1O85A

Radiation-reduced tryparedoxin-i
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
GLDKYLPGIEKLRRGDGEVEVKSLAGKLVFFYFSASWCPPCRGFTPQLIEFYDKFHESKNFEVVFCTWDEEEDGFAGYFAKMPWLAVPFAQSEAVQKLSKHFNVESIPTLIGVDADSGDVVTTRARATLVKDPEGEQFPWKDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPAREDOXIN
publication title Tryparedoxins from Crithidia Fasciculata and Trypanosoma Brucei: Photoreduction of the Redox Disulfide Using Synchrotron Radiation and Evidence for a Conformational Switch Implicated in Function
pubmed doi rcsb
source organism Crithidia fasciculata
molecule tags Electron transport
total genus 43
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1o85A00
2L5LA 5HFKA 3DXBA 2X8HA 4XS6A 1TTZA 3TUEA 4L0WA 5EL8A 3VK9A 4F03A 5D93A 3N9JA 4AF2A 3EWLA 3F4SA 4XRDA 1A8LA 4MF7A 1QQ2A 3RAZA 1O8WA 4D73B 5KN0A 4WEYA 5A4WA 3GYKA 4POKA 3JCML 2VLVA 4EXJA 4TR0A 4XS1A 3D22A 2CVKA 4ECJA 3APOA 1FB6A 2XBQA 3EMPA 1TW9A 1M99A 4QL7A 5KN2A 1ML6A 2B7KA 4POLA 6GSUA 3KP9A 2GSTA 18GSA 2C4JA 3IR4A 4FIWA 4F82A 1F3AA 5GAPD 2L4CA 5CO3A 1XZOA 2GT6A 1U6TA 1I9DA 3A2VA 1TKDB 4PX1A 5E59A 3GIXA 1SL1B 3ZVJA 5HFIA 3DVWA 5IO0A 3TRXA 1A24A 2WS2A 4L5LA 2VCWA 4MCUA 5JWQB 2OBKA 22GSA 1DE2A 2IFQA 3APSA 4CHSA 2I9HA 4PQHA 2LEGA 2PPTA 4MMMA 4N30A 1PQNA 4NHZA 5J3RA 3FR9A 4EDYA 3ERGA 3GKNA 4E8HA 2MBSA 2YJHA 1K0AA 3LYPA 3HYPA 1ZOFA 3D6IA 4FYCA 3TJJA 4J56E 1TXXA 3F9UA 4G10A 4KGIA 4OFNA 3SBCA 2LQOA 5J9BA 3FYGA 3F4TA 1R7HA 3H8QA 4IP1A 3LXZA 5D9VA 1XWBA 4KSOA 4GSNA 2PWJA 2MZCA 4IP6A 3TOTA 1MD3A 4JR4A 3UAPA 3KP8A 5ECPB 4HU9A 2YCDA 2I1UA 1XIYA 1USBA 1V58A 5DDLA 2YWNA 3I6AA 1Q4JA 1UA5A 2X8CA 5DVBA 2V6OA 1UVZA 2GS3A 14GSA 2GQKA 1J0FA 2OE3A 3Q18A 2M46A 2O8VB 5IPGA 2ZNMA 1X0RA 4HEA2 3E0UA 1X9WB 1OE7A 2CA8A 2OBIA 2AAWA 2E0QA 1GSDA 1XVQA 3PH9A 4ZXGA 2OACA 2CZ2A 2JSYA 2RM6A 3IAM2 1SENA 4OFMA 2PBJA 4ZB6A 2DJ2A 1GTBA 5D8IA 3RBTA 1WE0A 1XW5A 3F8UA 5ECSA 2F51A 1G6WA 1WPIA 2CVBA 2CVDA 3Q19A 2AYTA 1G6YA 3TKRA 1EOHA 1KEBA 4YQUA 4ZB8A 5ENUA 3LQ7A 3ERWA 1LJRA 1GH2A 2H73A 3GTUA 1QMVA 3M9KA 1ON4A 3CRUA 2GZZA 2VUPA 1WOUA 4RI7A 2WGRA 4NMUA 3KTLA 1GTIA 2GSRA 4ZBDA 5ECMB 4YQMA 1GSYA 2ON5A 2VAFA 4OD7A 2L57A 4ZILA 4XCSA 1PRXA 3CTGA 5CAXA 1S3AA 2VO4A 3AY8A 5ECLB 2HE3A 5C04A 2HFDA 5E4WA 1DUGA 4F0CA 4PURA 3TKSA 4BA7A 3APQA 1BAYA 4MPGA 5ECKB 4QQ7A 3F6DA 1I5GA 2I4AA 4KDUA 1F3BA 3CSJA 3TRQA 4MJEA 4Z7XA 2XPDA 1YDKA 4ZBBA 2CAQA 1AQVA 4IBPA 1SKSB 3P7XA 1JLVA 4POBA 3WD6A 1X5EA 4FH8A 2X64A 5CRHA 1Z7PA 1XWCA 1JLWA 2WB9A 1XVWA 1TRUA 2QGVA 5D9WA 1SD9A 1XOAA 2YWMA 2PMTA 3P8WA 3ZTLA 1M2BA 4O5RA 5IOXA 1B4PA 1QGVA 3HY2A 6GSTA 1Y25A 2DBCA 2IMEA 4AJ8A 2IMDA 5GAND 4MJCA 3UL3A 1EEMA 1SYXA 4XS4B 2FD3A 3DVXA 4GF0A 3CSIA 2FUG2 2AV4A 4DSSB 4I2UA 5HR1A 1ERWA 2HZFA 3DWVA 4I2TA 1N2AA 1VF2A 3VWVA 4GCIA 1B8XA 5LD0A 2WDUA 1YKCA 2IPAA 2B5YA 2EC4A 3F3RA 2FWHA 3BOAA 5EY6A 4NWYA 1K0DA 1GRXA 4DVCA 2I3YA 2VL3A 1X5CA 1O85A 4RQRA 4HJMA 1H75A 3LSZA 5D9TA 4EDZA 1GSQA 3EYTA 2B6MA 4JE1A 4BVXA 5LNKe 5J41A 4MF6A 2A2RA 5DCGA 1PSQA 3MNGA 1Z6MA 3IOSA 3TKSC 4ZL9A 1Z3EA 1TU7A 4GQFA 2G0FA 1TOFA 3SWLA 3FY7A 4HJ2A 1PKWA 3IE3A 3TKQA 2H1AA 1F9MA 1PKZA 3GNJA 1GL8A 2OADA 3C71A 3GURA 1UN2A 4KW6A 5D96A 1TK8B 1TP9A 3D5JA 2KUCA 4X1UA 1GNWA 1ERTA 5HR3A 3IRAA 1M2AA 3F3QA 4V2NA 1NHOA 4I6XA 4JU5A 1O81A 4Q5FA 1Z5YE 2VL2A 3A3TA 5B8AA 4JEDA 2ZCTA 2RUFA 3KJYA 4HI7A 3IHQA 1EOGA 4RQXA 1G7OA 2WJUA 3EURA 2FY6A 4I97A 1A2LA 2PUKC 1H4OA 2TRXA 3RDWA 2R4VA 2XPEA 4NV5A 5AISA 3EU3A 3TKSE 3QAVA 2IFQB 3MWHA 3H93A 3DIEA 3M1GA 1W89A 1XW6A 4QL9A 2YPMA 2KP1A 2JU5A 1A23A 3TKPA 3ZMLA 5GSTA 2OE1A 1RQMA 4L0UA 1O6JA 3A5WA 3UJ1A 3VI7A 1K3LA 2CX3A 3VURA 4EO3A 2LV3A 5DJLA 5DQSA 1YJ6A 1A0FA 2C80A 2H0GA 1K3YA 2H75A 1OC3A 3TB2A 2HRFA 1K3OA 4N10A 1E2YA 2N5FA 2D2ZA 4F0BA 7GSSA 2JADA 2DJ3A 2FWGA 1KNGA 4LLRA 4KX4A 1M9BA 3C7MA 3HVXA 2E2MA 5G5FA 4NAXA 3EU4A 3UOMA 3GKXA 1OC9A 16GSA 2J9HA 1HD2A 4MK3A 3EINA 3CXGA 4X43A 2M80A 4IKHA 2VCXA 4GLTA 4JZQA 2H6YA 4MZWA 3NIVA 1PA3A 2F9SA 4O7HA 3D21A 2FLSA 4ECIA 2MMNA 1SJZA 2IL3A 3LORA 2H1BA 1PX7A 3TJFA 4OCEA 3ZLPA 2Z9SA 2FA8A 3ME7A 3VWWA 4BWQA 2YWIA 2E7PA 2VL2C 1B4QA 2YANA 1T3BA 4NV2A 1GP1A 3H79A 3F63A 4WF5A 2ES7A 2LJAA 2RLIA 2YV7A 3KXOA 1WP0A 2X8GA 3FR3A 3F6FA 2GLRA 2B7JA 1EGRA 5JWRB 1XOBA 3I69A 1XW9A 1O7UA 4TN8A 5D73A 3L9VA 2GZYA 4I8BA 3TJGA 3L78A 5DALB 3A2XA 2H71A 1NHYA 5G31A 3GTUB 2PU9C 4ACSA 3LFLA 1U3AA 11GSA 4HU7A 4WR4A 2R37A 5EPFA 2WZ9A 4TR3A 2PVQA 1PL1A 4BL7A 3GRXA 3TOUA 2CV4A 4MP4A 1QFNA 2O7KA 2C3TA 3RPPA 5CREA 2B5EA 4TVEA 1XWGA 1GLQA 3O3TA 5JCUA 4TXOA 1VGLA 1GSFA 4LMWA 1Q98A 2KOKA 3L0HA 3UMAA 1V98A 3VLNA 3VI5A 4Q5NA 3M9JA 4KAEA 5HR2A 2F8FA 1S3DA 2BMXA 3DRNA 2LNTA 5F8BA 4ILFA 3HZ4A 4OFTA 1FHEA 1U3IA 2M72A 3VFIA 3GKKA 1GUMA 1LBKA 2CZ3A 4K0NA 1GTAA 3C73A 1W4VA 5IPHA 3NZNA 1EP8A 1V2AA 3QFAC 3Q74A 4N0VA 2K9FA 2LTKA 4F9ZA 2QKEA 1WMJA 1QXHA 3IXRA 2VCTA 3S9FA 1ACVA 4WBJA 3BCKA 5A4VA 1THXA 5B6NA 1QUWA 2YOIA 1YQ1A 3IK9A 1B9XC 1ERUA 3P90A 2G2QA 2IMFA 3RPNA 3HHVA 5ECHB 3I9V2 1Z6NA 12GSA 3EC3A 1T7PB 3ZZXA 5J9CA 2VM2A 3GL5A 5IMFA 3G9BA 4GQCA 4XHMA 2YV9A 4TRXA 1NSWA 2GQMA 5DALA 2R6KA 3TJKA 4K7OA 20GSA 4EE0A 2O85A 2RM5A 1PD21 1VF1A 4Q5RA 2IWTA 1CQGA 2H6XA 1THOA 2NVLA 4GWRA 1PMTA 3FKFA 3QAWA 2P31A 1E6BA 5CYYA 1M9AA 1T4ZA 2VCVA 3GKMA 2FWEA 3U5RE 1TJDA 4LL4B 2RUEA 5G5EA 3U6VA 2PVOC 5G2ZA 2LKUA 3HA9A 2ZUPA 4AJ6A 2GTUA 2HRNA 4TKYA 1AQXA 2AB6A 2WULA 5CP1A 1T8EB 3TJBA 5F07A 3QAGA 3IAS2 1XCCA 4ZBAA 4MZBA 4RI6A 4V2LA 4K7NA 1ZMAA 2H30A 4V1Ap 2V1MA 3CYNA 3L4NA 4O32A 1TK0B 4IW9A 1EP7A 4Q5QA 19GSA 4ZB9A 2CAIA 2LJRA 1OE8A 1O8XA 2F8AA 4BWSA 1J9BA 3ERFA 2X99A 2L4QA 1GTUA 4MH2A 1R5PA 3GX0A 3DD3A 1CQHA 2FNOA 3O76A 4ID0A 3IK7A 2DIYA 1BG5A 4TR4A 1XBSA 4X0XA 3VWUA 4AGSA 3DKSA 2VLUA 2H1DA 1RK4A 2EIRA 4NXIA 1SJ6A 4ECBA 1OKTA 4CW9A 3QMXA 2F3MA 4ZIJA 3E9JB 5C00A 3D4MA 4EF0A 1SU9A 1AAZA 1ILOA 2H6ZA 2E2GA 3FEUA 4WETA 4HQSA 1HNAA 3FK8A 5A5KA 2K6VA 5DCHA 2GQLA 5ECQB 2NBSA 1SK1A 2FCHA 2LSTA 1SJIA 4TR1A 2WFCA 2WCIA 1S3CA 5AGYA 1ERVA 4TOPA 2IMKA 4P3YB 5L71A 1ZGNA 2AHEA 1GWCA 4ML1A 2MMZA 3G7YA 2QSIA 2AJQB 4RUVA 4DSRA 2MMAA 1FVJA 4FYBA 1GSSA 2HZEB 2V41A 2N5AA 3PR8A 4XIHA 3CTFA 2DJ0A 1V40A 5G1LA 3F4RA 1R5AA 1XPVA 3L9SA 1TRWA 2V32A 5F05A 3M3MA 2C3NA 1PX6A 1TU8A 1JZDA 5JWOB 1K0NA 3ZL5A 3Q6OA 3ME8A 5F0GA 1LU4A 1TRVA 4IGJA 3ED3A 1OC9B 2LRCA 3CMIA 4GTUA 1ZCPA 4PNGA 3VPQA 1R26A 1MD4A 4GSTA 1K0OA 4KCAA 2JL4A 4OO4A 2C0GA 4KSMA 3UVHA 1R4WA 4FO5A 3J7Yk 1GUKA 1EWXA 4L8EA 4EL1A 3LYKA 2YN1A 3GSSA 4F2IA 4GRFA 3QDNA 4WBRD 2L59A 4WR5A 4POMA 4MLYA 4ISDA 1VF3A 2GGTA 2VD0A 1SK2A 4OWYA 1YKAA 1FO5A 3IBHA 1SKWB 5EVOA 2L6DA 3GN3A 5IIZA 3C1SA 3W8JA 4MJBA 3KIJA 1K0BA 3DMLA 5CRGA 1U88A 3FR6A 1MDIA 4EVMA 3GSTA 2I81A 5G30A 1MTCA 2A4VA 4IHUA 1FAAA 1F2EA 2FWFA 1Z9HA 5KN3A 6GSYA 5HFGA 2XBIA 6GSXA 4YH2A 5IQYA 2PN8A 8GSSA 5INYA 1AUCA 1SD8A 4E8EA 1A0RP 3ISOA 4TXVA 4IJIA 1T1VA 4MA9A 3PGTA 5ID2A 2HZEA 3ZITA 2HI7A 4KCEA 1A2JA 4AJ7A 3ZRDA 3ZMKA 1UC7A 3GFKA 2K8SA 2C0DA 2KLXA 3DGQA 1EV4A 1NM3A 2HYXA 3KGKA 3UVTA 3ZFLA 5D9XA 2RIIA 4KB3A 4EC0A 1EZKA 1HNBA 3F0IA 2HSHA 5IO2A 4JR6A 4TXOB 1EGOA 2EIOA 2H74A 5LCZA 4ECCA 3US3A 2P5QA 2FHEA 3FRCA 6GSSA 1T4YA 5KN1A 4YAVA 5CNWA 3CBUA 3WYWA 1OVNA 3FW2A 2YZHA 3KH7A 4HZ4A 2B1KA 9GSSA 5ELAA 2VOCA 4G2EA 3O6TA 3HJMA 4HS1A 3GH9A 2O89A 3RHBA 2IIYA 4NHWA 3UIWA 10GSA 3GUSA 2LJKA 4MDCA 2IJYA 1Y6EA 1YY7A 5IMDA 2JSZA 4PUAA 1K0MA 4XRAA 1RW1A 4PQIA 2VIMA 3GV1A 2LRNA 3W8SA 4MABA 3HCZA 1WJKA 3H1NA 1ZZYA 3P2AA 5B8BA 2DSAA 3KEBA 2FA4A 1KTEA 3LXTA 3RHCA 4WKWA 4KDYA 3J7Yb 3MDKA 3DEXA 3N5OA 3UBKA 1SYRA 5ELGA 2LQQA 1JZRA 4MF5A 3WT2A 1AQWA 4IQAA 2KP2A 3E3EA 2AUVA 1NW2A 4K1FA 3KMNA 4EKZA 4FYUA 4V1Ag 3ZIVA 2K18A 3I43A 3ZFBA 4K0GA 3KTBA 4MJAA 1DBYA 2TIRA 3GA4A 3HKRA 2LRTA 1ZYQB 3VPTA 5KEJA 4ULXA 1X9MB 1WIKA 3IC4A 2GSSA 2VCQA 4KNDA 2C8UA 3GH6A 3KMOA 2EIQA 4G9HA 3UEMA 1J08A 2CQ9A 4JRRA 4K9ZA 3QD9A 2JZSA 4IN0A 4PNFA 5IMZA 2REMA 1DSBA 4TW5A 1IYHA 1JZOA 2DJ1A 3D4TA 3FZ4A 3LG6A 1B48A 3BBYA 5H5SA 5H5QA 4GXZA 5DAKB 1SK0A 4CDOA 1M2DA 2C1YA 4H86A 5COHA 3ZYWA 3VWXA 2ON7A 2XHFA 1FB0A 1KBNA 3H4KA 3KZQA 3ZIJA 4IVFA 1YEXA 4BVYA 1PGTA 1C72A 4D73A 2P5RA 2KHPA 2GSQA 3MSZA 5AIXA 2H8LA 3QR6A 3A2WA 5GZZB 1B9YC 1EEJA 2OKAA 4YQVA 1WWJA 1AXDA 1AW9A 2WRTA 2HXKA 3PINA 17GSA 4EUYA 4KE3A 3WT1A 3FZ9A 2JZRA 3TRPA 3QPMA 4N11A 5IMCA 3LWAA 2LUSA 4JBBA 2MMOA 4ZL8A 1OKDA 1WRYA 5G1KA 2DMLA 2V2GA 4OMVA 3D0ZA 3IDVA 4TR1B 2DC5A 2R3XA 5FHIA 2R2JA 4K7IA 3ZREA 1MEKA 2DIZA 1GSEA 1OAZA 3LEFA 3G7JA 3TDGA 4HQZA 3QFBC 3OR5A 4PUFC 1TI1A 3UARA 2B3SA 3BD2A 3NOFA 1FOVA 1BJXA 2C3QA 1F37A 3EMXA 3BCIA 4IS0A 1PN9A 1V9WA 2HNLA 4LMVA 1BYEA 3LJRA 3HD5A 5J4UA 4IJ3A 4XTSA 3HVSA 1YEPA 2OJLA 2C0FA 3HZ8A 2IN3A 2HSYA 3IA1A 4J2FA 2K8VA 5JCWA 3FHKA 1N8JA 2DMMA 5F06A 1OC8A 3TCOA 3M0FA 2P0GA 4MH3A 3C8EA 2PGTA 1X9SB 5DAKA 4HDEA 2NTOA 3IV4A 4MZCA 4IELA 1URMA 3R2QA 3TGZA 4GSSA 1TRSA 3W6GA 2LNSA 2NPBA 4HUAA 2CT6A 1F6MC 1VF4A 5IM9A 1EV9A 4K6XA 4I5QA 2MBTA 3G7IA 4PQ1A 3L9UA 1GULA 5HR0A 5ECOB 1TI3A 4N0ZA 5IMVA 1PL2A 2JZTA 1XXUA 2VLTA 3V1WA 4WF4A 2BJXA 2LS5A 3MAKA 5DJMA 3UBLA 4KA0A 2YJ7A 3C1RA 2O87A 2YP6A 3HXSA 1A2MA 1U87A 1M0UA 1OYJA 1TDIA 4PGTA 2YNXA 1Z7RA 5IOWA 5CRDA 5H5RA 2VCZA 2B1LA 1SKRB 3KD0A 2IMIA 3GX8A 3WGXA 3BJ5A 1AIUA 1JFUA 1SL2B 1HNCA 1YF0A 5B7CA 1ZL9A 5ID2B 3CRTA 5B6MA 1O73A 1GNEA 5AIVA 2ALBA 2YZUA 2GDRA 3DYRA 3WGEA 2BTOT 1ZYEA 4K2DA 2H70A 2HLSA 2OE0A 3LGCA 4L5OA 1YF1A 3QCPA 2VD1A 1G0TA 1XWAA 3ZVJD 4OCFA 4BPYA 3GHAA 1HYUA 3KM6A 3HDCA 4OO5A 3WGDA 3IPZA 1FW1A 2DJKA 4KH7A 3GMFA 4DEJA 2HT9A 2XC2A 3HJOA 1MDKA 5DBQA 2NDOA 1FVKA 1QK8A 2QC7A 4J57E 2OA7A 1JZWA 2H66A 1MDJA 1GLPA 4LL1B 1T00A 2H72A 5ECRB 2MYGA 2B5XA 1M7TA 1G7EA 3EVIA 5ECIB 2PERA 2TRCP 5JCGA 4MPFA 2DJJA 1V57A 2VM1A 1ST9A 5AN1A 4ZL7A 2GVPA 2H76A 3EE2A 1BX9A 2DLXA 3M8NA 5ECNB 1A8YA 1XWKA 5DQYA 3GL3A 5GSSA 4V2MA 2H0HA 1K0CA 5FWGA 2L6CA 4G19A 1JHBA 4WXTA 6GSVA 4HZ2A 3KCMA 2H1GA 2CX4A 2VL9A 3HVVA 1AC1A 1BEDA 4IQ1A 13GSA 2L5OA 4NPBA 5A4UA 1ABAA 4PXOA 1HQOA 3KH9A 1GSUA 2GT5A 2R5GA 4HOJA 4XS4A 5IMAA 2N5BA 2V6KA 1BQ7A 1X5DA 4K8MA 4DSSA 2H19A 1DE1A 1IYIA 2C0EA 5ABRA 1YZXA 3QOUA 2GZPA 3FZ5A 3HJPA 4LA1A 2J23A 2A2SA 3FZAA 5J5NA 2JACA 2H01A 1GUHA 1FG4A 4O92A 5FT3A 4YAPA 3K8NA 3CSHA 1VRSD 2YWOA 2FGXA 4KDXA 4ML6A 5CRWA 4KUNA 2H0IA 5HQPA 1TK5B 1XFLA 1SL0B 6GSWA 4DSQA
chains in the Genus database with same CATH superfamily
2L5LA 5HFKA 3DXBA 2X8HA 4FQUA 4XS6A 1TTZA 3TUEA 4L0WA 5EL8A 4HSCX 3VK9A 4F03A 5D93A 3N9JA 4AF2A 3EWLA 3F4SA 4XRDA 1A8LA 4MF7A 1QQ2A 4BVYB 3RAZA 4KF9A 1O8WA 4D73B 5KN0A 4WEYA 5A4WA 3GYKA 4POKA 3JCML 2VLVA 4EXJA 2DKIA 4TR0A 4XS1A 3D22A 2CVKA 4ECJA 3APOA 1FB6A 4Z2UA 2XBQA 3EMPA 1TW9A 1M99A 1S3RA 4QL7A 5KN2A 1ML6A 2B7KA 4POLA 6GSUA 3KP9A 2GSTA 18GSA 2C4JA 3IR4A 4FIWA 4F82A 1F3AA 5GAPD 2L4CA 5CO3A 1XZOA 2GT6A 1U6TA 1I9DA 3A2VA 3MIXA 4PX1A 1TKDB 5E59A 3GIXA 1SL1B 3ZVJA 5HFIA 3DVWA 5IO0A 3TRXA 1A24A 2WS2A 4L5LA 2VCWA 4MCUA 5JWQB 2OBKA 22GSA 1DE2A 2IFQA 3APSA 4CHSA 2I9HA 4PQHA 2LEGA 2PPTA 4MMMA 4N30A 1PQNA 4NHZA 5J3RA 3FR9A 4EDYA 3ERGA 3GKNA 3PPUA 4E8HA 4Z2TA 2MBSA 2YJHA 1PFOA 1K0AA 3LYPA 3HYPA 1ZOFA 3D6IA 4FYCA 3TJJA 4J56E 1TXXA 3F9UA 4G10A 4KGIA 4OFNA 3SBCA 2LQOA 5J9BA 3FYGA 3F4TA 1R7HA 3H8QA 4IP1A 3LXZA 5D9VA 1XG8A 1XWBA 4KSOA 4GSNA 2PWJA 2MZCA 4IP6A 3TOTA 1MD3A 4JR4A 3UAPA 3KP8A 5ECPB 4HU9A 2YCDA 2I1UA 1XIYA 1USBA 1V58A 5DDLA 2YWNA 3I6AA 1Q4JA 1UA5A 2X8CA 5DVBA 2V6OA 1UVZA 2GS3A 14GSA 2GQKA 1J0FA 2OE3A 3Q18A 2M46A 4ICYA 2O8VB 4G0KA 5IPGA 2ZNMA 1X0RA 4HEA2 3E0UA 1X9WB 1OE7A 2CA8A 2OBIA 2AAWA 2E0QA 1GSDA 1XVQA 3PH9A 4ZXGA 3R3EA 2UZ8A 2OACA 2CZ2A 2JSYA 2RM6A 3IAM2 1SENA 4OFMA 2PBJA 4ZB6A 2DJ2A 1GTBA 5D8IA 3RBTA 1WE0A 1XW5A 3F8UA 5ECSA 2F51A 1G6WA 1WPIA 2CVBA 2CVDA 3Q19A 2AYTA 1G6YA 3TKRA 1EOHA 1KEBA 4YQUA 4ZB8A 5ENUA 3LQ7A 3ERWA 1LJRA 1GH2A 2H73A 3GTUA 4CY6A 1QMVA 3M9KA 1ON4A 1M3IA 3CRUA 2GZZA 2VUPA 1WOUA 4RI7A 2WGRA 3A5IA 4NMUA 3KTLA 1GTIA 2GSRA 4ZBDA 5ECMB 4YQMA 1GSYA 2ON5A 2VAFA 4OD7A 2L57A 4ZILA 4XCSA 1PRXA 3CTGA 5CAXA 1S3AA 2VO4A 3AY8A 5ECLB 2HE3A 2QA1A 5C04A 2HFDA 2R0CA 1DUGA 5E4WA 4F0CA 4PURA 3TKSA 4BA7A 3APQA 1BAYA 4MPGA 5ECKB 4QQ7A 3F6DA 1I5GA 2I4AA 4KDUA 1F3BA 2DKHA 3CSJA 3TRQA 4MJEA 4Z7XA 2XPDA 1YDKA 4ZBBA 2CAQA 1AQVA 4IBPA 1SKSB 3P7XA 1JLVA 4POBA 3WD6A 1X5EA 4FH8A 2X64A 5CRHA 1Z7PA 1XWCA 1JLWA 2WB9A 1XVWA 1TRUA 2QGVA 5D9WA 1SD9A 1XOAA 2YWMA 2PMTA 3P8WA 3ZTLA 1M2BA 4O5RA 5IOXA 1B4PA 1QGVA 3HY2A 6GSTA 1Y25A 2DBCA 2IMEA 4AJ8A 2IMDA 5GAND 4MJCA 3UL3A 1EEMA 1SYXA 4XS4B 2FD3A 3DVXA 4GF0A 3CSIA 4MNNA 2FUG2 2AV4A 4DSSB 4I2UA 5HR1A 1ERWA 2HZFA 3DWVA 4I2TA 1N2AA 1VF2A 3VWVA 4GCIA 1B8XA 5LD0A 2WDUA 1YKCA 2IPAA 2B5YA 2EC4A 3F3RA 2FWHA 3BOAA 5EY6A 4NWYA 1K0DA 1GRXA 4DVCA 2I3YA 2VL3A 1X5CA 1O85A 4RQRA 4HJMA 1H75A 3LSZA 5D9TA 4EDZA 4G0LA 1GSQA 3EYTA 2B6MA 4JE1A 4BVXA 5LNKe 5J41A 4MF6A 2A2RA 5DCGA 1PSQA 3MNGA 1Z6MA 3IOSA 3TKSC 4ZL9A 1Z3EA 1TU7A 4GQFA 2G0FA 1TOFA 3SWLA 3FY7A 4HJ2A 1PKWA 3IE3A 3TKQA 2H1AA 1F9MA 1PKZA 3GNJA 1GL8A 2OADA 3C71A 3GURA 1UN2A 4KW6A 5D96A 1TK8B 1TP9A 3D5JA 2KUCA 4X1UA 4USSA 1GNWA 1ERTA 5HR3A 3IRAA 1M2AA 3F3QA 4V2NA 4YKFA 1NHOA 4I6XA 4JU5A 1O81A 4Q5FA 1Z5YE 2VL2A 3A3TA 5B8AA 4JEDA 2ZCTA 2RUFA 3KJYA 4HI7A 3IHQA 1EOGA 4RQXA 1G7OA 2WJUA 3EURA 2FY6A 4I97A 1A2LA 2PUKC 1H4OA 2TRXA 3RDWA 2R4VA 2XPEA 4NV5A 5AISA 3EU3A 3TKSE 3QAVA 2IFQB 3MWHA 3H93A 3DIEA 3M1GA 1W89A 1XW6A 3EPTA 4QL9A 2YPMA 2KP1A 2JU5A 1A23A 3TKPA 3ZMLA 5GSTA 2OE1A 1RQMA 4L0UA 1O6JA 3A5WA 3UJ1A 3VI7A 1K3LA 2CX3A 3VURA 4EO3A 2LV3A 5DJLA 5DQSA 1YJ6A 1A0FA 2C80A 2H0GA 1K3YA 2H75A 1OC3A 3TB2A 2HRFA 1K3OA 4N10A 1E2YA 2N5FA 2D2ZA 4F0BA 7GSSA 2JADA 2DJ3A 2FWGA 1KNGA 4LLRA 4KX4A 1M9BA 3C7MA 3HVXA 2E2MA 5G5FA 4NAXA 3EU4A 3UOMA 3GKXA 1OC9A 16GSA 2J9HA 1HD2A 4MK3A 3EINA 3CXGA 4X43A 2M80A 4IKHA 2VCXA 4GLTA 4JZQA 2H6YA 4MZWA 3NIVA 1PA3A 2F9SA 4O7HA 3D21A 2FLSA 4ECIA 2MMNA 1SJZA 2IL3A 3LORA 2H1BA 1PX7A 3TJFA 4OCEA 3ZLPA 2Z9SA 2FA8A 3ME7A 3VWWA 4BWQA 2YWIA 2E7PA 2VL2C 1B4QA 2YANA 1T3BA 4NV2A 1GP1A 3H79A 3F63A 4WF5A 2ES7A 2LJAA 2RLIA 2YV7A 3KXOA 1WP0A 2X8GA 3FR3A 3F6FA 2GLRA 2B7JA 1EGRA 5JWRB 1XOBA 3I69A 1XW9A 1O7UA 4TN8A 5D73A 2R0PA 3L9VA 2GZYA 4I8BA 3TJGA 3L78A 5DALB 3A2XA 2H71A 1NHYA 5G31A 3GTUB 2PU9C 4ACSA 3LFLA 4Z2RA 1U3AA 11GSA 4HU7A 4WR4A 2R37A 5EPFA 2WZ9A 4TR3A 2PVQA 1PL1A 4BL7A 3GRXA 3TOUA 2CV4A 4MP4A 1QFNA 2O7KA 2C3TA 3RPPA 5CREA 2B5EA 4TVEA 1XWGA 1GLQA 3O3TA 5JCUA 2HSMA 4TXOA 1VGLA 1GSFA 4LMWA 1Q98A 2KOKA 3L0HA 3UMAA 1V98A 3VLNA 3VI5A 4Q5NA 3M9JA 4KAEA 5HR2A 2F8FA 1S3DA 2BMXA 3DRNA 2LNTA 5F8BA 4ILFA 3HZ4A 4OFTA 3IHGA 1FHEA 1U3IA 2M72A 3VFIA 3GKKA 1GUMA 1LBKA 2CZ3A 4K0NA 1GTAA 3C73A 1W4VA 5IPHA 3NZNA 1EP8A 1V2AA 3QFAC 3Q74A 4N0VA 2K9FA 2LTKA 4F9ZA 2QKEA 1WMJA 1QXHA 3IXRA 2VCTA 3S9FA 1ACVA 4WBJA 3BCKA 5A4VA 1THXA 5B6NA 1QUWA 2YOIA 1YQ1A 3IK9A 1B9XC 1ERUA 3P90A 2G2QA 2IMFA 3RPNA 3HHVA 5ECHB 2R0GA 3I9V2 1Z6NA 12GSA 3EC3A 1T7PB 3ZZXA 5J9CA 1ZYNA 2VM2A 3GL5A 5IMFA 3G9BA 4GQCA 4XHMA 2YV9A 4TRXA 1NSWA 2GQMA 5DALA 2R6KA 3TJKA 4K7OA 20GSA 4EE0A 2O85A 2RM5A 1PD21 1VF1A 4Q5RA 2IWTA 1CQGA 2H6XA 1THOA 2NVLA 4GWRA 1PMTA 3FKFA 3QAWA 2P31A 1E6BA 1M9AA 1T4ZA 2VCVA 5CYYA 3GKMA 2FWEA 3U5RE 1TJDA 4LL4B 2RUEA 5G5EA 3U6VA 2PVOC 5G2ZA 2LKUA 3HA9A 2ZUPA 4AJ6A 2GTUA 2HRNA 4TKYA 2A2PA 1AQXA 2AB6A 2WULA 5CP1A 3CQFA 1T8EB 3TJBA 5F07A 4BVXB 3QAGA 3IAS2 1XCCA 4ZBAA 4MZBA 4RI6A 4V2LA 4K7NA 1ZMAA 2H30A 4V1Ap 2V1MA 3CYNA 3L4NA 4O32A 4CY8A 1TK0B 4IW9A 1EP7A 4Q5QA 19GSA 4ZB9A 2CAIA 2LJRA 1OE8A 1O8XA 2F8AA 4BWSA 1J9BA 3ERFA 2X99A 2L4QA 1GTUA 4O5UA 4MH2A 1R5PA 3GX0A 3DD3A 1CQHA 2FNOA 3O76A 4ID0A 3IK7A 2DIYA 1BG5A 4TR4A 1XBSA 4X0XA 3VWUA 4AGSA 3DKSA 2VLUA 2H1DA 1RK4A 2EIRA 4NXIA 4K5SA 1SJ6A 4ECBA 1OKTA 4CW9A 3QMXA 2F3MA 4ZIJA 3E9JB 5C00A 3D4MA 4EF0A 1SU9A 1AAZA 4O5QA 1ILOA 2H6ZA 2E2GA 3FEUA 4WETA 4HQSA 1HNAA 3FK8A 5A5KA 2K6VA 5DCHA 2GQLA 5ECQB 2NBSA 1SK1A 2FCHA 2LSTA 1SJIA 4TR1A 2WFCA 2WCIA 1S3CA 5AGYA 1ERVA 4TOPA 2IMKA 4P3YB 5L71A 1ZGNA 2AHEA 1GWCA 4ML1A 2MMZA 3G7YA 4G0IA 2QSIA 2AJQB 4RUVA 4DSRA 2MMAA 1FVJA 4FYBA 1GSSA 2HZEB 2V41A 2N5AA 3PR8A 1PN0A 4XIHA 3CTFA 2DJ0A 1V40A 5G1LA 3F4RA 1R5AA 1XPVA 3L9SA 1TRWA 2V32A 5F05A 3M3MA 2C3NA 1PX6A 1TU8A 1JZDA 5JWOB 1K0NA 3ZL5A 3Q6OA 2HRAA 3ME8A 5F0GA 1LU4A 1TRVA 4IGJA 3ED3A 1OC9B 2LRCA 3CMIA 4GTUA 1ZCPA 4PNGA 3VPQA 1R26A 1MD4A 4GSTA 1K0OA 4KCAA 2JL4A 4OO4A 2C0GA 4KSMA 3UVHA 1R4WA 4FO5A 3J7Yk 1GUKA 1EWXA 4L8EA 4EL1A 3LYKA 2YN1A 3GSSA 4F2IA 4GRFA 3QDNA 4WBRD 2L59A 4WR5A 4POMA 4MLYA 4ISDA 1VF3A 5BRTA 2GGTA 2VD0A 1SK2A 4OWYA 1YKAA 1FO5A 3IBHA 1SKWB 5EVOA 2L6DA 3GN3A 5IIZA 3C1SA 3W8JA 4MJBA 3KIJA 1K0BA 3DMLA 5CRGA 1U88A 3FR6A 1MDIA 4EVMA 3GSTA 2I81A 5G30A 1MTCA 2A4VA 4IHUA 1FAAA 1F2EA 2FWFA 1Z9HA 5KN3A 2X4AA 6GSYA 4YKGA 5HFGA 2XBIA 3FMWA 6GSXA 3MYDA 4YH2A 4EIPA 5IQYA 2PN8A 8GSSA 5INYA 1AUCA 1SD8A 4E8EA 1A0RP 3ISOA 4TXVA 4IJIA 1T1VA 4MA9A 3PGTA 5ID2A 2HZEA 3ZITA 2HI7A 4KCEA 1A2JA 4AJ7A 3ZRDA 3ZMKA 1UC7A 4BL7B 3GFKA 2K8SA 2C0DA 2KLXA 3DGQA 1EV4A 1NM3A 2HYXA 3KGKA 3UVTA 3ZFLA 5D9XA 2RIIA 4KB3A 4EC0A 1EZKA 1HNBA 3F0IA 2HSHA 5IO2A 4JR6A 4TXOB 1EGOA 2EIOA 2H74A 5LCZA 4ECCA 3US3A 2P5QA 2FHEA 3FRCA 6GSSA 1T4YA 5KN1A 4YAVA 5CNWA 3CBUA 3WYWA 1OVNA 3FW2A 2YZHA 3KH7A 4HZ4A 2B1KA 9GSSA 5ELAA 2VOCA 4G2EA 3O6TA 3HJMA 4HS1A 3GH9A 2O89A 3RHBA 2IIYA 4NHWA 3UIWA 10GSA 3GUSA 2LJKA 4MDCA 2IJYA 1Y6EA 1YY7A 5IMDA 2JSZA 4PUAA 1K0MA 4XRAA 1RW1A 4PQIA 2VIMA 3IC8A 3GV1A 2LRNA 3W8SA 4MABA 3HCZA 1WJKA 3H1NA 1ZZYA 3P2AA 5B8BA 2DSAA 3KEBA 2FA4A 1KTEA 3LXTA 3RHCA 4WKWA 4KDYA 3J7Yb 3MDKA 3DEXA 3N5OA 3UBKA 1SYRA 5ELGA 2LQQA 1JZRA 4MF5A 3WT2A 1AQWA 4IQAA 2KP2A 3E3EA 2AUVA 1NW2A 4K1FA 3HVNA 3KMNA 4EKZA 4FYUA 4V1Ag 3ZIVA 2K18A 3I43A 3ZFBA 4K0GA 3KTBA 4MJAA 1DBYA 2TIRA 3GA4A 3HKRA 2LRTA 1ZYQB 3VPTA 5KEJA 4ULXA 1X9MB 1WIKA 2QA2A 3IC4A 2GSSA 2VCQA 4KNDA 2C8UA 3GH6A 3KMOA 2EIQA 4G9HA 3UEMA 1J08A 2CQ9A 4JRRA 1FOHA 4K9ZA 3QD9A 2JZSA 4IN0A 4PNFA 5IMZA 2REMA 1DSBA 4TW5A 1IYHA 1JZOA 2DJ1A 3D4TA 3FZ4A 3LG6A 1B48A 3BBYA 5H5SA 5H5QA 4GXZA 5DAKB 1SK0A 4CDOA 1M2DA 2C1YA 4H86A 5COHA 3ZYWA 4K2XA 3VWXA 2ON7A 2XHFA 1FB0A 1KBNA 3H4KA 3KZQA 3ZIJA 4IVFA 1YEXA 4BVYA 1PGTA 1C72A 4D73A 2P5RA 2KHPA 2GSQA 3MSZA 5AIXA 2H8LA 3QR6A 3A2WA 5GZZB 1B9YC 1EEJA 2OKAA 4X4JA 4YQVA 1WWJA 1AXDA 1AW9A 2WRTA 2HXKA 3PINA 17GSA 4EUYA 4KE3A 3WT1A 3FZ9A 2JZRA 3TRPA 3QPMA 4N11A 5IMCA 3LWAA 2LUSA 4JBBA 2MMOA 4ZL8A 1OKDA 1WRYA 5G1KA 2DMLA 2V2GA 4OMVA 3D0ZA 3IDVA 4TR1B 2DC5A 2R3XA 5FHIA 2R2JA 4K7IA 3ZREA 1MEKA 2DIZA 1GSEA 1OAZA 3LEFA 3G7JA 3TDGA 4HQZA 3QFBC 3OR5A 4PUFC 1TI1A 3UARA 2B3SA 3BD2A 3NOFA 1FOVA 4A5PA 1BJXA 2C3QA 1F37A 3EMXA 3BCIA 4IS0A 1PN9A 1V9WA 2HNLA 4LMVA 1BYEA 3LJRA 3HD5A 5J4UA 4IJ3A 4XTSA 3HVSA 1YEPA 2OJLA 2C0FA 3HZ8A 2IN3A 2HSYA 3IA1A 4J2FA 2K8VA 5JCWA 3FHKA 1N8JA 2DMMA 5BMUA 5F06A 1OC8A 3TCOA 3M0FA 2P0GA 4MH3A 3C8EA 2X49A 2PGTA 1X9SB 5DAKA 4HDEA 2NTOA 3IV4A 4MZCA 4IELA 1URMA 3R2QA 3TGZA 4GSSA 1TRSA 3W6GA 2LNSA 2NPBA 4HUAA 2CT6A 1F6MC 1VF4A 5IM9A 1EV9A 4K6XA 4I5QA 2MBTA 3G7IA 4PQ1A 3L9UA 1GULA 5HR0A 5ECOB 1TI3A 4N0ZA 5IMVA 1PL2A 2JZTA 1XXUA 2VLTA 3V1WA 4WF4A 2BJXA 2LS5A 3MAKA 5DJMA 3UBLA 4KA0A 2YJ7A 2HRKA 3C1RA 2O87A 2YP6A 3HXSA 1A2MA 1U87A 1M0UA 1OYJA 1TDIA 4PGTA 1ZYPA 2YNXA 1Z7RA 5IOWA 5CRDA 5H5RA 2VCZA 2B1LA 1SKRB 3KD0A 2IMIA 3GX8A 2A4HA 3WGXA 3BJ5A 1AIUA 1JFUA 1SL2B 1HNCA 1YF0A 5B7CA 1ZL9A 5ID2B 3CRTA 5B6MA 1O73A 1GNEA 5AIVA 2ALBA 2YZUA 2GDRA 3DYRA 3WGEA 2BTOT 1ZYEA 4K2DA 2H70A 2HLSA 2OE0A 3LGCA 4L5OA 1YF1A 3QCPA 2VD1A 1G0TA 1XWAA 3ZVJD 4OCFA 4BPYA 3GHAA 1HYUA 3KM6A 3HDCA 4OO5A 3WGDA 3IPZA 1FW1A 2DJKA 4KH7A 1M3JA 3GMFA 4DEJA 2HT9A 2XC2A 4PTSA 3HJOA 1MDKA 5KOXA 5DBQA 2NDOA 1FVKA 1QK8A 2QC7A 4J57E 2OA7A 1JZWA 2H66A 1MDJA 1GLPA 4LL1B 1T00A 2H72A 5ECRB 2MYGA 2B5XA 1M7TA 1G7EA 3EVIA 5ECIB 2PERA 2TRCP 5JCGA 4MPFA 2DJJA 1V57A 2VM1A 1ST9A 5AN1A 4ZL7A 2GVPA 2H76A 3EE2A 1BX9A 2DLXA 3M8NA 5ECNB 1A8YA 1XWKA 5DQYA 3GL3A 5GSSA 4V2MA 2H0HA 1K0CA 5FWGA 2L6CA 4G19A 1JHBA 4WXTA 6GSVA 4HZ2A 3KCMA 2H1GA 2CX4A 2VL9A 3HVVA 1AC1A 1BEDA 4IQ1A 13GSA 2L5OA 4NPBA 5A4UA 1ABAA 4PXOA 1HQOA 3KH9A 1GSUA 2GT5A 4BIKA 2R5GA 4EIQA 4HOJA 4XS4A 5IMAA 2N5BA 2V6KA 1BQ7A 1X5DA 4K8MA 4DSSA 2H19A 1DE1A 1IYIA 2C0EA 5ABRA 1YZXA 3QOUA 2GZPA 3FZ5A 3HJPA 4K5RA 4LA1A 5KOWA 3LW9A 2J23A 2A2SA 3FZAA 5J5NA 2JACA 2H01A 1GUHA 1FG4A 4O92A 5FT3A 4YAPA 3K8NA 3CSHA 1VRSD 2YWOA 2FGXA 4KDXA 4ML6A 5CRWA 4KUNA 2H0IA 5HQPA 1TK5B 1XFLA 1SL0B 6GSWA 4DSQA
chains in the Genus database with same CATH topology
2L5LA 5HFKA 3DXBA 2X8HA 4FQUA 4XS6A 1TTZA 3TUEA 4L0WA 5EL8A 3VK9A 4F03A 5D93A 3N9JA 4AF2A 3EWLA 3F4SA 4XRDA 1A8LA 4MF7A 1QQ2A 4BVYB 3RAZA 4KF9A 1O8WA 4D73B 5KN0A 4WEYA 5A4WA 3GYKA 4POKA 3JCML 2VLVA 4EXJA 2DKIA 4TR0A 4XS1A 3D22A 2CVKA 4ECJA 3APOA 1FB6A 4Z2UA 2XBQA 3EMPA 1TW9A 1M99A 4QL7A 5KN2A 1ML6A 2B7KA 4POLA 6GSUA 3KP9A 2GSTA 18GSA 2C4JA 3IR4A 4FIWA 4F82A 1F3AA 5GAPD 2L4CA 5CO3A 1XZOA 2GT6A 1U6TA 1I9DA 3A2VA 3MIXA 4PX1A 1TKDB 5E59A 3GIXA 1SL1B 3ZVJA 5HFIA 3DVWA 5IO0A 3TRXA 1A24A 2WS2A 4L5LA 2VCWA 4MCUA 5JWQB 2OBKA 22GSA 1DE2A 2IFQA 3APSA 4CHSA 2I9HA 4PQHA 2LEGA 2PPTA 4MMMA 4N30A 1PQNA 4NHZA 5J3RA 3FR9A 4EDYA 3ERGA 3GKNA 3PPUA 4E8HA 4Z2TA 2MBSA 2YJHA 1K0AA 3LYPA 3HYPA 1ZOFA 3D6IA 4FYCA 3TJJA 4J56E 1TXXA 3F9UA 4G10A 4KGIA 4OFNA 3SBCA 2LQOA 5J9BA 3FYGA 3F4TA 1R7HA 3H8QA 4IP1A 3LXZA 5D9VA 1XWBA 4KSOA 4GSNA 2PWJA 2MZCA 4IP6A 3TOTA 1MD3A 4JR4A 3UAPA 3KP8A 5ECPB 4HU9A 2YCDA 2I1UA 1XIYA 1USBA 1V58A 5DDLA 2YWNA 3I6AA 1Q4JA 1UA5A 2X8CA 5DVBA 2V6OA 1UVZA 2GS3A 14GSA 2GQKA 1J0FA 2OE3A 3Q18A 2M46A 4ICYA 2O8VB 4G0KA 5IPGA 2ZNMA 1X0RA 4HEA2 3E0UA 1X9WB 1OE7A 2CA8A 2OBIA 2AAWA 2E0QA 1GSDA 1XVQA 3PH9A 4ZXGA 3R3EA 2UZ8A 2OACA 2CZ2A 2JSYA 2RM6A 3IAM2 1SENA 4OFMA 2PBJA 4ZB6A 2DJ2A 1GTBA 5D8IA 3RBTA 1WE0A 1XW5A 3F8UA 5ECSA 2F51A 1G6WA 1WPIA 2CVBA 2CVDA 3Q19A 2AYTA 1G6YA 3TKRA 1EOHA 1KEBA 4YQUA 4ZB8A 5ENUA 3LQ7A 3ERWA 1LJRA 1GH2A 2H73A 3GTUA 4CY6A 1QMVA 3M9KA 1ON4A 3CRUA 2GZZA 2VUPA 1WOUA 4RI7A 2WGRA 3A5IA 4NMUA 3KTLA 1GTIA 2GSRA 4ZBDA 5ECMB 4YQMA 1GSYA 2ON5A 2VAFA 4OD7A 2L57A 4ZILA 4XCSA 1PRXA 3CTGA 5CAXA 1S3AA 2VO4A 3AY8A 5ECLB 2HE3A 2QA1A 5C04A 2HFDA 2R0CA 1DUGA 5E4WA 4F0CA 4PURA 3TKSA 4BA7A 3APQA 1BAYA 4MPGA 5ECKB 4QQ7A 3F6DA 1I5GA 2I4AA 4KDUA 1F3BA 2DKHA 3CSJA 3TRQA 4MJEA 4Z7XA 2XPDA 1YDKA 4ZBBA 2CAQA 1AQVA 4IBPA 1SKSB 3P7XA 1JLVA 4POBA 3WD6A 1X5EA 4FH8A 2X64A 5CRHA 1Z7PA 1XWCA 1JLWA 2WB9A 1XVWA 1TRUA 2QGVA 5D9WA 1SD9A 1XOAA 2YWMA 2PMTA 3P8WA 3ZTLA 1M2BA 4O5RA 5IOXA 1B4PA 1QGVA 3HY2A 6GSTA 1Y25A 2DBCA 2IMEA 4AJ8A 2IMDA 5GAND 4MJCA 3UL3A 1EEMA 1SYXA 4XS4B 2FD3A 3DVXA 4GF0A 3CSIA 4MNNA 2FUG2 2AV4A 4DSSB 4I2UA 5HR1A 1ERWA 2HZFA 3DWVA 4I2TA 1N2AA 1VF2A 3VWVA 4GCIA 1B8XA 5LD0A 2WDUA 1YKCA 2IPAA 2B5YA 2EC4A 3F3RA 2FWHA 3BOAA 5EY6A 4NWYA 1K0DA 1GRXA 4DVCA 2I3YA 2VL3A 1X5CA 1O85A 4RQRA 4HJMA 1H75A 3LSZA 5D9TA 4EDZA 4G0LA 1GSQA 3EYTA 2B6MA 4JE1A 4BVXA 5LNKe 5J41A 4MF6A 2A2RA 5DCGA 1PSQA 3MNGA 1Z6MA 3IOSA 3TKSC 4ZL9A 1Z3EA 1TU7A 4GQFA 2G0FA 1TOFA 3SWLA 3FY7A 4HJ2A 1PKWA 3IE3A 3TKQA 2H1AA 1F9MA 1PKZA 3GNJA 1GL8A 2OADA 3C71A 3GURA 1UN2A 4KW6A 5D96A 1TK8B 1TP9A 3D5JA 2KUCA 4X1UA 4USSA 1GNWA 1ERTA 5HR3A 3IRAA 1M2AA 3F3QA 4V2NA 4YKFA 1NHOA 4I6XA 4JU5A 1O81A 4Q5FA 1Z5YE 2VL2A 3A3TA 5B8AA 4JEDA 2ZCTA 2RUFA 3KJYA 4HI7A 3IHQA 1EOGA 4RQXA 1G7OA 2WJUA 3EURA 2FY6A 4I97A 1A2LA 2PUKC 1H4OA 2TRXA 3RDWA 2R4VA 2XPEA 4NV5A 5AISA 3EU3A 3TKSE 3QAVA 2IFQB 3MWHA 3H93A 3DIEA 3M1GA 1W89A 1XW6A 3EPTA 4QL9A 2YPMA 2KP1A 2JU5A 1A23A 3TKPA 3ZMLA 5GSTA 2OE1A 1RQMA 4L0UA 1O6JA 3A5WA 3UJ1A 3VI7A 1K3LA 2CX3A 3VURA 4EO3A 2LV3A 5DJLA 5DQSA 1YJ6A 1A0FA 2C80A 2H0GA 1K3YA 2H75A 1OC3A 3TB2A 2HRFA 1K3OA 4N10A 1E2YA 2N5FA 2D2ZA 4F0BA 7GSSA 2JADA 2DJ3A 2FWGA 1KNGA 4LLRA 4KX4A 1M9BA 3C7MA 3HVXA 2E2MA 5G5FA 4NAXA 3EU4A 3UOMA 3GKXA 1OC9A 16GSA 2J9HA 1HD2A 4MK3A 3EINA 3CXGA 4X43A 2M80A 4IKHA 2VCXA 4GLTA 4JZQA 2H6YA 4MZWA 3NIVA 1PA3A 2F9SA 4O7HA 3D21A 2FLSA 4ECIA 2MMNA 1SJZA 2IL3A 3LORA 2H1BA 1PX7A 3TJFA 4OCEA 3ZLPA 2Z9SA 2FA8A 3ME7A 3VWWA 4BWQA 2YWIA 2E7PA 2VL2C 1B4QA 2YANA 1T3BA 4NV2A 1GP1A 3H79A 3F63A 4WF5A 2ES7A 2LJAA 2RLIA 2YV7A 3KXOA 1WP0A 2X8GA 3FR3A 3F6FA 2GLRA 2B7JA 1EGRA 5JWRB 1XOBA 3I69A 1XW9A 1O7UA 4TN8A 5D73A 2R0PA 3L9VA 2GZYA 4I8BA 3TJGA 3L78A 5DALB 3A2XA 2H71A 1NHYA 5G31A 3GTUB 2PU9C 4ACSA 3LFLA 4Z2RA 1U3AA 11GSA 4HU7A 4WR4A 2R37A 5EPFA 2WZ9A 4TR3A 2PVQA 1PL1A 4BL7A 3GRXA 3TOUA 2CV4A 4MP4A 1QFNA 2O7KA 2C3TA 3RPPA 5CREA 2B5EA 4TVEA 1XWGA 1GLQA 3O3TA 5JCUA 2HSMA 4TXOA 1VGLA 1GSFA 4LMWA 1Q98A 2KOKA 3L0HA 3UMAA 1V98A 3VLNA 3VI5A 4Q5NA 3M9JA 4KAEA 5HR2A 2F8FA 1S3DA 2BMXA 3DRNA 2LNTA 5F8BA 4ILFA 3HZ4A 4OFTA 3IHGA 1FHEA 1U3IA 2M72A 3VFIA 3GKKA 1GUMA 1LBKA 2CZ3A 4K0NA 1GTAA 3C73A 1W4VA 5IPHA 3NZNA 1EP8A 1V2AA 3QFAC 3Q74A 4N0VA 2K9FA 2LTKA 4F9ZA 2QKEA 1WMJA 1QXHA 3IXRA 2VCTA 3S9FA 1ACVA 4WBJA 3BCKA 5A4VA 1THXA 5B6NA 1QUWA 2YOIA 1YQ1A 3IK9A 1B9XC 1ERUA 3P90A 2G2QA 2IMFA 3RPNA 3HHVA 5ECHB 2R0GA 3I9V2 1Z6NA 12GSA 3EC3A 1T7PB 3ZZXA 5J9CA 1ZYNA 2VM2A 3GL5A 5IMFA 3G9BA 4GQCA 4XHMA 2YV9A 4TRXA 1NSWA 2GQMA 5DALA 2R6KA 3TJKA 4K7OA 20GSA 4EE0A 2O85A 2RM5A 1PD21 1VF1A 4Q5RA 2IWTA 1CQGA 2H6XA 1THOA 2NVLA 4GWRA 1PMTA 3FKFA 3QAWA 2P31A 1E6BA 5CYYA 1M9AA 1T4ZA 2VCVA 3GKMA 2FWEA 3U5RE 1TJDA 4LL4B 2RUEA 5G5EA 3U6VA 2PVOC 5G2ZA 2LKUA 3HA9A 2ZUPA 4AJ6A 2GTUA 2HRNA 4TKYA 2A2PA 1AQXA 2AB6A 2WULA 5CP1A 1T8EB 3TJBA 5F07A 4BVXB 3QAGA 3IAS2 1XCCA 4ZBAA 4MZBA 4RI6A 4V2LA 4K7NA 1ZMAA 2H30A 4V1Ap 2V1MA 3CYNA 3L4NA 4O32A 4CY8A 1TK0B 4IW9A 1EP7A 4Q5QA 19GSA 4ZB9A 2CAIA 2LJRA 1OE8A 1O8XA 2F8AA 4BWSA 1J9BA 3ERFA 2X99A 2L4QA 1GTUA 4O5UA 4MH2A 1R5PA 3GX0A 3DD3A 1CQHA 2FNOA 3O76A 4ID0A 3IK7A 2DIYA 1BG5A 4TR4A 1XBSA 4X0XA 3VWUA 4AGSA 3DKSA 2VLUA 2H1DA 1RK4A 2EIRA 4NXIA 4K5SA 1SJ6A 4ECBA 1OKTA 4CW9A 3QMXA 2F3MA 4ZIJA 3E9JB 5C00A 3D4MA 4EF0A 1SU9A 1AAZA 4O5QA 1ILOA 2H6ZA 2E2GA 3FEUA 4WETA 4HQSA 1HNAA 3FK8A 5A5KA 2K6VA 5DCHA 2GQLA 5ECQB 2NBSA 1SK1A 2FCHA 2LSTA 1SJIA 4TR1A 2WFCA 2WCIA 1S3CA 5AGYA 1ERVA 4TOPA 2IMKA 4P3YB 5L71A 1ZGNA 2AHEA 1GWCA 4ML1A 2MMZA 3G7YA 4G0IA 2QSIA 2AJQB 4RUVA 4DSRA 2MMAA 1FVJA 4FYBA 1GSSA 2HZEB 2V41A 2N5AA 3PR8A 1PN0A 4XIHA 3CTFA 2DJ0A 1V40A 5G1LA 3F4RA 1R5AA 1XPVA 3L9SA 1TRWA 2V32A 5F05A 3M3MA 2C3NA 1PX6A 1TU8A 1JZDA 5JWOB 1K0NA 3ZL5A 3Q6OA 2HRAA 3ME8A 5F0GA 1LU4A 1TRVA 4IGJA 3ED3A 1OC9B 2LRCA 3CMIA 4GTUA 1ZCPA 4PNGA 3VPQA 1R26A 1MD4A 4GSTA 1K0OA 4KCAA 2JL4A 4OO4A 2C0GA 4KSMA 3UVHA 1R4WA 4FO5A 3J7Yk 1GUKA 1EWXA 4L8EA 4EL1A 3LYKA 2YN1A 3GSSA 4F2IA 4GRFA 3QDNA 4WBRD 2L59A 4WR5A 4POMA 4MLYA 4ISDA 1VF3A 5BRTA 2GGTA 2VD0A 1SK2A 4OWYA 1YKAA 1FO5A 3IBHA 1SKWB 5EVOA 2L6DA 3GN3A 5IIZA 3C1SA 3W8JA 4MJBA 3KIJA 1K0BA 3DMLA 5CRGA 1U88A 3FR6A 1MDIA 4EVMA 3GSTA 2I81A 5G30A 1MTCA 2A4VA 4IHUA 1FAAA 1F2EA 2FWFA 1Z9HA 5KN3A 2X4AA 6GSYA 4YKGA 5HFGA 2XBIA 3FMWA 6GSXA 3MYDA 4YH2A 4EIPA 5IQYA 2PN8A 8GSSA 5INYA 1AUCA 1SD8A 4E8EA 1A0RP 3ISOA 4TXVA 4IJIA 1T1VA 4MA9A 3PGTA 5ID2A 2HZEA 3ZITA 2HI7A 4KCEA 1A2JA 4AJ7A 3ZRDA 3ZMKA 1UC7A 4BL7B 3GFKA 2K8SA 2C0DA 2KLXA 3DGQA 1EV4A 1NM3A 2HYXA 3KGKA 3UVTA 3ZFLA 5D9XA 2RIIA 4KB3A 4EC0A 1EZKA 1HNBA 3F0IA 2HSHA 5IO2A 4JR6A 4TXOB 1EGOA 2EIOA 2H74A 5LCZA 4ECCA 3US3A 2P5QA 2FHEA 3FRCA 6GSSA 1T4YA 5KN1A 4YAVA 5CNWA 3CBUA 3WYWA 1OVNA 3FW2A 2YZHA 3KH7A 4HZ4A 2B1KA 9GSSA 5ELAA 2VOCA 4G2EA 3O6TA 3HJMA 4HS1A 3GH9A 2O89A 3RHBA 2IIYA 4NHWA 3UIWA 10GSA 3GUSA 2LJKA 4MDCA 2IJYA 1Y6EA 1YY7A 5IMDA 2JSZA 4PUAA 1K0MA 4XRAA 1RW1A 4PQIA 2VIMA 3IC8A 3GV1A 2LRNA 3W8SA 4MABA 3HCZA 1WJKA 3H1NA 1ZZYA 3P2AA 5B8BA 2DSAA 3KEBA 2FA4A 1KTEA 3LXTA 3RHCA 4WKWA 4KDYA 3J7Yb 3MDKA 3DEXA 3N5OA 3UBKA 1SYRA 5ELGA 2LQQA 1JZRA 4MF5A 3WT2A 1AQWA 4IQAA 2KP2A 3E3EA 2AUVA 1NW2A 4K1FA 3KMNA 4EKZA 4FYUA 4V1Ag 3ZIVA 2K18A 3I43A 3ZFBA 4K0GA 3KTBA 4MJAA 1DBYA 2TIRA 3GA4A 3HKRA 2LRTA 1ZYQB 3VPTA 5KEJA 4ULXA 1X9MB 1WIKA 2QA2A 3IC4A 2GSSA 2VCQA 4KNDA 2C8UA 3GH6A 3KMOA 2EIQA 4G9HA 3UEMA 1J08A 2CQ9A 4JRRA 1FOHA 4K9ZA 3QD9A 2JZSA 4IN0A 4PNFA 5IMZA 2REMA 1DSBA 4TW5A 1IYHA 1JZOA 2DJ1A 3D4TA 3FZ4A 3LG6A 1B48A 3BBYA 5H5SA 5H5QA 4GXZA 5DAKB 1SK0A 4CDOA 1M2DA 2C1YA 4H86A 5COHA 3ZYWA 4K2XA 3VWXA 2ON7A 2XHFA 1FB0A 1KBNA 3H4KA 3KZQA 3ZIJA 4IVFA 1YEXA 4BVYA 1PGTA 1C72A 4D73A 2P5RA 2KHPA 2GSQA 3MSZA 5AIXA 2H8LA 3QR6A 3A2WA 5GZZB 1B9YC 1EEJA 2OKAA 4X4JA 4YQVA 1WWJA 1AXDA 1AW9A 2WRTA 2HXKA 3PINA 17GSA 4EUYA 4KE3A 3WT1A 3FZ9A 2JZRA 3TRPA 3QPMA 4N11A 5IMCA 3LWAA 2LUSA 4JBBA 2MMOA 4ZL8A 1OKDA 1WRYA 5G1KA 2DMLA 2V2GA 4OMVA 3D0ZA 3IDVA 4TR1B 2DC5A 2R3XA 5FHIA 2R2JA 4K7IA 3ZREA 1MEKA 2DIZA 1GSEA 1OAZA 3LEFA 3G7JA 3TDGA 4HQZA 3QFBC 3OR5A 4PUFC 1TI1A 3UARA 2B3SA 3BD2A 3NOFA 1FOVA 4A5PA 1BJXA 2C3QA 1F37A 3EMXA 3BCIA 4IS0A 1PN9A 1V9WA 2HNLA 4LMVA 1BYEA 3LJRA 3HD5A 5J4UA 4IJ3A 4XTSA 3HVSA 1YEPA 2OJLA 2C0FA 3HZ8A 2IN3A 2HSYA 3IA1A 4J2FA 2K8VA 5JCWA 3FHKA 1N8JA 2DMMA 5BMUA 5F06A 1OC8A 3TCOA 3M0FA 2P0GA 4MH3A 3C8EA 2X49A 2PGTA 1X9SB 5DAKA 4HDEA 2NTOA 3IV4A 4MZCA 4IELA 1URMA 3R2QA 3TGZA 4GSSA 1TRSA 3W6GA 2LNSA 2NPBA 4HUAA 2CT6A 1F6MC 1VF4A 5IM9A 1EV9A 4K6XA 4I5QA 2MBTA 3G7IA 4PQ1A 3L9UA 1GULA 5HR0A 5ECOB 1TI3A 4N0ZA 5IMVA 1PL2A 2JZTA 1XXUA 2VLTA 3V1WA 4WF4A 2BJXA 2LS5A 3MAKA 5DJMA 3UBLA 4KA0A 2YJ7A 2HRKA 3C1RA 2O87A 2YP6A 3HXSA 1A2MA 1U87A 1M0UA 1OYJA 1TDIA 4PGTA 1ZYPA 2YNXA 1Z7RA 5IOWA 5CRDA 5H5RA 2VCZA 2B1LA 1SKRB 3KD0A 2IMIA 3GX8A 2A4HA 3WGXA 3BJ5A 1AIUA 1JFUA 1SL2B 1HNCA 1YF0A 5B7CA 1ZL9A 5ID2B 3CRTA 5B6MA 1O73A 1GNEA 5AIVA 2ALBA 2YZUA 2GDRA 3DYRA 3WGEA 2BTOT 1ZYEA 4K2DA 2H70A 2HLSA 2OE0A 3LGCA 4L5OA 1YF1A 3QCPA 2VD1A 1G0TA 1XWAA 3ZVJD 4OCFA 4BPYA 3GHAA 1HYUA 3KM6A 3HDCA 4OO5A 3WGDA 3IPZA 1FW1A 2DJKA 4KH7A 3GMFA 4DEJA 2HT9A 2XC2A 4PTSA 3HJOA 1MDKA 5KOXA 5DBQA 2NDOA 1FVKA 1QK8A 2QC7A 4J57E 2OA7A 1JZWA 2H66A 1MDJA 1GLPA 4LL1B 1T00A 2H72A 5ECRB 2MYGA 2B5XA 1M7TA 1G7EA 3EVIA 5ECIB 2PERA 2TRCP 5JCGA 4MPFA 2DJJA 1V57A 2VM1A 1ST9A 5AN1A 4ZL7A 2GVPA 2H76A 3EE2A 1BX9A 2DLXA 3M8NA 5ECNB 1A8YA 1XWKA 5DQYA 3GL3A 5GSSA 4V2MA 2H0HA 1K0CA 5FWGA 2L6CA 4G19A 1JHBA 4WXTA 6GSVA 4HZ2A 3KCMA 2H1GA 2CX4A 2VL9A 3HVVA 1AC1A 1BEDA 4IQ1A 13GSA 2L5OA 4NPBA 5A4UA 1ABAA 4PXOA 1HQOA 3KH9A 1GSUA 2GT5A 2R5GA 4EIQA 4HOJA 4XS4A 5IMAA 2N5BA 2V6KA 1BQ7A 1X5DA 4K8MA 4DSSA 2H19A 1DE1A 1IYIA 2C0EA 5ABRA 1YZXA 3QOUA 2GZPA 3FZ5A 3HJPA 4K5RA 4LA1A 5KOWA 3LW9A 2J23A 2A2SA 3FZAA 5J5NA 2JACA 2H01A 1GUHA 1FG4A 4O92A 5FT3A 4YAPA 3K8NA 3CSHA 1VRSD 2YWOA 2FGXA 4KDXA 4ML6A 5CRWA 4KUNA 2H0IA 5HQPA 1TK5B 1XFLA 1SL0B 6GSWA 4DSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L5L A;  5HFK A;  3DXB A;  2X8H A;  4XS6 A;  1TTZ A;  3TUE A;  4L0W A;  5EL8 A;  3VK9 A;  4F03 A;  5D93 A;  3N9J A;  4AF2 A;  3EWL A;  3F4S A;  4XRD A;  1A8L A;  4MF7 A;  1QQ2 A;  3RAZ A;  1O8W A;  4D73 B;  5KN0 A;  4WEY A;  5A4W A;  3GYK A;  4POK A;  3JCM L;  2VLV A;  4EXJ A;  4TR0 A;  4XS1 A;  3D22 A;  2CVK A;  4ECJ A;  3APO A;  1FB6 A;  2XBQ A;  3EMP A;  1TW9 A;  1M99 A;  4QL7 A;  5KN2 A;  1ML6 A;  2B7K A;  4POL A;  6GSU A;  3KP9 A;  2GST A;  18GS A;  2C4J A;  3IR4 A;  4FIW A;  4F82 A;  1F3A A;  5GAP D;  2L4C A;  5CO3 A;  1XZO A;  2GT6 A;  1U6T A;  1I9D A;  3A2V A;  1TKD B;  4PX1 A;  5E59 A;  3GIX A;  1SL1 B;  3ZVJ A;  5HFI A;  3DVW A;  5IO0 A;  3TRX A;  1A24 A;  2WS2 A;  4L5L A;  2VCW A;  4MCU A;  5JWQ B;  2OBK A;  22GS A;  1DE2 A;  2IFQ A;  3APS A;  4CHS A;  2I9H A;  4PQH A;  2LEG A;  2PPT A;  4MMM A;  4N30 A;  1PQN A;  4NHZ A;  5J3R A;  3FR9 A;  4EDY A;  3ERG A;  3GKN A;  4E8H A;  2MBS A;  2YJH A;  1K0A A;  3LYP A;  3HYP A;  1ZOF A;  3D6I A;  4FYC A;  3TJJ A;  4J56 E;  1TXX A;  3F9U A;  4G10 A;  4KGI A;  4OFN A;  3SBC A;  2LQO A;  5J9B A;  3FYG A;  3F4T A;  1R7H A;  3H8Q A;  4IP1 A;  3LXZ A;  5D9V A;  1XWB A;  4KSO A;  4GSN A;  2PWJ A;  2MZC A;  4IP6 A;  3TOT A;  1MD3 A;  4JR4 A;  3UAP A;  3KP8 A;  5ECP B;  4HU9 A;  2YCD A;  2I1U A;  1XIY A;  1USB A;  1V58 A;  5DDL A;  2YWN A;  3I6A A;  1Q4J A;  1UA5 A;  2X8C A;  5DVB A;  2V6O A;  1UVZ A;  2GS3 A;  14GS A;  2GQK A;  1J0F A;  2OE3 A;  3Q18 A;  2M46 A;  2O8V B;  5IPG A;  2ZNM A;  1X0R A;  4HEA 2;  3E0U A;  1X9W B;  1OE7 A;  2CA8 A;  2OBI A;  2AAW A;  2E0Q A;  1GSD A;  1XVQ A;  3PH9 A;  4ZXG A;  2OAC A;  2CZ2 A;  2JSY A;  2RM6 A;  3IAM 2;  1SEN A;  4OFM A;  2PBJ A;  4ZB6 A;  2DJ2 A;  1GTB A;  5D8I A;  3RBT A;  1WE0 A;  1XW5 A;  3F8U A;  5ECS A;  2F51 A;  1G6W A;  1WPI A;  2CVB A;  2CVD A;  3Q19 A;  2AYT A;  1G6Y A;  3TKR A;  1EOH A;  1KEB A;  4YQU A;  4ZB8 A;  5ENU A;  3LQ7 A;  3ERW A;  1LJR A;  1GH2 A;  2H73 A;  3GTU A;  1QMV A;  3M9K A;  1ON4 A;  3CRU A;  2GZZ A;  2VUP A;  1WOU A;  4RI7 A;  2WGR A;  4NMU A;  3KTL A;  1GTI A;  2GSR A;  4ZBD A;  5ECM B;  4YQM A;  1GSY A;  2ON5 A;  2VAF A;  4OD7 A;  2L57 A;  4ZIL A;  4XCS A;  1PRX A;  3CTG A;  5CAX A;  1S3A A;  2VO4 A;  3AY8 A;  5ECL B;  2HE3 A;  5C04 A;  2HFD A;  5E4W A;  1DUG A;  4F0C A;  4PUR A;  3TKS A;  4BA7 A;  3APQ A;  1BAY A;  4MPG A;  5ECK B;  4QQ7 A;  3F6D A;  1I5G A;  2I4A A;  4KDU A;  1F3B A;  3CSJ A;  3TRQ A;  4MJE A;  4Z7X A;  2XPD A;  1YDK A;  4ZBB A;  2CAQ A;  1AQV A;  4IBP A;  1SKS B;  3P7X A;  1JLV A;  4POB A;  3WD6 A;  1X5E A;  4FH8 A;  2X64 A;  5CRH A;  1Z7P A;  1XWC A;  1JLW A;  2WB9 A;  1XVW A;  1TRU A;  2QGV A;  5D9W A;  1SD9 A;  1XOA A;  2YWM A;  2PMT A;  3P8W A;  3ZTL A;  1M2B A;  4O5R A;  5IOX A;  1B4P A;  1QGV A;  3HY2 A;  6GST A;  1Y25 A;  2DBC A;  2IME A;  4AJ8 A;  2IMD A;  5GAN D;  4MJC A;  3UL3 A;  1EEM A;  1SYX A;  4XS4 B;  2FD3 A;  3DVX A;  4GF0 A;  3CSI A;  2FUG 2;  2AV4 A;  4DSS B;  4I2U A;  5HR1 A;  1ERW A;  2HZF A;  3DWV A;  4I2T A;  1N2A A;  1VF2 A;  3VWV A;  4GCI A;  1B8X A;  5LD0 A;  2WDU A;  1YKC A;  2IPA A;  2B5Y A;  2EC4 A;  3F3R A;  2FWH A;  3BOA A;  5EY6 A;  4NWY A;  1K0D A;  1GRX A;  4DVC A;  2I3Y A;  2VL3 A;  1X5C A;  1O85 A;  4RQR A;  4HJM A;  1H75 A;  3LSZ A;  5D9T A;  4EDZ A;  1GSQ A;  3EYT A;  2B6M A;  4JE1 A;  4BVX A;  5LNK e;  5J41 A;  4MF6 A;  2A2R A;  5DCG A;  1PSQ A;  3MNG A;  1Z6M A;  3IOS A;  3TKS C;  4ZL9 A;  1Z3E A;  1TU7 A;  4GQF A;  2G0F A;  1TOF A;  3SWL A;  3FY7 A;  4HJ2 A;  1PKW A;  3IE3 A;  3TKQ A;  2H1A A;  1F9M A;  1PKZ A;  3GNJ A;  1GL8 A;  2OAD A;  3C71 A;  3GUR A;  1UN2 A;  4KW6 A;  5D96 A;  1TK8 B;  1TP9 A;  3D5J A;  2KUC A;  4X1U A;  1GNW A;  1ERT A;  5HR3 A;  3IRA A;  1M2A A;  3F3Q A;  4V2N A;  1NHO A;  4I6X A;  4JU5 A;  1O81 A;  4Q5F A;  1Z5Y E;  2VL2 A;  3A3T A;  5B8A A;  4JED A;  2ZCT A;  2RUF A;  3KJY A;  4HI7 A;  3IHQ A;  1EOG A;  4RQX A;  1G7O A;  2WJU A;  3EUR A;  2FY6 A;  4I97 A;  1A2L A;  2PUK C;  1H4O A;  2TRX A;  3RDW A;  2R4V A;  2XPE A;  4NV5 A;  5AIS A;  3EU3 A;  3TKS E;  3QAV A;  2IFQ B;  3MWH A;  3H93 A;  3DIE A;  3M1G A;  1W89 A;  1XW6 A;  4QL9 A;  2YPM A;  2KP1 A;  2JU5 A;  1A23 A;  3TKP A;  3ZML A;  5GST A;  2OE1 A;  1RQM A;  4L0U A;  1O6J A;  3A5W A;  3UJ1 A;  3VI7 A;  1K3L A;  2CX3 A;  3VUR A;  4EO3 A;  2LV3 A;  5DJL A;  5DQS A;  1YJ6 A;  1A0F A;  2C80 A;  2H0G A;  1K3Y A;  2H75 A;  1OC3 A;  3TB2 A;  2HRF A;  1K3O A;  4N10 A;  1E2Y A;  2N5F A;  2D2Z A;  4F0B A;  7GSS A;  2JAD A;  2DJ3 A;  2FWG A;  1KNG A;  4LLR A;  4KX4 A;  1M9B A;  3C7M A;  3HVX A;  2E2M A;  5G5F A;  4NAX A;  3EU4 A;  3UOM A;  3GKX A;  1OC9 A;  16GS A;  2J9H A;  1HD2 A;  4MK3 A;  3EIN A;  3CXG A;  4X43 A;  2M80 A;  4IKH A;  2VCX A;  4GLT A;  4JZQ A;  2H6Y A;  4MZW A;  3NIV A;  1PA3 A;  2F9S A;  4O7H A;  3D21 A;  2FLS A;  4ECI A;  2MMN A;  1SJZ A;  2IL3 A;  3LOR A;  2H1B A;  1PX7 A;  3TJF A;  4OCE A;  3ZLP A;  2Z9S A;  2FA8 A;  3ME7 A;  3VWW A;  4BWQ A;  2YWI A;  2E7P A;  2VL2 C;  1B4Q A;  2YAN A;  1T3B A;  4NV2 A;  1GP1 A;  3H79 A;  3F63 A;  4WF5 A;  2ES7 A;  2LJA A;  2RLI A;  2YV7 A;  3KXO A;  1WP0 A;  2X8G A;  3FR3 A;  3F6F A;  2GLR A;  2B7J A;  1EGR A;  5JWR B;  1XOB A;  3I69 A;  1XW9 A;  1O7U A;  4TN8 A;  5D73 A;  3L9V A;  2GZY A;  4I8B A;  3TJG A;  3L78 A;  5DAL B;  3A2X A;  2H71 A;  1NHY A;  5G31 A;  3GTU B;  2PU9 C;  4ACS A;  3LFL A;  1U3A A;  11GS A;  4HU7 A;  4WR4 A;  2R37 A;  5EPF A;  2WZ9 A;  4TR3 A;  2PVQ A;  1PL1 A;  4BL7 A;  3GRX A;  3TOU A;  2CV4 A;  4MP4 A;  1QFN A;  2O7K A;  2C3T A;  3RPP A;  5CRE A;  2B5E A;  4TVE A;  1XWG A;  1GLQ A;  3O3T A;  5JCU A;  4TXO A;  1VGL A;  1GSF A;  4LMW A;  1Q98 A;  2KOK A;  3L0H A;  3UMA A;  1V98 A;  3VLN A;  3VI5 A;  4Q5N A;  3M9J A;  4KAE A;  5HR2 A;  2F8F A;  1S3D A;  2BMX A;  3DRN A;  2LNT A;  5F8B A;  4ILF A;  3HZ4 A;  4OFT A;  1FHE A;  1U3I A;  2M72 A;  3VFI A;  3GKK A;  1GUM A;  1LBK A;  2CZ3 A;  4K0N A;  1GTA A;  3C73 A;  1W4V A;  5IPH A;  3NZN A;  1EP8 A;  1V2A A;  3QFA C;  3Q74 A;  4N0V A;  2K9F A;  2LTK A;  4F9Z A;  2QKE A;  1WMJ A;  1QXH A;  3IXR A;  2VCT A;  3S9F A;  1ACV A;  4WBJ A;  3BCK A;  5A4V A;  1THX A;  5B6N A;  1QUW A;  2YOI A;  1YQ1 A;  3IK9 A;  1B9X C;  1ERU A;  3P90 A;  2G2Q A;  2IMF A;  3RPN A;  3HHV A;  5ECH B;  3I9V 2;  1Z6N A;  12GS A;  3EC3 A;  1T7P B;  3ZZX A;  5J9C A;  2VM2 A;  3GL5 A;  5IMF A;  3G9B A;  4GQC A;  4XHM A;  2YV9 A;  4TRX A;  1NSW A;  2GQM A;  5DAL A;  2R6K A;  3TJK A;  4K7O A;  20GS A;  4EE0 A;  2O85 A;  2RM5 A;  1PD2 1;  1VF1 A;  4Q5R A;  2IWT A;  1CQG A;  2H6X A;  1THO A;  2NVL A;  4GWR A;  1PMT A;  3FKF A;  3QAW A;  2P31 A;  1E6B A;  5CYY A;  1M9A A;  1T4Z A;  2VCV A;  3GKM A;  2FWE A;  3U5R E;  1TJD A;  4LL4 B;  2RUE A;  5G5E A;  3U6V A;  2PVO C;  5G2Z A;  2LKU A;  3HA9 A;  2ZUP A;  4AJ6 A;  2GTU A;  2HRN A;  4TKY A;  1AQX A;  2AB6 A;  2WUL A;  5CP1 A;  1T8E B;  3TJB A;  5F07 A;  3QAG A;  3IAS 2;  1XCC A;  4ZBA A;  4MZB A;  4RI6 A;  4V2L A;  4K7N A;  1ZMA A;  2H30 A;  4V1A p;  2V1M A;  3CYN A;  3L4N A;  4O32 A;  1TK0 B;  4IW9 A;  1EP7 A;  4Q5Q A;  19GS A;  4ZB9 A;  2CAI A;  2LJR A;  1OE8 A;  1O8X A;  2F8A A;  4BWS A;  1J9B A;  3ERF A;  2X99 A;  2L4Q A;  1GTU A;  4MH2 A;  1R5P A;  3GX0 A;  3DD3 A;  1CQH A;  2FNO A;  3O76 A;  4ID0 A;  3IK7 A;  2DIY A;  1BG5 A;  4TR4 A;  1XBS A;  4X0X A;  3VWU A;  4AGS A;  3DKS A;  2VLU A;  2H1D A;  1RK4 A;  2EIR A;  4NXI A;  1SJ6 A;  4ECB A;  1OKT A;  4CW9 A;  3QMX A;  2F3M A;  4ZIJ A;  3E9J B;  5C00 A;  3D4M A;  4EF0 A;  1SU9 A;  1AAZ A;  1ILO A;  2H6Z A;  2E2G A;  3FEU A;  4WET A;  4HQS A;  1HNA A;  3FK8 A;  5A5K A;  2K6V A;  5DCH A;  2GQL A;  5ECQ B;  2NBS A;  1SK1 A;  2FCH A;  2LST A;  1SJI A;  4TR1 A;  2WFC A;  2WCI A;  1S3C A;  5AGY A;  1ERV A;  4TOP A;  2IMK A;  4P3Y B;  5L71 A;  1ZGN A;  2AHE A;  1GWC A;  4ML1 A;  2MMZ A;  3G7Y A;  2QSI A;  2AJQ B;  4RUV A;  4DSR A;  2MMA A;  1FVJ A;  4FYB A;  1GSS A;  2HZE B;  2V41 A;  2N5A A;  3PR8 A;  4XIH A;  3CTF A;  2DJ0 A;  1V40 A;  5G1L A;  3F4R A;  1R5A A;  1XPV A;  3L9S A;  1TRW A;  2V32 A;  5F05 A;  3M3M A;  2C3N A;  1PX6 A;  1TU8 A;  1JZD A;  5JWO B;  1K0N A;  3ZL5 A;  3Q6O A;  3ME8 A;  5F0G A;  1LU4 A;  1TRV A;  4IGJ A;  3ED3 A;  1OC9 B;  2LRC A;  3CMI A;  4GTU A;  1ZCP A;  4PNG A;  3VPQ A;  1R26 A;  1MD4 A;  4GST A;  1K0O A;  4KCA A;  2JL4 A;  4OO4 A;  2C0G A;  4KSM A;  3UVH A;  1R4W A;  4FO5 A;  3J7Y k;  1GUK A;  1EWX A;  4L8E A;  4EL1 A;  3LYK A;  2YN1 A;  3GSS A;  4F2I A;  4GRF A;  3QDN A;  4WBR D;  2L59 A;  4WR5 A;  4POM A;  4MLY A;  4ISD A;  1VF3 A;  2GGT A;  2VD0 A;  1SK2 A;  4OWY A;  1YKA A;  1FO5 A;  3IBH A;  1SKW B;  5EVO A;  2L6D A;  3GN3 A;  5IIZ A;  3C1S A;  3W8J A;  4MJB A;  3KIJ A;  1K0B A;  3DML A;  5CRG A;  1U88 A;  3FR6 A;  1MDI A;  4EVM A;  3GST A;  2I81 A;  5G30 A;  1MTC A;  2A4V A;  4IHU A;  1FAA A;  1F2E A;  2FWF A;  1Z9H A;  5KN3 A;  6GSY A;  5HFG A;  2XBI A;  6GSX A;  4YH2 A;  5IQY A;  2PN8 A;  8GSS A;  5INY A;  1AUC A;  1SD8 A;  4E8E A;  1A0R P;  3ISO A;  4TXV A;  4IJI A;  1T1V A;  4MA9 A;  3PGT A;  5ID2 A;  2HZE A;  3ZIT A;  2HI7 A;  4KCE A;  1A2J A;  4AJ7 A;  3ZRD A;  3ZMK A;  1UC7 A;  3GFK A;  2K8S A;  2C0D A;  2KLX A;  3DGQ A;  1EV4 A;  1NM3 A;  2HYX A;  3KGK A;  3UVT A;  3ZFL A;  5D9X A;  2RII A;  4KB3 A;  4EC0 A;  1EZK A;  1HNB A;  3F0I A;  2HSH A;  5IO2 A;  4JR6 A;  4TXO B;  1EGO A;  2EIO A;  2H74 A;  5LCZ A;  4ECC A;  3US3 A;  2P5Q A;  2FHE A;  3FRC A;  6GSS A;  1T4Y A;  5KN1 A;  4YAV A;  5CNW A;  3CBU A;  3WYW A;  1OVN A;  3FW2 A;  2YZH A;  3KH7 A;  4HZ4 A;  2B1K A;  9GSS A;  5ELA A;  2VOC A;  4G2E A;  3O6T A;  3HJM A;  4HS1 A;  3GH9 A;  2O89 A;  3RHB A;  2IIY A;  4NHW A;  3UIW A;  10GS A;  3GUS A;  2LJK A;  4MDC A;  2IJY A;  1Y6E A;  1YY7 A;  5IMD A;  2JSZ A;  4PUA A;  1K0M A;  4XRA A;  1RW1 A;  4PQI A;  2VIM A;  3GV1 A;  2LRN A;  3W8S A;  4MAB A;  3HCZ A;  1WJK A;  3H1N A;  1ZZY A;  3P2A A;  5B8B A;  2DSA A;  3KEB A;  2FA4 A;  1KTE A;  3LXT A;  3RHC A;  4WKW A;  4KDY A;  3J7Y b;  3MDK A;  3DEX A;  3N5O A;  3UBK A;  1SYR A;  5ELG A;  2LQQ A;  1JZR A;  4MF5 A;  3WT2 A;  1AQW A;  4IQA A;  2KP2 A;  3E3E A;  2AUV A;  1NW2 A;  4K1F A;  3KMN A;  4EKZ A;  4FYU A;  4V1A g;  3ZIV A;  2K18 A;  3I43 A;  3ZFB A;  4K0G A;  3KTB A;  4MJA A;  1DBY A;  2TIR A;  3GA4 A;  3HKR A;  2LRT A;  1ZYQ B;  3VPT A;  5KEJ A;  4ULX A;  1X9M B;  1WIK A;  3IC4 A;  2GSS A;  2VCQ A;  4KND A;  2C8U A;  3GH6 A;  3KMO A;  2EIQ A;  4G9H A;  3UEM A;  1J08 A;  2CQ9 A;  4JRR A;  4K9Z A;  3QD9 A;  2JZS A;  4IN0 A;  4PNF A;  5IMZ A;  2REM A;  1DSB A;  4TW5 A;  1IYH A;  1JZO A;  2DJ1 A;  3D4T A;  3FZ4 A;  3LG6 A;  1B48 A;  3BBY A;  5H5S A;  5H5Q A;  4GXZ A;  5DAK B;  1SK0 A;  4CDO A;  1M2D A;  2C1Y A;  4H86 A;  5COH A;  3ZYW A;  3VWX A;  2ON7 A;  2XHF A;  1FB0 A;  1KBN A;  3H4K A;  3KZQ A;  3ZIJ A;  4IVF A;  1YEX A;  4BVY A;  1PGT A;  1C72 A;  4D73 A;  2P5R A;  2KHP A;  2GSQ A;  3MSZ A;  5AIX A;  2H8L A;  3QR6 A;  3A2W A;  5GZZ B;  1B9Y C;  1EEJ A;  2OKA A;  4YQV A;  1WWJ A;  1AXD A;  1AW9 A;  2WRT A;  2HXK A;  3PIN A;  17GS A;  4EUY A;  4KE3 A;  3WT1 A;  3FZ9 A;  2JZR A;  3TRP A;  3QPM A;  4N11 A;  5IMC A;  3LWA A;  2LUS A;  4JBB A;  2MMO A;  4ZL8 A;  1OKD A;  1WRY A;  5G1K A;  2DML A;  2V2G A;  4OMV A;  3D0Z A;  3IDV A;  4TR1 B;  2DC5 A;  2R3X A;  5FHI A;  2R2J A;  4K7I A;  3ZRE A;  1MEK A;  2DIZ A;  1GSE A;  1OAZ A;  3LEF A;  3G7J A;  3TDG A;  4HQZ A;  3QFB C;  3OR5 A;  4PUF C;  1TI1 A;  3UAR A;  2B3S A;  3BD2 A;  3NOF A;  1FOV A;  1BJX A;  2C3Q A;  1F37 A;  3EMX A;  3BCI A;  4IS0 A;  1PN9 A;  1V9W A;  2HNL A;  4LMV A;  1BYE A;  3LJR A;  3HD5 A;  5J4U A;  4IJ3 A;  4XTS A;  3HVS A;  1YEP A;  2OJL A;  2C0F A;  3HZ8 A;  2IN3 A;  2HSY A;  3IA1 A;  4J2F A;  2K8V A;  5JCW A;  3FHK A;  1N8J A;  2DMM A;  5F06 A;  1OC8 A;  3TCO A;  3M0F A;  2P0G A;  4MH3 A;  3C8E A;  2PGT A;  1X9S B;  5DAK A;  4HDE A;  2NTO A;  3IV4 A;  4MZC A;  4IEL A;  1URM A;  3R2Q A;  3TGZ A;  4GSS A;  1TRS A;  3W6G A;  2LNS A;  2NPB A;  4HUA A;  2CT6 A;  1F6M C;  1VF4 A;  5IM9 A;  1EV9 A;  4K6X A;  4I5Q A;  2MBT A;  3G7I A;  4PQ1 A;  3L9U A;  1GUL A;  5HR0 A;  5ECO B;  1TI3 A;  4N0Z A;  5IMV A;  1PL2 A;  2JZT A;  1XXU A;  2VLT A;  3V1W A;  4WF4 A;  2BJX A;  2LS5 A;  3MAK A;  5DJM A;  3UBL A;  4KA0 A;  2YJ7 A;  3C1R A;  2O87 A;  2YP6 A;  3HXS A;  1A2M A;  1U87 A;  1M0U A;  1OYJ A;  1TDI A;  4PGT A;  2YNX A;  1Z7R A;  5IOW A;  5CRD A;  5H5R A;  2VCZ A;  2B1L A;  1SKR B;  3KD0 A;  2IMI A;  3GX8 A;  3WGX A;  3BJ5 A;  1AIU A;  1JFU A;  1SL2 B;  1HNC A;  1YF0 A;  5B7C A;  1ZL9 A;  5ID2 B;  3CRT A;  5B6M A;  1O73 A;  1GNE A;  5AIV A;  2ALB A;  2YZU A;  2GDR A;  3DYR A;  3WGE A;  2BTO T;  1ZYE A;  4K2D A;  2H70 A;  2HLS A;  2OE0 A;  3LGC A;  4L5O A;  1YF1 A;  3QCP A;  2VD1 A;  1G0T A;  1XWA A;  3ZVJ D;  4OCF A;  4BPY A;  3GHA A;  1HYU A;  3KM6 A;  3HDC A;  4OO5 A;  3WGD A;  3IPZ A;  1FW1 A;  2DJK A;  4KH7 A;  3GMF A;  4DEJ A;  2HT9 A;  2XC2 A;  3HJO A;  1MDK A;  5DBQ A;  2NDO A;  1FVK A;  1QK8 A;  2QC7 A;  4J57 E;  2OA7 A;  1JZW A;  2H66 A;  1MDJ A;  1GLP A;  4LL1 B;  1T00 A;  2H72 A;  5ECR B;  2MYG A;  2B5X A;  1M7T A;  1G7E A;  3EVI A;  5ECI B;  2PER A;  2TRC P;  5JCG A;  4MPF A;  2DJJ A;  1V57 A;  2VM1 A;  1ST9 A;  5AN1 A;  4ZL7 A;  2GVP A;  2H76 A;  3EE2 A;  1BX9 A;  2DLX A;  3M8N A;  5ECN B;  1A8Y A;  1XWK A;  5DQY A;  3GL3 A;  5GSS A;  4V2M A;  2H0H A;  1K0C A;  5FWG A;  2L6C A;  4G19 A;  1JHB A;  4WXT A;  6GSV A;  4HZ2 A;  3KCM A;  2H1G A;  2CX4 A;  2VL9 A;  3HVV A;  1AC1 A;  1BED A;  4IQ1 A;  13GS A;  2L5O A;  4NPB A;  5A4U A;  1ABA A;  4PXO A;  1HQO A;  3KH9 A;  1GSU A;  2GT5 A;  2R5G A;  4HOJ A;  4XS4 A;  5IMA A;  2N5B A;  2V6K A;  1BQ7 A;  1X5D A;  4K8M A;  4DSS A;  2H19 A;  1DE1 A;  1IYI A;  2C0E A;  5ABR A;  1YZX A;  3QOU A;  2GZP A;  3FZ5 A;  3HJP A;  4LA1 A;  2J23 A;  2A2S A;  3FZA A;  5J5N A;  2JAC A;  2H01 A;  1GUH A;  1FG4 A;  4O92 A;  5FT3 A;  4YAP A;  3K8N A;  3CSH A;  1VRS D;  2YWO A;  2FGX A;  4KDX A;  4ML6 A;  5CRW A;  4KUN A;  2H0I A;  5HQP A;  1TK5 B;  1XFL A;  1SL0 B;  6GSW A;  4DSQ A; 
#chains in the Genus database with same CATH topology
 2L5L A;  5HFK A;  3DXB A;  2X8H A;  4FQU A;  4XS6 A;  1TTZ A;  3TUE A;  4L0W A;  5EL8 A;  4HSC X;  3VK9 A;  4F03 A;  5D93 A;  3N9J A;  4AF2 A;  3EWL A;  3F4S A;  4XRD A;  1A8L A;  4MF7 A;  1QQ2 A;  4BVY B;  3RAZ A;  4KF9 A;  1O8W A;  4D73 B;  5KN0 A;  4WEY A;  5A4W A;  3GYK A;  4POK A;  3JCM L;  2VLV A;  4EXJ A;  2DKI A;  4TR0 A;  4XS1 A;  3D22 A;  2CVK A;  4ECJ A;  3APO A;  1FB6 A;  4Z2U A;  2XBQ A;  3EMP A;  1TW9 A;  1M99 A;  1S3R A;  4QL7 A;  5KN2 A;  1ML6 A;  2B7K A;  4POL A;  6GSU A;  3KP9 A;  2GST A;  18GS A;  2C4J A;  3IR4 A;  4FIW A;  4F82 A;  1F3A A;  5GAP D;  2L4C A;  5CO3 A;  1XZO A;  2GT6 A;  1U6T A;  1I9D A;  3A2V A;  3MIX A;  4PX1 A;  1TKD B;  5E59 A;  3GIX A;  1SL1 B;  3ZVJ A;  5HFI A;  3DVW A;  5IO0 A;  3TRX A;  1A24 A;  2WS2 A;  4L5L A;  2VCW A;  4MCU A;  5JWQ B;  2OBK A;  22GS A;  1DE2 A;  2IFQ A;  3APS A;  4CHS A;  2I9H A;  4PQH A;  2LEG A;  2PPT A;  4MMM A;  4N30 A;  1PQN A;  4NHZ A;  5J3R A;  3FR9 A;  4EDY A;  3ERG A;  3GKN A;  3PPU A;  4E8H A;  4Z2T A;  2MBS A;  2YJH A;  1PFO A;  1K0A A;  3LYP A;  3HYP A;  1ZOF A;  3D6I A;  4FYC A;  3TJJ A;  4J56 E;  1TXX A;  3F9U A;  4G10 A;  4KGI A;  4OFN A;  3SBC A;  2LQO A;  5J9B A;  3FYG A;  3F4T A;  1R7H A;  3H8Q A;  4IP1 A;  3LXZ A;  5D9V A;  1XG8 A;  1XWB A;  4KSO A;  4GSN A;  2PWJ A;  2MZC A;  4IP6 A;  3TOT A;  1MD3 A;  4JR4 A;  3UAP A;  3KP8 A;  5ECP B;  4HU9 A;  2YCD A;  2I1U A;  1XIY A;  1USB A;  1V58 A;  5DDL A;  2YWN A;  3I6A A;  1Q4J A;  1UA5 A;  2X8C A;  5DVB A;  2V6O A;  1UVZ A;  2GS3 A;  14GS A;  2GQK A;  1J0F A;  2OE3 A;  3Q18 A;  2M46 A;  4ICY A;  2O8V B;  4G0K A;  5IPG A;  2ZNM A;  1X0R A;  4HEA 2;  3E0U A;  1X9W B;  1OE7 A;  2CA8 A;  2OBI A;  2AAW A;  2E0Q A;  1GSD A;  1XVQ A;  3PH9 A;  4ZXG A;  3R3E A;  2UZ8 A;  2OAC A;  2CZ2 A;  2JSY A;  2RM6 A;  3IAM 2;  1SEN A;  4OFM A;  2PBJ A;  4ZB6 A;  2DJ2 A;  1GTB A;  5D8I A;  3RBT A;  1WE0 A;  1XW5 A;  3F8U A;  5ECS A;  2F51 A;  1G6W A;  1WPI A;  2CVB A;  2CVD A;  3Q19 A;  2AYT A;  1G6Y A;  3TKR A;  1EOH A;  1KEB A;  4YQU A;  4ZB8 A;  5ENU A;  3LQ7 A;  3ERW A;  1LJR A;  1GH2 A;  2H73 A;  3GTU A;  4CY6 A;  1QMV A;  3M9K A;  1ON4 A;  1M3I A;  3CRU A;  2GZZ A;  2VUP A;  1WOU A;  4RI7 A;  2WGR A;  3A5I A;  4NMU A;  3KTL A;  1GTI A;  2GSR A;  4ZBD A;  5ECM B;  4YQM A;  1GSY A;  2ON5 A;  2VAF A;  4OD7 A;  2L57 A;  4ZIL A;  4XCS A;  1PRX A;  3CTG A;  5CAX A;  1S3A A;  2VO4 A;  3AY8 A;  5ECL B;  2HE3 A;  2QA1 A;  5C04 A;  2HFD A;  2R0C A;  1DUG A;  5E4W A;  4F0C A;  4PUR A;  3TKS A;  4BA7 A;  3APQ A;  1BAY A;  4MPG A;  5ECK B;  4QQ7 A;  3F6D A;  1I5G A;  2I4A A;  4KDU A;  1F3B A;  2DKH A;  3CSJ A;  3TRQ A;  4MJE A;  4Z7X A;  2XPD A;  1YDK A;  4ZBB A;  2CAQ A;  1AQV A;  4IBP A;  1SKS B;  3P7X A;  1JLV A;  4POB A;  3WD6 A;  1X5E A;  4FH8 A;  2X64 A;  5CRH A;  1Z7P A;  1XWC A;  1JLW A;  2WB9 A;  1XVW A;  1TRU A;  2QGV A;  5D9W A;  1SD9 A;  1XOA A;  2YWM A;  2PMT A;  3P8W A;  3ZTL A;  1M2B A;  4O5R A;  5IOX A;  1B4P A;  1QGV A;  3HY2 A;  6GST A;  1Y25 A;  2DBC A;  2IME A;  4AJ8 A;  2IMD A;  5GAN D;  4MJC A;  3UL3 A;  1EEM A;  1SYX A;  4XS4 B;  2FD3 A;  3DVX A;  4GF0 A;  3CSI A;  4MNN A;  2FUG 2;  2AV4 A;  4DSS B;  4I2U A;  5HR1 A;  1ERW A;  2HZF A;  3DWV A;  4I2T A;  1N2A A;  1VF2 A;  3VWV A;  4GCI A;  1B8X A;  5LD0 A;  2WDU A;  1YKC A;  2IPA A;  2B5Y A;  2EC4 A;  3F3R A;  2FWH A;  3BOA A;  5EY6 A;  4NWY A;  1K0D A;  1GRX A;  4DVC A;  2I3Y A;  2VL3 A;  1X5C A;  1O85 A;  4RQR A;  4HJM A;  1H75 A;  3LSZ A;  5D9T A;  4EDZ A;  4G0L A;  1GSQ A;  3EYT A;  2B6M A;  4JE1 A;  4BVX A;  5LNK e;  5J41 A;  4MF6 A;  2A2R A;  5DCG A;  1PSQ A;  3MNG A;  1Z6M A;  3IOS A;  3TKS C;  4ZL9 A;  1Z3E A;  1TU7 A;  4GQF A;  2G0F A;  1TOF A;  3SWL A;  3FY7 A;  4HJ2 A;  1PKW A;  3IE3 A;  3TKQ A;  2H1A A;  1F9M A;  1PKZ A;  3GNJ A;  1GL8 A;  2OAD A;  3C71 A;  3GUR A;  1UN2 A;  4KW6 A;  5D96 A;  1TK8 B;  1TP9 A;  3D5J A;  2KUC A;  4X1U A;  4USS A;  1GNW A;  1ERT A;  5HR3 A;  3IRA A;  1M2A A;  3F3Q A;  4V2N A;  4YKF A;  1NHO A;  4I6X A;  4JU5 A;  1O81 A;  4Q5F A;  1Z5Y E;  2VL2 A;  3A3T A;  5B8A A;  4JED A;  2ZCT A;  2RUF A;  3KJY A;  4HI7 A;  3IHQ A;  1EOG A;  4RQX A;  1G7O A;  2WJU A;  3EUR A;  2FY6 A;  4I97 A;  1A2L A;  2PUK C;  1H4O A;  2TRX A;  3RDW A;  2R4V A;  2XPE A;  4NV5 A;  5AIS A;  3EU3 A;  3TKS E;  3QAV A;  2IFQ B;  3MWH A;  3H93 A;  3DIE A;  3M1G A;  1W89 A;  1XW6 A;  3EPT A;  4QL9 A;  2YPM A;  2KP1 A;  2JU5 A;  1A23 A;  3TKP A;  3ZML A;  5GST A;  2OE1 A;  1RQM A;  4L0U A;  1O6J A;  3A5W A;  3UJ1 A;  3VI7 A;  1K3L A;  2CX3 A;  3VUR A;  4EO3 A;  2LV3 A;  5DJL A;  5DQS A;  1YJ6 A;  1A0F A;  2C80 A;  2H0G A;  1K3Y A;  2H75 A;  1OC3 A;  3TB2 A;  2HRF A;  1K3O A;  4N10 A;  1E2Y A;  2N5F A;  2D2Z A;  4F0B A;  7GSS A;  2JAD A;  2DJ3 A;  2FWG A;  1KNG A;  4LLR A;  4KX4 A;  1M9B A;  3C7M A;  3HVX A;  2E2M A;  5G5F A;  4NAX A;  3EU4 A;  3UOM A;  3GKX A;  1OC9 A;  16GS A;  2J9H A;  1HD2 A;  4MK3 A;  3EIN A;  3CXG A;  4X43 A;  2M80 A;  4IKH A;  2VCX A;  4GLT A;  4JZQ A;  2H6Y A;  4MZW A;  3NIV A;  1PA3 A;  2F9S A;  4O7H A;  3D21 A;  2FLS A;  4ECI A;  2MMN A;  1SJZ A;  2IL3 A;  3LOR A;  2H1B A;  1PX7 A;  3TJF A;  4OCE A;  3ZLP A;  2Z9S A;  2FA8 A;  3ME7 A;  3VWW A;  4BWQ A;  2YWI A;  2E7P A;  2VL2 C;  1B4Q A;  2YAN A;  1T3B A;  4NV2 A;  1GP1 A;  3H79 A;  3F63 A;  4WF5 A;  2ES7 A;  2LJA A;  2RLI A;  2YV7 A;  3KXO A;  1WP0 A;  2X8G A;  3FR3 A;  3F6F A;  2GLR A;  2B7J A;  1EGR A;  5JWR B;  1XOB A;  3I69 A;  1XW9 A;  1O7U A;  4TN8 A;  5D73 A;  2R0P A;  3L9V A;  2GZY A;  4I8B A;  3TJG A;  3L78 A;  5DAL B;  3A2X A;  2H71 A;  1NHY A;  5G31 A;  3GTU B;  2PU9 C;  4ACS A;  3LFL A;  4Z2R A;  1U3A A;  11GS A;  4HU7 A;  4WR4 A;  2R37 A;  5EPF A;  2WZ9 A;  4TR3 A;  2PVQ A;  1PL1 A;  4BL7 A;  3GRX A;  3TOU A;  2CV4 A;  4MP4 A;  1QFN A;  2O7K A;  2C3T A;  3RPP A;  5CRE A;  2B5E A;  4TVE A;  1XWG A;  1GLQ A;  3O3T A;  5JCU A;  2HSM A;  4TXO A;  1VGL A;  1GSF A;  4LMW A;  1Q98 A;  2KOK A;  3L0H A;  3UMA A;  1V98 A;  3VLN A;  3VI5 A;  4Q5N A;  3M9J A;  4KAE A;  5HR2 A;  2F8F A;  1S3D A;  2BMX A;  3DRN A;  2LNT A;  5F8B A;  4ILF A;  3HZ4 A;  4OFT A;  3IHG A;  1FHE A;  1U3I A;  2M72 A;  3VFI A;  3GKK A;  1GUM A;  1LBK A;  2CZ3 A;  4K0N A;  1GTA A;  3C73 A;  1W4V A;  5IPH A;  3NZN A;  1EP8 A;  1V2A A;  3QFA C;  3Q74 A;  4N0V A;  2K9F A;  2LTK A;  4F9Z A;  2QKE A;  1WMJ A;  1QXH A;  3IXR A;  2VCT A;  3S9F A;  1ACV A;  4WBJ A;  3BCK A;  5A4V A;  1THX A;  5B6N A;  1QUW A;  2YOI A;  1YQ1 A;  3IK9 A;  1B9X C;  1ERU A;  3P90 A;  2G2Q A;  2IMF A;  3RPN A;  3HHV A;  5ECH B;  2R0G A;  3I9V 2;  1Z6N A;  12GS A;  3EC3 A;  1T7P B;  3ZZX A;  5J9C A;  1ZYN A;  2VM2 A;  3GL5 A;  5IMF A;  3G9B A;  4GQC A;  4XHM A;  2YV9 A;  4TRX A;  1NSW A;  2GQM A;  5DAL A;  2R6K A;  3TJK A;  4K7O A;  20GS A;  4EE0 A;  2O85 A;  2RM5 A;  1PD2 1;  1VF1 A;  4Q5R A;  2IWT A;  1CQG A;  2H6X A;  1THO A;  2NVL A;  4GWR A;  1PMT A;  3FKF A;  3QAW A;  2P31 A;  1E6B A;  1M9A A;  1T4Z A;  2VCV A;  5CYY A;  3GKM A;  2FWE A;  3U5R E;  1TJD A;  4LL4 B;  2RUE A;  5G5E A;  3U6V A;  2PVO C;  5G2Z A;  2LKU A;  3HA9 A;  2ZUP A;  4AJ6 A;  2GTU A;  2HRN A;  4TKY A;  2A2P A;  1AQX A;  2AB6 A;  2WUL A;  5CP1 A;  3CQF A;  1T8E B;  3TJB A;  5F07 A;  4BVX B;  3QAG A;  3IAS 2;  1XCC A;  4ZBA A;  4MZB A;  4RI6 A;  4V2L A;  4K7N A;  1ZMA A;  2H30 A;  4V1A p;  2V1M A;  3CYN A;  3L4N A;  4O32 A;  4CY8 A;  1TK0 B;  4IW9 A;  1EP7 A;  4Q5Q A;  19GS A;  4ZB9 A;  2CAI A;  2LJR A;  1OE8 A;  1O8X A;  2F8A A;  4BWS A;  1J9B A;  3ERF A;  2X99 A;  2L4Q A;  1GTU A;  4O5U A;  4MH2 A;  1R5P A;  3GX0 A;  3DD3 A;  1CQH A;  2FNO A;  3O76 A;  4ID0 A;  3IK7 A;  2DIY A;  1BG5 A;  4TR4 A;  1XBS A;  4X0X A;  3VWU A;  4AGS A;  3DKS A;  2VLU A;  2H1D A;  1RK4 A;  2EIR A;  4NXI A;  4K5S A;  1SJ6 A;  4ECB A;  1OKT A;  4CW9 A;  3QMX A;  2F3M A;  4ZIJ A;  3E9J B;  5C00 A;  3D4M A;  4EF0 A;  1SU9 A;  1AAZ A;  4O5Q A;  1ILO A;  2H6Z A;  2E2G A;  3FEU A;  4WET A;  4HQS A;  1HNA A;  3FK8 A;  5A5K A;  2K6V A;  5DCH A;  2GQL A;  5ECQ B;  2NBS A;  1SK1 A;  2FCH A;  2LST A;  1SJI A;  4TR1 A;  2WFC A;  2WCI A;  1S3C A;  5AGY A;  1ERV A;  4TOP A;  2IMK A;  4P3Y B;  5L71 A;  1ZGN A;  2AHE A;  1GWC A;  4ML1 A;  2MMZ A;  3G7Y A;  4G0I A;  2QSI A;  2AJQ B;  4RUV A;  4DSR A;  2MMA A;  1FVJ A;  4FYB A;  1GSS A;  2HZE B;  2V41 A;  2N5A A;  3PR8 A;  1PN0 A;  4XIH A;  3CTF A;  2DJ0 A;  1V40 A;  5G1L A;  3F4R A;  1R5A A;  1XPV A;  3L9S A;  1TRW A;  2V32 A;  5F05 A;  3M3M A;  2C3N A;  1PX6 A;  1TU8 A;  1JZD A;  5JWO B;  1K0N A;  3ZL5 A;  3Q6O A;  2HRA A;  3ME8 A;  5F0G A;  1LU4 A;  1TRV A;  4IGJ A;  3ED3 A;  1OC9 B;  2LRC A;  3CMI A;  4GTU A;  1ZCP A;  4PNG A;  3VPQ A;  1R26 A;  1MD4 A;  4GST A;  1K0O A;  4KCA A;  2JL4 A;  4OO4 A;  2C0G A;  4KSM A;  3UVH A;  1R4W A;  4FO5 A;  3J7Y k;  1GUK A;  1EWX A;  4L8E A;  4EL1 A;  3LYK A;  2YN1 A;  3GSS A;  4F2I A;  4GRF A;  3QDN A;  4WBR D;  2L59 A;  4WR5 A;  4POM A;  4MLY A;  4ISD A;  1VF3 A;  5BRT A;  2GGT A;  2VD0 A;  1SK2 A;  4OWY A;  1YKA A;  1FO5 A;  3IBH A;  1SKW B;  5EVO A;  2L6D A;  3GN3 A;  5IIZ A;  3C1S A;  3W8J A;  4MJB A;  3KIJ A;  1K0B A;  3DML A;  5CRG A;  1U88 A;  3FR6 A;  1MDI A;  4EVM A;  3GST A;  2I81 A;  5G30 A;  1MTC A;  2A4V A;  4IHU A;  1FAA A;  1F2E A;  2FWF A;  1Z9H A;  5KN3 A;  2X4A A;  6GSY A;  4YKG A;  5HFG A;  2XBI A;  3FMW A;  6GSX A;  3MYD A;  4YH2 A;  4EIP A;  5IQY A;  2PN8 A;  8GSS A;  5INY A;  1AUC A;  1SD8 A;  4E8E A;  1A0R P;  3ISO A;  4TXV A;  4IJI A;  1T1V A;  4MA9 A;  3PGT A;  5ID2 A;  2HZE A;  3ZIT A;  2HI7 A;  4KCE A;  1A2J A;  4AJ7 A;  3ZRD A;  3ZMK A;  1UC7 A;  4BL7 B;  3GFK A;  2K8S A;  2C0D A;  2KLX A;  3DGQ A;  1EV4 A;  1NM3 A;  2HYX A;  3KGK A;  3UVT A;  3ZFL A;  5D9X A;  2RII A;  4KB3 A;  4EC0 A;  1EZK A;  1HNB A;  3F0I A;  2HSH A;  5IO2 A;  4JR6 A;  4TXO B;  1EGO A;  2EIO A;  2H74 A;  5LCZ A;  4ECC A;  3US3 A;  2P5Q A;  2FHE A;  3FRC A;  6GSS A;  1T4Y A;  5KN1 A;  4YAV A;  5CNW A;  3CBU A;  3WYW A;  1OVN A;  3FW2 A;  2YZH A;  3KH7 A;  4HZ4 A;  2B1K A;  9GSS A;  5ELA A;  2VOC A;  4G2E A;  3O6T A;  3HJM A;  4HS1 A;  3GH9 A;  2O89 A;  3RHB A;  2IIY A;  4NHW A;  3UIW A;  10GS A;  3GUS A;  2LJK A;  4MDC A;  2IJY A;  1Y6E A;  1YY7 A;  5IMD A;  2JSZ A;  4PUA A;  1K0M A;  4XRA A;  1RW1 A;  4PQI A;  2VIM A;  3IC8 A;  3GV1 A;  2LRN A;  3W8S A;  4MAB A;  3HCZ A;  1WJK A;  3H1N A;  1ZZY A;  3P2A A;  5B8B A;  2DSA A;  3KEB A;  2FA4 A;  1KTE A;  3LXT A;  3RHC A;  4WKW A;  4KDY A;  3J7Y b;  3MDK A;  3DEX A;  3N5O A;  3UBK A;  1SYR A;  5ELG A;  2LQQ A;  1JZR A;  4MF5 A;  3WT2 A;  1AQW A;  4IQA A;  2KP2 A;  3E3E A;  2AUV A;  1NW2 A;  4K1F A;  3HVN A;  3KMN A;  4EKZ A;  4FYU A;  4V1A g;  3ZIV A;  2K18 A;  3I43 A;  3ZFB A;  4K0G A;  3KTB A;  4MJA A;  1DBY A;  2TIR A;  3GA4 A;  3HKR A;  2LRT A;  1ZYQ B;  3VPT A;  5KEJ A;  4ULX A;  1X9M B;  1WIK A;  2QA2 A;  3IC4 A;  2GSS A;  2VCQ A;  4KND A;  2C8U A;  3GH6 A;  3KMO A;  2EIQ A;  4G9H A;  3UEM A;  1J08 A;  2CQ9 A;  4JRR A;  1FOH A;  4K9Z A;  3QD9 A;  2JZS A;  4IN0 A;  4PNF A;  5IMZ A;  2REM A;  1DSB A;  4TW5 A;  1IYH A;  1JZO A;  2DJ1 A;  3D4T A;  3FZ4 A;  3LG6 A;  1B48 A;  3BBY A;  5H5S A;  5H5Q A;  4GXZ A;  5DAK B;  1SK0 A;  4CDO A;  1M2D A;  2C1Y A;  4H86 A;  5COH A;  3ZYW A;  4K2X A;  3VWX A;  2ON7 A;  2XHF A;  1FB0 A;  1KBN A;  3H4K A;  3KZQ A;  3ZIJ A;  4IVF A;  1YEX A;  4BVY A;  1PGT A;  1C72 A;  4D73 A;  2P5R A;  2KHP A;  2GSQ A;  3MSZ A;  5AIX A;  2H8L A;  3QR6 A;  3A2W A;  5GZZ B;  1B9Y C;  1EEJ A;  2OKA A;  4X4J A;  4YQV A;  1WWJ A;  1AXD A;  1AW9 A;  2WRT A;  2HXK A;  3PIN A;  17GS A;  4EUY A;  4KE3 A;  3WT1 A;  3FZ9 A;  2JZR A;  3TRP A;  3QPM A;  4N11 A;  5IMC A;  3LWA A;  2LUS A;  4JBB A;  2MMO A;  4ZL8 A;  1OKD A;  1WRY A;  5G1K A;  2DML A;  2V2G A;  4OMV A;  3D0Z A;  3IDV A;  4TR1 B;  2DC5 A;  2R3X A;  5FHI A;  2R2J A;  4K7I A;  3ZRE A;  1MEK A;  2DIZ A;  1GSE A;  1OAZ A;  3LEF A;  3G7J A;  3TDG A;  4HQZ A;  3QFB C;  3OR5 A;  4PUF C;  1TI1 A;  3UAR A;  2B3S A;  3BD2 A;  3NOF A;  1FOV A;  4A5P A;  1BJX A;  2C3Q A;  1F37 A;  3EMX A;  3BCI A;  4IS0 A;  1PN9 A;  1V9W A;  2HNL A;  4LMV A;  1BYE A;  3LJR A;  3HD5 A;  5J4U A;  4IJ3 A;  4XTS A;  3HVS A;  1YEP A;  2OJL A;  2C0F A;  3HZ8 A;  2IN3 A;  2HSY A;  3IA1 A;  4J2F A;  2K8V A;  5JCW A;  3FHK A;  1N8J A;  2DMM A;  5BMU A;  5F06 A;  1OC8 A;  3TCO A;  3M0F A;  2P0G A;  4MH3 A;  3C8E A;  2X49 A;  2PGT A;  1X9S B;  5DAK A;  4HDE A;  2NTO A;  3IV4 A;  4MZC A;  4IEL A;  1URM A;  3R2Q A;  3TGZ A;  4GSS A;  1TRS A;  3W6G A;  2LNS A;  2NPB A;  4HUA A;  2CT6 A;  1F6M C;  1VF4 A;  5IM9 A;  1EV9 A;  4K6X A;  4I5Q A;  2MBT A;  3G7I A;  4PQ1 A;  3L9U A;  1GUL A;  5HR0 A;  5ECO B;  1TI3 A;  4N0Z A;  5IMV A;  1PL2 A;  2JZT A;  1XXU A;  2VLT A;  3V1W A;  4WF4 A;  2BJX A;  2LS5 A;  3MAK A;  5DJM A;  3UBL A;  4KA0 A;  2YJ7 A;  2HRK A;  3C1R A;  2O87 A;  2YP6 A;  3HXS A;  1A2M A;  1U87 A;  1M0U A;  1OYJ A;  1TDI A;  4PGT A;  1ZYP A;  2YNX A;  1Z7R A;  5IOW A;  5CRD A;  5H5R A;  2VCZ A;  2B1L A;  1SKR B;  3KD0 A;  2IMI A;  3GX8 A;  2A4H A;  3WGX A;  3BJ5 A;  1AIU A;  1JFU A;  1SL2 B;  1HNC A;  1YF0 A;  5B7C A;  1ZL9 A;  5ID2 B;  3CRT A;  5B6M A;  1O73 A;  1GNE A;  5AIV A;  2ALB A;  2YZU A;  2GDR A;  3DYR A;  3WGE A;  2BTO T;  1ZYE A;  4K2D A;  2H70 A;  2HLS A;  2OE0 A;  3LGC A;  4L5O A;  1YF1 A;  3QCP A;  2VD1 A;  1G0T A;  1XWA A;  3ZVJ D;  4OCF A;  4BPY A;  3GHA A;  1HYU A;  3KM6 A;  3HDC A;  4OO5 A;  3WGD A;  3IPZ A;  1FW1 A;  2DJK A;  4KH7 A;  1M3J A;  3GMF A;  4DEJ A;  2HT9 A;  2XC2 A;  4PTS A;  3HJO A;  1MDK A;  5KOX A;  5DBQ A;  2NDO A;  1FVK A;  1QK8 A;  2QC7 A;  4J57 E;  2OA7 A;  1JZW A;  2H66 A;  1MDJ A;  1GLP A;  4LL1 B;  1T00 A;  2H72 A;  5ECR B;  2MYG A;  2B5X A;  1M7T A;  1G7E A;  3EVI A;  5ECI B;  2PER A;  2TRC P;  5JCG A;  4MPF A;  2DJJ A;  1V57 A;  2VM1 A;  1ST9 A;  5AN1 A;  4ZL7 A;  2GVP A;  2H76 A;  3EE2 A;  1BX9 A;  2DLX A;  3M8N A;  5ECN B;  1A8Y A;  1XWK A;  5DQY A;  3GL3 A;  5GSS A;  4V2M A;  2H0H A;  1K0C A;  5FWG A;  2L6C A;  4G19 A;  1JHB A;  4WXT A;  6GSV A;  4HZ2 A;  3KCM A;  2H1G A;  2CX4 A;  2VL9 A;  3HVV A;  1AC1 A;  1BED A;  4IQ1 A;  13GS A;  2L5O A;  4NPB A;  5A4U A;  1ABA A;  4PXO A;  1HQO A;  3KH9 A;  1GSU A;  2GT5 A;  4BIK A;  2R5G A;  4EIQ A;  4HOJ A;  4XS4 A;  5IMA A;  2N5B A;  2V6K A;  1BQ7 A;  1X5D A;  4K8M A;  4DSS A;  2H19 A;  1DE1 A;  1IYI A;  2C0E A;  5ABR A;  1YZX A;  3QOU A;  2GZP A;  3FZ5 A;  3HJP A;  4K5R A;  4LA1 A;  5KOW A;  3LW9 A;  2J23 A;  2A2S A;  3FZA A;  5J5N A;  2JAC A;  2H01 A;  1GUH A;  1FG4 A;  4O92 A;  5FT3 A;  4YAP A;  3K8N A;  3CSH A;  1VRS D;  2YWO A;  2FGX A;  4KDX A;  4ML6 A;  5CRW A;  4KUN A;  2H0I A;  5HQP A;  1TK5 B;  1XFL A;  1SL0 B;  6GSW A;  4DSQ A; 
#chains in the Genus database with same CATH homology
 2L5L A;  5HFK A;  3DXB A;  2X8H A;  4FQU A;  4XS6 A;  1TTZ A;  3TUE A;  4L0W A;  5EL8 A;  3VK9 A;  4F03 A;  5D93 A;  3N9J A;  4AF2 A;  3EWL A;  3F4S A;  4XRD A;  1A8L A;  4MF7 A;  1QQ2 A;  4BVY B;  3RAZ A;  4KF9 A;  1O8W A;  4D73 B;  5KN0 A;  4WEY A;  5A4W A;  3GYK A;  4POK A;  3JCM L;  2VLV A;  4EXJ A;  2DKI A;  4TR0 A;  4XS1 A;  3D22 A;  2CVK A;  4ECJ A;  3APO A;  1FB6 A;  4Z2U A;  2XBQ A;  3EMP A;  1TW9 A;  1M99 A;  4QL7 A;  5KN2 A;  1ML6 A;  2B7K A;  4POL A;  6GSU A;  3KP9 A;  2GST A;  18GS A;  2C4J A;  3IR4 A;  4FIW A;  4F82 A;  1F3A A;  5GAP D;  2L4C A;  5CO3 A;  1XZO A;  2GT6 A;  1U6T A;  1I9D A;  3A2V A;  3MIX A;  4PX1 A;  1TKD B;  5E59 A;  3GIX A;  1SL1 B;  3ZVJ A;  5HFI A;  3DVW A;  5IO0 A;  3TRX A;  1A24 A;  2WS2 A;  4L5L A;  2VCW A;  4MCU A;  5JWQ B;  2OBK A;  22GS A;  1DE2 A;  2IFQ A;  3APS A;  4CHS A;  2I9H A;  4PQH A;  2LEG A;  2PPT A;  4MMM A;  4N30 A;  1PQN A;  4NHZ A;  5J3R A;  3FR9 A;  4EDY A;  3ERG A;  3GKN A;  3PPU A;  4E8H A;  4Z2T A;  2MBS A;  2YJH A;  1K0A A;  3LYP A;  3HYP A;  1ZOF A;  3D6I A;  4FYC A;  3TJJ A;  4J56 E;  1TXX A;  3F9U A;  4G10 A;  4KGI A;  4OFN A;  3SBC A;  2LQO A;  5J9B A;  3FYG A;  3F4T A;  1R7H A;  3H8Q A;  4IP1 A;  3LXZ A;  5D9V A;  1XWB A;  4KSO A;  4GSN A;  2PWJ A;  2MZC A;  4IP6 A;  3TOT A;  1MD3 A;  4JR4 A;  3UAP A;  3KP8 A;  5ECP B;  4HU9 A;  2YCD A;  2I1U A;  1XIY A;  1USB A;  1V58 A;  5DDL A;  2YWN A;  3I6A A;  1Q4J A;  1UA5 A;  2X8C A;  5DVB A;  2V6O A;  1UVZ A;  2GS3 A;  14GS A;  2GQK A;  1J0F A;  2OE3 A;  3Q18 A;  2M46 A;  4ICY A;  2O8V B;  4G0K A;  5IPG A;  2ZNM A;  1X0R A;  4HEA 2;  3E0U A;  1X9W B;  1OE7 A;  2CA8 A;  2OBI A;  2AAW A;  2E0Q A;  1GSD A;  1XVQ A;  3PH9 A;  4ZXG A;  3R3E A;  2UZ8 A;  2OAC A;  2CZ2 A;  2JSY A;  2RM6 A;  3IAM 2;  1SEN A;  4OFM A;  2PBJ A;  4ZB6 A;  2DJ2 A;  1GTB A;  5D8I A;  3RBT A;  1WE0 A;  1XW5 A;  3F8U A;  5ECS A;  2F51 A;  1G6W A;  1WPI A;  2CVB A;  2CVD A;  3Q19 A;  2AYT A;  1G6Y A;  3TKR A;  1EOH A;  1KEB A;  4YQU A;  4ZB8 A;  5ENU A;  3LQ7 A;  3ERW A;  1LJR A;  1GH2 A;  2H73 A;  3GTU A;  4CY6 A;  1QMV A;  3M9K A;  1ON4 A;  3CRU A;  2GZZ A;  2VUP A;  1WOU A;  4RI7 A;  2WGR A;  3A5I A;  4NMU A;  3KTL A;  1GTI A;  2GSR A;  4ZBD A;  5ECM B;  4YQM A;  1GSY A;  2ON5 A;  2VAF A;  4OD7 A;  2L57 A;  4ZIL A;  4XCS A;  1PRX A;  3CTG A;  5CAX A;  1S3A A;  2VO4 A;  3AY8 A;  5ECL B;  2HE3 A;  2QA1 A;  5C04 A;  2HFD A;  2R0C A;  1DUG A;  5E4W A;  4F0C A;  4PUR A;  3TKS A;  4BA7 A;  3APQ A;  1BAY A;  4MPG A;  5ECK B;  4QQ7 A;  3F6D A;  1I5G A;  2I4A A;  4KDU A;  1F3B A;  2DKH A;  3CSJ A;  3TRQ A;  4MJE A;  4Z7X A;  2XPD A;  1YDK A;  4ZBB A;  2CAQ A;  1AQV A;  4IBP A;  1SKS B;  3P7X A;  1JLV A;  4POB A;  3WD6 A;  1X5E A;  4FH8 A;  2X64 A;  5CRH A;  1Z7P A;  1XWC A;  1JLW A;  2WB9 A;  1XVW A;  1TRU A;  2QGV A;  5D9W A;  1SD9 A;  1XOA A;  2YWM A;  2PMT A;  3P8W A;  3ZTL A;  1M2B A;  4O5R A;  5IOX A;  1B4P A;  1QGV A;  3HY2 A;  6GST A;  1Y25 A;  2DBC A;  2IME A;  4AJ8 A;  2IMD A;  5GAN D;  4MJC A;  3UL3 A;  1EEM A;  1SYX A;  4XS4 B;  2FD3 A;  3DVX A;  4GF0 A;  3CSI A;  4MNN A;  2FUG 2;  2AV4 A;  4DSS B;  4I2U A;  5HR1 A;  1ERW A;  2HZF A;  3DWV A;  4I2T A;  1N2A A;  1VF2 A;  3VWV A;  4GCI A;  1B8X A;  5LD0 A;  2WDU A;  1YKC A;  2IPA A;  2B5Y A;  2EC4 A;  3F3R A;  2FWH A;  3BOA A;  5EY6 A;  4NWY A;  1K0D A;  1GRX A;  4DVC A;  2I3Y A;  2VL3 A;  1X5C A;  1O85 A;  4RQR A;  4HJM A;  1H75 A;  3LSZ A;  5D9T A;  4EDZ A;  4G0L A;  1GSQ A;  3EYT A;  2B6M A;  4JE1 A;  4BVX A;  5LNK e;  5J41 A;  4MF6 A;  2A2R A;  5DCG A;  1PSQ A;  3MNG A;  1Z6M A;  3IOS A;  3TKS C;  4ZL9 A;  1Z3E A;  1TU7 A;  4GQF A;  2G0F A;  1TOF A;  3SWL A;  3FY7 A;  4HJ2 A;  1PKW A;  3IE3 A;  3TKQ A;  2H1A A;  1F9M A;  1PKZ A;  3GNJ A;  1GL8 A;  2OAD A;  3C71 A;  3GUR A;  1UN2 A;  4KW6 A;  5D96 A;  1TK8 B;  1TP9 A;  3D5J A;  2KUC A;  4X1U A;  4USS A;  1GNW A;  1ERT A;  5HR3 A;  3IRA A;  1M2A A;  3F3Q A;  4V2N A;  4YKF A;  1NHO A;  4I6X A;  4JU5 A;  1O81 A;  4Q5F A;  1Z5Y E;  2VL2 A;  3A3T A;  5B8A A;  4JED A;  2ZCT A;  2RUF A;  3KJY A;  4HI7 A;  3IHQ A;  1EOG A;  4RQX A;  1G7O A;  2WJU A;  3EUR A;  2FY6 A;  4I97 A;  1A2L A;  2PUK C;  1H4O A;  2TRX A;  3RDW A;  2R4V A;  2XPE A;  4NV5 A;  5AIS A;  3EU3 A;  3TKS E;  3QAV A;  2IFQ B;  3MWH A;  3H93 A;  3DIE A;  3M1G A;  1W89 A;  1XW6 A;  3EPT A;  4QL9 A;  2YPM A;  2KP1 A;  2JU5 A;  1A23 A;  3TKP A;  3ZML A;  5GST A;  2OE1 A;  1RQM A;  4L0U A;  1O6J A;  3A5W A;  3UJ1 A;  3VI7 A;  1K3L A;  2CX3 A;  3VUR A;  4EO3 A;  2LV3 A;  5DJL A;  5DQS A;  1YJ6 A;  1A0F A;  2C80 A;  2H0G A;  1K3Y A;  2H75 A;  1OC3 A;  3TB2 A;  2HRF A;  1K3O A;  4N10 A;  1E2Y A;  2N5F A;  2D2Z A;  4F0B A;  7GSS A;  2JAD A;  2DJ3 A;  2FWG A;  1KNG A;  4LLR A;  4KX4 A;  1M9B A;  3C7M A;  3HVX A;  2E2M A;  5G5F A;  4NAX A;  3EU4 A;  3UOM A;  3GKX A;  1OC9 A;  16GS A;  2J9H A;  1HD2 A;  4MK3 A;  3EIN A;  3CXG A;  4X43 A;  2M80 A;  4IKH A;  2VCX A;  4GLT A;  4JZQ A;  2H6Y A;  4MZW A;  3NIV A;  1PA3 A;  2F9S A;  4O7H A;  3D21 A;  2FLS A;  4ECI A;  2MMN A;  1SJZ A;  2IL3 A;  3LOR A;  2H1B A;  1PX7 A;  3TJF A;  4OCE A;  3ZLP A;  2Z9S A;  2FA8 A;  3ME7 A;  3VWW A;  4BWQ A;  2YWI A;  2E7P A;  2VL2 C;  1B4Q A;  2YAN A;  1T3B A;  4NV2 A;  1GP1 A;  3H79 A;  3F63 A;  4WF5 A;  2ES7 A;  2LJA A;  2RLI A;  2YV7 A;  3KXO A;  1WP0 A;  2X8G A;  3FR3 A;  3F6F A;  2GLR A;  2B7J A;  1EGR A;  5JWR B;  1XOB A;  3I69 A;  1XW9 A;  1O7U A;  4TN8 A;  5D73 A;  2R0P A;  3L9V A;  2GZY A;  4I8B A;  3TJG A;  3L78 A;  5DAL B;  3A2X A;  2H71 A;  1NHY A;  5G31 A;  3GTU B;  2PU9 C;  4ACS A;  3LFL A;  4Z2R A;  1U3A A;  11GS A;  4HU7 A;  4WR4 A;  2R37 A;  5EPF A;  2WZ9 A;  4TR3 A;  2PVQ A;  1PL1 A;  4BL7 A;  3GRX A;  3TOU A;  2CV4 A;  4MP4 A;  1QFN A;  2O7K A;  2C3T A;  3RPP A;  5CRE A;  2B5E A;  4TVE A;  1XWG A;  1GLQ A;  3O3T A;  5JCU A;  2HSM A;  4TXO A;  1VGL A;  1GSF A;  4LMW A;  1Q98 A;  2KOK A;  3L0H A;  3UMA A;  1V98 A;  3VLN A;  3VI5 A;  4Q5N A;  3M9J A;  4KAE A;  5HR2 A;  2F8F A;  1S3D A;  2BMX A;  3DRN A;  2LNT A;  5F8B A;  4ILF A;  3HZ4 A;  4OFT A;  3IHG A;  1FHE A;  1U3I A;  2M72 A;  3VFI A;  3GKK A;  1GUM A;  1LBK A;  2CZ3 A;  4K0N A;  1GTA A;  3C73 A;  1W4V A;  5IPH A;  3NZN A;  1EP8 A;  1V2A A;  3QFA C;  3Q74 A;  4N0V A;  2K9F A;  2LTK A;  4F9Z A;  2QKE A;  1WMJ A;  1QXH A;  3IXR A;  2VCT A;  3S9F A;  1ACV A;  4WBJ A;  3BCK A;  5A4V A;  1THX A;  5B6N A;  1QUW A;  2YOI A;  1YQ1 A;  3IK9 A;  1B9X C;  1ERU A;  3P90 A;  2G2Q A;  2IMF A;  3RPN A;  3HHV A;  5ECH B;  2R0G A;  3I9V 2;  1Z6N A;  12GS A;  3EC3 A;  1T7P B;  3ZZX A;  5J9C A;  1ZYN A;  2VM2 A;  3GL5 A;  5IMF A;  3G9B A;  4GQC A;  4XHM A;  2YV9 A;  4TRX A;  1NSW A;  2GQM A;  5DAL A;  2R6K A;  3TJK A;  4K7O A;  20GS A;  4EE0 A;  2O85 A;  2RM5 A;  1PD2 1;  1VF1 A;  4Q5R A;  2IWT A;  1CQG A;  2H6X A;  1THO A;  2NVL A;  4GWR A;  1PMT A;  3FKF A;  3QAW A;  2P31 A;  1E6B A;  5CYY A;  1M9A A;  1T4Z A;  2VCV A;  3GKM A;  2FWE A;  3U5R E;  1TJD A;  4LL4 B;  2RUE A;  5G5E A;  3U6V A;  2PVO C;  5G2Z A;  2LKU A;  3HA9 A;  2ZUP A;  4AJ6 A;  2GTU A;  2HRN A;  4TKY A;  2A2P A;  1AQX A;  2AB6 A;  2WUL A;  5CP1 A;  1T8E B;  3TJB A;  5F07 A;  4BVX B;  3QAG A;  3IAS 2;  1XCC A;  4ZBA A;  4MZB A;  4RI6 A;  4V2L A;  4K7N A;  1ZMA A;  2H30 A;  4V1A p;  2V1M A;  3CYN A;  3L4N A;  4O32 A;  4CY8 A;  1TK0 B;  4IW9 A;  1EP7 A;  4Q5Q A;  19GS A;  4ZB9 A;  2CAI A;  2LJR A;  1OE8 A;  1O8X A;  2F8A A;  4BWS A;  1J9B A;  3ERF A;  2X99 A;  2L4Q A;  1GTU A;  4O5U A;  4MH2 A;  1R5P A;  3GX0 A;  3DD3 A;  1CQH A;  2FNO A;  3O76 A;  4ID0 A;  3IK7 A;  2DIY A;  1BG5 A;  4TR4 A;  1XBS A;  4X0X A;  3VWU A;  4AGS A;  3DKS A;  2VLU A;  2H1D A;  1RK4 A;  2EIR A;  4NXI A;  4K5S A;  1SJ6 A;  4ECB A;  1OKT A;  4CW9 A;  3QMX A;  2F3M A;  4ZIJ A;  3E9J B;  5C00 A;  3D4M A;  4EF0 A;  1SU9 A;  1AAZ A;  4O5Q A;  1ILO A;  2H6Z A;  2E2G A;  3FEU A;  4WET A;  4HQS A;  1HNA A;  3FK8 A;  5A5K A;  2K6V A;  5DCH A;  2GQL A;  5ECQ B;  2NBS A;  1SK1 A;  2FCH A;  2LST A;  1SJI A;  4TR1 A;  2WFC A;  2WCI A;  1S3C A;  5AGY A;  1ERV A;  4TOP A;  2IMK A;  4P3Y B;  5L71 A;  1ZGN A;  2AHE A;  1GWC A;  4ML1 A;  2MMZ A;  3G7Y A;  4G0I A;  2QSI A;  2AJQ B;  4RUV A;  4DSR A;  2MMA A;  1FVJ A;  4FYB A;  1GSS A;  2HZE B;  2V41 A;  2N5A A;  3PR8 A;  1PN0 A;  4XIH A;  3CTF A;  2DJ0 A;  1V40 A;  5G1L A;  3F4R A;  1R5A A;  1XPV A;  3L9S A;  1TRW A;  2V32 A;  5F05 A;  3M3M A;  2C3N A;  1PX6 A;  1TU8 A;  1JZD A;  5JWO B;  1K0N A;  3ZL5 A;  3Q6O A;  2HRA A;  3ME8 A;  5F0G A;  1LU4 A;  1TRV A;  4IGJ A;  3ED3 A;  1OC9 B;  2LRC A;  3CMI A;  4GTU A;  1ZCP A;  4PNG A;  3VPQ A;  1R26 A;  1MD4 A;  4GST A;  1K0O A;  4KCA A;  2JL4 A;  4OO4 A;  2C0G A;  4KSM A;  3UVH A;  1R4W A;  4FO5 A;  3J7Y k;  1GUK A;  1EWX A;  4L8E A;  4EL1 A;  3LYK A;  2YN1 A;  3GSS A;  4F2I A;  4GRF A;  3QDN A;  4WBR D;  2L59 A;  4WR5 A;  4POM A;  4MLY A;  4ISD A;  1VF3 A;  5BRT A;  2GGT A;  2VD0 A;  1SK2 A;  4OWY A;  1YKA A;  1FO5 A;  3IBH A;  1SKW B;  5EVO A;  2L6D A;  3GN3 A;  5IIZ A;  3C1S A;  3W8J A;  4MJB A;  3KIJ A;  1K0B A;  3DML A;  5CRG A;  1U88 A;  3FR6 A;  1MDI A;  4EVM A;  3GST A;  2I81 A;  5G30 A;  1MTC A;  2A4V A;  4IHU A;  1FAA A;  1F2E A;  2FWF A;  1Z9H A;  5KN3 A;  2X4A A;  6GSY A;  4YKG A;  5HFG A;  2XBI A;  3FMW A;  6GSX A;  3MYD A;  4YH2 A;  4EIP A;  5IQY A;  2PN8 A;  8GSS A;  5INY A;  1AUC A;  1SD8 A;  4E8E A;  1A0R P;  3ISO A;  4TXV A;  4IJI A;  1T1V A;  4MA9 A;  3PGT A;  5ID2 A;  2HZE A;  3ZIT A;  2HI7 A;  4KCE A;  1A2J A;  4AJ7 A;  3ZRD A;  3ZMK A;  1UC7 A;  4BL7 B;  3GFK A;  2K8S A;  2C0D A;  2KLX A;  3DGQ A;  1EV4 A;  1NM3 A;  2HYX A;  3KGK A;  3UVT A;  3ZFL A;  5D9X A;  2RII A;  4KB3 A;  4EC0 A;  1EZK A;  1HNB A;  3F0I A;  2HSH A;  5IO2 A;  4JR6 A;  4TXO B;  1EGO A;  2EIO A;  2H74 A;  5LCZ A;  4ECC A;  3US3 A;  2P5Q A;  2FHE A;  3FRC A;  6GSS A;  1T4Y A;  5KN1 A;  4YAV A;  5CNW A;  3CBU A;  3WYW A;  1OVN A;  3FW2 A;  2YZH A;  3KH7 A;  4HZ4 A;  2B1K A;  9GSS A;  5ELA A;  2VOC A;  4G2E A;  3O6T A;  3HJM A;  4HS1 A;  3GH9 A;  2O89 A;  3RHB A;  2IIY A;  4NHW A;  3UIW A;  10GS A;  3GUS A;  2LJK A;  4MDC A;  2IJY A;  1Y6E A;  1YY7 A;  5IMD A;  2JSZ A;  4PUA A;  1K0M A;  4XRA A;  1RW1 A;  4PQI A;  2VIM A;  3IC8 A;  3GV1 A;  2LRN A;  3W8S A;  4MAB A;  3HCZ A;  1WJK A;  3H1N A;  1ZZY A;  3P2A A;  5B8B A;  2DSA A;  3KEB A;  2FA4 A;  1KTE A;  3LXT A;  3RHC A;  4WKW A;  4KDY A;  3J7Y b;  3MDK A;  3DEX A;  3N5O A;  3UBK A;  1SYR A;  5ELG A;  2LQQ A;  1JZR A;  4MF5 A;  3WT2 A;  1AQW A;  4IQA A;  2KP2 A;  3E3E A;  2AUV A;  1NW2 A;  4K1F A;  3KMN A;  4EKZ A;  4FYU A;  4V1A g;  3ZIV A;  2K18 A;  3I43 A;  3ZFB A;  4K0G A;  3KTB A;  4MJA A;  1DBY A;  2TIR A;  3GA4 A;  3HKR A;  2LRT A;  1ZYQ B;  3VPT A;  5KEJ A;  4ULX A;  1X9M B;  1WIK A;  2QA2 A;  3IC4 A;  2GSS A;  2VCQ A;  4KND A;  2C8U A;  3GH6 A;  3KMO A;  2EIQ A;  4G9H A;  3UEM A;  1J08 A;  2CQ9 A;  4JRR A;  1FOH A;  4K9Z A;  3QD9 A;  2JZS A;  4IN0 A;  4PNF A;  5IMZ A;  2REM A;  1DSB A;  4TW5 A;  1IYH A;  1JZO A;  2DJ1 A;  3D4T A;  3FZ4 A;  3LG6 A;  1B48 A;  3BBY A;  5H5S A;  5H5Q A;  4GXZ A;  5DAK B;  1SK0 A;  4CDO A;  1M2D A;  2C1Y A;  4H86 A;  5COH A;  3ZYW A;  4K2X A;  3VWX A;  2ON7 A;  2XHF A;  1FB0 A;  1KBN A;  3H4K A;  3KZQ A;  3ZIJ A;  4IVF A;  1YEX A;  4BVY A;  1PGT A;  1C72 A;  4D73 A;  2P5R A;  2KHP A;  2GSQ A;  3MSZ A;  5AIX A;  2H8L A;  3QR6 A;  3A2W A;  5GZZ B;  1B9Y C;  1EEJ A;  2OKA A;  4X4J A;  4YQV A;  1WWJ A;  1AXD A;  1AW9 A;  2WRT A;  2HXK A;  3PIN A;  17GS A;  4EUY A;  4KE3 A;  3WT1 A;  3FZ9 A;  2JZR A;  3TRP A;  3QPM A;  4N11 A;  5IMC A;  3LWA A;  2LUS A;  4JBB A;  2MMO A;  4ZL8 A;  1OKD A;  1WRY A;  5G1K A;  2DML A;  2V2G A;  4OMV A;  3D0Z A;  3IDV A;  4TR1 B;  2DC5 A;  2R3X A;  5FHI A;  2R2J A;  4K7I A;  3ZRE A;  1MEK A;  2DIZ A;  1GSE A;  1OAZ A;  3LEF A;  3G7J A;  3TDG A;  4HQZ A;  3QFB C;  3OR5 A;  4PUF C;  1TI1 A;  3UAR A;  2B3S A;  3BD2 A;  3NOF A;  1FOV A;  4A5P A;  1BJX A;  2C3Q A;  1F37 A;  3EMX A;  3BCI A;  4IS0 A;  1PN9 A;  1V9W A;  2HNL A;  4LMV A;  1BYE A;  3LJR A;  3HD5 A;  5J4U A;  4IJ3 A;  4XTS A;  3HVS A;  1YEP A;  2OJL A;  2C0F A;  3HZ8 A;  2IN3 A;  2HSY A;  3IA1 A;  4J2F A;  2K8V A;  5JCW A;  3FHK A;  1N8J A;  2DMM A;  5BMU A;  5F06 A;  1OC8 A;  3TCO A;  3M0F A;  2P0G A;  4MH3 A;  3C8E A;  2X49 A;  2PGT A;  1X9S B;  5DAK A;  4HDE A;  2NTO A;  3IV4 A;  4MZC A;  4IEL A;  1URM A;  3R2Q A;  3TGZ A;  4GSS A;  1TRS A;  3W6G A;  2LNS A;  2NPB A;  4HUA A;  2CT6 A;  1F6M C;  1VF4 A;  5IM9 A;  1EV9 A;  4K6X A;  4I5Q A;  2MBT A;  3G7I A;  4PQ1 A;  3L9U A;  1GUL A;  5HR0 A;  5ECO B;  1TI3 A;  4N0Z A;  5IMV A;  1PL2 A;  2JZT A;  1XXU A;  2VLT A;  3V1W A;  4WF4 A;  2BJX A;  2LS5 A;  3MAK A;  5DJM A;  3UBL A;  4KA0 A;  2YJ7 A;  2HRK A;  3C1R A;  2O87 A;  2YP6 A;  3HXS A;  1A2M A;  1U87 A;  1M0U A;  1OYJ A;  1TDI A;  4PGT A;  1ZYP A;  2YNX A;  1Z7R A;  5IOW A;  5CRD A;  5H5R A;  2VCZ A;  2B1L A;  1SKR B;  3KD0 A;  2IMI A;  3GX8 A;  2A4H A;  3WGX A;  3BJ5 A;  1AIU A;  1JFU A;  1SL2 B;  1HNC A;  1YF0 A;  5B7C A;  1ZL9 A;  5ID2 B;  3CRT A;  5B6M A;  1O73 A;  1GNE A;  5AIV A;  2ALB A;  2YZU A;  2GDR A;  3DYR A;  3WGE A;  2BTO T;  1ZYE A;  4K2D A;  2H70 A;  2HLS A;  2OE0 A;  3LGC A;  4L5O A;  1YF1 A;  3QCP A;  2VD1 A;  1G0T A;  1XWA A;  3ZVJ D;  4OCF A;  4BPY A;  3GHA A;  1HYU A;  3KM6 A;  3HDC A;  4OO5 A;  3WGD A;  3IPZ A;  1FW1 A;  2DJK A;  4KH7 A;  3GMF A;  4DEJ A;  2HT9 A;  2XC2 A;  4PTS A;  3HJO A;  1MDK A;  5KOX A;  5DBQ A;  2NDO A;  1FVK A;  1QK8 A;  2QC7 A;  4J57 E;  2OA7 A;  1JZW A;  2H66 A;  1MDJ A;  1GLP A;  4LL1 B;  1T00 A;  2H72 A;  5ECR B;  2MYG A;  2B5X A;  1M7T A;  1G7E A;  3EVI A;  5ECI B;  2PER A;  2TRC P;  5JCG A;  4MPF A;  2DJJ A;  1V57 A;  2VM1 A;  1ST9 A;  5AN1 A;  4ZL7 A;  2GVP A;  2H76 A;  3EE2 A;  1BX9 A;  2DLX A;  3M8N A;  5ECN B;  1A8Y A;  1XWK A;  5DQY A;  3GL3 A;  5GSS A;  4V2M A;  2H0H A;  1K0C A;  5FWG A;  2L6C A;  4G19 A;  1JHB A;  4WXT A;  6GSV A;  4HZ2 A;  3KCM A;  2H1G A;  2CX4 A;  2VL9 A;  3HVV A;  1AC1 A;  1BED A;  4IQ1 A;  13GS A;  2L5O A;  4NPB A;  5A4U A;  1ABA A;  4PXO A;  1HQO A;  3KH9 A;  1GSU A;  2GT5 A;  2R5G A;  4EIQ A;  4HOJ A;  4XS4 A;  5IMA A;  2N5B A;  2V6K A;  1BQ7 A;  1X5D A;  4K8M A;  4DSS A;  2H19 A;  1DE1 A;  1IYI A;  2C0E A;  5ABR A;  1YZX A;  3QOU A;  2GZP A;  3FZ5 A;  3HJP A;  4K5R A;  4LA1 A;  5KOW A;  3LW9 A;  2J23 A;  2A2S A;  3FZA A;  5J5N A;  2JAC A;  2H01 A;  1GUH A;  1FG4 A;  4O92 A;  5FT3 A;  4YAP A;  3K8N A;  3CSH A;  1VRS D;  2YWO A;  2FGX A;  4KDX A;  4ML6 A;  5CRW A;  4KUN A;  2H0I A;  5HQP A;  1TK5 B;  1XFL A;  1SL0 B;  6GSW A;  4DSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...