1O85A

Radiation-reduced tryparedoxin-i
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
b'GLDKYLPGIEKLRRGDGEVEVKSLAGKLVFFYFSASWCPPCRGFTPQLIEFYDKFHESKNFEVVFCTWDEEEDGFAGYFAKMPWLAVPFAQSEAVQKLSKHFNVESIPTLIGVDADSGDVVTTRARATLVKDPEGEQFPWKDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPAREDOXIN
publication title Tryparedoxins from Crithidia Fasciculata and Trypanosoma Brucei: Photoreduction of the Redox Disulfide Using Synchrotron Radiation and Evidence for a Conformational Switch Implicated in Function
pubmed doi rcsb
source organism Crithidia fasciculata
molecule tags Electron transport
total genus 43
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1o85A00
1R5PA 5C04A 1PKZA 3QAVA 1JZWA 3A2XA 4BWSA 3ZTLA 2F8AA 1ZOFA 1O81A 4ML6A 4V1Ap 3WT2A 2IIYA 1TW9A 2L57A 3F4RA 4OFMA 3WYWA 2WB9A 3GN3A 2IN3A 5LCZA 1TP9A 3TKSA 1F3BA 3VI5A 4RQRA 3H1NA 4JR4A 5COHA 2KP1A 5HR2A 6GSYA 1DE1A 4ZXGA 4MZCA 2H0IA 1XW6A 3KMNA 1TI3A 5LNKe 4MMMA 4YAPA 2H19A 3UAPA 1I9DA 2B6MA 2R4VA 2O7KA 4NMUA 1JZDA 1XPVA 4GF0A 5D9XA 2G2QA 4X43A 3D22A 2IJYA 1MD3A 1GSUA 3LXTA 5DAKA 1M2AA 3TKSC 5INYA 5IQYA 4XRAA 20GSA 2HRNA 3KM6A 2IFQA 2QC7A 4TN8A 2LRTA 4GQCA 13GSA 5IMCA 2OBKA 3FK8A 2X8HA 4IGJA 3ZITA 5DCHA 1TK8B 1X5DA 5H5QA 2E2MA 1ZYQB 5IMFA 4ECIA 5G2ZA 4KB3A 4ML1A 3TOUA 4ZBAA 4MF7A 3GH9A 1SK2A 2LEGA 5CAXA 3C71A 1ZZYA 3MNGA 3C1SA 3FZ5A 2HZEA 2MBTA 4Q5NA 2C0DA 5D93A 3ZL5A 2B7JA 4TR4A 3TKPA 3UEMA 1T1VA 1FVJA 2X8CA 3TOTA 5HR1A 1N8JA 3HCZA 2H0GA 2VCXA 1AQVA 3GRXA 2PERA 2VD0A 1WJKA 2VL3A 2IMFA 1VF2A 4RQXA 2XC2A 3DVWA 4ZL8A 1M7TA 1ZMAA 3KGKA 2CX4A 3DVXA 4MPGA 2YV9A 5HFKA 2H1DA 3LEFA 2NBSA 2OACA 2VL9A 2I4AA 4L0UA 4LA1A 1K3YA 4Q5RA 1GP1A 1G7EA 17GSA 1RQMA 4IQAA 2NTOA 3I9V2 1HYUA 2BJXA 5FT3A 1ML6A 3UIWA 4OO4A 4OFNA 3R2QA 1GL8A 2LNSA 3ISOA 6GSUA 5JWRB 3ZIJA 2NPBA 4TR0A 1USBA 4MABA 4CW9A 3VWUA 1YZXA 18GSA 1GTUA 5AIVA 5JCGA 1YEPA 1YQ1A 1JLVA 5D9VA 2H71A 4GTUA 4K0GA 4IS0A 4J2FA 4LMVA 4ZBBA 5KEJA 4BPYA 2H30A 3DWVA 5ID2B 4POBA 2H73A 1PGTA 4PURA 3ZRDA 3VPQA 4TXOA 3NIVA 2GLRA 2YWMA 3IAS2 1JLWA 3HYPA 3LFLA 3W8JA 5GZZB 2GQKA 2TIRA 3O3TA 5ECRB 1F9MA 2GSSA 4X0XA 4DSQA 1K0CA 4WXTA 4XS4B 2P31A 5IO0A 2L5LA 3GL5A 4K1FA 4HQSA 5GSTA 3HKRA 3HHVA 4ZB9A 3K8NA 1PA3A 4OCEA 2J9HA 1URMA 4JR6A 2VCQA 1GRXA 5FHIA 3WD6A 2C3QA 1SL2B 3RHCA 2H1GA 3LXZA 1GLPA 5DBQA 4KCAA 4MJBA 1A23A 1AQWA 2VLUA 3Q18A 5IMZA 1R5AA 4YH2A 3UL3A 1HNCA 2WGRA 1X9SB 1YKCA 3C1RA 4LL4B 3TJFA 3A2VA 2KOKA 2H6YA 2WS2A 4FH8A 5CRWA 5ENUA 2HYXA 4KW6A 1GSYA 3ZMLA 2ALBA 4TR1A 4F0BA 4RUVA 2J23A 5ECIB 4QL7A 4DSSB 5IPGA 3G7IA 1ERUA 3VI7A 2V1MA 4HU7A 1VF4A 2OJLA 4KSMA 2QSIA 5G1KA 4ZILA 1X5CA 3EVIA 1FHEA 3M0FA 3Q6OA 3KCMA 1YJ6A 5H5RA 2YP6A 3FZ9A 2XBIA 1XW5A 3HD5A 1OVNA 4KX4A 5G5FA 4MH3A 2IWTA 2YPMA 1NW2A 2AUVA 1K0MA 1QQ2A 2AV4A 4IW9A 3BCKA 2H72A 4GLTA 4PQIA 1Z6NA 4H86A 2JZTA 1PX6A 1PRXA 5G30A 5F0GA 5EL8A 2DJ3A 3F0IA 3W6GA 5KN1A 2V6OA 4EXJA 2WDUA 3L9UA 2YWOA 4HU9A 5CRHA 2K6VA 4HOJA 2H01A 4K0NA 2XBQA 3IE3A 1Z7PA 4ILFA 1J9BA 2HSHA 1GULA 3IPZA 4IELA 4HZ4A 4KNDA 3E3EA 1I5GA 5KN0A 1WRYA 3RHBA 4FIWA 2R37A 5EVOA 2YWIA 3G7JA 1XFLA 1HQOA 3GKNA 1XBSA 2LSTA 2EC4A 3TGZA 4CDOA 3LJRA 5GSSA 4BA7A 1PL2A 1PN9A 3TDGA 3DRNA 1TOFA 1THOA 2ZUPA 1PMTA 1K0AA 1G6YA 19GSA 2V41A 4HZ2A 1GUHA 1U3IA 4ECBA 1ZYEA 1PX7A 2C80A 4MZWA 5DALA 1Y6EA 2IMEA 2NVLA 1OC9B 1EOHA 2A4VA 1F2EA 4ZIJA 5F07A 4NHWA 4PNFA 3FHKA 3RDWA 1O85A 1A2LA 2DJJA 4TXVA 2DJKA 2FGXA 4Z7XA 1M2DA 1XWBA 2LRCA 4WETA 5ABRA 3GA4A 1FAAA 3N9JA 3TRQA 5J5NA 2YOIA 1GTAA 3GX8A 3APQA 3WT1A 1K0BA 1MDJA 3VURA 4I2TA 4D73B 1JHBA 2O8VB 14GSA 4FYBA 4WR5A 4IQ1A 2H66A 3ERWA 4KCEA 4MF6A 3LQ7A 1MDIA 1EV4A 5IIZA 1V40A 2FLSA 4QL9A 3EU3A 3GYKA 5FWGA 1Q4JA 4V2NA 4AGSA 5G1LA 3ZYWA 2GVPA 1ERTA 1ERWA 4AF2A 4PXOA 2GDRA 1XWAA 4G9HA 4NHZA 5G5EA 1SJIA 3A3TA 2C8UA 3IBHA 1XW9A 1M2BA 5F8BA 3UJ1A 1S3DA 1U88A 2HT9A 3F63A 2GQMA 3GMFA 4ZL9A 1UVZA 2JSYA 3L9VA 4NXIA 3NOFA 2B1KA 1VGLA 1M9AA 4K2DA 1ACVA 2MBSA 1S3AA 3BOAA 3NZNA 1Z9HA 4GQFA 3UOMA 3APOA 1PQNA 3GTUB 3F6FA 2VCZA 3F4SA 3WGXA 2MZCA 2VL2C 1NHYA 4POKA 3KTBA 1V2AA 3ME8A 4TR3A 2CV4A 3UVHA 2VOCA 4L8EA 1VF1A 3CSJA 1VRSD 2VCWA 4JZQA 4JBBA 3QR6A 4PUAA 4ISDA 1M0UA 1R26A 5GAND 3KXOA 3QMXA 5D9WA 2OE0A 2DBCA 4KDXA 3KP9A 2HE3A 4GWRA 3KD0A 1T00A 4MF5A 1B9XC 1SK0A 2PGTA 2ZCTA 3GURA 2N5FA 2C3NA 1SYXA 4DVCA 1SD9A 2C0GA 3GV1A 3FR3A 1BJXA 2CX3A 2CVBA 4WBJA 3HJOA 5E4WA 3FY7A 5HFGA 1K0OA 1E2YA 3KEBA 2IMKA 3H93A 1WPIA 5J9CA 4L0WA 5DQYA 4KAEA 3FR9A 4NV2A 2YN1A 1GTBA 1ON4A 4PGTA 4KDYA 4IP6A 3IAM2 2V32A 3EE2A 4K6XA 2R6KA 2Z9SA 4ZB8A 2NDOA 1EV9A 2FWGA 3LGCA 4EVMA 2DJ2A 2B3SA 3H79A 3GHAA 3TJBA 3APSA 1OYJA 2M80A 2F3MA 2GTUA 2QGVA 4OD7A 5F06A 5IOWA 3C8EA 1GNEA 5ECKB 3RPNA 4XTSA 3TKQA 1WWJA 2HZEB 3DIEA 2L59A 1M9BA 2GZPA 1UN2A 3PINA 2RM6A 2HFDA 1DE2A 1JZRA 1FO5A 1WE0A 1YF1A 5B6NA 2EIQA 5CYYA 2PUKC 3J7Yb 2LS5A 4GRFA 4HUAA 4XS1A 2AJQB 1K0NA 5ELAA 2VAFA 1KEBA 1X5EA 2YZUA 1Z5YE 4IBPA 1GNWA 1M99A 4AJ6A 5HR0A 4CHSA 2RLIA 2MYGA 5IMDA 2HRFA 4I8BA 1EGOA 1PSQA 2LJKA 1SL0B 1K3OA 2P0GA 4ZBDA 3VWVA 2HI7A 2A2SA 3D4TA 4EDYA 2RUEA 1G0TA 5ID2A 3HVVA 4MZBA 2L4CA 5ECOB 1XWKA 2CAQA 1CQHA 4AJ7A 3TKSE 1GLQA 1AXDA 5A4VA 2VCVA 2QKEA 3HA9A 3LORA 4O5RA 4WF5A 3Q19A 2F9SA 4HEA2 5CO3A 4OFTA 4XS4A 3A5WA 4MLYA 3VPTA 4OMVA 3EINA 4E8HA 5ECLB 4MK3A 4NPBA 4N11A 4ZB6A 1SK1A 4OWYA 4TVEA 2FWHA 5AGYA 1FVKA 1PD21 3G7YA 4WF4A 1TRWA 1RW1A 3IHQA 1ZL9A 4PUFC 4I97A 3CYNA 1GUMA 2KHPA 3VK9A 8GSSA 1WOUA 3VLNA 2AYTA 1QUWA 5B7CA 1W89A 2VLVA 3IK7A 4LMWA 1C72A 2HZFA 5H5SA 3M3MA 3ED3A 2EIRA 1GSFA 1UC7A 2RIIA 5JWQB 1EEJA 3F3RA 3RBTA 5ECPB 4O32A 1YEXA 2YWNA 2PU9C 4KA0A 3KH7A 2DSAA 4IJIA 4OO5A 3D0ZA 4HDEA 5CNWA 1WP0A 2PN8A 1V57A 3UMAA 3AY8A 1GSEA 11GSA 4ECCA 1A8LA 2JL4A 2TRCP 1F3AA 1U87A 5G31A 3WGDA 4IJ3A 1SENA 5CRDA 4ZL7A 1EGRA 1EEMA 4NAXA 3BJ5A 4POMA 2FA4A 3TCOA 4HQZA 5E59A 3UBKA 2XPDA 2OKAA 3FEUA 4XHMA 3UBLA 1TU7A 5HR3A 3EWLA 3DMLA 1THXA 3H8QA 1HNBA 2RM5A 3FRCA 4MDCA 1BG5A 1QXHA 3ERGA 5EY6A 4FYUA 2VLTA 5J4UA 1Q98A 2JU5A 2LV3A 9GSSA 2VM1A 2OE3A 4KE3A 3SBCA 1XZOA 2BTOT 5DVBA 2X8GA 1Z3EA 4KDUA 16GSA 4TRXA 4HJ2A 1XWGA 1A0FA 1N2AA 4IP1A 6GSXA 4IKHA 5LD0A 4F03A 3IR4A 3KJYA 3GX0A 1OC9A 2HLSA 4EC0A 4G2EA 1A8YA 3VWWA 1H4OA 2O85A 3HVXA 2OADA 2R3XA 2E7PA 4G19A 3ME7A 1TRVA 1DUGA 2H8LA 3DKSA 2A2RA 3ZFBA 3CTFA 2MMZA 7GSSA 2CQ9A 2K8SA 3ZZXA 1B48A 1F37A 4F0CA 4ID0A 3TB2A 2LNTA 3IC4A 1TK5B 1GSDA 3CRUA 1XIYA 4IN0A 4D73A 2MMOA 2C0EA 2GGTA 1GUKA 3D6IA 2H0HA 3IK9A 2PMTA 2RUFA 3GIXA 4TKYA 1YF0A 1MEKA 2B5YA 2WRTA 1ST9A 1O8WA 2FWEA 4V2MA 2CA8A 2V6KA 1T8EB 2L6DA 3LWAA 1XXUA 5DQSA 2H1BA 2C0FA 5EPFA 1UA5A 4GSNA 3TJJA 1E6BA 1LBKA 1IYHA 2GT5A 2V2GA 2D2ZA 3KTLA 3EYTA 5ECQB 2KLXA 3D21A 6GSSA 1HNAA 1NSWA 3L78A 3GNJA 3DGQA 1BX9A 2PVOC 3FYGA 2L4QA 3HZ8A 3Q74A 4TW5A 3F3QA 2P5QA 1G7OA 2VCTA 4N0ZA 3GKMA 3KMOA 2H6ZA 1EWXA 5AN1A 2LJAA 2LKUA 4V1Ag 5DJMA 1Z7RA 4GCIA 4MH2A 4YAVA 4BVXA 3PGTA 5ECNB 1GSSA 4K7OA 3F8UA 2C4JA 5ECMB 3QD9A 2GZZA 4LL1B 4I5QA 3HXSA 5C00A 5IOXA 2CVKA 4ACSA 1LJRA 3HJPA 2FHEA 4L5LA 1YDKA 1YKAA 4KGIA 4RI6A 4GXZA 3PH9A 3HVSA 3QOUA 1PL1A 3QPMA 3S9FA 3M9KA 5HFIA 12GSA 2XPEA 4EL1A 3HDCA 1TRSA 3P8WA 1DBYA 1U6TA 3GL3A 2LJRA 1FB6A 5JWOB 5KN3A 5IMVA 1XOBA 3A2WA 1ERVA 1QMVA 4AJ8A 1JZOA 3GKKA 4IVFA 3HZ4A 1RK4A 1NHOA 2H70A 1IYIA 2ZNMA 5A4WA 3IDVA 4O92A 5IMAA 1EOGA 3US3A 5B8AA 4BVYA 4PQHA 2WFCA 1QFNA 3LYPA 2CT6A 3GH6A 1AQXA 5DAKB 2PVQA 3M8NA 1XVWA 1QK8A 1OE7A 1XCCA 2CAIA 4ECJA 2IFQB 3RAZA 2EIOA 4E8EA 1O73A 3M1GA 3C73A 3QDNA 2B1LA 4F2IA 2FCHA 5HQPA 2DC5A 2FD3A 2I9HA 4ULXA 1GSQA 3TRXA 2DJ0A 5DCGA 3ZLPA 4Q5QA 4EDZA 3W8SA 2LQQA 5A4UA 4JU5A 4N0VA 2IL3A 4K8MA 1OKDA 4KUNA 3ZVJD 5J3RA 2I1UA 1B8XA 5AISA 4XCSA 3IV4A 3BBYA 4PQ1A 3EU4A 3I43A 1EP7A 1A2MA 2E2GA 2VO4A 5B8BA 3P2AA 4WEYA 4XIHA 2VM2A 1ILOA 4HS1A 1QGVA 3DXBA 3KIJA 2VD1A 1X9WB 5D73A 1TKDB 5D9TA 2I3YA 2JSZA 2IMDA 1ZCPA 2ON5A 2REMA 2DMMA 3CSHA 3FW2A 2FUG2 3CXGA 2KP2A 3C7MA 3L4NA 3J7Yk 2H6XA 4GSSA 2K18A 2B5EA 4J57E 1R4WA 4NWYA 1XVQA 1A0RP 2YJHA 1TU8A 3EC3A 2M46A 1AIUA 3FZ4A 4IHUA 3FKFA 2C3TA 2O87A 1OAZA 2AAWA 3LSZA 22GSA 4MPFA 1B9YC 3U5RE 3IOSA 4PNGA 1W4VA 1FOVA 3KP8A 2VUPA 2PPTA 3KZQA 4JEDA 1LU4A 1OC3A 2R2JA 1YY7A 3QFAC 1T3BA 5J9BA 1SKWB 1J08A 2H76A 5B6MA 3F4TA 5JCWA 2H75A 2MMAA 1SKSB 1AW9A 6GSVA 1TXXA 2LQOA 4TXOB 2E0QA 3MSZA 5L71A 3IRAA 1Z6MA 4L5OA 1KBNA 3GKXA 2H1AA 4PX1A 2GZYA 3VFIA 1G6WA 5KN2A 2YZHA 1FB0A 2KUCA 4HJMA 1MTCA 4EO3A 1TI1A 2GQLA 4XS6A 2CVDA 3QAWA 1BAYA 3GUSA 2YCDA 4N10A 2FWFA 1TRUA 3L9SA 3MAKA 5J41A 2HSYA 4POLA 3EMPA 4YQUA 2R5GA 2M72A 1T7PB 1EP8A 3CBUA 3N5OA 1V98A 1BYEA 2WULA 1WIKA 1T4YA 4DSSA 3FR6A 3LYKA 3WGEA 2OE1A 1SU9A 2YNXA 4JE1A 2X64A 1B4QA 1OC8A 3CRTA 2IMIA 3OR5A 1V9WA 3ZMKA 4K7IA 5ECHB 3FZAA 4J56E 1TK0B 5F05A 3UVTA 1O7UA 4WKWA 2DMLA 3RPPA 1SJ6A 5ECSA 4TR1B 2FA8A 1DSBA 2VIMA 1AAZA 1EZKA 1HD2A 1X9MB 5D96A 2LRNA 2AB6A 2GSRA 4FYCA 1B4PA 1KNGA 3F9UA 4DEJA 4TOPA 1ZGNA 4QQ7A 2L5OA 1J0FA 3IA1A 2N5BA 5GAPD 5CP1A 4KSOA 4MCUA 2K9FA 3GFKA 2GSTA 4MA9A 4F9ZA 4NV5A 2OA7A 2PBJA 1XOAA 4DSRA 3I6AA 3G9BA 2HNLA 3BD2A 3F6DA 4BL7A 4P3YB 5AIXA 1O6JA 3D5JA 4LLRA 3QCPA 1MDKA 2PWJA 2JADA 4FO5A 2JZSA 4K9ZA 2FY6A 3ZIVA 3TKRA 4EUYA 4MP4A 4O7HA 2K8VA 4BWQA 4MJCA 1T4ZA 3L0HA 1F6MC 3DEXA 1FW1A 4KH7A 3MDKA 2X99A 3QAGA 3UARA 3ZFLA 2GSQA 1OKTA 1SYRA 2LTKA 4V2LA 1Y25A 5CRGA 5CREA 4I2UA 1S3CA 1GTIA 3E9JB 2L6CA 3P7XA 1K3LA 2MMNA 2WCIA 3EMXA 3CTGA 4XRDA 3LG6A 2WJUA 3KH9A 2CZ2A 4F82A 1GWCA 1SD8A 2GS3A 3TJKA 5JCUA 3DD3A 6GSWA 1U3AA 5D8IA 2YANA 2ON7A 1BEDA 1A24A 3BCIA 2JACA 4EF0A 4YQMA 2XHFA 2IPAA 2DJ1A 3TRPA 2DIZA 2HXKA 1TDIA 3IXRA 2YV7A 5DDLA 3D4MA 1KTEA 5A5KA 5DALB 3HJMA 4OCFA 1ABAA 4WR4A 4K7NA 1SL1B 2B7KA 3ZVJA 2DIYA 3V1WA 1VF3A 1XWCA 2I81A 1AUCA 2JZRA 5IO2A 3CMIA 4RI7A 5IM9A 5IPHA 2FNOA 2WZ9A 3VWXA 1A2JA 4MJAA 4WBRD 3QFBC 5DJLA 4Q5FA 1V58A 2ES7A 3PR8A 3I69A 4X1UA 2YJ7A 4GSTA 3SWLA 1TTZA 2CZ3A 2LUSA 4EKZA 1X0RA 3O76A 3U6VA 2F8FA 2B5XA 4N30A 2OBIA 1CQGA 2O89A 3M9JA 1FG4A 2N5AA 3MWHA 2F51A 3CSIA 3H4KA 3P90A 2G0FA 1WMJA 3DYRA 1PKWA 2BMXA 5ELGA 1MD4A 6GSTA 2TRXA 2VL2A 1BQ7A 4MJEA 4HI7A 2AHEA 1JFUA 3ERFA 3O6TA 4G10A 1R7HA 3GTUA 1O8XA 2DLXA 3TJGA 3GSTA 1AC1A 1GH2A 3HY2A 10GSA 4I6XA 1H75A 4JRRA 1SJZA 2C1YA 3JCML 2GT6A 1TJDA 3ZREA 3TUEA 1NM3A 1K0DA 1SKRB 3GSSA 2P5RA 4EE0A 3E0UA 3EURA 4YQVA 1OE8A 2H74A
chains in the Genus database with same CATH superfamily
1R5PA 5C04A 1PKZA 3QAVA 1JZWA 3A2XA 4BWSA 3ZTLA 2F8AA 1ZOFA 1O81A 4ML6A 4V1Ap 3WT2A 2IIYA 1TW9A 2L57A 3F4RA 1M3IA 4OFMA 3WYWA 2WB9A 3GN3A 1PN0A 2IN3A 5LCZA 1TP9A 3TKSA 1F3BA 3VI5A 4RQRA 3H1NA 4JR4A 4X4JA 5COHA 2KP1A 5HR2A 6GSYA 1DE1A 4ZXGA 4MZCA 2H0IA 1XW6A 3KMNA 1TI3A 5LNKe 4MMMA 4YAPA 2H19A 3UAPA 1I9DA 2B6MA 2R4VA 2O7KA 4NMUA 1JZDA 1XPVA 4GF0A 5D9XA 2G2QA 4X43A 3D22A 2IJYA 1MD3A 1GSUA 3LXTA 5DAKA 1M2AA 3TKSC 5INYA 5IQYA 4XRAA 20GSA 2HRNA 3KM6A 2IFQA 2QC7A 4TN8A 2LRTA 4GQCA 13GSA 5IMCA 2OBKA 3FK8A 2X8HA 4IGJA 3ZITA 5DCHA 1TK8B 1X5DA 5H5QA 2E2MA 1ZYQB 5IMFA 4ECIA 5G2ZA 2HSMA 4KB3A 4A5PA 4ML1A 3TOUA 4ZBAA 4MF7A 3GH9A 1SK2A 2LEGA 5CAXA 3C71A 1ZZYA 3MNGA 3C1SA 3FZ5A 2HZEA 2MBTA 4Q5NA 2C0DA 5D93A 3ZL5A 2HRAA 2B7JA 4TR4A 3TKPA 3UEMA 1T1VA 1FVJA 2X8CA 3TOTA 5HR1A 1N8JA 3HCZA 2H0GA 2VCXA 1AQVA 3GRXA 2PERA 2VD0A 1WJKA 2VL3A 2IMFA 1VF2A 4RQXA 2XC2A 3DVWA 4ZL8A 1M7TA 1ZMAA 3KGKA 2CX4A 3DVXA 4MPGA 2YV9A 4YKFA 5HFKA 2H1DA 3LEFA 2NBSA 2OACA 2VL9A 2I4AA 3MYDA 4L0UA 4LA1A 1K3YA 3PPUA 1GP1A 4Q5RA 1G7EA 17GSA 1RQMA 4IQAA 2NTOA 3I9V2 1HYUA 2BJXA 5FT3A 1ML6A 3UIWA 4OO4A 4OFNA 3R2QA 1GL8A 2LNSA 3ISOA 6GSUA 5JWRB 3ZIJA 2NPBA 4TR0A 1USBA 4MABA 4CW9A 3VWUA 1YZXA 18GSA 1GTUA 5AIVA 5JCGA 1YEPA 1YQ1A 1JLVA 5D9VA 1FOHA 2H71A 4GTUA 4K0GA 4IS0A 4J2FA 4LMVA 4ZBBA 5KEJA 4BPYA 2H30A 3DWVA 5ID2B 4POBA 2H73A 1PGTA 4PURA 3ZRDA 3VPQA 4TXOA 3NIVA 2GLRA 2YWMA 3IAS2 1JLWA 3HYPA 3LFLA 3W8JA 5GZZB 2GQKA 2TIRA 3O3TA 5ECRB 1F9MA 2GSSA 4X0XA 4DSQA 1K0CA 4WXTA 4XS4B 2P31A 5IO0A 2L5LA 3GL5A 4K1FA 4HQSA 5GSTA 3HKRA 3HHVA 4ZB9A 3K8NA 1PA3A 4OCEA 2J9HA 1URMA 4JR6A 2VCQA 1GRXA 5FHIA 3WD6A 2C3QA 1SL2B 3RHCA 2H1GA 3LXZA 1GLPA 5DBQA 4KCAA 4MJBA 1A23A 1AQWA 2VLUA 3Q18A 5IMZA 1R5AA 4YH2A 3UL3A 1HNCA 2WGRA 1X9SB 1YKCA 3C1RA 4YKGA 4LL4B 3TJFA 3A2VA 2KOKA 2H6YA 2WS2A 4FH8A 5CRWA 5ENUA 2HYXA 4KW6A 1GSYA 3ZMLA 2ALBA 4TR1A 4F0BA 4RUVA 2J23A 5ECIB 4QL7A 4DSSB 5IPGA 3G7IA 1ERUA 3VI7A 2V1MA 4HU7A 1VF4A 2OJLA 4KSMA 2QSIA 5G1KA 4ZILA 1X5CA 3EVIA 1FHEA 3M0FA 3Q6OA 3KCMA 1YJ6A 5H5RA 2YP6A 3FZ9A 2XBIA 1XW5A 3HD5A 1OVNA 4KX4A 5G5FA 4MH3A 2IWTA 2YPMA 1NW2A 2AUVA 1K0MA 1QQ2A 2AV4A 4IW9A 3BCKA 2H72A 4GLTA 4PQIA 1Z6NA 4H86A 2JZTA 1PX6A 1PRXA 5G30A 5F0GA 5EL8A 2DKHA 2DJ3A 3F0IA 3W6GA 5KN1A 2V6OA 4EXJA 2WDUA 3L9UA 2YWOA 4HU9A 5CRHA 2K6VA 4HOJA 2H01A 4K0NA 2XBQA 3IE3A 1Z7PA 4ILFA 1J9BA 2HSHA 1GULA 3IPZA 4IELA 4HZ4A 4KNDA 3E3EA 2R0CA 1I5GA 5KN0A 1WRYA 3RHBA 4FIWA 2R37A 5EVOA 2YWIA 3G7JA 1XFLA 1HQOA 3GKNA 1XBSA 2LSTA 2EC4A 3TGZA 4CDOA 3LJRA 5GSSA 4BA7A 1PL2A 1PN9A 3TDGA 3DRNA 1TOFA 1THOA 2ZUPA 1PMTA 1K0AA 1G6YA 19GSA 2V41A 4HZ2A 1GUHA 1U3IA 4ECBA 1ZYEA 1PX7A 2C80A 4MZWA 5DALA 1Y6EA 2IMEA 2NVLA 1OC9B 1EOHA 2A4VA 1F2EA 4ZIJA 5F07A 4NHWA 4PNFA 3FHKA 3RDWA 1O85A 1A2LA 2DJJA 4TXVA 2DJKA 2FGXA 4Z7XA 1M2DA 1XWBA 2LRCA 4WETA 5ABRA 3GA4A 1FAAA 3N9JA 3TRQA 5J5NA 2YOIA 1GTAA 3GX8A 3APQA 3WT1A 1K0BA 1MDJA 3VURA 4I2TA 4D73B 1JHBA 2A2PA 2O8VB 14GSA 4FYBA 4WR5A 4IQ1A 2H66A 3ERWA 4KCEA 4MF6A 3LQ7A 1MDIA 1EV4A 5IIZA 1V40A 2FLSA 4QL9A 3EU3A 3GYKA 5FWGA 1Q4JA 4V2NA 4AGSA 5G1LA 3ZYWA 2GVPA 1ERTA 1ERWA 4AF2A 4PXOA 2GDRA 1XWAA 4G9HA 4NHZA 5G5EA 1SJIA 3A3TA 4PTSA 2C8UA 3IBHA 1XW9A 1M2BA 5F8BA 3UJ1A 1S3DA 1U88A 2HT9A 3F63A 2GQMA 3GMFA 4ZL9A 1UVZA 2JSYA 3L9VA 4NXIA 3NOFA 2B1KA 2R0GA 1VGLA 1M9AA 4K2DA 1ACVA 2MBSA 1S3AA 3BOAA 3NZNA 1Z9HA 4GQFA 3UOMA 3APOA 4Z2RA 1PQNA 3GTUB 2X4AA 3F6FA 2VCZA 3F4SA 3WGXA 2MZCA 2VL2C 1NHYA 4POKA 3KTBA 1V2AA 3ME8A 4TR3A 2CV4A 3UVHA 2VOCA 4L8EA 4BVXB 1VF1A 3CSJA 1VRSD 2VCWA 4JZQA 4JBBA 3QR6A 4PUAA 4ISDA 1M0UA 1R26A 4EIPA 5GAND 3KXOA 3QMXA 5D9WA 2OE0A 2DBCA 4KDXA 3KP9A 2HE3A 4GWRA 3KD0A 1T00A 4MF5A 1B9XC 1SK0A 2PGTA 2ZCTA 3GURA 2N5FA 2C3NA 1SYXA 4DVCA 1SD9A 2C0GA 4CY6A 3GV1A 3FR3A 1BJXA 2CX3A 2CVBA 3MIXA 4WBJA 3HJOA 5E4WA 3FY7A 5HFGA 1K0OA 1E2YA 3KEBA 2IMKA 3H93A 1WPIA 5J9CA 4L0WA 5DQYA 4KAEA 4BVYB 3FR9A 4NV2A 2YN1A 1GTBA 1ON4A 4PGTA 4KDYA 4IP6A 3IAM2 2V32A 3EE2A 4K6XA 4KF9A 2R6KA 2Z9SA 4EIQA 4ZB8A 2X49A 2NDOA 1EV9A 4CY8A 2FWGA 3LGCA 4EVMA 2DJ2A 2B3SA 3H79A 3GHAA 3TJBA 3APSA 1OYJA 2M80A 2F3MA 1M3JA 2GTUA 2QGVA 4OD7A 5F06A 5IOWA 3C8EA 1GNEA 5ECKB 3RPNA 4XTSA 3TKQA 1WWJA 2HZEB 3DIEA 2L59A 1M9BA 2GZPA 1UN2A 3PINA 2RM6A 2HFDA 1DE2A 1JZRA 1FO5A 1WE0A 1YF1A 5B6NA 2EIQA 5CYYA 2PUKC 3J7Yb 3IC8A 5BRTA 2LS5A 4GRFA 4HUAA 4XS1A 2AJQB 1K0NA 5ELAA 2VAFA 1KEBA 1X5EA 2YZUA 4HSCX 1Z5YE 4IBPA 1GNWA 1M99A 4AJ6A 5HR0A 4CHSA 2QA2A 2RLIA 2MYGA 5IMDA 2HRFA 4I8BA 4USSA 1EGOA 1PSQA 2LJKA 5BMUA 1SL0B 1K3OA 2P0GA 4ZBDA 3VWVA 2HI7A 2A2SA 3D4TA 4EDYA 2RUEA 1G0TA 5ID2A 3HVVA 4MZBA 2L4CA 5ECOB 1XWKA 2CAQA 1CQHA 4AJ7A 3TKSE 1GLQA 2R0PA 1AXDA 5A4VA 2VCVA 2QKEA 3HA9A 3LORA 4O5RA 4WF5A 3Q19A 2F9SA 4HEA2 5CO3A 4OFTA 4XS4A 3A5WA 4MLYA 3VPTA 4OMVA 3EINA 4E8HA 5ECLB 4MK3A 4NPBA 4N11A 4ZB6A 1SK1A 4OWYA 4TVEA 2FWHA 5AGYA 1FVKA 1PD21 1S3RA 3G7YA 4WF4A 1TRWA 1RW1A 3IHQA 1ZL9A 4PUFC 4I97A 3CYNA 1GUMA 2KHPA 3VK9A 8GSSA 1WOUA 3VLNA 2AYTA 1QUWA 5B7CA 1W89A 2VLVA 3IK7A 4LMWA 1C72A 2HZFA 5H5SA 3M3MA 3ED3A 2EIRA 1GSFA 1UC7A 4BIKA 2RIIA 5JWQB 1EEJA 3F3RA 3RBTA 5ECPB 4O32A 1YEXA 2YWNA 2PU9C 4KA0A 3KH7A 2DSAA 4IJIA 4OO5A 3D0ZA 4HDEA 5CNWA 1WP0A 2PN8A 1V57A 3UMAA 3AY8A 1GSEA 11GSA 4ECCA 1A8LA 2JL4A 4K5RA 2TRCP 1F3AA 1U87A 5G31A 3WGDA 4IJ3A 1SENA 5CRDA 4ZL7A 1EGRA 1EEMA 4NAXA 3BJ5A 4MNNA 4POMA 2FA4A 3TCOA 4HQZA 5E59A 3UBKA 2XPDA 2OKAA 3FEUA 4XHMA 3UBLA 1TU7A 1PFOA 5HR3A 3EWLA 4BL7B 3DMLA 1THXA 3H8QA 1HNBA 2RM5A 3FRCA 4MDCA 1BG5A 1QXHA 3ERGA 5EY6A 4FYUA 2VLTA 5J4UA 1Q98A 2JU5A 2LV3A 9GSSA 2QA1A 2VM1A 2OE3A 4KE3A 3SBCA 1XZOA 2BTOT 5DVBA 2X8GA 1Z3EA 4KDUA 16GSA 4TRXA 4HJ2A 1XWGA 1A0FA 1N2AA 4IP1A 6GSXA 4IKHA 5LD0A 4F03A 3IR4A 3KJYA 3GX0A 1OC9A 2HLSA 4EC0A 4Z2UA 4G2EA 1A8YA 3VWWA 1H4OA 2O85A 3HVXA 2OADA 2R3XA 2E7PA 4G19A 3ME7A 1TRVA 4K2XA 1DUGA 2H8LA 3DKSA 2A2RA 3ZFBA 3CTFA 2MMZA 7GSSA 2CQ9A 2K8SA 3ZZXA 1B48A 1F37A 4F0CA 4ID0A 3TB2A 2LNTA 3IC4A 1TK5B 1GSDA 3CRUA 1XIYA 4IN0A 4D73A 2MMOA 2C0EA 4G0LA 2GGTA 1GUKA 3D6IA 4O5QA 2H0HA 3IK9A 2PMTA 2RUFA 3GIXA 4FQUA 4TKYA 1YF0A 1MEKA 2B5YA 2WRTA 1ST9A 3CQFA 1O8WA 2FWEA 4V2MA 2CA8A 2V6KA 1T8EB 3HVNA 2L6DA 3LWAA 1XXUA 5DQSA 2H1BA 2C0FA 5EPFA 1UA5A 3LW9A 4GSNA 3TJJA 1E6BA 1LBKA 1IYHA 2GT5A 2V2GA 2D2ZA 3KTLA 3EYTA 5ECQB 2KLXA 3D21A 6GSSA 1HNAA 1NSWA 3L78A 3GNJA 3DGQA 1BX9A 2PVOC 3FYGA 2L4QA 3HZ8A 3Q74A 4TW5A 3F3QA 2P5QA 1G7OA 2VCTA 4N0ZA 3GKMA 3KMOA 2H6ZA 1EWXA 5AN1A 2LJAA 2LKUA 4V1Ag 5DJMA 1Z7RA 4GCIA 4MH2A 4YAVA 4BVXA 3PGTA 5ECNB 1GSSA 4K7OA 3F8UA 2C4JA 5ECMB 3QD9A 2GZZA 4LL1B 4I5QA 3HXSA 5C00A 5IOXA 2CVKA 4ACSA 1LJRA 3HJPA 2FHEA 4L5LA 1YDKA 1YKAA 4KGIA 4RI6A 4GXZA 3PH9A 3HVSA 3QOUA 1PL1A 3QPMA 3S9FA 3M9KA 5HFIA 12GSA 2XPEA 4EL1A 3HDCA 1TRSA 3P8WA 1DBYA 1U6TA 3GL3A 2LJRA 1FB6A 5JWOB 5KN3A 5IMVA 1XOBA 3A2WA 1ERVA 1QMVA 4AJ8A 1JZOA 3GKKA 4IVFA 3HZ4A 1RK4A 1NHOA 2H70A 1IYIA 4G0IA 2ZNMA 5A4WA 3IDVA 4O92A 5IMAA 1EOGA 3US3A 5B8AA 4BVYA 4PQHA 2WFCA 2DKIA 1QFNA 3LYPA 2CT6A 3GH6A 1AQXA 5DAKB 2PVQA 3M8NA 1XVWA 1QK8A 1OE7A 1XCCA 2CAIA 4ECJA 2IFQB 3RAZA 2EIOA 4E8EA 1O73A 3M1GA 3C73A 3QDNA 2B1LA 4F2IA 2FCHA 5HQPA 2DC5A 2FD3A 2I9HA 4ULXA 1GSQA 3TRXA 2DJ0A 5DCGA 3ZLPA 4Q5QA 4EDZA 3W8SA 2LQQA 5A4UA 4JU5A 4N0VA 2IL3A 4K8MA 1OKDA 4KUNA 3ZVJD 5J3RA 2I1UA 1B8XA 4G0KA 5AISA 4XCSA 3IV4A 3BBYA 4PQ1A 3EU4A 3I43A 1EP7A 1A2MA 2E2GA 2VO4A 5B8BA 3IHGA 3P2AA 4WEYA 1ZYPA 4XIHA 2VM2A 1ILOA 4HS1A 1QGVA 3DXBA 3KIJA 2VD1A 1X9WB 5D73A 1TKDB 2A4HA 5D9TA 2I3YA 2JSZA 2IMDA 1ZCPA 2ON5A 2REMA 2DMMA 3CSHA 3FW2A 2FUG2 3CXGA 2KP2A 3C7MA 3L4NA 3J7Yk 2H6XA 4GSSA 2K18A 2B5EA 4J57E 1R4WA 4NWYA 1XVQA 1A0RP 2YJHA 1TU8A 3EC3A 2M46A 1AIUA 3FZ4A 4IHUA 3FKFA 2C3TA 2O87A 1OAZA 2AAWA 3LSZA 22GSA 4MPFA 1B9YC 3U5RE 3IOSA 4PNGA 1W4VA 1FOVA 3KP8A 2VUPA 3EPTA 2PPTA 3KZQA 4JEDA 1LU4A 1OC3A 2R2JA 1YY7A 3QFAC 1T3BA 5J9BA 1SKWB 1J08A 2H76A 5B6MA 3F4TA 5JCWA 2H75A 2MMAA 3FMWA 1SKSB 1AW9A 6GSVA 1TXXA 2LQOA 4TXOB 2E0QA 3MSZA 5L71A 2UZ8A 3IRAA 1Z6MA 4L5OA 1KBNA 3GKXA 2H1AA 4PX1A 2GZYA 3VFIA 1G6WA 5KN2A 2YZHA 1FB0A 2KUCA 1ZYNA 4HJMA 1MTCA 4EO3A 1TI1A 2GQLA 4XS6A 2CVDA 3QAWA 1BAYA 3GUSA 2YCDA 4N10A 2FWFA 1TRUA 3L9SA 3MAKA 4Z2TA 5J41A 2HSYA 4POLA 3EMPA 4YQUA 2R5GA 2M72A 1XG8A 1T7PB 1EP8A 3CBUA 3N5OA 1V98A 1BYEA 2WULA 1WIKA 1T4YA 4DSSA 3FR6A 3LYKA 3WGEA 2OE1A 1SU9A 2YNXA 4JE1A 2X64A 1B4QA 1OC8A 3CRTA 2IMIA 3OR5A 1V9WA 3ZMKA 4K7IA 5ECHB 3FZAA 4J56E 1TK0B 5F05A 3UVTA 1O7UA 4WKWA 4O5UA 2DMLA 3RPPA 1SJ6A 5ECSA 4TR1B 2FA8A 1DSBA 2VIMA 1AAZA 1EZKA 1HD2A 1X9MB 5D96A 2LRNA 2HRKA 2AB6A 2GSRA 4FYCA 1B4PA 1KNGA 3F9UA 4DEJA 4TOPA 1ZGNA 4QQ7A 2L5OA 1J0FA 3IA1A 2N5BA 5GAPD 5CP1A 4KSOA 4MCUA 3A5IA 2K9FA 3GFKA 2GSTA 4MA9A 4F9ZA 4NV5A 2OA7A 2PBJA 1XOAA 4DSRA 3I6AA 3G9BA 2HNLA 3BD2A 3F6DA 4BL7A 4P3YB 5AIXA 1O6JA 3D5JA 4LLRA 3QCPA 1MDKA 2PWJA 2JADA 4FO5A 2JZSA 4K9ZA 2FY6A 3ZIVA 3TKRA 4EUYA 4MP4A 4O7HA 2K8VA 4BWQA 4MJCA 1T4ZA 3L0HA 1F6MC 3DEXA 1FW1A 4KH7A 3MDKA 2X99A 3QAGA 3UARA 3ZFLA 2GSQA 1OKTA 1SYRA 2LTKA 4V2LA 1Y25A 5CRGA 5CREA 4I2UA 1S3CA 1GTIA 3R3EA 3E9JB 2L6CA 3P7XA 1K3LA 2MMNA 2WCIA 3EMXA 3CTGA 4XRDA 3LG6A 2WJUA 3KH9A 2CZ2A 4F82A 1GWCA 1SD8A 2GS3A 4ICYA 3TJKA 5JCUA 3DD3A 6GSWA 1U3AA 5D8IA 2YANA 2ON7A 1BEDA 5KOWA 1A24A 3BCIA 2JACA 4EF0A 2XHFA 4YQMA 2IPAA 2DJ1A 3TRPA 2DIZA 2HXKA 1TDIA 3IXRA 2YV7A 5DDLA 3D4MA 1KTEA 5A5KA 5DALB 3HJMA 4OCFA 1ABAA 4WR4A 4K7NA 1SL1B 2B7KA 3ZVJA 2DIYA 3V1WA 5KOXA 1VF3A 1XWCA 2I81A 1AUCA 2JZRA 5IO2A 3CMIA 4RI7A 5IM9A 5IPHA 2FNOA 2WZ9A 3VWXA 1A2JA 4K5SA 4MJAA 4WBRD 3QFBC 5DJLA 4Q5FA 1V58A 2ES7A 3PR8A 3I69A 4X1UA 2YJ7A 4GSTA 3SWLA 1TTZA 2CZ3A 2LUSA 4EKZA 1X0RA 3O76A 3U6VA 2F8FA 2B5XA 4N30A 2OBIA 1CQGA 2O89A 3M9JA 1FG4A 2N5AA 3MWHA 2F51A 3CSIA 3H4KA 3P90A 2G0FA 1WMJA 3DYRA 1PKWA 2BMXA 5ELGA 1MD4A 6GSTA 2TRXA 2VL2A 1BQ7A 4MJEA 4HI7A 2AHEA 1JFUA 3ERFA 3O6TA 4G10A 1R7HA 3GTUA 1O8XA 2DLXA 3TJGA 3GSTA 1AC1A 1GH2A 3HY2A 10GSA 4I6XA 1H75A 4JRRA 1SJZA 2C1YA 3JCML 2GT6A 1TJDA 3ZREA 3TUEA 1NM3A 1K0DA 1SKRB 3GSSA 2P5RA 4EE0A 3E0UA 3EURA 4YQVA 1OE8A 2H74A
chains in the Genus database with same CATH topology
1R5PA 5C04A 1PKZA 3QAVA 1JZWA 3A2XA 4BWSA 3ZTLA 2F8AA 1ZOFA 1O81A 4ML6A 4V1Ap 3WT2A 2IIYA 1TW9A 2L57A 3F4RA 4OFMA 3WYWA 2WB9A 3GN3A 1PN0A 2IN3A 5LCZA 1TP9A 3TKSA 1F3BA 3VI5A 4RQRA 3H1NA 4JR4A 4X4JA 5COHA 2KP1A 5HR2A 6GSYA 1DE1A 4ZXGA 4MZCA 2H0IA 1XW6A 3KMNA 1TI3A 5LNKe 4MMMA 4YAPA 2H19A 3UAPA 1I9DA 2B6MA 2R4VA 2O7KA 4NMUA 1JZDA 1XPVA 4GF0A 5D9XA 2G2QA 4X43A 3D22A 2IJYA 1MD3A 1GSUA 3LXTA 5DAKA 1M2AA 3TKSC 5INYA 5IQYA 4XRAA 20GSA 2HRNA 3KM6A 2IFQA 2QC7A 4TN8A 2LRTA 4GQCA 13GSA 5IMCA 2OBKA 3FK8A 2X8HA 4IGJA 3ZITA 5DCHA 1TK8B 1X5DA 5H5QA 2E2MA 1ZYQB 5IMFA 4ECIA 5G2ZA 2HSMA 4KB3A 4A5PA 4ML1A 3TOUA 4ZBAA 4MF7A 3GH9A 1SK2A 2LEGA 5CAXA 3C71A 1ZZYA 3MNGA 3C1SA 3FZ5A 2HZEA 2MBTA 4Q5NA 2C0DA 5D93A 3ZL5A 2HRAA 2B7JA 4TR4A 3TKPA 3UEMA 1T1VA 1FVJA 2X8CA 3TOTA 5HR1A 1N8JA 3HCZA 2H0GA 2VCXA 1AQVA 3GRXA 2PERA 2VD0A 1WJKA 2VL3A 2IMFA 1VF2A 4RQXA 2XC2A 3DVWA 4ZL8A 1M7TA 1ZMAA 3KGKA 2CX4A 3DVXA 4MPGA 2YV9A 4YKFA 5HFKA 2H1DA 3LEFA 2NBSA 2OACA 2VL9A 2I4AA 3MYDA 4L0UA 4LA1A 1K3YA 3PPUA 1GP1A 4Q5RA 1G7EA 17GSA 1RQMA 4IQAA 2NTOA 3I9V2 1HYUA 2BJXA 5FT3A 1ML6A 3UIWA 4OO4A 4OFNA 3R2QA 1GL8A 2LNSA 3ISOA 6GSUA 5JWRB 3ZIJA 2NPBA 4TR0A 1USBA 4MABA 4CW9A 3VWUA 1YZXA 18GSA 1GTUA 5AIVA 5JCGA 1YEPA 1YQ1A 1JLVA 5D9VA 1FOHA 2H71A 4GTUA 4K0GA 4IS0A 4J2FA 4LMVA 4ZBBA 5KEJA 4BPYA 2H30A 3DWVA 5ID2B 4POBA 2H73A 1PGTA 4PURA 3ZRDA 3VPQA 4TXOA 3NIVA 2GLRA 2YWMA 3IAS2 1JLWA 3HYPA 3LFLA 3W8JA 5GZZB 2GQKA 2TIRA 3O3TA 5ECRB 1F9MA 2GSSA 4X0XA 4DSQA 1K0CA 4WXTA 4XS4B 2P31A 5IO0A 2L5LA 3GL5A 4K1FA 4HQSA 5GSTA 3HKRA 3HHVA 4ZB9A 3K8NA 1PA3A 4OCEA 2J9HA 1URMA 4JR6A 2VCQA 1GRXA 5FHIA 3WD6A 2C3QA 1SL2B 3RHCA 2H1GA 3LXZA 1GLPA 5DBQA 4KCAA 4MJBA 1A23A 1AQWA 2VLUA 3Q18A 5IMZA 1R5AA 4YH2A 3UL3A 1HNCA 2WGRA 1X9SB 1YKCA 3C1RA 4YKGA 4LL4B 3TJFA 3A2VA 2KOKA 2H6YA 2WS2A 4FH8A 5CRWA 5ENUA 2HYXA 4KW6A 1GSYA 3ZMLA 2ALBA 4TR1A 4F0BA 4RUVA 2J23A 5ECIB 4QL7A 4DSSB 5IPGA 3G7IA 1ERUA 3VI7A 2V1MA 4HU7A 1VF4A 2OJLA 4KSMA 2QSIA 5G1KA 4ZILA 1X5CA 3EVIA 1FHEA 3M0FA 3Q6OA 3KCMA 1YJ6A 5H5RA 2YP6A 3FZ9A 2XBIA 1XW5A 3HD5A 1OVNA 4KX4A 5G5FA 4MH3A 2IWTA 2YPMA 1NW2A 2AUVA 1K0MA 1QQ2A 2AV4A 4IW9A 3BCKA 2H72A 4GLTA 4PQIA 1Z6NA 4H86A 2JZTA 1PX6A 1PRXA 5G30A 5F0GA 5EL8A 2DKHA 2DJ3A 3F0IA 3W6GA 5KN1A 2V6OA 4EXJA 2WDUA 3L9UA 2YWOA 4HU9A 5CRHA 2K6VA 4HOJA 2H01A 4K0NA 2XBQA 3IE3A 1Z7PA 4ILFA 1J9BA 2HSHA 1GULA 3IPZA 4IELA 4HZ4A 4KNDA 3E3EA 2R0CA 1I5GA 5KN0A 1WRYA 3RHBA 4FIWA 2R37A 5EVOA 2YWIA 3G7JA 1XFLA 1HQOA 3GKNA 1XBSA 2LSTA 2EC4A 3TGZA 4CDOA 3LJRA 5GSSA 4BA7A 1PL2A 1PN9A 3TDGA 3DRNA 1TOFA 1THOA 2ZUPA 1PMTA 1K0AA 1G6YA 19GSA 2V41A 4HZ2A 1GUHA 1U3IA 4ECBA 1ZYEA 1PX7A 2C80A 4MZWA 5DALA 1Y6EA 2IMEA 2NVLA 1OC9B 1EOHA 2A4VA 1F2EA 4ZIJA 5F07A 4NHWA 4PNFA 3FHKA 3RDWA 1O85A 1A2LA 2DJJA 4TXVA 2DJKA 2FGXA 4Z7XA 1M2DA 1XWBA 2LRCA 4WETA 5ABRA 3GA4A 1FAAA 3N9JA 3TRQA 5J5NA 2YOIA 1GTAA 3GX8A 3APQA 3WT1A 1K0BA 1MDJA 3VURA 4I2TA 4D73B 1JHBA 2A2PA 2O8VB 14GSA 4FYBA 4WR5A 4IQ1A 2H66A 3ERWA 4KCEA 4MF6A 3LQ7A 1MDIA 1EV4A 5IIZA 1V40A 2FLSA 4QL9A 3EU3A 3GYKA 5FWGA 1Q4JA 4V2NA 4AGSA 5G1LA 3ZYWA 2GVPA 1ERTA 1ERWA 4AF2A 4PXOA 2GDRA 1XWAA 4G9HA 4NHZA 5G5EA 1SJIA 3A3TA 4PTSA 2C8UA 3IBHA 1XW9A 1M2BA 5F8BA 3UJ1A 1S3DA 1U88A 2HT9A 3F63A 2GQMA 3GMFA 4ZL9A 1UVZA 2JSYA 3L9VA 4NXIA 3NOFA 2B1KA 2R0GA 1VGLA 1M9AA 4K2DA 1ACVA 2MBSA 1S3AA 3BOAA 3NZNA 1Z9HA 4GQFA 3UOMA 3APOA 4Z2RA 1PQNA 3GTUB 2X4AA 3F6FA 2VCZA 3F4SA 3WGXA 2MZCA 2VL2C 1NHYA 4POKA 3KTBA 1V2AA 3ME8A 4TR3A 2CV4A 3UVHA 2VOCA 4L8EA 4BVXB 1VF1A 3CSJA 1VRSD 2VCWA 4JZQA 4JBBA 3QR6A 4PUAA 4ISDA 1M0UA 1R26A 4EIPA 5GAND 3KXOA 3QMXA 5D9WA 2OE0A 2DBCA 4KDXA 3KP9A 2HE3A 4GWRA 3KD0A 1T00A 4MF5A 1B9XC 1SK0A 2PGTA 2ZCTA 3GURA 2N5FA 2C3NA 1SYXA 4DVCA 1SD9A 2C0GA 4CY6A 3GV1A 3FR3A 1BJXA 2CX3A 2CVBA 3MIXA 4WBJA 3HJOA 5E4WA 3FY7A 5HFGA 1K0OA 1E2YA 3KEBA 2IMKA 3H93A 1WPIA 5J9CA 4L0WA 5DQYA 4KAEA 4BVYB 3FR9A 4NV2A 2YN1A 1GTBA 1ON4A 4PGTA 4KDYA 4IP6A 3IAM2 2V32A 3EE2A 4K6XA 4KF9A 2R6KA 2Z9SA 4EIQA 4ZB8A 2X49A 2NDOA 1EV9A 4CY8A 2FWGA 3LGCA 4EVMA 2DJ2A 2B3SA 3H79A 3GHAA 3TJBA 3APSA 1OYJA 2M80A 2F3MA 2GTUA 2QGVA 4OD7A 5F06A 5IOWA 3C8EA 1GNEA 5ECKB 3RPNA 4XTSA 3TKQA 1WWJA 2HZEB 3DIEA 2L59A 1M9BA 2GZPA 1UN2A 3PINA 2RM6A 2HFDA 1DE2A 1JZRA 1FO5A 1WE0A 1YF1A 5B6NA 2EIQA 5CYYA 2PUKC 3J7Yb 3IC8A 5BRTA 2LS5A 4GRFA 4HUAA 4XS1A 2AJQB 1K0NA 5ELAA 2VAFA 1KEBA 1X5EA 2YZUA 1Z5YE 4IBPA 1GNWA 1M99A 4AJ6A 5HR0A 4CHSA 2QA2A 2RLIA 2MYGA 5IMDA 2HRFA 4I8BA 4USSA 1EGOA 1PSQA 2LJKA 5BMUA 1SL0B 1K3OA 2P0GA 4ZBDA 3VWVA 2HI7A 2A2SA 3D4TA 4EDYA 2RUEA 1G0TA 5ID2A 3HVVA 4MZBA 2L4CA 5ECOB 1XWKA 2CAQA 1CQHA 4AJ7A 3TKSE 1GLQA 2R0PA 1AXDA 5A4VA 2VCVA 2QKEA 3HA9A 3LORA 4O5RA 4WF5A 3Q19A 2F9SA 4HEA2 5CO3A 4OFTA 4XS4A 3A5WA 4MLYA 3VPTA 4OMVA 3EINA 4E8HA 5ECLB 4MK3A 4NPBA 4N11A 4ZB6A 1SK1A 4OWYA 4TVEA 2FWHA 5AGYA 1FVKA 1PD21 3G7YA 4WF4A 1TRWA 1RW1A 3IHQA 1ZL9A 4PUFC 4I97A 3CYNA 1GUMA 2KHPA 3VK9A 8GSSA 1WOUA 3VLNA 2AYTA 1QUWA 5B7CA 1W89A 2VLVA 3IK7A 4LMWA 1C72A 2HZFA 5H5SA 3M3MA 3ED3A 2EIRA 1GSFA 1UC7A 2RIIA 5JWQB 1EEJA 3F3RA 3RBTA 5ECPB 4O32A 1YEXA 2YWNA 2PU9C 4KA0A 3KH7A 2DSAA 4IJIA 4OO5A 3D0ZA 4HDEA 5CNWA 1WP0A 2PN8A 1V57A 3UMAA 3AY8A 1GSEA 11GSA 4ECCA 1A8LA 2JL4A 4K5RA 2TRCP 1F3AA 1U87A 5G31A 3WGDA 4IJ3A 1SENA 5CRDA 4ZL7A 1EGRA 1EEMA 4NAXA 3BJ5A 4MNNA 4POMA 2FA4A 3TCOA 4HQZA 5E59A 3UBKA 2XPDA 2OKAA 3FEUA 4XHMA 3UBLA 1TU7A 5HR3A 3EWLA 4BL7B 3DMLA 1THXA 3H8QA 1HNBA 2RM5A 3FRCA 4MDCA 1BG5A 1QXHA 3ERGA 5EY6A 4FYUA 2VLTA 5J4UA 1Q98A 2JU5A 2LV3A 9GSSA 2QA1A 2VM1A 2OE3A 4KE3A 3SBCA 1XZOA 2BTOT 5DVBA 2X8GA 1Z3EA 4KDUA 16GSA 4TRXA 4HJ2A 1XWGA 1A0FA 1N2AA 4IP1A 6GSXA 4IKHA 5LD0A 4F03A 3IR4A 3KJYA 3GX0A 1OC9A 2HLSA 4EC0A 4Z2UA 4G2EA 1A8YA 3VWWA 1H4OA 2O85A 3HVXA 2OADA 2R3XA 2E7PA 4G19A 3ME7A 1TRVA 4K2XA 1DUGA 2H8LA 3DKSA 2A2RA 3ZFBA 3CTFA 2MMZA 7GSSA 2CQ9A 2K8SA 3ZZXA 1B48A 1F37A 4F0CA 4ID0A 3TB2A 2LNTA 3IC4A 1TK5B 1GSDA 3CRUA 1XIYA 4IN0A 4D73A 2MMOA 2C0EA 4G0LA 2GGTA 1GUKA 3D6IA 4O5QA 2H0HA 3IK9A 2PMTA 2RUFA 3GIXA 4FQUA 4TKYA 1YF0A 1MEKA 2B5YA 2WRTA 1ST9A 1O8WA 2FWEA 4V2MA 2CA8A 2V6KA 1T8EB 2L6DA 3LWAA 1XXUA 5DQSA 2H1BA 2C0FA 5EPFA 1UA5A 3LW9A 4GSNA 3TJJA 1E6BA 1LBKA 1IYHA 2GT5A 2V2GA 2D2ZA 3KTLA 3EYTA 5ECQB 2KLXA 3D21A 6GSSA 1HNAA 1NSWA 3L78A 3GNJA 3DGQA 1BX9A 2PVOC 3FYGA 2L4QA 3HZ8A 3Q74A 4TW5A 3F3QA 2P5QA 1G7OA 2VCTA 4N0ZA 3GKMA 3KMOA 2H6ZA 1EWXA 5AN1A 2LJAA 2LKUA 4V1Ag 5DJMA 1Z7RA 4GCIA 4MH2A 4YAVA 4BVXA 3PGTA 5ECNB 1GSSA 4K7OA 3F8UA 2C4JA 5ECMB 3QD9A 2GZZA 4LL1B 4I5QA 3HXSA 5C00A 5IOXA 2CVKA 4ACSA 1LJRA 3HJPA 2FHEA 4L5LA 1YDKA 1YKAA 4KGIA 4RI6A 4GXZA 3PH9A 3HVSA 3QOUA 1PL1A 3QPMA 3S9FA 3M9KA 5HFIA 12GSA 2XPEA 4EL1A 3HDCA 1TRSA 3P8WA 1DBYA 1U6TA 3GL3A 2LJRA 1FB6A 5JWOB 5KN3A 5IMVA 1XOBA 3A2WA 1ERVA 1QMVA 4AJ8A 1JZOA 3GKKA 4IVFA 3HZ4A 1RK4A 1NHOA 2H70A 1IYIA 4G0IA 2ZNMA 5A4WA 3IDVA 4O92A 5IMAA 1EOGA 3US3A 5B8AA 4BVYA 4PQHA 2WFCA 2DKIA 1QFNA 3LYPA 2CT6A 3GH6A 1AQXA 5DAKB 2PVQA 3M8NA 1XVWA 1QK8A 1OE7A 1XCCA 2CAIA 4ECJA 2IFQB 3RAZA 2EIOA 4E8EA 1O73A 3M1GA 3C73A 3QDNA 2B1LA 4F2IA 2FCHA 5HQPA 2DC5A 2FD3A 2I9HA 4ULXA 1GSQA 3TRXA 2DJ0A 5DCGA 3ZLPA 4Q5QA 4EDZA 3W8SA 2LQQA 5A4UA 4JU5A 4N0VA 2IL3A 4K8MA 1OKDA 4KUNA 3ZVJD 5J3RA 2I1UA 1B8XA 4G0KA 5AISA 4XCSA 3IV4A 3BBYA 4PQ1A 3EU4A 3I43A 1EP7A 1A2MA 2E2GA 2VO4A 5B8BA 3IHGA 3P2AA 4WEYA 1ZYPA 4XIHA 2VM2A 1ILOA 4HS1A 1QGVA 3DXBA 3KIJA 2VD1A 1X9WB 5D73A 1TKDB 2A4HA 5D9TA 2I3YA 2JSZA 2IMDA 1ZCPA 2ON5A 2REMA 2DMMA 3CSHA 3FW2A 2FUG2 3CXGA 2KP2A 3C7MA 3L4NA 3J7Yk 2H6XA 4GSSA 2K18A 2B5EA 4J57E 1R4WA 4NWYA 1XVQA 1A0RP 2YJHA 1TU8A 3EC3A 2M46A 1AIUA 3FZ4A 4IHUA 3FKFA 2C3TA 2O87A 1OAZA 2AAWA 3LSZA 22GSA 4MPFA 1B9YC 3U5RE 3IOSA 4PNGA 1W4VA 1FOVA 3KP8A 2VUPA 3EPTA 2PPTA 3KZQA 4JEDA 1LU4A 1OC3A 2R2JA 1YY7A 3QFAC 1T3BA 5J9BA 1SKWB 1J08A 2H76A 5B6MA 3F4TA 5JCWA 2H75A 2MMAA 3FMWA 1SKSB 1AW9A 6GSVA 1TXXA 2LQOA 4TXOB 2E0QA 3MSZA 5L71A 2UZ8A 3IRAA 1Z6MA 4L5OA 1KBNA 3GKXA 2H1AA 4PX1A 2GZYA 3VFIA 1G6WA 5KN2A 2YZHA 1FB0A 2KUCA 1ZYNA 4HJMA 1MTCA 4EO3A 1TI1A 2GQLA 4XS6A 2CVDA 3QAWA 1BAYA 3GUSA 2YCDA 4N10A 2FWFA 1TRUA 3L9SA 3MAKA 4Z2TA 5J41A 2HSYA 4POLA 3EMPA 4YQUA 2R5GA 2M72A 1T7PB 1EP8A 3CBUA 3N5OA 1V98A 1BYEA 2WULA 1WIKA 1T4YA 4DSSA 3FR6A 3LYKA 3WGEA 2OE1A 1SU9A 2YNXA 4JE1A 2X64A 1B4QA 1OC8A 3CRTA 2IMIA 3OR5A 1V9WA 3ZMKA 4K7IA 5ECHB 3FZAA 4J56E 1TK0B 5F05A 3UVTA 1O7UA 4WKWA 4O5UA 2DMLA 3RPPA 1SJ6A 5ECSA 4TR1B 2FA8A 1DSBA 2VIMA 1AAZA 1EZKA 1HD2A 1X9MB 5D96A 2LRNA 2HRKA 2AB6A 2GSRA 4FYCA 1B4PA 1KNGA 3F9UA 4DEJA 4TOPA 1ZGNA 4QQ7A 2L5OA 1J0FA 3IA1A 2N5BA 5GAPD 5CP1A 4KSOA 4MCUA 3A5IA 2K9FA 3GFKA 2GSTA 4MA9A 4F9ZA 4NV5A 2OA7A 2PBJA 1XOAA 4DSRA 3I6AA 3G9BA 2HNLA 3BD2A 3F6DA 4BL7A 4P3YB 5AIXA 1O6JA 3D5JA 4LLRA 3QCPA 1MDKA 2PWJA 2JADA 4FO5A 2JZSA 4K9ZA 2FY6A 3ZIVA 3TKRA 4EUYA 4MP4A 4O7HA 2K8VA 4BWQA 4MJCA 1T4ZA 3L0HA 1F6MC 3DEXA 1FW1A 4KH7A 3MDKA 2X99A 3QAGA 3UARA 3ZFLA 2GSQA 1OKTA 1SYRA 2LTKA 4V2LA 1Y25A 5CRGA 5CREA 4I2UA 1S3CA 1GTIA 3R3EA 3E9JB 2L6CA 3P7XA 1K3LA 2MMNA 2WCIA 3EMXA 3CTGA 4XRDA 3LG6A 2WJUA 3KH9A 2CZ2A 4F82A 1GWCA 1SD8A 2GS3A 4ICYA 3TJKA 5JCUA 3DD3A 6GSWA 1U3AA 5D8IA 2YANA 2ON7A 1BEDA 5KOWA 1A24A 3BCIA 2JACA 4EF0A 4YQMA 2XHFA 2IPAA 2DJ1A 3TRPA 2DIZA 2HXKA 1TDIA 3IXRA 2YV7A 5DDLA 3D4MA 1KTEA 5A5KA 5DALB 3HJMA 4OCFA 1ABAA 4WR4A 4K7NA 1SL1B 2B7KA 3ZVJA 2DIYA 3V1WA 5KOXA 1VF3A 1XWCA 2I81A 1AUCA 2JZRA 5IO2A 3CMIA 4RI7A 5IM9A 5IPHA 2FNOA 2WZ9A 3VWXA 1A2JA 4K5SA 4MJAA 4WBRD 3QFBC 5DJLA 4Q5FA 1V58A 2ES7A 3PR8A 3I69A 4X1UA 2YJ7A 4GSTA 3SWLA 1TTZA 2CZ3A 2LUSA 4EKZA 1X0RA 3O76A 3U6VA 2F8FA 2B5XA 4N30A 2OBIA 1CQGA 2O89A 3M9JA 1FG4A 2N5AA 3MWHA 2F51A 3CSIA 3H4KA 3P90A 2G0FA 1WMJA 3DYRA 1PKWA 2BMXA 5ELGA 1MD4A 6GSTA 2TRXA 2VL2A 1BQ7A 4MJEA 4HI7A 2AHEA 1JFUA 3ERFA 3O6TA 4G10A 1R7HA 3GTUA 1O8XA 2DLXA 3TJGA 3GSTA 1AC1A 1GH2A 3HY2A 10GSA 4I6XA 1H75A 4JRRA 1SJZA 2C1YA 3JCML 2GT6A 1TJDA 3ZREA 3TUEA 1NM3A 1K0DA 1SKRB 3GSSA 2P5RA 4EE0A 3E0UA 3EURA 4YQVA 1OE8A 2H74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5P A;  5C04 A;  1PKZ A;  3QAV A;  1JZW A;  3A2X A;  4BWS A;  3ZTL A;  2F8A A;  1ZOF A;  1O81 A;  4ML6 A;  4V1A p;  3WT2 A;  2IIY A;  1TW9 A;  2L57 A;  3F4R A;  4OFM A;  3WYW A;  2WB9 A;  3GN3 A;  2IN3 A;  5LCZ A;  1TP9 A;  3TKS A;  1F3B A;  3VI5 A;  4RQR A;  3H1N A;  4JR4 A;  5COH A;  2KP1 A;  5HR2 A;  6GSY A;  1DE1 A;  4ZXG A;  4MZC A;  2H0I A;  1XW6 A;  3KMN A;  1TI3 A;  5LNK e;  4MMM A;  4YAP A;  2H19 A;  3UAP A;  1I9D A;  2B6M A;  2R4V A;  2O7K A;  4NMU A;  1JZD A;  1XPV A;  4GF0 A;  5D9X A;  2G2Q A;  4X43 A;  3D22 A;  2IJY A;  1MD3 A;  1GSU A;  3LXT A;  5DAK A;  1M2A A;  3TKS C;  5INY A;  5IQY A;  4XRA A;  20GS A;  2HRN A;  3KM6 A;  2IFQ A;  2QC7 A;  4TN8 A;  2LRT A;  4GQC A;  13GS A;  5IMC A;  2OBK A;  3FK8 A;  2X8H A;  4IGJ A;  3ZIT A;  5DCH A;  1TK8 B;  1X5D A;  5H5Q A;  2E2M A;  1ZYQ B;  5IMF A;  4ECI A;  5G2Z A;  4KB3 A;  4ML1 A;  3TOU A;  4ZBA A;  4MF7 A;  3GH9 A;  1SK2 A;  2LEG A;  5CAX A;  3C71 A;  1ZZY A;  3MNG A;  3C1S A;  3FZ5 A;  2HZE A;  2MBT A;  4Q5N A;  2C0D A;  5D93 A;  3ZL5 A;  2B7J A;  4TR4 A;  3TKP A;  3UEM A;  1T1V A;  1FVJ A;  2X8C A;  3TOT A;  5HR1 A;  1N8J A;  3HCZ A;  2H0G A;  2VCX A;  1AQV A;  3GRX A;  2PER A;  2VD0 A;  1WJK A;  2VL3 A;  2IMF A;  1VF2 A;  4RQX A;  2XC2 A;  3DVW A;  4ZL8 A;  1M7T A;  1ZMA A;  3KGK A;  2CX4 A;  3DVX A;  4MPG A;  2YV9 A;  5HFK A;  2H1D A;  3LEF A;  2NBS A;  2OAC A;  2VL9 A;  2I4A A;  4L0U A;  4LA1 A;  1K3Y A;  4Q5R A;  1GP1 A;  1G7E A;  17GS A;  1RQM A;  4IQA A;  2NTO A;  3I9V 2;  1HYU A;  2BJX A;  5FT3 A;  1ML6 A;  3UIW A;  4OO4 A;  4OFN A;  3R2Q A;  1GL8 A;  2LNS A;  3ISO A;  6GSU A;  5JWR B;  3ZIJ A;  2NPB A;  4TR0 A;  1USB A;  4MAB A;  4CW9 A;  3VWU A;  1YZX A;  18GS A;  1GTU A;  5AIV A;  5JCG A;  1YEP A;  1YQ1 A;  1JLV A;  5D9V A;  2H71 A;  4GTU A;  4K0G A;  4IS0 A;  4J2F A;  4LMV A;  4ZBB A;  5KEJ A;  4BPY A;  2H30 A;  3DWV A;  5ID2 B;  4POB A;  2H73 A;  1PGT A;  4PUR A;  3ZRD A;  3VPQ A;  4TXO A;  3NIV A;  2GLR A;  2YWM A;  3IAS 2;  1JLW A;  3HYP A;  3LFL A;  3W8J A;  5GZZ B;  2GQK A;  2TIR A;  3O3T A;  5ECR B;  1F9M A;  2GSS A;  4X0X A;  4DSQ A;  1K0C A;  4WXT A;  4XS4 B;  2P31 A;  5IO0 A;  2L5L A;  3GL5 A;  4K1F A;  4HQS A;  5GST A;  3HKR A;  3HHV A;  4ZB9 A;  3K8N A;  1PA3 A;  4OCE A;  2J9H A;  1URM A;  4JR6 A;  2VCQ A;  1GRX A;  5FHI A;  3WD6 A;  2C3Q A;  1SL2 B;  3RHC A;  2H1G A;  3LXZ A;  1GLP A;  5DBQ A;  4KCA A;  4MJB A;  1A23 A;  1AQW A;  2VLU A;  3Q18 A;  5IMZ A;  1R5A A;  4YH2 A;  3UL3 A;  1HNC A;  2WGR A;  1X9S B;  1YKC A;  3C1R A;  4LL4 B;  3TJF A;  3A2V A;  2KOK A;  2H6Y A;  2WS2 A;  4FH8 A;  5CRW A;  5ENU A;  2HYX A;  4KW6 A;  1GSY A;  3ZML A;  2ALB A;  4TR1 A;  4F0B A;  4RUV A;  2J23 A;  5ECI B;  4QL7 A;  4DSS B;  5IPG A;  3G7I A;  1ERU A;  3VI7 A;  2V1M A;  4HU7 A;  1VF4 A;  2OJL A;  4KSM A;  2QSI A;  5G1K A;  4ZIL A;  1X5C A;  3EVI A;  1FHE A;  3M0F A;  3Q6O A;  3KCM A;  1YJ6 A;  5H5R A;  2YP6 A;  3FZ9 A;  2XBI A;  1XW5 A;  3HD5 A;  1OVN A;  4KX4 A;  5G5F A;  4MH3 A;  2IWT A;  2YPM A;  1NW2 A;  2AUV A;  1K0M A;  1QQ2 A;  2AV4 A;  4IW9 A;  3BCK A;  2H72 A;  4GLT A;  4PQI A;  1Z6N A;  4H86 A;  2JZT A;  1PX6 A;  1PRX A;  5G30 A;  5F0G A;  5EL8 A;  2DJ3 A;  3F0I A;  3W6G A;  5KN1 A;  2V6O A;  4EXJ A;  2WDU A;  3L9U A;  2YWO A;  4HU9 A;  5CRH A;  2K6V A;  4HOJ A;  2H01 A;  4K0N A;  2XBQ A;  3IE3 A;  1Z7P A;  4ILF A;  1J9B A;  2HSH A;  1GUL A;  3IPZ A;  4IEL A;  4HZ4 A;  4KND A;  3E3E A;  1I5G A;  5KN0 A;  1WRY A;  3RHB A;  4FIW A;  2R37 A;  5EVO A;  2YWI A;  3G7J A;  1XFL A;  1HQO A;  3GKN A;  1XBS A;  2LST A;  2EC4 A;  3TGZ A;  4CDO A;  3LJR A;  5GSS A;  4BA7 A;  1PL2 A;  1PN9 A;  3TDG A;  3DRN A;  1TOF A;  1THO A;  2ZUP A;  1PMT A;  1K0A A;  1G6Y A;  19GS A;  2V41 A;  4HZ2 A;  1GUH A;  1U3I A;  4ECB A;  1ZYE A;  1PX7 A;  2C80 A;  4MZW A;  5DAL A;  1Y6E A;  2IME A;  2NVL A;  1OC9 B;  1EOH A;  2A4V A;  1F2E A;  4ZIJ A;  5F07 A;  4NHW A;  4PNF A;  3FHK A;  3RDW A;  1O85 A;  1A2L A;  2DJJ A;  4TXV A;  2DJK A;  2FGX A;  4Z7X A;  1M2D A;  1XWB A;  2LRC A;  4WET A;  5ABR A;  3GA4 A;  1FAA A;  3N9J A;  3TRQ A;  5J5N A;  2YOI A;  1GTA A;  3GX8 A;  3APQ A;  3WT1 A;  1K0B A;  1MDJ A;  3VUR A;  4I2T A;  4D73 B;  1JHB A;  2O8V B;  14GS A;  4FYB A;  4WR5 A;  4IQ1 A;  2H66 A;  3ERW A;  4KCE A;  4MF6 A;  3LQ7 A;  1MDI A;  1EV4 A;  5IIZ A;  1V40 A;  2FLS A;  4QL9 A;  3EU3 A;  3GYK A;  5FWG A;  1Q4J A;  4V2N A;  4AGS A;  5G1L A;  3ZYW A;  2GVP A;  1ERT A;  1ERW A;  4AF2 A;  4PXO A;  2GDR A;  1XWA A;  4G9H A;  4NHZ A;  5G5E A;  1SJI A;  3A3T A;  2C8U A;  3IBH A;  1XW9 A;  1M2B A;  5F8B A;  3UJ1 A;  1S3D A;  1U88 A;  2HT9 A;  3F63 A;  2GQM A;  3GMF A;  4ZL9 A;  1UVZ A;  2JSY A;  3L9V A;  4NXI A;  3NOF A;  2B1K A;  1VGL A;  1M9A A;  4K2D A;  1ACV A;  2MBS A;  1S3A A;  3BOA A;  3NZN A;  1Z9H A;  4GQF A;  3UOM A;  3APO A;  1PQN A;  3GTU B;  3F6F A;  2VCZ A;  3F4S A;  3WGX A;  2MZC A;  2VL2 C;  1NHY A;  4POK A;  3KTB A;  1V2A A;  3ME8 A;  4TR3 A;  2CV4 A;  3UVH A;  2VOC A;  4L8E A;  1VF1 A;  3CSJ A;  1VRS D;  2VCW A;  4JZQ A;  4JBB A;  3QR6 A;  4PUA A;  4ISD A;  1M0U A;  1R26 A;  5GAN D;  3KXO A;  3QMX A;  5D9W A;  2OE0 A;  2DBC A;  4KDX A;  3KP9 A;  2HE3 A;  4GWR A;  3KD0 A;  1T00 A;  4MF5 A;  1B9X C;  1SK0 A;  2PGT A;  2ZCT A;  3GUR A;  2N5F A;  2C3N A;  1SYX A;  4DVC A;  1SD9 A;  2C0G A;  3GV1 A;  3FR3 A;  1BJX A;  2CX3 A;  2CVB A;  4WBJ A;  3HJO A;  5E4W A;  3FY7 A;  5HFG A;  1K0O A;  1E2Y A;  3KEB A;  2IMK A;  3H93 A;  1WPI A;  5J9C A;  4L0W A;  5DQY A;  4KAE A;  3FR9 A;  4NV2 A;  2YN1 A;  1GTB A;  1ON4 A;  4PGT A;  4KDY A;  4IP6 A;  3IAM 2;  2V32 A;  3EE2 A;  4K6X A;  2R6K A;  2Z9S A;  4ZB8 A;  2NDO A;  1EV9 A;  2FWG A;  3LGC A;  4EVM A;  2DJ2 A;  2B3S A;  3H79 A;  3GHA A;  3TJB A;  3APS A;  1OYJ A;  2M80 A;  2F3M A;  2GTU A;  2QGV A;  4OD7 A;  5F06 A;  5IOW A;  3C8E A;  1GNE A;  5ECK B;  3RPN A;  4XTS A;  3TKQ A;  1WWJ A;  2HZE B;  3DIE A;  2L59 A;  1M9B A;  2GZP A;  1UN2 A;  3PIN A;  2RM6 A;  2HFD A;  1DE2 A;  1JZR A;  1FO5 A;  1WE0 A;  1YF1 A;  5B6N A;  2EIQ A;  5CYY A;  2PUK C;  3J7Y b;  2LS5 A;  4GRF A;  4HUA A;  4XS1 A;  2AJQ B;  1K0N A;  5ELA A;  2VAF A;  1KEB A;  1X5E A;  2YZU A;  1Z5Y E;  4IBP A;  1GNW A;  1M99 A;  4AJ6 A;  5HR0 A;  4CHS A;  2RLI A;  2MYG A;  5IMD A;  2HRF A;  4I8B A;  1EGO A;  1PSQ A;  2LJK A;  1SL0 B;  1K3O A;  2P0G A;  4ZBD A;  3VWV A;  2HI7 A;  2A2S A;  3D4T A;  4EDY A;  2RUE A;  1G0T A;  5ID2 A;  3HVV A;  4MZB A;  2L4C A;  5ECO B;  1XWK A;  2CAQ A;  1CQH A;  4AJ7 A;  3TKS E;  1GLQ A;  1AXD A;  5A4V A;  2VCV A;  2QKE A;  3HA9 A;  3LOR A;  4O5R A;  4WF5 A;  3Q19 A;  2F9S A;  4HEA 2;  5CO3 A;  4OFT A;  4XS4 A;  3A5W A;  4MLY A;  3VPT A;  4OMV A;  3EIN A;  4E8H A;  5ECL B;  4MK3 A;  4NPB A;  4N11 A;  4ZB6 A;  1SK1 A;  4OWY A;  4TVE A;  2FWH A;  5AGY A;  1FVK A;  1PD2 1;  3G7Y A;  4WF4 A;  1TRW A;  1RW1 A;  3IHQ A;  1ZL9 A;  4PUF C;  4I97 A;  3CYN A;  1GUM A;  2KHP A;  3VK9 A;  8GSS A;  1WOU A;  3VLN A;  2AYT A;  1QUW A;  5B7C A;  1W89 A;  2VLV A;  3IK7 A;  4LMW A;  1C72 A;  2HZF A;  5H5S A;  3M3M A;  3ED3 A;  2EIR A;  1GSF A;  1UC7 A;  2RII A;  5JWQ B;  1EEJ A;  3F3R A;  3RBT A;  5ECP B;  4O32 A;  1YEX A;  2YWN A;  2PU9 C;  4KA0 A;  3KH7 A;  2DSA A;  4IJI A;  4OO5 A;  3D0Z A;  4HDE A;  5CNW A;  1WP0 A;  2PN8 A;  1V57 A;  3UMA A;  3AY8 A;  1GSE A;  11GS A;  4ECC A;  1A8L A;  2JL4 A;  2TRC P;  1F3A A;  1U87 A;  5G31 A;  3WGD A;  4IJ3 A;  1SEN A;  5CRD A;  4ZL7 A;  1EGR A;  1EEM A;  4NAX A;  3BJ5 A;  4POM A;  2FA4 A;  3TCO A;  4HQZ A;  5E59 A;  3UBK A;  2XPD A;  2OKA A;  3FEU A;  4XHM A;  3UBL A;  1TU7 A;  5HR3 A;  3EWL A;  3DML A;  1THX A;  3H8Q A;  1HNB A;  2RM5 A;  3FRC A;  4MDC A;  1BG5 A;  1QXH A;  3ERG A;  5EY6 A;  4FYU A;  2VLT A;  5J4U A;  1Q98 A;  2JU5 A;  2LV3 A;  9GSS A;  2VM1 A;  2OE3 A;  4KE3 A;  3SBC A;  1XZO A;  2BTO T;  5DVB A;  2X8G A;  1Z3E A;  4KDU A;  16GS A;  4TRX A;  4HJ2 A;  1XWG A;  1A0F A;  1N2A A;  4IP1 A;  6GSX A;  4IKH A;  5LD0 A;  4F03 A;  3IR4 A;  3KJY A;  3GX0 A;  1OC9 A;  2HLS A;  4EC0 A;  4G2E A;  1A8Y A;  3VWW A;  1H4O A;  2O85 A;  3HVX A;  2OAD A;  2R3X A;  2E7P A;  4G19 A;  3ME7 A;  1TRV A;  1DUG A;  2H8L A;  3DKS A;  2A2R A;  3ZFB A;  3CTF A;  2MMZ A;  7GSS A;  2CQ9 A;  2K8S A;  3ZZX A;  1B48 A;  1F37 A;  4F0C A;  4ID0 A;  3TB2 A;  2LNT A;  3IC4 A;  1TK5 B;  1GSD A;  3CRU A;  1XIY A;  4IN0 A;  4D73 A;  2MMO A;  2C0E A;  2GGT A;  1GUK A;  3D6I A;  2H0H A;  3IK9 A;  2PMT A;  2RUF A;  3GIX A;  4TKY A;  1YF0 A;  1MEK A;  2B5Y A;  2WRT A;  1ST9 A;  1O8W A;  2FWE A;  4V2M A;  2CA8 A;  2V6K A;  1T8E B;  2L6D A;  3LWA A;  1XXU A;  5DQS A;  2H1B A;  2C0F A;  5EPF A;  1UA5 A;  4GSN A;  3TJJ A;  1E6B A;  1LBK A;  1IYH A;  2GT5 A;  2V2G A;  2D2Z A;  3KTL A;  3EYT A;  5ECQ B;  2KLX A;  3D21 A;  6GSS A;  1HNA A;  1NSW A;  3L78 A;  3GNJ A;  3DGQ A;  1BX9 A;  2PVO C;  3FYG A;  2L4Q A;  3HZ8 A;  3Q74 A;  4TW5 A;  3F3Q A;  2P5Q A;  1G7O A;  2VCT A;  4N0Z A;  3GKM A;  3KMO A;  2H6Z A;  1EWX A;  5AN1 A;  2LJA A;  2LKU A;  4V1A g;  5DJM A;  1Z7R A;  4GCI A;  4MH2 A;  4YAV A;  4BVX A;  3PGT A;  5ECN B;  1GSS A;  4K7O A;  3F8U A;  2C4J A;  5ECM B;  3QD9 A;  2GZZ A;  4LL1 B;  4I5Q A;  3HXS A;  5C00 A;  5IOX A;  2CVK A;  4ACS A;  1LJR A;  3HJP A;  2FHE A;  4L5L A;  1YDK A;  1YKA A;  4KGI A;  4RI6 A;  4GXZ A;  3PH9 A;  3HVS A;  3QOU A;  1PL1 A;  3QPM A;  3S9F A;  3M9K A;  5HFI A;  12GS A;  2XPE A;  4EL1 A;  3HDC A;  1TRS A;  3P8W A;  1DBY A;  1U6T A;  3GL3 A;  2LJR A;  1FB6 A;  5JWO B;  5KN3 A;  5IMV A;  1XOB A;  3A2W A;  1ERV A;  1QMV A;  4AJ8 A;  1JZO A;  3GKK A;  4IVF A;  3HZ4 A;  1RK4 A;  1NHO A;  2H70 A;  1IYI A;  2ZNM A;  5A4W A;  3IDV A;  4O92 A;  5IMA A;  1EOG A;  3US3 A;  5B8A A;  4BVY A;  4PQH A;  2WFC A;  1QFN A;  3LYP A;  2CT6 A;  3GH6 A;  1AQX A;  5DAK B;  2PVQ A;  3M8N A;  1XVW A;  1QK8 A;  1OE7 A;  1XCC A;  2CAI A;  4ECJ A;  2IFQ B;  3RAZ A;  2EIO A;  4E8E A;  1O73 A;  3M1G A;  3C73 A;  3QDN A;  2B1L A;  4F2I A;  2FCH A;  5HQP A;  2DC5 A;  2FD3 A;  2I9H A;  4ULX A;  1GSQ A;  3TRX A;  2DJ0 A;  5DCG A;  3ZLP A;  4Q5Q A;  4EDZ A;  3W8S A;  2LQQ A;  5A4U A;  4JU5 A;  4N0V A;  2IL3 A;  4K8M A;  1OKD A;  4KUN A;  3ZVJ D;  5J3R A;  2I1U A;  1B8X A;  5AIS A;  4XCS A;  3IV4 A;  3BBY A;  4PQ1 A;  3EU4 A;  3I43 A;  1EP7 A;  1A2M A;  2E2G A;  2VO4 A;  5B8B A;  3P2A A;  4WEY A;  4XIH A;  2VM2 A;  1ILO A;  4HS1 A;  1QGV A;  3DXB A;  3KIJ A;  2VD1 A;  1X9W B;  5D73 A;  1TKD B;  5D9T A;  2I3Y A;  2JSZ A;  2IMD A;  1ZCP A;  2ON5 A;  2REM A;  2DMM A;  3CSH A;  3FW2 A;  2FUG 2;  3CXG A;  2KP2 A;  3C7M A;  3L4N A;  3J7Y k;  2H6X A;  4GSS A;  2K18 A;  2B5E A;  4J57 E;  1R4W A;  4NWY A;  1XVQ A;  1A0R P;  2YJH A;  1TU8 A;  3EC3 A;  2M46 A;  1AIU A;  3FZ4 A;  4IHU A;  3FKF A;  2C3T A;  2O87 A;  1OAZ A;  2AAW A;  3LSZ A;  22GS A;  4MPF A;  1B9Y C;  3U5R E;  3IOS A;  4PNG A;  1W4V A;  1FOV A;  3KP8 A;  2VUP A;  2PPT A;  3KZQ A;  4JED A;  1LU4 A;  1OC3 A;  2R2J A;  1YY7 A;  3QFA C;  1T3B A;  5J9B A;  1SKW B;  1J08 A;  2H76 A;  5B6M A;  3F4T A;  5JCW A;  2H75 A;  2MMA A;  1SKS B;  1AW9 A;  6GSV A;  1TXX A;  2LQO A;  4TXO B;  2E0Q A;  3MSZ A;  5L71 A;  3IRA A;  1Z6M A;  4L5O A;  1KBN A;  3GKX A;  2H1A A;  4PX1 A;  2GZY A;  3VFI A;  1G6W A;  5KN2 A;  2YZH A;  1FB0 A;  2KUC A;  4HJM A;  1MTC A;  4EO3 A;  1TI1 A;  2GQL A;  4XS6 A;  2CVD A;  3QAW A;  1BAY A;  3GUS A;  2YCD A;  4N10 A;  2FWF A;  1TRU A;  3L9S A;  3MAK A;  5J41 A;  2HSY A;  4POL A;  3EMP A;  4YQU A;  2R5G A;  2M72 A;  1T7P B;  1EP8 A;  3CBU A;  3N5O A;  1V98 A;  1BYE A;  2WUL A;  1WIK A;  1T4Y A;  4DSS A;  3FR6 A;  3LYK A;  3WGE A;  2OE1 A;  1SU9 A;  2YNX A;  4JE1 A;  2X64 A;  1B4Q A;  1OC8 A;  3CRT A;  2IMI A;  3OR5 A;  1V9W A;  3ZMK A;  4K7I A;  5ECH B;  3FZA A;  4J56 E;  1TK0 B;  5F05 A;  3UVT A;  1O7U A;  4WKW A;  2DML A;  3RPP A;  1SJ6 A;  5ECS A;  4TR1 B;  2FA8 A;  1DSB A;  2VIM A;  1AAZ A;  1EZK A;  1HD2 A;  1X9M B;  5D96 A;  2LRN A;  2AB6 A;  2GSR A;  4FYC A;  1B4P A;  1KNG A;  3F9U A;  4DEJ A;  4TOP A;  1ZGN A;  4QQ7 A;  2L5O A;  1J0F A;  3IA1 A;  2N5B A;  5GAP D;  5CP1 A;  4KSO A;  4MCU A;  2K9F A;  3GFK A;  2GST A;  4MA9 A;  4F9Z A;  4NV5 A;  2OA7 A;  2PBJ A;  1XOA A;  4DSR A;  3I6A A;  3G9B A;  2HNL A;  3BD2 A;  3F6D A;  4BL7 A;  4P3Y B;  5AIX A;  1O6J A;  3D5J A;  4LLR A;  3QCP A;  1MDK A;  2PWJ A;  2JAD A;  4FO5 A;  2JZS A;  4K9Z A;  2FY6 A;  3ZIV A;  3TKR A;  4EUY A;  4MP4 A;  4O7H A;  2K8V A;  4BWQ A;  4MJC A;  1T4Z A;  3L0H A;  1F6M C;  3DEX A;  1FW1 A;  4KH7 A;  3MDK A;  2X99 A;  3QAG A;  3UAR A;  3ZFL A;  2GSQ A;  1OKT A;  1SYR A;  2LTK A;  4V2L A;  1Y25 A;  5CRG A;  5CRE A;  4I2U A;  1S3C A;  1GTI A;  3E9J B;  2L6C A;  3P7X A;  1K3L A;  2MMN A;  2WCI A;  3EMX A;  3CTG A;  4XRD A;  3LG6 A;  2WJU A;  3KH9 A;  2CZ2 A;  4F82 A;  1GWC A;  1SD8 A;  2GS3 A;  3TJK A;  5JCU A;  3DD3 A;  6GSW A;  1U3A A;  5D8I A;  2YAN A;  2ON7 A;  1BED A;  1A24 A;  3BCI A;  2JAC A;  4EF0 A;  4YQM A;  2XHF A;  2IPA A;  2DJ1 A;  3TRP A;  2DIZ A;  2HXK A;  1TDI A;  3IXR A;  2YV7 A;  5DDL A;  3D4M A;  1KTE A;  5A5K A;  5DAL B;  3HJM A;  4OCF A;  1ABA A;  4WR4 A;  4K7N A;  1SL1 B;  2B7K A;  3ZVJ A;  2DIY A;  3V1W A;  1VF3 A;  1XWC A;  2I81 A;  1AUC A;  2JZR A;  5IO2 A;  3CMI A;  4RI7 A;  5IM9 A;  5IPH A;  2FNO A;  2WZ9 A;  3VWX A;  1A2J A;  4MJA A;  4WBR D;  3QFB C;  5DJL A;  4Q5F A;  1V58 A;  2ES7 A;  3PR8 A;  3I69 A;  4X1U A;  2YJ7 A;  4GST A;  3SWL A;  1TTZ A;  2CZ3 A;  2LUS A;  4EKZ A;  1X0R A;  3O76 A;  3U6V A;  2F8F A;  2B5X A;  4N30 A;  2OBI A;  1CQG A;  2O89 A;  3M9J A;  1FG4 A;  2N5A A;  3MWH A;  2F51 A;  3CSI A;  3H4K A;  3P90 A;  2G0F A;  1WMJ A;  3DYR A;  1PKW A;  2BMX A;  5ELG A;  1MD4 A;  6GST A;  2TRX A;  2VL2 A;  1BQ7 A;  4MJE A;  4HI7 A;  2AHE A;  1JFU A;  3ERF A;  3O6T A;  4G10 A;  1R7H A;  3GTU A;  1O8X A;  2DLX A;  3TJG A;  3GST A;  1AC1 A;  1GH2 A;  3HY2 A;  10GS A;  4I6X A;  1H75 A;  4JRR A;  1SJZ A;  2C1Y A;  3JCM L;  2GT6 A;  1TJD A;  3ZRE A;  3TUE A;  1NM3 A;  1K0D A;  1SKR B;  3GSS A;  2P5R A;  4EE0 A;  3E0U A;  3EUR A;  4YQV A;  1OE8 A;  2H74 A; 
#chains in the Genus database with same CATH topology
 1R5P A;  5C04 A;  1PKZ A;  3QAV A;  1JZW A;  3A2X A;  4BWS A;  3ZTL A;  2F8A A;  1ZOF A;  1O81 A;  4ML6 A;  4V1A p;  3WT2 A;  2IIY A;  1TW9 A;  2L57 A;  3F4R A;  1M3I A;  4OFM A;  3WYW A;  2WB9 A;  3GN3 A;  1PN0 A;  2IN3 A;  5LCZ A;  1TP9 A;  3TKS A;  1F3B A;  3VI5 A;  4RQR A;  3H1N A;  4JR4 A;  4X4J A;  5COH A;  2KP1 A;  5HR2 A;  6GSY A;  1DE1 A;  4ZXG A;  4MZC A;  2H0I A;  1XW6 A;  3KMN A;  1TI3 A;  5LNK e;  4MMM A;  4YAP A;  2H19 A;  3UAP A;  1I9D A;  2B6M A;  2R4V A;  2O7K A;  4NMU A;  1JZD A;  1XPV A;  4GF0 A;  5D9X A;  2G2Q A;  4X43 A;  3D22 A;  2IJY A;  1MD3 A;  1GSU A;  3LXT A;  5DAK A;  1M2A A;  3TKS C;  5INY A;  5IQY A;  4XRA A;  20GS A;  2HRN A;  3KM6 A;  2IFQ A;  2QC7 A;  4TN8 A;  2LRT A;  4GQC A;  13GS A;  5IMC A;  2OBK A;  3FK8 A;  2X8H A;  4IGJ A;  3ZIT A;  5DCH A;  1TK8 B;  1X5D A;  5H5Q A;  2E2M A;  1ZYQ B;  5IMF A;  4ECI A;  5G2Z A;  2HSM A;  4KB3 A;  4A5P A;  4ML1 A;  3TOU A;  4ZBA A;  4MF7 A;  3GH9 A;  1SK2 A;  2LEG A;  5CAX A;  3C71 A;  1ZZY A;  3MNG A;  3C1S A;  3FZ5 A;  2HZE A;  2MBT A;  4Q5N A;  2C0D A;  5D93 A;  3ZL5 A;  2HRA A;  2B7J A;  4TR4 A;  3TKP A;  3UEM A;  1T1V A;  1FVJ A;  2X8C A;  3TOT A;  5HR1 A;  1N8J A;  3HCZ A;  2H0G A;  2VCX A;  1AQV A;  3GRX A;  2PER A;  2VD0 A;  1WJK A;  2VL3 A;  2IMF A;  1VF2 A;  4RQX A;  2XC2 A;  3DVW A;  4ZL8 A;  1M7T A;  1ZMA A;  3KGK A;  2CX4 A;  3DVX A;  4MPG A;  2YV9 A;  4YKF A;  5HFK A;  2H1D A;  3LEF A;  2NBS A;  2OAC A;  2VL9 A;  2I4A A;  3MYD A;  4L0U A;  4LA1 A;  1K3Y A;  3PPU A;  1GP1 A;  4Q5R A;  1G7E A;  17GS A;  1RQM A;  4IQA A;  2NTO A;  3I9V 2;  1HYU A;  2BJX A;  5FT3 A;  1ML6 A;  3UIW A;  4OO4 A;  4OFN A;  3R2Q A;  1GL8 A;  2LNS A;  3ISO A;  6GSU A;  5JWR B;  3ZIJ A;  2NPB A;  4TR0 A;  1USB A;  4MAB A;  4CW9 A;  3VWU A;  1YZX A;  18GS A;  1GTU A;  5AIV A;  5JCG A;  1YEP A;  1YQ1 A;  1JLV A;  5D9V A;  1FOH A;  2H71 A;  4GTU A;  4K0G A;  4IS0 A;  4J2F A;  4LMV A;  4ZBB A;  5KEJ A;  4BPY A;  2H30 A;  3DWV A;  5ID2 B;  4POB A;  2H73 A;  1PGT A;  4PUR A;  3ZRD A;  3VPQ A;  4TXO A;  3NIV A;  2GLR A;  2YWM A;  3IAS 2;  1JLW A;  3HYP A;  3LFL A;  3W8J A;  5GZZ B;  2GQK A;  2TIR A;  3O3T A;  5ECR B;  1F9M A;  2GSS A;  4X0X A;  4DSQ A;  1K0C A;  4WXT A;  4XS4 B;  2P31 A;  5IO0 A;  2L5L A;  3GL5 A;  4K1F A;  4HQS A;  5GST A;  3HKR A;  3HHV A;  4ZB9 A;  3K8N A;  1PA3 A;  4OCE A;  2J9H A;  1URM A;  4JR6 A;  2VCQ A;  1GRX A;  5FHI A;  3WD6 A;  2C3Q A;  1SL2 B;  3RHC A;  2H1G A;  3LXZ A;  1GLP A;  5DBQ A;  4KCA A;  4MJB A;  1A23 A;  1AQW A;  2VLU A;  3Q18 A;  5IMZ A;  1R5A A;  4YH2 A;  3UL3 A;  1HNC A;  2WGR A;  1X9S B;  1YKC A;  3C1R A;  4YKG A;  4LL4 B;  3TJF A;  3A2V A;  2KOK A;  2H6Y A;  2WS2 A;  4FH8 A;  5CRW A;  5ENU A;  2HYX A;  4KW6 A;  1GSY A;  3ZML A;  2ALB A;  4TR1 A;  4F0B A;  4RUV A;  2J23 A;  5ECI B;  4QL7 A;  4DSS B;  5IPG A;  3G7I A;  1ERU A;  3VI7 A;  2V1M A;  4HU7 A;  1VF4 A;  2OJL A;  4KSM A;  2QSI A;  5G1K A;  4ZIL A;  1X5C A;  3EVI A;  1FHE A;  3M0F A;  3Q6O A;  3KCM A;  1YJ6 A;  5H5R A;  2YP6 A;  3FZ9 A;  2XBI A;  1XW5 A;  3HD5 A;  1OVN A;  4KX4 A;  5G5F A;  4MH3 A;  2IWT A;  2YPM A;  1NW2 A;  2AUV A;  1K0M A;  1QQ2 A;  2AV4 A;  4IW9 A;  3BCK A;  2H72 A;  4GLT A;  4PQI A;  1Z6N A;  4H86 A;  2JZT A;  1PX6 A;  1PRX A;  5G30 A;  5F0G A;  5EL8 A;  2DKH A;  2DJ3 A;  3F0I A;  3W6G A;  5KN1 A;  2V6O A;  4EXJ A;  2WDU A;  3L9U A;  2YWO A;  4HU9 A;  5CRH A;  2K6V A;  4HOJ A;  2H01 A;  4K0N A;  2XBQ A;  3IE3 A;  1Z7P A;  4ILF A;  1J9B A;  2HSH A;  1GUL A;  3IPZ A;  4IEL A;  4HZ4 A;  4KND A;  3E3E A;  2R0C A;  1I5G A;  5KN0 A;  1WRY A;  3RHB A;  4FIW A;  2R37 A;  5EVO A;  2YWI A;  3G7J A;  1XFL A;  1HQO A;  3GKN A;  1XBS A;  2LST A;  2EC4 A;  3TGZ A;  4CDO A;  3LJR A;  5GSS A;  4BA7 A;  1PL2 A;  1PN9 A;  3TDG A;  3DRN A;  1TOF A;  1THO A;  2ZUP A;  1PMT A;  1K0A A;  1G6Y A;  19GS A;  2V41 A;  4HZ2 A;  1GUH A;  1U3I A;  4ECB A;  1ZYE A;  1PX7 A;  2C80 A;  4MZW A;  5DAL A;  1Y6E A;  2IME A;  2NVL A;  1OC9 B;  1EOH A;  2A4V A;  1F2E A;  4ZIJ A;  5F07 A;  4NHW A;  4PNF A;  3FHK A;  3RDW A;  1O85 A;  1A2L A;  2DJJ A;  4TXV A;  2DJK A;  2FGX A;  4Z7X A;  1M2D A;  1XWB A;  2LRC A;  4WET A;  5ABR A;  3GA4 A;  1FAA A;  3N9J A;  3TRQ A;  5J5N A;  2YOI A;  1GTA A;  3GX8 A;  3APQ A;  3WT1 A;  1K0B A;  1MDJ A;  3VUR A;  4I2T A;  4D73 B;  1JHB A;  2A2P A;  2O8V B;  14GS A;  4FYB A;  4WR5 A;  4IQ1 A;  2H66 A;  3ERW A;  4KCE A;  4MF6 A;  3LQ7 A;  1MDI A;  1EV4 A;  5IIZ A;  1V40 A;  2FLS A;  4QL9 A;  3EU3 A;  3GYK A;  5FWG A;  1Q4J A;  4V2N A;  4AGS A;  5G1L A;  3ZYW A;  2GVP A;  1ERT A;  1ERW A;  4AF2 A;  4PXO A;  2GDR A;  1XWA A;  4G9H A;  4NHZ A;  5G5E A;  1SJI A;  3A3T A;  4PTS A;  2C8U A;  3IBH A;  1XW9 A;  1M2B A;  5F8B A;  3UJ1 A;  1S3D A;  1U88 A;  2HT9 A;  3F63 A;  2GQM A;  3GMF A;  4ZL9 A;  1UVZ A;  2JSY A;  3L9V A;  4NXI A;  3NOF A;  2B1K A;  2R0G A;  1VGL A;  1M9A A;  4K2D A;  1ACV A;  2MBS A;  1S3A A;  3BOA A;  3NZN A;  1Z9H A;  4GQF A;  3UOM A;  3APO A;  4Z2R A;  1PQN A;  3GTU B;  2X4A A;  3F6F A;  2VCZ A;  3F4S A;  3WGX A;  2MZC A;  2VL2 C;  1NHY A;  4POK A;  3KTB A;  1V2A A;  3ME8 A;  4TR3 A;  2CV4 A;  3UVH A;  2VOC A;  4L8E A;  4BVX B;  1VF1 A;  3CSJ A;  1VRS D;  2VCW A;  4JZQ A;  4JBB A;  3QR6 A;  4PUA A;  4ISD A;  1M0U A;  1R26 A;  4EIP A;  5GAN D;  3KXO A;  3QMX A;  5D9W A;  2OE0 A;  2DBC A;  4KDX A;  3KP9 A;  2HE3 A;  4GWR A;  3KD0 A;  1T00 A;  4MF5 A;  1B9X C;  1SK0 A;  2PGT A;  2ZCT A;  3GUR A;  2N5F A;  2C3N A;  1SYX A;  4DVC A;  1SD9 A;  2C0G A;  4CY6 A;  3GV1 A;  3FR3 A;  1BJX A;  2CX3 A;  2CVB A;  3MIX A;  4WBJ A;  3HJO A;  5E4W A;  3FY7 A;  5HFG A;  1K0O A;  1E2Y A;  3KEB A;  2IMK A;  3H93 A;  1WPI A;  5J9C A;  4L0W A;  5DQY A;  4KAE A;  4BVY B;  3FR9 A;  4NV2 A;  2YN1 A;  1GTB A;  1ON4 A;  4PGT A;  4KDY A;  4IP6 A;  3IAM 2;  2V32 A;  3EE2 A;  4K6X A;  4KF9 A;  2R6K A;  2Z9S A;  4EIQ A;  4ZB8 A;  2X49 A;  2NDO A;  1EV9 A;  4CY8 A;  2FWG A;  3LGC A;  4EVM A;  2DJ2 A;  2B3S A;  3H79 A;  3GHA A;  3TJB A;  3APS A;  1OYJ A;  2M80 A;  2F3M A;  1M3J A;  2GTU A;  2QGV A;  4OD7 A;  5F06 A;  5IOW A;  3C8E A;  1GNE A;  5ECK B;  3RPN A;  4XTS A;  3TKQ A;  1WWJ A;  2HZE B;  3DIE A;  2L59 A;  1M9B A;  2GZP A;  1UN2 A;  3PIN A;  2RM6 A;  2HFD A;  1DE2 A;  1JZR A;  1FO5 A;  1WE0 A;  1YF1 A;  5B6N A;  2EIQ A;  5CYY A;  2PUK C;  3J7Y b;  3IC8 A;  5BRT A;  2LS5 A;  4GRF A;  4HUA A;  4XS1 A;  2AJQ B;  1K0N A;  5ELA A;  2VAF A;  1KEB A;  1X5E A;  2YZU A;  4HSC X;  1Z5Y E;  4IBP A;  1GNW A;  1M99 A;  4AJ6 A;  5HR0 A;  4CHS A;  2QA2 A;  2RLI A;  2MYG A;  5IMD A;  2HRF A;  4I8B A;  4USS A;  1EGO A;  1PSQ A;  2LJK A;  5BMU A;  1SL0 B;  1K3O A;  2P0G A;  4ZBD A;  3VWV A;  2HI7 A;  2A2S A;  3D4T A;  4EDY A;  2RUE A;  1G0T A;  5ID2 A;  3HVV A;  4MZB A;  2L4C A;  5ECO B;  1XWK A;  2CAQ A;  1CQH A;  4AJ7 A;  3TKS E;  1GLQ A;  2R0P A;  1AXD A;  5A4V A;  2VCV A;  2QKE A;  3HA9 A;  3LOR A;  4O5R A;  4WF5 A;  3Q19 A;  2F9S A;  4HEA 2;  5CO3 A;  4OFT A;  4XS4 A;  3A5W A;  4MLY A;  3VPT A;  4OMV A;  3EIN A;  4E8H A;  5ECL B;  4MK3 A;  4NPB A;  4N11 A;  4ZB6 A;  1SK1 A;  4OWY A;  4TVE A;  2FWH A;  5AGY A;  1FVK A;  1PD2 1;  1S3R A;  3G7Y A;  4WF4 A;  1TRW A;  1RW1 A;  3IHQ A;  1ZL9 A;  4PUF C;  4I97 A;  3CYN A;  1GUM A;  2KHP A;  3VK9 A;  8GSS A;  1WOU A;  3VLN A;  2AYT A;  1QUW A;  5B7C A;  1W89 A;  2VLV A;  3IK7 A;  4LMW A;  1C72 A;  2HZF A;  5H5S A;  3M3M A;  3ED3 A;  2EIR A;  1GSF A;  1UC7 A;  4BIK A;  2RII A;  5JWQ B;  1EEJ A;  3F3R A;  3RBT A;  5ECP B;  4O32 A;  1YEX A;  2YWN A;  2PU9 C;  4KA0 A;  3KH7 A;  2DSA A;  4IJI A;  4OO5 A;  3D0Z A;  4HDE A;  5CNW A;  1WP0 A;  2PN8 A;  1V57 A;  3UMA A;  3AY8 A;  1GSE A;  11GS A;  4ECC A;  1A8L A;  2JL4 A;  4K5R A;  2TRC P;  1F3A A;  1U87 A;  5G31 A;  3WGD A;  4IJ3 A;  1SEN A;  5CRD A;  4ZL7 A;  1EGR A;  1EEM A;  4NAX A;  3BJ5 A;  4MNN A;  4POM A;  2FA4 A;  3TCO A;  4HQZ A;  5E59 A;  3UBK A;  2XPD A;  2OKA A;  3FEU A;  4XHM A;  3UBL A;  1TU7 A;  1PFO A;  5HR3 A;  3EWL A;  4BL7 B;  3DML A;  1THX A;  3H8Q A;  1HNB A;  2RM5 A;  3FRC A;  4MDC A;  1BG5 A;  1QXH A;  3ERG A;  5EY6 A;  4FYU A;  2VLT A;  5J4U A;  1Q98 A;  2JU5 A;  2LV3 A;  9GSS A;  2QA1 A;  2VM1 A;  2OE3 A;  4KE3 A;  3SBC A;  1XZO A;  2BTO T;  5DVB A;  2X8G A;  1Z3E A;  4KDU A;  16GS A;  4TRX A;  4HJ2 A;  1XWG A;  1A0F A;  1N2A A;  4IP1 A;  6GSX A;  4IKH A;  5LD0 A;  4F03 A;  3IR4 A;  3KJY A;  3GX0 A;  1OC9 A;  2HLS A;  4EC0 A;  4Z2U A;  4G2E A;  1A8Y A;  3VWW A;  1H4O A;  2O85 A;  3HVX A;  2OAD A;  2R3X A;  2E7P A;  4G19 A;  3ME7 A;  1TRV A;  4K2X A;  1DUG A;  2H8L A;  3DKS A;  2A2R A;  3ZFB A;  3CTF A;  2MMZ A;  7GSS A;  2CQ9 A;  2K8S A;  3ZZX A;  1B48 A;  1F37 A;  4F0C A;  4ID0 A;  3TB2 A;  2LNT A;  3IC4 A;  1TK5 B;  1GSD A;  3CRU A;  1XIY A;  4IN0 A;  4D73 A;  2MMO A;  2C0E A;  4G0L A;  2GGT A;  1GUK A;  3D6I A;  4O5Q A;  2H0H A;  3IK9 A;  2PMT A;  2RUF A;  3GIX A;  4FQU A;  4TKY A;  1YF0 A;  1MEK A;  2B5Y A;  2WRT A;  1ST9 A;  3CQF A;  1O8W A;  2FWE A;  4V2M A;  2CA8 A;  2V6K A;  1T8E B;  3HVN A;  2L6D A;  3LWA A;  1XXU A;  5DQS A;  2H1B A;  2C0F A;  5EPF A;  1UA5 A;  3LW9 A;  4GSN A;  3TJJ A;  1E6B A;  1LBK A;  1IYH A;  2GT5 A;  2V2G A;  2D2Z A;  3KTL A;  3EYT A;  5ECQ B;  2KLX A;  3D21 A;  6GSS A;  1HNA A;  1NSW A;  3L78 A;  3GNJ A;  3DGQ A;  1BX9 A;  2PVO C;  3FYG A;  2L4Q A;  3HZ8 A;  3Q74 A;  4TW5 A;  3F3Q A;  2P5Q A;  1G7O A;  2VCT A;  4N0Z A;  3GKM A;  3KMO A;  2H6Z A;  1EWX A;  5AN1 A;  2LJA A;  2LKU A;  4V1A g;  5DJM A;  1Z7R A;  4GCI A;  4MH2 A;  4YAV A;  4BVX A;  3PGT A;  5ECN B;  1GSS A;  4K7O A;  3F8U A;  2C4J A;  5ECM B;  3QD9 A;  2GZZ A;  4LL1 B;  4I5Q A;  3HXS A;  5C00 A;  5IOX A;  2CVK A;  4ACS A;  1LJR A;  3HJP A;  2FHE A;  4L5L A;  1YDK A;  1YKA A;  4KGI A;  4RI6 A;  4GXZ A;  3PH9 A;  3HVS A;  3QOU A;  1PL1 A;  3QPM A;  3S9F A;  3M9K A;  5HFI A;  12GS A;  2XPE A;  4EL1 A;  3HDC A;  1TRS A;  3P8W A;  1DBY A;  1U6T A;  3GL3 A;  2LJR A;  1FB6 A;  5JWO B;  5KN3 A;  5IMV A;  1XOB A;  3A2W A;  1ERV A;  1QMV A;  4AJ8 A;  1JZO A;  3GKK A;  4IVF A;  3HZ4 A;  1RK4 A;  1NHO A;  2H70 A;  1IYI A;  4G0I A;  2ZNM A;  5A4W A;  3IDV A;  4O92 A;  5IMA A;  1EOG A;  3US3 A;  5B8A A;  4BVY A;  4PQH A;  2WFC A;  2DKI A;  1QFN A;  3LYP A;  2CT6 A;  3GH6 A;  1AQX A;  5DAK B;  2PVQ A;  3M8N A;  1XVW A;  1QK8 A;  1OE7 A;  1XCC A;  2CAI A;  4ECJ A;  2IFQ B;  3RAZ A;  2EIO A;  4E8E A;  1O73 A;  3M1G A;  3C73 A;  3QDN A;  2B1L A;  4F2I A;  2FCH A;  5HQP A;  2DC5 A;  2FD3 A;  2I9H A;  4ULX A;  1GSQ A;  3TRX A;  2DJ0 A;  5DCG A;  3ZLP A;  4Q5Q A;  4EDZ A;  3W8S A;  2LQQ A;  5A4U A;  4JU5 A;  4N0V A;  2IL3 A;  4K8M A;  1OKD A;  4KUN A;  3ZVJ D;  5J3R A;  2I1U A;  1B8X A;  4G0K A;  5AIS A;  4XCS A;  3IV4 A;  3BBY A;  4PQ1 A;  3EU4 A;  3I43 A;  1EP7 A;  1A2M A;  2E2G A;  2VO4 A;  5B8B A;  3IHG A;  3P2A A;  4WEY A;  1ZYP A;  4XIH A;  2VM2 A;  1ILO A;  4HS1 A;  1QGV A;  3DXB A;  3KIJ A;  2VD1 A;  1X9W B;  5D73 A;  1TKD B;  2A4H A;  5D9T A;  2I3Y A;  2JSZ A;  2IMD A;  1ZCP A;  2ON5 A;  2REM A;  2DMM A;  3CSH A;  3FW2 A;  2FUG 2;  3CXG A;  2KP2 A;  3C7M A;  3L4N A;  3J7Y k;  2H6X A;  4GSS A;  2K18 A;  2B5E A;  4J57 E;  1R4W A;  4NWY A;  1XVQ A;  1A0R P;  2YJH A;  1TU8 A;  3EC3 A;  2M46 A;  1AIU A;  3FZ4 A;  4IHU A;  3FKF A;  2C3T A;  2O87 A;  1OAZ A;  2AAW A;  3LSZ A;  22GS A;  4MPF A;  1B9Y C;  3U5R E;  3IOS A;  4PNG A;  1W4V A;  1FOV A;  3KP8 A;  2VUP A;  3EPT A;  2PPT A;  3KZQ A;  4JED A;  1LU4 A;  1OC3 A;  2R2J A;  1YY7 A;  3QFA C;  1T3B A;  5J9B A;  1SKW B;  1J08 A;  2H76 A;  5B6M A;  3F4T A;  5JCW A;  2H75 A;  2MMA A;  3FMW A;  1SKS B;  1AW9 A;  6GSV A;  1TXX A;  2LQO A;  4TXO B;  2E0Q A;  3MSZ A;  5L71 A;  2UZ8 A;  3IRA A;  1Z6M A;  4L5O A;  1KBN A;  3GKX A;  2H1A A;  4PX1 A;  2GZY A;  3VFI A;  1G6W A;  5KN2 A;  2YZH A;  1FB0 A;  2KUC A;  1ZYN A;  4HJM A;  1MTC A;  4EO3 A;  1TI1 A;  2GQL A;  4XS6 A;  2CVD A;  3QAW A;  1BAY A;  3GUS A;  2YCD A;  4N10 A;  2FWF A;  1TRU A;  3L9S A;  3MAK A;  4Z2T A;  5J41 A;  2HSY A;  4POL A;  3EMP A;  4YQU A;  2R5G A;  2M72 A;  1XG8 A;  1T7P B;  1EP8 A;  3CBU A;  3N5O A;  1V98 A;  1BYE A;  2WUL A;  1WIK A;  1T4Y A;  4DSS A;  3FR6 A;  3LYK A;  3WGE A;  2OE1 A;  1SU9 A;  2YNX A;  4JE1 A;  2X64 A;  1B4Q A;  1OC8 A;  3CRT A;  2IMI A;  3OR5 A;  1V9W A;  3ZMK A;  4K7I A;  5ECH B;  3FZA A;  4J56 E;  1TK0 B;  5F05 A;  3UVT A;  1O7U A;  4WKW A;  4O5U A;  2DML A;  3RPP A;  1SJ6 A;  5ECS A;  4TR1 B;  2FA8 A;  1DSB A;  2VIM A;  1AAZ A;  1EZK A;  1HD2 A;  1X9M B;  5D96 A;  2LRN A;  2HRK A;  2AB6 A;  2GSR A;  4FYC A;  1B4P A;  1KNG A;  3F9U A;  4DEJ A;  4TOP A;  1ZGN A;  4QQ7 A;  2L5O A;  1J0F A;  3IA1 A;  2N5B A;  5GAP D;  5CP1 A;  4KSO A;  4MCU A;  3A5I A;  2K9F A;  3GFK A;  2GST A;  4MA9 A;  4F9Z A;  4NV5 A;  2OA7 A;  2PBJ A;  1XOA A;  4DSR A;  3I6A A;  3G9B A;  2HNL A;  3BD2 A;  3F6D A;  4BL7 A;  4P3Y B;  5AIX A;  1O6J A;  3D5J A;  4LLR A;  3QCP A;  1MDK A;  2PWJ A;  2JAD A;  4FO5 A;  2JZS A;  4K9Z A;  2FY6 A;  3ZIV A;  3TKR A;  4EUY A;  4MP4 A;  4O7H A;  2K8V A;  4BWQ A;  4MJC A;  1T4Z A;  3L0H A;  1F6M C;  3DEX A;  1FW1 A;  4KH7 A;  3MDK A;  2X99 A;  3QAG A;  3UAR A;  3ZFL A;  2GSQ A;  1OKT A;  1SYR A;  2LTK A;  4V2L A;  1Y25 A;  5CRG A;  5CRE A;  4I2U A;  1S3C A;  1GTI A;  3R3E A;  3E9J B;  2L6C A;  3P7X A;  1K3L A;  2MMN A;  2WCI A;  3EMX A;  3CTG A;  4XRD A;  3LG6 A;  2WJU A;  3KH9 A;  2CZ2 A;  4F82 A;  1GWC A;  1SD8 A;  2GS3 A;  4ICY A;  3TJK A;  5JCU A;  3DD3 A;  6GSW A;  1U3A A;  5D8I A;  2YAN A;  2ON7 A;  1BED A;  5KOW A;  1A24 A;  3BCI A;  2JAC A;  4EF0 A;  2XHF A;  4YQM A;  2IPA A;  2DJ1 A;  3TRP A;  2DIZ A;  2HXK A;  1TDI A;  3IXR A;  2YV7 A;  5DDL A;  3D4M A;  1KTE A;  5A5K A;  5DAL B;  3HJM A;  4OCF A;  1ABA A;  4WR4 A;  4K7N A;  1SL1 B;  2B7K A;  3ZVJ A;  2DIY A;  3V1W A;  5KOX A;  1VF3 A;  1XWC A;  2I81 A;  1AUC A;  2JZR A;  5IO2 A;  3CMI A;  4RI7 A;  5IM9 A;  5IPH A;  2FNO A;  2WZ9 A;  3VWX A;  1A2J A;  4K5S A;  4MJA A;  4WBR D;  3QFB C;  5DJL A;  4Q5F A;  1V58 A;  2ES7 A;  3PR8 A;  3I69 A;  4X1U A;  2YJ7 A;  4GST A;  3SWL A;  1TTZ A;  2CZ3 A;  2LUS A;  4EKZ A;  1X0R A;  3O76 A;  3U6V A;  2F8F A;  2B5X A;  4N30 A;  2OBI A;  1CQG A;  2O89 A;  3M9J A;  1FG4 A;  2N5A A;  3MWH A;  2F51 A;  3CSI A;  3H4K A;  3P90 A;  2G0F A;  1WMJ A;  3DYR A;  1PKW A;  2BMX A;  5ELG A;  1MD4 A;  6GST A;  2TRX A;  2VL2 A;  1BQ7 A;  4MJE A;  4HI7 A;  2AHE A;  1JFU A;  3ERF A;  3O6T A;  4G10 A;  1R7H A;  3GTU A;  1O8X A;  2DLX A;  3TJG A;  3GST A;  1AC1 A;  1GH2 A;  3HY2 A;  10GS A;  4I6X A;  1H75 A;  4JRR A;  1SJZ A;  2C1Y A;  3JCM L;  2GT6 A;  1TJD A;  3ZRE A;  3TUE A;  1NM3 A;  1K0D A;  1SKR B;  3GSS A;  2P5R A;  4EE0 A;  3E0U A;  3EUR A;  4YQV A;  1OE8 A;  2H74 A; 
#chains in the Genus database with same CATH homology
 1R5P A;  5C04 A;  1PKZ A;  3QAV A;  1JZW A;  3A2X A;  4BWS A;  3ZTL A;  2F8A A;  1ZOF A;  1O81 A;  4ML6 A;  4V1A p;  3WT2 A;  2IIY A;  1TW9 A;  2L57 A;  3F4R A;  4OFM A;  3WYW A;  2WB9 A;  3GN3 A;  1PN0 A;  2IN3 A;  5LCZ A;  1TP9 A;  3TKS A;  1F3B A;  3VI5 A;  4RQR A;  3H1N A;  4JR4 A;  4X4J A;  5COH A;  2KP1 A;  5HR2 A;  6GSY A;  1DE1 A;  4ZXG A;  4MZC A;  2H0I A;  1XW6 A;  3KMN A;  1TI3 A;  5LNK e;  4MMM A;  4YAP A;  2H19 A;  3UAP A;  1I9D A;  2B6M A;  2R4V A;  2O7K A;  4NMU A;  1JZD A;  1XPV A;  4GF0 A;  5D9X A;  2G2Q A;  4X43 A;  3D22 A;  2IJY A;  1MD3 A;  1GSU A;  3LXT A;  5DAK A;  1M2A A;  3TKS C;  5INY A;  5IQY A;  4XRA A;  20GS A;  2HRN A;  3KM6 A;  2IFQ A;  2QC7 A;  4TN8 A;  2LRT A;  4GQC A;  13GS A;  5IMC A;  2OBK A;  3FK8 A;  2X8H A;  4IGJ A;  3ZIT A;  5DCH A;  1TK8 B;  1X5D A;  5H5Q A;  2E2M A;  1ZYQ B;  5IMF A;  4ECI A;  5G2Z A;  2HSM A;  4KB3 A;  4A5P A;  4ML1 A;  3TOU A;  4ZBA A;  4MF7 A;  3GH9 A;  1SK2 A;  2LEG A;  5CAX A;  3C71 A;  1ZZY A;  3MNG A;  3C1S A;  3FZ5 A;  2HZE A;  2MBT A;  4Q5N A;  2C0D A;  5D93 A;  3ZL5 A;  2HRA A;  2B7J A;  4TR4 A;  3TKP A;  3UEM A;  1T1V A;  1FVJ A;  2X8C A;  3TOT A;  5HR1 A;  1N8J A;  3HCZ A;  2H0G A;  2VCX A;  1AQV A;  3GRX A;  2PER A;  2VD0 A;  1WJK A;  2VL3 A;  2IMF A;  1VF2 A;  4RQX A;  2XC2 A;  3DVW A;  4ZL8 A;  1M7T A;  1ZMA A;  3KGK A;  2CX4 A;  3DVX A;  4MPG A;  2YV9 A;  4YKF A;  5HFK A;  2H1D A;  3LEF A;  2NBS A;  2OAC A;  2VL9 A;  2I4A A;  3MYD A;  4L0U A;  4LA1 A;  1K3Y A;  3PPU A;  1GP1 A;  4Q5R A;  1G7E A;  17GS A;  1RQM A;  4IQA A;  2NTO A;  3I9V 2;  1HYU A;  2BJX A;  5FT3 A;  1ML6 A;  3UIW A;  4OO4 A;  4OFN A;  3R2Q A;  1GL8 A;  2LNS A;  3ISO A;  6GSU A;  5JWR B;  3ZIJ A;  2NPB A;  4TR0 A;  1USB A;  4MAB A;  4CW9 A;  3VWU A;  1YZX A;  18GS A;  1GTU A;  5AIV A;  5JCG A;  1YEP A;  1YQ1 A;  1JLV A;  5D9V A;  1FOH A;  2H71 A;  4GTU A;  4K0G A;  4IS0 A;  4J2F A;  4LMV A;  4ZBB A;  5KEJ A;  4BPY A;  2H30 A;  3DWV A;  5ID2 B;  4POB A;  2H73 A;  1PGT A;  4PUR A;  3ZRD A;  3VPQ A;  4TXO A;  3NIV A;  2GLR A;  2YWM A;  3IAS 2;  1JLW A;  3HYP A;  3LFL A;  3W8J A;  5GZZ B;  2GQK A;  2TIR A;  3O3T A;  5ECR B;  1F9M A;  2GSS A;  4X0X A;  4DSQ A;  1K0C A;  4WXT A;  4XS4 B;  2P31 A;  5IO0 A;  2L5L A;  3GL5 A;  4K1F A;  4HQS A;  5GST A;  3HKR A;  3HHV A;  4ZB9 A;  3K8N A;  1PA3 A;  4OCE A;  2J9H A;  1URM A;  4JR6 A;  2VCQ A;  1GRX A;  5FHI A;  3WD6 A;  2C3Q A;  1SL2 B;  3RHC A;  2H1G A;  3LXZ A;  1GLP A;  5DBQ A;  4KCA A;  4MJB A;  1A23 A;  1AQW A;  2VLU A;  3Q18 A;  5IMZ A;  1R5A A;  4YH2 A;  3UL3 A;  1HNC A;  2WGR A;  1X9S B;  1YKC A;  3C1R A;  4YKG A;  4LL4 B;  3TJF A;  3A2V A;  2KOK A;  2H6Y A;  2WS2 A;  4FH8 A;  5CRW A;  5ENU A;  2HYX A;  4KW6 A;  1GSY A;  3ZML A;  2ALB A;  4TR1 A;  4F0B A;  4RUV A;  2J23 A;  5ECI B;  4QL7 A;  4DSS B;  5IPG A;  3G7I A;  1ERU A;  3VI7 A;  2V1M A;  4HU7 A;  1VF4 A;  2OJL A;  4KSM A;  2QSI A;  5G1K A;  4ZIL A;  1X5C A;  3EVI A;  1FHE A;  3M0F A;  3Q6O A;  3KCM A;  1YJ6 A;  5H5R A;  2YP6 A;  3FZ9 A;  2XBI A;  1XW5 A;  3HD5 A;  1OVN A;  4KX4 A;  5G5F A;  4MH3 A;  2IWT A;  2YPM A;  1NW2 A;  2AUV A;  1K0M A;  1QQ2 A;  2AV4 A;  4IW9 A;  3BCK A;  2H72 A;  4GLT A;  4PQI A;  1Z6N A;  4H86 A;  2JZT A;  1PX6 A;  1PRX A;  5G30 A;  5F0G A;  5EL8 A;  2DKH A;  2DJ3 A;  3F0I A;  3W6G A;  5KN1 A;  2V6O A;  4EXJ A;  2WDU A;  3L9U A;  2YWO A;  4HU9 A;  5CRH A;  2K6V A;  4HOJ A;  2H01 A;  4K0N A;  2XBQ A;  3IE3 A;  1Z7P A;  4ILF A;  1J9B A;  2HSH A;  1GUL A;  3IPZ A;  4IEL A;  4HZ4 A;  4KND A;  3E3E A;  2R0C A;  1I5G A;  5KN0 A;  1WRY A;  3RHB A;  4FIW A;  2R37 A;  5EVO A;  2YWI A;  3G7J A;  1XFL A;  1HQO A;  3GKN A;  1XBS A;  2LST A;  2EC4 A;  3TGZ A;  4CDO A;  3LJR A;  5GSS A;  4BA7 A;  1PL2 A;  1PN9 A;  3TDG A;  3DRN A;  1TOF A;  1THO A;  2ZUP A;  1PMT A;  1K0A A;  1G6Y A;  19GS A;  2V41 A;  4HZ2 A;  1GUH A;  1U3I A;  4ECB A;  1ZYE A;  1PX7 A;  2C80 A;  4MZW A;  5DAL A;  1Y6E A;  2IME A;  2NVL A;  1OC9 B;  1EOH A;  2A4V A;  1F2E A;  4ZIJ A;  5F07 A;  4NHW A;  4PNF A;  3FHK A;  3RDW A;  1O85 A;  1A2L A;  2DJJ A;  4TXV A;  2DJK A;  2FGX A;  4Z7X A;  1M2D A;  1XWB A;  2LRC A;  4WET A;  5ABR A;  3GA4 A;  1FAA A;  3N9J A;  3TRQ A;  5J5N A;  2YOI A;  1GTA A;  3GX8 A;  3APQ A;  3WT1 A;  1K0B A;  1MDJ A;  3VUR A;  4I2T A;  4D73 B;  1JHB A;  2A2P A;  2O8V B;  14GS A;  4FYB A;  4WR5 A;  4IQ1 A;  2H66 A;  3ERW A;  4KCE A;  4MF6 A;  3LQ7 A;  1MDI A;  1EV4 A;  5IIZ A;  1V40 A;  2FLS A;  4QL9 A;  3EU3 A;  3GYK A;  5FWG A;  1Q4J A;  4V2N A;  4AGS A;  5G1L A;  3ZYW A;  2GVP A;  1ERT A;  1ERW A;  4AF2 A;  4PXO A;  2GDR A;  1XWA A;  4G9H A;  4NHZ A;  5G5E A;  1SJI A;  3A3T A;  4PTS A;  2C8U A;  3IBH A;  1XW9 A;  1M2B A;  5F8B A;  3UJ1 A;  1S3D A;  1U88 A;  2HT9 A;  3F63 A;  2GQM A;  3GMF A;  4ZL9 A;  1UVZ A;  2JSY A;  3L9V A;  4NXI A;  3NOF A;  2B1K A;  2R0G A;  1VGL A;  1M9A A;  4K2D A;  1ACV A;  2MBS A;  1S3A A;  3BOA A;  3NZN A;  1Z9H A;  4GQF A;  3UOM A;  3APO A;  4Z2R A;  1PQN A;  3GTU B;  2X4A A;  3F6F A;  2VCZ A;  3F4S A;  3WGX A;  2MZC A;  2VL2 C;  1NHY A;  4POK A;  3KTB A;  1V2A A;  3ME8 A;  4TR3 A;  2CV4 A;  3UVH A;  2VOC A;  4L8E A;  4BVX B;  1VF1 A;  3CSJ A;  1VRS D;  2VCW A;  4JZQ A;  4JBB A;  3QR6 A;  4PUA A;  4ISD A;  1M0U A;  1R26 A;  4EIP A;  5GAN D;  3KXO A;  3QMX A;  5D9W A;  2OE0 A;  2DBC A;  4KDX A;  3KP9 A;  2HE3 A;  4GWR A;  3KD0 A;  1T00 A;  4MF5 A;  1B9X C;  1SK0 A;  2PGT A;  2ZCT A;  3GUR A;  2N5F A;  2C3N A;  1SYX A;  4DVC A;  1SD9 A;  2C0G A;  4CY6 A;  3GV1 A;  3FR3 A;  1BJX A;  2CX3 A;  2CVB A;  3MIX A;  4WBJ A;  3HJO A;  5E4W A;  3FY7 A;  5HFG A;  1K0O A;  1E2Y A;  3KEB A;  2IMK A;  3H93 A;  1WPI A;  5J9C A;  4L0W A;  5DQY A;  4KAE A;  4BVY B;  3FR9 A;  4NV2 A;  2YN1 A;  1GTB A;  1ON4 A;  4PGT A;  4KDY A;  4IP6 A;  3IAM 2;  2V32 A;  3EE2 A;  4K6X A;  4KF9 A;  2R6K A;  2Z9S A;  4EIQ A;  4ZB8 A;  2X49 A;  2NDO A;  1EV9 A;  4CY8 A;  2FWG A;  3LGC A;  4EVM A;  2DJ2 A;  2B3S A;  3H79 A;  3GHA A;  3TJB A;  3APS A;  1OYJ A;  2M80 A;  2F3M A;  2GTU A;  2QGV A;  4OD7 A;  5F06 A;  5IOW A;  3C8E A;  1GNE A;  5ECK B;  3RPN A;  4XTS A;  3TKQ A;  1WWJ A;  2HZE B;  3DIE A;  2L59 A;  1M9B A;  2GZP A;  1UN2 A;  3PIN A;  2RM6 A;  2HFD A;  1DE2 A;  1JZR A;  1FO5 A;  1WE0 A;  1YF1 A;  5B6N A;  2EIQ A;  5CYY A;  2PUK C;  3J7Y b;  3IC8 A;  5BRT A;  2LS5 A;  4GRF A;  4HUA A;  4XS1 A;  2AJQ B;  1K0N A;  5ELA A;  2VAF A;  1KEB A;  1X5E A;  2YZU A;  1Z5Y E;  4IBP A;  1GNW A;  1M99 A;  4AJ6 A;  5HR0 A;  4CHS A;  2QA2 A;  2RLI A;  2MYG A;  5IMD A;  2HRF A;  4I8B A;  4USS A;  1EGO A;  1PSQ A;  2LJK A;  5BMU A;  1SL0 B;  1K3O A;  2P0G A;  4ZBD A;  3VWV A;  2HI7 A;  2A2S A;  3D4T A;  4EDY A;  2RUE A;  1G0T A;  5ID2 A;  3HVV A;  4MZB A;  2L4C A;  5ECO B;  1XWK A;  2CAQ A;  1CQH A;  4AJ7 A;  3TKS E;  1GLQ A;  2R0P A;  1AXD A;  5A4V A;  2VCV A;  2QKE A;  3HA9 A;  3LOR A;  4O5R A;  4WF5 A;  3Q19 A;  2F9S A;  4HEA 2;  5CO3 A;  4OFT A;  4XS4 A;  3A5W A;  4MLY A;  3VPT A;  4OMV A;  3EIN A;  4E8H A;  5ECL B;  4MK3 A;  4NPB A;  4N11 A;  4ZB6 A;  1SK1 A;  4OWY A;  4TVE A;  2FWH A;  5AGY A;  1FVK A;  1PD2 1;  3G7Y A;  4WF4 A;  1TRW A;  1RW1 A;  3IHQ A;  1ZL9 A;  4PUF C;  4I97 A;  3CYN A;  1GUM A;  2KHP A;  3VK9 A;  8GSS A;  1WOU A;  3VLN A;  2AYT A;  1QUW A;  5B7C A;  1W89 A;  2VLV A;  3IK7 A;  4LMW A;  1C72 A;  2HZF A;  5H5S A;  3M3M A;  3ED3 A;  2EIR A;  1GSF A;  1UC7 A;  2RII A;  5JWQ B;  1EEJ A;  3F3R A;  3RBT A;  5ECP B;  4O32 A;  1YEX A;  2YWN A;  2PU9 C;  4KA0 A;  3KH7 A;  2DSA A;  4IJI A;  4OO5 A;  3D0Z A;  4HDE A;  5CNW A;  1WP0 A;  2PN8 A;  1V57 A;  3UMA A;  3AY8 A;  1GSE A;  11GS A;  4ECC A;  1A8L A;  2JL4 A;  4K5R A;  2TRC P;  1F3A A;  1U87 A;  5G31 A;  3WGD A;  4IJ3 A;  1SEN A;  5CRD A;  4ZL7 A;  1EGR A;  1EEM A;  4NAX A;  3BJ5 A;  4MNN A;  4POM A;  2FA4 A;  3TCO A;  4HQZ A;  5E59 A;  3UBK A;  2XPD A;  2OKA A;  3FEU A;  4XHM A;  3UBL A;  1TU7 A;  5HR3 A;  3EWL A;  4BL7 B;  3DML A;  1THX A;  3H8Q A;  1HNB A;  2RM5 A;  3FRC A;  4MDC A;  1BG5 A;  1QXH A;  3ERG A;  5EY6 A;  4FYU A;  2VLT A;  5J4U A;  1Q98 A;  2JU5 A;  2LV3 A;  9GSS A;  2QA1 A;  2VM1 A;  2OE3 A;  4KE3 A;  3SBC A;  1XZO A;  2BTO T;  5DVB A;  2X8G A;  1Z3E A;  4KDU A;  16GS A;  4TRX A;  4HJ2 A;  1XWG A;  1A0F A;  1N2A A;  4IP1 A;  6GSX A;  4IKH A;  5LD0 A;  4F03 A;  3IR4 A;  3KJY A;  3GX0 A;  1OC9 A;  2HLS A;  4EC0 A;  4Z2U A;  4G2E A;  1A8Y A;  3VWW A;  1H4O A;  2O85 A;  3HVX A;  2OAD A;  2R3X A;  2E7P A;  4G19 A;  3ME7 A;  1TRV A;  4K2X A;  1DUG A;  2H8L A;  3DKS A;  2A2R A;  3ZFB A;  3CTF A;  2MMZ A;  7GSS A;  2CQ9 A;  2K8S A;  3ZZX A;  1B48 A;  1F37 A;  4F0C A;  4ID0 A;  3TB2 A;  2LNT A;  3IC4 A;  1TK5 B;  1GSD A;  3CRU A;  1XIY A;  4IN0 A;  4D73 A;  2MMO A;  2C0E A;  4G0L A;  2GGT A;  1GUK A;  3D6I A;  4O5Q A;  2H0H A;  3IK9 A;  2PMT A;  2RUF A;  3GIX A;  4FQU A;  4TKY A;  1YF0 A;  1MEK A;  2B5Y A;  2WRT A;  1ST9 A;  1O8W A;  2FWE A;  4V2M A;  2CA8 A;  2V6K A;  1T8E B;  2L6D A;  3LWA A;  1XXU A;  5DQS A;  2H1B A;  2C0F A;  5EPF A;  1UA5 A;  3LW9 A;  4GSN A;  3TJJ A;  1E6B A;  1LBK A;  1IYH A;  2GT5 A;  2V2G A;  2D2Z A;  3KTL A;  3EYT A;  5ECQ B;  2KLX A;  3D21 A;  6GSS A;  1HNA A;  1NSW A;  3L78 A;  3GNJ A;  3DGQ A;  1BX9 A;  2PVO C;  3FYG A;  2L4Q A;  3HZ8 A;  3Q74 A;  4TW5 A;  3F3Q A;  2P5Q A;  1G7O A;  2VCT A;  4N0Z A;  3GKM A;  3KMO A;  2H6Z A;  1EWX A;  5AN1 A;  2LJA A;  2LKU A;  4V1A g;  5DJM A;  1Z7R A;  4GCI A;  4MH2 A;  4YAV A;  4BVX A;  3PGT A;  5ECN B;  1GSS A;  4K7O A;  3F8U A;  2C4J A;  5ECM B;  3QD9 A;  2GZZ A;  4LL1 B;  4I5Q A;  3HXS A;  5C00 A;  5IOX A;  2CVK A;  4ACS A;  1LJR A;  3HJP A;  2FHE A;  4L5L A;  1YDK A;  1YKA A;  4KGI A;  4RI6 A;  4GXZ A;  3PH9 A;  3HVS A;  3QOU A;  1PL1 A;  3QPM A;  3S9F A;  3M9K A;  5HFI A;  12GS A;  2XPE A;  4EL1 A;  3HDC A;  1TRS A;  3P8W A;  1DBY A;  1U6T A;  3GL3 A;  2LJR A;  1FB6 A;  5JWO B;  5KN3 A;  5IMV A;  1XOB A;  3A2W A;  1ERV A;  1QMV A;  4AJ8 A;  1JZO A;  3GKK A;  4IVF A;  3HZ4 A;  1RK4 A;  1NHO A;  2H70 A;  1IYI A;  4G0I A;  2ZNM A;  5A4W A;  3IDV A;  4O92 A;  5IMA A;  1EOG A;  3US3 A;  5B8A A;  4BVY A;  4PQH A;  2WFC A;  2DKI A;  1QFN A;  3LYP A;  2CT6 A;  3GH6 A;  1AQX A;  5DAK B;  2PVQ A;  3M8N A;  1XVW A;  1QK8 A;  1OE7 A;  1XCC A;  2CAI A;  4ECJ A;  2IFQ B;  3RAZ A;  2EIO A;  4E8E A;  1O73 A;  3M1G A;  3C73 A;  3QDN A;  2B1L A;  4F2I A;  2FCH A;  5HQP A;  2DC5 A;  2FD3 A;  2I9H A;  4ULX A;  1GSQ A;  3TRX A;  2DJ0 A;  5DCG A;  3ZLP A;  4Q5Q A;  4EDZ A;  3W8S A;  2LQQ A;  5A4U A;  4JU5 A;  4N0V A;  2IL3 A;  4K8M A;  1OKD A;  4KUN A;  3ZVJ D;  5J3R A;  2I1U A;  1B8X A;  4G0K A;  5AIS A;  4XCS A;  3IV4 A;  3BBY A;  4PQ1 A;  3EU4 A;  3I43 A;  1EP7 A;  1A2M A;  2E2G A;  2VO4 A;  5B8B A;  3IHG A;  3P2A A;  4WEY A;  1ZYP A;  4XIH A;  2VM2 A;  1ILO A;  4HS1 A;  1QGV A;  3DXB A;  3KIJ A;  2VD1 A;  1X9W B;  5D73 A;  1TKD B;  2A4H A;  5D9T A;  2I3Y A;  2JSZ A;  2IMD A;  1ZCP A;  2ON5 A;  2REM A;  2DMM A;  3CSH A;  3FW2 A;  2FUG 2;  3CXG A;  2KP2 A;  3C7M A;  3L4N A;  3J7Y k;  2H6X A;  4GSS A;  2K18 A;  2B5E A;  4J57 E;  1R4W A;  4NWY A;  1XVQ A;  1A0R P;  2YJH A;  1TU8 A;  3EC3 A;  2M46 A;  1AIU A;  3FZ4 A;  4IHU A;  3FKF A;  2C3T A;  2O87 A;  1OAZ A;  2AAW A;  3LSZ A;  22GS A;  4MPF A;  1B9Y C;  3U5R E;  3IOS A;  4PNG A;  1W4V A;  1FOV A;  3KP8 A;  2VUP A;  3EPT A;  2PPT A;  3KZQ A;  4JED A;  1LU4 A;  1OC3 A;  2R2J A;  1YY7 A;  3QFA C;  1T3B A;  5J9B A;  1SKW B;  1J08 A;  2H76 A;  5B6M A;  3F4T A;  5JCW A;  2H75 A;  2MMA A;  3FMW A;  1SKS B;  1AW9 A;  6GSV A;  1TXX A;  2LQO A;  4TXO B;  2E0Q A;  3MSZ A;  5L71 A;  2UZ8 A;  3IRA A;  1Z6M A;  4L5O A;  1KBN A;  3GKX A;  2H1A A;  4PX1 A;  2GZY A;  3VFI A;  1G6W A;  5KN2 A;  2YZH A;  1FB0 A;  2KUC A;  1ZYN A;  4HJM A;  1MTC A;  4EO3 A;  1TI1 A;  2GQL A;  4XS6 A;  2CVD A;  3QAW A;  1BAY A;  3GUS A;  2YCD A;  4N10 A;  2FWF A;  1TRU A;  3L9S A;  3MAK A;  4Z2T A;  5J41 A;  2HSY A;  4POL A;  3EMP A;  4YQU A;  2R5G A;  2M72 A;  1T7P B;  1EP8 A;  3CBU A;  3N5O A;  1V98 A;  1BYE A;  2WUL A;  1WIK A;  1T4Y A;  4DSS A;  3FR6 A;  3LYK A;  3WGE A;  2OE1 A;  1SU9 A;  2YNX A;  4JE1 A;  2X64 A;  1B4Q A;  1OC8 A;  3CRT A;  2IMI A;  3OR5 A;  1V9W A;  3ZMK A;  4K7I A;  5ECH B;  3FZA A;  4J56 E;  1TK0 B;  5F05 A;  3UVT A;  1O7U A;  4WKW A;  4O5U A;  2DML A;  3RPP A;  1SJ6 A;  5ECS A;  4TR1 B;  2FA8 A;  1DSB A;  2VIM A;  1AAZ A;  1EZK A;  1HD2 A;  1X9M B;  5D96 A;  2LRN A;  2HRK A;  2AB6 A;  2GSR A;  4FYC A;  1B4P A;  1KNG A;  3F9U A;  4DEJ A;  4TOP A;  1ZGN A;  4QQ7 A;  2L5O A;  1J0F A;  3IA1 A;  2N5B A;  5GAP D;  5CP1 A;  4KSO A;  4MCU A;  3A5I A;  2K9F A;  3GFK A;  2GST A;  4MA9 A;  4F9Z A;  4NV5 A;  2OA7 A;  2PBJ A;  1XOA A;  4DSR A;  3I6A A;  3G9B A;  2HNL A;  3BD2 A;  3F6D A;  4BL7 A;  4P3Y B;  5AIX A;  1O6J A;  3D5J A;  4LLR A;  3QCP A;  1MDK A;  2PWJ A;  2JAD A;  4FO5 A;  2JZS A;  4K9Z A;  2FY6 A;  3ZIV A;  3TKR A;  4EUY A;  4MP4 A;  4O7H A;  2K8V A;  4BWQ A;  4MJC A;  1T4Z A;  3L0H A;  1F6M C;  3DEX A;  1FW1 A;  4KH7 A;  3MDK A;  2X99 A;  3QAG A;  3UAR A;  3ZFL A;  2GSQ A;  1OKT A;  1SYR A;  2LTK A;  4V2L A;  1Y25 A;  5CRG A;  5CRE A;  4I2U A;  1S3C A;  1GTI A;  3R3E A;  3E9J B;  2L6C A;  3P7X A;  1K3L A;  2MMN A;  2WCI A;  3EMX A;  3CTG A;  4XRD A;  3LG6 A;  2WJU A;  3KH9 A;  2CZ2 A;  4F82 A;  1GWC A;  1SD8 A;  2GS3 A;  4ICY A;  3TJK A;  5JCU A;  3DD3 A;  6GSW A;  1U3A A;  5D8I A;  2YAN A;  2ON7 A;  1BED A;  5KOW A;  1A24 A;  3BCI A;  2JAC A;  4EF0 A;  4YQM A;  2XHF A;  2IPA A;  2DJ1 A;  3TRP A;  2DIZ A;  2HXK A;  1TDI A;  3IXR A;  2YV7 A;  5DDL A;  3D4M A;  1KTE A;  5A5K A;  5DAL B;  3HJM A;  4OCF A;  1ABA A;  4WR4 A;  4K7N A;  1SL1 B;  2B7K A;  3ZVJ A;  2DIY A;  3V1W A;  5KOX A;  1VF3 A;  1XWC A;  2I81 A;  1AUC A;  2JZR A;  5IO2 A;  3CMI A;  4RI7 A;  5IM9 A;  5IPH A;  2FNO A;  2WZ9 A;  3VWX A;  1A2J A;  4K5S A;  4MJA A;  4WBR D;  3QFB C;  5DJL A;  4Q5F A;  1V58 A;  2ES7 A;  3PR8 A;  3I69 A;  4X1U A;  2YJ7 A;  4GST A;  3SWL A;  1TTZ A;  2CZ3 A;  2LUS A;  4EKZ A;  1X0R A;  3O76 A;  3U6V A;  2F8F A;  2B5X A;  4N30 A;  2OBI A;  1CQG A;  2O89 A;  3M9J A;  1FG4 A;  2N5A A;  3MWH A;  2F51 A;  3CSI A;  3H4K A;  3P90 A;  2G0F A;  1WMJ A;  3DYR A;  1PKW A;  2BMX A;  5ELG A;  1MD4 A;  6GST A;  2TRX A;  2VL2 A;  1BQ7 A;  4MJE A;  4HI7 A;  2AHE A;  1JFU A;  3ERF A;  3O6T A;  4G10 A;  1R7H A;  3GTU A;  1O8X A;  2DLX A;  3TJG A;  3GST A;  1AC1 A;  1GH2 A;  3HY2 A;  10GS A;  4I6X A;  1H75 A;  4JRR A;  1SJZ A;  2C1Y A;  3JCM L;  2GT6 A;  1TJD A;  3ZRE A;  3TUE A;  1NM3 A;  1K0D A;  1SKR B;  3GSS A;  2P5R A;  4EE0 A;  3E0U A;  3EUR A;  4YQV A;  1OE8 A;  2H74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...