1O85A

Radiation-reduced tryparedoxin-i
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
GLDKYLPGIEKLRRGDGEVEVKSLAGKLVFFYFSASWCPPCRGFTPQLIEFYDKFHESKNFEVVFCTWDEEEDGFAGYFAKMPWLAVPFAQSEAVQKLSKHFNVESIPTLIGVDADSGDVVTTRARATLVKDPEGEQFPWKDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords TRYPAREDOXIN
publication title Tryparedoxins from Crithidia Fasciculata and Trypanosoma Brucei: Photoreduction of the Redox Disulfide Using Synchrotron Radiation and Evidence for a Conformational Switch Implicated in Function
pubmed doi rcsb
source organism Crithidia fasciculata
total genus 43
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1o85A00
1ML6A 2M80A 1ERUA 3TRXA 4EKZA 3H79A 4WF4A 3P2AA 3FHKA 4NXIA 1MD4A 3GIXA 1ON4A 2C3QA 3QPMA 4MH3A 5AN1A 1TU8A 1GTIA 4POLA 2AYTA 1TDIA 4PX1A 3IAM2 4XHMA 1EV4A 1CQHA 2CVBA 4Q5QA 4LMWA 2MMAA 1F3BA 5D9TA 2FHEA 2H75A 1CQGA 3H93A 1Y25A 2H01A 3CYNA 1X9MB 3ZRDA 2IMIA 3F3QA 1YZXA 1VF4A 5DQSA 4LLRA 2MYGA 4N30A 17GSA 3GTUB 4X43A 3ED3A 1TK0B 2CVDA 1WWJA 2LKUA 3E9JB 3LXTA 3I43A 4ZBAA 3QAGA 1ZL9A 2YWMA 1F9MA 4P3YB 5E59A 3GMFA 4MF6A 3WGDA 2H1DA 3QD9A 2GTUA 2VCZA 5ECQB 5DQYA 1RQMA 4MJEA 2FD3A 2RM6A 3QAWA 2DSAA 2IMFA 2K18A 4N0VA 1GSFA 3VI5A 4K7OA 2K8SA 2WS2A 4HU7A 4KDXA 3UMAA 4XRAA 1SL2B 4OFTA 1JFUA 3FY7A 4OFNA 5A4VA 3DVWA 1FB0A 2AUVA 1WMJA 4OCFA 4ZBBA 3QFBC 4HZ2A 5C04A 3P7XA 2MMNA 2WB9A 4ECIA 1Q4JA 3LFLA 2DJ2A 3D22A 3L4NA 2O87A 3GTUA 5AIVA 1YEXA 3F0IA 3F63A 3KEBA 2VD0A 2JZTA 2VLUA 2FY6A 1TRWA 4LMVA 3TJBA 2GZYA 3FRCA 2F8AA 2C3NA 1SJ6A 5HR0A 5IPHA 2GZZA 2E0QA 3HXSA 3W8JA 2AHEA 1HNAA 5GSTA 2RUEA 2J9HA 2PVQA 4G19A 2YOIA 3TRPA 2PERA 2GQKA 5LNKe 2V41A 1J0FA 3F4TA 2L6CA 5AISA 3FZ4A 3RPNA 4KX4A 1AAZA 1GLPA 1JLWA 5F06A 1SD8A 4JEDA 3M8NA 3KTLA 1TP9A 2VLTA 2KP1A 3RHCA 3DEXA 2X99A 2MZCA 2KP2A 5CRDA 5KEJA 1EZKA 4TR4A 2WDUA 4EF0A 2G0FA 2PPTA 4FIWA 3C8EA 4EO3A 4KSMA 4I6XA 5D8IA 3PR8A 3HDCA 3IV4A 2TIRA 2C80A 1TXXA 2HRNA 3MSZA 3APQA 1LJRA 3U5RE 2YJ7A 5GZZB 4MPGA 4I2TA 1GSDA 5CRWA 2J23A 3L9VA 5D93A 5JWRB 1KNGA 1WJKA 3KMOA 3AY8A 1SK1A 2C8UA 5J5NA 1XXUA 2VOCA 4PXOA 3C71A 3CSJA 1BJXA 3L9UA 2ZCTA 1BG5A 1A8YA 1EOHA 4L0UA 3IR4A 1MDIA 2BMXA 1GUHA 3O3TA 4K7IA 5ID2B 3A2WA 2HLSA 2GSSA 5F05A 5IM9A 3Q6OA 1PL1A 5J9CA 2CX4A 1YKCA 2CZ2A 1TRSA 5CNWA 3FZ9A 1U87A 2C0DA 2RUFA 3UBLA 2LSTA 3IHQA 3FZ5A 4TW5A 1Q98A 3O6TA 2YZHA 1SK0A 3WD6A 3IAS2 4TOPA 2ON5A 4TXVA 3ZIVA 2CQ9A 4ISDA 3IPZA 2HNLA 2B5XA 4AJ6A 4HDEA 3APOA 1SL0B 1TOFA 1AQWA 2VAFA 1GL8A 4OCEA 3GL5A 4D73A 3L9SA 2IMEA 2IL3A 1G0TA 3KIJA 1QUWA 4TKYA 3HVXA 3UAPA 3GKNA 4WBJA 4OWYA 2GLRA 1SU9A 3TGZA 4I5QA 2LUSA 3TKQA 3LGCA 3LG6A 2ZUPA 2FGXA 5ID2A 2VL2C 3LSZA 4FYUA 1NHYA 2CAIA 2DMMA 3NOFA 3KH9A 4NWYA 2X64A 1O6JA 3D5JA 3KD0A 4EDYA 3CTGA 4MJAA 1GWCA 3KM6A 4AJ7A 2C1YA 2JACA 5IO0A 4F2IA 3EINA 5HR2A 2C3TA 3HYPA 3KZQA 3DYRA 3KH7A 4YAVA 1VGLA 4YQUA 1FW1A 1OKDA 2V6OA 5H5SA 3WGXA 5DALA 3VWWA 3N5OA 4TR0A 1V57A 2GT6A 3FW2A 2GSQA 4HJ2A 2VUPA 4ECCA 2H6ZA 1A2LA 1NSWA 5CRHA 4V1Ag 1JZOA 16GSA 3QMXA 1YF1A 5F0GA 5J9BA 4HU9A 1T4YA 3MNGA 4V2NA 2H1AA 4XCSA 2DJ0A 2WFCA 2XBQA 1TJDA 1R5PA 3Q74A 4IS0A 5JWOB 3D4TA 2H6XA 1X9SB 4MH2A 5ECMB 3G9BA 4MK3A 1TI1A 2V6KA 3UJ1A 3LWAA 2EC4A 2AAWA 4HUAA 2DIYA 2IIYA 2LRNA 3Q19A 4POBA 1DE1A 3CBUA 4MZBA 1YDKA 3CMIA 1OE7A 2MMZA 2IN3A 2N5AA 5A4UA 4PQ1A 2GS3A 3GL3A 4ECBA 3BBYA 4MF7A 2HI7A 1XW6A 1VF1A 1ZYQB 3UBKA 2HT9A 3F3RA 4QL9A 4H86A 4N0ZA 1E2YA 4MZCA 4KW6A 2VD1A 2WULA 5HQPA 3M1GA 14GSA 5G1LA 1H4OA 5ENUA 1Z5YE 3G7JA 2A4VA 1GP1A 3H8QA 2OA7A 5B6NA 4G2EA 5HFIA 3VWXA 4DSRA 3GA4A 3FZAA 2K9FA 2OADA 4IQAA 3KGKA 3FR9A 2GSRA 2YPMA 3GH9A 2PBJA 4J56E 3VURA 2K6VA 1ACVA 2EIOA 3EU4A 2VCVA 1M9BA 3F6DA 2P5QA 2P5RA 4JRRA 19GSA 2C4JA 2VL3A 3TRQA 1ZYEA 3VK9A 1B4QA 3TKPA 1QMVA 3A3TA 7GSSA 1X0RA 6GSSA 3TJGA 1EGRA 3VFIA 5ELGA 2HFDA 2CAQA 1NW2A 3F6FA 4FO5A 1OC8A 5D9VA 3QR6A 1XW9A 5IMZA 3Q18A 4WR5A 2H1BA 1XOAA 2ZNMA 1B4PA 22GSA 3UARA 3IOSA 2R5GA 3LORA 2O85A 5ABRA 1GSEA 1GSSA 5ECHB 5ELAA 1OYJA 5DVBA 1K0AA 4L8EA 3WYWA 4J57E 2FWGA 2WCIA 3MDKA 2EIRA 3V1WA 1T8EB 6GSWA 2XPEA 1A8LA 2YWIA 3G7YA 5IMCA 3LXZA 1Z7PA 1WP0A 4HOJA 2R37A 3D21A 1FHEA 3LYPA 1R5AA 5LCZA 1BYEA 8GSSA 1V58A 3ZITA 1GRXA 4KNDA 1FG4A 1V98A 1SKWB 3PH9A 1BAYA 2I81A 5ECPB 4YH2A 3IC4A 4QL7A 1BX9A 3BJ5A 3KP9A 1Z6NA 3HJOA 5DCHA 1V9WA 4K1FA 4IQ1A 2PUKC 2LRCA 5IMDA 1JZDA 1PN9A 2LQQA 2GGTA 4K8MA 3VI7A 4GF0A 5G1KA 1Z6MA 4L5LA 4IELA 5A5KA 1N2AA 4ULXA 2B5EA 4EVMA 5F8BA 1TK5B 4WXTA 4X0XA 1BEDA 2Z9SA 1AXDA 3LEFA 4MMMA 4AF2A 2XHFA 2FLSA 4IJIA 1M2BA 1JZWA 2E7PA 2LQOA 5LD0A 1DSBA 4HJMA 4KA0A 3P90A 1Y6EA 4GLTA 1M2AA 3FK8A 1XIYA 2L6DA 4ML1A 3D0ZA 1OAZA 2QKEA 2WZ9A 5INYA 5ECSA 1TRVA 2FA8A 5J3RA 1WE0A 3ME7A 3OR5A 1PL2A 2DJJA 1J08A 1A2MA 3US3A 3TKSA 1PGTA 2YP6A 5DDLA 2LV3A 4ZIJA 3A2XA 1OVNA 4MCUA 1SKRB 4IJ3A 2REMA 4ZL9A 3EE2A 4FH8A 4LL1B 3QCPA 1X5CA 1GSYA 2IFQA 4ECJA 2JADA 3APSA 4BL7A 1JLVA 5EVOA 1K0CA 4MJCA 3HHVA 2BJXA 2VCXA 4L5OA 4TR1A 2HZEA 4EC0A 1HQOA 2YV9A 3DGQA 2VIMA 3ZL5A 4K7NA 2VM2A 3DVXA 2MMOA 3TOUA 4OO5A 3MWHA 3I69A 1SENA 1FVJA 1TTZA 3ZYWA 1SYXA 1GUMA 4YAPA 2LS5A 4ZB9A 1YJ6A 2FWFA 1URMA 2LJKA 2F3MA 4D73B 4IKHA 2QC7A 2DIZA 4NV5A 2HYXA 4XS6A 5HFGA 3GN3A 1MTCA 2P0GA 4NHZA 5CYYA 2B1LA 3JCML 2H8LA 3GRXA 3IA1A 3ZLPA 1B8XA 3SBCA 2H19A 3HCZA 4GSTA 1A24A 2E2GA 4KCEA 5H5QA 1T7PB 1YY7A 1NHOA 2JU5A 1OKTA 5AIXA 2YWOA 4MLYA 1LU4A 4RUVA 3LJRA 2ON7A 2PN8A 2H0GA 1O85A 1A2JA 1GSUA 4WBRD 2DJ3A 2G2QA 4F03A 3ZZXA 4G10A 5IIZA 2VLVA 1O8XA 2V32A 3C1SA 3S9FA 4Q5RA 5DALB 2PGTA 1K3OA 3I6AA 3F8UA 1TW9A 1AC1A 4EE0A 3K8NA 2KLXA 4GQCA 4WETA 4PQHA 2NVLA 2KHPA 3EMXA 1F6MC 1GUKA 1SKSB 4K6XA 2PU9C 5J4UA 1O8WA 4L0WA 4CDOA 2GDRA 5HR1A 4CHSA 13GSA 4J2FA 5D9WA 1C72A 2H72A 1HD2A 2H0HA 3F4RA 1W4VA 1S3CA 3O76A 1W89A 2AV4A 3E3EA 5KN1A 4ML6A 3W6GA 1GNWA 2C0FA 4LA1A 5F07A 1FOVA 4EL1A 2FWEA 1DBYA 4K2DA 1UN2A 1FO5A 3HD5A 3DXBA 4DSSA 2VCQA 3UVTA 3GURA 1F37A 3HY2A 5DCGA 4BA7A 1K0MA 2GSTA 4GRFA 2QSIA 3ERFA 1KEBA 5ECOB 5ECIB 2H30A 3HZ8A 4KB3A 5GAPD 1O7UA 1VF2A 2OE3A 5C00A 6GSYA 1EEJA 3GSSA 4F0CA 4F0BA 4HI7A 1R26A 4TN8A 1FVKA 1EP7A 4GQFA 3TKSC 2LJAA 2GZPA 1A23A 4Z7XA 1OC3A 2B7JA 3ZMKA 1F2EA 3W8SA 1T00A 2A2SA 2H74A 5CRGA 2RLIA 3A2VA 4KDUA 1U6TA 2KOKA 4X1UA 1V40A 2LRTA 3DD3A 1XVQA 1EOGA 1XZOA 2I4AA 3FKFA 1OC9A 5KN2A 2C0EA 1ILOA 4XIHA 1GSQA 3GNJA 3TOTA 3BCIA 4N10A 1YKAA 4JBBA 5D9XA 2NDOA 1EP8A 1AQXA 2R4VA 3DRNA 2P31A 3DWVA 4K0NA 5IPGA 5KN0A 4NAXA 3H1NA 5B7CA 2DJKA 1ERWA 2NTOA 1AQVA 3EYTA 4EDZA 3M9JA 3HJMA 2YNXA 3GH6A 1O73A 4RQXA 1ZGNA 2H76A 1XWGA 3HJPA 3GKKA 2M72A 1T4ZA 1KBNA 3M0FA 3GYKA 5G5FA 5B8AA 5HFKA 1JZRA 5ECLB 4NHWA 4HZ4A 3WT2A 1OE8A 5ECKB 1WRYA 5IOWA 2E2MA 4JR6A 4QQ7A 3IK9A 1Z3EA 1IYIA 3ERGA 1F3AA 3DIEA 3GX0A 1K0DA 1ABAA 4KSOA 1YQ1A 2OBIA 4PNGA 2YV7A 1XFLA 3ZREA 3CXGA 4MJBA 2B5YA 1SYRA 2V1MA 4GXZA 4NMUA 2MBSA 4AJ8A 2R2JA 2FCHA 1HYUA 3PINA 2N5BA 2CV4A 1THXA 4WF5A 4GSSA 1GTBA 2H0IA 1DUGA 4PQIA 4KGIA 2WRTA 3L78A 5GSSA 1PKWA 1MD3A 1TI3A 1YEPA 1PKZA 1VRSD 4G9HA 4HS1A 4XS1A 5G30A 4IN0A 1PX6A 2DJ1A 3UOMA 3FEUA 4AGSA 4TXOA 4RQRA 4TVEA 6GSXA 4MP4A 4BWQA 3BD2A 2L5OA 2LNSA 3GX8A 1FAAA 4ID0A 3PGTA 1M99A 4I97A 4DEJA 2YZUA 4OFMA 3J7Yk 1M9AA 2R6KA 2FUG2 5DJLA 4XS4B 1PSQA 1H75A 3HZ4A 3GUSA 1TRUA 5IMVA 1LBKA 3TJFA 5B8BA 2HXKA 4FYBA 2H1GA 2DC5A 4HQZA 1ST9A 1S3AA 2L57A 5DBQA 4KUNA 3KTBA 4Q5NA 2CA8A 2A2RA 4F9ZA 1MEKA 4BVYA 2H71A 4ACSA 3FR6A 2PVOC 3RBTA 1UA5A 4PUFC 1XWBA 5JWQB 3KXOA 3ISOA 1B48A 3L0HA 4EXJA 1M2DA 2KUCA 4V2MA 3H4KA 2IMKA 4DVCA 2JSYA 3D6IA 11GSA 2OBKA 3IBHA 2WGRA 1NM3A 1MDKA 1HNBA 2GQLA 2H70A 2X8GA 3DKSA 2L4CA 2OE1A 5AGYA 1XWKA 1GULA 5D73A 1SJZA 3EC3A 4IW9A 1PX7A 4XS4A 3NZNA 4KH7A 1EGOA 2IFQB 2F9SA 3IE3A 3ZIJA 1ZCPA 2VCTA 1XWCA 4GCIA 1G7OA 4MABA 3VPQA 1XCCA 3TB2A 3QOUA 4NV2A 1RW1A 4V1Ap 2YWNA 4POKA 1U3AA 4TR1B 1K0NA 2HZEB 5D96A 1XVWA 2AJQB 5G5EA 3BCKA 4RI6A 4BPYA 1SL1B 4ZL8A 2AB6A 3CRTA 4CW9A 4IBPA 3I9V2 3GKXA 4PUAA 2VL2A 3HA9A 4NPBA 5IOXA 1M7TA 3RAZA 3C1RA 2FA4A 4I2UA 1VF3A 1X5EA 2HSYA 3IRAA 3TKSE 2GT5A 3IDVA 1PRXA 3QAVA 5JCUA 4K9ZA 4IP6A 1GLQA 3HVVA 4ILFA 5COHA 2X8HA 1WOUA 5CO3A 5JCGA 3UEMA 3CSIA 5EPFA 4V2LA 3TCOA 2BTOT 1B9YC 1XWAA 2K8VA 3VPTA 4KCAA 2C0GA 1A0FA 4Q5FA 1USBA 5FHIA 5G31A 2GVPA 6GSTA 2HRFA 1SK2A 2OJLA 3TJKA 12GSA 3ZVJD 5ECNB 4MPFA 4GSNA 6GSUA 2IJYA 4MDCA 1M0UA 1X5DA 2OKAA 3G7IA 3ZFLA 2DMLA 3GHAA 3VLNA 3QDNA 4JR4A 1JHBA 1YF0A 5KN3A 4RI7A 2H73A 2TRXA 1I9DA 4JE1A 4O5RA 3KMNA 3ZMLA 4E8HA 4O7HA 3U6VA 3M9KA 1XPVA 2PWJA 1KTEA 2OE0A 2L59A 2OACA 5IMFA 1I5GA 1ZOFA 2RIIA 2DLXA 2CZ3A 2GQMA 3FYGA 1ZZYA 1BQ7A 2YCDA 4DSSB 2JZSA 3RPPA 3RHBA 4TR3A 3M3MA 4YQVA 2TRCP 3ME8A 2HSHA 2FNOA 3IXRA 2JZRA 1EV9A 3TUEA 5L71A 3KJYA 4O32A 2O8VB 2PMTA 1R4WA 5GAND 3NIVA 1K3YA 5CAXA 2CX3A 3GV1A 1GH2A 3UIWA 1V2AA 1QXHA 3EWLA 4ZB8A 2B6MA 3KP8A 5HR3A 2YJHA 1PA3A 1U88A 4E8EA 2IWTA 1MDJA 1Z7RA 1B9XC 2F8FA 1RK4A 4HEA2 2LJRA 1QQ2A 3F4SA 2DBCA 3EMPA 3IK7A 3UVHA 4XRDA 3N9JA 2HE3A 2B7KA 3GFKA 2I9HA 2IPAA 3TKRA 4MZWA 1DE2A 4ZXGA 4ZILA 2L4QA 2MBTA 3E0UA 4IP1A 3A5WA 1G6WA 4MA9A 1TU7A 3CRUA 4GTUA 4K0GA 1A0RP 2VCWA 5EL8A 2H6YA 1OC9B 5FT3A 5FWGA 3CTFA 3QFAC 4O92A 4GWRA 2VL9A 5DJMA 4IGJA 3EU3A 5CREA 4PURA 4EUYA 4PGTA 5H5RA 4KAEA 20GSA 1TKDB 1TK8B 4OD7A 1O81A 3TDGA 4KE3A 1GTUA 2XPDA 1K0OA 2B3SA 6GSVA 1SJIA 2HZFA 1J9BA 2O89A 2NPBA 2XC2A 1AW9A 5ECRB 3CSHA 2EIQA 1G7EA 1IYHA 1PD21 4PNFA 2R3XA 4BWSA 1T1VA 3MAKA 2B1KA 1WPIA 2I1UA 1XOBA 2XBIA 3RDWA 2D2ZA 3ERWA 4N11A 1EWXA 1X9WB 5CP1A 1HNCA 3J7Yb 2L5LA 3C73A 2ES7A 1ZMAA 4XTSA 5G2ZA 3EVIA 9GSSA 4DSQA 1GTAA 3P8WA 2X8CA 4LL4B 1ERVA 4ZL7A 2I3YA 2N5FA 5IO2A 5DAKB 2LNTA 2LTKA 3SWLA 3GSTA 5A4WA 1PMTA 3VWVA 2RM5A 5E4WA 4POMA 4HQSA 4OMVA 3HVSA 2M46A 4WKWA 2CVKA 4F82A 1PQNA 3DMLA 4WEYA 5J41A 3HKRA 4JU5A 1E6BA 3R2QA 2CT6A 3VWUA 2IMDA 2VM1A 2H66A 4YQMA 1AUCA 4TRXA 2YANA 1UC7A 1THOA 3ZVJA 3WT1A 4OO4A 1AIUA 3WGEA 2LEGA 1N8JA 1U3IA 1T3BA 4TXOB 4BVXA 3FR3A 4JZQA 3LYKA 18GSA 1EEMA 1Z9HA 1QK8A 3ZFBA 4I8BA 2F51A 2O7KA 4WR4A 5JCWA 5EY6A 3EURA 10GSA 2YN1A 2VO4A 1R7HA 3KCMA 3ZTLA 4ZB6A 2ALBA 1QFNA 2NBSA 1XBSA 1UVZA 4IHUA 3LQ7A 5DAKA 1GNEA 1S3DA 1K0BA 3D4MA 3BOAA 2JL4A 1XW5A 2V2GA 4KDYA 1QGVA 1ERTA 2FWHA 4IVFA 1K3LA 2JSZA 3C7MA 5B6MA 3GKMA 3UL3A 2QGVA 3TJJA 4MF5A 1G6YA 2WJUA 1FB6A 4FYCA 5IQYA 3F9UA 4ZBDA 5IMAA 1SD9A 1WIKA
chains in the Genus database with same CATH superfamily
4K2XA 1ML6A 2M80A 1ERUA 2QA1A 3TRXA 4EKZA 3H79A 4WF4A 3P2AA 3FHKA 4NXIA 1MD4A 3GIXA 2HRAA 1ON4A 2C3QA 3QPMA 4MH3A 5AN1A 1TU8A 1GTIA 4POLA 2AYTA 1TDIA 4PX1A 3IAM2 4XHMA 1EV4A 1CQHA 2CVBA 4Q5QA 4LMWA 2MMAA 1F3BA 5D9TA 2FHEA 2H75A 1CQGA 3H93A 4X4JA 1Y25A 2H01A 3CYNA 1X9MB 3ZRDA 2IMIA 3F3QA 1YZXA 1VF4A 5DQSA 4LLRA 2MYGA 4N30A 17GSA 3GTUB 4X43A 3ED3A 1TK0B 2CVDA 1WWJA 2LKUA 3E9JB 3LXTA 3I43A 4ZBAA 2UZ8A 3QAGA 1ZL9A 2YWMA 1F9MA 4P3YB 5E59A 3GMFA 4MF6A 3WGDA 2H1DA 3QD9A 2GTUA 2VCZA 5ECQB 5DQYA 1RQMA 4MJEA 2FD3A 2RM6A 3QAWA 2DSAA 2IMFA 2K18A 4N0VA 1GSFA 3VI5A 4K7OA 2K8SA 2WS2A 4HU7A 4KDXA 3UMAA 4XRAA 1SL2B 4OFTA 1JFUA 3FY7A 4OFNA 5A4VA 3DVWA 1FB0A 2AUVA 1WMJA 4OCFA 4ZBBA 3QFBC 4HZ2A 5C04A 3P7XA 2MMNA 4EIQA 2WB9A 4ECIA 1Q4JA 3LFLA 2DJ2A 3D22A 3L4NA 2O87A 4Z2RA 3GTUA 5AIVA 1PFOA 1YEXA 2QA2A 3F0IA 3F63A 3KEBA 2VD0A 2JZTA 2VLUA 2FY6A 1TRWA 4LMVA 3TJBA 2GZYA 3FRCA 2F8AA 4Z2TA 2C3NA 1SJ6A 5HR0A 5IPHA 2GZZA 2E0QA 3HXSA 3W8JA 2AHEA 1HNAA 5GSTA 2RUEA 2J9HA 2PVQA 4USSA 4G19A 2YOIA 3TRPA 2PERA 2GQKA 5LNKe 2V41A 1J0FA 3F4TA 2L6CA 5AISA 3FZ4A 3RPNA 4KX4A 1AAZA 1GLPA 1JLWA 5F06A 1SD8A 4JEDA 3M8NA 3KTLA 2R0GA 1TP9A 2VLTA 2KP1A 3RHCA 3DEXA 2X99A 2MZCA 2X49A 2KP2A 5CRDA 5KEJA 1EZKA 4TR4A 2WDUA 4EF0A 2G0FA 2PPTA 4FIWA 3C8EA 4EO3A 4KSMA 4I6XA 5D8IA 3PR8A 3HDCA 3IV4A 2TIRA 2C80A 2R0PA 1TXXA 2HRNA 3MSZA 3APQA 1LJRA 3U5RE 2YJ7A 5GZZB 4MPGA 4I2TA 1GSDA 5CRWA 2J23A 3L9VA 5D93A 5JWRB 1KNGA 1WJKA 3KMOA 3AY8A 1SK1A 2C8UA 5J5NA 1XXUA 2VOCA 4PXOA 3C71A 3CSJA 1BJXA 3L9UA 2ZCTA 1BG5A 1A8YA 1EOHA 4L0UA 3IR4A 1MDIA 2BMXA 1GUHA 3O3TA 4K7IA 5ID2B 3A2WA 2HLSA 2GSSA 5F05A 5IM9A 3Q6OA 1PL1A 5J9CA 2CX4A 1YKCA 2CZ2A 1TRSA 5CNWA 3FZ9A 1U87A 2C0DA 2RUFA 3UBLA 2LSTA 3IHQA 3FZ5A 4TW5A 1Q98A 3O6TA 2YZHA 1SK0A 3WD6A 3IAS2 4TOPA 2ON5A 4TXVA 3ZIVA 2CQ9A 4ISDA 4BIKA 3IPZA 2HNLA 2B5XA 4AJ6A 4HDEA 3APOA 1SL0B 1TOFA 4G0KA 1AQWA 2VAFA 1GL8A 4OCEA 3GL5A 4D73A 3L9SA 2IMEA 2IL3A 1G0TA 3KIJA 1QUWA 4TKYA 3HVXA 3UAPA 3GKNA 4WBJA 4OWYA 2GLRA 1SU9A 3TGZA 4I5QA 2LUSA 3TKQA 3LGCA 3LG6A 2ZUPA 2FGXA 5ID2A 2VL2C 3LSZA 4FYUA 1NHYA 2CAIA 2DMMA 3NOFA 3KH9A 4NWYA 2X64A 1O6JA 3D5JA 3KD0A 4EDYA 3CTGA 4MJAA 1GWCA 3KM6A 4AJ7A 2C1YA 2JACA 5IO0A 4F2IA 3EINA 5HR2A 2C3TA 3HYPA 3KZQA 3DYRA 3KH7A 4YAVA 1VGLA 4YQUA 1FW1A 1OKDA 2V6OA 5H5SA 3WGXA 5DALA 3VWWA 3N5OA 4TR0A 1V57A 5KOWA 2GT6A 3FW2A 2GSQA 4HJ2A 2VUPA 4ECCA 2H6ZA 1A2LA 1NSWA 5CRHA 4V1Ag 1JZOA 16GSA 3QMXA 1YF1A 5F0GA 5J9BA 2HRKA 4HU9A 1T4YA 3MNGA 4V2NA 2H1AA 4XCSA 2DJ0A 2WFCA 2XBQA 2HSMA 1TJDA 1R5PA 3Q74A 4IS0A 5JWOB 3D4TA 2H6XA 1X9SB 4MH2A 5ECMB 3G9BA 4MK3A 1TI1A 2V6KA 2DKIA 3UJ1A 3LWAA 2EC4A 2AAWA 2R0CA 4HUAA 2DIYA 2IIYA 2LRNA 3Q19A 4POBA 1DE1A 3CBUA 4MZBA 1YDKA 3CMIA 1OE7A 2MMZA 2IN3A 2N5AA 5A4UA 4PQ1A 3MIXA 2GS3A 3GL3A 4ECBA 3BBYA 4MF7A 2HI7A 1XW6A 1VF1A 1ZYQB 3UBKA 2HT9A 3F3RA 4QL9A 4H86A 4N0ZA 1E2YA 4MZCA 4KW6A 2VD1A 2WULA 5HQPA 3M1GA 14GSA 5G1LA 1H4OA 5ENUA 1Z5YE 4A5PA 3G7JA 2A4VA 1GP1A 3H8QA 2OA7A 5B6NA 4G2EA 5HFIA 3VWXA 4DSRA 3GA4A 3FZAA 2K9FA 2OADA 4IQAA 3KGKA 1PN0A 3FR9A 3A5IA 2GSRA 2YPMA 3GH9A 1FOHA 2PBJA 4J56E 3VURA 2K6VA 1ACVA 2EIOA 3EU4A 2VCVA 1M9BA 3F6DA 2P5QA 2P5RA 4JRRA 19GSA 2C4JA 2VL3A 3TRQA 1ZYEA 3VK9A 1B4QA 3TKPA 4O5QA 1QMVA 3A3TA 7GSSA 1X0RA 6GSSA 3TJGA 1EGRA 3VFIA 5ELGA 2HFDA 2CAQA 1NW2A 3F6FA 4FO5A 1OC8A 5D9VA 3QR6A 1XW9A 5IMZA 3Q18A 4WR5A 2H1BA 1XOAA 2ZNMA 1B4PA 22GSA 3UARA 3IOSA 2R5GA 3LORA 2O85A 5ABRA 1GSEA 1GSSA 5ECHB 5ELAA 1OYJA 5DVBA 1K0AA 4L8EA 3WYWA 3IHGA 4J57E 2FWGA 2WCIA 3MDKA 2EIRA 3V1WA 1T8EB 6GSWA 2XPEA 1A8LA 2YWIA 3G7YA 5IMCA 3LXZA 1Z7PA 1WP0A 4HOJA 2R37A 3D21A 1FHEA 2DKHA 3LYPA 1R5AA 5LCZA 1BYEA 8GSSA 4K5SA 1V58A 3ZITA 1GRXA 4KNDA 1FG4A 1V98A 1SKWB 3PH9A 4YKGA 1BAYA 2I81A 5ECPB 4YH2A 3IC4A 4QL7A 1BX9A 3BJ5A 3KP9A 1Z6NA 3HJOA 5DCHA 1V9WA 4K1FA 4IQ1A 2PUKC 2LRCA 5IMDA 1JZDA 1PN9A 2LQQA 2GGTA 4K8MA 3VI7A 4GF0A 5G1KA 1Z6MA 4L5LA 4IELA 4HSCX 5A5KA 1N2AA 4ULXA 3PPUA 2B5EA 4EVMA 5F8BA 1TK5B 4WXTA 4X0XA 1BEDA 2Z9SA 1AXDA 3LEFA 4MMMA 4AF2A 2XHFA 2FLSA 4IJIA 1M2BA 1JZWA 2E7PA 2LQOA 5LD0A 1DSBA 4HJMA 4KA0A 3P90A 1Y6EA 4GLTA 1M2AA 3FK8A 1XIYA 2L6DA 4ML1A 3D0ZA 1OAZA 2QKEA 2WZ9A 5INYA 5ECSA 1TRVA 2FA8A 5J3RA 1WE0A 3ME7A 3OR5A 1PL2A 2DJJA 1J08A 1A2MA 3US3A 3TKSA 1PGTA 2YP6A 5DDLA 2LV3A 4ZIJA 3A2XA 1OVNA 4MCUA 1SKRB 4IJ3A 2REMA 4ZL9A 3EE2A 3MYDA 4FH8A 4LL1B 3QCPA 1X5CA 1GSYA 2IFQA 4ECJA 2JADA 3APSA 4BL7A 1JLVA 5EVOA 1K0CA 4MJCA 3HHVA 2BJXA 2VCXA 4L5OA 4TR1A 2HZEA 4EC0A 1HQOA 2YV9A 3DGQA 2VIMA 3ZL5A 4K7NA 2VM2A 3DVXA 2MMOA 3TOUA 4OO5A 3MWHA 3I69A 1SENA 1FVJA 1TTZA 3ZYWA 5KOXA 1SYXA 1GUMA 4YAPA 2LS5A 4ZB9A 1YJ6A 2FWFA 1URMA 2A2PA 2LJKA 2F3MA 4D73B 4IKHA 2QC7A 2DIZA 4NV5A 2HYXA 4XS6A 5HFGA 3GN3A 1MTCA 2P0GA 4NHZA 5CYYA 2B1LA 3JCML 2H8LA 3GRXA 3IA1A 3ZLPA 1B8XA 3SBCA 2H19A 3HCZA 4GSTA 1A24A 2E2GA 4KCEA 5H5QA 1T7PB 1YY7A 1NHOA 2JU5A 1OKTA 1M3JA 5AIXA 2YWOA 4MLYA 1LU4A 4RUVA 3LJRA 2ON7A 2PN8A 2H0GA 1O85A 1A2JA 4MNNA 1GSUA 4WBRD 2DJ3A 2G2QA 4F03A 3ZZXA 4G10A 5IIZA 2VLVA 1O8XA 2V32A 3C1SA 3S9FA 4Q5RA 2A4HA 5DALB 2PGTA 1K3OA 3I6AA 3F8UA 1TW9A 1AC1A 4EE0A 3K8NA 2KLXA 4GQCA 4WETA 4PQHA 2NVLA 2KHPA 3EMXA 1F6MC 1GUKA 1SKSB 4K6XA 2PU9C 5J4UA 1O8WA 4L0WA 4CDOA 2GDRA 5HR1A 4CHSA 13GSA 4J2FA 5D9WA 1C72A 2H72A 1HD2A 2H0HA 3F4RA 1W4VA 1S3CA 3O76A 1W89A 2AV4A 3E3EA 5KN1A 4ML6A 3W6GA 1GNWA 2C0FA 4LA1A 5F07A 1FOVA 4EL1A 2FWEA 1DBYA 4K2DA 1UN2A 1FO5A 3HD5A 3DXBA 4DSSA 2VCQA 3UVTA 3GURA 1F37A 3HY2A 5DCGA 4BA7A 1K0MA 2GSTA 4GRFA 2QSIA 3ERFA 1KEBA 5ECOB 5ECIB 2H30A 3HZ8A 4KB3A 5GAPD 1O7UA 1VF2A 2OE3A 5C00A 6GSYA 1EEJA 3GSSA 4F0CA 4F0BA 4HI7A 1R26A 4TN8A 1FVKA 1EP7A 4GQFA 3TKSC 2LJAA 2GZPA 1A23A 4Z7XA 1OC3A 2B7JA 3ZMKA 1F2EA 3W8SA 1T00A 2A2SA 2H74A 4YKFA 5CRGA 2RLIA 3A2VA 4KDUA 1M3IA 1U6TA 2KOKA 4X1UA 1V40A 2LRTA 3DD3A 1XVQA 1EOGA 1XZOA 2I4AA 3FKFA 1OC9A 5KN2A 2C0EA 1ILOA 4XIHA 1GSQA 3GNJA 3TOTA 3BCIA 4N10A 1YKAA 4JBBA 5D9XA 2NDOA 1EP8A 1AQXA 2R4VA 3DRNA 2P31A 3DWVA 4K0NA 5IPGA 5KN0A 4NAXA 3H1NA 5B7CA 2DJKA 1ERWA 2NTOA 1AQVA 3EYTA 4EDZA 3M9JA 3HJMA 2YNXA 3GH6A 1O73A 4RQXA 1ZGNA 2H76A 1XWGA 3HJPA 3GKKA 2M72A 1T4ZA 1KBNA 3M0FA 3GYKA 5G5FA 5B8AA 5HFKA 1JZRA 5ECLB 4NHWA 4HZ4A 3WT2A 1OE8A 5ECKB 1WRYA 5IOWA 2E2MA 4JR6A 4QQ7A 3IK9A 1Z3EA 1IYIA 3ERGA 1F3AA 3DIEA 3GX0A 1K0DA 1ABAA 4KSOA 1YQ1A 2OBIA 4PNGA 2YV7A 4KF9A 1XFLA 3ZREA 3CXGA 4MJBA 2B5YA 1SYRA 2V1MA 4GXZA 4NMUA 2MBSA 4EIPA 4AJ8A 2R2JA 2FCHA 1HYUA 3PINA 2N5BA 2CV4A 4BVYB 1THXA 4WF5A 4GSSA 1GTBA 2H0IA 1DUGA 4PQIA 4KGIA 4ICYA 2WRTA 3L78A 5GSSA 1PKWA 1MD3A 1TI3A 1YEPA 1PKZA 1VRSD 4G9HA 4HS1A 4XS1A 5G30A 4IN0A 1PX6A 4K5RA 2DJ1A 3UOMA 3FEUA 4AGSA 4TXOA 4RQRA 4TVEA 6GSXA 4MP4A 4BWQA 3BD2A 2L5OA 2LNSA 3GX8A 1FAAA 4ID0A 3PGTA 1M99A 4I97A 4DEJA 2YZUA 4OFMA 3J7Yk 1M9AA 2R6KA 2FUG2 5DJLA 4XS4B 1PSQA 1H75A 3HZ4A 3GUSA 1TRUA 5IMVA 1LBKA 3TJFA 5B8BA 2HXKA 4FYBA 2H1GA 2DC5A 4HQZA 1ST9A 1S3AA 2L57A 5DBQA 4KUNA 3KTBA 4Q5NA 2CA8A 2A2RA 4F9ZA 1MEKA 4BVYA 2H71A 4ACSA 3FR6A 2PVOC 3RBTA 1UA5A 4PUFC 5BMUA 1XWBA 5JWQB 3KXOA 3ISOA 1B48A 3L0HA 4EXJA 1M2DA 2KUCA 4V2MA 3H4KA 1ZYPA 2IMKA 4DVCA 2JSYA 3D6IA 11GSA 2OBKA 3IBHA 2WGRA 1NM3A 4O5UA 1MDKA 1HNBA 2GQLA 2H70A 2X8GA 3DKSA 2L4CA 2OE1A 5AGYA 1XWKA 1GULA 5D73A 1SJZA 3EC3A 4IW9A 1PX7A 4XS4A 3NZNA 4KH7A 1EGOA 2IFQB 2F9SA 3IE3A 4BL7B 3ZIJA 1ZCPA 2VCTA 1XWCA 4GCIA 1G7OA 4MABA 3VPQA 1XCCA 3TB2A 3QOUA 4NV2A 1RW1A 4V1Ap 2YWNA 4POKA 1U3AA 4TR1B 1K0NA 2HZEB 5D96A 1XVWA 2AJQB 5G5EA 3BCKA 4RI6A 3IC8A 4BPYA 1SL1B 4ZL8A 2AB6A 3CRTA 4CW9A 4IBPA 3I9V2 3GKXA 5BRTA 4PUAA 2VL2A 3HA9A 4NPBA 3FMWA 5IOXA 1M7TA 3RAZA 3C1RA 2FA4A 4I2UA 1VF3A 1X5EA 2HSYA 3CQFA 3IRAA 3TKSE 2GT5A 3IDVA 1PRXA 3QAVA 5JCUA 4CY8A 4K9ZA 4IP6A 1GLQA 3HVVA 4ILFA 5COHA 2X8HA 1WOUA 5CO3A 5JCGA 3UEMA 3CSIA 4G0IA 5EPFA 4V2LA 3TCOA 2BTOT 2X4AA 1B9YC 1XWAA 2K8VA 3VPTA 4KCAA 2C0GA 1A0FA 4Q5FA 1USBA 5FHIA 5G31A 2GVPA 6GSTA 2HRFA 1SK2A 2OJLA 3TJKA 12GSA 3ZVJD 5ECNB 4MPFA 4GSNA 6GSUA 2IJYA 4FQUA 4MDCA 1M0UA 1X5DA 2OKAA 3G7IA 3ZFLA 2DMLA 3GHAA 3VLNA 3QDNA 4JR4A 1JHBA 1YF0A 5KN3A 4RI7A 2H73A 2TRXA 1I9DA 4JE1A 4O5RA 3KMNA 3ZMLA 4E8HA 1S3RA 4O7HA 3U6VA 3M9KA 1XPVA 2PWJA 1KTEA 2OE0A 2L59A 2OACA 5IMFA 1I5GA 1ZOFA 2RIIA 2DLXA 2CZ3A 2GQMA 3FYGA 1ZZYA 1BQ7A 2YCDA 4DSSB 2JZSA 3RPPA 3RHBA 4TR3A 3M3MA 4YQVA 2TRCP 3ME8A 2HSHA 2FNOA 3IXRA 2JZRA 1EV9A 3TUEA 5L71A 3KJYA 4O32A 2O8VB 2PMTA 1R4WA 5GAND 3NIVA 1K3YA 5CAXA 2CX3A 3GV1A 1GH2A 3UIWA 1V2AA 1QXHA 3EWLA 4ZB8A 2B6MA 3KP8A 5HR3A 2YJHA 1PA3A 1U88A 4E8EA 1ZYNA 2IWTA 1MDJA 1Z7RA 1B9XC 2F8FA 1RK4A 4HEA2 2LJRA 1QQ2A 3F4SA 2DBCA 3EMPA 3IK7A 3UVHA 4XRDA 3N9JA 2HE3A 2B7KA 3GFKA 2I9HA 2IPAA 3TKRA 4MZWA 1DE2A 4ZXGA 4ZILA 2L4QA 2MBTA 3E0UA 4IP1A 3A5WA 1G6WA 4MA9A 1TU7A 3CRUA 4GTUA 4K0GA 1A0RP 2VCWA 5EL8A 2H6YA 1OC9B 5FT3A 5FWGA 3LW9A 3CTFA 3QFAC 4O92A 4GWRA 2VL9A 5DJMA 4IGJA 3EU3A 5CREA 4PURA 4EUYA 4PGTA 5H5RA 4KAEA 20GSA 1TKDB 1TK8B 4OD7A 1O81A 3TDGA 4KE3A 1GTUA 2XPDA 1K0OA 2B3SA 6GSVA 1SJIA 2HZFA 1J9BA 2O89A 2NPBA 2XC2A 1AW9A 5ECRB 3CSHA 2EIQA 1G7EA 1IYHA 1PD21 4PNFA 4BVXB 2R3XA 4BWSA 1T1VA 3MAKA 2B1KA 1WPIA 2I1UA 1XOBA 2XBIA 3RDWA 2D2ZA 3ERWA 4N11A 1EWXA 1X9WB 4G0LA 5CP1A 1HNCA 3J7Yb 2L5LA 3C73A 2ES7A 1ZMAA 4XTSA 5G2ZA 3EVIA 9GSSA 4DSQA 1GTAA 3P8WA 2X8CA 4LL4B 1ERVA 4PTSA 4ZL7A 2I3YA 2N5FA 3EPTA 5IO2A 5DAKB 2LNTA 2LTKA 3SWLA 3GSTA 5A4WA 1PMTA 3VWVA 2RM5A 5E4WA 4POMA 4HQSA 4OMVA 3HVSA 2M46A 4WKWA 2CVKA 4F82A 1PQNA 3DMLA 4WEYA 4CY6A 5J41A 3HKRA 4JU5A 1E6BA 3R2QA 2CT6A 3VWUA 2IMDA 2VM1A 2H66A 4YQMA 1AUCA 4TRXA 2YANA 1UC7A 1THOA 3ZVJA 3WT1A 4OO4A 1AIUA 3WGEA 2LEGA 1N8JA 1U3IA 1T3BA 4TXOB 4BVXA 3FR3A 1XG8A 4JZQA 3LYKA 18GSA 1EEMA 1Z9HA 1QK8A 3ZFBA 4I8BA 2F51A 2O7KA 4WR4A 5JCWA 5EY6A 3EURA 10GSA 3HVNA 2YN1A 2VO4A 1R7HA 3KCMA 3ZTLA 4ZB6A 2ALBA 1QFNA 2NBSA 1XBSA 1UVZA 4IHUA 3LQ7A 5DAKA 1GNEA 1S3DA 1K0BA 3D4MA 3BOAA 2JL4A 1XW5A 2V2GA 4KDYA 1QGVA 1ERTA 2FWHA 4IVFA 4Z2UA 1K3LA 2JSZA 3C7MA 5B6MA 3GKMA 3UL3A 3R3EA 2QGVA 3TJJA 4MF5A 1G6YA 2WJUA 1FB6A 4FYCA 5IQYA 3F9UA 4ZBDA 5IMAA 1SD9A 1WIKA
chains in the Genus database with same CATH topology
4K2XA 1ML6A 2M80A 1ERUA 2QA1A 3TRXA 4EKZA 3H79A 4WF4A 3P2AA 3FHKA 4NXIA 1MD4A 3GIXA 2HRAA 1ON4A 2C3QA 3QPMA 4MH3A 5AN1A 1TU8A 1GTIA 4POLA 2AYTA 1TDIA 4PX1A 3IAM2 4XHMA 1EV4A 1CQHA 2CVBA 4Q5QA 4LMWA 2MMAA 1F3BA 5D9TA 2FHEA 2H75A 1CQGA 3H93A 4X4JA 1Y25A 2H01A 3CYNA 1X9MB 3ZRDA 2IMIA 3F3QA 1YZXA 1VF4A 5DQSA 4LLRA 2MYGA 4N30A 17GSA 3GTUB 4X43A 3ED3A 1TK0B 2CVDA 1WWJA 2LKUA 3E9JB 3LXTA 3I43A 4ZBAA 2UZ8A 3QAGA 1ZL9A 2YWMA 1F9MA 4P3YB 5E59A 3GMFA 4MF6A 3WGDA 2H1DA 3QD9A 2GTUA 2VCZA 5ECQB 5DQYA 1RQMA 4MJEA 2FD3A 2RM6A 3QAWA 2DSAA 2IMFA 2K18A 4N0VA 1GSFA 3VI5A 4K7OA 2K8SA 2WS2A 4HU7A 4KDXA 3UMAA 4XRAA 1SL2B 4OFTA 1JFUA 3FY7A 4OFNA 5A4VA 3DVWA 1FB0A 2AUVA 1WMJA 4OCFA 4ZBBA 3QFBC 4HZ2A 5C04A 3P7XA 2MMNA 4EIQA 2WB9A 4ECIA 1Q4JA 3LFLA 2DJ2A 3D22A 3L4NA 2O87A 4Z2RA 3GTUA 5AIVA 1YEXA 2QA2A 3F0IA 3F63A 3KEBA 2VD0A 2JZTA 2VLUA 2FY6A 1TRWA 4LMVA 3TJBA 2GZYA 3FRCA 2F8AA 4Z2TA 2C3NA 1SJ6A 5HR0A 5IPHA 2GZZA 2E0QA 3HXSA 3W8JA 2AHEA 1HNAA 5GSTA 2RUEA 2J9HA 2PVQA 4USSA 4G19A 2YOIA 3TRPA 2PERA 2GQKA 5LNKe 2V41A 1J0FA 3F4TA 2L6CA 5AISA 3FZ4A 3RPNA 4KX4A 1AAZA 1GLPA 1JLWA 5F06A 1SD8A 4JEDA 3M8NA 3KTLA 2R0GA 1TP9A 2VLTA 2KP1A 3RHCA 3DEXA 2X99A 2MZCA 2X49A 2KP2A 5CRDA 5KEJA 1EZKA 4TR4A 2WDUA 4EF0A 2G0FA 2PPTA 4FIWA 3C8EA 4EO3A 4KSMA 4I6XA 5D8IA 3PR8A 3HDCA 3IV4A 2TIRA 2C80A 2R0PA 1TXXA 2HRNA 3MSZA 3APQA 1LJRA 3U5RE 2YJ7A 5GZZB 4MPGA 4I2TA 1GSDA 5CRWA 2J23A 3L9VA 5D93A 5JWRB 1KNGA 1WJKA 3KMOA 3AY8A 1SK1A 2C8UA 5J5NA 1XXUA 2VOCA 4PXOA 3C71A 3CSJA 1BJXA 3L9UA 2ZCTA 1BG5A 1A8YA 1EOHA 4L0UA 3IR4A 1MDIA 2BMXA 1GUHA 3O3TA 4K7IA 5ID2B 3A2WA 2HLSA 2GSSA 5F05A 5IM9A 3Q6OA 1PL1A 5J9CA 2CX4A 1YKCA 2CZ2A 1TRSA 5CNWA 3FZ9A 1U87A 2C0DA 2RUFA 3UBLA 2LSTA 3IHQA 3FZ5A 4TW5A 1Q98A 3O6TA 2YZHA 1SK0A 3WD6A 3IAS2 4TOPA 2ON5A 4TXVA 3ZIVA 2CQ9A 4ISDA 3IPZA 2HNLA 2B5XA 4AJ6A 4HDEA 3APOA 1SL0B 1TOFA 4G0KA 1AQWA 2VAFA 1GL8A 4OCEA 3GL5A 4D73A 3L9SA 2IMEA 2IL3A 1G0TA 3KIJA 1QUWA 4TKYA 3HVXA 3UAPA 3GKNA 4WBJA 4OWYA 2GLRA 1SU9A 3TGZA 4I5QA 2LUSA 3TKQA 3LGCA 3LG6A 2ZUPA 2FGXA 5ID2A 2VL2C 3LSZA 4FYUA 1NHYA 2CAIA 2DMMA 3NOFA 3KH9A 4NWYA 2X64A 1O6JA 3D5JA 3KD0A 4EDYA 3CTGA 4MJAA 1GWCA 3KM6A 4AJ7A 2C1YA 2JACA 5IO0A 4F2IA 3EINA 5HR2A 2C3TA 3HYPA 3KZQA 3DYRA 3KH7A 4YAVA 1VGLA 4YQUA 1FW1A 1OKDA 2V6OA 5H5SA 3WGXA 5DALA 3VWWA 3N5OA 4TR0A 1V57A 5KOWA 2GT6A 3FW2A 2GSQA 4HJ2A 2VUPA 4ECCA 2H6ZA 1A2LA 1NSWA 5CRHA 4V1Ag 1JZOA 16GSA 3QMXA 1YF1A 5F0GA 5J9BA 2HRKA 4HU9A 1T4YA 3MNGA 4V2NA 2H1AA 4XCSA 2DJ0A 2WFCA 2XBQA 2HSMA 1TJDA 1R5PA 3Q74A 4IS0A 5JWOB 3D4TA 2H6XA 1X9SB 4MH2A 5ECMB 3G9BA 4MK3A 1TI1A 2V6KA 2DKIA 3UJ1A 3LWAA 2EC4A 2AAWA 2R0CA 4HUAA 2DIYA 2IIYA 2LRNA 3Q19A 4POBA 1DE1A 3CBUA 4MZBA 1YDKA 3CMIA 1OE7A 2MMZA 2IN3A 2N5AA 5A4UA 4PQ1A 3MIXA 2GS3A 3GL3A 4ECBA 3BBYA 4MF7A 2HI7A 1XW6A 1VF1A 1ZYQB 3UBKA 2HT9A 3F3RA 4QL9A 4H86A 4N0ZA 1E2YA 4MZCA 4KW6A 2VD1A 2WULA 5HQPA 3M1GA 14GSA 5G1LA 1H4OA 5ENUA 1Z5YE 4A5PA 3G7JA 2A4VA 1GP1A 3H8QA 2OA7A 5B6NA 4G2EA 5HFIA 3VWXA 4DSRA 3GA4A 3FZAA 2K9FA 2OADA 4IQAA 3KGKA 1PN0A 3FR9A 3A5IA 2GSRA 2YPMA 3GH9A 1FOHA 2PBJA 4J56E 3VURA 2K6VA 1ACVA 2EIOA 3EU4A 2VCVA 1M9BA 3F6DA 2P5QA 2P5RA 4JRRA 19GSA 2C4JA 2VL3A 3TRQA 1ZYEA 3VK9A 1B4QA 3TKPA 4O5QA 1QMVA 3A3TA 7GSSA 1X0RA 6GSSA 3TJGA 1EGRA 3VFIA 5ELGA 2HFDA 2CAQA 1NW2A 3F6FA 4FO5A 1OC8A 5D9VA 3QR6A 1XW9A 5IMZA 3Q18A 4WR5A 2H1BA 1XOAA 2ZNMA 1B4PA 22GSA 3UARA 3IOSA 2R5GA 3LORA 2O85A 5ABRA 1GSEA 1GSSA 5ECHB 5ELAA 1OYJA 5DVBA 1K0AA 4L8EA 3WYWA 3IHGA 4J57E 2FWGA 2WCIA 3MDKA 2EIRA 3V1WA 1T8EB 6GSWA 2XPEA 1A8LA 2YWIA 3G7YA 5IMCA 3LXZA 1Z7PA 1WP0A 4HOJA 2R37A 3D21A 1FHEA 2DKHA 3LYPA 1R5AA 5LCZA 1BYEA 8GSSA 4K5SA 1V58A 3ZITA 1GRXA 4KNDA 1FG4A 1V98A 1SKWB 3PH9A 4YKGA 1BAYA 2I81A 5ECPB 4YH2A 3IC4A 4QL7A 1BX9A 3BJ5A 3KP9A 1Z6NA 3HJOA 5DCHA 1V9WA 4K1FA 4IQ1A 2PUKC 2LRCA 5IMDA 1JZDA 1PN9A 2LQQA 2GGTA 4K8MA 3VI7A 4GF0A 5G1KA 1Z6MA 4L5LA 4IELA 5A5KA 1N2AA 4ULXA 3PPUA 2B5EA 4EVMA 5F8BA 1TK5B 4WXTA 4X0XA 1BEDA 2Z9SA 1AXDA 3LEFA 4MMMA 4AF2A 2XHFA 2FLSA 4IJIA 1M2BA 1JZWA 2E7PA 2LQOA 5LD0A 1DSBA 4HJMA 4KA0A 3P90A 1Y6EA 4GLTA 1M2AA 3FK8A 1XIYA 2L6DA 4ML1A 3D0ZA 1OAZA 2QKEA 2WZ9A 5INYA 5ECSA 1TRVA 2FA8A 5J3RA 1WE0A 3ME7A 3OR5A 1PL2A 2DJJA 1J08A 1A2MA 3US3A 3TKSA 1PGTA 2YP6A 5DDLA 2LV3A 4ZIJA 3A2XA 1OVNA 4MCUA 1SKRB 4IJ3A 2REMA 4ZL9A 3EE2A 3MYDA 4FH8A 4LL1B 3QCPA 1X5CA 1GSYA 2IFQA 4ECJA 2JADA 3APSA 4BL7A 1JLVA 5EVOA 1K0CA 4MJCA 3HHVA 2BJXA 2VCXA 4L5OA 4TR1A 2HZEA 4EC0A 1HQOA 2YV9A 3DGQA 2VIMA 3ZL5A 4K7NA 2VM2A 3DVXA 2MMOA 3TOUA 4OO5A 3MWHA 3I69A 1SENA 1FVJA 1TTZA 3ZYWA 5KOXA 1SYXA 1GUMA 4YAPA 2LS5A 4ZB9A 1YJ6A 2FWFA 1URMA 2A2PA 2LJKA 2F3MA 4D73B 4IKHA 2QC7A 2DIZA 4NV5A 2HYXA 4XS6A 5HFGA 3GN3A 1MTCA 2P0GA 4NHZA 5CYYA 2B1LA 3JCML 2H8LA 3GRXA 3IA1A 3ZLPA 1B8XA 3SBCA 2H19A 3HCZA 4GSTA 1A24A 2E2GA 4KCEA 5H5QA 1T7PB 1YY7A 1NHOA 2JU5A 1OKTA 5AIXA 2YWOA 4MLYA 1LU4A 4RUVA 3LJRA 2ON7A 2PN8A 2H0GA 1O85A 1A2JA 4MNNA 1GSUA 4WBRD 2DJ3A 2G2QA 4F03A 3ZZXA 4G10A 5IIZA 2VLVA 1O8XA 2V32A 3C1SA 3S9FA 4Q5RA 2A4HA 5DALB 2PGTA 1K3OA 3I6AA 3F8UA 1TW9A 1AC1A 4EE0A 3K8NA 2KLXA 4GQCA 4WETA 4PQHA 2NVLA 2KHPA 3EMXA 1F6MC 1GUKA 1SKSB 4K6XA 2PU9C 5J4UA 1O8WA 4L0WA 4CDOA 2GDRA 5HR1A 4CHSA 13GSA 4J2FA 5D9WA 1C72A 2H72A 1HD2A 2H0HA 3F4RA 1W4VA 1S3CA 3O76A 1W89A 2AV4A 3E3EA 5KN1A 4ML6A 3W6GA 1GNWA 2C0FA 4LA1A 5F07A 1FOVA 4EL1A 2FWEA 1DBYA 4K2DA 1UN2A 1FO5A 3HD5A 3DXBA 4DSSA 2VCQA 3UVTA 3GURA 1F37A 3HY2A 5DCGA 4BA7A 1K0MA 2GSTA 4GRFA 2QSIA 3ERFA 1KEBA 5ECOB 5ECIB 2H30A 3HZ8A 4KB3A 5GAPD 1O7UA 1VF2A 2OE3A 5C00A 6GSYA 1EEJA 3GSSA 4F0CA 4F0BA 4HI7A 1R26A 4TN8A 1FVKA 1EP7A 4GQFA 3TKSC 2LJAA 2GZPA 1A23A 4Z7XA 1OC3A 2B7JA 3ZMKA 1F2EA 3W8SA 1T00A 2A2SA 2H74A 4YKFA 5CRGA 2RLIA 3A2VA 4KDUA 1U6TA 2KOKA 4X1UA 1V40A 2LRTA 3DD3A 1XVQA 1EOGA 1XZOA 2I4AA 3FKFA 1OC9A 5KN2A 2C0EA 1ILOA 4XIHA 1GSQA 3GNJA 3TOTA 3BCIA 4N10A 1YKAA 4JBBA 5D9XA 2NDOA 1EP8A 1AQXA 2R4VA 3DRNA 2P31A 3DWVA 4K0NA 5IPGA 5KN0A 4NAXA 3H1NA 5B7CA 2DJKA 1ERWA 2NTOA 1AQVA 3EYTA 4EDZA 3M9JA 3HJMA 2YNXA 3GH6A 1O73A 4RQXA 1ZGNA 2H76A 1XWGA 3HJPA 3GKKA 2M72A 1T4ZA 1KBNA 3M0FA 3GYKA 5G5FA 5B8AA 5HFKA 1JZRA 5ECLB 4NHWA 4HZ4A 3WT2A 1OE8A 5ECKB 1WRYA 5IOWA 2E2MA 4JR6A 4QQ7A 3IK9A 1Z3EA 1IYIA 3ERGA 1F3AA 3DIEA 3GX0A 1K0DA 1ABAA 4KSOA 1YQ1A 2OBIA 4PNGA 2YV7A 4KF9A 1XFLA 3ZREA 3CXGA 4MJBA 2B5YA 1SYRA 2V1MA 4GXZA 4NMUA 2MBSA 4EIPA 4AJ8A 2R2JA 2FCHA 1HYUA 3PINA 2N5BA 2CV4A 4BVYB 1THXA 4WF5A 4GSSA 1GTBA 2H0IA 1DUGA 4PQIA 4KGIA 4ICYA 2WRTA 3L78A 5GSSA 1PKWA 1MD3A 1TI3A 1YEPA 1PKZA 1VRSD 4G9HA 4HS1A 4XS1A 5G30A 4IN0A 1PX6A 4K5RA 2DJ1A 3UOMA 3FEUA 4AGSA 4TXOA 4RQRA 4TVEA 6GSXA 4MP4A 4BWQA 3BD2A 2L5OA 2LNSA 3GX8A 1FAAA 4ID0A 3PGTA 1M99A 4I97A 4DEJA 2YZUA 4OFMA 3J7Yk 1M9AA 2R6KA 2FUG2 5DJLA 4XS4B 1PSQA 1H75A 3HZ4A 3GUSA 1TRUA 5IMVA 1LBKA 3TJFA 5B8BA 2HXKA 4FYBA 2H1GA 2DC5A 4HQZA 1ST9A 1S3AA 2L57A 5DBQA 4KUNA 3KTBA 4Q5NA 2CA8A 2A2RA 4F9ZA 1MEKA 4BVYA 2H71A 4ACSA 3FR6A 2PVOC 3RBTA 1UA5A 4PUFC 5BMUA 1XWBA 5JWQB 3KXOA 3ISOA 1B48A 3L0HA 4EXJA 1M2DA 2KUCA 4V2MA 3H4KA 1ZYPA 2IMKA 4DVCA 2JSYA 3D6IA 11GSA 2OBKA 3IBHA 2WGRA 1NM3A 4O5UA 1MDKA 1HNBA 2GQLA 2H70A 2X8GA 3DKSA 2L4CA 2OE1A 5AGYA 1XWKA 1GULA 5D73A 1SJZA 3EC3A 4IW9A 1PX7A 4XS4A 3NZNA 4KH7A 1EGOA 2IFQB 2F9SA 3IE3A 4BL7B 3ZIJA 1ZCPA 2VCTA 1XWCA 4GCIA 1G7OA 4MABA 3VPQA 1XCCA 3TB2A 3QOUA 4NV2A 1RW1A 4V1Ap 2YWNA 4POKA 1U3AA 4TR1B 1K0NA 2HZEB 5D96A 1XVWA 2AJQB 5G5EA 3BCKA 4RI6A 3IC8A 4BPYA 1SL1B 4ZL8A 2AB6A 3CRTA 4CW9A 4IBPA 3I9V2 3GKXA 5BRTA 4PUAA 2VL2A 3HA9A 4NPBA 3FMWA 5IOXA 1M7TA 3RAZA 3C1RA 2FA4A 4I2UA 1VF3A 1X5EA 2HSYA 3IRAA 3TKSE 2GT5A 3IDVA 1PRXA 3QAVA 5JCUA 4CY8A 4K9ZA 4IP6A 1GLQA 3HVVA 4ILFA 5COHA 2X8HA 1WOUA 5CO3A 5JCGA 3UEMA 3CSIA 4G0IA 5EPFA 4V2LA 3TCOA 2BTOT 2X4AA 1B9YC 1XWAA 2K8VA 3VPTA 4KCAA 2C0GA 1A0FA 4Q5FA 1USBA 5FHIA 5G31A 2GVPA 6GSTA 2HRFA 1SK2A 2OJLA 3TJKA 12GSA 3ZVJD 5ECNB 4MPFA 4GSNA 6GSUA 2IJYA 4FQUA 4MDCA 1M0UA 1X5DA 2OKAA 3G7IA 3ZFLA 2DMLA 3GHAA 3VLNA 3QDNA 4JR4A 1JHBA 1YF0A 5KN3A 4RI7A 2H73A 2TRXA 1I9DA 4JE1A 4O5RA 3KMNA 3ZMLA 4E8HA 4O7HA 3U6VA 3M9KA 1XPVA 2PWJA 1KTEA 2OE0A 2L59A 2OACA 5IMFA 1I5GA 1ZOFA 2RIIA 2DLXA 2CZ3A 2GQMA 3FYGA 1ZZYA 1BQ7A 2YCDA 4DSSB 2JZSA 3RPPA 3RHBA 4TR3A 3M3MA 4YQVA 2TRCP 3ME8A 2HSHA 2FNOA 3IXRA 2JZRA 1EV9A 3TUEA 5L71A 3KJYA 4O32A 2O8VB 2PMTA 1R4WA 5GAND 3NIVA 1K3YA 5CAXA 2CX3A 3GV1A 1GH2A 3UIWA 1V2AA 1QXHA 3EWLA 4ZB8A 2B6MA 3KP8A 5HR3A 2YJHA 1PA3A 1U88A 4E8EA 1ZYNA 2IWTA 1MDJA 1Z7RA 1B9XC 2F8FA 1RK4A 4HEA2 2LJRA 1QQ2A 3F4SA 2DBCA 3EMPA 3IK7A 3UVHA 4XRDA 3N9JA 2HE3A 2B7KA 3GFKA 2I9HA 2IPAA 3TKRA 4MZWA 1DE2A 4ZXGA 4ZILA 2L4QA 2MBTA 3E0UA 4IP1A 3A5WA 1G6WA 4MA9A 1TU7A 3CRUA 4GTUA 4K0GA 1A0RP 2VCWA 5EL8A 2H6YA 1OC9B 5FT3A 5FWGA 3LW9A 3CTFA 3QFAC 4O92A 4GWRA 2VL9A 5DJMA 4IGJA 3EU3A 5CREA 4PURA 4EUYA 4PGTA 5H5RA 4KAEA 20GSA 1TKDB 1TK8B 4OD7A 1O81A 3TDGA 4KE3A 1GTUA 2XPDA 1K0OA 2B3SA 6GSVA 1SJIA 2HZFA 1J9BA 2O89A 2NPBA 2XC2A 1AW9A 5ECRB 3CSHA 2EIQA 1G7EA 1IYHA 1PD21 4PNFA 4BVXB 2R3XA 4BWSA 1T1VA 3MAKA 2B1KA 1WPIA 2I1UA 1XOBA 2XBIA 3RDWA 2D2ZA 3ERWA 4N11A 1EWXA 1X9WB 4G0LA 5CP1A 1HNCA 3J7Yb 2L5LA 3C73A 2ES7A 1ZMAA 4XTSA 5G2ZA 3EVIA 9GSSA 4DSQA 1GTAA 3P8WA 2X8CA 4LL4B 1ERVA 4PTSA 4ZL7A 2I3YA 2N5FA 3EPTA 5IO2A 5DAKB 2LNTA 2LTKA 3SWLA 3GSTA 5A4WA 1PMTA 3VWVA 2RM5A 5E4WA 4POMA 4HQSA 4OMVA 3HVSA 2M46A 4WKWA 2CVKA 4F82A 1PQNA 3DMLA 4WEYA 4CY6A 5J41A 3HKRA 4JU5A 1E6BA 3R2QA 2CT6A 3VWUA 2IMDA 2VM1A 2H66A 4YQMA 1AUCA 4TRXA 2YANA 1UC7A 1THOA 3ZVJA 3WT1A 4OO4A 1AIUA 3WGEA 2LEGA 1N8JA 1U3IA 1T3BA 4TXOB 4BVXA 3FR3A 4JZQA 3LYKA 18GSA 1EEMA 1Z9HA 1QK8A 3ZFBA 4I8BA 2F51A 2O7KA 4WR4A 5JCWA 5EY6A 3EURA 10GSA 2YN1A 2VO4A 1R7HA 3KCMA 3ZTLA 4ZB6A 2ALBA 1QFNA 2NBSA 1XBSA 1UVZA 4IHUA 3LQ7A 5DAKA 1GNEA 1S3DA 1K0BA 3D4MA 3BOAA 2JL4A 1XW5A 2V2GA 4KDYA 1QGVA 1ERTA 2FWHA 4IVFA 4Z2UA 1K3LA 2JSZA 3C7MA 5B6MA 3GKMA 3UL3A 3R3EA 2QGVA 3TJJA 4MF5A 1G6YA 2WJUA 1FB6A 4FYCA 5IQYA 3F9UA 4ZBDA 5IMAA 1SD9A 1WIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML6 A;  2M80 A;  1ERU A;  3TRX A;  4EKZ A;  3H79 A;  4WF4 A;  3P2A A;  3FHK A;  4NXI A;  1MD4 A;  3GIX A;  1ON4 A;  2C3Q A;  3QPM A;  4MH3 A;  5AN1 A;  1TU8 A;  1GTI A;  4POL A;  2AYT A;  1TDI A;  4PX1 A;  3IAM 2;  4XHM A;  1EV4 A;  1CQH A;  2CVB A;  4Q5Q A;  4LMW A;  2MMA A;  1F3B A;  5D9T A;  2FHE A;  2H75 A;  1CQG A;  3H93 A;  1Y25 A;  2H01 A;  3CYN A;  1X9M B;  3ZRD A;  2IMI A;  3F3Q A;  1YZX A;  1VF4 A;  5DQS A;  4LLR A;  2MYG A;  4N30 A;  17GS A;  3GTU B;  4X43 A;  3ED3 A;  1TK0 B;  2CVD A;  1WWJ A;  2LKU A;  3E9J B;  3LXT A;  3I43 A;  4ZBA A;  3QAG A;  1ZL9 A;  2YWM A;  1F9M A;  4P3Y B;  5E59 A;  3GMF A;  4MF6 A;  3WGD A;  2H1D A;  3QD9 A;  2GTU A;  2VCZ A;  5ECQ B;  5DQY A;  1RQM A;  4MJE A;  2FD3 A;  2RM6 A;  3QAW A;  2DSA A;  2IMF A;  2K18 A;  4N0V A;  1GSF A;  3VI5 A;  4K7O A;  2K8S A;  2WS2 A;  4HU7 A;  4KDX A;  3UMA A;  4XRA A;  1SL2 B;  4OFT A;  1JFU A;  3FY7 A;  4OFN A;  5A4V A;  3DVW A;  1FB0 A;  2AUV A;  1WMJ A;  4OCF A;  4ZBB A;  3QFB C;  4HZ2 A;  5C04 A;  3P7X A;  2MMN A;  2WB9 A;  4ECI A;  1Q4J A;  3LFL A;  2DJ2 A;  3D22 A;  3L4N A;  2O87 A;  3GTU A;  5AIV A;  1YEX A;  3F0I A;  3F63 A;  3KEB A;  2VD0 A;  2JZT A;  2VLU A;  2FY6 A;  1TRW A;  4LMV A;  3TJB A;  2GZY A;  3FRC A;  2F8A A;  2C3N A;  1SJ6 A;  5HR0 A;  5IPH A;  2GZZ A;  2E0Q A;  3HXS A;  3W8J A;  2AHE A;  1HNA A;  5GST A;  2RUE A;  2J9H A;  2PVQ A;  4G19 A;  2YOI A;  3TRP A;  2PER A;  2GQK A;  5LNK e;  2V41 A;  1J0F A;  3F4T A;  2L6C A;  5AIS A;  3FZ4 A;  3RPN A;  4KX4 A;  1AAZ A;  1GLP A;  1JLW A;  5F06 A;  1SD8 A;  4JED A;  3M8N A;  3KTL A;  1TP9 A;  2VLT A;  2KP1 A;  3RHC A;  3DEX A;  2X99 A;  2MZC A;  2KP2 A;  5CRD A;  5KEJ A;  1EZK A;  4TR4 A;  2WDU A;  4EF0 A;  2G0F A;  2PPT A;  4FIW A;  3C8E A;  4EO3 A;  4KSM A;  4I6X A;  5D8I A;  3PR8 A;  3HDC A;  3IV4 A;  2TIR A;  2C80 A;  1TXX A;  2HRN A;  3MSZ A;  3APQ A;  1LJR A;  3U5R E;  2YJ7 A;  5GZZ B;  4MPG A;  4I2T A;  1GSD A;  5CRW A;  2J23 A;  3L9V A;  5D93 A;  5JWR B;  1KNG A;  1WJK A;  3KMO A;  3AY8 A;  1SK1 A;  2C8U A;  5J5N A;  1XXU A;  2VOC A;  4PXO A;  3C71 A;  3CSJ A;  1BJX A;  3L9U A;  2ZCT A;  1BG5 A;  1A8Y A;  1EOH A;  4L0U A;  3IR4 A;  1MDI A;  2BMX A;  1GUH A;  3O3T A;  4K7I A;  5ID2 B;  3A2W A;  2HLS A;  2GSS A;  5F05 A;  5IM9 A;  3Q6O A;  1PL1 A;  5J9C A;  2CX4 A;  1YKC A;  2CZ2 A;  1TRS A;  5CNW A;  3FZ9 A;  1U87 A;  2C0D A;  2RUF A;  3UBL A;  2LST A;  3IHQ A;  3FZ5 A;  4TW5 A;  1Q98 A;  3O6T A;  2YZH A;  1SK0 A;  3WD6 A;  3IAS 2;  4TOP A;  2ON5 A;  4TXV A;  3ZIV A;  2CQ9 A;  4ISD A;  3IPZ A;  2HNL A;  2B5X A;  4AJ6 A;  4HDE A;  3APO A;  1SL0 B;  1TOF A;  1AQW A;  2VAF A;  1GL8 A;  4OCE A;  3GL5 A;  4D73 A;  3L9S A;  2IME A;  2IL3 A;  1G0T A;  3KIJ A;  1QUW A;  4TKY A;  3HVX A;  3UAP A;  3GKN A;  4WBJ A;  4OWY A;  2GLR A;  1SU9 A;  3TGZ A;  4I5Q A;  2LUS A;  3TKQ A;  3LGC A;  3LG6 A;  2ZUP A;  2FGX A;  5ID2 A;  2VL2 C;  3LSZ A;  4FYU A;  1NHY A;  2CAI A;  2DMM A;  3NOF A;  3KH9 A;  4NWY A;  2X64 A;  1O6J A;  3D5J A;  3KD0 A;  4EDY A;  3CTG A;  4MJA A;  1GWC A;  3KM6 A;  4AJ7 A;  2C1Y A;  2JAC A;  5IO0 A;  4F2I A;  3EIN A;  5HR2 A;  2C3T A;  3HYP A;  3KZQ A;  3DYR A;  3KH7 A;  4YAV A;  1VGL A;  4YQU A;  1FW1 A;  1OKD A;  2V6O A;  5H5S A;  3WGX A;  5DAL A;  3VWW A;  3N5O A;  4TR0 A;  1V57 A;  2GT6 A;  3FW2 A;  2GSQ A;  4HJ2 A;  2VUP A;  4ECC A;  2H6Z A;  1A2L A;  1NSW A;  5CRH A;  4V1A g;  1JZO A;  16GS A;  3QMX A;  1YF1 A;  5F0G A;  5J9B A;  4HU9 A;  1T4Y A;  3MNG A;  4V2N A;  2H1A A;  4XCS A;  2DJ0 A;  2WFC A;  2XBQ A;  1TJD A;  1R5P A;  3Q74 A;  4IS0 A;  5JWO B;  3D4T A;  2H6X A;  1X9S B;  4MH2 A;  5ECM B;  3G9B A;  4MK3 A;  1TI1 A;  2V6K A;  3UJ1 A;  3LWA A;  2EC4 A;  2AAW A;  4HUA A;  2DIY A;  2IIY A;  2LRN A;  3Q19 A;  4POB A;  1DE1 A;  3CBU A;  4MZB A;  1YDK A;  3CMI A;  1OE7 A;  2MMZ A;  2IN3 A;  2N5A A;  5A4U A;  4PQ1 A;  2GS3 A;  3GL3 A;  4ECB A;  3BBY A;  4MF7 A;  2HI7 A;  1XW6 A;  1VF1 A;  1ZYQ B;  3UBK A;  2HT9 A;  3F3R A;  4QL9 A;  4H86 A;  4N0Z A;  1E2Y A;  4MZC A;  4KW6 A;  2VD1 A;  2WUL A;  5HQP A;  3M1G A;  14GS A;  5G1L A;  1H4O A;  5ENU A;  1Z5Y E;  3G7J A;  2A4V A;  1GP1 A;  3H8Q A;  2OA7 A;  5B6N A;  4G2E A;  5HFI A;  3VWX A;  4DSR A;  3GA4 A;  3FZA A;  2K9F A;  2OAD A;  4IQA A;  3KGK A;  3FR9 A;  2GSR A;  2YPM A;  3GH9 A;  2PBJ A;  4J56 E;  3VUR A;  2K6V A;  1ACV A;  2EIO A;  3EU4 A;  2VCV A;  1M9B A;  3F6D A;  2P5Q A;  2P5R A;  4JRR A;  19GS A;  2C4J A;  2VL3 A;  3TRQ A;  1ZYE A;  3VK9 A;  1B4Q A;  3TKP A;  1QMV A;  3A3T A;  7GSS A;  1X0R A;  6GSS A;  3TJG A;  1EGR A;  3VFI A;  5ELG A;  2HFD A;  2CAQ A;  1NW2 A;  3F6F A;  4FO5 A;  1OC8 A;  5D9V A;  3QR6 A;  1XW9 A;  5IMZ A;  3Q18 A;  4WR5 A;  2H1B A;  1XOA A;  2ZNM A;  1B4P A;  22GS A;  3UAR A;  3IOS A;  2R5G A;  3LOR A;  2O85 A;  5ABR A;  1GSE A;  1GSS A;  5ECH B;  5ELA A;  1OYJ A;  5DVB A;  1K0A A;  4L8E A;  3WYW A;  4J57 E;  2FWG A;  2WCI A;  3MDK A;  2EIR A;  3V1W A;  1T8E B;  6GSW A;  2XPE A;  1A8L A;  2YWI A;  3G7Y A;  5IMC A;  3LXZ A;  1Z7P A;  1WP0 A;  4HOJ A;  2R37 A;  3D21 A;  1FHE A;  3LYP A;  1R5A A;  5LCZ A;  1BYE A;  8GSS A;  1V58 A;  3ZIT A;  1GRX A;  4KND A;  1FG4 A;  1V98 A;  1SKW B;  3PH9 A;  1BAY A;  2I81 A;  5ECP B;  4YH2 A;  3IC4 A;  4QL7 A;  1BX9 A;  3BJ5 A;  3KP9 A;  1Z6N A;  3HJO A;  5DCH A;  1V9W A;  4K1F A;  4IQ1 A;  2PUK C;  2LRC A;  5IMD A;  1JZD A;  1PN9 A;  2LQQ A;  2GGT A;  4K8M A;  3VI7 A;  4GF0 A;  5G1K A;  1Z6M A;  4L5L A;  4IEL A;  5A5K A;  1N2A A;  4ULX A;  2B5E A;  4EVM A;  5F8B A;  1TK5 B;  4WXT A;  4X0X A;  1BED A;  2Z9S A;  1AXD A;  3LEF A;  4MMM A;  4AF2 A;  2XHF A;  2FLS A;  4IJI A;  1M2B A;  1JZW A;  2E7P A;  2LQO A;  5LD0 A;  1DSB A;  4HJM A;  4KA0 A;  3P90 A;  1Y6E A;  4GLT A;  1M2A A;  3FK8 A;  1XIY A;  2L6D A;  4ML1 A;  3D0Z A;  1OAZ A;  2QKE A;  2WZ9 A;  5INY A;  5ECS A;  1TRV A;  2FA8 A;  5J3R A;  1WE0 A;  3ME7 A;  3OR5 A;  1PL2 A;  2DJJ A;  1J08 A;  1A2M A;  3US3 A;  3TKS A;  1PGT A;  2YP6 A;  5DDL A;  2LV3 A;  4ZIJ A;  3A2X A;  1OVN A;  4MCU A;  1SKR B;  4IJ3 A;  2REM A;  4ZL9 A;  3EE2 A;  4FH8 A;  4LL1 B;  3QCP A;  1X5C A;  1GSY A;  2IFQ A;  4ECJ A;  2JAD A;  3APS A;  4BL7 A;  1JLV A;  5EVO A;  1K0C A;  4MJC A;  3HHV A;  2BJX A;  2VCX A;  4L5O A;  4TR1 A;  2HZE A;  4EC0 A;  1HQO A;  2YV9 A;  3DGQ A;  2VIM A;  3ZL5 A;  4K7N A;  2VM2 A;  3DVX A;  2MMO A;  3TOU A;  4OO5 A;  3MWH A;  3I69 A;  1SEN A;  1FVJ A;  1TTZ A;  3ZYW A;  1SYX A;  1GUM A;  4YAP A;  2LS5 A;  4ZB9 A;  1YJ6 A;  2FWF A;  1URM A;  2LJK A;  2F3M A;  4D73 B;  4IKH A;  2QC7 A;  2DIZ A;  4NV5 A;  2HYX A;  4XS6 A;  5HFG A;  3GN3 A;  1MTC A;  2P0G A;  4NHZ A;  5CYY A;  2B1L A;  3JCM L;  2H8L A;  3GRX A;  3IA1 A;  3ZLP A;  1B8X A;  3SBC A;  2H19 A;  3HCZ A;  4GST A;  1A24 A;  2E2G A;  4KCE A;  5H5Q A;  1T7P B;  1YY7 A;  1NHO A;  2JU5 A;  1OKT A;  5AIX A;  2YWO A;  4MLY A;  1LU4 A;  4RUV A;  3LJR A;  2ON7 A;  2PN8 A;  2H0G A;  1O85 A;  1A2J A;  1GSU A;  4WBR D;  2DJ3 A;  2G2Q A;  4F03 A;  3ZZX A;  4G10 A;  5IIZ A;  2VLV A;  1O8X A;  2V32 A;  3C1S A;  3S9F A;  4Q5R A;  5DAL B;  2PGT A;  1K3O A;  3I6A A;  3F8U A;  1TW9 A;  1AC1 A;  4EE0 A;  3K8N A;  2KLX A;  4GQC A;  4WET A;  4PQH A;  2NVL A;  2KHP A;  3EMX A;  1F6M C;  1GUK A;  1SKS B;  4K6X A;  2PU9 C;  5J4U A;  1O8W A;  4L0W A;  4CDO A;  2GDR A;  5HR1 A;  4CHS A;  13GS A;  4J2F A;  5D9W A;  1C72 A;  2H72 A;  1HD2 A;  2H0H A;  3F4R A;  1W4V A;  1S3C A;  3O76 A;  1W89 A;  2AV4 A;  3E3E A;  5KN1 A;  4ML6 A;  3W6G A;  1GNW A;  2C0F A;  4LA1 A;  5F07 A;  1FOV A;  4EL1 A;  2FWE A;  1DBY A;  4K2D A;  1UN2 A;  1FO5 A;  3HD5 A;  3DXB A;  4DSS A;  2VCQ A;  3UVT A;  3GUR A;  1F37 A;  3HY2 A;  5DCG A;  4BA7 A;  1K0M A;  2GST A;  4GRF A;  2QSI A;  3ERF A;  1KEB A;  5ECO B;  5ECI B;  2H30 A;  3HZ8 A;  4KB3 A;  5GAP D;  1O7U A;  1VF2 A;  2OE3 A;  5C00 A;  6GSY A;  1EEJ A;  3GSS A;  4F0C A;  4F0B A;  4HI7 A;  1R26 A;  4TN8 A;  1FVK A;  1EP7 A;  4GQF A;  3TKS C;  2LJA A;  2GZP A;  1A23 A;  4Z7X A;  1OC3 A;  2B7J A;  3ZMK A;  1F2E A;  3W8S A;  1T00 A;  2A2S A;  2H74 A;  5CRG A;  2RLI A;  3A2V A;  4KDU A;  1U6T A;  2KOK A;  4X1U A;  1V40 A;  2LRT A;  3DD3 A;  1XVQ A;  1EOG A;  1XZO A;  2I4A A;  3FKF A;  1OC9 A;  5KN2 A;  2C0E A;  1ILO A;  4XIH A;  1GSQ A;  3GNJ A;  3TOT A;  3BCI A;  4N10 A;  1YKA A;  4JBB A;  5D9X A;  2NDO A;  1EP8 A;  1AQX A;  2R4V A;  3DRN A;  2P31 A;  3DWV A;  4K0N A;  5IPG A;  5KN0 A;  4NAX A;  3H1N A;  5B7C A;  2DJK A;  1ERW A;  2NTO A;  1AQV A;  3EYT A;  4EDZ A;  3M9J A;  3HJM A;  2YNX A;  3GH6 A;  1O73 A;  4RQX A;  1ZGN A;  2H76 A;  1XWG A;  3HJP A;  3GKK A;  2M72 A;  1T4Z A;  1KBN A;  3M0F A;  3GYK A;  5G5F A;  5B8A A;  5HFK A;  1JZR A;  5ECL B;  4NHW A;  4HZ4 A;  3WT2 A;  1OE8 A;  5ECK B;  1WRY A;  5IOW A;  2E2M A;  4JR6 A;  4QQ7 A;  3IK9 A;  1Z3E A;  1IYI A;  3ERG A;  1F3A A;  3DIE A;  3GX0 A;  1K0D A;  1ABA A;  4KSO A;  1YQ1 A;  2OBI A;  4PNG A;  2YV7 A;  1XFL A;  3ZRE A;  3CXG A;  4MJB A;  2B5Y A;  1SYR A;  2V1M A;  4GXZ A;  4NMU A;  2MBS A;  4AJ8 A;  2R2J A;  2FCH A;  1HYU A;  3PIN A;  2N5B A;  2CV4 A;  1THX A;  4WF5 A;  4GSS A;  1GTB A;  2H0I A;  1DUG A;  4PQI A;  4KGI A;  2WRT A;  3L78 A;  5GSS A;  1PKW A;  1MD3 A;  1TI3 A;  1YEP A;  1PKZ A;  1VRS D;  4G9H A;  4HS1 A;  4XS1 A;  5G30 A;  4IN0 A;  1PX6 A;  2DJ1 A;  3UOM A;  3FEU A;  4AGS A;  4TXO A;  4RQR A;  4TVE A;  6GSX A;  4MP4 A;  4BWQ A;  3BD2 A;  2L5O A;  2LNS A;  3GX8 A;  1FAA A;  4ID0 A;  3PGT A;  1M99 A;  4I97 A;  4DEJ A;  2YZU A;  4OFM A;  3J7Y k;  1M9A A;  2R6K A;  2FUG 2;  5DJL A;  4XS4 B;  1PSQ A;  1H75 A;  3HZ4 A;  3GUS A;  1TRU A;  5IMV A;  1LBK A;  3TJF A;  5B8B A;  2HXK A;  4FYB A;  2H1G A;  2DC5 A;  4HQZ A;  1ST9 A;  1S3A A;  2L57 A;  5DBQ A;  4KUN A;  3KTB A;  4Q5N A;  2CA8 A;  2A2R A;  4F9Z A;  1MEK A;  4BVY A;  2H71 A;  4ACS A;  3FR6 A;  2PVO C;  3RBT A;  1UA5 A;  4PUF C;  1XWB A;  5JWQ B;  3KXO A;  3ISO A;  1B48 A;  3L0H A;  4EXJ A;  1M2D A;  2KUC A;  4V2M A;  3H4K A;  2IMK A;  4DVC A;  2JSY A;  3D6I A;  11GS A;  2OBK A;  3IBH A;  2WGR A;  1NM3 A;  1MDK A;  1HNB A;  2GQL A;  2H70 A;  2X8G A;  3DKS A;  2L4C A;  2OE1 A;  5AGY A;  1XWK A;  1GUL A;  5D73 A;  1SJZ A;  3EC3 A;  4IW9 A;  1PX7 A;  4XS4 A;  3NZN A;  4KH7 A;  1EGO A;  2IFQ B;  2F9S A;  3IE3 A;  3ZIJ A;  1ZCP A;  2VCT A;  1XWC A;  4GCI A;  1G7O A;  4MAB A;  3VPQ A;  1XCC A;  3TB2 A;  3QOU A;  4NV2 A;  1RW1 A;  4V1A p;  2YWN A;  4POK A;  1U3A A;  4TR1 B;  1K0N A;  2HZE B;  5D96 A;  1XVW A;  2AJQ B;  5G5E A;  3BCK A;  4RI6 A;  4BPY A;  1SL1 B;  4ZL8 A;  2AB6 A;  3CRT A;  4CW9 A;  4IBP A;  3I9V 2;  3GKX A;  4PUA A;  2VL2 A;  3HA9 A;  4NPB A;  5IOX A;  1M7T A;  3RAZ A;  3C1R A;  2FA4 A;  4I2U A;  1VF3 A;  1X5E A;  2HSY A;  3IRA A;  3TKS E;  2GT5 A;  3IDV A;  1PRX A;  3QAV A;  5JCU A;  4K9Z A;  4IP6 A;  1GLQ A;  3HVV A;  4ILF A;  5COH A;  2X8H A;  1WOU A;  5CO3 A;  5JCG A;  3UEM A;  3CSI A;  5EPF A;  4V2L A;  3TCO A;  2BTO T;  1B9Y C;  1XWA A;  2K8V A;  3VPT A;  4KCA A;  2C0G A;  1A0F A;  4Q5F A;  1USB A;  5FHI A;  5G31 A;  2GVP A;  6GST A;  2HRF A;  1SK2 A;  2OJL A;  3TJK A;  12GS A;  3ZVJ D;  5ECN B;  4MPF A;  4GSN A;  6GSU A;  2IJY A;  4MDC A;  1M0U A;  1X5D A;  2OKA A;  3G7I A;  3ZFL A;  2DML A;  3GHA A;  3VLN A;  3QDN A;  4JR4 A;  1JHB A;  1YF0 A;  5KN3 A;  4RI7 A;  2H73 A;  2TRX A;  1I9D A;  4JE1 A;  4O5R A;  3KMN A;  3ZML A;  4E8H A;  4O7H A;  3U6V A;  3M9K A;  1XPV A;  2PWJ A;  1KTE A;  2OE0 A;  2L59 A;  2OAC A;  5IMF A;  1I5G A;  1ZOF A;  2RII A;  2DLX A;  2CZ3 A;  2GQM A;  3FYG A;  1ZZY A;  1BQ7 A;  2YCD A;  4DSS B;  2JZS A;  3RPP A;  3RHB A;  4TR3 A;  3M3M A;  4YQV A;  2TRC P;  3ME8 A;  2HSH A;  2FNO A;  3IXR A;  2JZR A;  1EV9 A;  3TUE A;  5L71 A;  3KJY A;  4O32 A;  2O8V B;  2PMT A;  1R4W A;  5GAN D;  3NIV A;  1K3Y A;  5CAX A;  2CX3 A;  3GV1 A;  1GH2 A;  3UIW A;  1V2A A;  1QXH A;  3EWL A;  4ZB8 A;  2B6M A;  3KP8 A;  5HR3 A;  2YJH A;  1PA3 A;  1U88 A;  4E8E A;  2IWT A;  1MDJ A;  1Z7R A;  1B9X C;  2F8F A;  1RK4 A;  4HEA 2;  2LJR A;  1QQ2 A;  3F4S A;  2DBC A;  3EMP A;  3IK7 A;  3UVH A;  4XRD A;  3N9J A;  2HE3 A;  2B7K A;  3GFK A;  2I9H A;  2IPA A;  3TKR A;  4MZW A;  1DE2 A;  4ZXG A;  4ZIL A;  2L4Q A;  2MBT A;  3E0U A;  4IP1 A;  3A5W A;  1G6W A;  4MA9 A;  1TU7 A;  3CRU A;  4GTU A;  4K0G A;  1A0R P;  2VCW A;  5EL8 A;  2H6Y A;  1OC9 B;  5FT3 A;  5FWG A;  3CTF A;  3QFA C;  4O92 A;  4GWR A;  2VL9 A;  5DJM A;  4IGJ A;  3EU3 A;  5CRE A;  4PUR A;  4EUY A;  4PGT A;  5H5R A;  4KAE A;  20GS A;  1TKD B;  1TK8 B;  4OD7 A;  1O81 A;  3TDG A;  4KE3 A;  1GTU A;  2XPD A;  1K0O A;  2B3S A;  6GSV A;  1SJI A;  2HZF A;  1J9B A;  2O89 A;  2NPB A;  2XC2 A;  1AW9 A;  5ECR B;  3CSH A;  2EIQ A;  1G7E A;  1IYH A;  1PD2 1;  4PNF A;  2R3X A;  4BWS A;  1T1V A;  3MAK A;  2B1K A;  1WPI A;  2I1U A;  1XOB A;  2XBI A;  3RDW A;  2D2Z A;  3ERW A;  4N11 A;  1EWX A;  1X9W B;  5CP1 A;  1HNC A;  3J7Y b;  2L5L A;  3C73 A;  2ES7 A;  1ZMA A;  4XTS A;  5G2Z A;  3EVI A;  9GSS A;  4DSQ A;  1GTA A;  3P8W A;  2X8C A;  4LL4 B;  1ERV A;  4ZL7 A;  2I3Y A;  2N5F A;  5IO2 A;  5DAK B;  2LNT A;  2LTK A;  3SWL A;  3GST A;  5A4W A;  1PMT A;  3VWV A;  2RM5 A;  5E4W A;  4POM A;  4HQS A;  4OMV A;  3HVS A;  2M46 A;  4WKW A;  2CVK A;  4F82 A;  1PQN A;  3DML A;  4WEY A;  5J41 A;  3HKR A;  4JU5 A;  1E6B A;  3R2Q A;  2CT6 A;  3VWU A;  2IMD A;  2VM1 A;  2H66 A;  4YQM A;  1AUC A;  4TRX A;  2YAN A;  1UC7 A;  1THO A;  3ZVJ A;  3WT1 A;  4OO4 A;  1AIU A;  3WGE A;  2LEG A;  1N8J A;  1U3I A;  1T3B A;  4TXO B;  4BVX A;  3FR3 A;  4JZQ A;  3LYK A;  18GS A;  1EEM A;  1Z9H A;  1QK8 A;  3ZFB A;  4I8B A;  2F51 A;  2O7K A;  4WR4 A;  5JCW A;  5EY6 A;  3EUR A;  10GS A;  2YN1 A;  2VO4 A;  1R7H A;  3KCM A;  3ZTL A;  4ZB6 A;  2ALB A;  1QFN A;  2NBS A;  1XBS A;  1UVZ A;  4IHU A;  3LQ7 A;  5DAK A;  1GNE A;  1S3D A;  1K0B A;  3D4M A;  3BOA A;  2JL4 A;  1XW5 A;  2V2G A;  4KDY A;  1QGV A;  1ERT A;  2FWH A;  4IVF A;  1K3L A;  2JSZ A;  3C7M A;  5B6M A;  3GKM A;  3UL3 A;  2QGV A;  3TJJ A;  4MF5 A;  1G6Y A;  2WJU A;  1FB6 A;  4FYC A;  5IQY A;  3F9U A;  4ZBD A;  5IMA A;  1SD9 A;  1WIK A; 
#chains in the Genus database with same CATH topology
 4K2X A;  1ML6 A;  2M80 A;  1ERU A;  2QA1 A;  3TRX A;  4EKZ A;  3H79 A;  4WF4 A;  3P2A A;  3FHK A;  4NXI A;  1MD4 A;  3GIX A;  2HRA A;  1ON4 A;  2C3Q A;  3QPM A;  4MH3 A;  5AN1 A;  1TU8 A;  1GTI A;  4POL A;  2AYT A;  1TDI A;  4PX1 A;  3IAM 2;  4XHM A;  1EV4 A;  1CQH A;  2CVB A;  4Q5Q A;  4LMW A;  2MMA A;  1F3B A;  5D9T A;  2FHE A;  2H75 A;  1CQG A;  3H93 A;  4X4J A;  1Y25 A;  2H01 A;  3CYN A;  1X9M B;  3ZRD A;  2IMI A;  3F3Q A;  1YZX A;  1VF4 A;  5DQS A;  4LLR A;  2MYG A;  4N30 A;  17GS A;  3GTU B;  4X43 A;  3ED3 A;  1TK0 B;  2CVD A;  1WWJ A;  2LKU A;  3E9J B;  3LXT A;  3I43 A;  4ZBA A;  2UZ8 A;  3QAG A;  1ZL9 A;  2YWM A;  1F9M A;  4P3Y B;  5E59 A;  3GMF A;  4MF6 A;  3WGD A;  2H1D A;  3QD9 A;  2GTU A;  2VCZ A;  5ECQ B;  5DQY A;  1RQM A;  4MJE A;  2FD3 A;  2RM6 A;  3QAW A;  2DSA A;  2IMF A;  2K18 A;  4N0V A;  1GSF A;  3VI5 A;  4K7O A;  2K8S A;  2WS2 A;  4HU7 A;  4KDX A;  3UMA A;  4XRA A;  1SL2 B;  4OFT A;  1JFU A;  3FY7 A;  4OFN A;  5A4V A;  3DVW A;  1FB0 A;  2AUV A;  1WMJ A;  4OCF A;  4ZBB A;  3QFB C;  4HZ2 A;  5C04 A;  3P7X A;  2MMN A;  4EIQ A;  2WB9 A;  4ECI A;  1Q4J A;  3LFL A;  2DJ2 A;  3D22 A;  3L4N A;  2O87 A;  4Z2R A;  3GTU A;  5AIV A;  1PFO A;  1YEX A;  2QA2 A;  3F0I A;  3F63 A;  3KEB A;  2VD0 A;  2JZT A;  2VLU A;  2FY6 A;  1TRW A;  4LMV A;  3TJB A;  2GZY A;  3FRC A;  2F8A A;  4Z2T A;  2C3N A;  1SJ6 A;  5HR0 A;  5IPH A;  2GZZ A;  2E0Q A;  3HXS A;  3W8J A;  2AHE A;  1HNA A;  5GST A;  2RUE A;  2J9H A;  2PVQ A;  4USS A;  4G19 A;  2YOI A;  3TRP A;  2PER A;  2GQK A;  5LNK e;  2V41 A;  1J0F A;  3F4T A;  2L6C A;  5AIS A;  3FZ4 A;  3RPN A;  4KX4 A;  1AAZ A;  1GLP A;  1JLW A;  5F06 A;  1SD8 A;  4JED A;  3M8N A;  3KTL A;  2R0G A;  1TP9 A;  2VLT A;  2KP1 A;  3RHC A;  3DEX A;  2X99 A;  2MZC A;  2X49 A;  2KP2 A;  5CRD A;  5KEJ A;  1EZK A;  4TR4 A;  2WDU A;  4EF0 A;  2G0F A;  2PPT A;  4FIW A;  3C8E A;  4EO3 A;  4KSM A;  4I6X A;  5D8I A;  3PR8 A;  3HDC A;  3IV4 A;  2TIR A;  2C80 A;  2R0P A;  1TXX A;  2HRN A;  3MSZ A;  3APQ A;  1LJR A;  3U5R E;  2YJ7 A;  5GZZ B;  4MPG A;  4I2T A;  1GSD A;  5CRW A;  2J23 A;  3L9V A;  5D93 A;  5JWR B;  1KNG A;  1WJK A;  3KMO A;  3AY8 A;  1SK1 A;  2C8U A;  5J5N A;  1XXU A;  2VOC A;  4PXO A;  3C71 A;  3CSJ A;  1BJX A;  3L9U A;  2ZCT A;  1BG5 A;  1A8Y A;  1EOH A;  4L0U A;  3IR4 A;  1MDI A;  2BMX A;  1GUH A;  3O3T A;  4K7I A;  5ID2 B;  3A2W A;  2HLS A;  2GSS A;  5F05 A;  5IM9 A;  3Q6O A;  1PL1 A;  5J9C A;  2CX4 A;  1YKC A;  2CZ2 A;  1TRS A;  5CNW A;  3FZ9 A;  1U87 A;  2C0D A;  2RUF A;  3UBL A;  2LST A;  3IHQ A;  3FZ5 A;  4TW5 A;  1Q98 A;  3O6T A;  2YZH A;  1SK0 A;  3WD6 A;  3IAS 2;  4TOP A;  2ON5 A;  4TXV A;  3ZIV A;  2CQ9 A;  4ISD A;  4BIK A;  3IPZ A;  2HNL A;  2B5X A;  4AJ6 A;  4HDE A;  3APO A;  1SL0 B;  1TOF A;  4G0K A;  1AQW A;  2VAF A;  1GL8 A;  4OCE A;  3GL5 A;  4D73 A;  3L9S A;  2IME A;  2IL3 A;  1G0T A;  3KIJ A;  1QUW A;  4TKY A;  3HVX A;  3UAP A;  3GKN A;  4WBJ A;  4OWY A;  2GLR A;  1SU9 A;  3TGZ A;  4I5Q A;  2LUS A;  3TKQ A;  3LGC A;  3LG6 A;  2ZUP A;  2FGX A;  5ID2 A;  2VL2 C;  3LSZ A;  4FYU A;  1NHY A;  2CAI A;  2DMM A;  3NOF A;  3KH9 A;  4NWY A;  2X64 A;  1O6J A;  3D5J A;  3KD0 A;  4EDY A;  3CTG A;  4MJA A;  1GWC A;  3KM6 A;  4AJ7 A;  2C1Y A;  2JAC A;  5IO0 A;  4F2I A;  3EIN A;  5HR2 A;  2C3T A;  3HYP A;  3KZQ A;  3DYR A;  3KH7 A;  4YAV A;  1VGL A;  4YQU A;  1FW1 A;  1OKD A;  2V6O A;  5H5S A;  3WGX A;  5DAL A;  3VWW A;  3N5O A;  4TR0 A;  1V57 A;  5KOW A;  2GT6 A;  3FW2 A;  2GSQ A;  4HJ2 A;  2VUP A;  4ECC A;  2H6Z A;  1A2L A;  1NSW A;  5CRH A;  4V1A g;  1JZO A;  16GS A;  3QMX A;  1YF1 A;  5F0G A;  5J9B A;  2HRK A;  4HU9 A;  1T4Y A;  3MNG A;  4V2N A;  2H1A A;  4XCS A;  2DJ0 A;  2WFC A;  2XBQ A;  2HSM A;  1TJD A;  1R5P A;  3Q74 A;  4IS0 A;  5JWO B;  3D4T A;  2H6X A;  1X9S B;  4MH2 A;  5ECM B;  3G9B A;  4MK3 A;  1TI1 A;  2V6K A;  2DKI A;  3UJ1 A;  3LWA A;  2EC4 A;  2AAW A;  2R0C A;  4HUA A;  2DIY A;  2IIY A;  2LRN A;  3Q19 A;  4POB A;  1DE1 A;  3CBU A;  4MZB A;  1YDK A;  3CMI A;  1OE7 A;  2MMZ A;  2IN3 A;  2N5A A;  5A4U A;  4PQ1 A;  3MIX A;  2GS3 A;  3GL3 A;  4ECB A;  3BBY A;  4MF7 A;  2HI7 A;  1XW6 A;  1VF1 A;  1ZYQ B;  3UBK A;  2HT9 A;  3F3R A;  4QL9 A;  4H86 A;  4N0Z A;  1E2Y A;  4MZC A;  4KW6 A;  2VD1 A;  2WUL A;  5HQP A;  3M1G A;  14GS A;  5G1L A;  1H4O A;  5ENU A;  1Z5Y E;  4A5P A;  3G7J A;  2A4V A;  1GP1 A;  3H8Q A;  2OA7 A;  5B6N A;  4G2E A;  5HFI A;  3VWX A;  4DSR A;  3GA4 A;  3FZA A;  2K9F A;  2OAD A;  4IQA A;  3KGK A;  1PN0 A;  3FR9 A;  3A5I A;  2GSR A;  2YPM A;  3GH9 A;  1FOH A;  2PBJ A;  4J56 E;  3VUR A;  2K6V A;  1ACV A;  2EIO A;  3EU4 A;  2VCV A;  1M9B A;  3F6D A;  2P5Q A;  2P5R A;  4JRR A;  19GS A;  2C4J A;  2VL3 A;  3TRQ A;  1ZYE A;  3VK9 A;  1B4Q A;  3TKP A;  4O5Q A;  1QMV A;  3A3T A;  7GSS A;  1X0R A;  6GSS A;  3TJG A;  1EGR A;  3VFI A;  5ELG A;  2HFD A;  2CAQ A;  1NW2 A;  3F6F A;  4FO5 A;  1OC8 A;  5D9V A;  3QR6 A;  1XW9 A;  5IMZ A;  3Q18 A;  4WR5 A;  2H1B A;  1XOA A;  2ZNM A;  1B4P A;  22GS A;  3UAR A;  3IOS A;  2R5G A;  3LOR A;  2O85 A;  5ABR A;  1GSE A;  1GSS A;  5ECH B;  5ELA A;  1OYJ A;  5DVB A;  1K0A A;  4L8E A;  3WYW A;  3IHG A;  4J57 E;  2FWG A;  2WCI A;  3MDK A;  2EIR A;  3V1W A;  1T8E B;  6GSW A;  2XPE A;  1A8L A;  2YWI A;  3G7Y A;  5IMC A;  3LXZ A;  1Z7P A;  1WP0 A;  4HOJ A;  2R37 A;  3D21 A;  1FHE A;  2DKH A;  3LYP A;  1R5A A;  5LCZ A;  1BYE A;  8GSS A;  4K5S A;  1V58 A;  3ZIT A;  1GRX A;  4KND A;  1FG4 A;  1V98 A;  1SKW B;  3PH9 A;  4YKG A;  1BAY A;  2I81 A;  5ECP B;  4YH2 A;  3IC4 A;  4QL7 A;  1BX9 A;  3BJ5 A;  3KP9 A;  1Z6N A;  3HJO A;  5DCH A;  1V9W A;  4K1F A;  4IQ1 A;  2PUK C;  2LRC A;  5IMD A;  1JZD A;  1PN9 A;  2LQQ A;  2GGT A;  4K8M A;  3VI7 A;  4GF0 A;  5G1K A;  1Z6M A;  4L5L A;  4IEL A;  4HSC X;  5A5K A;  1N2A A;  4ULX A;  3PPU A;  2B5E A;  4EVM A;  5F8B A;  1TK5 B;  4WXT A;  4X0X A;  1BED A;  2Z9S A;  1AXD A;  3LEF A;  4MMM A;  4AF2 A;  2XHF A;  2FLS A;  4IJI A;  1M2B A;  1JZW A;  2E7P A;  2LQO A;  5LD0 A;  1DSB A;  4HJM A;  4KA0 A;  3P90 A;  1Y6E A;  4GLT A;  1M2A A;  3FK8 A;  1XIY A;  2L6D A;  4ML1 A;  3D0Z A;  1OAZ A;  2QKE A;  2WZ9 A;  5INY A;  5ECS A;  1TRV A;  2FA8 A;  5J3R A;  1WE0 A;  3ME7 A;  3OR5 A;  1PL2 A;  2DJJ A;  1J08 A;  1A2M A;  3US3 A;  3TKS A;  1PGT A;  2YP6 A;  5DDL A;  2LV3 A;  4ZIJ A;  3A2X A;  1OVN A;  4MCU A;  1SKR B;  4IJ3 A;  2REM A;  4ZL9 A;  3EE2 A;  3MYD A;  4FH8 A;  4LL1 B;  3QCP A;  1X5C A;  1GSY A;  2IFQ A;  4ECJ A;  2JAD A;  3APS A;  4BL7 A;  1JLV A;  5EVO A;  1K0C A;  4MJC A;  3HHV A;  2BJX A;  2VCX A;  4L5O A;  4TR1 A;  2HZE A;  4EC0 A;  1HQO A;  2YV9 A;  3DGQ A;  2VIM A;  3ZL5 A;  4K7N A;  2VM2 A;  3DVX A;  2MMO A;  3TOU A;  4OO5 A;  3MWH A;  3I69 A;  1SEN A;  1FVJ A;  1TTZ A;  3ZYW A;  5KOX A;  1SYX A;  1GUM A;  4YAP A;  2LS5 A;  4ZB9 A;  1YJ6 A;  2FWF A;  1URM A;  2A2P A;  2LJK A;  2F3M A;  4D73 B;  4IKH A;  2QC7 A;  2DIZ A;  4NV5 A;  2HYX A;  4XS6 A;  5HFG A;  3GN3 A;  1MTC A;  2P0G A;  4NHZ A;  5CYY A;  2B1L A;  3JCM L;  2H8L A;  3GRX A;  3IA1 A;  3ZLP A;  1B8X A;  3SBC A;  2H19 A;  3HCZ A;  4GST A;  1A24 A;  2E2G A;  4KCE A;  5H5Q A;  1T7P B;  1YY7 A;  1NHO A;  2JU5 A;  1OKT A;  1M3J A;  5AIX A;  2YWO A;  4MLY A;  1LU4 A;  4RUV A;  3LJR A;  2ON7 A;  2PN8 A;  2H0G A;  1O85 A;  1A2J A;  4MNN A;  1GSU A;  4WBR D;  2DJ3 A;  2G2Q A;  4F03 A;  3ZZX A;  4G10 A;  5IIZ A;  2VLV A;  1O8X A;  2V32 A;  3C1S A;  3S9F A;  4Q5R A;  2A4H A;  5DAL B;  2PGT A;  1K3O A;  3I6A A;  3F8U A;  1TW9 A;  1AC1 A;  4EE0 A;  3K8N A;  2KLX A;  4GQC A;  4WET A;  4PQH A;  2NVL A;  2KHP A;  3EMX A;  1F6M C;  1GUK A;  1SKS B;  4K6X A;  2PU9 C;  5J4U A;  1O8W A;  4L0W A;  4CDO A;  2GDR A;  5HR1 A;  4CHS A;  13GS A;  4J2F A;  5D9W A;  1C72 A;  2H72 A;  1HD2 A;  2H0H A;  3F4R A;  1W4V A;  1S3C A;  3O76 A;  1W89 A;  2AV4 A;  3E3E A;  5KN1 A;  4ML6 A;  3W6G A;  1GNW A;  2C0F A;  4LA1 A;  5F07 A;  1FOV A;  4EL1 A;  2FWE A;  1DBY A;  4K2D A;  1UN2 A;  1FO5 A;  3HD5 A;  3DXB A;  4DSS A;  2VCQ A;  3UVT A;  3GUR A;  1F37 A;  3HY2 A;  5DCG A;  4BA7 A;  1K0M A;  2GST A;  4GRF A;  2QSI A;  3ERF A;  1KEB A;  5ECO B;  5ECI B;  2H30 A;  3HZ8 A;  4KB3 A;  5GAP D;  1O7U A;  1VF2 A;  2OE3 A;  5C00 A;  6GSY A;  1EEJ A;  3GSS A;  4F0C A;  4F0B A;  4HI7 A;  1R26 A;  4TN8 A;  1FVK A;  1EP7 A;  4GQF A;  3TKS C;  2LJA A;  2GZP A;  1A23 A;  4Z7X A;  1OC3 A;  2B7J A;  3ZMK A;  1F2E A;  3W8S A;  1T00 A;  2A2S A;  2H74 A;  4YKF A;  5CRG A;  2RLI A;  3A2V A;  4KDU A;  1M3I A;  1U6T A;  2KOK A;  4X1U A;  1V40 A;  2LRT A;  3DD3 A;  1XVQ A;  1EOG A;  1XZO A;  2I4A A;  3FKF A;  1OC9 A;  5KN2 A;  2C0E A;  1ILO A;  4XIH A;  1GSQ A;  3GNJ A;  3TOT A;  3BCI A;  4N10 A;  1YKA A;  4JBB A;  5D9X A;  2NDO A;  1EP8 A;  1AQX A;  2R4V A;  3DRN A;  2P31 A;  3DWV A;  4K0N A;  5IPG A;  5KN0 A;  4NAX A;  3H1N A;  5B7C A;  2DJK A;  1ERW A;  2NTO A;  1AQV A;  3EYT A;  4EDZ A;  3M9J A;  3HJM A;  2YNX A;  3GH6 A;  1O73 A;  4RQX A;  1ZGN A;  2H76 A;  1XWG A;  3HJP A;  3GKK A;  2M72 A;  1T4Z A;  1KBN A;  3M0F A;  3GYK A;  5G5F A;  5B8A A;  5HFK A;  1JZR A;  5ECL B;  4NHW A;  4HZ4 A;  3WT2 A;  1OE8 A;  5ECK B;  1WRY A;  5IOW A;  2E2M A;  4JR6 A;  4QQ7 A;  3IK9 A;  1Z3E A;  1IYI A;  3ERG A;  1F3A A;  3DIE A;  3GX0 A;  1K0D A;  1ABA A;  4KSO A;  1YQ1 A;  2OBI A;  4PNG A;  2YV7 A;  4KF9 A;  1XFL A;  3ZRE A;  3CXG A;  4MJB A;  2B5Y A;  1SYR A;  2V1M A;  4GXZ A;  4NMU A;  2MBS A;  4EIP A;  4AJ8 A;  2R2J A;  2FCH A;  1HYU A;  3PIN A;  2N5B A;  2CV4 A;  4BVY B;  1THX A;  4WF5 A;  4GSS A;  1GTB A;  2H0I A;  1DUG A;  4PQI A;  4KGI A;  4ICY A;  2WRT A;  3L78 A;  5GSS A;  1PKW A;  1MD3 A;  1TI3 A;  1YEP A;  1PKZ A;  1VRS D;  4G9H A;  4HS1 A;  4XS1 A;  5G30 A;  4IN0 A;  1PX6 A;  4K5R A;  2DJ1 A;  3UOM A;  3FEU A;  4AGS A;  4TXO A;  4RQR A;  4TVE A;  6GSX A;  4MP4 A;  4BWQ A;  3BD2 A;  2L5O A;  2LNS A;  3GX8 A;  1FAA A;  4ID0 A;  3PGT A;  1M99 A;  4I97 A;  4DEJ A;  2YZU A;  4OFM A;  3J7Y k;  1M9A A;  2R6K A;  2FUG 2;  5DJL A;  4XS4 B;  1PSQ A;  1H75 A;  3HZ4 A;  3GUS A;  1TRU A;  5IMV A;  1LBK A;  3TJF A;  5B8B A;  2HXK A;  4FYB A;  2H1G A;  2DC5 A;  4HQZ A;  1ST9 A;  1S3A A;  2L57 A;  5DBQ A;  4KUN A;  3KTB A;  4Q5N A;  2CA8 A;  2A2R A;  4F9Z A;  1MEK A;  4BVY A;  2H71 A;  4ACS A;  3FR6 A;  2PVO C;  3RBT A;  1UA5 A;  4PUF C;  5BMU A;  1XWB A;  5JWQ B;  3KXO A;  3ISO A;  1B48 A;  3L0H A;  4EXJ A;  1M2D A;  2KUC A;  4V2M A;  3H4K A;  1ZYP A;  2IMK A;  4DVC A;  2JSY A;  3D6I A;  11GS A;  2OBK A;  3IBH A;  2WGR A;  1NM3 A;  4O5U A;  1MDK A;  1HNB A;  2GQL A;  2H70 A;  2X8G A;  3DKS A;  2L4C A;  2OE1 A;  5AGY A;  1XWK A;  1GUL A;  5D73 A;  1SJZ A;  3EC3 A;  4IW9 A;  1PX7 A;  4XS4 A;  3NZN A;  4KH7 A;  1EGO A;  2IFQ B;  2F9S A;  3IE3 A;  4BL7 B;  3ZIJ A;  1ZCP A;  2VCT A;  1XWC A;  4GCI A;  1G7O A;  4MAB A;  3VPQ A;  1XCC A;  3TB2 A;  3QOU A;  4NV2 A;  1RW1 A;  4V1A p;  2YWN A;  4POK A;  1U3A A;  4TR1 B;  1K0N A;  2HZE B;  5D96 A;  1XVW A;  2AJQ B;  5G5E A;  3BCK A;  4RI6 A;  3IC8 A;  4BPY A;  1SL1 B;  4ZL8 A;  2AB6 A;  3CRT A;  4CW9 A;  4IBP A;  3I9V 2;  3GKX A;  5BRT A;  4PUA A;  2VL2 A;  3HA9 A;  4NPB A;  3FMW A;  5IOX A;  1M7T A;  3RAZ A;  3C1R A;  2FA4 A;  4I2U A;  1VF3 A;  1X5E A;  2HSY A;  3CQF A;  3IRA A;  3TKS E;  2GT5 A;  3IDV A;  1PRX A;  3QAV A;  5JCU A;  4CY8 A;  4K9Z A;  4IP6 A;  1GLQ A;  3HVV A;  4ILF A;  5COH A;  2X8H A;  1WOU A;  5CO3 A;  5JCG A;  3UEM A;  3CSI A;  4G0I A;  5EPF A;  4V2L A;  3TCO A;  2BTO T;  2X4A A;  1B9Y C;  1XWA A;  2K8V A;  3VPT A;  4KCA A;  2C0G A;  1A0F A;  4Q5F A;  1USB A;  5FHI A;  5G31 A;  2GVP A;  6GST A;  2HRF A;  1SK2 A;  2OJL A;  3TJK A;  12GS A;  3ZVJ D;  5ECN B;  4MPF A;  4GSN A;  6GSU A;  2IJY A;  4FQU A;  4MDC A;  1M0U A;  1X5D A;  2OKA A;  3G7I A;  3ZFL A;  2DML A;  3GHA A;  3VLN A;  3QDN A;  4JR4 A;  1JHB A;  1YF0 A;  5KN3 A;  4RI7 A;  2H73 A;  2TRX A;  1I9D A;  4JE1 A;  4O5R A;  3KMN A;  3ZML A;  4E8H A;  1S3R A;  4O7H A;  3U6V A;  3M9K A;  1XPV A;  2PWJ A;  1KTE A;  2OE0 A;  2L59 A;  2OAC A;  5IMF A;  1I5G A;  1ZOF A;  2RII A;  2DLX A;  2CZ3 A;  2GQM A;  3FYG A;  1ZZY A;  1BQ7 A;  2YCD A;  4DSS B;  2JZS A;  3RPP A;  3RHB A;  4TR3 A;  3M3M A;  4YQV A;  2TRC P;  3ME8 A;  2HSH A;  2FNO A;  3IXR A;  2JZR A;  1EV9 A;  3TUE A;  5L71 A;  3KJY A;  4O32 A;  2O8V B;  2PMT A;  1R4W A;  5GAN D;  3NIV A;  1K3Y A;  5CAX A;  2CX3 A;  3GV1 A;  1GH2 A;  3UIW A;  1V2A A;  1QXH A;  3EWL A;  4ZB8 A;  2B6M A;  3KP8 A;  5HR3 A;  2YJH A;  1PA3 A;  1U88 A;  4E8E A;  1ZYN A;  2IWT A;  1MDJ A;  1Z7R A;  1B9X C;  2F8F A;  1RK4 A;  4HEA 2;  2LJR A;  1QQ2 A;  3F4S A;  2DBC A;  3EMP A;  3IK7 A;  3UVH A;  4XRD A;  3N9J A;  2HE3 A;  2B7K A;  3GFK A;  2I9H A;  2IPA A;  3TKR A;  4MZW A;  1DE2 A;  4ZXG A;  4ZIL A;  2L4Q A;  2MBT A;  3E0U A;  4IP1 A;  3A5W A;  1G6W A;  4MA9 A;  1TU7 A;  3CRU A;  4GTU A;  4K0G A;  1A0R P;  2VCW A;  5EL8 A;  2H6Y A;  1OC9 B;  5FT3 A;  5FWG A;  3LW9 A;  3CTF A;  3QFA C;  4O92 A;  4GWR A;  2VL9 A;  5DJM A;  4IGJ A;  3EU3 A;  5CRE A;  4PUR A;  4EUY A;  4PGT A;  5H5R A;  4KAE A;  20GS A;  1TKD B;  1TK8 B;  4OD7 A;  1O81 A;  3TDG A;  4KE3 A;  1GTU A;  2XPD A;  1K0O A;  2B3S A;  6GSV A;  1SJI A;  2HZF A;  1J9B A;  2O89 A;  2NPB A;  2XC2 A;  1AW9 A;  5ECR B;  3CSH A;  2EIQ A;  1G7E A;  1IYH A;  1PD2 1;  4PNF A;  4BVX B;  2R3X A;  4BWS A;  1T1V A;  3MAK A;  2B1K A;  1WPI A;  2I1U A;  1XOB A;  2XBI A;  3RDW A;  2D2Z A;  3ERW A;  4N11 A;  1EWX A;  1X9W B;  4G0L A;  5CP1 A;  1HNC A;  3J7Y b;  2L5L A;  3C73 A;  2ES7 A;  1ZMA A;  4XTS A;  5G2Z A;  3EVI A;  9GSS A;  4DSQ A;  1GTA A;  3P8W A;  2X8C A;  4LL4 B;  1ERV A;  4PTS A;  4ZL7 A;  2I3Y A;  2N5F A;  3EPT A;  5IO2 A;  5DAK B;  2LNT A;  2LTK A;  3SWL A;  3GST A;  5A4W A;  1PMT A;  3VWV A;  2RM5 A;  5E4W A;  4POM A;  4HQS A;  4OMV A;  3HVS A;  2M46 A;  4WKW A;  2CVK A;  4F82 A;  1PQN A;  3DML A;  4WEY A;  4CY6 A;  5J41 A;  3HKR A;  4JU5 A;  1E6B A;  3R2Q A;  2CT6 A;  3VWU A;  2IMD A;  2VM1 A;  2H66 A;  4YQM A;  1AUC A;  4TRX A;  2YAN A;  1UC7 A;  1THO A;  3ZVJ A;  3WT1 A;  4OO4 A;  1AIU A;  3WGE A;  2LEG A;  1N8J A;  1U3I A;  1T3B A;  4TXO B;  4BVX A;  3FR3 A;  1XG8 A;  4JZQ A;  3LYK A;  18GS A;  1EEM A;  1Z9H A;  1QK8 A;  3ZFB A;  4I8B A;  2F51 A;  2O7K A;  4WR4 A;  5JCW A;  5EY6 A;  3EUR A;  10GS A;  3HVN A;  2YN1 A;  2VO4 A;  1R7H A;  3KCM A;  3ZTL A;  4ZB6 A;  2ALB A;  1QFN A;  2NBS A;  1XBS A;  1UVZ A;  4IHU A;  3LQ7 A;  5DAK A;  1GNE A;  1S3D A;  1K0B A;  3D4M A;  3BOA A;  2JL4 A;  1XW5 A;  2V2G A;  4KDY A;  1QGV A;  1ERT A;  2FWH A;  4IVF A;  4Z2U A;  1K3L A;  2JSZ A;  3C7M A;  5B6M A;  3GKM A;  3UL3 A;  3R3E A;  2QGV A;  3TJJ A;  4MF5 A;  1G6Y A;  2WJU A;  1FB6 A;  4FYC A;  5IQY A;  3F9U A;  4ZBD A;  5IMA A;  1SD9 A;  1WIK A; 
#chains in the Genus database with same CATH homology
 4K2X A;  1ML6 A;  2M80 A;  1ERU A;  2QA1 A;  3TRX A;  4EKZ A;  3H79 A;  4WF4 A;  3P2A A;  3FHK A;  4NXI A;  1MD4 A;  3GIX A;  2HRA A;  1ON4 A;  2C3Q A;  3QPM A;  4MH3 A;  5AN1 A;  1TU8 A;  1GTI A;  4POL A;  2AYT A;  1TDI A;  4PX1 A;  3IAM 2;  4XHM A;  1EV4 A;  1CQH A;  2CVB A;  4Q5Q A;  4LMW A;  2MMA A;  1F3B A;  5D9T A;  2FHE A;  2H75 A;  1CQG A;  3H93 A;  4X4J A;  1Y25 A;  2H01 A;  3CYN A;  1X9M B;  3ZRD A;  2IMI A;  3F3Q A;  1YZX A;  1VF4 A;  5DQS A;  4LLR A;  2MYG A;  4N30 A;  17GS A;  3GTU B;  4X43 A;  3ED3 A;  1TK0 B;  2CVD A;  1WWJ A;  2LKU A;  3E9J B;  3LXT A;  3I43 A;  4ZBA A;  2UZ8 A;  3QAG A;  1ZL9 A;  2YWM A;  1F9M A;  4P3Y B;  5E59 A;  3GMF A;  4MF6 A;  3WGD A;  2H1D A;  3QD9 A;  2GTU A;  2VCZ A;  5ECQ B;  5DQY A;  1RQM A;  4MJE A;  2FD3 A;  2RM6 A;  3QAW A;  2DSA A;  2IMF A;  2K18 A;  4N0V A;  1GSF A;  3VI5 A;  4K7O A;  2K8S A;  2WS2 A;  4HU7 A;  4KDX A;  3UMA A;  4XRA A;  1SL2 B;  4OFT A;  1JFU A;  3FY7 A;  4OFN A;  5A4V A;  3DVW A;  1FB0 A;  2AUV A;  1WMJ A;  4OCF A;  4ZBB A;  3QFB C;  4HZ2 A;  5C04 A;  3P7X A;  2MMN A;  4EIQ A;  2WB9 A;  4ECI A;  1Q4J A;  3LFL A;  2DJ2 A;  3D22 A;  3L4N A;  2O87 A;  4Z2R A;  3GTU A;  5AIV A;  1YEX A;  2QA2 A;  3F0I A;  3F63 A;  3KEB A;  2VD0 A;  2JZT A;  2VLU A;  2FY6 A;  1TRW A;  4LMV A;  3TJB A;  2GZY A;  3FRC A;  2F8A A;  4Z2T A;  2C3N A;  1SJ6 A;  5HR0 A;  5IPH A;  2GZZ A;  2E0Q A;  3HXS A;  3W8J A;  2AHE A;  1HNA A;  5GST A;  2RUE A;  2J9H A;  2PVQ A;  4USS A;  4G19 A;  2YOI A;  3TRP A;  2PER A;  2GQK A;  5LNK e;  2V41 A;  1J0F A;  3F4T A;  2L6C A;  5AIS A;  3FZ4 A;  3RPN A;  4KX4 A;  1AAZ A;  1GLP A;  1JLW A;  5F06 A;  1SD8 A;  4JED A;  3M8N A;  3KTL A;  2R0G A;  1TP9 A;  2VLT A;  2KP1 A;  3RHC A;  3DEX A;  2X99 A;  2MZC A;  2X49 A;  2KP2 A;  5CRD A;  5KEJ A;  1EZK A;  4TR4 A;  2WDU A;  4EF0 A;  2G0F A;  2PPT A;  4FIW A;  3C8E A;  4EO3 A;  4KSM A;  4I6X A;  5D8I A;  3PR8 A;  3HDC A;  3IV4 A;  2TIR A;  2C80 A;  2R0P A;  1TXX A;  2HRN A;  3MSZ A;  3APQ A;  1LJR A;  3U5R E;  2YJ7 A;  5GZZ B;  4MPG A;  4I2T A;  1GSD A;  5CRW A;  2J23 A;  3L9V A;  5D93 A;  5JWR B;  1KNG A;  1WJK A;  3KMO A;  3AY8 A;  1SK1 A;  2C8U A;  5J5N A;  1XXU A;  2VOC A;  4PXO A;  3C71 A;  3CSJ A;  1BJX A;  3L9U A;  2ZCT A;  1BG5 A;  1A8Y A;  1EOH A;  4L0U A;  3IR4 A;  1MDI A;  2BMX A;  1GUH A;  3O3T A;  4K7I A;  5ID2 B;  3A2W A;  2HLS A;  2GSS A;  5F05 A;  5IM9 A;  3Q6O A;  1PL1 A;  5J9C A;  2CX4 A;  1YKC A;  2CZ2 A;  1TRS A;  5CNW A;  3FZ9 A;  1U87 A;  2C0D A;  2RUF A;  3UBL A;  2LST A;  3IHQ A;  3FZ5 A;  4TW5 A;  1Q98 A;  3O6T A;  2YZH A;  1SK0 A;  3WD6 A;  3IAS 2;  4TOP A;  2ON5 A;  4TXV A;  3ZIV A;  2CQ9 A;  4ISD A;  3IPZ A;  2HNL A;  2B5X A;  4AJ6 A;  4HDE A;  3APO A;  1SL0 B;  1TOF A;  4G0K A;  1AQW A;  2VAF A;  1GL8 A;  4OCE A;  3GL5 A;  4D73 A;  3L9S A;  2IME A;  2IL3 A;  1G0T A;  3KIJ A;  1QUW A;  4TKY A;  3HVX A;  3UAP A;  3GKN A;  4WBJ A;  4OWY A;  2GLR A;  1SU9 A;  3TGZ A;  4I5Q A;  2LUS A;  3TKQ A;  3LGC A;  3LG6 A;  2ZUP A;  2FGX A;  5ID2 A;  2VL2 C;  3LSZ A;  4FYU A;  1NHY A;  2CAI A;  2DMM A;  3NOF A;  3KH9 A;  4NWY A;  2X64 A;  1O6J A;  3D5J A;  3KD0 A;  4EDY A;  3CTG A;  4MJA A;  1GWC A;  3KM6 A;  4AJ7 A;  2C1Y A;  2JAC A;  5IO0 A;  4F2I A;  3EIN A;  5HR2 A;  2C3T A;  3HYP A;  3KZQ A;  3DYR A;  3KH7 A;  4YAV A;  1VGL A;  4YQU A;  1FW1 A;  1OKD A;  2V6O A;  5H5S A;  3WGX A;  5DAL A;  3VWW A;  3N5O A;  4TR0 A;  1V57 A;  5KOW A;  2GT6 A;  3FW2 A;  2GSQ A;  4HJ2 A;  2VUP A;  4ECC A;  2H6Z A;  1A2L A;  1NSW A;  5CRH A;  4V1A g;  1JZO A;  16GS A;  3QMX A;  1YF1 A;  5F0G A;  5J9B A;  2HRK A;  4HU9 A;  1T4Y A;  3MNG A;  4V2N A;  2H1A A;  4XCS A;  2DJ0 A;  2WFC A;  2XBQ A;  2HSM A;  1TJD A;  1R5P A;  3Q74 A;  4IS0 A;  5JWO B;  3D4T A;  2H6X A;  1X9S B;  4MH2 A;  5ECM B;  3G9B A;  4MK3 A;  1TI1 A;  2V6K A;  2DKI A;  3UJ1 A;  3LWA A;  2EC4 A;  2AAW A;  2R0C A;  4HUA A;  2DIY A;  2IIY A;  2LRN A;  3Q19 A;  4POB A;  1DE1 A;  3CBU A;  4MZB A;  1YDK A;  3CMI A;  1OE7 A;  2MMZ A;  2IN3 A;  2N5A A;  5A4U A;  4PQ1 A;  3MIX A;  2GS3 A;  3GL3 A;  4ECB A;  3BBY A;  4MF7 A;  2HI7 A;  1XW6 A;  1VF1 A;  1ZYQ B;  3UBK A;  2HT9 A;  3F3R A;  4QL9 A;  4H86 A;  4N0Z A;  1E2Y A;  4MZC A;  4KW6 A;  2VD1 A;  2WUL A;  5HQP A;  3M1G A;  14GS A;  5G1L A;  1H4O A;  5ENU A;  1Z5Y E;  4A5P A;  3G7J A;  2A4V A;  1GP1 A;  3H8Q A;  2OA7 A;  5B6N A;  4G2E A;  5HFI A;  3VWX A;  4DSR A;  3GA4 A;  3FZA A;  2K9F A;  2OAD A;  4IQA A;  3KGK A;  1PN0 A;  3FR9 A;  3A5I A;  2GSR A;  2YPM A;  3GH9 A;  1FOH A;  2PBJ A;  4J56 E;  3VUR A;  2K6V A;  1ACV A;  2EIO A;  3EU4 A;  2VCV A;  1M9B A;  3F6D A;  2P5Q A;  2P5R A;  4JRR A;  19GS A;  2C4J A;  2VL3 A;  3TRQ A;  1ZYE A;  3VK9 A;  1B4Q A;  3TKP A;  4O5Q A;  1QMV A;  3A3T A;  7GSS A;  1X0R A;  6GSS A;  3TJG A;  1EGR A;  3VFI A;  5ELG A;  2HFD A;  2CAQ A;  1NW2 A;  3F6F A;  4FO5 A;  1OC8 A;  5D9V A;  3QR6 A;  1XW9 A;  5IMZ A;  3Q18 A;  4WR5 A;  2H1B A;  1XOA A;  2ZNM A;  1B4P A;  22GS A;  3UAR A;  3IOS A;  2R5G A;  3LOR A;  2O85 A;  5ABR A;  1GSE A;  1GSS A;  5ECH B;  5ELA A;  1OYJ A;  5DVB A;  1K0A A;  4L8E A;  3WYW A;  3IHG A;  4J57 E;  2FWG A;  2WCI A;  3MDK A;  2EIR A;  3V1W A;  1T8E B;  6GSW A;  2XPE A;  1A8L A;  2YWI A;  3G7Y A;  5IMC A;  3LXZ A;  1Z7P A;  1WP0 A;  4HOJ A;  2R37 A;  3D21 A;  1FHE A;  2DKH A;  3LYP A;  1R5A A;  5LCZ A;  1BYE A;  8GSS A;  4K5S A;  1V58 A;  3ZIT A;  1GRX A;  4KND A;  1FG4 A;  1V98 A;  1SKW B;  3PH9 A;  4YKG A;  1BAY A;  2I81 A;  5ECP B;  4YH2 A;  3IC4 A;  4QL7 A;  1BX9 A;  3BJ5 A;  3KP9 A;  1Z6N A;  3HJO A;  5DCH A;  1V9W A;  4K1F A;  4IQ1 A;  2PUK C;  2LRC A;  5IMD A;  1JZD A;  1PN9 A;  2LQQ A;  2GGT A;  4K8M A;  3VI7 A;  4GF0 A;  5G1K A;  1Z6M A;  4L5L A;  4IEL A;  5A5K A;  1N2A A;  4ULX A;  3PPU A;  2B5E A;  4EVM A;  5F8B A;  1TK5 B;  4WXT A;  4X0X A;  1BED A;  2Z9S A;  1AXD A;  3LEF A;  4MMM A;  4AF2 A;  2XHF A;  2FLS A;  4IJI A;  1M2B A;  1JZW A;  2E7P A;  2LQO A;  5LD0 A;  1DSB A;  4HJM A;  4KA0 A;  3P90 A;  1Y6E A;  4GLT A;  1M2A A;  3FK8 A;  1XIY A;  2L6D A;  4ML1 A;  3D0Z A;  1OAZ A;  2QKE A;  2WZ9 A;  5INY A;  5ECS A;  1TRV A;  2FA8 A;  5J3R A;  1WE0 A;  3ME7 A;  3OR5 A;  1PL2 A;  2DJJ A;  1J08 A;  1A2M A;  3US3 A;  3TKS A;  1PGT A;  2YP6 A;  5DDL A;  2LV3 A;  4ZIJ A;  3A2X A;  1OVN A;  4MCU A;  1SKR B;  4IJ3 A;  2REM A;  4ZL9 A;  3EE2 A;  3MYD A;  4FH8 A;  4LL1 B;  3QCP A;  1X5C A;  1GSY A;  2IFQ A;  4ECJ A;  2JAD A;  3APS A;  4BL7 A;  1JLV A;  5EVO A;  1K0C A;  4MJC A;  3HHV A;  2BJX A;  2VCX A;  4L5O A;  4TR1 A;  2HZE A;  4EC0 A;  1HQO A;  2YV9 A;  3DGQ A;  2VIM A;  3ZL5 A;  4K7N A;  2VM2 A;  3DVX A;  2MMO A;  3TOU A;  4OO5 A;  3MWH A;  3I69 A;  1SEN A;  1FVJ A;  1TTZ A;  3ZYW A;  5KOX A;  1SYX A;  1GUM A;  4YAP A;  2LS5 A;  4ZB9 A;  1YJ6 A;  2FWF A;  1URM A;  2A2P A;  2LJK A;  2F3M A;  4D73 B;  4IKH A;  2QC7 A;  2DIZ A;  4NV5 A;  2HYX A;  4XS6 A;  5HFG A;  3GN3 A;  1MTC A;  2P0G A;  4NHZ A;  5CYY A;  2B1L A;  3JCM L;  2H8L A;  3GRX A;  3IA1 A;  3ZLP A;  1B8X A;  3SBC A;  2H19 A;  3HCZ A;  4GST A;  1A24 A;  2E2G A;  4KCE A;  5H5Q A;  1T7P B;  1YY7 A;  1NHO A;  2JU5 A;  1OKT A;  5AIX A;  2YWO A;  4MLY A;  1LU4 A;  4RUV A;  3LJR A;  2ON7 A;  2PN8 A;  2H0G A;  1O85 A;  1A2J A;  4MNN A;  1GSU A;  4WBR D;  2DJ3 A;  2G2Q A;  4F03 A;  3ZZX A;  4G10 A;  5IIZ A;  2VLV A;  1O8X A;  2V32 A;  3C1S A;  3S9F A;  4Q5R A;  2A4H A;  5DAL B;  2PGT A;  1K3O A;  3I6A A;  3F8U A;  1TW9 A;  1AC1 A;  4EE0 A;  3K8N A;  2KLX A;  4GQC A;  4WET A;  4PQH A;  2NVL A;  2KHP A;  3EMX A;  1F6M C;  1GUK A;  1SKS B;  4K6X A;  2PU9 C;  5J4U A;  1O8W A;  4L0W A;  4CDO A;  2GDR A;  5HR1 A;  4CHS A;  13GS A;  4J2F A;  5D9W A;  1C72 A;  2H72 A;  1HD2 A;  2H0H A;  3F4R A;  1W4V A;  1S3C A;  3O76 A;  1W89 A;  2AV4 A;  3E3E A;  5KN1 A;  4ML6 A;  3W6G A;  1GNW A;  2C0F A;  4LA1 A;  5F07 A;  1FOV A;  4EL1 A;  2FWE A;  1DBY A;  4K2D A;  1UN2 A;  1FO5 A;  3HD5 A;  3DXB A;  4DSS A;  2VCQ A;  3UVT A;  3GUR A;  1F37 A;  3HY2 A;  5DCG A;  4BA7 A;  1K0M A;  2GST A;  4GRF A;  2QSI A;  3ERF A;  1KEB A;  5ECO B;  5ECI B;  2H30 A;  3HZ8 A;  4KB3 A;  5GAP D;  1O7U A;  1VF2 A;  2OE3 A;  5C00 A;  6GSY A;  1EEJ A;  3GSS A;  4F0C A;  4F0B A;  4HI7 A;  1R26 A;  4TN8 A;  1FVK A;  1EP7 A;  4GQF A;  3TKS C;  2LJA A;  2GZP A;  1A23 A;  4Z7X A;  1OC3 A;  2B7J A;  3ZMK A;  1F2E A;  3W8S A;  1T00 A;  2A2S A;  2H74 A;  4YKF A;  5CRG A;  2RLI A;  3A2V A;  4KDU A;  1U6T A;  2KOK A;  4X1U A;  1V40 A;  2LRT A;  3DD3 A;  1XVQ A;  1EOG A;  1XZO A;  2I4A A;  3FKF A;  1OC9 A;  5KN2 A;  2C0E A;  1ILO A;  4XIH A;  1GSQ A;  3GNJ A;  3TOT A;  3BCI A;  4N10 A;  1YKA A;  4JBB A;  5D9X A;  2NDO A;  1EP8 A;  1AQX A;  2R4V A;  3DRN A;  2P31 A;  3DWV A;  4K0N A;  5IPG A;  5KN0 A;  4NAX A;  3H1N A;  5B7C A;  2DJK A;  1ERW A;  2NTO A;  1AQV A;  3EYT A;  4EDZ A;  3M9J A;  3HJM A;  2YNX A;  3GH6 A;  1O73 A;  4RQX A;  1ZGN A;  2H76 A;  1XWG A;  3HJP A;  3GKK A;  2M72 A;  1T4Z A;  1KBN A;  3M0F A;  3GYK A;  5G5F A;  5B8A A;  5HFK A;  1JZR A;  5ECL B;  4NHW A;  4HZ4 A;  3WT2 A;  1OE8 A;  5ECK B;  1WRY A;  5IOW A;  2E2M A;  4JR6 A;  4QQ7 A;  3IK9 A;  1Z3E A;  1IYI A;  3ERG A;  1F3A A;  3DIE A;  3GX0 A;  1K0D A;  1ABA A;  4KSO A;  1YQ1 A;  2OBI A;  4PNG A;  2YV7 A;  4KF9 A;  1XFL A;  3ZRE A;  3CXG A;  4MJB A;  2B5Y A;  1SYR A;  2V1M A;  4GXZ A;  4NMU A;  2MBS A;  4EIP A;  4AJ8 A;  2R2J A;  2FCH A;  1HYU A;  3PIN A;  2N5B A;  2CV4 A;  4BVY B;  1THX A;  4WF5 A;  4GSS A;  1GTB A;  2H0I A;  1DUG A;  4PQI A;  4KGI A;  4ICY A;  2WRT A;  3L78 A;  5GSS A;  1PKW A;  1MD3 A;  1TI3 A;  1YEP A;  1PKZ A;  1VRS D;  4G9H A;  4HS1 A;  4XS1 A;  5G30 A;  4IN0 A;  1PX6 A;  4K5R A;  2DJ1 A;  3UOM A;  3FEU A;  4AGS A;  4TXO A;  4RQR A;  4TVE A;  6GSX A;  4MP4 A;  4BWQ A;  3BD2 A;  2L5O A;  2LNS A;  3GX8 A;  1FAA A;  4ID0 A;  3PGT A;  1M99 A;  4I97 A;  4DEJ A;  2YZU A;  4OFM A;  3J7Y k;  1M9A A;  2R6K A;  2FUG 2;  5DJL A;  4XS4 B;  1PSQ A;  1H75 A;  3HZ4 A;  3GUS A;  1TRU A;  5IMV A;  1LBK A;  3TJF A;  5B8B A;  2HXK A;  4FYB A;  2H1G A;  2DC5 A;  4HQZ A;  1ST9 A;  1S3A A;  2L57 A;  5DBQ A;  4KUN A;  3KTB A;  4Q5N A;  2CA8 A;  2A2R A;  4F9Z A;  1MEK A;  4BVY A;  2H71 A;  4ACS A;  3FR6 A;  2PVO C;  3RBT A;  1UA5 A;  4PUF C;  5BMU A;  1XWB A;  5JWQ B;  3KXO A;  3ISO A;  1B48 A;  3L0H A;  4EXJ A;  1M2D A;  2KUC A;  4V2M A;  3H4K A;  1ZYP A;  2IMK A;  4DVC A;  2JSY A;  3D6I A;  11GS A;  2OBK A;  3IBH A;  2WGR A;  1NM3 A;  4O5U A;  1MDK A;  1HNB A;  2GQL A;  2H70 A;  2X8G A;  3DKS A;  2L4C A;  2OE1 A;  5AGY A;  1XWK A;  1GUL A;  5D73 A;  1SJZ A;  3EC3 A;  4IW9 A;  1PX7 A;  4XS4 A;  3NZN A;  4KH7 A;  1EGO A;  2IFQ B;  2F9S A;  3IE3 A;  4BL7 B;  3ZIJ A;  1ZCP A;  2VCT A;  1XWC A;  4GCI A;  1G7O A;  4MAB A;  3VPQ A;  1XCC A;  3TB2 A;  3QOU A;  4NV2 A;  1RW1 A;  4V1A p;  2YWN A;  4POK A;  1U3A A;  4TR1 B;  1K0N A;  2HZE B;  5D96 A;  1XVW A;  2AJQ B;  5G5E A;  3BCK A;  4RI6 A;  3IC8 A;  4BPY A;  1SL1 B;  4ZL8 A;  2AB6 A;  3CRT A;  4CW9 A;  4IBP A;  3I9V 2;  3GKX A;  5BRT A;  4PUA A;  2VL2 A;  3HA9 A;  4NPB A;  3FMW A;  5IOX A;  1M7T A;  3RAZ A;  3C1R A;  2FA4 A;  4I2U A;  1VF3 A;  1X5E A;  2HSY A;  3IRA A;  3TKS E;  2GT5 A;  3IDV A;  1PRX A;  3QAV A;  5JCU A;  4CY8 A;  4K9Z A;  4IP6 A;  1GLQ A;  3HVV A;  4ILF A;  5COH A;  2X8H A;  1WOU A;  5CO3 A;  5JCG A;  3UEM A;  3CSI A;  4G0I A;  5EPF A;  4V2L A;  3TCO A;  2BTO T;  2X4A A;  1B9Y C;  1XWA A;  2K8V A;  3VPT A;  4KCA A;  2C0G A;  1A0F A;  4Q5F A;  1USB A;  5FHI A;  5G31 A;  2GVP A;  6GST A;  2HRF A;  1SK2 A;  2OJL A;  3TJK A;  12GS A;  3ZVJ D;  5ECN B;  4MPF A;  4GSN A;  6GSU A;  2IJY A;  4FQU A;  4MDC A;  1M0U A;  1X5D A;  2OKA A;  3G7I A;  3ZFL A;  2DML A;  3GHA A;  3VLN A;  3QDN A;  4JR4 A;  1JHB A;  1YF0 A;  5KN3 A;  4RI7 A;  2H73 A;  2TRX A;  1I9D A;  4JE1 A;  4O5R A;  3KMN A;  3ZML A;  4E8H A;  4O7H A;  3U6V A;  3M9K A;  1XPV A;  2PWJ A;  1KTE A;  2OE0 A;  2L59 A;  2OAC A;  5IMF A;  1I5G A;  1ZOF A;  2RII A;  2DLX A;  2CZ3 A;  2GQM A;  3FYG A;  1ZZY A;  1BQ7 A;  2YCD A;  4DSS B;  2JZS A;  3RPP A;  3RHB A;  4TR3 A;  3M3M A;  4YQV A;  2TRC P;  3ME8 A;  2HSH A;  2FNO A;  3IXR A;  2JZR A;  1EV9 A;  3TUE A;  5L71 A;  3KJY A;  4O32 A;  2O8V B;  2PMT A;  1R4W A;  5GAN D;  3NIV A;  1K3Y A;  5CAX A;  2CX3 A;  3GV1 A;  1GH2 A;  3UIW A;  1V2A A;  1QXH A;  3EWL A;  4ZB8 A;  2B6M A;  3KP8 A;  5HR3 A;  2YJH A;  1PA3 A;  1U88 A;  4E8E A;  1ZYN A;  2IWT A;  1MDJ A;  1Z7R A;  1B9X C;  2F8F A;  1RK4 A;  4HEA 2;  2LJR A;  1QQ2 A;  3F4S A;  2DBC A;  3EMP A;  3IK7 A;  3UVH A;  4XRD A;  3N9J A;  2HE3 A;  2B7K A;  3GFK A;  2I9H A;  2IPA A;  3TKR A;  4MZW A;  1DE2 A;  4ZXG A;  4ZIL A;  2L4Q A;  2MBT A;  3E0U A;  4IP1 A;  3A5W A;  1G6W A;  4MA9 A;  1TU7 A;  3CRU A;  4GTU A;  4K0G A;  1A0R P;  2VCW A;  5EL8 A;  2H6Y A;  1OC9 B;  5FT3 A;  5FWG A;  3LW9 A;  3CTF A;  3QFA C;  4O92 A;  4GWR A;  2VL9 A;  5DJM A;  4IGJ A;  3EU3 A;  5CRE A;  4PUR A;  4EUY A;  4PGT A;  5H5R A;  4KAE A;  20GS A;  1TKD B;  1TK8 B;  4OD7 A;  1O81 A;  3TDG A;  4KE3 A;  1GTU A;  2XPD A;  1K0O A;  2B3S A;  6GSV A;  1SJI A;  2HZF A;  1J9B A;  2O89 A;  2NPB A;  2XC2 A;  1AW9 A;  5ECR B;  3CSH A;  2EIQ A;  1G7E A;  1IYH A;  1PD2 1;  4PNF A;  4BVX B;  2R3X A;  4BWS A;  1T1V A;  3MAK A;  2B1K A;  1WPI A;  2I1U A;  1XOB A;  2XBI A;  3RDW A;  2D2Z A;  3ERW A;  4N11 A;  1EWX A;  1X9W B;  4G0L A;  5CP1 A;  1HNC A;  3J7Y b;  2L5L A;  3C73 A;  2ES7 A;  1ZMA A;  4XTS A;  5G2Z A;  3EVI A;  9GSS A;  4DSQ A;  1GTA A;  3P8W A;  2X8C A;  4LL4 B;  1ERV A;  4PTS A;  4ZL7 A;  2I3Y A;  2N5F A;  3EPT A;  5IO2 A;  5DAK B;  2LNT A;  2LTK A;  3SWL A;  3GST A;  5A4W A;  1PMT A;  3VWV A;  2RM5 A;  5E4W A;  4POM A;  4HQS A;  4OMV A;  3HVS A;  2M46 A;  4WKW A;  2CVK A;  4F82 A;  1PQN A;  3DML A;  4WEY A;  4CY6 A;  5J41 A;  3HKR A;  4JU5 A;  1E6B A;  3R2Q A;  2CT6 A;  3VWU A;  2IMD A;  2VM1 A;  2H66 A;  4YQM A;  1AUC A;  4TRX A;  2YAN A;  1UC7 A;  1THO A;  3ZVJ A;  3WT1 A;  4OO4 A;  1AIU A;  3WGE A;  2LEG A;  1N8J A;  1U3I A;  1T3B A;  4TXO B;  4BVX A;  3FR3 A;  4JZQ A;  3LYK A;  18GS A;  1EEM A;  1Z9H A;  1QK8 A;  3ZFB A;  4I8B A;  2F51 A;  2O7K A;  4WR4 A;  5JCW A;  5EY6 A;  3EUR A;  10GS A;  2YN1 A;  2VO4 A;  1R7H A;  3KCM A;  3ZTL A;  4ZB6 A;  2ALB A;  1QFN A;  2NBS A;  1XBS A;  1UVZ A;  4IHU A;  3LQ7 A;  5DAK A;  1GNE A;  1S3D A;  1K0B A;  3D4M A;  3BOA A;  2JL4 A;  1XW5 A;  2V2G A;  4KDY A;  1QGV A;  1ERT A;  2FWH A;  4IVF A;  4Z2U A;  1K3L A;  2JSZ A;  3C7M A;  5B6M A;  3GKM A;  3UL3 A;  3R3E A;  2QGV A;  3TJJ A;  4MF5 A;  1G6Y A;  2WJU A;  1FB6 A;  4FYC A;  5IQY A;  3F9U A;  4ZBD A;  5IMA A;  1SD9 A;  1WIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...