3BD2A

Crystal structure of staphylococcus aureus dsba e96q
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
164
structure length
164
Chain Sequence
GKPLVVVYGDYKCPYCKELDEKVMPKLRKNYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDQNKEWLTKELLDKHIKQLHLDKETENKIIKDYKTKDSKSWKAAEKDKKIAKDNHIKTTPTAFINGEKVEDPYDYESYEKLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Disulfide bond protein A
publication title Staphylococcus aureus DsbA Does Not Have a Destabilizing Disulfide: A NEW PARADIGM FOR BACTERIAL OXIDATIVE FOLDING
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 60
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2007-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3bd2A00
1GTIA 3IRAA 5IO0A 4WR5A 5D73A 5DQYA 1U87A 1M0UA 1ERTA 4WXTA 1H75A 1XVWA 1G6WA 2J23A 1J08A 4G10A 3KGKA 1Q98A 1T4ZA 2N5BA 2NPBA 2O7KA 4AF2A 2GS3A 2C4JA 3QDNA 3CRTA 4YH2A 1BYEA 1A2MA 5D9TA 2PGTA 2DC5A 3ERWA 2YNXA 1ERVA 3UBLA 4JE1A 5DBQA 2FA4A 1XXUA 4GWRA 1GNWA 2LSTA 1USBA 2B5XA 4KE3A 1Q4JA 1TK5B 2OE1A 2R2JA 1GSFA 4Q5QA 1X0RA 3EE2A 2GGTA 1QGVA 1M2DA 4L8EA 2C8UA 1A0FA 3I9V2 2H71A 5H5SA 3UJ1A 2I1UA 5KN0A 5C00A 2AAWA 2DJ1A 4YQUA 1TU8A 3L0HA 1UC7A 1V57A 1M7TA 4YAPA 5G31A 3FHKA 3UBKA 3SWLA 2H70A 2B7KA 1K0NA 1VRSD 4TR3A 5IM9A 1Z6MA 1OAZA 2R5GA 3GTUA 4HJMA 3D4TA 3EURA 4AJ7A 4EC0A 1FVJA 2TRXA 3W8SA 3ZYWA 1THOA 2FWEA 1ML6A 3O3TA 3FZ5A 2CA8A 3HVSA 2PUKC 3GH9A 2H1GA 3KM6A 4ZL8A 3TGZA 5EVOA 2NDOA 4DSRA 2IL3A 4HI7A 2L6DA 3TKQA 4N10A 4MABA 5ENUA 5B6NA 5FT3A 3VI7A 2CAIA 1XWGA 2OKAA 4IQAA 2IFQB 3H1NA 3IHQA 1QFNA 1K3OA 4POKA 1R4WA 1JZOA 4GSSA 4P3YB 5IMZA 2FUG2 5IQYA 1XCCA 1VF4A 3HKRA 1TOFA 1F2EA 2GSQA 4JZQA 1CQHA 3UVTA 3QPMA 3VPTA 4TR4A 5G5EA 4IP1A 4PGTA 3FEUA 1GLPA 1BX9A 4ZBDA 1B4QA 4L0UA 2VL9A 1XW6A 4K7OA 3IAS2 4TXOA 3MSZA 3TRXA 4HZ4A 1S3DA 2YWMA 1DUGA 4GCIA 5ECOB 3TDGA 3ERGA 5HR3A 3IDVA 4O7HA 2Z9SA 2LRTA 1SKSB 5CRGA 3D21A 4WBJA 3FZ4A 3LJRA 4ZXGA 3FW2A 3QAGA 1N8JA 1EP7A 3HD5A 4TOPA 1YEPA 4XS4A 1M9BA 1PGTA 4OD7A 3M8NA 2OBIA 1FG4A 5IO2A 3ZRDA 3E0UA 3UARA 3L9UA 5EY6A 1FAAA 2PBJA 2ES7A 2FWGA 1SD9A 2X8HA 4Q5NA 3Q19A 1TW9A 3ZZXA 1A24A 1O73A 4G9HA 4F03A 5F0GA 5JCWA 1G6YA 5HFGA 1YY7A 4PQHA 5J41A 2I81A 1J9BA 1YEXA 11GSA 2WCIA 3F63A 2IJYA 2YWNA 1GTBA 3A2VA 4K8MA 3M9KA 2YANA 4J56E 1AC1A 1ILOA 2B5EA 1UVZA 5AIXA 1PKWA 1ABAA 3NZNA 4L5OA 4KH7A 1SJ6A 1EGOA 2VL2C 5J9BA 2B1LA 4FO5A 2OA7A 2XPEA 4E8HA 4H86A 4WR4A 2YV9A 4XIHA 2IWTA 3M0FA 3GSTA 2WB9A 3L78A 4IQ1A 2ALBA 3KD0A 5ID2A 1GUHA 1KTEA 1GTUA 5IPGA 2YV7A 3TKPA 3NOFA 1O8WA 4MA9A 3VWVA 4OFMA 2H73A 1OC9A 4ECBA 4JRRA 1XWAA 1XWCA 2ON5A 1GSYA 2HZFA 2JADA 2A2RA 2EIRA 3DYRA 20GSA 2CVDA 1JLVA 2DIYA 2AB6A 4Q5FA 5G1LA 1F6MC 3DIEA 3GTUB 2HSHA 2KP2A 1GTAA 1GP1A 4MJAA 5D96A 1U88A 3F6FA 1PRXA 3LORA 4IBPA 1O8XA 1O85A 13GSA 2AHEA 3APQA 3CSJA 1AQXA 3LWAA 2B1KA 2FWFA 3GKNA 4HZ2A 4BPYA 4K9ZA 1M9AA 1VF3A 1YZXA 18GSA 1T1VA 1U3AA 2R6KA 5G30A 2VIMA 2M72A 3APOA 4IN0A 1B9YC 2GSRA 2HRFA 1TRWA 4L0WA 2OACA 3ZFLA 5ECSA 3M1GA 2IIYA 3BCIA 1SK1A 4IVFA 5JCGA 2XBIA 4GTUA 2LTKA 1MDKA 4IHUA 3IK7A 1R26A 4EUYA 2H8LA 3G9BA 2MYGA 2YWOA 1TK0B 3EWLA 2I3YA 2MZCA 3NIVA 1NW2A 2E0QA 4POLA 3US3A 1M99A 2FD3A 3CSHA 2MMNA 2F3MA 1V40A 5HFIA 3R2QA 4TXOB 3KMNA 5CP1A 3UAPA 4JR6A 16GSA 2I9HA 4GLTA 5F07A 2JSYA 4LLRA 3WD6A 2OE0A 5LD0A 4ID0A 3RAZA 3CRUA 3FZ9A 4MF6A 1B48A 4AJ8A 3ZIJA 1XWKA 4F0CA 2EC4A 4XS4B 2H76A 2AJQB 4FYUA 12GSA 4DVCA 3UIWA 3HHVA 4MF7A 2L5LA 1A0RP 1OVNA 1PKZA 3DMLA 5ECKB 2X8CA 1TP9A 5E4WA 3KXOA 3IBHA 1HNBA 3VURA 4GSNA 3OR5A 1EEJA 17GSA 2WULA 4PNFA 3ED3A 2V1MA 4HUAA 3BBYA 4TR0A 1AAZA 6GSXA 1GSQA 1PX6A 3W6GA 3K8NA 2REMA 1LU4A 2F8AA 4NHWA 1OC3A 5CO3A 2NVLA 2C80A 3VFIA 4YQVA 4TN8A 1ZOFA 4NHZA 4HS1A 3GRXA 4IGJA 3ZREA 1SYXA 5KN2A 4I5QA 3CBUA 1AUCA 2YOIA 1W89A 1TU7A 1MD3A 5ID2B 1K0OA 5DVBA 5DDLA 3G7JA 3P8WA 4TKYA 1ZL9A 5H5QA 1OC9B 1WIKA 1BQ7A 3QAVA 4MJCA 3P90A 4F2IA 2R3XA 1E6BA 2N5AA 10GSA 1UA5A 2TIRA 1RW1A 5AGYA 3QMXA 9GSSA 4HU9A 2LJKA 3GUSA 2LV3A 2DIZA 5ELAA 3TKSC 2V6KA 2VM2A 4OCFA 1GL8A 1AXDA 4X0XA 5ECHB 1V58A 2VM1A 2JU5A 5A4VA 3IV4A 3PINA 1S3CA 4KDXA 2IN3A 2PN8A 2VCZA 3GV1A 4LA1A 5ECMB 1R5AA 5ELGA 2HNLA 1ZGNA 2MMOA 3C8EA 5IOXA 1VF2A 4NV5A 1H4OA 2I4AA 3ZVJD 1JFUA 5INYA 5LCZA 3QR6A 5F06A 5LNKe 4ECJA 4RI7A 4ZL7A 2FCHA 2GLRA 1BG5A 4EDZA 5ECQB 2GQMA 2H19A 5J4UA 8GSSA 4OFNA 2DJ0A 4BVYA 3KH9A 1GSUA 2H1AA 4GQCA 2ZCTA 2CX3A 3CMIA 2VCWA 2FA8A 5ECNB 3HCZA 3TKSE 1SL1B 3IE3A 4FIWA 2H66A 4KCAA 3F4TA 1GUMA 3F4RA 5GSTA 3GA4A 4ECCA 3UL3A 1FB6A 4WETA 4K0GA 2CV4A 3O76A 5DALB 3HA9A 1X5CA 3HJPA 1ZZYA 3PGTA 4JEDA 4GQFA 1TKDB 1V2AA 2X8GA 1OE7A 3F6DA 1R7HA 4DSQA 1XOAA 5ECIB 2PERA 2H1BA 3RHBA 1O81A 5HQPA 2M80A 1XZOA 4MZCA 3F0IA 3QFBC 3LYKA 1A2JA 2DSAA 4TRXA 1WMJA 2EIQA 2LQOA 4TR1B 1X9WB 1K0BA 2FY6A 1ACVA 1SJZA 1G7EA 4K2DA 4BA7A 2GZZA 4ZILA 1URMA 1Z7RA 2AUVA 3F8UA 3EU3A 3FZAA 5AISA 1PL2A 4J57E 5JWRB 1SYRA 1NM3A 2B7JA 4AJ6A 1FVKA 2JZTA 2D2ZA 2NTOA 5B7CA 1ZMAA 3DD3A 3PR8A 2QKEA 5DQSA 4EF0A 1XBSA 4NPBA 2YPMA 1HYUA 1TRSA 3EMXA 2VD1A 5HR2A 5KN3A 3D6IA 3APSA 5F8BA 4OMVA 1SL2B 3DVXA 3P2AA 3S9FA 4BWSA 1X5DA 2MMAA 3CSIA 3I69A 5IMAA 5D9VA 1JZDA 3HJOA 1HNCA 1V9WA 4KA0A 1WJKA 4XTSA 3QCPA 5D9WA 2CVBA 2H74A 1Z9HA 14GSA 5ABRA 1F9MA 4IELA 1SL0B 2OE3A 2LQQA 2O89A 2H0HA 5A4UA 2YJHA 6GSSA 2HYXA 2YWIA 2DLXA 4N0VA 2VCVA 2ON7A 1EV9A 1QXHA 4F82A 1UN2A 1EZKA 4MMMA 2G2QA 1OC8A 3IA1A 1K3YA 4PQ1A 2X64A 2CZ3A 3F4SA 2C3QA 2LUSA 1I9DA 1T00A 2NBSA 4PQIA 4BVXA 2GDRA 3HYPA 3C1SA 2VOCA 4EDYA 1QK8A 4BL7A 3KZQA 3QOUA 2KHPA 1V98A 1ERWA 4RQRA 4WBRD 4PUFC 2PMTA 1BAYA 4ZB8A 2H01A 5B6MA 2HXKA 5ECLB 4I8BA 3DXBA 3IAM2 3AY8A 1F3AA 4G19A 5CRDA 2JZSA 1EWXA 2C1YA 4XS6A 2O8VB 3GYKA 2F51A 1FB0A 3HVVA 3F3RA 2GQLA 1B8XA 2C0GA 3DRNA 3RHCA 1JHBA 2CQ9A 3QFAC 2HRNA 19GSA 3EYTA 2H6YA 1AQVA 3GURA 2B5YA 4IJ3A 5GAPD 3KIJA 1TI1A 3ZL5A 4K7NA 1VF1A 1T3BA 3UOMA 5CREA 5CYYA 4IKHA 2GZYA 2L4QA 3RPPA 1PA3A 3MDKA 4XRAA 4POBA 1DBYA 3EINA 3WGDA 3ERFA 3D0ZA 3GHAA 3WT1A 3FK8A 3HVXA 3C73A 3M3MA 4GXZA 3TJBA 3D22A 4N11A 3ZITA 2HZEB 4MCUA 2R4VA 3W8JA 1PD21 3ZLPA 2QSIA 1GSSA 3Q6OA 3J7Yb 1O6JA 2L5OA 5FHIA 2YP6A 1YKAA 4EVMA 2VCTA 4TW5A 2CT6A 2H1DA 2P5RA 1CQGA 2CX4A 1T4YA 2VD0A 4KDUA 4DSSA 1QUWA 3MWHA 3ZTLA 1AW9A 1XPVA 3F9UA 2GSTA 2GTUA 5L71A 2GQKA 4LL1B 4K1FA 5DALA 4JBBA 4XCSA 3KJYA 2J9HA 3EU4A 3ZIVA 3BCKA 2O85A 2JZRA 4N30A 3TJJA 4OO4A 1QQ2A 2K18A 2DMLA 4HEA2 4K7IA 3BJ5A 3UVHA 4OO5A 1KEBA 2GSSA 5HR1A 4KUNA 3V1WA 2VL3A 4J2FA 2LNTA 3N5OA 1HNAA 6GSUA 3KMOA 3L9SA 4EE0A 1SD8A 5EL8A 3FY7A 1VGLA 1Z6NA 2F8FA 4KX4A 4POMA 1OYJA 4TR1A 3QAWA 22GSA 3ME8A 2V32A 5AN1A 4RQXA 4CHSA 4O5RA 2KP1A 4V2NA 3DEXA 4I2TA 2M46A 3G7IA 3GKMA 4KSMA 5G5FA 3LG6A 3Q74A 3UMAA 3ZFBA 1WE0A 1YJ6A 5CRHA 5IMVA 5F05A 4Z7XA 3TJGA 2DJ2A 4PNGA 4I2UA 4XRDA 3LFLA 1K0AA 3IR4A 1EOGA 1WOUA 4X43A 2WRTA 4DEJA 4CDOA 2CAQA 4MJBA 4QQ7A 4K6XA 2QC7A 1MEKA 2DMMA 3KP8A 4ILFA 2KLXA 5AIVA 4MK3A 1K0CA 3DKSA 5E59A 1GUKA 2E7PA 1QMVA 3H4KA 1GLQA 5IIZA 1XVQA 1JLWA 1RQMA 3JCML 5J5NA 1SK2A 3TRQA 1XW5A 4KB3A 4LMVA 1HQOA 1NHYA 4HU7A 1N2AA 2YZUA 4NV2A 1EP8A 2K8SA 1PX7A 2G0FA 4NMUA 4I97A 3A2WA 5FWGA 1R5PA 3H79A 2IPAA 4HOJA 1AQWA 2F9SA 2V2GA 4MZBA 3E3EA 4F9ZA 4MH3A 1EEMA 1NSWA 4D73A 1YF1A 4QL7A 3RBTA 2IMIA 4HJ2A 6GSTA 4O32A 4V1Ag 3N9JA 1WRYA 2JL4A 1JZWA 1WWJA 4CW9A 4HQSA 4ZL9A 2GT6A 2TRCP 3O6TA 2BTOT 3D5JA 2VLUA 1XFLA 2H75A 1GWCA 1J0FA 1SKRB 3VI5A 2V6OA 4OCEA 3E9JB 1PN9A 2HLSA 3TOTA 1LBKA 5DCGA 1A23A 3H93A 1KNGA 3FRCA 3M9JA 5ECRB 5GZZB 3HXSA 6GSYA 1W4VA 2IMFA 3GL3A 1GULA 2GT5A 5DAKA 1YKCA 1MTCA 4L5LA 4NAXA 4ZB6A 4NWYA 2FGXA 3GN3A 4OWYA 4Q5RA 1SKWB 2RUFA 3ME7A 3RDWA 1BJXA 4WF5A 2RUEA 5D93A 4IP6A 2YN1A 3RPNA 1F3BA 2K9FA 3ZMLA 2IMEA 3TKRA 5B8AA 3C71A 1Y6EA 2GZPA 3IPZA 5A4WA 3HZ8A 1LJRA 2DBCA 5H5RA 1NHOA 4MPFA 2HT9A 1GH2A 1Z3EA 2MBSA 5D9XA 4WKWA 2XC2A 4ISDA 4MJEA 5CNWA 4AGSA 4HDEA 3GIXA 2JACA 1M2BA 3D4MA 2BMXA 3TJKA 4DSSB 1ZYQB 1T7PB 2KOKA 4LL4B 4NXIA 2K6VA 2LS5A 3A3TA 2H6ZA 3WGEA 3KP9A 2A4VA 3FYGA 2CZ2A 2HZEA 2FHEA 3I6AA 3CTGA 2OADA 1TJDA 1EOHA 3FR3A 1X9SB 4MZWA 3P7XA 3WGXA 3GKXA 2FWHA 1Z5YE 2A2SA 3TKSA 3IXRA 5G2ZA 5HR0A 3Q18A 2RIIA 2P0GA 4PX1A 4E8EA 5DCHA 1XIYA 2R37A 1TTZA 2VO4A 4JR4A 3GKKA 2WFCA 4MDCA 3I43A 3CXGA 4GSTA 4KAEA 2VLVA 3VK9A 2PVQA 5EPFA 1YQ1A 3IC4A 3KEBA 4RI6A 4F0BA 3VLNA 3IK9A 2B6MA 1X5EA 2LRNA 4ZBBA 3EVIA 3MNGA 3GX0A 2RM6A 1EGRA 4EXJA 2L4CA 4MPGA 3LEFA 3LGCA 2C3NA 2WS2A 4TVEA 1FO5A 1TI3A 3C7MA 5J3RA 1ST9A 1MD4A 3IOSA 1G7OA 3HZ4A 4KNDA 2OJLA 1GSDA 3A5WA 3LXZA 2VCXA 2XHFA 3DGQA 4O92A 4MP4A 2P5QA 1FW1A 1Z7PA 4XHMA 3TJFA 3CTFA 1S3AA 5HFKA 4IS0A 3C1RA 3DVWA 3EC3A 2YZHA 3VWWA 3J7Yk 3KTBA 1XOBA 4KDYA 1TDIA 1O7UA 2AV4A 4EKZA 1E2YA 1GNEA 2C3TA 5DJMA 5IMFA 1TXXA 3FKFA 1RK4A 4GF0A 3KH7A 4D73B 2IMDA 5IMCA 4FYBA 4N0ZA 2PVOC 4ZB9A 2VUPA 2C0FA 1AIUA 1K0MA 1XW9A 1OE8A 2ZNMA 2IMKA 4WEYA 5JWQB 4PUAA 2P31A 4IJIA 1A2LA 4ML1A 2AYTA 1ERUA 2QGVA 4XS1A 5IOWA 3CYNA 4TXVA 4FH8A 1IYIA 5C04A 3WYWA 4EO3A 5KEJA 3SBCA 1T8EB 2VLTA 4BWQA 1MDIA 6GSWA 2B3SA 1I5GA 1K3LA 3HJMA 4RUVA 1TRVA 4MF5A 3L9VA 2O87A 5CAXA 3KCMA 3VWUA 4G2EA 2RLIA 5DAKB 5B8BA 1DE2A 1WP0A 2H30A 3KTLA 3QD9A 3MAKA 1SK0A 2LRCA 3DWVA 1OKDA 1ZYEA 1PQNA 2WGRA 4KW6A 2HI7A 4ZBAA 1SENA 3F3QA 2E2MA 2PWJA 7GSSA 1DE1A 3L4NA 3WT2A 3HY2A 4V2MA 1G0TA 2HE3A 2C0DA 2FNOA 2MBTA 3ZMKA 2VCQA 4HQZA 4V1Ap 2OBKA 3ZVJA 2L6CA 1F37A 1YDKA 4ULXA 1A8LA 2E2GA 1SJIA 3U5RE 1FHEA 1ON4A 4EL1A 4QL9A 2WZ9A 3GNJA 2VL2A 5KN1A 1EV4A 1YF0A 2CVKA 2GVPA 3ISOA 5A5KA 2H72A 1XWBA 4IW9A 2C0EA 4MH2A 4KGIA 3VPQA 3VWXA 1KBNA 2X99A 1TRUA 2LKUA 4FYCA 3A2XA 1MDJA 1JZRA 2HFDA 3GX8A 4KCEA 1B9XC 1GSEA 1M2AA 2PPTA 1OKTA 4ACSA 5JWOB 3BOAA 2LJRA 4WF4A 2ZUPA 3LQ7A 1U3IA 2IFQA 3TRPA 4V2LA 4YQMA 2YCDA 2FLSA 3UEMA 4YAVA 2BJXA 1X9MB 4GRFA 2VAFA 3GL5A 1DSBA 4LMWA 3HDCA 1C72A 2JSZA 1PL1A 1Y25A 1FOVA 2KUCA 5COHA 6GSVA 2YJ7A 2L59A 1PMTA 3FR9A 1THXA 3GMFA 1HD2A 1BEDA 3H8QA 3GSSA 3LYPA 3LXTA 2MMZA 1GRXA 3EMPA 2WJUA 5GAND 1ZCPA 3LSZA 4OFTA 3GFKA 2K8VA 2H0IA 3TUEA 5IMDA 1K0DA 4PXOA 2WDUA 1U6TA 1WPIA 3TOUA 1TK8B 1SU9A 5D8IA 4K0NA 5JCUA 4X1UA 4KSOA 2V41A 3TCOA 2L57A 3G7YA 5DJLA 5ECPB 3U6VA 1IYHA 2XPDA 2DJKA 2H0GA 2PU9C 4ML6A 1B4PA 4I6XA 2DJJA 3TB2A 1A8YA 2LJAA 3FR6A 4PURA 5GSSA 4MLYA 2EIOA 3PH9A 2LNSA 4JU5A 2N5FA 2XBQA 2H6XA 5J9CA 3BD2A 5CRWA 2LEGA 2RM5A 5IPHA 1PSQA 2DJ3A 3GH6A 2HSYA 5G1KA 4ZIJA 4ECIA
chains in the Genus database with same CATH superfamily
1GTIA 3IRAA 5IO0A 4WR5A 5D73A 5DQYA 1U87A 1M0UA 1ERTA 4WXTA 1H75A 1XVWA 1G6WA 2J23A 1J08A 4G10A 3KGKA 1Q98A 1T4ZA 2N5BA 2NPBA 2O7KA 4AF2A 2GS3A 2C4JA 3QDNA 2X49A 3CRTA 4YH2A 1BYEA 1A2MA 5D9TA 2PGTA 2DC5A 3ERWA 1PFOA 2YNXA 1ERVA 3UBLA 4JE1A 5DBQA 2FA4A 2UZ8A 1XXUA 4GWRA 1GNWA 2LSTA 1USBA 2B5XA 4KE3A 1Q4JA 1TK5B 2OE1A 2R2JA 1GSFA 4Q5QA 1X0RA 3EE2A 2GGTA 1QGVA 1M2DA 4L8EA 2C8UA 1A0FA 3I9V2 2H71A 5H5SA 3UJ1A 2I1UA 5KN0A 5C00A 2AAWA 2DJ1A 4YQUA 1TU8A 3L0HA 1UC7A 1V57A 1M7TA 4YAPA 5G31A 3FHKA 3UBKA 3SWLA 2H70A 2B7KA 3MYDA 1K0NA 1VRSD 4TR3A 5IM9A 1Z6MA 1OAZA 2R5GA 3GTUA 4HJMA 3D4TA 3EURA 4AJ7A 4EC0A 1FVJA 2TRXA 3W8SA 3ZYWA 1THOA 2FWEA 1ML6A 3O3TA 3FZ5A 2CA8A 3HVSA 4USSA 2PUKC 4G0LA 3GH9A 2H1GA 3KM6A 4ZL8A 3TGZA 5EVOA 2NDOA 4DSRA 2IL3A 4HI7A 2L6DA 3TKQA 4N10A 4MABA 5ENUA 5B6NA 5FT3A 3VI7A 2CAIA 1XWGA 2OKAA 4IQAA 2IFQB 3H1NA 3IHQA 1QFNA 1K3OA 4POKA 1R4WA 1JZOA 4GSSA 4P3YB 5IMZA 2FUG2 5BRTA 5IQYA 1XCCA 1VF4A 3HKRA 1TOFA 1F2EA 2GSQA 4JZQA 1CQHA 3UVTA 3QPMA 3VPTA 4TR4A 5G5EA 4IP1A 4PGTA 3FEUA 1GLPA 1BX9A 4ZBDA 1B4QA 4L0UA 2VL9A 1XW6A 4K7OA 3IAS2 4TXOA 3MSZA 3TRXA 4HZ4A 1S3DA 2YWMA 1DUGA 4GCIA 5ECOB 3TDGA 3ERGA 5HR3A 3IDVA 4O7HA 2Z9SA 2LRTA 1SKSB 5CRGA 3D21A 4WBJA 3FZ4A 3LJRA 4ZXGA 3FW2A 3QAGA 1N8JA 1EP7A 3HD5A 4TOPA 1YEPA 1M3JA 4XS4A 1M9BA 1PGTA 4OD7A 3M8NA 2OBIA 1FG4A 5IO2A 3ZRDA 3E0UA 3UARA 3L9UA 5EY6A 1FAAA 2PBJA 2ES7A 2R0CA 2FWGA 1SD9A 2X8HA 4Q5NA 3Q19A 3HVNA 1TW9A 3ZZXA 1A24A 1O73A 4G9HA 4F03A 5F0GA 5JCWA 1G6YA 5HFGA 1YY7A 4PQHA 5J41A 2I81A 1J9BA 1YEXA 11GSA 2WCIA 2R0GA 3F63A 2IJYA 2YWNA 1GTBA 3A2VA 4K8MA 3M9KA 2YANA 4J56E 1AC1A 1ILOA 2B5EA 1UVZA 4K5RA 5AIXA 1PKWA 1ABAA 3NZNA 4L5OA 4KH7A 1SJ6A 1EGOA 2VL2C 5J9BA 2B1LA 4FO5A 2OA7A 2XPEA 4E8HA 4H86A 4WR4A 2YV9A 4XIHA 2IWTA 3M0FA 3GSTA 2WB9A 3L78A 4IQ1A 2ALBA 3KD0A 5ID2A 1GUHA 1KTEA 1GTUA 5IPGA 2YV7A 3TKPA 3NOFA 1O8WA 4MA9A 3VWVA 4OFMA 2H73A 1OC9A 4ECBA 4JRRA 1XWAA 1XWCA 2ON5A 5BMUA 1GSYA 2HZFA 2JADA 2A2RA 2EIRA 3DYRA 20GSA 2CVDA 1JLVA 2DIYA 2AB6A 4Q5FA 5G1LA 1F6MC 3DIEA 3GTUB 2HSHA 2KP2A 1GTAA 1GP1A 4MJAA 3IHGA 5D96A 1U88A 3F6FA 1PRXA 3LORA 4IBPA 4BVYB 1O8XA 1O85A 13GSA 2AHEA 3APQA 3CSJA 1AQXA 3LWAA 2B1KA 1PN0A 2FWFA 3GKNA 4HZ2A 4BPYA 4G0KA 4K9ZA 1M9AA 1VF3A 1YZXA 18GSA 1T1VA 1U3AA 2R6KA 5G30A 2VIMA 2M72A 3APOA 4IN0A 4Z2TA 1B9YC 2GSRA 2HRFA 1TRWA 4L0WA 2OACA 3ZFLA 5ECSA 3M1GA 2IIYA 3BCIA 1SK1A 4IVFA 5JCGA 2XBIA 4GTUA 2LTKA 1MDKA 4IHUA 3IK7A 1R26A 4EUYA 2H8LA 3G9BA 2MYGA 2YWOA 1TK0B 3EWLA 2I3YA 2MZCA 3NIVA 1NW2A 2E0QA 4POLA 3US3A 1M99A 2FD3A 3CSHA 4KF9A 2MMNA 2F3MA 1V40A 5HFIA 3R2QA 4TXOB 3KMNA 5CP1A 3UAPA 4JR6A 16GSA 2I9HA 4GLTA 5F07A 2JSYA 4K2XA 4LLRA 3WD6A 2OE0A 5LD0A 4ID0A 3RAZA 4MNNA 3CRUA 3FZ9A 4MF6A 1B48A 4AJ8A 3ZIJA 1XWKA 4F0CA 2EC4A 4XS4B 2H76A 2AJQB 4FYUA 1ZYPA 12GSA 4DVCA 1XG8A 3UIWA 3HHVA 4MF7A 2L5LA 1A0RP 1OVNA 1PKZA 3DMLA 5ECKB 2X8CA 1TP9A 5E4WA 3KXOA 3IBHA 1HNBA 3VURA 4GSNA 3OR5A 1EEJA 2HSMA 17GSA 2WULA 4PNFA 3ED3A 2V1MA 4HUAA 3BBYA 4TR0A 1AAZA 6GSXA 1GSQA 1PX6A 3W6GA 3K8NA 2REMA 1LU4A 2F8AA 4NHWA 1OC3A 5CO3A 2NVLA 2C80A 3VFIA 4YQVA 4TN8A 1ZOFA 4NHZA 4HS1A 3GRXA 4IGJA 3ZREA 1SYXA 5KN2A 4I5QA 3CBUA 1AUCA 4G0IA 3EPTA 2YOIA 1W89A 1TU7A 1MD3A 5ID2B 4BL7B 1K0OA 5DVBA 5DDLA 3G7JA 3P8WA 4TKYA 1ZL9A 5H5QA 1OC9B 1WIKA 1BQ7A 3QAVA 4MJCA 3P90A 4F2IA 2R3XA 1E6BA 2N5AA 10GSA 1UA5A 2TIRA 3A5IA 1RW1A 5AGYA 3QMXA 9GSSA 2HRKA 2LJKA 4HU9A 3GUSA 2LV3A 2DIZA 5ELAA 3TKSC 2V6KA 2VM2A 4OCFA 1GL8A 1AXDA 4X0XA 5ECHB 1V58A 2VM1A 2JU5A 5A4VA 3IV4A 3PINA 1S3CA 4KDXA 2IN3A 2PN8A 2VCZA 3GV1A 4LA1A 5ECMB 1R5AA 5ELGA 3MIXA 2HNLA 1ZGNA 2MMOA 3C8EA 5IOXA 1VF2A 4NV5A 1H4OA 2I4AA 3ZVJD 1JFUA 5INYA 5LCZA 3QR6A 5F06A 5LNKe 4ECJA 4RI7A 4ZL7A 2FCHA 2GLRA 1BG5A 4EDZA 5ECQB 2GQMA 2H19A 5J4UA 8GSSA 4OFNA 2DJ0A 4BVYA 3KH9A 1GSUA 2H1AA 4GQCA 2ZCTA 2CX3A 3CMIA 2VCWA 2FA8A 5ECNB 3HCZA 3TKSE 1SL1B 3IE3A 4FIWA 2H66A 4KCAA 3F4TA 1GUMA 3F4RA 4X4JA 5GSTA 3GA4A 4ECCA 3UL3A 1FB6A 4WETA 4K0GA 2CV4A 3O76A 5DALB 3HA9A 3FMWA 1X5CA 3HJPA 4BIKA 1ZZYA 3PGTA 4JEDA 4GQFA 1TKDB 1V2AA 2X8GA 1OE7A 3F6DA 1R7HA 4EIQA 4DSQA 2X4AA 1XOAA 5ECIB 2PERA 2H1BA 3RHBA 1O81A 5HQPA 2M80A 1XZOA 4MZCA 3F0IA 3QFBC 3LYKA 1A2JA 4YKFA 2DSAA 4TRXA 1WMJA 3LW9A 2EIQA 2LQOA 4TR1B 1X9WB 1K0BA 2FY6A 1ACVA 1SJZA 1G7EA 4K2DA 4BA7A 2GZZA 4ZILA 1URMA 1Z7RA 2AUVA 3F8UA 3EU3A 3FZAA 1PL2A 4J57E 5AISA 5JWRB 1SYRA 1NM3A 2B7JA 4AJ6A 1FVKA 2JZTA 2D2ZA 2NTOA 5B7CA 1ZMAA 3DD3A 3PR8A 2QKEA 5DQSA 4EF0A 1XBSA 4NPBA 2YPMA 1HYUA 1TRSA 3EMXA 2VD1A 5HR2A 5KN3A 3D6IA 3APSA 4O5UA 5F8BA 4OMVA 1SL2B 3DVXA 3P2AA 3S9FA 4BWSA 1X5DA 2MMAA 3CSIA 3I69A 5IMAA 5D9VA 1JZDA 3HJOA 1HNCA 1V9WA 4KA0A 1WJKA 4XTSA 3QCPA 5D9WA 2CVBA 2H74A 1Z9HA 14GSA 5ABRA 1F9MA 4IELA 1SL0B 2OE3A 2LQQA 2O89A 2H0HA 5A4UA 2YJHA 6GSSA 2HYXA 2YWIA 2DLXA 4N0VA 2VCVA 2ON7A 1EV9A 1QXHA 4F82A 1UN2A 1EZKA 4MMMA 2G2QA 4CY6A 1OC8A 3IA1A 1K3YA 4PQ1A 2X64A 2CZ3A 3F4SA 2C3QA 2LUSA 1I9DA 1T00A 2NBSA 4PQIA 4BVXA 2GDRA 3HYPA 3C1SA 2VOCA 4EDYA 1QK8A 4BL7A 3KZQA 3QOUA 2KHPA 1V98A 1ERWA 4RQRA 4WBRD 4PUFC 2PMTA 1BAYA 4ZB8A 2H01A 5B6MA 2HXKA 5ECLB 4I8BA 3DXBA 4PTSA 3IAM2 3AY8A 1F3AA 4G19A 5CRDA 2JZSA 1EWXA 2C1YA 4XS6A 2O8VB 3GYKA 2F51A 1FB0A 3HVVA 3F3RA 2GQLA 1B8XA 2C0GA 3DRNA 3RHCA 1JHBA 2CQ9A 3QFAC 2HRNA 19GSA 1M3IA 3PPUA 3EYTA 2H6YA 1AQVA 3GURA 2B5YA 4IJ3A 5GAPD 3KIJA 1TI1A 3ZL5A 4K7NA 1VF1A 1T3BA 3UOMA 5CREA 5CYYA 4IKHA 2GZYA 2L4QA 3RPPA 1PA3A 3MDKA 4XRAA 4POBA 1DBYA 3EINA 3WGDA 3ERFA 3D0ZA 3GHAA 3WT1A 3FK8A 3HVXA 4A5PA 3C73A 3M3MA 4GXZA 3TJBA 3D22A 4N11A 3ZITA 2HZEB 4MCUA 2R4VA 3W8JA 1PD21 3ZLPA 2QSIA 1GSSA 3Q6OA 3J7Yb 1O6JA 2L5OA 5FHIA 2YP6A 1YKAA 4EVMA 2VCTA 4TW5A 2CT6A 2H1DA 2P5RA 1CQGA 2CX4A 1T4YA 2VD0A 4KDUA 4DSSA 1QUWA 3MWHA 3ZTLA 1AW9A 1XPVA 3F9UA 2GSTA 2GTUA 5L71A 2GQKA 4LL1B 4K1FA 5DALA 4JBBA 4XCSA 3KJYA 2J9HA 3EU4A 3ZIVA 3BCKA 2O85A 2JZRA 4N30A 3TJJA 4OO4A 1QQ2A 2K18A 2DMLA 4HEA2 4K7IA 3BJ5A 3UVHA 4OO5A 1KEBA 2GSSA 5HR1A 4KUNA 3V1WA 2VL3A 4J2FA 2LNTA 3N5OA 1HNAA 4HSCX 6GSUA 3KMOA 3L9SA 4EE0A 1SD8A 5EL8A 3FY7A 4CY8A 1VGLA 1Z6NA 2F8FA 4KX4A 4POMA 1OYJA 4TR1A 3QAWA 22GSA 3ME8A 2V32A 5AN1A 4RQXA 4CHSA 4O5RA 2KP1A 4V2NA 3DEXA 4I2TA 2M46A 3G7IA 3GKMA 4KSMA 5G5FA 3LG6A 3Q74A 3UMAA 3ZFBA 1WE0A 1YJ6A 5CRHA 5IMVA 5F05A 4Z7XA 3TJGA 2DJ2A 4PNGA 4I2UA 4XRDA 3LFLA 1K0AA 3IR4A 1EOGA 1WOUA 4X43A 2WRTA 4DEJA 4CDOA 2CAQA 4MJBA 4QQ7A 4K6XA 2QC7A 1MEKA 2DMMA 3KP8A 4ILFA 2KLXA 5AIVA 4MK3A 1K0CA 3DKSA 4ICYA 5E59A 1GUKA 2E7PA 1QMVA 3H4KA 1GLQA 5IIZA 1XVQA 1JLWA 1RQMA 3JCML 5J5NA 1SK2A 3TRQA 1XW5A 2QA1A 4KB3A 4LMVA 1HQOA 1NHYA 4HU7A 1N2AA 2YZUA 4NV2A 1EP8A 2K8SA 1PX7A 2A4HA 2G0FA 4NMUA 4I97A 1ZYNA 3A2WA 5FWGA 1R5PA 3H79A 2IPAA 4HOJA 1AQWA 2F9SA 2V2GA 4BVXB 4MZBA 3E3EA 4F9ZA 4MH3A 1EEMA 1NSWA 4D73A 1YF1A 4QL7A 3RBTA 2IMIA 4HJ2A 6GSTA 4O32A 4V1Ag 3N9JA 1WRYA 2JL4A 1JZWA 1WWJA 4CW9A 4HQSA 4ZL9A 2GT6A 2TRCP 3O6TA 2BTOT 3D5JA 2VLUA 1XFLA 2H75A 1GWCA 1J0FA 1SKRB 3VI5A 2V6OA 4OCEA 3E9JB 1PN9A 2HLSA 3TOTA 1LBKA 5DCGA 1A23A 3H93A 3M9JA 1KNGA 3FRCA 5ECRB 5GZZB 3HXSA 6GSYA 1W4VA 2IMFA 3GL3A 4FQUA 1GULA 4EIPA 2GT5A 5DAKA 1YKCA 1MTCA 4L5LA 4NAXA 4ZB6A 4NWYA 2FGXA 3GN3A 4OWYA 4Q5RA 1SKWB 2RUFA 3ME7A 3RDWA 1BJXA 4WF5A 2RUEA 5D93A 4IP6A 2YN1A 3RPNA 1F3BA 2K9FA 3ZMLA 2IMEA 3TKRA 5B8AA 3C71A 1Y6EA 2GZPA 3IPZA 5A4WA 3HZ8A 1LJRA 2DBCA 5H5RA 1NHOA 4MPFA 2QA2A 2HT9A 1GH2A 1Z3EA 2MBSA 5D9XA 2DKIA 4WKWA 2XC2A 4ISDA 4MJEA 5CNWA 4AGSA 4HDEA 3GIXA 2JACA 1M2BA 3D4MA 2BMXA 3TJKA 4DSSB 4Z2RA 1ZYQB 1T7PB 2KOKA 4LL4B 4NXIA 2K6VA 2LS5A 3A3TA 2H6ZA 3WGEA 3KP9A 2A4VA 3FYGA 2CZ2A 2HZEA 2FHEA 3I6AA 3CTGA 2OADA 1TJDA 5KOXA 1EOHA 3FR3A 1X9SB 4MZWA 3P7XA 3WGXA 3GKXA 4Z2UA 2FWHA 1Z5YE 2A2SA 3TKSA 3IXRA 5G2ZA 5HR0A 3Q18A 2RIIA 2P0GA 4PX1A 4E8EA 5DCHA 1XIYA 2R37A 1TTZA 2VO4A 4JR4A 3GKKA 2WFCA 4MDCA 3I43A 3CXGA 4GSTA 4KAEA 2VLVA 3VK9A 2PVQA 5EPFA 1YQ1A 3IC4A 2DKHA 3KEBA 4RI6A 4F0BA 3VLNA 3IK9A 2B6MA 1X5EA 2LRNA 4ZBBA 3EVIA 3MNGA 3GX0A 2RM6A 1EGRA 4EXJA 2L4CA 4MPGA 3LEFA 3LGCA 2C3NA 2WS2A 4TVEA 1FO5A 1TI3A 3C7MA 5J3RA 1ST9A 1MD4A 3IOSA 1G7OA 3HZ4A 4KNDA 2OJLA 1GSDA 1FOHA 3A5WA 3LXZA 2VCXA 2XHFA 3DGQA 4O92A 4MP4A 2P5QA 1FW1A 1Z7PA 4XHMA 3TJFA 3CTFA 1S3AA 5HFKA 4IS0A 3C1RA 3DVWA 5KOWA 3EC3A 2YZHA 3VWWA 3J7Yk 3KTBA 1XOBA 4KDYA 1TDIA 1O7UA 2AV4A 4EKZA 1E2YA 1GNEA 2C3TA 5DJMA 5IMFA 1TXXA 3FKFA 1RK4A 4GF0A 3KH7A 4D73B 2IMDA 5IMCA 4FYBA 4N0ZA 2PVOC 4ZB9A 2VUPA 2C0FA 1AIUA 1K0MA 1XW9A 1OE8A 2ZNMA 2IMKA 4WEYA 5JWQB 4PUAA 2P31A 4IJIA 1A2LA 4ML1A 2AYTA 1ERUA 2QGVA 4XS1A 5IOWA 3CYNA 4TXVA 4FH8A 1IYIA 5C04A 3WYWA 4EO3A 5KEJA 3SBCA 1T8EB 2VLTA 4BWQA 1MDIA 2HRAA 6GSWA 2B3SA 1I5GA 1K3LA 3HJMA 4RUVA 1TRVA 4MF5A 3L9VA 2O87A 5CAXA 3CQFA 3KCMA 3VWUA 4G2EA 2RLIA 5DAKB 5B8BA 1DE2A 1WP0A 2H30A 3KTLA 3QD9A 2A2PA 3MAKA 1SK0A 2LRCA 3DWVA 1OKDA 1ZYEA 1PQNA 2WGRA 4KW6A 2HI7A 4ZBAA 1SENA 3F3QA 2E2MA 2PWJA 7GSSA 1DE1A 3L4NA 3WT2A 3HY2A 4V2MA 1G0TA 2HE3A 2C0DA 2FNOA 2MBTA 3ZMKA 2VCQA 4HQZA 4V1Ap 2OBKA 3ZVJA 2L6CA 1F37A 1YDKA 4ULXA 1A8LA 2E2GA 4YKGA 1SJIA 3U5RE 1FHEA 1ON4A 4EL1A 4QL9A 2WZ9A 3GNJA 2VL2A 5KN1A 1EV4A 1YF0A 2CVKA 2GVPA 3ISOA 5A5KA 2H72A 1XWBA 4IW9A 2C0EA 4MH2A 4KGIA 3VPQA 3VWXA 1KBNA 2X99A 1TRUA 2LKUA 4FYCA 3R3EA 3A2XA 1MDJA 1JZRA 2HFDA 3GX8A 4KCEA 1B9XC 1GSEA 2R0PA 1M2AA 2PPTA 1OKTA 4ACSA 5JWOB 3BOAA 2LJRA 4WF4A 2ZUPA 3LQ7A 1U3IA 2IFQA 3TRPA 4V2LA 4YQMA 2YCDA 2FLSA 3UEMA 4YAVA 2BJXA 1X9MB 4GRFA 2VAFA 3GL5A 1DSBA 4LMWA 3HDCA 1C72A 2JSZA 1PL1A 1Y25A 1FOVA 2KUCA 5COHA 6GSVA 2YJ7A 2L59A 1PMTA 3FR9A 1THXA 3GMFA 1HD2A 1BEDA 3H8QA 3GSSA 3LYPA 3LXTA 2MMZA 1GRXA 3EMPA 2WJUA 5GAND 1ZCPA 3LSZA 1S3RA 4OFTA 3GFKA 2K8VA 2H0IA 3IC8A 3TUEA 5IMDA 1K0DA 4O5QA 4PXOA 2WDUA 1U6TA 1WPIA 3TOUA 1TK8B 1SU9A 5D8IA 4K0NA 5JCUA 4X1UA 4KSOA 2V41A 3TCOA 2L57A 3G7YA 5DJLA 5ECPB 3U6VA 1IYHA 2XPDA 2DJKA 2H0GA 2PU9C 4ML6A 1B4PA 4I6XA 2DJJA 3TB2A 1A8YA 2LJAA 3FR6A 4PURA 5GSSA 4MLYA 2EIOA 3PH9A 2LNSA 4JU5A 2N5FA 2XBQA 2H6XA 5J9CA 3BD2A 5CRWA 2LEGA 2RM5A 5IPHA 4K5SA 1PSQA 2DJ3A 3GH6A 2HSYA 5G1KA 4ZIJA 4ECIA
chains in the Genus database with same CATH topology
1GTIA 3IRAA 5IO0A 4WR5A 5D73A 5DQYA 1U87A 1M0UA 1ERTA 4WXTA 1H75A 1XVWA 1G6WA 2J23A 1J08A 4G10A 3KGKA 1Q98A 1T4ZA 2N5BA 2NPBA 2O7KA 4AF2A 2GS3A 2C4JA 3QDNA 2X49A 3CRTA 4YH2A 1BYEA 1A2MA 5D9TA 2PGTA 2DC5A 3ERWA 2YNXA 1ERVA 3UBLA 4JE1A 5DBQA 2FA4A 2UZ8A 1XXUA 4GWRA 1GNWA 2LSTA 1USBA 2B5XA 4KE3A 1Q4JA 1TK5B 2OE1A 2R2JA 1GSFA 4Q5QA 1X0RA 3EE2A 2GGTA 1QGVA 1M2DA 4L8EA 2C8UA 1A0FA 3I9V2 2H71A 5H5SA 3UJ1A 2I1UA 5KN0A 5C00A 2AAWA 2DJ1A 4YQUA 1TU8A 3L0HA 1UC7A 1V57A 1M7TA 4YAPA 5G31A 3FHKA 3UBKA 3SWLA 2H70A 2B7KA 3MYDA 1K0NA 1VRSD 4TR3A 5IM9A 1Z6MA 1OAZA 2R5GA 3GTUA 4HJMA 3D4TA 3EURA 4AJ7A 4EC0A 1FVJA 2TRXA 3W8SA 3ZYWA 1THOA 2FWEA 1ML6A 3O3TA 3FZ5A 2CA8A 3HVSA 4USSA 2PUKC 4G0LA 3GH9A 2H1GA 3KM6A 4ZL8A 3TGZA 5EVOA 2NDOA 4DSRA 2IL3A 4HI7A 2L6DA 3TKQA 4N10A 4MABA 5ENUA 5B6NA 5FT3A 3VI7A 2CAIA 1XWGA 2OKAA 4IQAA 2IFQB 3H1NA 3IHQA 1QFNA 1K3OA 4POKA 1R4WA 1JZOA 4GSSA 4P3YB 5IMZA 2FUG2 5BRTA 5IQYA 1XCCA 1VF4A 3HKRA 1TOFA 1F2EA 2GSQA 4JZQA 1CQHA 3UVTA 3QPMA 3VPTA 4TR4A 5G5EA 4IP1A 4PGTA 3FEUA 1GLPA 1BX9A 4ZBDA 1B4QA 4L0UA 2VL9A 1XW6A 4K7OA 3IAS2 4TXOA 3MSZA 3TRXA 4HZ4A 1S3DA 2YWMA 1DUGA 4GCIA 5ECOB 3TDGA 3ERGA 5HR3A 3IDVA 4O7HA 2Z9SA 2LRTA 1SKSB 5CRGA 3D21A 4WBJA 3FZ4A 3LJRA 4ZXGA 3FW2A 3QAGA 1N8JA 1EP7A 3HD5A 4TOPA 1YEPA 4XS4A 1M9BA 1PGTA 4OD7A 3M8NA 2OBIA 1FG4A 5IO2A 3ZRDA 3E0UA 3UARA 3L9UA 5EY6A 1FAAA 2PBJA 2ES7A 2R0CA 2FWGA 1SD9A 2X8HA 4Q5NA 3Q19A 1TW9A 3ZZXA 1A24A 1O73A 4G9HA 4F03A 5F0GA 5JCWA 1G6YA 5HFGA 1YY7A 4PQHA 5J41A 2I81A 1J9BA 1YEXA 11GSA 2WCIA 2R0GA 3F63A 2IJYA 2YWNA 1GTBA 3A2VA 4K8MA 3M9KA 2YANA 4J56E 1AC1A 1ILOA 2B5EA 1UVZA 4K5RA 5AIXA 1PKWA 1ABAA 3NZNA 4L5OA 4KH7A 1SJ6A 1EGOA 2VL2C 5J9BA 2B1LA 4FO5A 2OA7A 2XPEA 4E8HA 4H86A 4WR4A 2YV9A 4XIHA 2IWTA 3M0FA 3GSTA 2WB9A 3L78A 4IQ1A 2ALBA 3KD0A 5ID2A 1GUHA 1KTEA 1GTUA 5IPGA 2YV7A 3TKPA 3NOFA 1O8WA 4MA9A 3VWVA 4OFMA 2H73A 1OC9A 4ECBA 4JRRA 1XWAA 1XWCA 2ON5A 5BMUA 1GSYA 2HZFA 2JADA 2A2RA 2EIRA 3DYRA 20GSA 2CVDA 1JLVA 2DIYA 2AB6A 4Q5FA 5G1LA 1F6MC 3DIEA 3GTUB 2HSHA 2KP2A 1GTAA 1GP1A 4MJAA 3IHGA 5D96A 1U88A 3F6FA 1PRXA 3LORA 4IBPA 4BVYB 1O8XA 1O85A 13GSA 2AHEA 3APQA 3CSJA 1AQXA 3LWAA 2B1KA 1PN0A 2FWFA 3GKNA 4HZ2A 4BPYA 4G0KA 4K9ZA 1M9AA 1VF3A 1YZXA 18GSA 1T1VA 1U3AA 2R6KA 5G30A 2VIMA 2M72A 3APOA 4IN0A 4Z2TA 1B9YC 2GSRA 2HRFA 1TRWA 4L0WA 2OACA 3ZFLA 5ECSA 3M1GA 2IIYA 3BCIA 1SK1A 4IVFA 5JCGA 2XBIA 4GTUA 2LTKA 1MDKA 4IHUA 3IK7A 1R26A 4EUYA 2H8LA 3G9BA 2MYGA 2YWOA 1TK0B 3EWLA 2I3YA 2MZCA 3NIVA 1NW2A 2E0QA 4POLA 3US3A 1M99A 2FD3A 3CSHA 4KF9A 2MMNA 2F3MA 1V40A 5HFIA 3R2QA 4TXOB 3KMNA 5CP1A 3UAPA 4JR6A 16GSA 2I9HA 4GLTA 5F07A 2JSYA 4K2XA 4LLRA 3WD6A 2OE0A 5LD0A 4ID0A 3RAZA 4MNNA 3CRUA 3FZ9A 4MF6A 1B48A 4AJ8A 3ZIJA 1XWKA 4F0CA 2EC4A 4XS4B 2H76A 2AJQB 4FYUA 1ZYPA 12GSA 4DVCA 3UIWA 3HHVA 4MF7A 2L5LA 1A0RP 1OVNA 1PKZA 3DMLA 5ECKB 2X8CA 1TP9A 5E4WA 3KXOA 3IBHA 1HNBA 3VURA 4GSNA 3OR5A 1EEJA 2HSMA 17GSA 2WULA 4PNFA 3ED3A 2V1MA 4HUAA 3BBYA 4TR0A 1AAZA 6GSXA 1GSQA 1PX6A 3W6GA 3K8NA 2REMA 1LU4A 2F8AA 4NHWA 1OC3A 5CO3A 2NVLA 2C80A 3VFIA 4YQVA 4TN8A 1ZOFA 4NHZA 4HS1A 3GRXA 4IGJA 3ZREA 1SYXA 5KN2A 4I5QA 3CBUA 1AUCA 4G0IA 3EPTA 2YOIA 1W89A 1TU7A 1MD3A 5ID2B 4BL7B 1K0OA 5DVBA 5DDLA 3G7JA 3P8WA 4TKYA 1ZL9A 5H5QA 1OC9B 1WIKA 1BQ7A 3QAVA 4MJCA 3P90A 4F2IA 2R3XA 1E6BA 2N5AA 10GSA 1UA5A 2TIRA 3A5IA 1RW1A 5AGYA 3QMXA 9GSSA 2HRKA 2LJKA 4HU9A 3GUSA 2LV3A 2DIZA 5ELAA 3TKSC 2V6KA 2VM2A 4OCFA 1GL8A 1AXDA 4X0XA 5ECHB 1V58A 2VM1A 2JU5A 5A4VA 3IV4A 3PINA 1S3CA 4KDXA 2IN3A 2PN8A 2VCZA 3GV1A 4LA1A 5ECMB 1R5AA 5ELGA 3MIXA 2HNLA 1ZGNA 2MMOA 3C8EA 5IOXA 1VF2A 4NV5A 1H4OA 2I4AA 3ZVJD 1JFUA 5INYA 5LCZA 3QR6A 5F06A 5LNKe 4ECJA 4RI7A 4ZL7A 2FCHA 2GLRA 1BG5A 4EDZA 5ECQB 2GQMA 2H19A 5J4UA 8GSSA 4OFNA 2DJ0A 4BVYA 3KH9A 1GSUA 2H1AA 4GQCA 2ZCTA 2CX3A 3CMIA 2VCWA 2FA8A 5ECNB 3HCZA 3TKSE 1SL1B 3IE3A 4FIWA 2H66A 4KCAA 3F4TA 1GUMA 3F4RA 4X4JA 5GSTA 3GA4A 4ECCA 3UL3A 1FB6A 4WETA 4K0GA 2CV4A 3O76A 5DALB 3HA9A 3FMWA 1X5CA 3HJPA 1ZZYA 3PGTA 4JEDA 4GQFA 1TKDB 1V2AA 2X8GA 1OE7A 3F6DA 1R7HA 4EIQA 4DSQA 2X4AA 1XOAA 5ECIB 2PERA 2H1BA 3RHBA 1O81A 5HQPA 2M80A 1XZOA 4MZCA 3F0IA 3QFBC 3LYKA 1A2JA 4YKFA 2DSAA 4TRXA 1WMJA 3LW9A 2EIQA 2LQOA 4TR1B 1X9WB 1K0BA 2FY6A 1ACVA 1SJZA 1G7EA 4K2DA 4BA7A 2GZZA 4ZILA 1URMA 1Z7RA 2AUVA 3F8UA 3EU3A 3FZAA 5AISA 1PL2A 4J57E 5JWRB 1SYRA 1NM3A 2B7JA 4AJ6A 1FVKA 2JZTA 2D2ZA 2NTOA 5B7CA 1ZMAA 3DD3A 3PR8A 2QKEA 5DQSA 4EF0A 1XBSA 4NPBA 2YPMA 1HYUA 1TRSA 3EMXA 2VD1A 5HR2A 5KN3A 3D6IA 3APSA 4O5UA 5F8BA 4OMVA 1SL2B 3DVXA 3P2AA 3S9FA 4BWSA 1X5DA 2MMAA 3CSIA 3I69A 5IMAA 5D9VA 1JZDA 3HJOA 1HNCA 1V9WA 4KA0A 1WJKA 4XTSA 3QCPA 5D9WA 2CVBA 2H74A 1Z9HA 14GSA 5ABRA 1F9MA 4IELA 1SL0B 2OE3A 2LQQA 2O89A 2H0HA 5A4UA 2YJHA 6GSSA 2HYXA 2YWIA 2DLXA 4N0VA 2VCVA 2ON7A 1EV9A 1QXHA 4F82A 1UN2A 1EZKA 4MMMA 2G2QA 4CY6A 1OC8A 3IA1A 1K3YA 4PQ1A 2X64A 2CZ3A 3F4SA 2C3QA 2LUSA 1I9DA 1T00A 2NBSA 4PQIA 4BVXA 2GDRA 3HYPA 3C1SA 2VOCA 4EDYA 1QK8A 4BL7A 3KZQA 3QOUA 2KHPA 1V98A 1ERWA 4RQRA 4WBRD 4PUFC 2PMTA 1BAYA 4ZB8A 2H01A 5B6MA 2HXKA 5ECLB 4I8BA 3DXBA 4PTSA 3IAM2 3AY8A 1F3AA 4G19A 5CRDA 2JZSA 1EWXA 2C1YA 4XS6A 2O8VB 3GYKA 2F51A 1FB0A 3HVVA 3F3RA 2GQLA 1B8XA 2C0GA 3DRNA 3RHCA 1JHBA 2CQ9A 3QFAC 2HRNA 19GSA 3PPUA 3EYTA 2H6YA 1AQVA 3GURA 2B5YA 4IJ3A 5GAPD 3KIJA 1TI1A 3ZL5A 4K7NA 1VF1A 1T3BA 3UOMA 5CREA 5CYYA 4IKHA 2GZYA 2L4QA 3RPPA 1PA3A 3MDKA 4XRAA 4POBA 1DBYA 3EINA 3WGDA 3ERFA 3D0ZA 3GHAA 3WT1A 3FK8A 3HVXA 4A5PA 3C73A 3M3MA 4GXZA 3TJBA 3D22A 4N11A 3ZITA 2HZEB 4MCUA 2R4VA 3W8JA 1PD21 3ZLPA 2QSIA 1GSSA 3Q6OA 3J7Yb 1O6JA 2L5OA 5FHIA 2YP6A 1YKAA 4EVMA 2VCTA 4TW5A 2CT6A 2H1DA 2P5RA 1CQGA 2CX4A 1T4YA 2VD0A 4KDUA 4DSSA 1QUWA 3MWHA 3ZTLA 1AW9A 1XPVA 3F9UA 2GSTA 2GTUA 5L71A 2GQKA 4LL1B 4K1FA 5DALA 4JBBA 4XCSA 3KJYA 2J9HA 3EU4A 3ZIVA 3BCKA 2O85A 2JZRA 4N30A 3TJJA 4OO4A 1QQ2A 2K18A 2DMLA 4HEA2 4K7IA 3BJ5A 3UVHA 4OO5A 1KEBA 2GSSA 5HR1A 4KUNA 3V1WA 2VL3A 4J2FA 2LNTA 3N5OA 1HNAA 6GSUA 3KMOA 3L9SA 4EE0A 1SD8A 5EL8A 3FY7A 4CY8A 1VGLA 1Z6NA 2F8FA 4KX4A 4POMA 1OYJA 4TR1A 3QAWA 22GSA 3ME8A 2V32A 5AN1A 4RQXA 4CHSA 4O5RA 2KP1A 4V2NA 3DEXA 4I2TA 2M46A 3G7IA 3GKMA 4KSMA 5G5FA 3LG6A 3Q74A 3UMAA 3ZFBA 1WE0A 1YJ6A 5CRHA 5IMVA 5F05A 4Z7XA 3TJGA 2DJ2A 4PNGA 4I2UA 4XRDA 3LFLA 1K0AA 3IR4A 1EOGA 1WOUA 4X43A 2WRTA 4DEJA 4CDOA 2CAQA 4MJBA 4QQ7A 4K6XA 2QC7A 1MEKA 2DMMA 3KP8A 4ILFA 2KLXA 5AIVA 4MK3A 1K0CA 3DKSA 4ICYA 5E59A 1GUKA 2E7PA 1QMVA 3H4KA 1GLQA 5IIZA 1XVQA 1JLWA 1RQMA 3JCML 5J5NA 1SK2A 3TRQA 1XW5A 2QA1A 4KB3A 4LMVA 1HQOA 1NHYA 4HU7A 1N2AA 2YZUA 4NV2A 1EP8A 2K8SA 1PX7A 2A4HA 2G0FA 4NMUA 4I97A 1ZYNA 3A2WA 5FWGA 1R5PA 3H79A 2IPAA 4HOJA 1AQWA 2F9SA 2V2GA 4BVXB 4MZBA 3E3EA 4F9ZA 4MH3A 1EEMA 1NSWA 4D73A 1YF1A 4QL7A 3RBTA 2IMIA 4HJ2A 6GSTA 4O32A 4V1Ag 3N9JA 1WRYA 2JL4A 1JZWA 1WWJA 4CW9A 4HQSA 4ZL9A 2GT6A 2TRCP 3O6TA 2BTOT 3D5JA 2VLUA 1XFLA 2H75A 1GWCA 1J0FA 1SKRB 3VI5A 2V6OA 4OCEA 3E9JB 1PN9A 2HLSA 3TOTA 1LBKA 5DCGA 1A23A 3H93A 3M9JA 1KNGA 3FRCA 5ECRB 5GZZB 3HXSA 6GSYA 1W4VA 2IMFA 3GL3A 4FQUA 1GULA 4EIPA 2GT5A 5DAKA 1YKCA 1MTCA 4L5LA 4NAXA 4ZB6A 4NWYA 2FGXA 3GN3A 4OWYA 4Q5RA 1SKWB 2RUFA 3ME7A 3RDWA 1BJXA 4WF5A 2RUEA 5D93A 4IP6A 2YN1A 3RPNA 1F3BA 2K9FA 3ZMLA 2IMEA 3TKRA 5B8AA 3C71A 1Y6EA 2GZPA 3IPZA 5A4WA 3HZ8A 1LJRA 2DBCA 5H5RA 1NHOA 4MPFA 2QA2A 2HT9A 1GH2A 1Z3EA 2MBSA 5D9XA 2DKIA 4WKWA 2XC2A 4ISDA 4MJEA 5CNWA 4AGSA 4HDEA 3GIXA 2JACA 1M2BA 3D4MA 2BMXA 3TJKA 4DSSB 4Z2RA 1ZYQB 1T7PB 2KOKA 4LL4B 4NXIA 2K6VA 2LS5A 3A3TA 2H6ZA 3WGEA 3KP9A 2A4VA 3FYGA 2CZ2A 2HZEA 2FHEA 3I6AA 3CTGA 2OADA 1TJDA 5KOXA 1EOHA 3FR3A 1X9SB 4MZWA 3P7XA 3WGXA 3GKXA 4Z2UA 2FWHA 1Z5YE 2A2SA 3TKSA 3IXRA 5G2ZA 5HR0A 3Q18A 2RIIA 2P0GA 4PX1A 4E8EA 5DCHA 1XIYA 2R37A 1TTZA 2VO4A 4JR4A 3GKKA 2WFCA 4MDCA 3I43A 3CXGA 4GSTA 4KAEA 2VLVA 3VK9A 2PVQA 5EPFA 1YQ1A 3IC4A 2DKHA 3KEBA 4RI6A 4F0BA 3VLNA 3IK9A 2B6MA 1X5EA 2LRNA 4ZBBA 3EVIA 3MNGA 3GX0A 2RM6A 1EGRA 4EXJA 2L4CA 4MPGA 3LEFA 3LGCA 2C3NA 2WS2A 4TVEA 1FO5A 1TI3A 3C7MA 5J3RA 1ST9A 1MD4A 3IOSA 1G7OA 3HZ4A 4KNDA 2OJLA 1GSDA 1FOHA 3A5WA 3LXZA 2VCXA 2XHFA 3DGQA 4O92A 4MP4A 2P5QA 1FW1A 1Z7PA 4XHMA 3TJFA 3CTFA 1S3AA 5HFKA 4IS0A 3C1RA 3DVWA 5KOWA 3EC3A 2YZHA 3VWWA 3J7Yk 3KTBA 1XOBA 4KDYA 1TDIA 1O7UA 2AV4A 4EKZA 1E2YA 1GNEA 2C3TA 5DJMA 5IMFA 1TXXA 3FKFA 1RK4A 4GF0A 3KH7A 4D73B 2IMDA 5IMCA 4FYBA 4N0ZA 2PVOC 4ZB9A 2VUPA 2C0FA 1AIUA 1K0MA 1XW9A 1OE8A 2ZNMA 2IMKA 4WEYA 5JWQB 4PUAA 2P31A 4IJIA 1A2LA 4ML1A 2AYTA 1ERUA 2QGVA 4XS1A 5IOWA 3CYNA 4TXVA 4FH8A 1IYIA 5C04A 3WYWA 4EO3A 5KEJA 3SBCA 1T8EB 2VLTA 4BWQA 1MDIA 2HRAA 6GSWA 2B3SA 1I5GA 1K3LA 3HJMA 4RUVA 1TRVA 4MF5A 3L9VA 2O87A 5CAXA 3KCMA 3VWUA 4G2EA 2RLIA 5DAKB 5B8BA 1DE2A 1WP0A 2H30A 3KTLA 3QD9A 2A2PA 3MAKA 1SK0A 2LRCA 3DWVA 1OKDA 1ZYEA 1PQNA 2WGRA 4KW6A 2HI7A 4ZBAA 1SENA 3F3QA 2E2MA 2PWJA 7GSSA 1DE1A 3L4NA 3WT2A 3HY2A 4V2MA 1G0TA 2HE3A 2C0DA 2FNOA 2MBTA 3ZMKA 2VCQA 4HQZA 4V1Ap 2OBKA 3ZVJA 2L6CA 1F37A 1YDKA 4ULXA 1A8LA 2E2GA 4YKGA 1SJIA 3U5RE 1FHEA 1ON4A 4EL1A 4QL9A 2WZ9A 3GNJA 2VL2A 5KN1A 1EV4A 1YF0A 2CVKA 2GVPA 3ISOA 5A5KA 2H72A 1XWBA 4IW9A 2C0EA 4MH2A 4KGIA 3VPQA 3VWXA 1KBNA 2X99A 1TRUA 2LKUA 4FYCA 3R3EA 3A2XA 1MDJA 1JZRA 2HFDA 3GX8A 4KCEA 1B9XC 1GSEA 2R0PA 1M2AA 2PPTA 1OKTA 4ACSA 5JWOB 3BOAA 2LJRA 4WF4A 2ZUPA 3LQ7A 1U3IA 2IFQA 3TRPA 4V2LA 4YQMA 2YCDA 2FLSA 3UEMA 4YAVA 2BJXA 1X9MB 4GRFA 2VAFA 3GL5A 1DSBA 4LMWA 3HDCA 1C72A 2JSZA 1PL1A 1Y25A 1FOVA 2KUCA 5COHA 6GSVA 2YJ7A 2L59A 1PMTA 3FR9A 1THXA 3GMFA 1HD2A 1BEDA 3H8QA 3GSSA 3LYPA 3LXTA 2MMZA 1GRXA 3EMPA 2WJUA 5GAND 1ZCPA 3LSZA 4OFTA 3GFKA 2K8VA 2H0IA 3IC8A 3TUEA 5IMDA 1K0DA 4O5QA 4PXOA 2WDUA 1U6TA 1WPIA 3TOUA 1TK8B 1SU9A 5D8IA 4K0NA 5JCUA 4X1UA 4KSOA 2V41A 3TCOA 2L57A 3G7YA 5DJLA 5ECPB 3U6VA 1IYHA 2XPDA 2DJKA 2H0GA 2PU9C 4ML6A 1B4PA 4I6XA 2DJJA 3TB2A 1A8YA 2LJAA 3FR6A 4PURA 5GSSA 4MLYA 2EIOA 3PH9A 2LNSA 4JU5A 2N5FA 2XBQA 2H6XA 5J9CA 3BD2A 5CRWA 2LEGA 2RM5A 5IPHA 4K5SA 1PSQA 2DJ3A 3GH6A 2HSYA 5G1KA 4ZIJA 4ECIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GTI A;  3IRA A;  5IO0 A;  4WR5 A;  5D73 A;  5DQY A;  1U87 A;  1M0U A;  1ERT A;  4WXT A;  1H75 A;  1XVW A;  1G6W A;  2J23 A;  1J08 A;  4G10 A;  3KGK A;  1Q98 A;  1T4Z A;  2N5B A;  2NPB A;  2O7K A;  4AF2 A;  2GS3 A;  2C4J A;  3QDN A;  3CRT A;  4YH2 A;  1BYE A;  1A2M A;  5D9T A;  2PGT A;  2DC5 A;  3ERW A;  2YNX A;  1ERV A;  3UBL A;  4JE1 A;  5DBQ A;  2FA4 A;  1XXU A;  4GWR A;  1GNW A;  2LST A;  1USB A;  2B5X A;  4KE3 A;  1Q4J A;  1TK5 B;  2OE1 A;  2R2J A;  1GSF A;  4Q5Q A;  1X0R A;  3EE2 A;  2GGT A;  1QGV A;  1M2D A;  4L8E A;  2C8U A;  1A0F A;  3I9V 2;  2H71 A;  5H5S A;  3UJ1 A;  2I1U A;  5KN0 A;  5C00 A;  2AAW A;  2DJ1 A;  4YQU A;  1TU8 A;  3L0H A;  1UC7 A;  1V57 A;  1M7T A;  4YAP A;  5G31 A;  3FHK A;  3UBK A;  3SWL A;  2H70 A;  2B7K A;  1K0N A;  1VRS D;  4TR3 A;  5IM9 A;  1Z6M A;  1OAZ A;  2R5G A;  3GTU A;  4HJM A;  3D4T A;  3EUR A;  4AJ7 A;  4EC0 A;  1FVJ A;  2TRX A;  3W8S A;  3ZYW A;  1THO A;  2FWE A;  1ML6 A;  3O3T A;  3FZ5 A;  2CA8 A;  3HVS A;  2PUK C;  3GH9 A;  2H1G A;  3KM6 A;  4ZL8 A;  3TGZ A;  5EVO A;  2NDO A;  4DSR A;  2IL3 A;  4HI7 A;  2L6D A;  3TKQ A;  4N10 A;  4MAB A;  5ENU A;  5B6N A;  5FT3 A;  3VI7 A;  2CAI A;  1XWG A;  2OKA A;  4IQA A;  2IFQ B;  3H1N A;  3IHQ A;  1QFN A;  1K3O A;  4POK A;  1R4W A;  1JZO A;  4GSS A;  4P3Y B;  5IMZ A;  2FUG 2;  5IQY A;  1XCC A;  1VF4 A;  3HKR A;  1TOF A;  1F2E A;  2GSQ A;  4JZQ A;  1CQH A;  3UVT A;  3QPM A;  3VPT A;  4TR4 A;  5G5E A;  4IP1 A;  4PGT A;  3FEU A;  1GLP A;  1BX9 A;  4ZBD A;  1B4Q A;  4L0U A;  2VL9 A;  1XW6 A;  4K7O A;  3IAS 2;  4TXO A;  3MSZ A;  3TRX A;  4HZ4 A;  1S3D A;  2YWM A;  1DUG A;  4GCI A;  5ECO B;  3TDG A;  3ERG A;  5HR3 A;  3IDV A;  4O7H A;  2Z9S A;  2LRT A;  1SKS B;  5CRG A;  3D21 A;  4WBJ A;  3FZ4 A;  3LJR A;  4ZXG A;  3FW2 A;  3QAG A;  1N8J A;  1EP7 A;  3HD5 A;  4TOP A;  1YEP A;  4XS4 A;  1M9B A;  1PGT A;  4OD7 A;  3M8N A;  2OBI A;  1FG4 A;  5IO2 A;  3ZRD A;  3E0U A;  3UAR A;  3L9U A;  5EY6 A;  1FAA A;  2PBJ A;  2ES7 A;  2FWG A;  1SD9 A;  2X8H A;  4Q5N A;  3Q19 A;  1TW9 A;  3ZZX A;  1A24 A;  1O73 A;  4G9H A;  4F03 A;  5F0G A;  5JCW A;  1G6Y A;  5HFG A;  1YY7 A;  4PQH A;  5J41 A;  2I81 A;  1J9B A;  1YEX A;  11GS A;  2WCI A;  3F63 A;  2IJY A;  2YWN A;  1GTB A;  3A2V A;  4K8M A;  3M9K A;  2YAN A;  4J56 E;  1AC1 A;  1ILO A;  2B5E A;  1UVZ A;  5AIX A;  1PKW A;  1ABA A;  3NZN A;  4L5O A;  4KH7 A;  1SJ6 A;  1EGO A;  2VL2 C;  5J9B A;  2B1L A;  4FO5 A;  2OA7 A;  2XPE A;  4E8H A;  4H86 A;  4WR4 A;  2YV9 A;  4XIH A;  2IWT A;  3M0F A;  3GST A;  2WB9 A;  3L78 A;  4IQ1 A;  2ALB A;  3KD0 A;  5ID2 A;  1GUH A;  1KTE A;  1GTU A;  5IPG A;  2YV7 A;  3TKP A;  3NOF A;  1O8W A;  4MA9 A;  3VWV A;  4OFM A;  2H73 A;  1OC9 A;  4ECB A;  4JRR A;  1XWA A;  1XWC A;  2ON5 A;  1GSY A;  2HZF A;  2JAD A;  2A2R A;  2EIR A;  3DYR A;  20GS A;  2CVD A;  1JLV A;  2DIY A;  2AB6 A;  4Q5F A;  5G1L A;  1F6M C;  3DIE A;  3GTU B;  2HSH A;  2KP2 A;  1GTA A;  1GP1 A;  4MJA A;  5D96 A;  1U88 A;  3F6F A;  1PRX A;  3LOR A;  4IBP A;  1O8X A;  1O85 A;  13GS A;  2AHE A;  3APQ A;  3CSJ A;  1AQX A;  3LWA A;  2B1K A;  2FWF A;  3GKN A;  4HZ2 A;  4BPY A;  4K9Z A;  1M9A A;  1VF3 A;  1YZX A;  18GS A;  1T1V A;  1U3A A;  2R6K A;  5G30 A;  2VIM A;  2M72 A;  3APO A;  4IN0 A;  1B9Y C;  2GSR A;  2HRF A;  1TRW A;  4L0W A;  2OAC A;  3ZFL A;  5ECS A;  3M1G A;  2IIY A;  3BCI A;  1SK1 A;  4IVF A;  5JCG A;  2XBI A;  4GTU A;  2LTK A;  1MDK A;  4IHU A;  3IK7 A;  1R26 A;  4EUY A;  2H8L A;  3G9B A;  2MYG A;  2YWO A;  1TK0 B;  3EWL A;  2I3Y A;  2MZC A;  3NIV A;  1NW2 A;  2E0Q A;  4POL A;  3US3 A;  1M99 A;  2FD3 A;  3CSH A;  2MMN A;  2F3M A;  1V40 A;  5HFI A;  3R2Q A;  4TXO B;  3KMN A;  5CP1 A;  3UAP A;  4JR6 A;  16GS A;  2I9H A;  4GLT A;  5F07 A;  2JSY A;  4LLR A;  3WD6 A;  2OE0 A;  5LD0 A;  4ID0 A;  3RAZ A;  3CRU A;  3FZ9 A;  4MF6 A;  1B48 A;  4AJ8 A;  3ZIJ A;  1XWK A;  4F0C A;  2EC4 A;  4XS4 B;  2H76 A;  2AJQ B;  4FYU A;  12GS A;  4DVC A;  3UIW A;  3HHV A;  4MF7 A;  2L5L A;  1A0R P;  1OVN A;  1PKZ A;  3DML A;  5ECK B;  2X8C A;  1TP9 A;  5E4W A;  3KXO A;  3IBH A;  1HNB A;  3VUR A;  4GSN A;  3OR5 A;  1EEJ A;  17GS A;  2WUL A;  4PNF A;  3ED3 A;  2V1M A;  4HUA A;  3BBY A;  4TR0 A;  1AAZ A;  6GSX A;  1GSQ A;  1PX6 A;  3W6G A;  3K8N A;  2REM A;  1LU4 A;  2F8A A;  4NHW A;  1OC3 A;  5CO3 A;  2NVL A;  2C80 A;  3VFI A;  4YQV A;  4TN8 A;  1ZOF A;  4NHZ A;  4HS1 A;  3GRX A;  4IGJ A;  3ZRE A;  1SYX A;  5KN2 A;  4I5Q A;  3CBU A;  1AUC A;  2YOI A;  1W89 A;  1TU7 A;  1MD3 A;  5ID2 B;  1K0O A;  5DVB A;  5DDL A;  3G7J A;  3P8W A;  4TKY A;  1ZL9 A;  5H5Q A;  1OC9 B;  1WIK A;  1BQ7 A;  3QAV A;  4MJC A;  3P90 A;  4F2I A;  2R3X A;  1E6B A;  2N5A A;  10GS A;  1UA5 A;  2TIR A;  1RW1 A;  5AGY A;  3QMX A;  9GSS A;  4HU9 A;  2LJK A;  3GUS A;  2LV3 A;  2DIZ A;  5ELA A;  3TKS C;  2V6K A;  2VM2 A;  4OCF A;  1GL8 A;  1AXD A;  4X0X A;  5ECH B;  1V58 A;  2VM1 A;  2JU5 A;  5A4V A;  3IV4 A;  3PIN A;  1S3C A;  4KDX A;  2IN3 A;  2PN8 A;  2VCZ A;  3GV1 A;  4LA1 A;  5ECM B;  1R5A A;  5ELG A;  2HNL A;  1ZGN A;  2MMO A;  3C8E A;  5IOX A;  1VF2 A;  4NV5 A;  1H4O A;  2I4A A;  3ZVJ D;  1JFU A;  5INY A;  5LCZ A;  3QR6 A;  5F06 A;  5LNK e;  4ECJ A;  4RI7 A;  4ZL7 A;  2FCH A;  2GLR A;  1BG5 A;  4EDZ A;  5ECQ B;  2GQM A;  2H19 A;  5J4U A;  8GSS A;  4OFN A;  2DJ0 A;  4BVY A;  3KH9 A;  1GSU A;  2H1A A;  4GQC A;  2ZCT A;  2CX3 A;  3CMI A;  2VCW A;  2FA8 A;  5ECN B;  3HCZ A;  3TKS E;  1SL1 B;  3IE3 A;  4FIW A;  2H66 A;  4KCA A;  3F4T A;  1GUM A;  3F4R A;  5GST A;  3GA4 A;  4ECC A;  3UL3 A;  1FB6 A;  4WET A;  4K0G A;  2CV4 A;  3O76 A;  5DAL B;  3HA9 A;  1X5C A;  3HJP A;  1ZZY A;  3PGT A;  4JED A;  4GQF A;  1TKD B;  1V2A A;  2X8G A;  1OE7 A;  3F6D A;  1R7H A;  4DSQ A;  1XOA A;  5ECI B;  2PER A;  2H1B A;  3RHB A;  1O81 A;  5HQP A;  2M80 A;  1XZO A;  4MZC A;  3F0I A;  3QFB C;  3LYK A;  1A2J A;  2DSA A;  4TRX A;  1WMJ A;  2EIQ A;  2LQO A;  4TR1 B;  1X9W B;  1K0B A;  2FY6 A;  1ACV A;  1SJZ A;  1G7E A;  4K2D A;  4BA7 A;  2GZZ A;  4ZIL A;  1URM A;  1Z7R A;  2AUV A;  3F8U A;  3EU3 A;  3FZA A;  5AIS A;  1PL2 A;  4J57 E;  5JWR B;  1SYR A;  1NM3 A;  2B7J A;  4AJ6 A;  1FVK A;  2JZT A;  2D2Z A;  2NTO A;  5B7C A;  1ZMA A;  3DD3 A;  3PR8 A;  2QKE A;  5DQS A;  4EF0 A;  1XBS A;  4NPB A;  2YPM A;  1HYU A;  1TRS A;  3EMX A;  2VD1 A;  5HR2 A;  5KN3 A;  3D6I A;  3APS A;  5F8B A;  4OMV A;  1SL2 B;  3DVX A;  3P2A A;  3S9F A;  4BWS A;  1X5D A;  2MMA A;  3CSI A;  3I69 A;  5IMA A;  5D9V A;  1JZD A;  3HJO A;  1HNC A;  1V9W A;  4KA0 A;  1WJK A;  4XTS A;  3QCP A;  5D9W A;  2CVB A;  2H74 A;  1Z9H A;  14GS A;  5ABR A;  1F9M A;  4IEL A;  1SL0 B;  2OE3 A;  2LQQ A;  2O89 A;  2H0H A;  5A4U A;  2YJH A;  6GSS A;  2HYX A;  2YWI A;  2DLX A;  4N0V A;  2VCV A;  2ON7 A;  1EV9 A;  1QXH A;  4F82 A;  1UN2 A;  1EZK A;  4MMM A;  2G2Q A;  1OC8 A;  3IA1 A;  1K3Y A;  4PQ1 A;  2X64 A;  2CZ3 A;  3F4S A;  2C3Q A;  2LUS A;  1I9D A;  1T00 A;  2NBS A;  4PQI A;  4BVX A;  2GDR A;  3HYP A;  3C1S A;  2VOC A;  4EDY A;  1QK8 A;  4BL7 A;  3KZQ A;  3QOU A;  2KHP A;  1V98 A;  1ERW A;  4RQR A;  4WBR D;  4PUF C;  2PMT A;  1BAY A;  4ZB8 A;  2H01 A;  5B6M A;  2HXK A;  5ECL B;  4I8B A;  3DXB A;  3IAM 2;  3AY8 A;  1F3A A;  4G19 A;  5CRD A;  2JZS A;  1EWX A;  2C1Y A;  4XS6 A;  2O8V B;  3GYK A;  2F51 A;  1FB0 A;  3HVV A;  3F3R A;  2GQL A;  1B8X A;  2C0G A;  3DRN A;  3RHC A;  1JHB A;  2CQ9 A;  3QFA C;  2HRN A;  19GS A;  3EYT A;  2H6Y A;  1AQV A;  3GUR A;  2B5Y A;  4IJ3 A;  5GAP D;  3KIJ A;  1TI1 A;  3ZL5 A;  4K7N A;  1VF1 A;  1T3B A;  3UOM A;  5CRE A;  5CYY A;  4IKH A;  2GZY A;  2L4Q A;  3RPP A;  1PA3 A;  3MDK A;  4XRA A;  4POB A;  1DBY A;  3EIN A;  3WGD A;  3ERF A;  3D0Z A;  3GHA A;  3WT1 A;  3FK8 A;  3HVX A;  3C73 A;  3M3M A;  4GXZ A;  3TJB A;  3D22 A;  4N11 A;  3ZIT A;  2HZE B;  4MCU A;  2R4V A;  3W8J A;  1PD2 1;  3ZLP A;  2QSI A;  1GSS A;  3Q6O A;  3J7Y b;  1O6J A;  2L5O A;  5FHI A;  2YP6 A;  1YKA A;  4EVM A;  2VCT A;  4TW5 A;  2CT6 A;  2H1D A;  2P5R A;  1CQG A;  2CX4 A;  1T4Y A;  2VD0 A;  4KDU A;  4DSS A;  1QUW A;  3MWH A;  3ZTL A;  1AW9 A;  1XPV A;  3F9U A;  2GST A;  2GTU A;  5L71 A;  2GQK A;  4LL1 B;  4K1F A;  5DAL A;  4JBB A;  4XCS A;  3KJY A;  2J9H A;  3EU4 A;  3ZIV A;  3BCK A;  2O85 A;  2JZR A;  4N30 A;  3TJJ A;  4OO4 A;  1QQ2 A;  2K18 A;  2DML A;  4HEA 2;  4K7I A;  3BJ5 A;  3UVH A;  4OO5 A;  1KEB A;  2GSS A;  5HR1 A;  4KUN A;  3V1W A;  2VL3 A;  4J2F A;  2LNT A;  3N5O A;  1HNA A;  6GSU A;  3KMO A;  3L9S A;  4EE0 A;  1SD8 A;  5EL8 A;  3FY7 A;  1VGL A;  1Z6N A;  2F8F A;  4KX4 A;  4POM A;  1OYJ A;  4TR1 A;  3QAW A;  22GS A;  3ME8 A;  2V32 A;  5AN1 A;  4RQX A;  4CHS A;  4O5R A;  2KP1 A;  4V2N A;  3DEX A;  4I2T A;  2M46 A;  3G7I A;  3GKM A;  4KSM A;  5G5F A;  3LG6 A;  3Q74 A;  3UMA A;  3ZFB A;  1WE0 A;  1YJ6 A;  5CRH A;  5IMV A;  5F05 A;  4Z7X A;  3TJG A;  2DJ2 A;  4PNG A;  4I2U A;  4XRD A;  3LFL A;  1K0A A;  3IR4 A;  1EOG A;  1WOU A;  4X43 A;  2WRT A;  4DEJ A;  4CDO A;  2CAQ A;  4MJB A;  4QQ7 A;  4K6X A;  2QC7 A;  1MEK A;  2DMM A;  3KP8 A;  4ILF A;  2KLX A;  5AIV A;  4MK3 A;  1K0C A;  3DKS A;  5E59 A;  1GUK A;  2E7P A;  1QMV A;  3H4K A;  1GLQ A;  5IIZ A;  1XVQ A;  1JLW A;  1RQM A;  3JCM L;  5J5N A;  1SK2 A;  3TRQ A;  1XW5 A;  4KB3 A;  4LMV A;  1HQO A;  1NHY A;  4HU7 A;  1N2A A;  2YZU A;  4NV2 A;  1EP8 A;  2K8S A;  1PX7 A;  2G0F A;  4NMU A;  4I97 A;  3A2W A;  5FWG A;  1R5P A;  3H79 A;  2IPA A;  4HOJ A;  1AQW A;  2F9S A;  2V2G A;  4MZB A;  3E3E A;  4F9Z A;  4MH3 A;  1EEM A;  1NSW A;  4D73 A;  1YF1 A;  4QL7 A;  3RBT A;  2IMI A;  4HJ2 A;  6GST A;  4O32 A;  4V1A g;  3N9J A;  1WRY A;  2JL4 A;  1JZW A;  1WWJ A;  4CW9 A;  4HQS A;  4ZL9 A;  2GT6 A;  2TRC P;  3O6T A;  2BTO T;  3D5J A;  2VLU A;  1XFL A;  2H75 A;  1GWC A;  1J0F A;  1SKR B;  3VI5 A;  2V6O A;  4OCE A;  3E9J B;  1PN9 A;  2HLS A;  3TOT A;  1LBK A;  5DCG A;  1A23 A;  3H93 A;  1KNG A;  3FRC A;  3M9J A;  5ECR B;  5GZZ B;  3HXS A;  6GSY A;  1W4V A;  2IMF A;  3GL3 A;  1GUL A;  2GT5 A;  5DAK A;  1YKC A;  1MTC A;  4L5L A;  4NAX A;  4ZB6 A;  4NWY A;  2FGX A;  3GN3 A;  4OWY A;  4Q5R A;  1SKW B;  2RUF A;  3ME7 A;  3RDW A;  1BJX A;  4WF5 A;  2RUE A;  5D93 A;  4IP6 A;  2YN1 A;  3RPN A;  1F3B A;  2K9F A;  3ZML A;  2IME A;  3TKR A;  5B8A A;  3C71 A;  1Y6E A;  2GZP A;  3IPZ A;  5A4W A;  3HZ8 A;  1LJR A;  2DBC A;  5H5R A;  1NHO A;  4MPF A;  2HT9 A;  1GH2 A;  1Z3E A;  2MBS A;  5D9X A;  4WKW A;  2XC2 A;  4ISD A;  4MJE A;  5CNW A;  4AGS A;  4HDE A;  3GIX A;  2JAC A;  1M2B A;  3D4M A;  2BMX A;  3TJK A;  4DSS B;  1ZYQ B;  1T7P B;  2KOK A;  4LL4 B;  4NXI A;  2K6V A;  2LS5 A;  3A3T A;  2H6Z A;  3WGE A;  3KP9 A;  2A4V A;  3FYG A;  2CZ2 A;  2HZE A;  2FHE A;  3I6A A;  3CTG A;  2OAD A;  1TJD A;  1EOH A;  3FR3 A;  1X9S B;  4MZW A;  3P7X A;  3WGX A;  3GKX A;  2FWH A;  1Z5Y E;  2A2S A;  3TKS A;  3IXR A;  5G2Z A;  5HR0 A;  3Q18 A;  2RII A;  2P0G A;  4PX1 A;  4E8E A;  5DCH A;  1XIY A;  2R37 A;  1TTZ A;  2VO4 A;  4JR4 A;  3GKK A;  2WFC A;  4MDC A;  3I43 A;  3CXG A;  4GST A;  4KAE A;  2VLV A;  3VK9 A;  2PVQ A;  5EPF A;  1YQ1 A;  3IC4 A;  3KEB A;  4RI6 A;  4F0B A;  3VLN A;  3IK9 A;  2B6M A;  1X5E A;  2LRN A;  4ZBB A;  3EVI A;  3MNG A;  3GX0 A;  2RM6 A;  1EGR A;  4EXJ A;  2L4C A;  4MPG A;  3LEF A;  3LGC A;  2C3N A;  2WS2 A;  4TVE A;  1FO5 A;  1TI3 A;  3C7M A;  5J3R A;  1ST9 A;  1MD4 A;  3IOS A;  1G7O A;  3HZ4 A;  4KND A;  2OJL A;  1GSD A;  3A5W A;  3LXZ A;  2VCX A;  2XHF A;  3DGQ A;  4O92 A;  4MP4 A;  2P5Q A;  1FW1 A;  1Z7P A;  4XHM A;  3TJF A;  3CTF A;  1S3A A;  5HFK A;  4IS0 A;  3C1R A;  3DVW A;  3EC3 A;  2YZH A;  3VWW A;  3J7Y k;  3KTB A;  1XOB A;  4KDY A;  1TDI A;  1O7U A;  2AV4 A;  4EKZ A;  1E2Y A;  1GNE A;  2C3T A;  5DJM A;  5IMF A;  1TXX A;  3FKF A;  1RK4 A;  4GF0 A;  3KH7 A;  4D73 B;  2IMD A;  5IMC A;  4FYB A;  4N0Z A;  2PVO C;  4ZB9 A;  2VUP A;  2C0F A;  1AIU A;  1K0M A;  1XW9 A;  1OE8 A;  2ZNM A;  2IMK A;  4WEY A;  5JWQ B;  4PUA A;  2P31 A;  4IJI A;  1A2L A;  4ML1 A;  2AYT A;  1ERU A;  2QGV A;  4XS1 A;  5IOW A;  3CYN A;  4TXV A;  4FH8 A;  1IYI A;  5C04 A;  3WYW A;  4EO3 A;  5KEJ A;  3SBC A;  1T8E B;  2VLT A;  4BWQ A;  1MDI A;  6GSW A;  2B3S A;  1I5G A;  1K3L A;  3HJM A;  4RUV A;  1TRV A;  4MF5 A;  3L9V A;  2O87 A;  5CAX A;  3KCM A;  3VWU A;  4G2E A;  2RLI A;  5DAK B;  5B8B A;  1DE2 A;  1WP0 A;  2H30 A;  3KTL A;  3QD9 A;  3MAK A;  1SK0 A;  2LRC A;  3DWV A;  1OKD A;  1ZYE A;  1PQN A;  2WGR A;  4KW6 A;  2HI7 A;  4ZBA A;  1SEN A;  3F3Q A;  2E2M A;  2PWJ A;  7GSS A;  1DE1 A;  3L4N A;  3WT2 A;  3HY2 A;  4V2M A;  1G0T A;  2HE3 A;  2C0D A;  2FNO A;  2MBT A;  3ZMK A;  2VCQ A;  4HQZ A;  4V1A p;  2OBK A;  3ZVJ A;  2L6C A;  1F37 A;  1YDK A;  4ULX A;  1A8L A;  2E2G A;  1SJI A;  3U5R E;  1FHE A;  1ON4 A;  4EL1 A;  4QL9 A;  2WZ9 A;  3GNJ A;  2VL2 A;  5KN1 A;  1EV4 A;  1YF0 A;  2CVK A;  2GVP A;  3ISO A;  5A5K A;  2H72 A;  1XWB A;  4IW9 A;  2C0E A;  4MH2 A;  4KGI A;  3VPQ A;  3VWX A;  1KBN A;  2X99 A;  1TRU A;  2LKU A;  4FYC A;  3A2X A;  1MDJ A;  1JZR A;  2HFD A;  3GX8 A;  4KCE A;  1B9X C;  1GSE A;  1M2A A;  2PPT A;  1OKT A;  4ACS A;  5JWO B;  3BOA A;  2LJR A;  4WF4 A;  2ZUP A;  3LQ7 A;  1U3I A;  2IFQ A;  3TRP A;  4V2L A;  4YQM A;  2YCD A;  2FLS A;  3UEM A;  4YAV A;  2BJX A;  1X9M B;  4GRF A;  2VAF A;  3GL5 A;  1DSB A;  4LMW A;  3HDC A;  1C72 A;  2JSZ A;  1PL1 A;  1Y25 A;  1FOV A;  2KUC A;  5COH A;  6GSV A;  2YJ7 A;  2L59 A;  1PMT A;  3FR9 A;  1THX A;  3GMF A;  1HD2 A;  1BED A;  3H8Q A;  3GSS A;  3LYP A;  3LXT A;  2MMZ A;  1GRX A;  3EMP A;  2WJU A;  5GAN D;  1ZCP A;  3LSZ A;  4OFT A;  3GFK A;  2K8V A;  2H0I A;  3TUE A;  5IMD A;  1K0D A;  4PXO A;  2WDU A;  1U6T A;  1WPI A;  3TOU A;  1TK8 B;  1SU9 A;  5D8I A;  4K0N A;  5JCU A;  4X1U A;  4KSO A;  2V41 A;  3TCO A;  2L57 A;  3G7Y A;  5DJL A;  5ECP B;  3U6V A;  1IYH A;  2XPD A;  2DJK A;  2H0G A;  2PU9 C;  4ML6 A;  1B4P A;  4I6X A;  2DJJ A;  3TB2 A;  1A8Y A;  2LJA A;  3FR6 A;  4PUR A;  5GSS A;  4MLY A;  2EIO A;  3PH9 A;  2LNS A;  4JU5 A;  2N5F A;  2XBQ A;  2H6X A;  5J9C A;  3BD2 A;  5CRW A;  2LEG A;  2RM5 A;  5IPH A;  1PSQ A;  2DJ3 A;  3GH6 A;  2HSY A;  5G1K A;  4ZIJ A;  4ECI A; 
#chains in the Genus database with same CATH topology
 1GTI A;  3IRA A;  5IO0 A;  4WR5 A;  5D73 A;  5DQY A;  1U87 A;  1M0U A;  1ERT A;  4WXT A;  1H75 A;  1XVW A;  1G6W A;  2J23 A;  1J08 A;  4G10 A;  3KGK A;  1Q98 A;  1T4Z A;  2N5B A;  2NPB A;  2O7K A;  4AF2 A;  2GS3 A;  2C4J A;  3QDN A;  2X49 A;  3CRT A;  4YH2 A;  1BYE A;  1A2M A;  5D9T A;  2PGT A;  2DC5 A;  3ERW A;  1PFO A;  2YNX A;  1ERV A;  3UBL A;  4JE1 A;  5DBQ A;  2FA4 A;  2UZ8 A;  1XXU A;  4GWR A;  1GNW A;  2LST A;  1USB A;  2B5X A;  4KE3 A;  1Q4J A;  1TK5 B;  2OE1 A;  2R2J A;  1GSF A;  4Q5Q A;  1X0R A;  3EE2 A;  2GGT A;  1QGV A;  1M2D A;  4L8E A;  2C8U A;  1A0F A;  3I9V 2;  2H71 A;  5H5S A;  3UJ1 A;  2I1U A;  5KN0 A;  5C00 A;  2AAW A;  2DJ1 A;  4YQU A;  1TU8 A;  3L0H A;  1UC7 A;  1V57 A;  1M7T A;  4YAP A;  5G31 A;  3FHK A;  3UBK A;  3SWL A;  2H70 A;  2B7K A;  3MYD A;  1K0N A;  1VRS D;  4TR3 A;  5IM9 A;  1Z6M A;  1OAZ A;  2R5G A;  3GTU A;  4HJM A;  3D4T A;  3EUR A;  4AJ7 A;  4EC0 A;  1FVJ A;  2TRX A;  3W8S A;  3ZYW A;  1THO A;  2FWE A;  1ML6 A;  3O3T A;  3FZ5 A;  2CA8 A;  3HVS A;  4USS A;  2PUK C;  4G0L A;  3GH9 A;  2H1G A;  3KM6 A;  4ZL8 A;  3TGZ A;  5EVO A;  2NDO A;  4DSR A;  2IL3 A;  4HI7 A;  2L6D A;  3TKQ A;  4N10 A;  4MAB A;  5ENU A;  5B6N A;  5FT3 A;  3VI7 A;  2CAI A;  1XWG A;  2OKA A;  4IQA A;  2IFQ B;  3H1N A;  3IHQ A;  1QFN A;  1K3O A;  4POK A;  1R4W A;  1JZO A;  4GSS A;  4P3Y B;  5IMZ A;  2FUG 2;  5BRT A;  5IQY A;  1XCC A;  1VF4 A;  3HKR A;  1TOF A;  1F2E A;  2GSQ A;  4JZQ A;  1CQH A;  3UVT A;  3QPM A;  3VPT A;  4TR4 A;  5G5E A;  4IP1 A;  4PGT A;  3FEU A;  1GLP A;  1BX9 A;  4ZBD A;  1B4Q A;  4L0U A;  2VL9 A;  1XW6 A;  4K7O A;  3IAS 2;  4TXO A;  3MSZ A;  3TRX A;  4HZ4 A;  1S3D A;  2YWM A;  1DUG A;  4GCI A;  5ECO B;  3TDG A;  3ERG A;  5HR3 A;  3IDV A;  4O7H A;  2Z9S A;  2LRT A;  1SKS B;  5CRG A;  3D21 A;  4WBJ A;  3FZ4 A;  3LJR A;  4ZXG A;  3FW2 A;  3QAG A;  1N8J A;  1EP7 A;  3HD5 A;  4TOP A;  1YEP A;  1M3J A;  4XS4 A;  1M9B A;  1PGT A;  4OD7 A;  3M8N A;  2OBI A;  1FG4 A;  5IO2 A;  3ZRD A;  3E0U A;  3UAR A;  3L9U A;  5EY6 A;  1FAA A;  2PBJ A;  2ES7 A;  2R0C A;  2FWG A;  1SD9 A;  2X8H A;  4Q5N A;  3Q19 A;  3HVN A;  1TW9 A;  3ZZX A;  1A24 A;  1O73 A;  4G9H A;  4F03 A;  5F0G A;  5JCW A;  1G6Y A;  5HFG A;  1YY7 A;  4PQH A;  5J41 A;  2I81 A;  1J9B A;  1YEX A;  11GS A;  2WCI A;  2R0G A;  3F63 A;  2IJY A;  2YWN A;  1GTB A;  3A2V A;  4K8M A;  3M9K A;  2YAN A;  4J56 E;  1AC1 A;  1ILO A;  2B5E A;  1UVZ A;  4K5R A;  5AIX A;  1PKW A;  1ABA A;  3NZN A;  4L5O A;  4KH7 A;  1SJ6 A;  1EGO A;  2VL2 C;  5J9B A;  2B1L A;  4FO5 A;  2OA7 A;  2XPE A;  4E8H A;  4H86 A;  4WR4 A;  2YV9 A;  4XIH A;  2IWT A;  3M0F A;  3GST A;  2WB9 A;  3L78 A;  4IQ1 A;  2ALB A;  3KD0 A;  5ID2 A;  1GUH A;  1KTE A;  1GTU A;  5IPG A;  2YV7 A;  3TKP A;  3NOF A;  1O8W A;  4MA9 A;  3VWV A;  4OFM A;  2H73 A;  1OC9 A;  4ECB A;  4JRR A;  1XWA A;  1XWC A;  2ON5 A;  5BMU A;  1GSY A;  2HZF A;  2JAD A;  2A2R A;  2EIR A;  3DYR A;  20GS A;  2CVD A;  1JLV A;  2DIY A;  2AB6 A;  4Q5F A;  5G1L A;  1F6M C;  3DIE A;  3GTU B;  2HSH A;  2KP2 A;  1GTA A;  1GP1 A;  4MJA A;  3IHG A;  5D96 A;  1U88 A;  3F6F A;  1PRX A;  3LOR A;  4IBP A;  4BVY B;  1O8X A;  1O85 A;  13GS A;  2AHE A;  3APQ A;  3CSJ A;  1AQX A;  3LWA A;  2B1K A;  1PN0 A;  2FWF A;  3GKN A;  4HZ2 A;  4BPY A;  4G0K A;  4K9Z A;  1M9A A;  1VF3 A;  1YZX A;  18GS A;  1T1V A;  1U3A A;  2R6K A;  5G30 A;  2VIM A;  2M72 A;  3APO A;  4IN0 A;  4Z2T A;  1B9Y C;  2GSR A;  2HRF A;  1TRW A;  4L0W A;  2OAC A;  3ZFL A;  5ECS A;  3M1G A;  2IIY A;  3BCI A;  1SK1 A;  4IVF A;  5JCG A;  2XBI A;  4GTU A;  2LTK A;  1MDK A;  4IHU A;  3IK7 A;  1R26 A;  4EUY A;  2H8L A;  3G9B A;  2MYG A;  2YWO A;  1TK0 B;  3EWL A;  2I3Y A;  2MZC A;  3NIV A;  1NW2 A;  2E0Q A;  4POL A;  3US3 A;  1M99 A;  2FD3 A;  3CSH A;  4KF9 A;  2MMN A;  2F3M A;  1V40 A;  5HFI A;  3R2Q A;  4TXO B;  3KMN A;  5CP1 A;  3UAP A;  4JR6 A;  16GS A;  2I9H A;  4GLT A;  5F07 A;  2JSY A;  4K2X A;  4LLR A;  3WD6 A;  2OE0 A;  5LD0 A;  4ID0 A;  3RAZ A;  4MNN A;  3CRU A;  3FZ9 A;  4MF6 A;  1B48 A;  4AJ8 A;  3ZIJ A;  1XWK A;  4F0C A;  2EC4 A;  4XS4 B;  2H76 A;  2AJQ B;  4FYU A;  1ZYP A;  12GS A;  4DVC A;  1XG8 A;  3UIW A;  3HHV A;  4MF7 A;  2L5L A;  1A0R P;  1OVN A;  1PKZ A;  3DML A;  5ECK B;  2X8C A;  1TP9 A;  5E4W A;  3KXO A;  3IBH A;  1HNB A;  3VUR A;  4GSN A;  3OR5 A;  1EEJ A;  2HSM A;  17GS A;  2WUL A;  4PNF A;  3ED3 A;  2V1M A;  4HUA A;  3BBY A;  4TR0 A;  1AAZ A;  6GSX A;  1GSQ A;  1PX6 A;  3W6G A;  3K8N A;  2REM A;  1LU4 A;  2F8A A;  4NHW A;  1OC3 A;  5CO3 A;  2NVL A;  2C80 A;  3VFI A;  4YQV A;  4TN8 A;  1ZOF A;  4NHZ A;  4HS1 A;  3GRX A;  4IGJ A;  3ZRE A;  1SYX A;  5KN2 A;  4I5Q A;  3CBU A;  1AUC A;  4G0I A;  3EPT A;  2YOI A;  1W89 A;  1TU7 A;  1MD3 A;  5ID2 B;  4BL7 B;  1K0O A;  5DVB A;  5DDL A;  3G7J A;  3P8W A;  4TKY A;  1ZL9 A;  5H5Q A;  1OC9 B;  1WIK A;  1BQ7 A;  3QAV A;  4MJC A;  3P90 A;  4F2I A;  2R3X A;  1E6B A;  2N5A A;  10GS A;  1UA5 A;  2TIR A;  3A5I A;  1RW1 A;  5AGY A;  3QMX A;  9GSS A;  2HRK A;  2LJK A;  4HU9 A;  3GUS A;  2LV3 A;  2DIZ A;  5ELA A;  3TKS C;  2V6K A;  2VM2 A;  4OCF A;  1GL8 A;  1AXD A;  4X0X A;  5ECH B;  1V58 A;  2VM1 A;  2JU5 A;  5A4V A;  3IV4 A;  3PIN A;  1S3C A;  4KDX A;  2IN3 A;  2PN8 A;  2VCZ A;  3GV1 A;  4LA1 A;  5ECM B;  1R5A A;  5ELG A;  3MIX A;  2HNL A;  1ZGN A;  2MMO A;  3C8E A;  5IOX A;  1VF2 A;  4NV5 A;  1H4O A;  2I4A A;  3ZVJ D;  1JFU A;  5INY A;  5LCZ A;  3QR6 A;  5F06 A;  5LNK e;  4ECJ A;  4RI7 A;  4ZL7 A;  2FCH A;  2GLR A;  1BG5 A;  4EDZ A;  5ECQ B;  2GQM A;  2H19 A;  5J4U A;  8GSS A;  4OFN A;  2DJ0 A;  4BVY A;  3KH9 A;  1GSU A;  2H1A A;  4GQC A;  2ZCT A;  2CX3 A;  3CMI A;  2VCW A;  2FA8 A;  5ECN B;  3HCZ A;  3TKS E;  1SL1 B;  3IE3 A;  4FIW A;  2H66 A;  4KCA A;  3F4T A;  1GUM A;  3F4R A;  4X4J A;  5GST A;  3GA4 A;  4ECC A;  3UL3 A;  1FB6 A;  4WET A;  4K0G A;  2CV4 A;  3O76 A;  5DAL B;  3HA9 A;  3FMW A;  1X5C A;  3HJP A;  4BIK A;  1ZZY A;  3PGT A;  4JED A;  4GQF A;  1TKD B;  1V2A A;  2X8G A;  1OE7 A;  3F6D A;  1R7H A;  4EIQ A;  4DSQ A;  2X4A A;  1XOA A;  5ECI B;  2PER A;  2H1B A;  3RHB A;  1O81 A;  5HQP A;  2M80 A;  1XZO A;  4MZC A;  3F0I A;  3QFB C;  3LYK A;  1A2J A;  4YKF A;  2DSA A;  4TRX A;  1WMJ A;  3LW9 A;  2EIQ A;  2LQO A;  4TR1 B;  1X9W B;  1K0B A;  2FY6 A;  1ACV A;  1SJZ A;  1G7E A;  4K2D A;  4BA7 A;  2GZZ A;  4ZIL A;  1URM A;  1Z7R A;  2AUV A;  3F8U A;  3EU3 A;  3FZA A;  1PL2 A;  4J57 E;  5AIS A;  5JWR B;  1SYR A;  1NM3 A;  2B7J A;  4AJ6 A;  1FVK A;  2JZT A;  2D2Z A;  2NTO A;  5B7C A;  1ZMA A;  3DD3 A;  3PR8 A;  2QKE A;  5DQS A;  4EF0 A;  1XBS A;  4NPB A;  2YPM A;  1HYU A;  1TRS A;  3EMX A;  2VD1 A;  5HR2 A;  5KN3 A;  3D6I A;  3APS A;  4O5U A;  5F8B A;  4OMV A;  1SL2 B;  3DVX A;  3P2A A;  3S9F A;  4BWS A;  1X5D A;  2MMA A;  3CSI A;  3I69 A;  5IMA A;  5D9V A;  1JZD A;  3HJO A;  1HNC A;  1V9W A;  4KA0 A;  1WJK A;  4XTS A;  3QCP A;  5D9W A;  2CVB A;  2H74 A;  1Z9H A;  14GS A;  5ABR A;  1F9M A;  4IEL A;  1SL0 B;  2OE3 A;  2LQQ A;  2O89 A;  2H0H A;  5A4U A;  2YJH A;  6GSS A;  2HYX A;  2YWI A;  2DLX A;  4N0V A;  2VCV A;  2ON7 A;  1EV9 A;  1QXH A;  4F82 A;  1UN2 A;  1EZK A;  4MMM A;  2G2Q A;  4CY6 A;  1OC8 A;  3IA1 A;  1K3Y A;  4PQ1 A;  2X64 A;  2CZ3 A;  3F4S A;  2C3Q A;  2LUS A;  1I9D A;  1T00 A;  2NBS A;  4PQI A;  4BVX A;  2GDR A;  3HYP A;  3C1S A;  2VOC A;  4EDY A;  1QK8 A;  4BL7 A;  3KZQ A;  3QOU A;  2KHP A;  1V98 A;  1ERW A;  4RQR A;  4WBR D;  4PUF C;  2PMT A;  1BAY A;  4ZB8 A;  2H01 A;  5B6M A;  2HXK A;  5ECL B;  4I8B A;  3DXB A;  4PTS A;  3IAM 2;  3AY8 A;  1F3A A;  4G19 A;  5CRD A;  2JZS A;  1EWX A;  2C1Y A;  4XS6 A;  2O8V B;  3GYK A;  2F51 A;  1FB0 A;  3HVV A;  3F3R A;  2GQL A;  1B8X A;  2C0G A;  3DRN A;  3RHC A;  1JHB A;  2CQ9 A;  3QFA C;  2HRN A;  19GS A;  1M3I A;  3PPU A;  3EYT A;  2H6Y A;  1AQV A;  3GUR A;  2B5Y A;  4IJ3 A;  5GAP D;  3KIJ A;  1TI1 A;  3ZL5 A;  4K7N A;  1VF1 A;  1T3B A;  3UOM A;  5CRE A;  5CYY A;  4IKH A;  2GZY A;  2L4Q A;  3RPP A;  1PA3 A;  3MDK A;  4XRA A;  4POB A;  1DBY A;  3EIN A;  3WGD A;  3ERF A;  3D0Z A;  3GHA A;  3WT1 A;  3FK8 A;  3HVX A;  4A5P A;  3C73 A;  3M3M A;  4GXZ A;  3TJB A;  3D22 A;  4N11 A;  3ZIT A;  2HZE B;  4MCU A;  2R4V A;  3W8J A;  1PD2 1;  3ZLP A;  2QSI A;  1GSS A;  3Q6O A;  3J7Y b;  1O6J A;  2L5O A;  5FHI A;  2YP6 A;  1YKA A;  4EVM A;  2VCT A;  4TW5 A;  2CT6 A;  2H1D A;  2P5R A;  1CQG A;  2CX4 A;  1T4Y A;  2VD0 A;  4KDU A;  4DSS A;  1QUW A;  3MWH A;  3ZTL A;  1AW9 A;  1XPV A;  3F9U A;  2GST A;  2GTU A;  5L71 A;  2GQK A;  4LL1 B;  4K1F A;  5DAL A;  4JBB A;  4XCS A;  3KJY A;  2J9H A;  3EU4 A;  3ZIV A;  3BCK A;  2O85 A;  2JZR A;  4N30 A;  3TJJ A;  4OO4 A;  1QQ2 A;  2K18 A;  2DML A;  4HEA 2;  4K7I A;  3BJ5 A;  3UVH A;  4OO5 A;  1KEB A;  2GSS A;  5HR1 A;  4KUN A;  3V1W A;  2VL3 A;  4J2F A;  2LNT A;  3N5O A;  1HNA A;  4HSC X;  6GSU A;  3KMO A;  3L9S A;  4EE0 A;  1SD8 A;  5EL8 A;  3FY7 A;  4CY8 A;  1VGL A;  1Z6N A;  2F8F A;  4KX4 A;  4POM A;  1OYJ A;  4TR1 A;  3QAW A;  22GS A;  3ME8 A;  2V32 A;  5AN1 A;  4RQX A;  4CHS A;  4O5R A;  2KP1 A;  4V2N A;  3DEX A;  4I2T A;  2M46 A;  3G7I A;  3GKM A;  4KSM A;  5G5F A;  3LG6 A;  3Q74 A;  3UMA A;  3ZFB A;  1WE0 A;  1YJ6 A;  5CRH A;  5IMV A;  5F05 A;  4Z7X A;  3TJG A;  2DJ2 A;  4PNG A;  4I2U A;  4XRD A;  3LFL A;  1K0A A;  3IR4 A;  1EOG A;  1WOU A;  4X43 A;  2WRT A;  4DEJ A;  4CDO A;  2CAQ A;  4MJB A;  4QQ7 A;  4K6X A;  2QC7 A;  1MEK A;  2DMM A;  3KP8 A;  4ILF A;  2KLX A;  5AIV A;  4MK3 A;  1K0C A;  3DKS A;  4ICY A;  5E59 A;  1GUK A;  2E7P A;  1QMV A;  3H4K A;  1GLQ A;  5IIZ A;  1XVQ A;  1JLW A;  1RQM A;  3JCM L;  5J5N A;  1SK2 A;  3TRQ A;  1XW5 A;  2QA1 A;  4KB3 A;  4LMV A;  1HQO A;  1NHY A;  4HU7 A;  1N2A A;  2YZU A;  4NV2 A;  1EP8 A;  2K8S A;  1PX7 A;  2A4H A;  2G0F A;  4NMU A;  4I97 A;  1ZYN A;  3A2W A;  5FWG A;  1R5P A;  3H79 A;  2IPA A;  4HOJ A;  1AQW A;  2F9S A;  2V2G A;  4BVX B;  4MZB A;  3E3E A;  4F9Z A;  4MH3 A;  1EEM A;  1NSW A;  4D73 A;  1YF1 A;  4QL7 A;  3RBT A;  2IMI A;  4HJ2 A;  6GST A;  4O32 A;  4V1A g;  3N9J A;  1WRY A;  2JL4 A;  1JZW A;  1WWJ A;  4CW9 A;  4HQS A;  4ZL9 A;  2GT6 A;  2TRC P;  3O6T A;  2BTO T;  3D5J A;  2VLU A;  1XFL A;  2H75 A;  1GWC A;  1J0F A;  1SKR B;  3VI5 A;  2V6O A;  4OCE A;  3E9J B;  1PN9 A;  2HLS A;  3TOT A;  1LBK A;  5DCG A;  1A23 A;  3H93 A;  3M9J A;  1KNG A;  3FRC A;  5ECR B;  5GZZ B;  3HXS A;  6GSY A;  1W4V A;  2IMF A;  3GL3 A;  4FQU A;  1GUL A;  4EIP A;  2GT5 A;  5DAK A;  1YKC A;  1MTC A;  4L5L A;  4NAX A;  4ZB6 A;  4NWY A;  2FGX A;  3GN3 A;  4OWY A;  4Q5R A;  1SKW B;  2RUF A;  3ME7 A;  3RDW A;  1BJX A;  4WF5 A;  2RUE A;  5D93 A;  4IP6 A;  2YN1 A;  3RPN A;  1F3B A;  2K9F A;  3ZML A;  2IME A;  3TKR A;  5B8A A;  3C71 A;  1Y6E A;  2GZP A;  3IPZ A;  5A4W A;  3HZ8 A;  1LJR A;  2DBC A;  5H5R A;  1NHO A;  4MPF A;  2QA2 A;  2HT9 A;  1GH2 A;  1Z3E A;  2MBS A;  5D9X A;  2DKI A;  4WKW A;  2XC2 A;  4ISD A;  4MJE A;  5CNW A;  4AGS A;  4HDE A;  3GIX A;  2JAC A;  1M2B A;  3D4M A;  2BMX A;  3TJK A;  4DSS B;  4Z2R A;  1ZYQ B;  1T7P B;  2KOK A;  4LL4 B;  4NXI A;  2K6V A;  2LS5 A;  3A3T A;  2H6Z A;  3WGE A;  3KP9 A;  2A4V A;  3FYG A;  2CZ2 A;  2HZE A;  2FHE A;  3I6A A;  3CTG A;  2OAD A;  1TJD A;  5KOX A;  1EOH A;  3FR3 A;  1X9S B;  4MZW A;  3P7X A;  3WGX A;  3GKX A;  4Z2U A;  2FWH A;  1Z5Y E;  2A2S A;  3TKS A;  3IXR A;  5G2Z A;  5HR0 A;  3Q18 A;  2RII A;  2P0G A;  4PX1 A;  4E8E A;  5DCH A;  1XIY A;  2R37 A;  1TTZ A;  2VO4 A;  4JR4 A;  3GKK A;  2WFC A;  4MDC A;  3I43 A;  3CXG A;  4GST A;  4KAE A;  2VLV A;  3VK9 A;  2PVQ A;  5EPF A;  1YQ1 A;  3IC4 A;  2DKH A;  3KEB A;  4RI6 A;  4F0B A;  3VLN A;  3IK9 A;  2B6M A;  1X5E A;  2LRN A;  4ZBB A;  3EVI A;  3MNG A;  3GX0 A;  2RM6 A;  1EGR A;  4EXJ A;  2L4C A;  4MPG A;  3LEF A;  3LGC A;  2C3N A;  2WS2 A;  4TVE A;  1FO5 A;  1TI3 A;  3C7M A;  5J3R A;  1ST9 A;  1MD4 A;  3IOS A;  1G7O A;  3HZ4 A;  4KND A;  2OJL A;  1GSD A;  1FOH A;  3A5W A;  3LXZ A;  2VCX A;  2XHF A;  3DGQ A;  4O92 A;  4MP4 A;  2P5Q A;  1FW1 A;  1Z7P A;  4XHM A;  3TJF A;  3CTF A;  1S3A A;  5HFK A;  4IS0 A;  3C1R A;  3DVW A;  5KOW A;  3EC3 A;  2YZH A;  3VWW A;  3J7Y k;  3KTB A;  1XOB A;  4KDY A;  1TDI A;  1O7U A;  2AV4 A;  4EKZ A;  1E2Y A;  1GNE A;  2C3T A;  5DJM A;  5IMF A;  1TXX A;  3FKF A;  1RK4 A;  4GF0 A;  3KH7 A;  4D73 B;  2IMD A;  5IMC A;  4FYB A;  4N0Z A;  2PVO C;  4ZB9 A;  2VUP A;  2C0F A;  1AIU A;  1K0M A;  1XW9 A;  1OE8 A;  2ZNM A;  2IMK A;  4WEY A;  5JWQ B;  4PUA A;  2P31 A;  4IJI A;  1A2L A;  4ML1 A;  2AYT A;  1ERU A;  2QGV A;  4XS1 A;  5IOW A;  3CYN A;  4TXV A;  4FH8 A;  1IYI A;  5C04 A;  3WYW A;  4EO3 A;  5KEJ A;  3SBC A;  1T8E B;  2VLT A;  4BWQ A;  1MDI A;  2HRA A;  6GSW A;  2B3S A;  1I5G A;  1K3L A;  3HJM A;  4RUV A;  1TRV A;  4MF5 A;  3L9V A;  2O87 A;  5CAX A;  3CQF A;  3KCM A;  3VWU A;  4G2E A;  2RLI A;  5DAK B;  5B8B A;  1DE2 A;  1WP0 A;  2H30 A;  3KTL A;  3QD9 A;  2A2P A;  3MAK A;  1SK0 A;  2LRC A;  3DWV A;  1OKD A;  1ZYE A;  1PQN A;  2WGR A;  4KW6 A;  2HI7 A;  4ZBA A;  1SEN A;  3F3Q A;  2E2M A;  2PWJ A;  7GSS A;  1DE1 A;  3L4N A;  3WT2 A;  3HY2 A;  4V2M A;  1G0T A;  2HE3 A;  2C0D A;  2FNO A;  2MBT A;  3ZMK A;  2VCQ A;  4HQZ A;  4V1A p;  2OBK A;  3ZVJ A;  2L6C A;  1F37 A;  1YDK A;  4ULX A;  1A8L A;  2E2G A;  4YKG A;  1SJI A;  3U5R E;  1FHE A;  1ON4 A;  4EL1 A;  4QL9 A;  2WZ9 A;  3GNJ A;  2VL2 A;  5KN1 A;  1EV4 A;  1YF0 A;  2CVK A;  2GVP A;  3ISO A;  5A5K A;  2H72 A;  1XWB A;  4IW9 A;  2C0E A;  4MH2 A;  4KGI A;  3VPQ A;  3VWX A;  1KBN A;  2X99 A;  1TRU A;  2LKU A;  4FYC A;  3R3E A;  3A2X A;  1MDJ A;  1JZR A;  2HFD A;  3GX8 A;  4KCE A;  1B9X C;  1GSE A;  2R0P A;  1M2A A;  2PPT A;  1OKT A;  4ACS A;  5JWO B;  3BOA A;  2LJR A;  4WF4 A;  2ZUP A;  3LQ7 A;  1U3I A;  2IFQ A;  3TRP A;  4V2L A;  4YQM A;  2YCD A;  2FLS A;  3UEM A;  4YAV A;  2BJX A;  1X9M B;  4GRF A;  2VAF A;  3GL5 A;  1DSB A;  4LMW A;  3HDC A;  1C72 A;  2JSZ A;  1PL1 A;  1Y25 A;  1FOV A;  2KUC A;  5COH A;  6GSV A;  2YJ7 A;  2L59 A;  1PMT A;  3FR9 A;  1THX A;  3GMF A;  1HD2 A;  1BED A;  3H8Q A;  3GSS A;  3LYP A;  3LXT A;  2MMZ A;  1GRX A;  3EMP A;  2WJU A;  5GAN D;  1ZCP A;  3LSZ A;  1S3R A;  4OFT A;  3GFK A;  2K8V A;  2H0I A;  3IC8 A;  3TUE A;  5IMD A;  1K0D A;  4O5Q A;  4PXO A;  2WDU A;  1U6T A;  1WPI A;  3TOU A;  1TK8 B;  1SU9 A;  5D8I A;  4K0N A;  5JCU A;  4X1U A;  4KSO A;  2V41 A;  3TCO A;  2L57 A;  3G7Y A;  5DJL A;  5ECP B;  3U6V A;  1IYH A;  2XPD A;  2DJK A;  2H0G A;  2PU9 C;  4ML6 A;  1B4P A;  4I6X A;  2DJJ A;  3TB2 A;  1A8Y A;  2LJA A;  3FR6 A;  4PUR A;  5GSS A;  4MLY A;  2EIO A;  3PH9 A;  2LNS A;  4JU5 A;  2N5F A;  2XBQ A;  2H6X A;  5J9C A;  3BD2 A;  5CRW A;  2LEG A;  2RM5 A;  5IPH A;  4K5S A;  1PSQ A;  2DJ3 A;  3GH6 A;  2HSY A;  5G1K A;  4ZIJ A;  4ECI A; 
#chains in the Genus database with same CATH homology
 1GTI A;  3IRA A;  5IO0 A;  4WR5 A;  5D73 A;  5DQY A;  1U87 A;  1M0U A;  1ERT A;  4WXT A;  1H75 A;  1XVW A;  1G6W A;  2J23 A;  1J08 A;  4G10 A;  3KGK A;  1Q98 A;  1T4Z A;  2N5B A;  2NPB A;  2O7K A;  4AF2 A;  2GS3 A;  2C4J A;  3QDN A;  2X49 A;  3CRT A;  4YH2 A;  1BYE A;  1A2M A;  5D9T A;  2PGT A;  2DC5 A;  3ERW A;  2YNX A;  1ERV A;  3UBL A;  4JE1 A;  5DBQ A;  2FA4 A;  2UZ8 A;  1XXU A;  4GWR A;  1GNW A;  2LST A;  1USB A;  2B5X A;  4KE3 A;  1Q4J A;  1TK5 B;  2OE1 A;  2R2J A;  1GSF A;  4Q5Q A;  1X0R A;  3EE2 A;  2GGT A;  1QGV A;  1M2D A;  4L8E A;  2C8U A;  1A0F A;  3I9V 2;  2H71 A;  5H5S A;  3UJ1 A;  2I1U A;  5KN0 A;  5C00 A;  2AAW A;  2DJ1 A;  4YQU A;  1TU8 A;  3L0H A;  1UC7 A;  1V57 A;  1M7T A;  4YAP A;  5G31 A;  3FHK A;  3UBK A;  3SWL A;  2H70 A;  2B7K A;  3MYD A;  1K0N A;  1VRS D;  4TR3 A;  5IM9 A;  1Z6M A;  1OAZ A;  2R5G A;  3GTU A;  4HJM A;  3D4T A;  3EUR A;  4AJ7 A;  4EC0 A;  1FVJ A;  2TRX A;  3W8S A;  3ZYW A;  1THO A;  2FWE A;  1ML6 A;  3O3T A;  3FZ5 A;  2CA8 A;  3HVS A;  4USS A;  2PUK C;  4G0L A;  3GH9 A;  2H1G A;  3KM6 A;  4ZL8 A;  3TGZ A;  5EVO A;  2NDO A;  4DSR A;  2IL3 A;  4HI7 A;  2L6D A;  3TKQ A;  4N10 A;  4MAB A;  5ENU A;  5B6N A;  5FT3 A;  3VI7 A;  2CAI A;  1XWG A;  2OKA A;  4IQA A;  2IFQ B;  3H1N A;  3IHQ A;  1QFN A;  1K3O A;  4POK A;  1R4W A;  1JZO A;  4GSS A;  4P3Y B;  5IMZ A;  2FUG 2;  5BRT A;  5IQY A;  1XCC A;  1VF4 A;  3HKR A;  1TOF A;  1F2E A;  2GSQ A;  4JZQ A;  1CQH A;  3UVT A;  3QPM A;  3VPT A;  4TR4 A;  5G5E A;  4IP1 A;  4PGT A;  3FEU A;  1GLP A;  1BX9 A;  4ZBD A;  1B4Q A;  4L0U A;  2VL9 A;  1XW6 A;  4K7O A;  3IAS 2;  4TXO A;  3MSZ A;  3TRX A;  4HZ4 A;  1S3D A;  2YWM A;  1DUG A;  4GCI A;  5ECO B;  3TDG A;  3ERG A;  5HR3 A;  3IDV A;  4O7H A;  2Z9S A;  2LRT A;  1SKS B;  5CRG A;  3D21 A;  4WBJ A;  3FZ4 A;  3LJR A;  4ZXG A;  3FW2 A;  3QAG A;  1N8J A;  1EP7 A;  3HD5 A;  4TOP A;  1YEP A;  4XS4 A;  1M9B A;  1PGT A;  4OD7 A;  3M8N A;  2OBI A;  1FG4 A;  5IO2 A;  3ZRD A;  3E0U A;  3UAR A;  3L9U A;  5EY6 A;  1FAA A;  2PBJ A;  2ES7 A;  2R0C A;  2FWG A;  1SD9 A;  2X8H A;  4Q5N A;  3Q19 A;  1TW9 A;  3ZZX A;  1A24 A;  1O73 A;  4G9H A;  4F03 A;  5F0G A;  5JCW A;  1G6Y A;  5HFG A;  1YY7 A;  4PQH A;  5J41 A;  2I81 A;  1J9B A;  1YEX A;  11GS A;  2WCI A;  2R0G A;  3F63 A;  2IJY A;  2YWN A;  1GTB A;  3A2V A;  4K8M A;  3M9K A;  2YAN A;  4J56 E;  1AC1 A;  1ILO A;  2B5E A;  1UVZ A;  4K5R A;  5AIX A;  1PKW A;  1ABA A;  3NZN A;  4L5O A;  4KH7 A;  1SJ6 A;  1EGO A;  2VL2 C;  5J9B A;  2B1L A;  4FO5 A;  2OA7 A;  2XPE A;  4E8H A;  4H86 A;  4WR4 A;  2YV9 A;  4XIH A;  2IWT A;  3M0F A;  3GST A;  2WB9 A;  3L78 A;  4IQ1 A;  2ALB A;  3KD0 A;  5ID2 A;  1GUH A;  1KTE A;  1GTU A;  5IPG A;  2YV7 A;  3TKP A;  3NOF A;  1O8W A;  4MA9 A;  3VWV A;  4OFM A;  2H73 A;  1OC9 A;  4ECB A;  4JRR A;  1XWA A;  1XWC A;  2ON5 A;  5BMU A;  1GSY A;  2HZF A;  2JAD A;  2A2R A;  2EIR A;  3DYR A;  20GS A;  2CVD A;  1JLV A;  2DIY A;  2AB6 A;  4Q5F A;  5G1L A;  1F6M C;  3DIE A;  3GTU B;  2HSH A;  2KP2 A;  1GTA A;  1GP1 A;  4MJA A;  3IHG A;  5D96 A;  1U88 A;  3F6F A;  1PRX A;  3LOR A;  4IBP A;  4BVY B;  1O8X A;  1O85 A;  13GS A;  2AHE A;  3APQ A;  3CSJ A;  1AQX A;  3LWA A;  2B1K A;  1PN0 A;  2FWF A;  3GKN A;  4HZ2 A;  4BPY A;  4G0K A;  4K9Z A;  1M9A A;  1VF3 A;  1YZX A;  18GS A;  1T1V A;  1U3A A;  2R6K A;  5G30 A;  2VIM A;  2M72 A;  3APO A;  4IN0 A;  4Z2T A;  1B9Y C;  2GSR A;  2HRF A;  1TRW A;  4L0W A;  2OAC A;  3ZFL A;  5ECS A;  3M1G A;  2IIY A;  3BCI A;  1SK1 A;  4IVF A;  5JCG A;  2XBI A;  4GTU A;  2LTK A;  1MDK A;  4IHU A;  3IK7 A;  1R26 A;  4EUY A;  2H8L A;  3G9B A;  2MYG A;  2YWO A;  1TK0 B;  3EWL A;  2I3Y A;  2MZC A;  3NIV A;  1NW2 A;  2E0Q A;  4POL A;  3US3 A;  1M99 A;  2FD3 A;  3CSH A;  4KF9 A;  2MMN A;  2F3M A;  1V40 A;  5HFI A;  3R2Q A;  4TXO B;  3KMN A;  5CP1 A;  3UAP A;  4JR6 A;  16GS A;  2I9H A;  4GLT A;  5F07 A;  2JSY A;  4K2X A;  4LLR A;  3WD6 A;  2OE0 A;  5LD0 A;  4ID0 A;  3RAZ A;  4MNN A;  3CRU A;  3FZ9 A;  4MF6 A;  1B48 A;  4AJ8 A;  3ZIJ A;  1XWK A;  4F0C A;  2EC4 A;  4XS4 B;  2H76 A;  2AJQ B;  4FYU A;  1ZYP A;  12GS A;  4DVC A;  3UIW A;  3HHV A;  4MF7 A;  2L5L A;  1A0R P;  1OVN A;  1PKZ A;  3DML A;  5ECK B;  2X8C A;  1TP9 A;  5E4W A;  3KXO A;  3IBH A;  1HNB A;  3VUR A;  4GSN A;  3OR5 A;  1EEJ A;  2HSM A;  17GS A;  2WUL A;  4PNF A;  3ED3 A;  2V1M A;  4HUA A;  3BBY A;  4TR0 A;  1AAZ A;  6GSX A;  1GSQ A;  1PX6 A;  3W6G A;  3K8N A;  2REM A;  1LU4 A;  2F8A A;  4NHW A;  1OC3 A;  5CO3 A;  2NVL A;  2C80 A;  3VFI A;  4YQV A;  4TN8 A;  1ZOF A;  4NHZ A;  4HS1 A;  3GRX A;  4IGJ A;  3ZRE A;  1SYX A;  5KN2 A;  4I5Q A;  3CBU A;  1AUC A;  4G0I A;  3EPT A;  2YOI A;  1W89 A;  1TU7 A;  1MD3 A;  5ID2 B;  4BL7 B;  1K0O A;  5DVB A;  5DDL A;  3G7J A;  3P8W A;  4TKY A;  1ZL9 A;  5H5Q A;  1OC9 B;  1WIK A;  1BQ7 A;  3QAV A;  4MJC A;  3P90 A;  4F2I A;  2R3X A;  1E6B A;  2N5A A;  10GS A;  1UA5 A;  2TIR A;  3A5I A;  1RW1 A;  5AGY A;  3QMX A;  9GSS A;  2HRK A;  2LJK A;  4HU9 A;  3GUS A;  2LV3 A;  2DIZ A;  5ELA A;  3TKS C;  2V6K A;  2VM2 A;  4OCF A;  1GL8 A;  1AXD A;  4X0X A;  5ECH B;  1V58 A;  2VM1 A;  2JU5 A;  5A4V A;  3IV4 A;  3PIN A;  1S3C A;  4KDX A;  2IN3 A;  2PN8 A;  2VCZ A;  3GV1 A;  4LA1 A;  5ECM B;  1R5A A;  5ELG A;  3MIX A;  2HNL A;  1ZGN A;  2MMO A;  3C8E A;  5IOX A;  1VF2 A;  4NV5 A;  1H4O A;  2I4A A;  3ZVJ D;  1JFU A;  5INY A;  5LCZ A;  3QR6 A;  5F06 A;  5LNK e;  4ECJ A;  4RI7 A;  4ZL7 A;  2FCH A;  2GLR A;  1BG5 A;  4EDZ A;  5ECQ B;  2GQM A;  2H19 A;  5J4U A;  8GSS A;  4OFN A;  2DJ0 A;  4BVY A;  3KH9 A;  1GSU A;  2H1A A;  4GQC A;  2ZCT A;  2CX3 A;  3CMI A;  2VCW A;  2FA8 A;  5ECN B;  3HCZ A;  3TKS E;  1SL1 B;  3IE3 A;  4FIW A;  2H66 A;  4KCA A;  3F4T A;  1GUM A;  3F4R A;  4X4J A;  5GST A;  3GA4 A;  4ECC A;  3UL3 A;  1FB6 A;  4WET A;  4K0G A;  2CV4 A;  3O76 A;  5DAL B;  3HA9 A;  3FMW A;  1X5C A;  3HJP A;  1ZZY A;  3PGT A;  4JED A;  4GQF A;  1TKD B;  1V2A A;  2X8G A;  1OE7 A;  3F6D A;  1R7H A;  4EIQ A;  4DSQ A;  2X4A A;  1XOA A;  5ECI B;  2PER A;  2H1B A;  3RHB A;  1O81 A;  5HQP A;  2M80 A;  1XZO A;  4MZC A;  3F0I A;  3QFB C;  3LYK A;  1A2J A;  4YKF A;  2DSA A;  4TRX A;  1WMJ A;  3LW9 A;  2EIQ A;  2LQO A;  4TR1 B;  1X9W B;  1K0B A;  2FY6 A;  1ACV A;  1SJZ A;  1G7E A;  4K2D A;  4BA7 A;  2GZZ A;  4ZIL A;  1URM A;  1Z7R A;  2AUV A;  3F8U A;  3EU3 A;  3FZA A;  5AIS A;  1PL2 A;  4J57 E;  5JWR B;  1SYR A;  1NM3 A;  2B7J A;  4AJ6 A;  1FVK A;  2JZT A;  2D2Z A;  2NTO A;  5B7C A;  1ZMA A;  3DD3 A;  3PR8 A;  2QKE A;  5DQS A;  4EF0 A;  1XBS A;  4NPB A;  2YPM A;  1HYU A;  1TRS A;  3EMX A;  2VD1 A;  5HR2 A;  5KN3 A;  3D6I A;  3APS A;  4O5U A;  5F8B A;  4OMV A;  1SL2 B;  3DVX A;  3P2A A;  3S9F A;  4BWS A;  1X5D A;  2MMA A;  3CSI A;  3I69 A;  5IMA A;  5D9V A;  1JZD A;  3HJO A;  1HNC A;  1V9W A;  4KA0 A;  1WJK A;  4XTS A;  3QCP A;  5D9W A;  2CVB A;  2H74 A;  1Z9H A;  14GS A;  5ABR A;  1F9M A;  4IEL A;  1SL0 B;  2OE3 A;  2LQQ A;  2O89 A;  2H0H A;  5A4U A;  2YJH A;  6GSS A;  2HYX A;  2YWI A;  2DLX A;  4N0V A;  2VCV A;  2ON7 A;  1EV9 A;  1QXH A;  4F82 A;  1UN2 A;  1EZK A;  4MMM A;  2G2Q A;  4CY6 A;  1OC8 A;  3IA1 A;  1K3Y A;  4PQ1 A;  2X64 A;  2CZ3 A;  3F4S A;  2C3Q A;  2LUS A;  1I9D A;  1T00 A;  2NBS A;  4PQI A;  4BVX A;  2GDR A;  3HYP A;  3C1S A;  2VOC A;  4EDY A;  1QK8 A;  4BL7 A;  3KZQ A;  3QOU A;  2KHP A;  1V98 A;  1ERW A;  4RQR A;  4WBR D;  4PUF C;  2PMT A;  1BAY A;  4ZB8 A;  2H01 A;  5B6M A;  2HXK A;  5ECL B;  4I8B A;  3DXB A;  4PTS A;  3IAM 2;  3AY8 A;  1F3A A;  4G19 A;  5CRD A;  2JZS A;  1EWX A;  2C1Y A;  4XS6 A;  2O8V B;  3GYK A;  2F51 A;  1FB0 A;  3HVV A;  3F3R A;  2GQL A;  1B8X A;  2C0G A;  3DRN A;  3RHC A;  1JHB A;  2CQ9 A;  3QFA C;  2HRN A;  19GS A;  3PPU A;  3EYT A;  2H6Y A;  1AQV A;  3GUR A;  2B5Y A;  4IJ3 A;  5GAP D;  3KIJ A;  1TI1 A;  3ZL5 A;  4K7N A;  1VF1 A;  1T3B A;  3UOM A;  5CRE A;  5CYY A;  4IKH A;  2GZY A;  2L4Q A;  3RPP A;  1PA3 A;  3MDK A;  4XRA A;  4POB A;  1DBY A;  3EIN A;  3WGD A;  3ERF A;  3D0Z A;  3GHA A;  3WT1 A;  3FK8 A;  3HVX A;  4A5P A;  3C73 A;  3M3M A;  4GXZ A;  3TJB A;  3D22 A;  4N11 A;  3ZIT A;  2HZE B;  4MCU A;  2R4V A;  3W8J A;  1PD2 1;  3ZLP A;  2QSI A;  1GSS A;  3Q6O A;  3J7Y b;  1O6J A;  2L5O A;  5FHI A;  2YP6 A;  1YKA A;  4EVM A;  2VCT A;  4TW5 A;  2CT6 A;  2H1D A;  2P5R A;  1CQG A;  2CX4 A;  1T4Y A;  2VD0 A;  4KDU A;  4DSS A;  1QUW A;  3MWH A;  3ZTL A;  1AW9 A;  1XPV A;  3F9U A;  2GST A;  2GTU A;  5L71 A;  2GQK A;  4LL1 B;  4K1F A;  5DAL A;  4JBB A;  4XCS A;  3KJY A;  2J9H A;  3EU4 A;  3ZIV A;  3BCK A;  2O85 A;  2JZR A;  4N30 A;  3TJJ A;  4OO4 A;  1QQ2 A;  2K18 A;  2DML A;  4HEA 2;  4K7I A;  3BJ5 A;  3UVH A;  4OO5 A;  1KEB A;  2GSS A;  5HR1 A;  4KUN A;  3V1W A;  2VL3 A;  4J2F A;  2LNT A;  3N5O A;  1HNA A;  6GSU A;  3KMO A;  3L9S A;  4EE0 A;  1SD8 A;  5EL8 A;  3FY7 A;  4CY8 A;  1VGL A;  1Z6N A;  2F8F A;  4KX4 A;  4POM A;  1OYJ A;  4TR1 A;  3QAW A;  22GS A;  3ME8 A;  2V32 A;  5AN1 A;  4RQX A;  4CHS A;  4O5R A;  2KP1 A;  4V2N A;  3DEX A;  4I2T A;  2M46 A;  3G7I A;  3GKM A;  4KSM A;  5G5F A;  3LG6 A;  3Q74 A;  3UMA A;  3ZFB A;  1WE0 A;  1YJ6 A;  5CRH A;  5IMV A;  5F05 A;  4Z7X A;  3TJG A;  2DJ2 A;  4PNG A;  4I2U A;  4XRD A;  3LFL A;  1K0A A;  3IR4 A;  1EOG A;  1WOU A;  4X43 A;  2WRT A;  4DEJ A;  4CDO A;  2CAQ A;  4MJB A;  4QQ7 A;  4K6X A;  2QC7 A;  1MEK A;  2DMM A;  3KP8 A;  4ILF A;  2KLX A;  5AIV A;  4MK3 A;  1K0C A;  3DKS A;  4ICY A;  5E59 A;  1GUK A;  2E7P A;  1QMV A;  3H4K A;  1GLQ A;  5IIZ A;  1XVQ A;  1JLW A;  1RQM A;  3JCM L;  5J5N A;  1SK2 A;  3TRQ A;  1XW5 A;  2QA1 A;  4KB3 A;  4LMV A;  1HQO A;  1NHY A;  4HU7 A;  1N2A A;  2YZU A;  4NV2 A;  1EP8 A;  2K8S A;  1PX7 A;  2A4H A;  2G0F A;  4NMU A;  4I97 A;  1ZYN A;  3A2W A;  5FWG A;  1R5P A;  3H79 A;  2IPA A;  4HOJ A;  1AQW A;  2F9S A;  2V2G A;  4BVX B;  4MZB A;  3E3E A;  4F9Z A;  4MH3 A;  1EEM A;  1NSW A;  4D73 A;  1YF1 A;  4QL7 A;  3RBT A;  2IMI A;  4HJ2 A;  6GST A;  4O32 A;  4V1A g;  3N9J A;  1WRY A;  2JL4 A;  1JZW A;  1WWJ A;  4CW9 A;  4HQS A;  4ZL9 A;  2GT6 A;  2TRC P;  3O6T A;  2BTO T;  3D5J A;  2VLU A;  1XFL A;  2H75 A;  1GWC A;  1J0F A;  1SKR B;  3VI5 A;  2V6O A;  4OCE A;  3E9J B;  1PN9 A;  2HLS A;  3TOT A;  1LBK A;  5DCG A;  1A23 A;  3H93 A;  3M9J A;  1KNG A;  3FRC A;  5ECR B;  5GZZ B;  3HXS A;  6GSY A;  1W4V A;  2IMF A;  3GL3 A;  4FQU A;  1GUL A;  4EIP A;  2GT5 A;  5DAK A;  1YKC A;  1MTC A;  4L5L A;  4NAX A;  4ZB6 A;  4NWY A;  2FGX A;  3GN3 A;  4OWY A;  4Q5R A;  1SKW B;  2RUF A;  3ME7 A;  3RDW A;  1BJX A;  4WF5 A;  2RUE A;  5D93 A;  4IP6 A;  2YN1 A;  3RPN A;  1F3B A;  2K9F A;  3ZML A;  2IME A;  3TKR A;  5B8A A;  3C71 A;  1Y6E A;  2GZP A;  3IPZ A;  5A4W A;  3HZ8 A;  1LJR A;  2DBC A;  5H5R A;  1NHO A;  4MPF A;  2QA2 A;  2HT9 A;  1GH2 A;  1Z3E A;  2MBS A;  5D9X A;  2DKI A;  4WKW A;  2XC2 A;  4ISD A;  4MJE A;  5CNW A;  4AGS A;  4HDE A;  3GIX A;  2JAC A;  1M2B A;  3D4M A;  2BMX A;  3TJK A;  4DSS B;  4Z2R A;  1ZYQ B;  1T7P B;  2KOK A;  4LL4 B;  4NXI A;  2K6V A;  2LS5 A;  3A3T A;  2H6Z A;  3WGE A;  3KP9 A;  2A4V A;  3FYG A;  2CZ2 A;  2HZE A;  2FHE A;  3I6A A;  3CTG A;  2OAD A;  1TJD A;  5KOX A;  1EOH A;  3FR3 A;  1X9S B;  4MZW A;  3P7X A;  3WGX A;  3GKX A;  4Z2U A;  2FWH A;  1Z5Y E;  2A2S A;  3TKS A;  3IXR A;  5G2Z A;  5HR0 A;  3Q18 A;  2RII A;  2P0G A;  4PX1 A;  4E8E A;  5DCH A;  1XIY A;  2R37 A;  1TTZ A;  2VO4 A;  4JR4 A;  3GKK A;  2WFC A;  4MDC A;  3I43 A;  3CXG A;  4GST A;  4KAE A;  2VLV A;  3VK9 A;  2PVQ A;  5EPF A;  1YQ1 A;  3IC4 A;  2DKH A;  3KEB A;  4RI6 A;  4F0B A;  3VLN A;  3IK9 A;  2B6M A;  1X5E A;  2LRN A;  4ZBB A;  3EVI A;  3MNG A;  3GX0 A;  2RM6 A;  1EGR A;  4EXJ A;  2L4C A;  4MPG A;  3LEF A;  3LGC A;  2C3N A;  2WS2 A;  4TVE A;  1FO5 A;  1TI3 A;  3C7M A;  5J3R A;  1ST9 A;  1MD4 A;  3IOS A;  1G7O A;  3HZ4 A;  4KND A;  2OJL A;  1GSD A;  1FOH A;  3A5W A;  3LXZ A;  2VCX A;  2XHF A;  3DGQ A;  4O92 A;  4MP4 A;  2P5Q A;  1FW1 A;  1Z7P A;  4XHM A;  3TJF A;  3CTF A;  1S3A A;  5HFK A;  4IS0 A;  3C1R A;  3DVW A;  5KOW A;  3EC3 A;  2YZH A;  3VWW A;  3J7Y k;  3KTB A;  1XOB A;  4KDY A;  1TDI A;  1O7U A;  2AV4 A;  4EKZ A;  1E2Y A;  1GNE A;  2C3T A;  5DJM A;  5IMF A;  1TXX A;  3FKF A;  1RK4 A;  4GF0 A;  3KH7 A;  4D73 B;  2IMD A;  5IMC A;  4FYB A;  4N0Z A;  2PVO C;  4ZB9 A;  2VUP A;  2C0F A;  1AIU A;  1K0M A;  1XW9 A;  1OE8 A;  2ZNM A;  2IMK A;  4WEY A;  5JWQ B;  4PUA A;  2P31 A;  4IJI A;  1A2L A;  4ML1 A;  2AYT A;  1ERU A;  2QGV A;  4XS1 A;  5IOW A;  3CYN A;  4TXV A;  4FH8 A;  1IYI A;  5C04 A;  3WYW A;  4EO3 A;  5KEJ A;  3SBC A;  1T8E B;  2VLT A;  4BWQ A;  1MDI A;  2HRA A;  6GSW A;  2B3S A;  1I5G A;  1K3L A;  3HJM A;  4RUV A;  1TRV A;  4MF5 A;  3L9V A;  2O87 A;  5CAX A;  3KCM A;  3VWU A;  4G2E A;  2RLI A;  5DAK B;  5B8B A;  1DE2 A;  1WP0 A;  2H30 A;  3KTL A;  3QD9 A;  2A2P A;  3MAK A;  1SK0 A;  2LRC A;  3DWV A;  1OKD A;  1ZYE A;  1PQN A;  2WGR A;  4KW6 A;  2HI7 A;  4ZBA A;  1SEN A;  3F3Q A;  2E2M A;  2PWJ A;  7GSS A;  1DE1 A;  3L4N A;  3WT2 A;  3HY2 A;  4V2M A;  1G0T A;  2HE3 A;  2C0D A;  2FNO A;  2MBT A;  3ZMK A;  2VCQ A;  4HQZ A;  4V1A p;  2OBK A;  3ZVJ A;  2L6C A;  1F37 A;  1YDK A;  4ULX A;  1A8L A;  2E2G A;  4YKG A;  1SJI A;  3U5R E;  1FHE A;  1ON4 A;  4EL1 A;  4QL9 A;  2WZ9 A;  3GNJ A;  2VL2 A;  5KN1 A;  1EV4 A;  1YF0 A;  2CVK A;  2GVP A;  3ISO A;  5A5K A;  2H72 A;  1XWB A;  4IW9 A;  2C0E A;  4MH2 A;  4KGI A;  3VPQ A;  3VWX A;  1KBN A;  2X99 A;  1TRU A;  2LKU A;  4FYC A;  3R3E A;  3A2X A;  1MDJ A;  1JZR A;  2HFD A;  3GX8 A;  4KCE A;  1B9X C;  1GSE A;  2R0P A;  1M2A A;  2PPT A;  1OKT A;  4ACS A;  5JWO B;  3BOA A;  2LJR A;  4WF4 A;  2ZUP A;  3LQ7 A;  1U3I A;  2IFQ A;  3TRP A;  4V2L A;  4YQM A;  2YCD A;  2FLS A;  3UEM A;  4YAV A;  2BJX A;  1X9M B;  4GRF A;  2VAF A;  3GL5 A;  1DSB A;  4LMW A;  3HDC A;  1C72 A;  2JSZ A;  1PL1 A;  1Y25 A;  1FOV A;  2KUC A;  5COH A;  6GSV A;  2YJ7 A;  2L59 A;  1PMT A;  3FR9 A;  1THX A;  3GMF A;  1HD2 A;  1BED A;  3H8Q A;  3GSS A;  3LYP A;  3LXT A;  2MMZ A;  1GRX A;  3EMP A;  2WJU A;  5GAN D;  1ZCP A;  3LSZ A;  4OFT A;  3GFK A;  2K8V A;  2H0I A;  3IC8 A;  3TUE A;  5IMD A;  1K0D A;  4O5Q A;  4PXO A;  2WDU A;  1U6T A;  1WPI A;  3TOU A;  1TK8 B;  1SU9 A;  5D8I A;  4K0N A;  5JCU A;  4X1U A;  4KSO A;  2V41 A;  3TCO A;  2L57 A;  3G7Y A;  5DJL A;  5ECP B;  3U6V A;  1IYH A;  2XPD A;  2DJK A;  2H0G A;  2PU9 C;  4ML6 A;  1B4P A;  4I6X A;  2DJJ A;  3TB2 A;  1A8Y A;  2LJA A;  3FR6 A;  4PUR A;  5GSS A;  4MLY A;  2EIO A;  3PH9 A;  2LNS A;  4JU5 A;  2N5F A;  2XBQ A;  2H6X A;  5J9C A;  3BD2 A;  5CRW A;  2LEG A;  2RM5 A;  5IPH A;  4K5S A;  1PSQ A;  2DJ3 A;  3GH6 A;  2HSY A;  5G1K A;  4ZIJ A;  4ECI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...