REM A;  2FLS A;  2G2Q A;  3UAP A;  3UAR A;  5LNK e;  1PRX A;  5IOX A;  1JZO A;  4LL1 B;  5L71 A;  1VF2 A;  4MA9 A;  5DJL A;  1B9Y C;  2WFC A;  5IMZ A;  3G7I A;  4J56 E;  3ZML A;  3MDK A;  4ZL9 A;  4FYC A;  4RI7 A;  4PTS A;  1YKA A;  4KB3 A;  3US3 A;  2OE0 A;  1GWC A;  1MDK A;  3WGE A;  3TKP A;  3LQ7 A;  3LGC A;  4Z2U A;  4HEA 2;  4KW6 A;  4ECJ A;  2OKA A;  5IPG A;  3VWW A;  2Z9S A;  4PUR A;  3QAV A;  2VL9 A;  1A2J A;  2PGT A;  5IMV A;  4IJ3 A;  3GKX A;  1DE2 A;  4HOJ A;  3GUR A;  1SKS B;  3W8S A;  1TW9 A;  4O32 A;  1GUH A;  4ZIJ A;  5J4U A;  1VRS D;  3GH9 A;  2L6D A;  1PFO A;  3BD2 A;  2LNS A;  4IQ1 A;  1N2A A;  3EU3 A;  2K6V A;  6GSU A;  5C00 A;  2AJQ B;  1PL2 A;  1T4Z A;  2GT5 A;  1F2E A;  2BMX A;  2X4A A;  2B3S A;  3C1R A;  2MMO A;  19GS A;  2EIO A;  4RQX A;  5IQY A;  3F63 A;  3IK7 A;  1XOB A;  3HVN A;  2MBT A;  2X64 A;  5HFK A;  4F9Z A;  1XWK A;  2YJH A;  4V2L A;  2KP2 A;  4WEY A;  4MJE A;  2CX4 A;  4TW5 A;  1BYE A;  2C0E A;  2XPD A;  3ZRD A;  2FHE A;  2R6K A;  5D8I A;  4WET A;  1GUL A;  3KM6 A;  4CDO A;  5DAK B;  2PPT A;  3P90 A;  2LRN A;  1YF1 A;  3VWV A;  2H73 A;  2GZP A;  2O89 A;  3PIN A;  9GSS A;  2LJA A;  3RPN A;  2R0P A;  5JWR B;  5FHI A;  1ML6 A;  3LYP A;  5G30 A;  3TRP A;  1VF4 A;  1X9W B;  4DSQ A;  2X8H A;  2CAI A;  4HQS A;  4KDU A;  2H1A A;  3TKQ A;  4TR1 A;  1VF3 A;  3PR8 A;  4PQI A;  1TRS A;  2XBI A;  4GRF A;  2H19 A;  2WGR A;  2YJ7 A;  2UZ8 A;  5DQS A;  2RUF A;  2A2S A;  2QKE A;  5CAX A;  4L5O A;  4YAP A;  2YCD A;  3KH7 A;  2LUS A;  4PNF A;  2K9F A;  2P0G A;  3GIX A;  3BCK A;  4BWQ A;  5HR1 A;  4IKH A;  3NZN A;  3K8N A;  2OAD A;  1SJI A;  1Z5Y E;  2DIZ A;  3ZTL A;  3ERG A;  3VPQ A;  4GLT A;  3ZYW A;  1S3A A;  1WE0 A;  4BVX A;  4G9H A;  2O7K A;  5ECK B;  5IMF A;  1JLV A;  1W89 A;  2YZU A;  1TRV A;  4KSO A;  1ZYP A;  2LRC A;  1FO5 A;  1V40 A;  3BBY A;  3A5I A;  2CX3 A;  5ENU A;  2GTU A;  2FWE A;  2MMA A;  4XS4 A;  1NM3 A;  4V2M A;  1M99 A;  4XCS A;  4IS0 A;  4PUA A;  2GDR A;  4V1A p;  2NBS A;  4N30 A;  4EXJ A;  1GLQ A;  5GST A;  5IPH A;  4USS A;  3GX0 A;  3LWA A;  5D9V A;  2IIY A;  4TVE A;  3G7Y A;  5F0G A;  4YQM A;  2LRT A;  2HE3 A;  1HD2 A;  1AXD A;  2BJX A;  5ELA A;  2DKI A;  1LJR A;  3ZIJ A;  5KN3 A;  3M9K A;  1B8X A;  1XOA A;  2L6C A;  5B8A A;  3HVX A;  3VFI A;  2H30 A;  2YN1 A;  3DD3 A;  3HHV A;  2IN3 A;  3CTG A;  1LBK A;  3F3Q A;  5KEJ A;  4GTU A;  1GL8 A;  2P5Q A;  5ELG A;  2AV4 A;  3MWH A;  2PWJ A;  3M0F A;  3BJ5 A;  3H4K A;  3U6V A;  3FY7 A;  3FZ4 A;  4ZBB A;  4K0G A;  4YQV A;  7GSS A;  4ZB8 A;  1HYU A;  1EV4 A;  3ERF A;  2LEG A;  1GRX A;  3AY8 A;  2DJ0 A;  1Z6N A;  4Z7X A;  1MDJ A;  2VD0 A;  3ZL5 A;  3GA4 A;  3F4S A;  3P2A A;  1K0M A;  1FW1 A;  3UL3 A;  1TXX A;  2JZS A;  4N11 A;  3DKS A;  4EE0 A;  3EVI A;  4HU9 A;  4RUV A;  3KCM A;  1UA5 A;  5HR0 A;  5GAN D;  4ZL8 A;  2TIR A;  1K0O A;  4OFN A;  4OFM A;  3QD9 A;  4TN8 A;  2MYG A;  2I4A A;  3GL5 A;  3LXT A;  2LNT A;  1XW5 A;  3TKR A;  2H76 A;  3ISO A;  1AQV A;  3I6A A;  2GSS A;  2R0G A;  3F6D A;  2MMZ A;  2H75 A;  3KTL A;  5E4W A;  1SEN A;  4HDE A;  2CA8 A;  3F8U A;  2C0G A;  4E8H A;  1PN9 A;  1Q98 A;  2R5G A;  5D93 A;  1AQX A;  3VI5 A;  3DGQ A;  3M9J A;  2IWT A;  4HZ2 A;  3F3R A;  3EE2 A;  3TDG A;  3HXS A;  1NHY A;  1GNE A;  4RQR A;  1G6Y A;  4ECB A;  5GSS A;  1PKZ A;  1ZOF A;  2B7K A;  2QA2 A;  1MTC A;  1PA3 A;  2FCH A;  2GS3 A;  2L4Q A;  2WZ9 A;  5IMC A;  4K5R A;  3CSJ A;  1K0D A;  1NSW A;  1N8J A;  4Q5F A;  5ECN B;  3FYG A;  5ECM B;  3HJP A;  1SU9 A;  2FWH A;  2H0G A;  1FOV A;  2CT6 A;  4FQU A;  3S9F A;  4NV5 A;  2PER A;  1A23 A;  1GSQ A;  5ID2 A;  2HZF A;  1SL2 B;  4MJC A;  2WB9 A;  4Z2T A;  3L78 A;  5ID2 B;  3W6G A;  2X99 A;  2V2G A;  2B5X A;  3DEX A;  3MAK A;  4HZ4 A;  1TOF A;  2V6O A;  3GL3 A;  4JRR A;  1M9B A;  3WT2 A;  3IHG A;  1WP0 A;  2VCZ A;  4AGS A;  4BWS A;  4E8E A;  2OBI A;  5ECS A;  2QA1 A;  1ERV A;  2IMD A;  1MD3 A;  2O85 A;  3A2W A;  2V6K A;  3IAS 2;  3F4T A;  2V32 A;  2F9S A;  4TR0 A;  1K3O A;  2QC7 A;  3LEF A;  4IQA A;  3TJG A;  1CQH A;  3O3T A;  3FZ9 A;  1XZO A;  4LLR A;  1GNW A;  4G0L A;  4CY6 A;  4XS1 A;  1O85 A;  3RBT A;  3R2Q A;  4LL4 B;  1BG5 A;  1GTA A;  5KOX A;  1ERT A;  2H0H A;  1NHO A;  1PMT A;  1AQW A;  1QUW A;  1E2Y A;  1MD4 A;  2YAN A;  1OYJ A;  1PKW A;  2OJL A;  3DRN A;  1GSY A;  5IM9 A;  4IP6 A;  5HFI A;  2I81 A;  3ZVJ A;  3EU4 A;  2C3N A;  3SBC A;  1M2B A;  2HRA A;  2L5O A;  5CRE A;  2N5A A;  4F2I A;  2KUC A;  2R4V A;  5G1K A;  4O7H A;  2H74 A;  4PQH A;  4XS6 A;  1ZZY A;  4XIH A;  3HCZ A;  3QDN A;  2AYT A;  4MH2 A;  1M2A A;  2VO4 A;  1WOU A;  4IVF A;  1U6T A;  3WD6 A;  4MZW A;  4KA0 A;  1XVQ A;  1SYR A;  3GMF A;  4MJB A;  2KP1 A;  1PX6 A;  1UVZ A;  4DVC A;  4D73 A;  3TCO A;  2FWF A;  5BRT A;  2H01 A;  4ISD A;  5HR3 A;  1FVK A;  4ICY A;  2GST A;  4D73 B;  4MH3 A;  4LA1 A;  3UJ1 A;  1TKD B;  1SKR B;  2MBS A;  4LMW A;  3QFA C;  4F0B A;  3FKF A;  4O5Q A;  3ZLP A;  2LST A;  3ZMK A;  3G7J A;  1TI1 A;  1YKC A;  1XWA A;  2DIY A;  4JBB A;  1AW9 A;  1SD8 A;  1EEJ A;  2P5R A;  3LFL A;  4K2D A;  4KAE A;  2DSA A;  4DEJ A;  1Q4J A;  2E0Q A;  1ZL9 A;  2M46 A;  2E7P A;  5ECI B;  2V1M A;  4MLY A;  4ILF A;  1J9B A;  5E59 A;  1V98 A;  5G2Z A;  4YKF A;  2B1K A;  3FEU A;  2DJ1 A;  1ON4 A;  1X9S B;  5DCG A;  2GSQ A;  2H6Z A;  2PVO C;  2YWN A;  5KOW A;  4FH8 A;  4N10 A;  5INY A;  2VCT A;  4GSS A;  3QMX A;  1GSF A;  3DML A;  2TRX A;  3M1G A;  4JU5 A;  3KZQ A;  3GX8 A;  2I9H A;  2YWO A;  2LV3 A;  2A2R A;  5A4U A;  1TP9 A;  1TTZ A;  2RUE A;  1JZW A;  2KHP A;  1DSB A;  2NVL A;  3E9J B;  4K7O A;  4DSR A;  4G2E A;  1WMJ A;  2IJY A;  1O81 A;  3FRC A;  1F37 A;  3GHA A;  2HYX A;  4BVY A;  5C04 A;  2DJ3 A;  2CQ9 A;  3DVX A;  2DML A;  4IGJ A;  3TRQ A;  1Z6M A;  4MMM A;  5D9T A;  5JCW A;  3HKR A;  3GYK A;  2ON7 A;  3HJM A;  2XPE A;  4X43 A;  5D9X A;  3HD5 A;  1WJK A;  2PMT A;  1T3B A;  2JU5 A;  3L9S A;  3D4M A;  4Q5Q A;  2VCQ A;  3BCI A;  3VPT A;  3CYN A;  2HRN A;  2L4C A;  3O6T A;  3HY2 A;  3PGT A;  3ZRE A;  3M8N A;  4JE1 A;  5AIV A;  5G5F A;  6GSV A;  1ACV A;  1M9A A;  3UOM A;  3P7X A;  1OC8 A;  3JCM L;  1JLW A;  3N5O A;  4JED A;  4JZQ A;  2FUG 2;  3A3T A;  1Y6E A;  4F03 A;  3GFK A;  2L5L A;  5ECO B;  2JSZ A;  3ZIT A;  2VCX A;  1F3B A;  3RAZ A;  1QQ2 A;  2KLX A;  1AAZ A;  1SJZ A;  3MNG A;  2JAD A;  3KP8 A; 
#chains in the Genus database with same CATH homology
 1SK1 A;  2GGT A;  1YZX A;  4TR1 B;  1CQG A;  3GV1 A;  4J57 E;  4NXI A;  3GKM A;  1V9W A;  4OCF A;  2YP6 A;  5F07 A;  3Q19 A;  2MMN A;  1XCC A;  4MF5 A;  1K3Y A;  4ZXG A;  2VOC A;  2JZR A;  1DE1 A;  3EIN A;  4O5U A;  2LKU A;  4CW9 A;  1K0B A;  2K8S A;  2AUV A;  3L9V A;  4BL7 A;  5G1L A;  2VIM A;  2CZ3 A;  2X49 A;  2AAW A;  1G0T A;  4BL7 B;  4WF4 A;  4BVX B;  3FZA A;  3H79 A;  2CVD A;  4ZIL A;  4K7I A;  4PNG A;  1QK8 A;  1PGT A;  1O8X A;  5IO2 A;  1AIU A;  2A4V A;  1SK0 A;  4WBR D;  3FZ5 A;  5F8B A;  4KGI A;  3J7Y k;  2J9H A;  2DC5 A;  4QQ7 A;  2NPB A;  3QOU A;  4EF0 A;  1XVW A;  2VL2 C;  4XS4 B;  5J41 A;  4NPB A;  2FNO A;  4XRD A;  2JZT A;  1QGV A;  4NV2 A;  1KTE A;  2WS2 A;  5COH A;  3V1W A;  3IC4 A;  1H4O A;  2C0D A;  1X5C A;  2D2Z A;  3HDC A;  3KGK A;  5FT3 A;  1NW2 A;  2PVQ A;  5A4W A;  2QSI A;  4WXT A;  4EIQ A;  1HNC A;  1BQ7 A;  4KND A;  2J23 A;  3QAG A;  4AJ7 A;  2PN8 A;  3GH6 A;  1M0U A;  3H1N A;  3C73 A;  3OR5 A;  4V2N A;  2I3Y A;  3FR9 A;  1DUG A;  2IMI A;  2YZH A;  2C80 A;  1GUM A;  1URM A;  2VM2 A;  3ERW A;  4GQC A;  2VD1 A;  1TK0 B;  2HT9 A;  1M7T A;  3VWX A;  1X9M B;  1THO A;  3U5R E;  1O6J A;  4Q5R A;  2VLV A;  4GXZ A;  2H6Y A;  4HJM A;  5EVO A;  1QXH A;  1ZMA A;  2FWG A;  2GVP A;  2M80 A;  5AGY A;  2OE3 A;  3FHK A;  3A2X A;  5DCH A;  4MP4 A;  2R0C A;  4MPF A;  3IA1 A;  3TOT A;  1GSS A;  4PQ1 A;  1SJ6 A;  1YF0 A;  2X8G A;  3CSH A;  6GSX A;  4YAV A;  1KBN A;  3F0I A;  3O76 A;  1M2D A;  4ID0 A;  2F3M A;  5G5E A;  1QMV A;  2LTK A;  3LJR A;  4NAX A;  2H1D A;  3IK9 A;  2B6M A;  1A8L A;  5EY6 A;  2CV4 A;  5IO0 A;  3GKK A;  13GS A;  2RM6 A;  1PN0 A;  5ECH B;  5HQP A;  4BPY A;  2R3X A;  2WJU A;  3HVV A;  4GST A;  2GQK A;  1G6W A;  3PH9 A;  1GSD A;  4O92 A;  5F06 A;  5CRW A;  4Z2R A;  2H8L A;  5CRH A;  1TDI A;  3DIE A;  1EP7 A;  1WIK A;  2YV7 A;  2HXK A;  6GSS A;  4KDX A;  5GZZ B;  4ZB6 A;  3GKN A;  2XHF A;  3APQ A;  3ME7 A;  2XC2 A;  1GSU A;  3E3E A;  3EMP A;  5KN0 A;  2YOI A;  4K0N A;  4EVM A;  5B6N A;  1FOH A;  1XW9 A;  2O87 A;  5FWG A;  4WR4 A;  5IMA A;  2IPA A;  1OE7 A;  11GS A;  4POK A;  4NHW A;  4XRA A;  1SK2 A;  2LQO A;  3TJF A;  4GWR A;  5EPF A;  1HNA A;  3ZVJ D;  4IHU A;  1GTU A;  1X0R A;  3CRT A;  5DQY A;  3DWV A;  4MCU A;  3TJJ A;  5CP1 A;  2HSM A;  3P8W A;  1H75 A;  1XPV A;  2IME A;  3HYP A;  4DSS A;  2NDO A;  3F9U A;  1FHE A;  2H1B A;  4KCE A;  2ZUP A;  5EL8 A;  1J08 A;  3KEB A;  4DSS B;  2E2G A;  2JL4 A;  3VUR A;  2GLR A;  1T1V A;  2DJK A;  5HR2 A;  4AJ8 A;  4KF9 A;  4FO5 A;  2FA4 A;  4G0K A;  4KDY A;  1TJD A;  4PGT A;  4ML1 A;  1EP8 A;  3F6F A;  1UC7 A;  2DJ2 A;  1BX9 A;  4XHM A;  3LG6 A;  4EDY A;  3UBL A;  2HZE A;  3MIX A;  3KP9 A;  1KEB A;  4GSN A;  2V41 A;  3FR6 A;  3EUR A;  3IDV A;  2HZE B;  4WBJ A;  4EIP A;  4ULX A;  2O8V B;  1R5A A;  1XW6 A;  2ALB A;  2L59 A;  5CRD A;  1WWJ A;  2GSR A;  2VLU A;  1ST9 A;  2EIQ A;  3WT1 A;  4TR4 A;  3UMA A;  3TKS C;  18GS A;  1C72 A;  1EEM A;  1VGL A;  2H1G A;  2X8C A;  3HZ4 A;  5JWO B;  1YEP A;  3RPP A;  4N0Z A;  4RI6 A;  3BOA A;  1U87 A;  3UVT A;  5IOW A;  1A24 A;  2VCV A;  4MZC A;  5DJM A;  5H5Q A;  4EC0 A;  2R2J A;  2DJJ A;  2N5B A;  5DDL A;  1RQM A;  2K8V A;  1ZYE A;  1G7E A;  4N0V A;  4AJ6 A;  2L57 A;  3IRA A;  4KUN A;  3D6I A;  5A4V A;  3GSS A;  4KX4 A;  4YQU A;  5B6M A;  4NHZ A;  1XFL A;  3IV4 A;  2WUL A;  1GLP A;  4XTS A;  1R5P A;  3PPU A;  3LSZ A;  2ES7 A;  1A8Y A;  5CNW A;  4QL9 A;  1OKT A;  3UEM A;  5ABR A;  1OKD A;  3IE3 A;  1Y25 A;  5IMD A;  5H5R A;  3FW2 A;  3TJK A;  3CTF A;  2WRT A;  1TU8 A;  3QAW A;  3UIW A;  1FAA A;  1EGR A;  1XWG A;  4I5Q A;  3KH9 A;  3GRX A;  3KMO A;  3LYK A;  1I5G A;  1IYH A;  3D0Z A;  3TB2 A;  3H93 A;  4L8E A;  2VL2 A;  3VLN A;  4WR5 A;  3GUS A;  4L0U A;  3C1S A;  4HS1 A;  1SKW B;  4K8M A;  1B48 A;  4K6X A;  4K5S A;  2XBQ A;  4K7N A;  2A2P A;  3I9V 2;  3LW9 A;  4ZBD A;  1PX7 A;  1ZYN A;  1S3D A;  3D5J A;  16GS A;  4AF2 A;  1IYI A;  2YWM A;  2M72 A;  3QR6 A;  2YWI A;  5D73 A;  2HFD A;  1F9M A;  1USB A;  1WRY A;  2CZ2 A;  3MSZ A;  3EMX A;  2PBJ A;  1E6B A;  1JZD A;  3GST A;  2QGV A;  4EO3 A;  2K18 A;  1T00 A;  2CVK A;  3KJY A;  1ILO A;  2GQM A;  4BVY B;  4JR4 A;  4EDZ A;  1HNB A;  3CXG A;  4PXO A;  1X5D A;  2KOK A;  3WGX A;  4L0W A;  4L5L A;  2EC4 A;  4MAB A;  3HZ8 A;  5LD0 A;  3D22 A;  2HSY A;  2DKH A;  3VK9 A;  3UVH A;  5AIS A;  5AN1 A;  3A5W A;  3A2V A;  1O73 A;  3HA9 A;  4V1A g;  2AHE A;  4TR3 A;  3L4N A;  4G10 A;  4TXO A;  2GT6 A;  1XWC A;  1Z7P A;  3ZFB A;  5DAK A;  4TXO B;  2B5E A;  1K0N A;  2JAC A;  2G0F A;  3IOS A;  3IBH A;  2DLX A;  1V57 A;  2VCW A;  1TI3 A;  4MF7 A;  5DAL A;  1A2L A;  2MZC A;  4EUY A;  3GTU A;  2FD3 A;  3FR3 A;  1Z3E A;  3FMW A;  3CMI A;  3TKS E;  3HVS A;  3APS A;  5DAL B;  4YKG A;  4ZBA A;  5G31 A;  4P3Y B;  3GTU B;  4EL1 A;  5D96 A;  4H86 A;  3G9B A;  2F8A A;  2OAC A;  3ME8 A;  1RW1 A;  2CVB A;  3E0U A;  2VL3 A;  6GSY A;  17GS A;  4K9Z A;  5B8B A;  5AIX A;  1YEX A;  1K0C A;  4G0I A;  5B7C A;  4I6X A;  10GS A;  4MNN A;  4CY8 A;  1B4Q A;  5J9C A;  4I97 A;  3CSI A;  3Q6O A;  2HRF A;  4YH2 A;  2RM5 A;  2A4H A;  1MDI A;  1XIY A;  3TRX A;  4WKW A;  3MYD A;  4ZB9 A;  4CHS A;  4OWY A;  2VLT A;  4IW9 A;  2C3T A;  1T8E B;  1EGO A;  2BTO T;  2R37 A;  3LXZ A;  2RLI A;  2DMM A;  3QCP A;  1TRU A;  1PQN A;  3I43 A;  3DVW A;  6GST A;  1EV9 A;  4TRX A;  5CRG A;  3NOF A;  4GQF A;  4HU7 A;  4ZL7 A;  1TRW A;  2HSH A;  1V58 A;  2HLS A;  1K3L A;  4JR6 A;  4IBP A;  1ERW A;  5H5S A;  1S3C A;  4POB A;  4PX1 A;  1B4P A;  5JCU A;  1BED A;  3DYR A;  4OCE A;  1O7U A;  1TU7 A;  3F4R A;  1GP1 A;  1U3A A;  1G7O A;  1B9X C;  1XBS A;  1Z9H A;  5ECL B;  1A0R P;  3H8Q A;  4OD7 A;  2B7J A;  5DBQ A;  2C1Y A;  4KE3 A;  1SD9 A;  2OBK A;  5JWQ B;  2ZCT A;  1YJ6 A;  3J7Y b;  1XWB A;  4I8B A;  1OC3 A;  1SL1 B;  4OO4 A;  2F51 A;  4K1F A;  1F3A A;  1T4Y A;  14GS A;  2IL3 A;  2YPM A;  1JFU A;  1OAZ A;  2WDU A;  2NTO A;  3WYW A;  3SWL A;  4ML6 A;  3TKS A;  4WF5 A;  2CAQ A;  1PL1 A;  4ECC A;  2GZZ A;  2OA7 A;  1BJX A;  4HI7 A;  2H71 A;  3IAM 2;  2LJK A;  1ERU A;  4FIW A;  3TOU A;  1YY7 A;  3ED3 A;  1A2M A;  5LCZ A;  4OFT A;  5J3R A;  3EYT A;  3KIJ A;  5JCG A;  3QFB C;  4MF6 A;  3R3E A;  5BMU A;  2FY6 A;  1R4W A;  1YDK A;  2ZNM A;  3TJB A;  3WGD A;  2C4J A;  3IHQ A;  2IMF A;  4MPG A;  3RHC A;  4HUA A;  4PUF C;  22GS A;  2H6X A;  3EC3 A;  2H72 A;  1VF1 A;  1W4V A;  4OO5 A;  3GN3 A;  2HNL A;  3LOR A;  4OMV A;  5ECQ B;  5DVB A;  2FGX A;  3Q74 A;  1OE8 A;  2HRK A;  4TOP A;  4FYU A;  4IN0 A;  1ZGN A;  3N9J A;  2E2M A;  3CBU A;  3D4T A;  4F0C A;  3IPZ A;  3NIV A;  1OVN A;  1AC1 A;  1PD2 1;  4MK3 A;  2JSY A;  5A5K A;  1QFN A;  1J0F A;  4MZB A;  2YNX A;  2I1U A;  2C3Q A;  1OC9 A;  1X5E A;  3KXO A;  1FG4 A;  4O5R A;  2B5Y A;  1R26 A;  1YQ1 A;  1OC9 B;  4FYB A;  2RII A;  1R7H A;  3ZZX A;  1TK8 B;  1F6M C;  3C71 A;  2PU9 C;  1GTI A;  2P31 A;  4EKZ A;  3IC8 A;  4HQZ A;  4A5P A;  2VAF A;  1V2A A;  4BA7 A;  5ECP B;  3CRU A;  4TKY A;  1GH2 A;  2GQL A;  3HJO A;  1FB0 A;  4MDC A;  1AUC A;  3GNJ A;  2H66 A;  4GF0 A;  4QL7 A;  2F8F A;  2EIR A;  2WCI A;  4IEL A;  4X0X A;  2FA8 A;  2N5F A;  5IIZ A;  4F82 A;  3QPM A;  4NWY A;  4MJA A;  1K0A A;  1ABA A;  2GZY A;  4K2X A;  20GS A;  5KN2 A;  3KD0 A;  2IMK A;  4X4J A;  1EOH A;  3M3M A;  3C8E A;  2C8U A;  1SYX A;  4GCI A;  1EZK A;  4IP1 A;  2PUK C;  3DXB A;  1A0F A;  4ACS A;  2OE1 A;  2LQQ A;  1HQO A;  1O8W A;  1T7P B;  1U3I A;  4TXV A;  3L9U A;  8GSS A;  3D21 A;  2VM1 A;  4I2T A;  4NMU A;  1LU4 A;  6GSW A;  2VUP A;  3IR4 A;  2B1L A;  1DBY A;  4G19 A;  4KSM A;  5KN1 A;  3RDW A;  1FVJ A;  1MEK A;  3EWL A;  2LJR A;  1GSE A;  3VWU A;  3TUE A;  5J9B A;  1Z7R A;  5J5N A;  2C0F A;  2HI7 A;  2LS5 A;  5D9W A;  4X1U A;  1ZCP A;  5ECR B;  1JHB A;  1UN2 A;  3RHB A;  5CO3 A;  3EPT A;  1BAY A;  3I69 A;  4POM A;  1ZYQ B;  4HJ2 A;  4KCA A;  1WPI A;  3KTB A;  1GTB A;  1PSQ A;  3IXR A;  4POL A;  2TRC P;  2IFQ A;  3ZFL A;  3Q18 A;  3VI7 A;  1FB6 A;  1EOG A;  1KNG A;  3ZIV A;  2IFQ B;  3UBK A;  5GAP D;  2AB6 A;  4I2U A;  1RK4 A;  5CYY A;  12GS A;  2DBC A;  3TGZ A;  3APO A;  4IJI A;  1TK5 B;  4KH7 A;  3FK8 A;  3W8J A;  2H70 A;  1THX A;  1XXU A;  2H0I A;  4Q5N A;  4ECI A;  1GUK A;  1I9D A;  2YV9 A;  2ON5 A;  1EWX A;  5HFG A;  5F05 A;  3KMN A;  1JZR A;  1U88 A;  4J2F A;  1SL0 B;  3C7M A;  3L0H A;  4LMV A;  2REM A;  2FLS A;  2G2Q A;  3UAP A;  3UAR A;  5LNK e;  1PRX A;  5IOX A;  1JZO A;  4LL1 B;  5L71 A;  1VF2 A;  4MA9 A;  5DJL A;  1B9Y C;  2WFC A;  5IMZ A;  3G7I A;  4J56 E;  3ZML A;  3MDK A;  4ZL9 A;  4FYC A;  4RI7 A;  4PTS A;  1YKA A;  4KB3 A;  3US3 A;  2OE0 A;  1GWC A;  1MDK A;  3WGE A;  3TKP A;  3LQ7 A;  3LGC A;  4Z2U A;  4HEA 2;  4KW6 A;  4ECJ A;  2OKA A;  5IPG A;  3VWW A;  2Z9S A;  4PUR A;  3QAV A;  2VL9 A;  1A2J A;  2PGT A;  5IMV A;  4IJ3 A;  3GKX A;  1DE2 A;  4HOJ A;  3GUR A;  1SKS B;  3W8S A;  1TW9 A;  4O32 A;  1GUH A;  4ZIJ A;  5J4U A;  1VRS D;  3GH9 A;  2L6D A;  3BD2 A;  2LNS A;  4IQ1 A;  1N2A A;  3EU3 A;  2K6V A;  6GSU A;  5C00 A;  2AJQ B;  1PL2 A;  1T4Z A;  2GT5 A;  1F2E A;  2BMX A;  2X4A A;  2B3S A;  3C1R A;  2MMO A;  19GS A;  2EIO A;  4RQX A;  5IQY A;  3F63 A;  3IK7 A;  1XOB A;  2MBT A;  2X64 A;  5HFK A;  4F9Z A;  1XWK A;  2YJH A;  4V2L A;  2KP2 A;  4WEY A;  4MJE A;  2CX4 A;  4TW5 A;  1BYE A;  2C0E A;  2XPD A;  3ZRD A;  2FHE A;  2R6K A;  5D8I A;  4WET A;  1GUL A;  3KM6 A;  4CDO A;  5DAK B;  2PPT A;  3P90 A;  2LRN A;  1YF1 A;  3VWV A;  2H73 A;  2GZP A;  2O89 A;  3PIN A;  9GSS A;  2LJA A;  3RPN A;  2R0P A;  5JWR B;  5FHI A;  1ML6 A;  3LYP A;  5G30 A;  3TRP A;  1VF4 A;  1X9W B;  4DSQ A;  2X8H A;  2CAI A;  4HQS A;  4KDU A;  2H1A A;  3TKQ A;  4TR1 A;  1VF3 A;  3PR8 A;  4PQI A;  1TRS A;  2XBI A;  4GRF A;  2H19 A;  2WGR A;  2YJ7 A;  2UZ8 A;  5DQS A;  2RUF A;  2A2S A;  2QKE A;  5CAX A;  4L5O A;  4YAP A;  2YCD A;  3KH7 A;  2LUS A;  4PNF A;  2K9F A;  2P0G A;  3GIX A;  3BCK A;  4BWQ A;  5HR1 A;  4IKH A;  3NZN A;  3K8N A;  2OAD A;  1SJI A;  1Z5Y E;  2DIZ A;  3ZTL A;  3ERG A;  3VPQ A;  4GLT A;  3ZYW A;  1S3A A;  1WE0 A;  4BVX A;  4G9H A;  2O7K A;  5ECK B;  5IMF A;  1JLV A;  1W89 A;  2YZU A;  1TRV A;  4KSO A;  1ZYP A;  2LRC A;  1FO5 A;  1V40 A;  3BBY A;  3A5I A;  2CX3 A;  5ENU A;  2GTU A;  2FWE A;  2MMA A;  4XS4 A;  1NM3 A;  4V2M A;  1M99 A;  4XCS A;  4IS0 A;  4PUA A;  2GDR A;  4V1A p;  2NBS A;  4N30 A;  4EXJ A;  1GLQ A;  5GST A;  5IPH A;  4USS A;  3GX0 A;  3LWA A;  5D9V A;  2IIY A;  4TVE A;  3G7Y A;  5F0G A;  4YQM A;  2LRT A;  2HE3 A;  1HD2 A;  1AXD A;  2BJX A;  5ELA A;  2DKI A;  1LJR A;  3ZIJ A;  5KN3 A;  3M9K A;  1B8X A;  1XOA A;  2L6C A;  5B8A A;  3HVX A;  3VFI A;  2H30 A;  2YN1 A;  3DD3 A;  3HHV A;  2IN3 A;  3CTG A;  1LBK A;  3F3Q A;  5KEJ A;  4GTU A;  1GL8 A;  2P5Q A;  5ELG A;  2AV4 A;  3MWH A;  2PWJ A;  3M0F A;  3BJ5 A;  3H4K A;  3U6V A;  3FY7 A;  3FZ4 A;  4ZBB A;  4K0G A;  4YQV A;  7GSS A;  4ZB8 A;  1HYU A;  1EV4 A;  3ERF A;  2LEG A;  1GRX A;  3AY8 A;  2DJ0 A;  1Z6N A;  4Z7X A;  1MDJ A;  2VD0 A;  3ZL5 A;  3GA4 A;  3F4S A;  3P2A A;  1K0M A;  1FW1 A;  3UL3 A;  1TXX A;  2JZS A;  4N11 A;  3DKS A;  4EE0 A;  3EVI A;  4HU9 A;  4RUV A;  3KCM A;  1UA5 A;  5HR0 A;  5GAN D;  4ZL8 A;  2TIR A;  1K0O A;  4OFN A;  4OFM A;  3QD9 A;  4TN8 A;  2MYG A;  2I4A A;  3GL5 A;  3LXT A;  2LNT A;  1XW5 A;  3TKR A;  2H76 A;  3ISO A;  1AQV A;  3I6A A;  2GSS A;  2R0G A;  3F6D A;  2MMZ A;  2H75 A;  3KTL A;  5E4W A;  1SEN A;  4HDE A;  2CA8 A;  3F8U A;  2C0G A;  4E8H A;  1PN9 A;  1Q98 A;  2R5G A;  5D93 A;  1AQX A;  3VI5 A;  3DGQ A;  3M9J A;  2IWT A;  4HZ2 A;  3F3R A;  3EE2 A;  3TDG A;  3HXS A;  1NHY A;  1GNE A;  4RQR A;  1G6Y A;  4ECB A;  5GSS A;  1PKZ A;  1ZOF A;  2B7K A;  2QA2 A;  1MTC A;  1PA3 A;  2FCH A;  2GS3 A;  2L4Q A;  2WZ9 A;  5IMC A;  4K5R A;  3CSJ A;  1K0D A;  1NSW A;  1N8J A;  4Q5F A;  5ECN B;  3FYG A;  5ECM B;  3HJP A;  1SU9 A;  2FWH A;  2H0G A;  1FOV A;  2CT6 A;  4FQU A;  3S9F A;  4NV5 A;  2PER A;  1A23 A;  1GSQ A;  5ID2 A;  2HZF A;  1SL2 B;  4MJC A;  2WB9 A;  4Z2T A;  3L78 A;  5ID2 B;  3W6G A;  2X99 A;  2V2G A;  2B5X A;  3DEX A;  3MAK A;  4HZ4 A;  1TOF A;  2V6O A;  3GL3 A;  4JRR A;  1M9B A;  3WT2 A;  3IHG A;  1WP0 A;  2VCZ A;  4AGS A;  4BWS A;  4E8E A;  2OBI A;  5ECS A;  2QA1 A;  1ERV A;  2IMD A;  1MD3 A;  2O85 A;  3A2W A;  2V6K A;  3IAS 2;  3F4T A;  2V32 A;  2F9S A;  4TR0 A;  1K3O A;  2QC7 A;  3LEF A;  4IQA A;  3TJG A;  1CQH A;  3O3T A;  3FZ9 A;  1XZO A;  4LLR A;  1GNW A;  4G0L A;  4CY6 A;  4XS1 A;  1O85 A;  3RBT A;  3R2Q A;  4LL4 B;  1BG5 A;  1GTA A;  5KOX A;  1ERT A;  2H0H A;  1NHO A;  1PMT A;  1AQW A;  1QUW A;  1E2Y A;  1MD4 A;  2YAN A;  1OYJ A;  1PKW A;  2OJL A;  3DRN A;  1GSY A;  5IM9 A;  4IP6 A;  5HFI A;  2I81 A;  3ZVJ A;  3EU4 A;  2C3N A;  3SBC A;  1M2B A;  2HRA A;  2L5O A;  5CRE A;  2N5A A;  4F2I A;  2KUC A;  2R4V A;  5G1K A;  4O7H A;  2H74 A;  4PQH A;  4XS6 A;  1ZZY A;  4XIH A;  3HCZ A;  3QDN A;  2AYT A;  4MH2 A;  1M2A A;  2VO4 A;  1WOU A;  4IVF A;  1U6T A;  3WD6 A;  4MZW A;  4KA0 A;  1XVQ A;  1SYR A;  3GMF A;  4MJB A;  2KP1 A;  1PX6 A;  1UVZ A;  4DVC A;  4D73 A;  3TCO A;  2FWF A;  5BRT A;  2H01 A;  4ISD A;  5HR3 A;  1FVK A;  4ICY A;  2GST A;  4D73 B;  4MH3 A;  4LA1 A;  3UJ1 A;  1TKD B;  1SKR B;  2MBS A;  4LMW A;  3QFA C;  4F0B A;  3FKF A;  4O5Q A;  3ZLP A;  2LST A;  3ZMK A;  3G7J A;  1TI1 A;  1YKC A;  1XWA A;  2DIY A;  4JBB A;  1AW9 A;  1SD8 A;  1EEJ A;  2P5R A;  3LFL A;  4K2D A;  4KAE A;  2DSA A;  4DEJ A;  1Q4J A;  2E0Q A;  1ZL9 A;  2M46 A;  2E7P A;  5ECI B;  2V1M A;  4MLY A;  4ILF A;  1J9B A;  5E59 A;  1V98 A;  5G2Z A;  4YKF A;  2B1K A;  3FEU A;  2DJ1 A;  1ON4 A;  1X9S B;  5DCG A;  2GSQ A;  2H6Z A;  2PVO C;  2YWN A;  5KOW A;  4FH8 A;  4N10 A;  5INY A;  2VCT A;  4GSS A;  3QMX A;  1GSF A;  3DML A;  2TRX A;  3M1G A;  4JU5 A;  3KZQ A;  3GX8 A;  2I9H A;  2YWO A;  2LV3 A;  2A2R A;  5A4U A;  1TP9 A;  1TTZ A;  2RUE A;  1JZW A;  2KHP A;  1DSB A;  2NVL A;  3E9J B;  4K7O A;  4DSR A;  4G2E A;  1WMJ A;  2IJY A;  1O81 A;  3FRC A;  1F37 A;  3GHA A;  2HYX A;  4BVY A;  5C04 A;  2DJ3 A;  2CQ9 A;  3DVX A;  2DML A;  4IGJ A;  3TRQ A;  1Z6M A;  4MMM A;  5D9T A;  5JCW A;  3HKR A;  3GYK A;  2ON7 A;  3HJM A;  2XPE A;  4X43 A;  5D9X A;  3HD5 A;  1WJK A;  2PMT A;  1T3B A;  2JU5 A;  3L9S A;  3D4M A;  4Q5Q A;  2VCQ A;  3BCI A;  3VPT A;  3CYN A;  2HRN A;  2L4C A;  3O6T A;  3HY2 A;  3PGT A;  3ZRE A;  3M8N A;  4JE1 A;  5AIV A;  5G5F A;  6GSV A;  1ACV A;  1M9A A;  3UOM A;  3P7X A;  1OC8 A;  3JCM L;  1JLW A;  3N5O A;  4JED A;  4JZQ A;  2FUG 2;  3A3T A;  1Y6E A;  4F03 A;  3GFK A;  2L5L A;  5ECO B;  2JSZ A;  3ZIT A;  2VCX A;  1F3B A;  3RAZ A;  1QQ2 A;  2KLX A;  1AAZ A;  1SJZ A;  3MNG A;  2JAD A;  3KP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...