4GWRA

Crystal structure of the second catalytic domain of protein disulfide isomerase p5
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
112
structure length
112
Chain Sequence
DVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein disulfide-isomerase A6
publication title To be published
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 37
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4gwrA00
1GTAA 6GSWA 4RI6A 1VF3A 4CHSA 2IFQB 3VI7A 5FHIA 4OWYA 1A24A 3GH9A 5HR1A 4K6XA 2K9FA 2BJXA 4J57E 2JADA 3MWHA 3GIXA 1MD3A 1YY7A 4K0NA 2VLVA 3M1GA 1JZWA 3L78A 3GTUB 4I97A 1TK0B 2V32A 2HI7A 1JHBA 4BL7A 4PGTA 3GSSA 2IL3A 1TTZA 4ZXGA 2LUSA 1W89A 22GSA 2OE3A 5ECIB 1TOFA 2H8LA 2JSZA 1FG4A 1YDKA 3KM6A 3UARA 2H19A 4MCUA 1O73A 2ZCTA 1X9SB 4K2DA 5DALA 5F8BA 3TRXA 2L5LA 1JFUA 3A3TA 3CTFA 1UA5A 2TRCP 5F0GA 3HKRA 3SWLA 2DMLA 2H1AA 5J9CA 2ON5A 4DVCA 1YKAA 3IE3A 2F3MA 4ZILA 1GP1A 1TI1A 3ZIVA 3EYTA 1GSQA 2DIYA 3F6FA 1A8YA 5DALB 1O81A 1EEMA 4POKA 1F6MC 3WGXA 4ECJA 4KGIA 2I3YA 2OBKA 3HD5A 3CRUA 4TOPA 1XW9A 2HRNA 3TKQA 4TXVA 4KB3A 2FNOA 3D21A 4KX4A 2JSYA 2YV7A 3M0FA 4G19A 4IBPA 4JR4A 3IRAA 5HR0A 5ECLB 2JACA 5AIVA 4OCEA 3EC3A 5DCHA 2AHEA 3QR6A 3M9KA 3DWVA 2GQLA 4WF5A 1TXXA 4AJ8A 2VCVA 4ZBDA 4V2MA 2C1YA 4CW9A 4JR6A 2CVKA 3ZFBA 1ZYQB 4ZB9A 1ML6A 3Q18A 3LYKA 3MNGA 3P2AA 3QOUA 3FZAA 4DSQA 2C80A 2WRTA 3ERWA 2GZPA 2H01A 3EWLA 4XRDA 4ECIA 3H4KA 1KEBA 4HU7A 3TKSE 3Q6OA 5CRDA 1WIKA 2FA8A 2QSIA 1S3CA 1Z7PA 5JCGA 1HQOA 4MP4A 4QQ7A 4KAEA 3R2QA 3F4SA 3W6GA 4MMMA 3IBHA 1MEKA 4X1UA 5GSSA 4K7IA 4LL4B 2H72A 2F8FA 4L5LA 5EL8A 2K8VA 2P0GA 16GSA 2FY6A 1H4OA 4F9ZA 3EINA 1TW9A 2JL4A 5DVBA 3F3RA 4O92A 3KTLA 5DJMA 2H6XA 5IMAA 3J7Yk 1KTEA 4POMA 1O85A 2RUFA 3C8EA 1XFLA 3TJGA 2K8SA 3GX8A 1M9AA 2VL2C 3GRXA 2FUG2 2YOIA 1ERVA 4XTSA 1LBKA 2EC4A 3FZ5A 2M72A 2I9HA 4NXIA 2GSTA 2JZSA 1YF1A 9GSSA 5G5EA 2ZNMA 2ZUPA 2VM1A 2PWJA 2L57A 1DE2A 2K18A 1N8JA 5D93A 3ZTLA 4IW9A 2FLSA 1C72A 1ABAA 3J7Yb 3UMAA 5KN3A 4MH2A 5ENUA 1SK1A 4ULXA 1VF1A 4AJ6A 1XVQA 5JWRB 3DMLA 2IIYA 2CVDA 1TRUA 3LORA 5KEJA 5EPFA 1SJIA 2HSYA 5ECMB 2PVQA 1SYRA 2B6MA 2LJKA 2H1GA 1T4ZA 5KN0A 2NDOA 3EVIA 3VK9A 3H8QA 1UVZA 2C3QA 3NZNA 4ID0A 2M80A 2JU5A 3WYWA 1X5DA 1BEDA 2KHPA 2E2MA 1G6YA 2GQMA 2CAQA 4IGJA 1GUMA 2DJJA 1B9YC 1SKSB 1EOHA 3L4NA 3UL3A 3TKSC 1M9BA 3G7JA 1I9DA 2VCTA 5E4WA 3D4TA 2FWGA 1F9MA 1SU9A 2FCHA 3GX0A 1YJ6A 1A2LA 4IP6A 2H74A 3DVWA 3I9V2 3VPQA 1J9BA 1U3IA 1V58A 3TJBA 1ZZYA 2PBJA 1PN9A 4BVYA 2A4VA 3LXZA 2YWOA 1O6JA 2H6ZA 5DAKA 4Q5QA 1TRVA 3KMNA 1QFNA 4K1FA 5D9VA 6GSSA 2AUVA 4K7OA 4GRFA 4WR4A 1VF4A 3AY8A 2IPAA 4HJMA 3HXSA 5EY6A 3N9JA 2DJKA 2OJLA 5GAND 2L6CA 1TRWA 3TB2A 4OO4A 3DEXA 3HCZA 1AQWA 4I5QA 1FO5A 2G2QA 4MJEA 3CSIA 3ZL5A 4JZQA 1THOA 5EVOA 1EP8A 3F8UA 2CVBA 1GUKA 4L5OA 3EE2A 4O7HA 3CSJA 1HNCA 1T1VA 2P5RA 3EU3A 1XIYA 4ZBAA 2REMA 3ZREA 1HNAA 5AIXA 2H6YA 1T7PB 1A2JA 1XWCA 2I1UA 6GSTA 2AAWA 5B6NA 4X43A 4RQRA 5D96A 1ZOFA 3Q19A 1A23A 1SKWB 3FZ9A 3G7IA 4NV2A 4K8MA 2RM6A 3KCMA 5ECPB 3UEMA 1FOVA 2H0HA 2R37A 4HQSA 4PNGA 3UBLA 2X8HA 1WMJA 1YF0A 3PH9A 4MPGA 1X9WB 2QKEA 2PGTA 2V1MA 3LFLA 2OA7A 4IS0A 4IQAA 4FYUA 3VFIA 4WR5A 3EMPA 1M2DA 3ME7A 4PX1A 3O6TA 4N0ZA 2H75A 3LYPA 1WJKA 2LS5A 1TU8A 1ZMAA 3DKSA 2EIRA 1LU4A 2KLXA 3ZVJD 2IWTA 1M7TA 4PNFA 1U6TA 4V1Ag 3QFBC 5A4WA 3EMXA 4LMWA 3S9FA 2DMMA 1T4YA 4EO3A 2F9SA 5J4UA 3A2VA 3GKXA 1CQHA 4N11A 5GAPD 4MA9A 2NBSA 2GSQA 2C3TA 3RHCA 4K0GA 4TKYA 3GTUA 3FK8A 1YEXA 4IP1A 1NSWA 4GTUA 4AGSA 3L9SA 1K0CA 3FY7A 3JCML 3LWAA 2B5XA 2WFCA 3ZRDA 1EWXA 4G10A 2VL2A 2L59A 1YZXA 4XS4A 2LNTA 3KP9A 1EV9A 2DSAA 1ERUA 3DD3A 4KW6A 4AF2A 3H79A 2H70A 3UIWA 4FYBA 2QC7A 3W8JA 4GCIA 4OO5A 4GQFA 3FZ4A 1OKDA 5HR2A 2IJYA 1URMA 1GSSA 5JCWA 3CSHA 2E7PA 4XS4B 1BG5A 5DQYA 4MJBA 1XOAA 3KJYA 4HUAA 1SL2B 4IELA 4MDCA 2H30A 2YZUA 5J9BA 3C1RA 3UBKA 5DJLA 1TDIA 2GS3A 1XZOA 2VCWA 2X8GA 4EDYA 2C0DA 1GRXA 2J23A 3QD9A 2LEGA 4TR3A 5JWOB 3HJPA 3H1NA 2PN8A 1J0FA 1JZOA 2CV4A 3F4RA 5F05A 4GSTA 4ECCA 3I6AA 2O8VB 2H1BA 1YKCA 2DJ0A 4BWQA 3TCOA 4ZL8A 3ZMLA 2R2JA 2B5YA 4POLA 2AB6A 1ERWA 4L8EA 5H5SA 3IAM2 19GSA 1XW6A 1AUCA 1XXUA 4GSSA 11GSA 1KBNA 5IQYA 2GSRA 1A0RP 3RBTA 3TRPA 2YWNA 4EUYA 1SYXA 2P31A 2XBQA 1SD9A 3ZLPA 5IPHA 3HDCA 3DGQA 1TJDA 2HZFA 3BD2A 4XRAA 5CRWA 2CZ3A 1OE7A 1ZL9A 4KNDA 3PINA 1GLQA 1WPIA 3D22A 5HFGA 4EDZA 4Q5FA 2V6OA 3FR3A 1S3DA 2MMAA 1OVNA 1PRXA 4LLRA 2WULA 2VCZA 1M2AA 4DEJA 2LQOA 2P5QA 2VD0A 1AC1A 3P7XA 4HZ2A 2IMKA 3A5WA 1ZCPA 5D9WA 5IPGA 3HVVA 3CYNA 1MDJA 2LRNA 4BWSA 2ON7A 3RPNA 5IO2A 2YCDA 1QGVA 5CAXA 2ES7A 3FYGA 4IKHA 3ISOA 2LTKA 1B4QA 1SK0A 1DE1A 3DRNA 3O76A 5CREA 4EE0A 3QPMA 3GKMA 2PMTA 2LJAA 1NHOA 1K3LA 2GVPA 5D9TA 2C8UA 3CMIA 4GXZA 4D73B 3KP8A 1HD2A 3ZZXA 1V98A 2A2RA 1GH2A 1IYHA 2HLSA 2C0GA 4KSOA 3GSTA 1TU7A 2CZ2A 4ML1A 2N5AA 3QAGA 1Y25A 4F0CA 1V57A 1LJRA 2YZHA 1GTBA 2HNLA 3GUSA 3I43A 4ECBA 4HS1A 5HQPA 1HNBA 1WE0A 4IHUA 1RW1A 8GSSA 2N5FA 1EEJA 4MF5A 5B8BA 3GNJA 1EOGA 2M46A 2C0EA 4OCFA 4ZB6A 4RI7A 1TKDB 1RK4A 1K3YA 1Z6NA 4JRRA 3L9VA 3GKNA 1PSQA 2H73A 3DVXA 3F4TA 4NMUA 1JZDA 4WF4A 4KUNA 4XIHA 1FB0A 4TVEA 2VD1A 3RAZA 5FT3A 5CP1A 3P8WA 1M2BA 2LRCA 3V1WA 1OAZA 2MZCA 2B7KA 1G6WA 3HYPA 4IJ3A 5DBQA 4ISDA 1SJZA 2RM5A 4K7NA 2YN1A 1BX9A 3ZIJA 3VLNA 4TR1A 2VIMA 4KDYA 3NIVA 3HVXA 4WXTA 3E3EA 2IN3A 2DJ1A 4AJ7A 4GLTA 5CO3A 5L71A 3BCIA 2GLRA 3TJJA 1GSDA 4FYCA 1X9MB 1KNGA 12GSA 2C3NA 4JEDA 1R26A 2B3SA 4TR1B 5CRHA 5F07A 2LV3A 3F9UA 4NWYA 1E6BA 5DCGA 1K0BA 3D6IA 5LD0A 1AQXA 2CA8A 5IO0A 2VL9A 3HY2A 3HJOA 4BVXA 4HDEA 3ZVJA 4N0VA 2OADA 3DXBA 1G7EA 1QQ2A 1ILOA 5F06A 2VLTA 2VL3A 3ME8A 3GL5A 4X0XA 1IYIA 3HVSA 2WS2A 2DLXA 4TRXA 1R4WA 1K0MA 1GSYA 2GSSA 2WDUA 1F3AA 2L5OA 3E9JB 1SJ6A 4ZIJA 2X99A 5IMFA 4HQZA 3GYKA 4L0WA 4NAXA 5DDLA 2GDRA 1AAZA 1WP0A 1ST9A 5IMZA 3IC4A 1T8EB 2FWHA 2XBIA 1U88A 4ML6A 1TP9A 5KN1A 4GQCA 1GNEA 3GA4A 3IA1A 3HJMA 2N5BA 5IOXA 2OKAA 1JLVA 5ECOB 1ZYEA 2G0FA 1OC9A 4YQMA 2VAFA 3RPPA 1WWJA 3VWVA 4OFMA 1PKWA 2R6KA 3IPZA 2ALBA 5LCZA 2IMIA 4WBJA 1O7UA 4OMVA 4Q5RA 4EKZA 4MJCA 3VWXA 3A2WA 3MDKA 5AISA 3W8SA 3GMFA 1UN2A 1NHYA 4V2NA 4MZBA 1TI3A 1O8WA 1OC9B 1U3AA 1EGOA 2V41A 2FA4A 1B48A 5J41A 5G1KA 3L0HA 5KN2A 1A0FA 3GKKA 4CDOA 3WGEA 4KSMA 3BCKA 1SD8A 3EURA 3G9BA 3WT1A 4ZL7A 4H86A 1GULA 2HT9A 1V2AA 2GZYA 1R7HA 3UOMA 1ZGNA 3KEBA 3TKPA 2O87A 3CBUA 1UC7A 2YWIA 4XHMA 4J2FA 2I4AA 1FVKA 2CX3A 2O7KA 2YPMA 2VUPA 1Z6MA 4E8EA 1WOUA 1GUHA 3IK7A 3M3MA 4HZ4A 1XW5A 1E2YA 2OE0A 4WKWA 1EGRA 3SBCA 4G2EA 3PR8A 2V6KA 4HJ2A 1PD21 2DBCA 3C7MA 3LG6A 1TK8B 3KZQA 2LKUA 4P3YB 4I6XA 2VCQA 2AYTA 4PURA 2B5EA 4O5RA 2PU9C 2KP2A 3CTGA 5IMVA 5B8AA 1NW2A 3K8NA 4G9HA 2E0QA 3QCPA 2TIRA 4N30A 2JZTA 2VLUA 4OFTA 4ZBBA 3I69A 3IXRA 3O3TA 5CRGA 4N10A 1SL1B 3WGDA 2RUEA 4FIWA 5HFKA 3QDNA 4MPFA 1W4VA 5IMCA 1TK5B 4QL9A 2B1KA 4YQVA 4TR4A 4HI7A 4OD7A 3HZ8A 1FW1A 3GHAA 2R5GA 3LQ7A 4I2UA 1XBSA 3QAWA 4MZWA 2TRXA 5D8IA 2J9HA 3BBYA 3DYRA 13GSA 3F6DA 3F63A 3D0ZA 1V40A 1G0TA 1XWGA 14GSA 4IN0A 2GT6A 1Y6EA 1B4PA 5ELGA 6GSYA 3VPTA 2WCIA 5ECQB 2RLIA 4EC0A 1THXA 3APSA 1GSUA 3L9UA 2MMOA 1B9XC 5B6MA 4PXOA 1FB6A 1ACVA 4IJIA 2VOCA 4PQ1A 2PUKC 4MLYA 2WJUA 4MH3A 3LXTA 1OC8A 4PQHA 4O32A 4Q5NA 1A8LA 5JCUA 2R3XA 1T3BA 4YAPA 5IIZA 3HA9A 1H75A 3G7YA 2DJ3A 1OYJA 4HEA2 4POBA 3CXGA 2GTUA 1NM3A 2MBTA 3H93A 3TKSA 3IV4A 1FVJA 18GSA 1XWAA 3TJFA 4JE1A 6GSUA 3ZFLA 1Z9HA 2PVOC 1AIUA 3HHVA 3NOFA 1GSEA 2CAIA 2YJ7A 4E8HA 3LEFA 1VRSD 4TW5A 1MDKA 2NTOA 1BQ7A 2MMZA 3TUEA 5HFIA 3UJ1A 3U6VA 2E2GA 2FWEA 5ELAA 2WB9A 1F3BA 1SKRB 2CX4A 2YJHA 1EZKA 2MMNA 3GN3A 1PA3A 5H5RA 2H0GA 2YV9A 3KMOA 3FR9A 4WEYA 2PPTA 2HYXA 4JBBA 4F82A 3IOSA 4XS6A 3QFAC 5IM9A 1PQNA 1A2MA 5ECHB 1XOBA 4ILFA 2FWFA 2LQQA 1GLPA 3LJRA 4KH7A 1PGTA 3N5OA 5G31A 4D73A 1VF2A 2F51A 3VWUA 3APQA 3TJKA 1AQVA 2LNSA 3PGTA 1Z7RA 4IQ1A 1XVWA 1GL8A 5A5KA 3KTBA 4MABA 5E59A 2DIZA 3ERFA 1XWBA 2XPEA 4NV5A 3ZITA 4TN8A 3KIJA 2X64A 1OKTA 1QMVA 3IDVA 3KH9A 3C73A 2YANA 3WD6A 2GT5A 4PUFC 2KP1A 5GZZB 2H1DA 5C04A 1K3OA 3TRQA 2MYGA 4J56E 3GL3A 3MSZA 5AN1A 1BJXA 2HFDA 4I2TA 5COHA 1GTIA 1CQGA 1JZRA 5ECSA 3WT2A 2L4QA 4HU9A 1K0DA 5J3RA 3GURA 3FR6A 1X0RA 5GSTA 1GTUA 4PUAA 1N2AA 3IK9A 2H76A 1YEPA 2XC2A 5G5FA 2RIIA 2B7JA 5H5QA 2GGTA 2L6DA 2R4VA 3FKFA 3IHQA 2FD3A 4KCEA 2F8AA 5G30A 4YAVA 3D5JA 3M8NA 1YQ1A 3FRCA 2GQKA 4OFNA 3ZMKA 4RQXA 2KOKA 3CRTA 4KE3A 1PL1A 4LA1A 4NHWA 1U87A 1JLWA 1Q98A 2HRFA 4MF7A 3U5RE 3MAKA 4EVMA 4MZCA 1QUWA 4GWRA 2HZEA 1B8XA 3ZYWA 2YNXA 4PQIA 2NVLA 3IR4A 3VURA 2JZRA 1MDIA 4FH8A 2NPBA 2H71A 5ECKB 4EXJA 5ABRA 2AJQB 1BYEA 1Z3EA 4LMVA 2D2ZA 1FAAA 1Z5YE 4MF6A 1F2EA 3IAS2 4I8BA 1XPVA 2PERA 4XS1A 2HZEB 5INYA 2X8CA 4JU5A 5G1LA 1O8XA 2B1LA 1K0OA 2CT6A 3LGCA 1T00A 3ED3A 4TXOA 4TR0A 4F2IA 4RUVA 1DUGA 2LSTA 4KA0A 2C0FA 2HXKA 1R5AA 3D4MA 1SENA 2YP6A 5ID2A 4K9ZA 2FHEA 3TDGA 1M99A 3TOUA 4QL7A 4GF0A 2VM2A 4TXOB 1SL0B 3US3A 4NHZA 5B7CA 2EIQA 3TGZA 1WRYA 1QXHA 2H66A 1M0UA 3F0IA 2AV4A 4GSNA 3GH6A 1XWKA 5ID2B 4LL1B 3BOAA 3P90A 3APOA 5A4VA 2Z9SA 1J08A 20GSA 1PL2A 1S3AA 4XCSA 2YWMA 1PKZA 2GZZA 4DSSA 3C1SA 5CYYA 3TKRA 3KXOA 1DBYA 2IMEA 4FO5A 3EU4A 4EL1A 1RQMA 1BAYA 3C71A 1DSBA 2BTOT 1G7OA 4MJAA 4Z7XA 5DAKB 3A2XA 1X5CA 4V1Ap 4YH2A 2DC5A 4ZB8A 3OR5A 5D73A 3E0UA 3KGKA 1OE8A 4DSSB 1AW9A 5LNKe 3VI5A 5C00A 3UVHA 1PMTA 5J5NA 4IVFA 4EF0A 2C4JA 1PX7A 4F03A 5HR3A 1K0NA 1R5PA 5AGYA 1EV4A 1SK2A 4KDUA 1USBA 2BMXA 4WBRD 1ON4A 3QMXA 3RHBA 1FHEA 3FW2A 2V2GA 5IMDA 3M9JA 4F0BA 2OACA 3RDWA 3LSZA 2I81A 1GWCA 3TOTA 4V2LA 1ERTA 3QAVA 2HSHA 1GNWA 3FHKA 5G2ZA 5JWQB 2K6VA 2WGRA 1K0AA 2OBIA 4L0UA 4YQUA 4ZL9A 2H0IA 2O89A 5A4UA 2A2SA 4KDXA 1I5GA 5ECRB 1AXDA 5D9XA 3F3QA 1VGLA 3GFKA 1PX6A 2MBSA 2FGXA 1QK8A 2QGVA 4HOJA 3Q74A 2DJ2A 2VO4A 3UVTA 5DQSA 1XCCA 4MK3A 3VWWA 5IOWA 1GSFA 2L4CA 7GSSA 1EP7A 2LJRA 3KD0A 2IMFA 3GV1A 3UAPA 6GSVA 2CQ9A 3BJ5A 2LRTA 2IMDA 1HYUA 3KH7A 2HE3A 2EIOA 6GSXA 4ACSA 2XHFA 3HZ4A 3FEUA 4BPYA 4DSRA 3ERGA 1F37A 2IFQA 2WZ9A 1MTCA 2OE1A 1V9WA 4KCAA 5CNWA 4NPBA 1Q4JA 5ECNB 17GSA 1TRSA 5FWGA 3DIEA 1MD4A 2VCXA 2XPDA 4WETA 10GSA 2O85A 2KUCA 1X5EA 1OC3A 4BA7A
chains in the Genus database with same CATH superfamily
1GTAA 6GSWA 4RI6A 1VF3A 4CHSA 2IFQB 3VI7A 5FHIA 4OWYA 1A24A 3GH9A 5HR1A 4K6XA 2K9FA 2BJXA 4O5QA 4J57E 2JADA 3MWHA 3GIXA 1MD3A 1YY7A 4K0NA 2VLVA 3M1GA 1JZWA 3L78A 2UZ8A 3GTUB 1XG8A 4I97A 1TK0B 2V32A 2HI7A 1JHBA 4BL7A 4PGTA 3GSSA 2IL3A 1TTZA 4ZXGA 2LUSA 1W89A 22GSA 2OE3A 5ECIB 1TOFA 2H8LA 2JSZA 1FG4A 1YDKA 3KM6A 3UARA 2H19A 4MCUA 1O73A 2ZCTA 1X9SB 4K2DA 5DALA 5F8BA 3TRXA 2L5LA 3MIXA 1JFUA 3A3TA 3CTFA 1UA5A 2TRCP 5F0GA 3HKRA 3SWLA 2DMLA 2H1AA 5J9CA 2ON5A 4DVCA 1YKAA 3IE3A 2F3MA 4ZILA 1GP1A 1TI1A 3ZIVA 3EYTA 1GSQA 2DIYA 3F6FA 1A8YA 5DALB 1O81A 1EEMA 4POKA 1F6MC 3WGXA 4ECJA 4ICYA 4KGIA 2I3YA 2OBKA 3HD5A 3CRUA 4TOPA 1XW9A 2HRNA 3TKQA 4TXVA 4KB3A 2FNOA 3D21A 4KX4A 2JSYA 4YKGA 2YV7A 3M0FA 4G19A 4IBPA 4JR4A 3IRAA 5HR0A 5ECLB 2JACA 5AIVA 4OCEA 3EC3A 5DCHA 2AHEA 3QR6A 3M9KA 3DWVA 2GQLA 4WF5A 1TXXA 4AJ8A 2VCVA 4ZBDA 4V2MA 2C1YA 4CW9A 4JR6A 2CVKA 3ZFBA 1ZYQB 4ZB9A 1ML6A 3Q18A 3LYKA 3MNGA 3P2AA 3QOUA 3FZAA 4DSQA 2C80A 2WRTA 3ERWA 2GZPA 2H01A 3EWLA 4XRDA 4ECIA 3H4KA 1KEBA 4HU7A 3TKSE 3Q6OA 5CRDA 1WIKA 2FA8A 2QSIA 1S3CA 1Z7PA 5JCGA 1HQOA 4MP4A 4Z2RA 4QQ7A 4KAEA 3R2QA 3F4SA 3W6GA 4MMMA 3IBHA 1MEKA 4X1UA 5GSSA 4K7IA 4LL4B 2H72A 2F8FA 4L5LA 5EL8A 2K8VA 2P0GA 16GSA 2FY6A 1H4OA 4F9ZA 3EINA 1TW9A 2JL4A 5DVBA 3F3RA 4O92A 2X4AA 3KTLA 5DJMA 2H6XA 5IMAA 3J7Yk 1KTEA 4POMA 1O85A 2RUFA 3C8EA 1XFLA 3TJGA 3R3EA 2K8SA 3GX8A 4G0IA 1M9AA 2VL2C 3GRXA 2FUG2 2YOIA 1ERVA 4XTSA 1LBKA 2EC4A 3FZ5A 2M72A 2I9HA 4NXIA 2GSTA 2JZSA 1YF1A 9GSSA 5G5EA 2ZNMA 2ZUPA 2VM1A 2PWJA 2L57A 1DE2A 2K18A 1N8JA 5D93A 2DKHA 3ZTLA 4IW9A 2FLSA 1C72A 1ABAA 3J7Yb 3UMAA 5KN3A 4MH2A 5ENUA 1SK1A 4ULXA 1VF1A 4AJ6A 1XVQA 5JWRB 3DMLA 2IIYA 2CVDA 1TRUA 3LORA 5KEJA 5EPFA 1SJIA 2HSYA 5ECMB 2PVQA 1SYRA 2B6MA 2LJKA 2H1GA 1T4ZA 5KN0A 2NDOA 3EVIA 3VK9A 3H8QA 1PFOA 1UVZA 2C3QA 3NZNA 4ID0A 2M80A 2JU5A 3WYWA 1X5DA 1BEDA 2KHPA 2E2MA 1G6YA 2GQMA 2CAQA 4IGJA 1GUMA 2DJJA 1B9YC 1SKSB 1EOHA 3L4NA 3UL3A 3TKSC 2HRKA 1M9BA 3G7JA 1I9DA 2X49A 2VCTA 5E4WA 3D4TA 2FWGA 1F9MA 1SU9A 2FCHA 3GX0A 1YJ6A 1A2LA 4IP6A 2H74A 3DVWA 3I9V2 3VPQA 1J9BA 1U3IA 1V58A 3TJBA 1ZZYA 2PBJA 1PN9A 4BVYA 2A4VA 3LXZA 2YWOA 1O6JA 2H6ZA 5DAKA 4Q5QA 1TRVA 3KMNA 1QFNA 4K1FA 5D9VA 2QA2A 6GSSA 3EPTA 2AUVA 4K7OA 4GRFA 4WR4A 4Z2TA 1VF4A 3AY8A 2IPAA 4HJMA 3HXSA 5EY6A 4BVYB 3N9JA 1S3RA 2DJKA 2OJLA 5GAND 2L6CA 1TRWA 3TB2A 4OO4A 3DEXA 1PN0A 3HCZA 1AQWA 4I5QA 1FO5A 2G2QA 4MJEA 3CSIA 3ZL5A 4JZQA 1THOA 5EVOA 1EP8A 3F8UA 2CVBA 4G0LA 1GUKA 4L5OA 3EE2A 4O7HA 3CSJA 1HNCA 1T1VA 2P5RA 3EU3A 1XIYA 4ZBAA 2REMA 3ZREA 1HNAA 5AIXA 2H6YA 1T7PB 1A2JA 1XWCA 2I1UA 6GSTA 2AAWA 5B6NA 4X43A 4RQRA 5D96A 1ZOFA 3Q19A 1A23A 1SKWB 3FZ9A 3G7IA 4NV2A 4K8MA 2RM6A 3KCMA 5ECPB 3UEMA 1FOVA 2H0HA 2R37A 4HQSA 4PNGA 3UBLA 2X8HA 1WMJA 1YF0A 3PH9A 4MPGA 1X9WB 2QKEA 2PGTA 2V1MA 3LFLA 2OA7A 4IS0A 4IQAA 4FYUA 3VFIA 4WR5A 3EMPA 1M2DA 3ME7A 4PX1A 3O6TA 4N0ZA 2H75A 3LYPA 1WJKA 2LS5A 4HSCX 1TU8A 1ZMAA 2EIRA 1LU4A 2KLXA 3DKSA 3ZVJD 2IWTA 1M7TA 4PNFA 1U6TA 4V1Ag 3QFBC 5A4WA 3EMXA 4LMWA 3S9FA 2DMMA 1T4YA 4EO3A 2F9SA 5J4UA 3A2VA 3GKXA 1CQHA 4N11A 5GAPD 4MA9A 2NBSA 2GSQA 2C3TA 3RHCA 4K0GA 4TKYA 3GTUA 3FK8A 1YEXA 4IP1A 1NSWA 4GTUA 4AGSA 3L9SA 1K0CA 3FY7A 3JCML 3LWAA 2B5XA 2WFCA 3ZRDA 4BIKA 1EWXA 4G10A 2VL2A 2L59A 1YZXA 4XS4A 2LNTA 3KP9A 1EV9A 2DSAA 1ERUA 3DD3A 4KW6A 4AF2A 3H79A 2H70A 3UIWA 4FYBA 2QC7A 3W8JA 4GCIA 4OO5A 4GQFA 3FZ4A 1OKDA 5HR2A 2IJYA 2QA1A 1URMA 4O5UA 1GSSA 5JCWA 3CSHA 2E7PA 4XS4B 1BG5A 5DQYA 4MJBA 1XOAA 3KJYA 4HUAA 1SL2B 4IELA 4MDCA 2H30A 2YZUA 5J9BA 3C1RA 3UBKA 5DJLA 1TDIA 2GS3A 1XZOA 2VCWA 2X8GA 4EDYA 2C0DA 4YKFA 1GRXA 2J23A 3QD9A 2LEGA 4TR3A 5JWOB 3HJPA 3H1NA 2PN8A 1J0FA 1JZOA 3CQFA 2CV4A 3F4RA 5F05A 4GSTA 4ECCA 3I6AA 2O8VB 2H1BA 1YKCA 2DJ0A 4BWQA 3TCOA 4ZL8A 3ZMLA 2R2JA 2B5YA 4POLA 2AB6A 1ERWA 4Z2UA 4L8EA 5H5SA 3IAM2 19GSA 1XW6A 1AUCA 3IHGA 1XXUA 4GSSA 11GSA 1KBNA 5IQYA 2GSRA 1A0RP 3RBTA 3TRPA 2YWNA 4EUYA 1SYXA 2P31A 2XBQA 1SD9A 3ZLPA 5IPHA 3HDCA 3DGQA 1TJDA 2HZFA 3BD2A 4XRAA 5CRWA 2CZ3A 1OE7A 1ZL9A 4KNDA 3PINA 1GLQA 1WPIA 3D22A 5HFGA 4EDZA 4Q5FA 2V6OA 3FR3A 1S3DA 2MMAA 1OVNA 1PRXA 4LLRA 2WULA 2VCZA 1M2AA 4DEJA 2LQOA 2P5QA 2VD0A 1AC1A 3P7XA 4HZ2A 2IMKA 3A5WA 1ZCPA 5D9WA 5IPGA 3HVVA 3CYNA 1MDJA 2LRNA 4BWSA 2ON7A 3RPNA 5IO2A 2YCDA 1QGVA 5CAXA 2ES7A 3FYGA 4IKHA 3ISOA 2LTKA 1B4QA 1SK0A 1DE1A 3DRNA 3O76A 5CREA 4EE0A 3QPMA 3GKMA 2PMTA 2LJAA 1NHOA 1K3LA 2GVPA 5D9TA 2C8UA 3CMIA 4GXZA 4D73B 3KP8A 1HD2A 3ZZXA 1V98A 2A2RA 1GH2A 1IYHA 2HLSA 2C0GA 4KSOA 3GSTA 1TU7A 2CZ2A 2A4HA 4ML1A 2N5AA 3HVNA 3QAGA 1Y25A 4F0CA 1V57A 1LJRA 2YZHA 1GTBA 2HNLA 3GUSA 3I43A 4ECBA 4HS1A 5HQPA 1HNBA 1WE0A 4IHUA 1RW1A 8GSSA 2N5FA 1EEJA 4MF5A 5B8BA 3GNJA 1EOGA 2M46A 2C0EA 4OCFA 4ZB6A 4RI7A 1TKDB 1RK4A 4PTSA 1K3YA 1Z6NA 4JRRA 3L9VA 3GKNA 1PSQA 2H73A 3DVXA 3F4TA 4NMUA 1JZDA 4WF4A 4KUNA 4XIHA 1FB0A 4TVEA 2VD1A 3RAZA 5FT3A 5CP1A 3P8WA 1M2BA 2LRCA 3V1WA 1OAZA 2HSMA 2MZCA 2B7KA 1G6WA 3HYPA 4IJ3A 5DBQA 4ISDA 3A5IA 1SJZA 2RM5A 4K7NA 2YN1A 1BX9A 3ZIJA 3VLNA 4TR1A 2VIMA 4KDYA 3NIVA 3HVXA 4WXTA 3E3EA 2IN3A 5BRTA 2DJ1A 4AJ7A 4GLTA 5CO3A 5L71A 3BCIA 2GLRA 3TJJA 1GSDA 4FYCA 1X9MB 1KNGA 12GSA 2C3NA 4JEDA 1R26A 2B3SA 4TR1B 5CRHA 5F07A 2LV3A 3F9UA 4NWYA 1E6BA 5DCGA 1K0BA 3D6IA 5LD0A 1AQXA 2CA8A 5IO0A 2VL9A 4FQUA 3HY2A 3HJOA 4BVXA 4HDEA 3ZVJA 4N0VA 2OADA 4A5PA 3DXBA 1G7EA 1QQ2A 1ILOA 5F06A 2VLTA 2VL3A 3ME8A 3GL5A 4X0XA 1IYIA 3HVSA 2WS2A 2DLXA 4TRXA 1R4WA 4BVXB 1K0MA 1GSYA 2GSSA 2WDUA 1F3AA 2L5OA 3E9JB 1SJ6A 4ZIJA 2X99A 5IMFA 4HQZA 3GYKA 4L0WA 4NAXA 5DDLA 2GDRA 1AAZA 1WP0A 1ST9A 5IMZA 3IC4A 1T8EB 2FWHA 2XBIA 1U88A 4ML6A 3PPUA 1TP9A 5KN1A 4GQCA 1GNEA 3GA4A 3IA1A 3HJMA 2N5BA 5IOXA 2OKAA 1JLVA 5ECOB 2R0PA 1ZYEA 2G0FA 1OC9A 4YQMA 2VAFA 3RPPA 1WWJA 3VWVA 4OFMA 1PKWA 2R6KA 3IPZA 2ALBA 5LCZA 2IMIA 4WBJA 1O7UA 4OMVA 4Q5RA 4EKZA 4MJCA 3VWXA 3A2WA 3MDKA 5AISA 3W8SA 3GMFA 1UN2A 1NHYA 4V2NA 4MZBA 1TI3A 1O8WA 1OC9B 1U3AA 1EGOA 2V41A 2FA4A 1B48A 5J41A 5G1KA 3L0HA 5KN2A 1A0FA 3GKKA 4CDOA 3WGEA 4KSMA 3BCKA 1SD8A 3EURA 3G9BA 3WT1A 4ZL7A 4H86A 1GULA 2HT9A 1V2AA 2GZYA 1R7HA 3UOMA 1ZGNA 3KEBA 3TKPA 2O87A 3CBUA 1UC7A 2YWIA 4XHMA 4J2FA 2I4AA 1FVKA 2CX3A 2O7KA 2YPMA 2VUPA 1Z6MA 4E8EA 1WOUA 1GUHA 3IK7A 3M3MA 4HZ4A 1XW5A 1E2YA 2OE0A 4WKWA 1EGRA 3SBCA 4G2EA 3PR8A 2V6KA 4HJ2A 2A2PA 1PD21 2DBCA 3C7MA 3LG6A 1TK8B 2DKIA 3KZQA 2LKUA 4P3YB 4I6XA 2VCQA 2AYTA 4PURA 2B5EA 4O5RA 2PU9C 2KP2A 3CTGA 5IMVA 5B8AA 1NW2A 3K8NA 4G9HA 2E0QA 3QCPA 2TIRA 4N30A 4MNNA 2JZTA 2VLUA 4OFTA 4ZBBA 3I69A 3IXRA 3O3TA 5CRGA 4N10A 1SL1B 3WGDA 2RUEA 4FIWA 5HFKA 3QDNA 4MPFA 1W4VA 5IMCA 1TK5B 4QL9A 2B1KA 4YQVA 4TR4A 4CY8A 4HI7A 4OD7A 3HZ8A 1FW1A 3GHAA 2R5GA 3LQ7A 4I2UA 1XBSA 3QAWA 4MZWA 2TRXA 5D8IA 2J9HA 3BBYA 3DYRA 13GSA 3F6DA 3F63A 3D0ZA 1V40A 1G0TA 1XWGA 14GSA 4IN0A 2GT6A 1Y6EA 1B4PA 5ELGA 2R0GA 6GSYA 3VPTA 2WCIA 5ECQB 2RLIA 4EC0A 1THXA 3APSA 1GSUA 3L9UA 2MMOA 1B9XC 5B6MA 4PXOA 1FB6A 1ACVA 4IJIA 2VOCA 4PQ1A 4BL7B 2PUKC 4MLYA 2WJUA 1ZYNA 4MH3A 3LXTA 1OC8A 4PQHA 4O32A 4Q5NA 1A8LA 5JCUA 2R3XA 1T3BA 4YAPA 5IIZA 3HA9A 1H75A 3G7YA 2DJ3A 1OYJA 4HEA2 4POBA 3CXGA 2GTUA 1NM3A 2MBTA 3H93A 3TKSA 3IV4A 1FVJA 18GSA 1XWAA 3TJFA 4JE1A 6GSUA 3ZFLA 1Z9HA 2PVOC 1AIUA 3HHVA 3NOFA 1FOHA 1GSEA 2CAIA 2YJ7A 4E8HA 3LEFA 1VRSD 4TW5A 4EIPA 1MDKA 2NTOA 1BQ7A 2MMZA 3TUEA 5HFIA 3UJ1A 3U6VA 2E2GA 2FWEA 5ELAA 2WB9A 1F3BA 1SKRB 2CX4A 2YJHA 1EZKA 2MMNA 3GN3A 1PA3A 5H5RA 2H0GA 2YV9A 3KMOA 3FR9A 4WEYA 2PPTA 2HYXA 4JBBA 4F82A 3IOSA 4XS6A 3QFAC 5IM9A 1PQNA 1A2MA 5ECHB 1XOBA 4ILFA 2FWFA 2LQQA 1GLPA 3LJRA 4KH7A 1PGTA 3N5OA 5G31A 4D73A 1VF2A 2F51A 3VWUA 3APQA 3TJKA 1M3JA 1AQVA 2LNSA 3PGTA 1Z7RA 4IQ1A 1XVWA 1GL8A 5A5KA 3KTBA 2R0CA 4MABA 5E59A 2DIZA 3ERFA 1XWBA 2XPEA 4NV5A 3ZITA 4TN8A 3KIJA 2X64A 1OKTA 1QMVA 5KOXA 3IDVA 3KH9A 3C73A 2YANA 4K5SA 3WD6A 2GT5A 4PUFC 2KP1A 5GZZB 2H1DA 5C04A 1K3OA 3TRQA 2MYGA 4J56E 3GL3A 3MSZA 5AN1A 1BJXA 2HFDA 4I2TA 5COHA 1GTIA 1CQGA 1JZRA 3IC8A 5ECSA 3WT2A 2L4QA 4HU9A 1K0DA 5J3RA 3GURA 3FR6A 1X0RA 5GSTA 1GTUA 4PUAA 1N2AA 3IK9A 2H76A 3FMWA 1YEPA 2XC2A 5G5FA 2RIIA 2B7JA 5H5QA 2GGTA 2L6DA 2R4VA 3FKFA 3IHQA 2FD3A 4KCEA 2F8AA 5G30A 4YAVA 3D5JA 5KOWA 3M8NA 1YQ1A 3FRCA 2GQKA 4OFNA 3ZMKA 4RQXA 2KOKA 3CRTA 4KE3A 1PL1A 4LA1A 4NHWA 1U87A 1JLWA 1Q98A 2HRFA 4MF7A 3U5RE 3MAKA 4EVMA 4MZCA 1QUWA 4GWRA 2HZEA 1B8XA 3ZYWA 2YNXA 4PQIA 2NVLA 3IR4A 3VURA 2JZRA 1MDIA 4FH8A 2NPBA 2H71A 5ECKB 4EXJA 5ABRA 2AJQB 1BYEA 1Z3EA 4LMVA 2D2ZA 1FAAA 1Z5YE 4MF6A 1F2EA 3IAS2 4I8BA 1XPVA 2PERA 4XS1A 2HZEB 5INYA 2X8CA 4JU5A 5G1LA 1O8XA 4K2XA 2B1LA 1K0OA 2CT6A 4EIQA 3LGCA 1T00A 3ED3A 4TXOA 4TR0A 4F2IA 4RUVA 1DUGA 2LSTA 4KA0A 2C0FA 2HXKA 1R5AA 3D4MA 1SENA 2YP6A 5ID2A 4K9ZA 2FHEA 3TDGA 1M99A 3TOUA 4QL7A 4GF0A 2VM2A 4TXOB 1SL0B 3US3A 4NHZA 5B7CA 2EIQA 3TGZA 1WRYA 1QXHA 2H66A 1M0UA 3F0IA 2AV4A 4GSNA 3GH6A 1XWKA 5ID2B 4LL1B 3BOAA 3P90A 3MYDA 3APOA 5A4VA 2Z9SA 1J08A 20GSA 1PL2A 1S3AA 4XCSA 1M3IA 2YWMA 1PKZA 2GZZA 4DSSA 3C1SA 5CYYA 3TKRA 3KXOA 1DBYA 2IMEA 4FO5A 3EU4A 4EL1A 1RQMA 1BAYA 3C71A 1DSBA 2BTOT 1G7OA 4MJAA 4Z7XA 5DAKB 3A2XA 1X5CA 4V1Ap 4YH2A 2DC5A 4ZB8A 3OR5A 5D73A 3E0UA 3KGKA 1OE8A 4G0KA 4DSSB 1AW9A 5LNKe 3VI5A 5C00A 5BMUA 3UVHA 1PMTA 5J5NA 4IVFA 4EF0A 2C4JA 2HRAA 1PX7A 4F03A 1ZYPA 5HR3A 1K0NA 1R5PA 5AGYA 1EV4A 1SK2A 3LW9A 4KDUA 1USBA 2BMXA 4WBRD 1ON4A 3QMXA 3RHBA 1FHEA 3FW2A 2V2GA 5IMDA 3M9JA 4F0BA 2OACA 3RDWA 3LSZA 2I81A 1GWCA 3TOTA 4V2LA 1ERTA 3QAVA 2HSHA 1GNWA 3FHKA 5G2ZA 5JWQB 2K6VA 2WGRA 1K0AA 2OBIA 4L0UA 4X4JA 4YQUA 4ZL9A 2H0IA 2O89A 5A4UA 2A2SA 4KDXA 1I5GA 5ECRB 1AXDA 5D9XA 3F3QA 1VGLA 3GFKA 1PX6A 2MBSA 2FGXA 1QK8A 2QGVA 4KF9A 4HOJA 3Q74A 2DJ2A 2VO4A 3UVTA 5DQSA 1XCCA 4MK3A 3VWWA 4USSA 5IOWA 1GSFA 2L4CA 7GSSA 1EP7A 2LJRA 3KD0A 2IMFA 3GV1A 3UAPA 6GSVA 2CQ9A 3BJ5A 2LRTA 2IMDA 1HYUA 3KH7A 2HE3A 2EIOA 6GSXA 4ACSA 2XHFA 3HZ4A 4CY6A 3FEUA 4BPYA 4DSRA 3ERGA 1F37A 2IFQA 2WZ9A 1MTCA 2OE1A 1V9WA 4KCAA 5CNWA 4NPBA 1Q4JA 5ECNB 17GSA 1TRSA 5FWGA 3DIEA 1MD4A 2VCXA 4WETA 2XPDA 10GSA 4K5RA 2O85A 2KUCA 1X5EA 1OC3A 4BA7A
chains in the Genus database with same CATH topology
1GTAA 6GSWA 4RI6A 1VF3A 4CHSA 2IFQB 3VI7A 5FHIA 4OWYA 1A24A 3GH9A 5HR1A 4K6XA 2K9FA 2BJXA 4O5QA 4J57E 2JADA 3MWHA 3GIXA 1MD3A 1YY7A 4K0NA 2VLVA 3M1GA 1JZWA 3L78A 2UZ8A 3GTUB 4I97A 1TK0B 2V32A 2HI7A 1JHBA 4BL7A 4PGTA 3GSSA 2IL3A 1TTZA 4ZXGA 2LUSA 1W89A 22GSA 2OE3A 5ECIB 1TOFA 2H8LA 2JSZA 1FG4A 1YDKA 3KM6A 3UARA 2H19A 4MCUA 1O73A 2ZCTA 1X9SB 4K2DA 5DALA 5F8BA 3TRXA 2L5LA 3MIXA 1JFUA 3A3TA 3CTFA 1UA5A 2TRCP 5F0GA 3HKRA 3SWLA 2DMLA 2H1AA 5J9CA 2ON5A 4DVCA 1YKAA 3IE3A 2F3MA 4ZILA 1GP1A 1TI1A 3ZIVA 3EYTA 1GSQA 2DIYA 3F6FA 1A8YA 5DALB 1O81A 1EEMA 4POKA 1F6MC 3WGXA 4ECJA 4ICYA 4KGIA 2I3YA 2OBKA 3HD5A 3CRUA 4TOPA 1XW9A 2HRNA 3TKQA 4TXVA 4KB3A 2FNOA 3D21A 4KX4A 2JSYA 4YKGA 2YV7A 3M0FA 4G19A 4IBPA 4JR4A 3IRAA 5HR0A 5ECLB 2JACA 5AIVA 4OCEA 3EC3A 5DCHA 2AHEA 3QR6A 3M9KA 3DWVA 2GQLA 4WF5A 1TXXA 4AJ8A 2VCVA 4ZBDA 4V2MA 2C1YA 4CW9A 4JR6A 2CVKA 3ZFBA 1ZYQB 4ZB9A 1ML6A 3Q18A 3LYKA 3MNGA 3P2AA 3QOUA 3FZAA 4DSQA 2C80A 2WRTA 3ERWA 2GZPA 2H01A 3EWLA 4XRDA 4ECIA 3H4KA 1KEBA 4HU7A 3TKSE 3Q6OA 5CRDA 1WIKA 2FA8A 2QSIA 1S3CA 1Z7PA 5JCGA 1HQOA 4MP4A 4Z2RA 4QQ7A 4KAEA 3R2QA 3F4SA 3W6GA 4MMMA 3IBHA 1MEKA 4X1UA 5GSSA 4K7IA 4LL4B 2H72A 2F8FA 4L5LA 5EL8A 2K8VA 2P0GA 16GSA 2FY6A 1H4OA 4F9ZA 3EINA 1TW9A 2JL4A 5DVBA 3F3RA 4O92A 2X4AA 3KTLA 5DJMA 2H6XA 5IMAA 3J7Yk 1KTEA 4POMA 1O85A 2RUFA 3C8EA 1XFLA 3TJGA 3R3EA 2K8SA 3GX8A 4G0IA 1M9AA 2VL2C 3GRXA 2FUG2 2YOIA 1ERVA 4XTSA 1LBKA 2EC4A 3FZ5A 2M72A 2I9HA 4NXIA 2GSTA 2JZSA 1YF1A 9GSSA 5G5EA 2ZNMA 2ZUPA 2VM1A 2PWJA 2L57A 1DE2A 2K18A 1N8JA 5D93A 2DKHA 3ZTLA 4IW9A 2FLSA 1C72A 1ABAA 3J7Yb 3UMAA 5KN3A 4MH2A 5ENUA 1SK1A 4ULXA 1VF1A 4AJ6A 1XVQA 5JWRB 3DMLA 2IIYA 2CVDA 1TRUA 3LORA 5KEJA 5EPFA 1SJIA 2HSYA 5ECMB 2PVQA 1SYRA 2B6MA 2LJKA 2H1GA 1T4ZA 5KN0A 2NDOA 3EVIA 3VK9A 3H8QA 1UVZA 2C3QA 3NZNA 4ID0A 2M80A 2JU5A 3WYWA 1X5DA 1BEDA 2KHPA 2E2MA 1G6YA 2GQMA 2CAQA 4IGJA 1GUMA 2DJJA 1B9YC 1SKSB 1EOHA 3L4NA 3UL3A 3TKSC 2HRKA 1M9BA 3G7JA 1I9DA 2X49A 2VCTA 5E4WA 3D4TA 2FWGA 1F9MA 1SU9A 2FCHA 3GX0A 1YJ6A 1A2LA 4IP6A 2H74A 3DVWA 3I9V2 3VPQA 1J9BA 1U3IA 1V58A 3TJBA 1ZZYA 2PBJA 1PN9A 4BVYA 2A4VA 3LXZA 2YWOA 1O6JA 2H6ZA 5DAKA 4Q5QA 1TRVA 3KMNA 1QFNA 4K1FA 5D9VA 2QA2A 6GSSA 3EPTA 2AUVA 4K7OA 4GRFA 4WR4A 4Z2TA 1VF4A 3AY8A 2IPAA 4HJMA 3HXSA 5EY6A 4BVYB 3N9JA 2DJKA 2OJLA 5GAND 2L6CA 1TRWA 3TB2A 4OO4A 3DEXA 1PN0A 3HCZA 1AQWA 4I5QA 1FO5A 2G2QA 4MJEA 3CSIA 3ZL5A 4JZQA 1THOA 5EVOA 1EP8A 3F8UA 2CVBA 4G0LA 1GUKA 4L5OA 3EE2A 4O7HA 3CSJA 1HNCA 1T1VA 2P5RA 3EU3A 1XIYA 4ZBAA 2REMA 3ZREA 1HNAA 5AIXA 2H6YA 1T7PB 1A2JA 1XWCA 2I1UA 6GSTA 2AAWA 5B6NA 4X43A 4RQRA 5D96A 1ZOFA 3Q19A 1A23A 1SKWB 3FZ9A 3G7IA 4NV2A 4K8MA 2RM6A 3KCMA 5ECPB 3UEMA 1FOVA 2H0HA 2R37A 4HQSA 4PNGA 3UBLA 2X8HA 1WMJA 1YF0A 3PH9A 4MPGA 1X9WB 2QKEA 2PGTA 2V1MA 3LFLA 2OA7A 4IS0A 4IQAA 4FYUA 3VFIA 4WR5A 3EMPA 1M2DA 3ME7A 4PX1A 3O6TA 4N0ZA 2H75A 3LYPA 1WJKA 2LS5A 1TU8A 1ZMAA 3DKSA 2EIRA 1LU4A 2KLXA 3ZVJD 2IWTA 1M7TA 4PNFA 1U6TA 4V1Ag 3QFBC 5A4WA 3EMXA 4LMWA 3S9FA 2DMMA 1T4YA 4EO3A 2F9SA 5J4UA 3A2VA 3GKXA 1CQHA 4N11A 5GAPD 4MA9A 2NBSA 2GSQA 2C3TA 3RHCA 4K0GA 4TKYA 3GTUA 3FK8A 1YEXA 4IP1A 1NSWA 4GTUA 4AGSA 3L9SA 1K0CA 3FY7A 3JCML 3LWAA 2B5XA 2WFCA 3ZRDA 1EWXA 4G10A 2VL2A 2L59A 1YZXA 4XS4A 2LNTA 3KP9A 1EV9A 2DSAA 1ERUA 3DD3A 4KW6A 4AF2A 3H79A 2H70A 3UIWA 4FYBA 2QC7A 3W8JA 4GCIA 4OO5A 4GQFA 3FZ4A 1OKDA 5HR2A 2IJYA 2QA1A 1URMA 4O5UA 1GSSA 5JCWA 3CSHA 2E7PA 4XS4B 1BG5A 5DQYA 4MJBA 1XOAA 3KJYA 4HUAA 1SL2B 4IELA 4MDCA 2H30A 2YZUA 5J9BA 3C1RA 3UBKA 5DJLA 1TDIA 2GS3A 1XZOA 2VCWA 2X8GA 4EDYA 2C0DA 4YKFA 1GRXA 2J23A 3QD9A 2LEGA 4TR3A 5JWOB 3HJPA 3H1NA 2PN8A 1J0FA 1JZOA 2CV4A 3F4RA 5F05A 4GSTA 4ECCA 3I6AA 2O8VB 2H1BA 1YKCA 2DJ0A 4BWQA 3TCOA 4ZL8A 3ZMLA 2R2JA 2B5YA 4POLA 2AB6A 1ERWA 4Z2UA 4L8EA 5H5SA 3IAM2 19GSA 1XW6A 1AUCA 3IHGA 1XXUA 4GSSA 11GSA 1KBNA 5IQYA 2GSRA 1A0RP 3RBTA 3TRPA 2YWNA 4EUYA 1SYXA 2P31A 2XBQA 1SD9A 3ZLPA 5IPHA 3HDCA 3DGQA 1TJDA 2HZFA 3BD2A 4XRAA 5CRWA 2CZ3A 1OE7A 1ZL9A 4KNDA 3PINA 1GLQA 1WPIA 3D22A 5HFGA 4EDZA 4Q5FA 2V6OA 3FR3A 1S3DA 2MMAA 1OVNA 1PRXA 4LLRA 2WULA 2VCZA 1M2AA 4DEJA 2LQOA 2P5QA 2VD0A 1AC1A 3P7XA 4HZ2A 2IMKA 3A5WA 1ZCPA 5D9WA 5IPGA 3HVVA 3CYNA 1MDJA 2LRNA 4BWSA 2ON7A 3RPNA 5IO2A 2YCDA 1QGVA 5CAXA 2ES7A 3FYGA 4IKHA 3ISOA 2LTKA 1B4QA 1SK0A 1DE1A 3DRNA 3O76A 5CREA 4EE0A 3QPMA 3GKMA 2PMTA 2LJAA 1NHOA 1K3LA 2GVPA 5D9TA 2C8UA 3CMIA 4GXZA 4D73B 3KP8A 1HD2A 3ZZXA 1V98A 2A2RA 1GH2A 1IYHA 2HLSA 2C0GA 4KSOA 3GSTA 1TU7A 2CZ2A 2A4HA 4ML1A 2N5AA 3QAGA 1Y25A 4F0CA 1V57A 1LJRA 2YZHA 1GTBA 2HNLA 3GUSA 3I43A 4ECBA 4HS1A 5HQPA 1HNBA 1WE0A 4IHUA 1RW1A 8GSSA 2N5FA 1EEJA 4MF5A 5B8BA 3GNJA 1EOGA 2M46A 2C0EA 4OCFA 4ZB6A 4RI7A 1TKDB 1RK4A 4PTSA 1K3YA 1Z6NA 4JRRA 3L9VA 3GKNA 1PSQA 2H73A 3DVXA 3F4TA 4NMUA 1JZDA 4WF4A 4KUNA 4XIHA 1FB0A 4TVEA 2VD1A 3RAZA 5FT3A 5CP1A 3P8WA 1M2BA 2LRCA 3V1WA 1OAZA 2HSMA 2MZCA 2B7KA 1G6WA 3HYPA 4IJ3A 5DBQA 4ISDA 3A5IA 1SJZA 2RM5A 4K7NA 2YN1A 1BX9A 3ZIJA 3VLNA 4TR1A 2VIMA 4KDYA 3NIVA 3HVXA 4WXTA 3E3EA 2IN3A 5BRTA 2DJ1A 4AJ7A 4GLTA 5CO3A 5L71A 3BCIA 2GLRA 3TJJA 1GSDA 4FYCA 1X9MB 1KNGA 12GSA 2C3NA 4JEDA 1R26A 2B3SA 4TR1B 5CRHA 5F07A 2LV3A 3F9UA 4NWYA 1E6BA 5DCGA 1K0BA 3D6IA 5LD0A 1AQXA 2CA8A 5IO0A 2VL9A 4FQUA 3HY2A 3HJOA 4BVXA 4HDEA 3ZVJA 4N0VA 2OADA 4A5PA 3DXBA 1G7EA 1QQ2A 1ILOA 5F06A 2VLTA 2VL3A 3ME8A 3GL5A 4X0XA 1IYIA 3HVSA 2WS2A 2DLXA 4TRXA 1R4WA 4BVXB 1K0MA 1GSYA 2GSSA 2WDUA 1F3AA 2L5OA 3E9JB 1SJ6A 4ZIJA 2X99A 5IMFA 4HQZA 3GYKA 4L0WA 4NAXA 5DDLA 2GDRA 1AAZA 1WP0A 1ST9A 5IMZA 3IC4A 1T8EB 2FWHA 2XBIA 1U88A 4ML6A 3PPUA 1TP9A 5KN1A 4GQCA 1GNEA 3GA4A 3IA1A 3HJMA 2N5BA 5IOXA 2OKAA 1JLVA 5ECOB 2R0PA 1ZYEA 2G0FA 1OC9A 4YQMA 2VAFA 3RPPA 1WWJA 3VWVA 4OFMA 1PKWA 2R6KA 3IPZA 2ALBA 5LCZA 2IMIA 4WBJA 1O7UA 4OMVA 4Q5RA 4EKZA 4MJCA 3VWXA 3A2WA 3MDKA 5AISA 3W8SA 3GMFA 1UN2A 1NHYA 4V2NA 4MZBA 1TI3A 1O8WA 1OC9B 1U3AA 1EGOA 2V41A 2FA4A 1B48A 5J41A 5G1KA 3L0HA 5KN2A 1A0FA 3GKKA 4CDOA 3WGEA 4KSMA 3BCKA 1SD8A 3EURA 3G9BA 3WT1A 4ZL7A 4H86A 1GULA 2HT9A 1V2AA 2GZYA 1R7HA 3UOMA 1ZGNA 3KEBA 3TKPA 2O87A 3CBUA 1UC7A 2YWIA 4XHMA 4J2FA 2I4AA 1FVKA 2CX3A 2O7KA 2YPMA 2VUPA 1Z6MA 4E8EA 1WOUA 1GUHA 3IK7A 3M3MA 4HZ4A 1XW5A 1E2YA 2OE0A 4WKWA 1EGRA 3SBCA 4G2EA 3PR8A 2V6KA 4HJ2A 2A2PA 1PD21 2DBCA 3C7MA 3LG6A 1TK8B 2DKIA 3KZQA 2LKUA 4P3YB 4I6XA 2VCQA 2AYTA 4PURA 2B5EA 4O5RA 2PU9C 2KP2A 3CTGA 5IMVA 5B8AA 1NW2A 3K8NA 4G9HA 2E0QA 3QCPA 2TIRA 4N30A 4MNNA 2JZTA 2VLUA 4OFTA 4ZBBA 3I69A 3IXRA 3O3TA 5CRGA 4N10A 1SL1B 3WGDA 2RUEA 4FIWA 5HFKA 3QDNA 4MPFA 1W4VA 5IMCA 1TK5B 4QL9A 2B1KA 4YQVA 4TR4A 4CY8A 4HI7A 4OD7A 3HZ8A 1FW1A 3GHAA 2R5GA 3LQ7A 4I2UA 1XBSA 3QAWA 4MZWA 2TRXA 5D8IA 2J9HA 3BBYA 3DYRA 13GSA 3F6DA 3F63A 3D0ZA 1V40A 1G0TA 1XWGA 14GSA 4IN0A 2GT6A 1Y6EA 1B4PA 5ELGA 2R0GA 6GSYA 3VPTA 2WCIA 5ECQB 2RLIA 4EC0A 1THXA 3APSA 1GSUA 3L9UA 2MMOA 1B9XC 5B6MA 4PXOA 1FB6A 1ACVA 4IJIA 2VOCA 4PQ1A 4BL7B 2PUKC 4MLYA 2WJUA 1ZYNA 4MH3A 3LXTA 1OC8A 4PQHA 4O32A 4Q5NA 1A8LA 5JCUA 2R3XA 1T3BA 4YAPA 5IIZA 3HA9A 1H75A 3G7YA 2DJ3A 1OYJA 4HEA2 4POBA 3CXGA 2GTUA 1NM3A 2MBTA 3H93A 3TKSA 3IV4A 1FVJA 18GSA 1XWAA 3TJFA 4JE1A 6GSUA 3ZFLA 1Z9HA 2PVOC 1AIUA 3HHVA 3NOFA 1FOHA 1GSEA 2CAIA 2YJ7A 4E8HA 3LEFA 1VRSD 4TW5A 4EIPA 1MDKA 2NTOA 1BQ7A 2MMZA 3TUEA 5HFIA 3UJ1A 3U6VA 2E2GA 2FWEA 5ELAA 2WB9A 1F3BA 1SKRB 2CX4A 2YJHA 1EZKA 2MMNA 3GN3A 1PA3A 5H5RA 2H0GA 2YV9A 3KMOA 3FR9A 4WEYA 2PPTA 2HYXA 4JBBA 4F82A 3IOSA 4XS6A 3QFAC 5IM9A 1PQNA 1A2MA 5ECHB 1XOBA 4ILFA 2FWFA 2LQQA 1GLPA 3LJRA 4KH7A 1PGTA 3N5OA 5G31A 4D73A 1VF2A 2F51A 3VWUA 3APQA 3TJKA 1AQVA 2LNSA 3PGTA 1Z7RA 4IQ1A 1XVWA 1GL8A 5A5KA 3KTBA 2R0CA 4MABA 5E59A 2DIZA 3ERFA 1XWBA 2XPEA 4NV5A 3ZITA 4TN8A 3KIJA 2X64A 1OKTA 1QMVA 5KOXA 3IDVA 3KH9A 3C73A 2YANA 4K5SA 3WD6A 2GT5A 4PUFC 2KP1A 5GZZB 2H1DA 5C04A 1K3OA 3TRQA 2MYGA 4J56E 3GL3A 3MSZA 5AN1A 1BJXA 2HFDA 4I2TA 5COHA 1GTIA 1CQGA 1JZRA 3IC8A 5ECSA 3WT2A 2L4QA 4HU9A 1K0DA 5J3RA 3GURA 3FR6A 1X0RA 5GSTA 1GTUA 4PUAA 1N2AA 3IK9A 2H76A 3FMWA 1YEPA 2XC2A 5G5FA 2RIIA 2B7JA 5H5QA 2GGTA 2L6DA 2R4VA 3FKFA 3IHQA 2FD3A 4KCEA 2F8AA 5G30A 4YAVA 3D5JA 5KOWA 3M8NA 1YQ1A 3FRCA 2GQKA 4OFNA 3ZMKA 4RQXA 2KOKA 3CRTA 4KE3A 1PL1A 4LA1A 4NHWA 1U87A 1JLWA 1Q98A 2HRFA 4MF7A 3U5RE 3MAKA 4EVMA 4MZCA 1QUWA 4GWRA 2HZEA 1B8XA 3ZYWA 2YNXA 4PQIA 2NVLA 3IR4A 3VURA 2JZRA 1MDIA 4FH8A 2NPBA 2H71A 5ECKB 4EXJA 5ABRA 2AJQB 1BYEA 1Z3EA 4LMVA 2D2ZA 1FAAA 1Z5YE 4MF6A 1F2EA 3IAS2 4I8BA 1XPVA 2PERA 4XS1A 2HZEB 5INYA 2X8CA 4JU5A 5G1LA 1O8XA 4K2XA 2B1LA 1K0OA 2CT6A 4EIQA 3LGCA 1T00A 3ED3A 4TXOA 4TR0A 4F2IA 4RUVA 1DUGA 2LSTA 4KA0A 2C0FA 2HXKA 1R5AA 3D4MA 1SENA 2YP6A 5ID2A 4K9ZA 2FHEA 3TDGA 1M99A 3TOUA 4QL7A 4GF0A 2VM2A 4TXOB 1SL0B 3US3A 4NHZA 5B7CA 2EIQA 3TGZA 1WRYA 1QXHA 2H66A 1M0UA 3F0IA 2AV4A 4GSNA 3GH6A 1XWKA 5ID2B 4LL1B 3BOAA 3P90A 3MYDA 3APOA 5A4VA 2Z9SA 1J08A 20GSA 1PL2A 1S3AA 4XCSA 2YWMA 1PKZA 2GZZA 4DSSA 3C1SA 5CYYA 3TKRA 3KXOA 1DBYA 2IMEA 4FO5A 3EU4A 4EL1A 1RQMA 1BAYA 3C71A 1DSBA 2BTOT 1G7OA 4MJAA 4Z7XA 5DAKB 3A2XA 1X5CA 4V1Ap 4YH2A 2DC5A 4ZB8A 3OR5A 5D73A 3E0UA 3KGKA 1OE8A 4G0KA 4DSSB 1AW9A 5LNKe 3VI5A 5C00A 5BMUA 3UVHA 1PMTA 5J5NA 4IVFA 4EF0A 2C4JA 2HRAA 1PX7A 4F03A 1ZYPA 5HR3A 1K0NA 1R5PA 5AGYA 1EV4A 1SK2A 3LW9A 4KDUA 1USBA 2BMXA 4WBRD 1ON4A 3QMXA 3RHBA 1FHEA 3FW2A 2V2GA 5IMDA 3M9JA 4F0BA 2OACA 3RDWA 3LSZA 2I81A 1GWCA 3TOTA 4V2LA 1ERTA 3QAVA 2HSHA 1GNWA 3FHKA 5G2ZA 5JWQB 2K6VA 2WGRA 1K0AA 2OBIA 4L0UA 4X4JA 4YQUA 4ZL9A 2H0IA 2O89A 5A4UA 2A2SA 4KDXA 1I5GA 5ECRB 1AXDA 5D9XA 3F3QA 1VGLA 3GFKA 1PX6A 2MBSA 2FGXA 1QK8A 2QGVA 4KF9A 4HOJA 3Q74A 2DJ2A 2VO4A 3UVTA 5DQSA 1XCCA 4MK3A 3VWWA 4USSA 5IOWA 1GSFA 2L4CA 7GSSA 1EP7A 2LJRA 3KD0A 2IMFA 3GV1A 3UAPA 6GSVA 2CQ9A 3BJ5A 2LRTA 2IMDA 1HYUA 3KH7A 2HE3A 2EIOA 6GSXA 4ACSA 2XHFA 3HZ4A 4CY6A 3FEUA 4BPYA 4DSRA 3ERGA 1F37A 2IFQA 2WZ9A 1MTCA 2OE1A 1V9WA 4KCAA 5CNWA 4NPBA 1Q4JA 5ECNB 17GSA 1TRSA 5FWGA 3DIEA 1MD4A 2VCXA 2XPDA 4WETA 10GSA 4K5RA 2O85A 2KUCA 1X5EA 1OC3A 4BA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GTA A;  6GSW A;  4RI6 A;  1VF3 A;  4CHS A;  2IFQ B;  3VI7 A;  5FHI A;  4OWY A;  1A24 A;  3GH9 A;  5HR1 A;  4K6X A;  2K9F A;  2BJX A;  4J57 E;  2JAD A;  3MWH A;  3GIX A;  1MD3 A;  1YY7 A;  4K0N A;  2VLV A;  3M1G A;  1JZW A;  3L78 A;  3GTU B;  4I97 A;  1TK0 B;  2V32 A;  2HI7 A;  1JHB A;  4BL7 A;  4PGT A;  3GSS A;  2IL3 A;  1TTZ A;  4ZXG A;  2LUS A;  1W89 A;  22GS A;  2OE3 A;  5ECI B;  1TOF A;  2H8L A;  2JSZ A;  1FG4 A;  1YDK A;  3KM6 A;  3UAR A;  2H19 A;  4MCU A;  1O73 A;  2ZCT A;  1X9S B;  4K2D A;  5DAL A;  5F8B A;  3TRX A;  2L5L A;  1JFU A;  3A3T A;  3CTF A;  1UA5 A;  2TRC P;  5F0G A;  3HKR A;  3SWL A;  2DML A;  2H1A A;  5J9C A;  2ON5 A;  4DVC A;  1YKA A;  3IE3 A;  2F3M A;  4ZIL A;  1GP1 A;  1TI1 A;  3ZIV A;  3EYT A;  1GSQ A;  2DIY A;  3F6F A;  1A8Y A;  5DAL B;  1O81 A;  1EEM A;  4POK A;  1F6M C;  3WGX A;  4ECJ A;  4KGI A;  2I3Y A;  2OBK A;  3HD5 A;  3CRU A;  4TOP A;  1XW9 A;  2HRN A;  3TKQ A;  4TXV A;  4KB3 A;  2FNO A;  3D21 A;  4KX4 A;  2JSY A;  2YV7 A;  3M0F A;  4G19 A;  4IBP A;  4JR4 A;  3IRA A;  5HR0 A;  5ECL B;  2JAC A;  5AIV A;  4OCE A;  3EC3 A;  5DCH A;  2AHE A;  3QR6 A;  3M9K A;  3DWV A;  2GQL A;  4WF5 A;  1TXX A;  4AJ8 A;  2VCV A;  4ZBD A;  4V2M A;  2C1Y A;  4CW9 A;  4JR6 A;  2CVK A;  3ZFB A;  1ZYQ B;  4ZB9 A;  1ML6 A;  3Q18 A;  3LYK A;  3MNG A;  3P2A A;  3QOU A;  3FZA A;  4DSQ A;  2C80 A;  2WRT A;  3ERW A;  2GZP A;  2H01 A;  3EWL A;  4XRD A;  4ECI A;  3H4K A;  1KEB A;  4HU7 A;  3TKS E;  3Q6O A;  5CRD A;  1WIK A;  2FA8 A;  2QSI A;  1S3C A;  1Z7P A;  5JCG A;  1HQO A;  4MP4 A;  4QQ7 A;  4KAE A;  3R2Q A;  3F4S A;  3W6G A;  4MMM A;  3IBH A;  1MEK A;  4X1U A;  5GSS A;  4K7I A;  4LL4 B;  2H72 A;  2F8F A;  4L5L A;  5EL8 A;  2K8V A;  2P0G A;  16GS A;  2FY6 A;  1H4O A;  4F9Z A;  3EIN A;  1TW9 A;  2JL4 A;  5DVB A;  3F3R A;  4O92 A;  3KTL A;  5DJM A;  2H6X A;  5IMA A;  3J7Y k;  1KTE A;  4POM A;  1O85 A;  2RUF A;  3C8E A;  1XFL A;  3TJG A;  2K8S A;  3GX8 A;  1M9A A;  2VL2 C;  3GRX A;  2FUG 2;  2YOI A;  1ERV A;  4XTS A;  1LBK A;  2EC4 A;  3FZ5 A;  2M72 A;  2I9H A;  4NXI A;  2GST A;  2JZS A;  1YF1 A;  9GSS A;  5G5E A;  2ZNM A;  2ZUP A;  2VM1 A;  2PWJ A;  2L57 A;  1DE2 A;  2K18 A;  1N8J A;  5D93 A;  3ZTL A;  4IW9 A;  2FLS A;  1C72 A;  1ABA A;  3J7Y b;  3UMA A;  5KN3 A;  4MH2 A;  5ENU A;  1SK1 A;  4ULX A;  1VF1 A;  4AJ6 A;  1XVQ A;  5JWR B;  3DML A;  2IIY A;  2CVD A;  1TRU A;  3LOR A;  5KEJ A;  5EPF A;  1SJI A;  2HSY A;  5ECM B;  2PVQ A;  1SYR A;  2B6M A;  2LJK A;  2H1G A;  1T4Z A;  5KN0 A;  2NDO A;  3EVI A;  3VK9 A;  3H8Q A;  1UVZ A;  2C3Q A;  3NZN A;  4ID0 A;  2M80 A;  2JU5 A;  3WYW A;  1X5D A;  1BED A;  2KHP A;  2E2M A;  1G6Y A;  2GQM A;  2CAQ A;  4IGJ A;  1GUM A;  2DJJ A;  1B9Y C;  1SKS B;  1EOH A;  3L4N A;  3UL3 A;  3TKS C;  1M9B A;  3G7J A;  1I9D A;  2VCT A;  5E4W A;  3D4T A;  2FWG A;  1F9M A;  1SU9 A;  2FCH A;  3GX0 A;  1YJ6 A;  1A2L A;  4IP6 A;  2H74 A;  3DVW A;  3I9V 2;  3VPQ A;  1J9B A;  1U3I A;  1V58 A;  3TJB A;  1ZZY A;  2PBJ A;  1PN9 A;  4BVY A;  2A4V A;  3LXZ A;  2YWO A;  1O6J A;  2H6Z A;  5DAK A;  4Q5Q A;  1TRV A;  3KMN A;  1QFN A;  4K1F A;  5D9V A;  6GSS A;  2AUV A;  4K7O A;  4GRF A;  4WR4 A;  1VF4 A;  3AY8 A;  2IPA A;  4HJM A;  3HXS A;  5EY6 A;  3N9J A;  2DJK A;  2OJL A;  5GAN D;  2L6C A;  1TRW A;  3TB2 A;  4OO4 A;  3DEX A;  3HCZ A;  1AQW A;  4I5Q A;  1FO5 A;  2G2Q A;  4MJE A;  3CSI A;  3ZL5 A;  4JZQ A;  1THO A;  5EVO A;  1EP8 A;  3F8U A;  2CVB A;  1GUK A;  4L5O A;  3EE2 A;  4O7H A;  3CSJ A;  1HNC A;  1T1V A;  2P5R A;  3EU3 A;  1XIY A;  4ZBA A;  2REM A;  3ZRE A;  1HNA A;  5AIX A;  2H6Y A;  1T7P B;  1A2J A;  1XWC A;  2I1U A;  6GST A;  2AAW A;  5B6N A;  4X43 A;  4RQR A;  5D96 A;  1ZOF A;  3Q19 A;  1A23 A;  1SKW B;  3FZ9 A;  3G7I A;  4NV2 A;  4K8M A;  2RM6 A;  3KCM A;  5ECP B;  3UEM A;  1FOV A;  2H0H A;  2R37 A;  4HQS A;  4PNG A;  3UBL A;  2X8H A;  1WMJ A;  1YF0 A;  3PH9 A;  4MPG A;  1X9W B;  2QKE A;  2PGT A;  2V1M A;  3LFL A;  2OA7 A;  4IS0 A;  4IQA A;  4FYU A;  3VFI A;  4WR5 A;  3EMP A;  1M2D A;  3ME7 A;  4PX1 A;  3O6T A;  4N0Z A;  2H75 A;  3LYP A;  1WJK A;  2LS5 A;  1TU8 A;  1ZMA A;  3DKS A;  2EIR A;  1LU4 A;  2KLX A;  3ZVJ D;  2IWT A;  1M7T A;  4PNF A;  1U6T A;  4V1A g;  3QFB C;  5A4W A;  3EMX A;  4LMW A;  3S9F A;  2DMM A;  1T4Y A;  4EO3 A;  2F9S A;  5J4U A;  3A2V A;  3GKX A;  1CQH A;  4N11 A;  5GAP D;  4MA9 A;  2NBS A;  2GSQ A;  2C3T A;  3RHC A;  4K0G A;  4TKY A;  3GTU A;  3FK8 A;  1YEX A;  4IP1 A;  1NSW A;  4GTU A;  4AGS A;  3L9S A;  1K0C A;  3FY7 A;  3JCM L;  3LWA A;  2B5X A;  2WFC A;  3ZRD A;  1EWX A;  4G10 A;  2VL2 A;  2L59 A;  1YZX A;  4XS4 A;  2LNT A;  3KP9 A;  1EV9 A;  2DSA A;  1ERU A;  3DD3 A;  4KW6 A;  4AF2 A;  3H79 A;  2H70 A;  3UIW A;  4FYB A;  2QC7 A;  3W8J A;  4GCI A;  4OO5 A;  4GQF A;  3FZ4 A;  1OKD A;  5HR2 A;  2IJY A;  1URM A;  1GSS A;  5JCW A;  3CSH A;  2E7P A;  4XS4 B;  1BG5 A;  5DQY A;  4MJB A;  1XOA A;  3KJY A;  4HUA A;  1SL2 B;  4IEL A;  4MDC A;  2H30 A;  2YZU A;  5J9B A;  3C1R A;  3UBK A;  5DJL A;  1TDI A;  2GS3 A;  1XZO A;  2VCW A;  2X8G A;  4EDY A;  2C0D A;  1GRX A;  2J23 A;  3QD9 A;  2LEG A;  4TR3 A;  5JWO B;  3HJP A;  3H1N A;  2PN8 A;  1J0F A;  1JZO A;  2CV4 A;  3F4R A;  5F05 A;  4GST A;  4ECC A;  3I6A A;  2O8V B;  2H1B A;  1YKC A;  2DJ0 A;  4BWQ A;  3TCO A;  4ZL8 A;  3ZML A;  2R2J A;  2B5Y A;  4POL A;  2AB6 A;  1ERW A;  4L8E A;  5H5S A;  3IAM 2;  19GS A;  1XW6 A;  1AUC A;  1XXU A;  4GSS A;  11GS A;  1KBN A;  5IQY A;  2GSR A;  1A0R P;  3RBT A;  3TRP A;  2YWN A;  4EUY A;  1SYX A;  2P31 A;  2XBQ A;  1SD9 A;  3ZLP A;  5IPH A;  3HDC A;  3DGQ A;  1TJD A;  2HZF A;  3BD2 A;  4XRA A;  5CRW A;  2CZ3 A;  1OE7 A;  1ZL9 A;  4KND A;  3PIN A;  1GLQ A;  1WPI A;  3D22 A;  5HFG A;  4EDZ A;  4Q5F A;  2V6O A;  3FR3 A;  1S3D A;  2MMA A;  1OVN A;  1PRX A;  4LLR A;  2WUL A;  2VCZ A;  1M2A A;  4DEJ A;  2LQO A;  2P5Q A;  2VD0 A;  1AC1 A;  3P7X A;  4HZ2 A;  2IMK A;  3A5W A;  1ZCP A;  5D9W A;  5IPG A;  3HVV A;  3CYN A;  1MDJ A;  2LRN A;  4BWS A;  2ON7 A;  3RPN A;  5IO2 A;  2YCD A;  1QGV A;  5CAX A;  2ES7 A;  3FYG A;  4IKH A;  3ISO A;  2LTK A;  1B4Q A;  1SK0 A;  1DE1 A;  3DRN A;  3O76 A;  5CRE A;  4EE0 A;  3QPM A;  3GKM A;  2PMT A;  2LJA A;  1NHO A;  1K3L A;  2GVP A;  5D9T A;  2C8U A;  3CMI A;  4GXZ A;  4D73 B;  3KP8 A;  1HD2 A;  3ZZX A;  1V98 A;  2A2R A;  1GH2 A;  1IYH A;  2HLS A;  2C0G A;  4KSO A;  3GST A;  1TU7 A;  2CZ2 A;  4ML1 A;  2N5A A;  3QAG A;  1Y25 A;  4F0C A;  1V57 A;  1LJR A;  2YZH A;  1GTB A;  2HNL A;  3GUS A;  3I43 A;  4ECB A;  4HS1 A;  5HQP A;  1HNB A;  1WE0 A;  4IHU A;  1RW1 A;  8GSS A;  2N5F A;  1EEJ A;  4MF5 A;  5B8B A;  3GNJ A;  1EOG A;  2M46 A;  2C0E A;  4OCF A;  4ZB6 A;  4RI7 A;  1TKD B;  1RK4 A;  1K3Y A;  1Z6N A;  4JRR A;  3L9V A;  3GKN A;  1PSQ A;  2H73 A;  3DVX A;  3F4T A;  4NMU A;  1JZD A;  4WF4 A;  4KUN A;  4XIH A;  1FB0 A;  4TVE A;  2VD1 A;  3RAZ A;  5FT3 A;  5CP1 A;  3P8W A;  1M2B A;  2LRC A;  3V1W A;  1OAZ A;  2MZC A;  2B7K A;  1G6W A;  3HYP A;  4IJ3 A;  5DBQ A;  4ISD A;  1SJZ A;  2RM5 A;  4K7N A;  2YN1 A;  1BX9 A;  3ZIJ A;  3VLN A;  4TR1 A;  2VIM A;  4KDY A;  3NIV A;  3HVX A;  4WXT A;  3E3E A;  2IN3 A;  2DJ1 A;  4AJ7 A;  4GLT A;  5CO3 A;  5L71 A;  3BCI A;  2GLR A;  3TJJ A;  1GSD A;  4FYC A;  1X9M B;  1KNG A;  12GS A;  2C3N A;  4JED A;  1R26 A;  2B3S A;  4TR1 B;  5CRH A;  5F07 A;  2LV3 A;  3F9U A;  4NWY A;  1E6B A;  5DCG A;  1K0B A;  3D6I A;  5LD0 A;  1AQX A;  2CA8 A;  5IO0 A;  2VL9 A;  3HY2 A;  3HJO A;  4BVX A;  4HDE A;  3ZVJ A;  4N0V A;  2OAD A;  3DXB A;  1G7E A;  1QQ2 A;  1ILO A;  5F06 A;  2VLT A;  2VL3 A;  3ME8 A;  3GL5 A;  4X0X A;  1IYI A;  3HVS A;  2WS2 A;  2DLX A;  4TRX A;  1R4W A;  1K0M A;  1GSY A;  2GSS A;  2WDU A;  1F3A A;  2L5O A;  3E9J B;  1SJ6 A;  4ZIJ A;  2X99 A;  5IMF A;  4HQZ A;  3GYK A;  4L0W A;  4NAX A;  5DDL A;  2GDR A;  1AAZ A;  1WP0 A;  1ST9 A;  5IMZ A;  3IC4 A;  1T8E B;  2FWH A;  2XBI A;  1U88 A;  4ML6 A;  1TP9 A;  5KN1 A;  4GQC A;  1GNE A;  3GA4 A;  3IA1 A;  3HJM A;  2N5B A;  5IOX A;  2OKA A;  1JLV A;  5ECO B;  1ZYE A;  2G0F A;  1OC9 A;  4YQM A;  2VAF A;  3RPP A;  1WWJ A;  3VWV A;  4OFM A;  1PKW A;  2R6K A;  3IPZ A;  2ALB A;  5LCZ A;  2IMI A;  4WBJ A;  1O7U A;  4OMV A;  4Q5R A;  4EKZ A;  4MJC A;  3VWX A;  3A2W A;  3MDK A;  5AIS A;  3W8S A;  3GMF A;  1UN2 A;  1NHY A;  4V2N A;  4MZB A;  1TI3 A;  1O8W A;  1OC9 B;  1U3A A;  1EGO A;  2V41 A;  2FA4 A;  1B48 A;  5J41 A;  5G1K A;  3L0H A;  5KN2 A;  1A0F A;  3GKK A;  4CDO A;  3WGE A;  4KSM A;  3BCK A;  1SD8 A;  3EUR A;  3G9B A;  3WT1 A;  4ZL7 A;  4H86 A;  1GUL A;  2HT9 A;  1V2A A;  2GZY A;  1R7H A;  3UOM A;  1ZGN A;  3KEB A;  3TKP A;  2O87 A;  3CBU A;  1UC7 A;  2YWI A;  4XHM A;  4J2F A;  2I4A A;  1FVK A;  2CX3 A;  2O7K A;  2YPM A;  2VUP A;  1Z6M A;  4E8E A;  1WOU A;  1GUH A;  3IK7 A;  3M3M A;  4HZ4 A;  1XW5 A;  1E2Y A;  2OE0 A;  4WKW A;  1EGR A;  3SBC A;  4G2E A;  3PR8 A;  2V6K A;  4HJ2 A;  1PD2 1;  2DBC A;  3C7M A;  3LG6 A;  1TK8 B;  3KZQ A;  2LKU A;  4P3Y B;  4I6X A;  2VCQ A;  2AYT A;  4PUR A;  2B5E A;  4O5R A;  2PU9 C;  2KP2 A;  3CTG A;  5IMV A;  5B8A A;  1NW2 A;  3K8N A;  4G9H A;  2E0Q A;  3QCP A;  2TIR A;  4N30 A;  2JZT A;  2VLU A;  4OFT A;  4ZBB A;  3I69 A;  3IXR A;  3O3T A;  5CRG A;  4N10 A;  1SL1 B;  3WGD A;  2RUE A;  4FIW A;  5HFK A;  3QDN A;  4MPF A;  1W4V A;  5IMC A;  1TK5 B;  4QL9 A;  2B1K A;  4YQV A;  4TR4 A;  4HI7 A;  4OD7 A;  3HZ8 A;  1FW1 A;  3GHA A;  2R5G A;  3LQ7 A;  4I2U A;  1XBS A;  3QAW A;  4MZW A;  2TRX A;  5D8I A;  2J9H A;  3BBY A;  3DYR A;  13GS A;  3F6D A;  3F63 A;  3D0Z A;  1V40 A;  1G0T A;  1XWG A;  14GS A;  4IN0 A;  2GT6 A;  1Y6E A;  1B4P A;  5ELG A;  6GSY A;  3VPT A;  2WCI A;  5ECQ B;  2RLI A;  4EC0 A;  1THX A;  3APS A;  1GSU A;  3L9U A;  2MMO A;  1B9X C;  5B6M A;  4PXO A;  1FB6 A;  1ACV A;  4IJI A;  2VOC A;  4PQ1 A;  2PUK C;  4MLY A;  2WJU A;  4MH3 A;  3LXT A;  1OC8 A;  4PQH A;  4O32 A;  4Q5N A;  1A8L A;  5JCU A;  2R3X A;  1T3B A;  4YAP A;  5IIZ A;  3HA9 A;  1H75 A;  3G7Y A;  2DJ3 A;  1OYJ A;  4HEA 2;  4POB A;  3CXG A;  2GTU A;  1NM3 A;  2MBT A;  3H93 A;  3TKS A;  3IV4 A;  1FVJ A;  18GS A;  1XWA A;  3TJF A;  4JE1 A;  6GSU A;  3ZFL A;  1Z9H A;  2PVO C;  1AIU A;  3HHV A;  3NOF A;  1GSE A;  2CAI A;  2YJ7 A;  4E8H A;  3LEF A;  1VRS D;  4TW5 A;  1MDK A;  2NTO A;  1BQ7 A;  2MMZ A;  3TUE A;  5HFI A;  3UJ1 A;  3U6V A;  2E2G A;  2FWE A;  5ELA A;  2WB9 A;  1F3B A;  1SKR B;  2CX4 A;  2YJH A;  1EZK A;  2MMN A;  3GN3 A;  1PA3 A;  5H5R A;  2H0G A;  2YV9 A;  3KMO A;  3FR9 A;  4WEY A;  2PPT A;  2HYX A;  4JBB A;  4F82 A;  3IOS A;  4XS6 A;  3QFA C;  5IM9 A;  1PQN A;  1A2M A;  5ECH B;  1XOB A;  4ILF A;  2FWF A;  2LQQ A;  1GLP A;  3LJR A;  4KH7 A;  1PGT A;  3N5O A;  5G31 A;  4D73 A;  1VF2 A;  2F51 A;  3VWU A;  3APQ A;  3TJK A;  1AQV A;  2LNS A;  3PGT A;  1Z7R A;  4IQ1 A;  1XVW A;  1GL8 A;  5A5K A;  3KTB A;  4MAB A;  5E59 A;  2DIZ A;  3ERF A;  1XWB A;  2XPE A;  4NV5 A;  3ZIT A;  4TN8 A;  3KIJ A;  2X64 A;  1OKT A;  1QMV A;  3IDV A;  3KH9 A;  3C73 A;  2YAN A;  3WD6 A;  2GT5 A;  4PUF C;  2KP1 A;  5GZZ B;  2H1D A;  5C04 A;  1K3O A;  3TRQ A;  2MYG A;  4J56 E;  3GL3 A;  3MSZ A;  5AN1 A;  1BJX A;  2HFD A;  4I2T A;  5COH A;  1GTI A;  1CQG A;  1JZR A;  5ECS A;  3WT2 A;  2L4Q A;  4HU9 A;  1K0D A;  5J3R A;  3GUR A;  3FR6 A;  1X0R A;  5GST A;  1GTU A;  4PUA A;  1N2A A;  3IK9 A;  2H76 A;  1YEP A;  2XC2 A;  5G5F A;  2RII A;  2B7J A;  5H5Q A;  2GGT A;  2L6D A;  2R4V A;  3FKF A;  3IHQ A;  2FD3 A;  4KCE A;  2F8A A;  5G30 A;  4YAV A;  3D5J A;  3M8N A;  1YQ1 A;  3FRC A;  2GQK A;  4OFN A;  3ZMK A;  4RQX A;  2KOK A;  3CRT A;  4KE3 A;  1PL1 A;  4LA1 A;  4NHW A;  1U87 A;  1JLW A;  1Q98 A;  2HRF A;  4MF7 A;  3U5R E;  3MAK A;  4EVM A;  4MZC A;  1QUW A;  4GWR A;  2HZE A;  1B8X A;  3ZYW A;  2YNX A;  4PQI A;  2NVL A;  3IR4 A;  3VUR A;  2JZR A;  1MDI A;  4FH8 A;  2NPB A;  2H71 A;  5ECK B;  4EXJ A;  5ABR A;  2AJQ B;  1BYE A;  1Z3E A;  4LMV A;  2D2Z A;  1FAA A;  1Z5Y E;  4MF6 A;  1F2E A;  3IAS 2;  4I8B A;  1XPV A;  2PER A;  4XS1 A;  2HZE B;  5INY A;  2X8C A;  4JU5 A;  5G1L A;  1O8X A;  2B1L A;  1K0O A;  2CT6 A;  3LGC A;  1T00 A;  3ED3 A;  4TXO A;  4TR0 A;  4F2I A;  4RUV A;  1DUG A;  2LST A;  4KA0 A;  2C0F A;  2HXK A;  1R5A A;  3D4M A;  1SEN A;  2YP6 A;  5ID2 A;  4K9Z A;  2FHE A;  3TDG A;  1M99 A;  3TOU A;  4QL7 A;  4GF0 A;  2VM2 A;  4TXO B;  1SL0 B;  3US3 A;  4NHZ A;  5B7C A;  2EIQ A;  3TGZ A;  1WRY A;  1QXH A;  2H66 A;  1M0U A;  3F0I A;  2AV4 A;  4GSN A;  3GH6 A;  1XWK A;  5ID2 B;  4LL1 B;  3BOA A;  3P90 A;  3APO A;  5A4V A;  2Z9S A;  1J08 A;  20GS A;  1PL2 A;  1S3A A;  4XCS A;  2YWM A;  1PKZ A;  2GZZ A;  4DSS A;  3C1S A;  5CYY A;  3TKR A;  3KXO A;  1DBY A;  2IME A;  4FO5 A;  3EU4 A;  4EL1 A;  1RQM A;  1BAY A;  3C71 A;  1DSB A;  2BTO T;  1G7O A;  4MJA A;  4Z7X A;  5DAK B;  3A2X A;  1X5C A;  4V1A p;  4YH2 A;  2DC5 A;  4ZB8 A;  3OR5 A;  5D73 A;  3E0U A;  3KGK A;  1OE8 A;  4DSS B;  1AW9 A;  5LNK e;  3VI5 A;  5C00 A;  3UVH A;  1PMT A;  5J5N A;  4IVF A;  4EF0 A;  2C4J A;  1PX7 A;  4F03 A;  5HR3 A;  1K0N A;  1R5P A;  5AGY A;  1EV4 A;  1SK2 A;  4KDU A;  1USB A;  2BMX A;  4WBR D;  1ON4 A;  3QMX A;  3RHB A;  1FHE A;  3FW2 A;  2V2G A;  5IMD A;  3M9J A;  4F0B A;  2OAC A;  3RDW A;  3LSZ A;  2I81 A;  1GWC A;  3TOT A;  4V2L A;  1ERT A;  3QAV A;  2HSH A;  1GNW A;  3FHK A;  5G2Z A;  5JWQ B;  2K6V A;  2WGR A;  1K0A A;  2OBI A;  4L0U A;  4YQU A;  4ZL9 A;  2H0I A;  2O89 A;  5A4U A;  2A2S A;  4KDX A;  1I5G A;  5ECR B;  1AXD A;  5D9X A;  3F3Q A;  1VGL A;  3GFK A;  1PX6 A;  2MBS A;  2FGX A;  1QK8 A;  2QGV A;  4HOJ A;  3Q74 A;  2DJ2 A;  2VO4 A;  3UVT A;  5DQS A;  1XCC A;  4MK3 A;  3VWW A;  5IOW A;  1GSF A;  2L4C A;  7GSS A;  1EP7 A;  2LJR A;  3KD0 A;  2IMF A;  3GV1 A;  3UAP A;  6GSV A;  2CQ9 A;  3BJ5 A;  2LRT A;  2IMD A;  1HYU A;  3KH7 A;  2HE3 A;  2EIO A;  6GSX A;  4ACS A;  2XHF A;  3HZ4 A;  3FEU A;  4BPY A;  4DSR A;  3ERG A;  1F37 A;  2IFQ A;  2WZ9 A;  1MTC A;  2OE1 A;  1V9W A;  4KCA A;  5CNW A;  4NPB A;  1Q4J A;  5ECN B;  17GS A;  1TRS A;  5FWG A;  3DIE A;  1MD4 A;  2VCX A;  2XPD A;  4WET A;  10GS A;  2O85 A;  2KUC A;  1X5E A;  1OC3 A;  4BA7 A; 
#chains in the Genus database with same CATH topology
 1GTA A;  6GSW A;  4RI6 A;  1VF3 A;  4CHS A;  2IFQ B;  3VI7 A;  5FHI A;  4OWY A;  1A24 A;  3GH9 A;  5HR1 A;  4K6X A;  2K9F A;  2BJX A;  4O5Q A;  4J57 E;  2JAD A;  3MWH A;  3GIX A;  1MD3 A;  1YY7 A;  4K0N A;  2VLV A;  3M1G A;  1JZW A;  3L78 A;  2UZ8 A;  3GTU B;  1XG8 A;  4I97 A;  1TK0 B;  2V32 A;  2HI7 A;  1JHB A;  4BL7 A;  4PGT A;  3GSS A;  2IL3 A;  1TTZ A;  4ZXG A;  2LUS A;  1W89 A;  22GS A;  2OE3 A;  5ECI B;  1TOF A;  2H8L A;  2JSZ A;  1FG4 A;  1YDK A;  3KM6 A;  3UAR A;  2H19 A;  4MCU A;  1O73 A;  2ZCT A;  1X9S B;  4K2D A;  5DAL A;  5F8B A;  3TRX A;  2L5L A;  3MIX A;  1JFU A;  3A3T A;  3CTF A;  1UA5 A;  2TRC P;  5F0G A;  3HKR A;  3SWL A;  2DML A;  2H1A A;  5J9C A;  2ON5 A;  4DVC A;  1YKA A;  3IE3 A;  2F3M A;  4ZIL A;  1GP1 A;  1TI1 A;  3ZIV A;  3EYT A;  1GSQ A;  2DIY A;  3F6F A;  1A8Y A;  5DAL B;  1O81 A;  1EEM A;  4POK A;  1F6M C;  3WGX A;  4ECJ A;  4ICY A;  4KGI A;  2I3Y A;  2OBK A;  3HD5 A;  3CRU A;  4TOP A;  1XW9 A;  2HRN A;  3TKQ A;  4TXV A;  4KB3 A;  2FNO A;  3D21 A;  4KX4 A;  2JSY A;  4YKG A;  2YV7 A;  3M0F A;  4G19 A;  4IBP A;  4JR4 A;  3IRA A;  5HR0 A;  5ECL B;  2JAC A;  5AIV A;  4OCE A;  3EC3 A;  5DCH A;  2AHE A;  3QR6 A;  3M9K A;  3DWV A;  2GQL A;  4WF5 A;  1TXX A;  4AJ8 A;  2VCV A;  4ZBD A;  4V2M A;  2C1Y A;  4CW9 A;  4JR6 A;  2CVK A;  3ZFB A;  1ZYQ B;  4ZB9 A;  1ML6 A;  3Q18 A;  3LYK A;  3MNG A;  3P2A A;  3QOU A;  3FZA A;  4DSQ A;  2C80 A;  2WRT A;  3ERW A;  2GZP A;  2H01 A;  3EWL A;  4XRD A;  4ECI A;  3H4K A;  1KEB A;  4HU7 A;  3TKS E;  3Q6O A;  5CRD A;  1WIK A;  2FA8 A;  2QSI A;  1S3C A;  1Z7P A;  5JCG A;  1HQO A;  4MP4 A;  4Z2R A;  4QQ7 A;  4KAE A;  3R2Q A;  3F4S A;  3W6G A;  4MMM A;  3IBH A;  1MEK A;  4X1U A;  5GSS A;  4K7I A;  4LL4 B;  2H72 A;  2F8F A;  4L5L A;  5EL8 A;  2K8V A;  2P0G A;  16GS A;  2FY6 A;  1H4O A;  4F9Z A;  3EIN A;  1TW9 A;  2JL4 A;  5DVB A;  3F3R A;  4O92 A;  2X4A A;  3KTL A;  5DJM A;  2H6X A;  5IMA A;  3J7Y k;  1KTE A;  4POM A;  1O85 A;  2RUF A;  3C8E A;  1XFL A;  3TJG A;  3R3E A;  2K8S A;  3GX8 A;  4G0I A;  1M9A A;  2VL2 C;  3GRX A;  2FUG 2;  2YOI A;  1ERV A;  4XTS A;  1LBK A;  2EC4 A;  3FZ5 A;  2M72 A;  2I9H A;  4NXI A;  2GST A;  2JZS A;  1YF1 A;  9GSS A;  5G5E A;  2ZNM A;  2ZUP A;  2VM1 A;  2PWJ A;  2L57 A;  1DE2 A;  2K18 A;  1N8J A;  5D93 A;  2DKH A;  3ZTL A;  4IW9 A;  2FLS A;  1C72 A;  1ABA A;  3J7Y b;  3UMA A;  5KN3 A;  4MH2 A;  5ENU A;  1SK1 A;  4ULX A;  1VF1 A;  4AJ6 A;  1XVQ A;  5JWR B;  3DML A;  2IIY A;  2CVD A;  1TRU A;  3LOR A;  5KEJ A;  5EPF A;  1SJI A;  2HSY A;  5ECM B;  2PVQ A;  1SYR A;  2B6M A;  2LJK A;  2H1G A;  1T4Z A;  5KN0 A;  2NDO A;  3EVI A;  3VK9 A;  3H8Q A;  1PFO A;  1UVZ A;  2C3Q A;  3NZN A;  4ID0 A;  2M80 A;  2JU5 A;  3WYW A;  1X5D A;  1BED A;  2KHP A;  2E2M A;  1G6Y A;  2GQM A;  2CAQ A;  4IGJ A;  1GUM A;  2DJJ A;  1B9Y C;  1SKS B;  1EOH A;  3L4N A;  3UL3 A;  3TKS C;  2HRK A;  1M9B A;  3G7J A;  1I9D A;  2X49 A;  2VCT A;  5E4W A;  3D4T A;  2FWG A;  1F9M A;  1SU9 A;  2FCH A;  3GX0 A;  1YJ6 A;  1A2L A;  4IP6 A;  2H74 A;  3DVW A;  3I9V 2;  3VPQ A;  1J9B A;  1U3I A;  1V58 A;  3TJB A;  1ZZY A;  2PBJ A;  1PN9 A;  4BVY A;  2A4V A;  3LXZ A;  2YWO A;  1O6J A;  2H6Z A;  5DAK A;  4Q5Q A;  1TRV A;  3KMN A;  1QFN A;  4K1F A;  5D9V A;  2QA2 A;  6GSS A;  3EPT A;  2AUV A;  4K7O A;  4GRF A;  4WR4 A;  4Z2T A;  1VF4 A;  3AY8 A;  2IPA A;  4HJM A;  3HXS A;  5EY6 A;  4BVY B;  3N9J A;  1S3R A;  2DJK A;  2OJL A;  5GAN D;  2L6C A;  1TRW A;  3TB2 A;  4OO4 A;  3DEX A;  1PN0 A;  3HCZ A;  1AQW A;  4I5Q A;  1FO5 A;  2G2Q A;  4MJE A;  3CSI A;  3ZL5 A;  4JZQ A;  1THO A;  5EVO A;  1EP8 A;  3F8U A;  2CVB A;  4G0L A;  1GUK A;  4L5O A;  3EE2 A;  4O7H A;  3CSJ A;  1HNC A;  1T1V A;  2P5R A;  3EU3 A;  1XIY A;  4ZBA A;  2REM A;  3ZRE A;  1HNA A;  5AIX A;  2H6Y A;  1T7P B;  1A2J A;  1XWC A;  2I1U A;  6GST A;  2AAW A;  5B6N A;  4X43 A;  4RQR A;  5D96 A;  1ZOF A;  3Q19 A;  1A23 A;  1SKW B;  3FZ9 A;  3G7I A;  4NV2 A;  4K8M A;  2RM6 A;  3KCM A;  5ECP B;  3UEM A;  1FOV A;  2H0H A;  2R37 A;  4HQS A;  4PNG A;  3UBL A;  2X8H A;  1WMJ A;  1YF0 A;  3PH9 A;  4MPG A;  1X9W B;  2QKE A;  2PGT A;  2V1M A;  3LFL A;  2OA7 A;  4IS0 A;  4IQA A;  4FYU A;  3VFI A;  4WR5 A;  3EMP A;  1M2D A;  3ME7 A;  4PX1 A;  3O6T A;  4N0Z A;  2H75 A;  3LYP A;  1WJK A;  2LS5 A;  4HSC X;  1TU8 A;  1ZMA A;  2EIR A;  1LU4 A;  2KLX A;  3DKS A;  3ZVJ D;  2IWT A;  1M7T A;  4PNF A;  1U6T A;  4V1A g;  3QFB C;  5A4W A;  3EMX A;  4LMW A;  3S9F A;  2DMM A;  1T4Y A;  4EO3 A;  2F9S A;  5J4U A;  3A2V A;  3GKX A;  1CQH A;  4N11 A;  5GAP D;  4MA9 A;  2NBS A;  2GSQ A;  2C3T A;  3RHC A;  4K0G A;  4TKY A;  3GTU A;  3FK8 A;  1YEX A;  4IP1 A;  1NSW A;  4GTU A;  4AGS A;  3L9S A;  1K0C A;  3FY7 A;  3JCM L;  3LWA A;  2B5X A;  2WFC A;  3ZRD A;  4BIK A;  1EWX A;  4G10 A;  2VL2 A;  2L59 A;  1YZX A;  4XS4 A;  2LNT A;  3KP9 A;  1EV9 A;  2DSA A;  1ERU A;  3DD3 A;  4KW6 A;  4AF2 A;  3H79 A;  2H70 A;  3UIW A;  4FYB A;  2QC7 A;  3W8J A;  4GCI A;  4OO5 A;  4GQF A;  3FZ4 A;  1OKD A;  5HR2 A;  2IJY A;  2QA1 A;  1URM A;  4O5U A;  1GSS A;  5JCW A;  3CSH A;  2E7P A;  4XS4 B;  1BG5 A;  5DQY A;  4MJB A;  1XOA A;  3KJY A;  4HUA A;  1SL2 B;  4IEL A;  4MDC A;  2H30 A;  2YZU A;  5J9B A;  3C1R A;  3UBK A;  5DJL A;  1TDI A;  2GS3 A;  1XZO A;  2VCW A;  2X8G A;  4EDY A;  2C0D A;  4YKF A;  1GRX A;  2J23 A;  3QD9 A;  2LEG A;  4TR3 A;  5JWO B;  3HJP A;  3H1N A;  2PN8 A;  1J0F A;  1JZO A;  3CQF A;  2CV4 A;  3F4R A;  5F05 A;  4GST A;  4ECC A;  3I6A A;  2O8V B;  2H1B A;  1YKC A;  2DJ0 A;  4BWQ A;  3TCO A;  4ZL8 A;  3ZML A;  2R2J A;  2B5Y A;  4POL A;  2AB6 A;  1ERW A;  4Z2U A;  4L8E A;  5H5S A;  3IAM 2;  19GS A;  1XW6 A;  1AUC A;  3IHG A;  1XXU A;  4GSS A;  11GS A;  1KBN A;  5IQY A;  2GSR A;  1A0R P;  3RBT A;  3TRP A;  2YWN A;  4EUY A;  1SYX A;  2P31 A;  2XBQ A;  1SD9 A;  3ZLP A;  5IPH A;  3HDC A;  3DGQ A;  1TJD A;  2HZF A;  3BD2 A;  4XRA A;  5CRW A;  2CZ3 A;  1OE7 A;  1ZL9 A;  4KND A;  3PIN A;  1GLQ A;  1WPI A;  3D22 A;  5HFG A;  4EDZ A;  4Q5F A;  2V6O A;  3FR3 A;  1S3D A;  2MMA A;  1OVN A;  1PRX A;  4LLR A;  2WUL A;  2VCZ A;  1M2A A;  4DEJ A;  2LQO A;  2P5Q A;  2VD0 A;  1AC1 A;  3P7X A;  4HZ2 A;  2IMK A;  3A5W A;  1ZCP A;  5D9W A;  5IPG A;  3HVV A;  3CYN A;  1MDJ A;  2LRN A;  4BWS A;  2ON7 A;  3RPN A;  5IO2 A;  2YCD A;  1QGV A;  5CAX A;  2ES7 A;  3FYG A;  4IKH A;  3ISO A;  2LTK A;  1B4Q A;  1SK0 A;  1DE1 A;  3DRN A;  3O76 A;  5CRE A;  4EE0 A;  3QPM A;  3GKM A;  2PMT A;  2LJA A;  1NHO A;  1K3L A;  2GVP A;  5D9T A;  2C8U A;  3CMI A;  4GXZ A;  4D73 B;  3KP8 A;  1HD2 A;  3ZZX A;  1V98 A;  2A2R A;  1GH2 A;  1IYH A;  2HLS A;  2C0G A;  4KSO A;  3GST A;  1TU7 A;  2CZ2 A;  2A4H A;  4ML1 A;  2N5A A;  3HVN A;  3QAG A;  1Y25 A;  4F0C A;  1V57 A;  1LJR A;  2YZH A;  1GTB A;  2HNL A;  3GUS A;  3I43 A;  4ECB A;  4HS1 A;  5HQP A;  1HNB A;  1WE0 A;  4IHU A;  1RW1 A;  8GSS A;  2N5F A;  1EEJ A;  4MF5 A;  5B8B A;  3GNJ A;  1EOG A;  2M46 A;  2C0E A;  4OCF A;  4ZB6 A;  4RI7 A;  1TKD B;  1RK4 A;  4PTS A;  1K3Y A;  1Z6N A;  4JRR A;  3L9V A;  3GKN A;  1PSQ A;  2H73 A;  3DVX A;  3F4T A;  4NMU A;  1JZD A;  4WF4 A;  4KUN A;  4XIH A;  1FB0 A;  4TVE A;  2VD1 A;  3RAZ A;  5FT3 A;  5CP1 A;  3P8W A;  1M2B A;  2LRC A;  3V1W A;  1OAZ A;  2HSM A;  2MZC A;  2B7K A;  1G6W A;  3HYP A;  4IJ3 A;  5DBQ A;  4ISD A;  3A5I A;  1SJZ A;  2RM5 A;  4K7N A;  2YN1 A;  1BX9 A;  3ZIJ A;  3VLN A;  4TR1 A;  2VIM A;  4KDY A;  3NIV A;  3HVX A;  4WXT A;  3E3E A;  2IN3 A;  5BRT A;  2DJ1 A;  4AJ7 A;  4GLT A;  5CO3 A;  5L71 A;  3BCI A;  2GLR A;  3TJJ A;  1GSD A;  4FYC A;  1X9M B;  1KNG A;  12GS A;  2C3N A;  4JED A;  1R26 A;  2B3S A;  4TR1 B;  5CRH A;  5F07 A;  2LV3 A;  3F9U A;  4NWY A;  1E6B A;  5DCG A;  1K0B A;  3D6I A;  5LD0 A;  1AQX A;  2CA8 A;  5IO0 A;  2VL9 A;  4FQU A;  3HY2 A;  3HJO A;  4BVX A;  4HDE A;  3ZVJ A;  4N0V A;  2OAD A;  4A5P A;  3DXB A;  1G7E A;  1QQ2 A;  1ILO A;  5F06 A;  2VLT A;  2VL3 A;  3ME8 A;  3GL5 A;  4X0X A;  1IYI A;  3HVS A;  2WS2 A;  2DLX A;  4TRX A;  1R4W A;  4BVX B;  1K0M A;  1GSY A;  2GSS A;  2WDU A;  1F3A A;  2L5O A;  3E9J B;  1SJ6 A;  4ZIJ A;  2X99 A;  5IMF A;  4HQZ A;  3GYK A;  4L0W A;  4NAX A;  5DDL A;  2GDR A;  1AAZ A;  1WP0 A;  1ST9 A;  5IMZ A;  3IC4 A;  1T8E B;  2FWH A;  2XBI A;  1U88 A;  4ML6 A;  3PPU A;  1TP9 A;  5KN1 A;  4GQC A;  1GNE A;  3GA4 A;  3IA1 A;  3HJM A;  2N5B A;  5IOX A;  2OKA A;  1JLV A;  5ECO B;  2R0P A;  1ZYE A;  2G0F A;  1OC9 A;  4YQM A;  2VAF A;  3RPP A;  1WWJ A;  3VWV A;  4OFM A;  1PKW A;  2R6K A;  3IPZ A;  2ALB A;  5LCZ A;  2IMI A;  4WBJ A;  1O7U A;  4OMV A;  4Q5R A;  4EKZ A;  4MJC A;  3VWX A;  3A2W A;  3MDK A;  5AIS A;  3W8S A;  3GMF A;  1UN2 A;  1NHY A;  4V2N A;  4MZB A;  1TI3 A;  1O8W A;  1OC9 B;  1U3A A;  1EGO A;  2V41 A;  2FA4 A;  1B48 A;  5J41 A;  5G1K A;  3L0H A;  5KN2 A;  1A0F A;  3GKK A;  4CDO A;  3WGE A;  4KSM A;  3BCK A;  1SD8 A;  3EUR A;  3G9B A;  3WT1 A;  4ZL7 A;  4H86 A;  1GUL A;  2HT9 A;  1V2A A;  2GZY A;  1R7H A;  3UOM A;  1ZGN A;  3KEB A;  3TKP A;  2O87 A;  3CBU A;  1UC7 A;  2YWI A;  4XHM A;  4J2F A;  2I4A A;  1FVK A;  2CX3 A;  2O7K A;  2YPM A;  2VUP A;  1Z6M A;  4E8E A;  1WOU A;  1GUH A;  3IK7 A;  3M3M A;  4HZ4 A;  1XW5 A;  1E2Y A;  2OE0 A;  4WKW A;  1EGR A;  3SBC A;  4G2E A;  3PR8 A;  2V6K A;  4HJ2 A;  2A2P A;  1PD2 1;  2DBC A;  3C7M A;  3LG6 A;  1TK8 B;  2DKI A;  3KZQ A;  2LKU A;  4P3Y B;  4I6X A;  2VCQ A;  2AYT A;  4PUR A;  2B5E A;  4O5R A;  2PU9 C;  2KP2 A;  3CTG A;  5IMV A;  5B8A A;  1NW2 A;  3K8N A;  4G9H A;  2E0Q A;  3QCP A;  2TIR A;  4N30 A;  4MNN A;  2JZT A;  2VLU A;  4OFT A;  4ZBB A;  3I69 A;  3IXR A;  3O3T A;  5CRG A;  4N10 A;  1SL1 B;  3WGD A;  2RUE A;  4FIW A;  5HFK A;  3QDN A;  4MPF A;  1W4V A;  5IMC A;  1TK5 B;  4QL9 A;  2B1K A;  4YQV A;  4TR4 A;  4CY8 A;  4HI7 A;  4OD7 A;  3HZ8 A;  1FW1 A;  3GHA A;  2R5G A;  3LQ7 A;  4I2U A;  1XBS A;  3QAW A;  4MZW A;  2TRX A;  5D8I A;  2J9H A;  3BBY A;  3DYR A;  13GS A;  3F6D A;  3F63 A;  3D0Z A;  1V40 A;  1G0T A;  1XWG A;  14GS A;  4IN0 A;  2GT6 A;  1Y6E A;  1B4P A;  5ELG A;  2R0G A;  6GSY A;  3VPT A;  2WCI A;  5ECQ B;  2RLI A;  4EC0 A;  1THX A;  3APS A;  1GSU A;  3L9U A;  2MMO A;  1B9X C;  5B6M A;  4PXO A;  1FB6 A;  1ACV A;  4IJI A;  2VOC A;  4PQ1 A;  4BL7 B;  2PUK C;  4MLY A;  2WJU A;  1ZYN A;  4MH3 A;  3LXT A;  1OC8 A;  4PQH A;  4O32 A;  4Q5N A;  1A8L A;  5JCU A;  2R3X A;  1T3B A;  4YAP A;  5IIZ A;  3HA9 A;  1H75 A;  3G7Y A;  2DJ3 A;  1OYJ A;  4HEA 2;  4POB A;  3CXG A;  2GTU A;  1NM3 A;  2MBT A;  3H93 A;  3TKS A;  3IV4 A;  1FVJ A;  18GS A;  1XWA A;  3TJF A;  4JE1 A;  6GSU A;  3ZFL A;  1Z9H A;  2PVO C;  1AIU A;  3HHV A;  3NOF A;  1FOH A;  1GSE A;  2CAI A;  2YJ7 A;  4E8H A;  3LEF A;  1VRS D;  4TW5 A;  4EIP A;  1MDK A;  2NTO A;  1BQ7 A;  2MMZ A;  3TUE A;  5HFI A;  3UJ1 A;  3U6V A;  2E2G A;  2FWE A;  5ELA A;  2WB9 A;  1F3B A;  1SKR B;  2CX4 A;  2YJH A;  1EZK A;  2MMN A;  3GN3 A;  1PA3 A;  5H5R A;  2H0G A;  2YV9 A;  3KMO A;  3FR9 A;  4WEY A;  2PPT A;  2HYX A;  4JBB A;  4F82 A;  3IOS A;  4XS6 A;  3QFA C;  5IM9 A;  1PQN A;  1A2M A;  5ECH B;  1XOB A;  4ILF A;  2FWF A;  2LQQ A;  1GLP A;  3LJR A;  4KH7 A;  1PGT A;  3N5O A;  5G31 A;  4D73 A;  1VF2 A;  2F51 A;  3VWU A;  3APQ A;  3TJK A;  1M3J A;  1AQV A;  2LNS A;  3PGT A;  1Z7R A;  4IQ1 A;  1XVW A;  1GL8 A;  5A5K A;  3KTB A;  2R0C A;  4MAB A;  5E59 A;  2DIZ A;  3ERF A;  1XWB A;  2XPE A;  4NV5 A;  3ZIT A;  4TN8 A;  3KIJ A;  2X64 A;  1OKT A;  1QMV A;  5KOX A;  3IDV A;  3KH9 A;  3C73 A;  2YAN A;  4K5S A;  3WD6 A;  2GT5 A;  4PUF C;  2KP1 A;  5GZZ B;  2H1D A;  5C04 A;  1K3O A;  3TRQ A;  2MYG A;  4J56 E;  3GL3 A;  3MSZ A;  5AN1 A;  1BJX A;  2HFD A;  4I2T A;  5COH A;  1GTI A;  1CQG A;  1JZR A;  3IC8 A;  5ECS A;  3WT2 A;  2L4Q A;  4HU9 A;  1K0D A;  5J3R A;  3GUR A;  3FR6 A;  1X0R A;  5GST A;  1GTU A;  4PUA A;  1N2A A;  3IK9 A;  2H76 A;  3FMW A;  1YEP A;  2XC2 A;  5G5F A;  2RII A;  2B7J A;  5H5Q A;  2GGT A;  2L6D A;  2R4V A;  3FKF A;  3IHQ A;  2FD3 A;  4KCE A;  2F8A A;  5G30 A;  4YAV A;  3D5J A;  5KOW A;  3M8N A;  1YQ1 A;  3FRC A;  2GQK A;  4OFN A;  3ZMK A;  4RQX A;  2KOK A;  3CRT A;  4KE3 A;  1PL1 A;  4LA1 A;  4NHW A;  1U87 A;  1JLW A;  1Q98 A;  2HRF A;  4MF7 A;  3U5R E;  3MAK A;  4EVM A;  4MZC A;  1QUW A;  4GWR A;  2HZE A;  1B8X A;  3ZYW A;  2YNX A;  4PQI A;  2NVL A;  3IR4 A;  3VUR A;  2JZR A;  1MDI A;  4FH8 A;  2NPB A;  2H71 A;  5ECK B;  4EXJ A;  5ABR A;  2AJQ B;  1BYE A;  1Z3E A;  4LMV A;  2D2Z A;  1FAA A;  1Z5Y E;  4MF6 A;  1F2E A;  3IAS 2;  4I8B A;  1XPV A;  2PER A;  4XS1 A;  2HZE B;  5INY A;  2X8C A;  4JU5 A;  5G1L A;  1O8X A;  4K2X A;  2B1L A;  1K0O A;  2CT6 A;  4EIQ A;  3LGC A;  1T00 A;  3ED3 A;  4TXO A;  4TR0 A;  4F2I A;  4RUV A;  1DUG A;  2LST A;  4KA0 A;  2C0F A;  2HXK A;  1R5A A;  3D4M A;  1SEN A;  2YP6 A;  5ID2 A;  4K9Z A;  2FHE A;  3TDG A;  1M99 A;  3TOU A;  4QL7 A;  4GF0 A;  2VM2 A;  4TXO B;  1SL0 B;  3US3 A;  4NHZ A;  5B7C A;  2EIQ A;  3TGZ A;  1WRY A;  1QXH A;  2H66 A;  1M0U A;  3F0I A;  2AV4 A;  4GSN A;  3GH6 A;  1XWK A;  5ID2 B;  4LL1 B;  3BOA A;  3P90 A;  3MYD A;  3APO A;  5A4V A;  2Z9S A;  1J08 A;  20GS A;  1PL2 A;  1S3A A;  4XCS A;  1M3I A;  2YWM A;  1PKZ A;  2GZZ A;  4DSS A;  3C1S A;  5CYY A;  3TKR A;  3KXO A;  1DBY A;  2IME A;  4FO5 A;  3EU4 A;  4EL1 A;  1RQM A;  1BAY A;  3C71 A;  1DSB A;  2BTO T;  1G7O A;  4MJA A;  4Z7X A;  5DAK B;  3A2X A;  1X5C A;  4V1A p;  4YH2 A;  2DC5 A;  4ZB8 A;  3OR5 A;  5D73 A;  3E0U A;  3KGK A;  1OE8 A;  4G0K A;  4DSS B;  1AW9 A;  5LNK e;  3VI5 A;  5C00 A;  5BMU A;  3UVH A;  1PMT A;  5J5N A;  4IVF A;  4EF0 A;  2C4J A;  2HRA A;  1PX7 A;  4F03 A;  1ZYP A;  5HR3 A;  1K0N A;  1R5P A;  5AGY A;  1EV4 A;  1SK2 A;  3LW9 A;  4KDU A;  1USB A;  2BMX A;  4WBR D;  1ON4 A;  3QMX A;  3RHB A;  1FHE A;  3FW2 A;  2V2G A;  5IMD A;  3M9J A;  4F0B A;  2OAC A;  3RDW A;  3LSZ A;  2I81 A;  1GWC A;  3TOT A;  4V2L A;  1ERT A;  3QAV A;  2HSH A;  1GNW A;  3FHK A;  5G2Z A;  5JWQ B;  2K6V A;  2WGR A;  1K0A A;  2OBI A;  4L0U A;  4X4J A;  4YQU A;  4ZL9 A;  2H0I A;  2O89 A;  5A4U A;  2A2S A;  4KDX A;  1I5G A;  5ECR B;  1AXD A;  5D9X A;  3F3Q A;  1VGL A;  3GFK A;  1PX6 A;  2MBS A;  2FGX A;  1QK8 A;  2QGV A;  4KF9 A;  4HOJ A;  3Q74 A;  2DJ2 A;  2VO4 A;  3UVT A;  5DQS A;  1XCC A;  4MK3 A;  3VWW A;  4USS A;  5IOW A;  1GSF A;  2L4C A;  7GSS A;  1EP7 A;  2LJR A;  3KD0 A;  2IMF A;  3GV1 A;  3UAP A;  6GSV A;  2CQ9 A;  3BJ5 A;  2LRT A;  2IMD A;  1HYU A;  3KH7 A;  2HE3 A;  2EIO A;  6GSX A;  4ACS A;  2XHF A;  3HZ4 A;  4CY6 A;  3FEU A;  4BPY A;  4DSR A;  3ERG A;  1F37 A;  2IFQ A;  2WZ9 A;  1MTC A;  2OE1 A;  1V9W A;  4KCA A;  5CNW A;  4NPB A;  1Q4J A;  5ECN B;  17GS A;  1TRS A;  5FWG A;  3DIE A;  1MD4 A;  2VCX A;  4WET A;  2XPD A;  10GS A;  4K5R A;  2O85 A;  2KUC A;  1X5E A;  1OC3 A;  4BA7 A; 
#chains in the Genus database with same CATH homology
 1GTA A;  6GSW A;  4RI6 A;  1VF3 A;  4CHS A;  2IFQ B;  3VI7 A;  5FHI A;  4OWY A;  1A24 A;  3GH9 A;  5HR1 A;  4K6X A;  2K9F A;  2BJX A;  4O5Q A;  4J57 E;  2JAD A;  3MWH A;  3GIX A;  1MD3 A;  1YY7 A;  4K0N A;  2VLV A;  3M1G A;  1JZW A;  3L78 A;  2UZ8 A;  3GTU B;  4I97 A;  1TK0 B;  2V32 A;  2HI7 A;  1JHB A;  4BL7 A;  4PGT A;  3GSS A;  2IL3 A;  1TTZ A;  4ZXG A;  2LUS A;  1W89 A;  22GS A;  2OE3 A;  5ECI B;  1TOF A;  2H8L A;  2JSZ A;  1FG4 A;  1YDK A;  3KM6 A;  3UAR A;  2H19 A;  4MCU A;  1O73 A;  2ZCT A;  1X9S B;  4K2D A;  5DAL A;  5F8B A;  3TRX A;  2L5L A;  3MIX A;  1JFU A;  3A3T A;  3CTF A;  1UA5 A;  2TRC P;  5F0G A;  3HKR A;  3SWL A;  2DML A;  2H1A A;  5J9C A;  2ON5 A;  4DVC A;  1YKA A;  3IE3 A;  2F3M A;  4ZIL A;  1GP1 A;  1TI1 A;  3ZIV A;  3EYT A;  1GSQ A;  2DIY A;  3F6F A;  1A8Y A;  5DAL B;  1O81 A;  1EEM A;  4POK A;  1F6M C;  3WGX A;  4ECJ A;  4ICY A;  4KGI A;  2I3Y A;  2OBK A;  3HD5 A;  3CRU A;  4TOP A;  1XW9 A;  2HRN A;  3TKQ A;  4TXV A;  4KB3 A;  2FNO A;  3D21 A;  4KX4 A;  2JSY A;  4YKG A;  2YV7 A;  3M0F A;  4G19 A;  4IBP A;  4JR4 A;  3IRA A;  5HR0 A;  5ECL B;  2JAC A;  5AIV A;  4OCE A;  3EC3 A;  5DCH A;  2AHE A;  3QR6 A;  3M9K A;  3DWV A;  2GQL A;  4WF5 A;  1TXX A;  4AJ8 A;  2VCV A;  4ZBD A;  4V2M A;  2C1Y A;  4CW9 A;  4JR6 A;  2CVK A;  3ZFB A;  1ZYQ B;  4ZB9 A;  1ML6 A;  3Q18 A;  3LYK A;  3MNG A;  3P2A A;  3QOU A;  3FZA A;  4DSQ A;  2C80 A;  2WRT A;  3ERW A;  2GZP A;  2H01 A;  3EWL A;  4XRD A;  4ECI A;  3H4K A;  1KEB A;  4HU7 A;  3TKS E;  3Q6O A;  5CRD A;  1WIK A;  2FA8 A;  2QSI A;  1S3C A;  1Z7P A;  5JCG A;  1HQO A;  4MP4 A;  4Z2R A;  4QQ7 A;  4KAE A;  3R2Q A;  3F4S A;  3W6G A;  4MMM A;  3IBH A;  1MEK A;  4X1U A;  5GSS A;  4K7I A;  4LL4 B;  2H72 A;  2F8F A;  4L5L A;  5EL8 A;  2K8V A;  2P0G A;  16GS A;  2FY6 A;  1H4O A;  4F9Z A;  3EIN A;  1TW9 A;  2JL4 A;  5DVB A;  3F3R A;  4O92 A;  2X4A A;  3KTL A;  5DJM A;  2H6X A;  5IMA A;  3J7Y k;  1KTE A;  4POM A;  1O85 A;  2RUF A;  3C8E A;  1XFL A;  3TJG A;  3R3E A;  2K8S A;  3GX8 A;  4G0I A;  1M9A A;  2VL2 C;  3GRX A;  2FUG 2;  2YOI A;  1ERV A;  4XTS A;  1LBK A;  2EC4 A;  3FZ5 A;  2M72 A;  2I9H A;  4NXI A;  2GST A;  2JZS A;  1YF1 A;  9GSS A;  5G5E A;  2ZNM A;  2ZUP A;  2VM1 A;  2PWJ A;  2L57 A;  1DE2 A;  2K18 A;  1N8J A;  5D93 A;  2DKH A;  3ZTL A;  4IW9 A;  2FLS A;  1C72 A;  1ABA A;  3J7Y b;  3UMA A;  5KN3 A;  4MH2 A;  5ENU A;  1SK1 A;  4ULX A;  1VF1 A;  4AJ6 A;  1XVQ A;  5JWR B;  3DML A;  2IIY A;  2CVD A;  1TRU A;  3LOR A;  5KEJ A;  5EPF A;  1SJI A;  2HSY A;  5ECM B;  2PVQ A;  1SYR A;  2B6M A;  2LJK A;  2H1G A;  1T4Z A;  5KN0 A;  2NDO A;  3EVI A;  3VK9 A;  3H8Q A;  1UVZ A;  2C3Q A;  3NZN A;  4ID0 A;  2M80 A;  2JU5 A;  3WYW A;  1X5D A;  1BED A;  2KHP A;  2E2M A;  1G6Y A;  2GQM A;  2CAQ A;  4IGJ A;  1GUM A;  2DJJ A;  1B9Y C;  1SKS B;  1EOH A;  3L4N A;  3UL3 A;  3TKS C;  2HRK A;  1M9B A;  3G7J A;  1I9D A;  2X49 A;  2VCT A;  5E4W A;  3D4T A;  2FWG A;  1F9M A;  1SU9 A;  2FCH A;  3GX0 A;  1YJ6 A;  1A2L A;  4IP6 A;  2H74 A;  3DVW A;  3I9V 2;  3VPQ A;  1J9B A;  1U3I A;  1V58 A;  3TJB A;  1ZZY A;  2PBJ A;  1PN9 A;  4BVY A;  2A4V A;  3LXZ A;  2YWO A;  1O6J A;  2H6Z A;  5DAK A;  4Q5Q A;  1TRV A;  3KMN A;  1QFN A;  4K1F A;  5D9V A;  2QA2 A;  6GSS A;  3EPT A;  2AUV A;  4K7O A;  4GRF A;  4WR4 A;  4Z2T A;  1VF4 A;  3AY8 A;  2IPA A;  4HJM A;  3HXS A;  5EY6 A;  4BVY B;  3N9J A;  2DJK A;  2OJL A;  5GAN D;  2L6C A;  1TRW A;  3TB2 A;  4OO4 A;  3DEX A;  1PN0 A;  3HCZ A;  1AQW A;  4I5Q A;  1FO5 A;  2G2Q A;  4MJE A;  3CSI A;  3ZL5 A;  4JZQ A;  1THO A;  5EVO A;  1EP8 A;  3F8U A;  2CVB A;  4G0L A;  1GUK A;  4L5O A;  3EE2 A;  4O7H A;  3CSJ A;  1HNC A;  1T1V A;  2P5R A;  3EU3 A;  1XIY A;  4ZBA A;  2REM A;  3ZRE A;  1HNA A;  5AIX A;  2H6Y A;  1T7P B;  1A2J A;  1XWC A;  2I1U A;  6GST A;  2AAW A;  5B6N A;  4X43 A;  4RQR A;  5D96 A;  1ZOF A;  3Q19 A;  1A23 A;  1SKW B;  3FZ9 A;  3G7I A;  4NV2 A;  4K8M A;  2RM6 A;  3KCM A;  5ECP B;  3UEM A;  1FOV A;  2H0H A;  2R37 A;  4HQS A;  4PNG A;  3UBL A;  2X8H A;  1WMJ A;  1YF0 A;  3PH9 A;  4MPG A;  1X9W B;  2QKE A;  2PGT A;  2V1M A;  3LFL A;  2OA7 A;  4IS0 A;  4IQA A;  4FYU A;  3VFI A;  4WR5 A;  3EMP A;  1M2D A;  3ME7 A;  4PX1 A;  3O6T A;  4N0Z A;  2H75 A;  3LYP A;  1WJK A;  2LS5 A;  1TU8 A;  1ZMA A;  3DKS A;  2EIR A;  1LU4 A;  2KLX A;  3ZVJ D;  2IWT A;  1M7T A;  4PNF A;  1U6T A;  4V1A g;  3QFB C;  5A4W A;  3EMX A;  4LMW A;  3S9F A;  2DMM A;  1T4Y A;  4EO3 A;  2F9S A;  5J4U A;  3A2V A;  3GKX A;  1CQH A;  4N11 A;  5GAP D;  4MA9 A;  2NBS A;  2GSQ A;  2C3T A;  3RHC A;  4K0G A;  4TKY A;  3GTU A;  3FK8 A;  1YEX A;  4IP1 A;  1NSW A;  4GTU A;  4AGS A;  3L9S A;  1K0C A;  3FY7 A;  3JCM L;  3LWA A;  2B5X A;  2WFC A;  3ZRD A;  1EWX A;  4G10 A;  2VL2 A;  2L59 A;  1YZX A;  4XS4 A;  2LNT A;  3KP9 A;  1EV9 A;  2DSA A;  1ERU A;  3DD3 A;  4KW6 A;  4AF2 A;  3H79 A;  2H70 A;  3UIW A;  4FYB A;  2QC7 A;  3W8J A;  4GCI A;  4OO5 A;  4GQF A;  3FZ4 A;  1OKD A;  5HR2 A;  2IJY A;  2QA1 A;  1URM A;  4O5U A;  1GSS A;  5JCW A;  3CSH A;  2E7P A;  4XS4 B;  1BG5 A;  5DQY A;  4MJB A;  1XOA A;  3KJY A;  4HUA A;  1SL2 B;  4IEL A;  4MDC A;  2H30 A;  2YZU A;  5J9B A;  3C1R A;  3UBK A;  5DJL A;  1TDI A;  2GS3 A;  1XZO A;  2VCW A;  2X8G A;  4EDY A;  2C0D A;  4YKF A;  1GRX A;  2J23 A;  3QD9 A;  2LEG A;  4TR3 A;  5JWO B;  3HJP A;  3H1N A;  2PN8 A;  1J0F A;  1JZO A;  2CV4 A;  3F4R A;  5F05 A;  4GST A;  4ECC A;  3I6A A;  2O8V B;  2H1B A;  1YKC A;  2DJ0 A;  4BWQ A;  3TCO A;  4ZL8 A;  3ZML A;  2R2J A;  2B5Y A;  4POL A;  2AB6 A;  1ERW A;  4Z2U A;  4L8E A;  5H5S A;  3IAM 2;  19GS A;  1XW6 A;  1AUC A;  3IHG A;  1XXU A;  4GSS A;  11GS A;  1KBN A;  5IQY A;  2GSR A;  1A0R P;  3RBT A;  3TRP A;  2YWN A;  4EUY A;  1SYX A;  2P31 A;  2XBQ A;  1SD9 A;  3ZLP A;  5IPH A;  3HDC A;  3DGQ A;  1TJD A;  2HZF A;  3BD2 A;  4XRA A;  5CRW A;  2CZ3 A;  1OE7 A;  1ZL9 A;  4KND A;  3PIN A;  1GLQ A;  1WPI A;  3D22 A;  5HFG A;  4EDZ A;  4Q5F A;  2V6O A;  3FR3 A;  1S3D A;  2MMA A;  1OVN A;  1PRX A;  4LLR A;  2WUL A;  2VCZ A;  1M2A A;  4DEJ A;  2LQO A;  2P5Q A;  2VD0 A;  1AC1 A;  3P7X A;  4HZ2 A;  2IMK A;  3A5W A;  1ZCP A;  5D9W A;  5IPG A;  3HVV A;  3CYN A;  1MDJ A;  2LRN A;  4BWS A;  2ON7 A;  3RPN A;  5IO2 A;  2YCD A;  1QGV A;  5CAX A;  2ES7 A;  3FYG A;  4IKH A;  3ISO A;  2LTK A;  1B4Q A;  1SK0 A;  1DE1 A;  3DRN A;  3O76 A;  5CRE A;  4EE0 A;  3QPM A;  3GKM A;  2PMT A;  2LJA A;  1NHO A;  1K3L A;  2GVP A;  5D9T A;  2C8U A;  3CMI A;  4GXZ A;  4D73 B;  3KP8 A;  1HD2 A;  3ZZX A;  1V98 A;  2A2R A;  1GH2 A;  1IYH A;  2HLS A;  2C0G A;  4KSO A;  3GST A;  1TU7 A;  2CZ2 A;  2A4H A;  4ML1 A;  2N5A A;  3QAG A;  1Y25 A;  4F0C A;  1V57 A;  1LJR A;  2YZH A;  1GTB A;  2HNL A;  3GUS A;  3I43 A;  4ECB A;  4HS1 A;  5HQP A;  1HNB A;  1WE0 A;  4IHU A;  1RW1 A;  8GSS A;  2N5F A;  1EEJ A;  4MF5 A;  5B8B A;  3GNJ A;  1EOG A;  2M46 A;  2C0E A;  4OCF A;  4ZB6 A;  4RI7 A;  1TKD B;  1RK4 A;  4PTS A;  1K3Y A;  1Z6N A;  4JRR A;  3L9V A;  3GKN A;  1PSQ A;  2H73 A;  3DVX A;  3F4T A;  4NMU A;  1JZD A;  4WF4 A;  4KUN A;  4XIH A;  1FB0 A;  4TVE A;  2VD1 A;  3RAZ A;  5FT3 A;  5CP1 A;  3P8W A;  1M2B A;  2LRC A;  3V1W A;  1OAZ A;  2HSM A;  2MZC A;  2B7K A;  1G6W A;  3HYP A;  4IJ3 A;  5DBQ A;  4ISD A;  3A5I A;  1SJZ A;  2RM5 A;  4K7N A;  2YN1 A;  1BX9 A;  3ZIJ A;  3VLN A;  4TR1 A;  2VIM A;  4KDY A;  3NIV A;  3HVX A;  4WXT A;  3E3E A;  2IN3 A;  5BRT A;  2DJ1 A;  4AJ7 A;  4GLT A;  5CO3 A;  5L71 A;  3BCI A;  2GLR A;  3TJJ A;  1GSD A;  4FYC A;  1X9M B;  1KNG A;  12GS A;  2C3N A;  4JED A;  1R26 A;  2B3S A;  4TR1 B;  5CRH A;  5F07 A;  2LV3 A;  3F9U A;  4NWY A;  1E6B A;  5DCG A;  1K0B A;  3D6I A;  5LD0 A;  1AQX A;  2CA8 A;  5IO0 A;  2VL9 A;  4FQU A;  3HY2 A;  3HJO A;  4BVX A;  4HDE A;  3ZVJ A;  4N0V A;  2OAD A;  4A5P A;  3DXB A;  1G7E A;  1QQ2 A;  1ILO A;  5F06 A;  2VLT A;  2VL3 A;  3ME8 A;  3GL5 A;  4X0X A;  1IYI A;  3HVS A;  2WS2 A;  2DLX A;  4TRX A;  1R4W A;  4BVX B;  1K0M A;  1GSY A;  2GSS A;  2WDU A;  1F3A A;  2L5O A;  3E9J B;  1SJ6 A;  4ZIJ A;  2X99 A;  5IMF A;  4HQZ A;  3GYK A;  4L0W A;  4NAX A;  5DDL A;  2GDR A;  1AAZ A;  1WP0 A;  1ST9 A;  5IMZ A;  3IC4 A;  1T8E B;  2FWH A;  2XBI A;  1U88 A;  4ML6 A;  3PPU A;  1TP9 A;  5KN1 A;  4GQC A;  1GNE A;  3GA4 A;  3IA1 A;  3HJM A;  2N5B A;  5IOX A;  2OKA A;  1JLV A;  5ECO B;  2R0P A;  1ZYE A;  2G0F A;  1OC9 A;  4YQM A;  2VAF A;  3RPP A;  1WWJ A;  3VWV A;  4OFM A;  1PKW A;  2R6K A;  3IPZ A;  2ALB A;  5LCZ A;  2IMI A;  4WBJ A;  1O7U A;  4OMV A;  4Q5R A;  4EKZ A;  4MJC A;  3VWX A;  3A2W A;  3MDK A;  5AIS A;  3W8S A;  3GMF A;  1UN2 A;  1NHY A;  4V2N A;  4MZB A;  1TI3 A;  1O8W A;  1OC9 B;  1U3A A;  1EGO A;  2V41 A;  2FA4 A;  1B48 A;  5J41 A;  5G1K A;  3L0H A;  5KN2 A;  1A0F A;  3GKK A;  4CDO A;  3WGE A;  4KSM A;  3BCK A;  1SD8 A;  3EUR A;  3G9B A;  3WT1 A;  4ZL7 A;  4H86 A;  1GUL A;  2HT9 A;  1V2A A;  2GZY A;  1R7H A;  3UOM A;  1ZGN A;  3KEB A;  3TKP A;  2O87 A;  3CBU A;  1UC7 A;  2YWI A;  4XHM A;  4J2F A;  2I4A A;  1FVK A;  2CX3 A;  2O7K A;  2YPM A;  2VUP A;  1Z6M A;  4E8E A;  1WOU A;  1GUH A;  3IK7 A;  3M3M A;  4HZ4 A;  1XW5 A;  1E2Y A;  2OE0 A;  4WKW A;  1EGR A;  3SBC A;  4G2E A;  3PR8 A;  2V6K A;  4HJ2 A;  2A2P A;  1PD2 1;  2DBC A;  3C7M A;  3LG6 A;  1TK8 B;  2DKI A;  3KZQ A;  2LKU A;  4P3Y B;  4I6X A;  2VCQ A;  2AYT A;  4PUR A;  2B5E A;  4O5R A;  2PU9 C;  2KP2 A;  3CTG A;  5IMV A;  5B8A A;  1NW2 A;  3K8N A;  4G9H A;  2E0Q A;  3QCP A;  2TIR A;  4N30 A;  4MNN A;  2JZT A;  2VLU A;  4OFT A;  4ZBB A;  3I69 A;  3IXR A;  3O3T A;  5CRG A;  4N10 A;  1SL1 B;  3WGD A;  2RUE A;  4FIW A;  5HFK A;  3QDN A;  4MPF A;  1W4V A;  5IMC A;  1TK5 B;  4QL9 A;  2B1K A;  4YQV A;  4TR4 A;  4CY8 A;  4HI7 A;  4OD7 A;  3HZ8 A;  1FW1 A;  3GHA A;  2R5G A;  3LQ7 A;  4I2U A;  1XBS A;  3QAW A;  4MZW A;  2TRX A;  5D8I A;  2J9H A;  3BBY A;  3DYR A;  13GS A;  3F6D A;  3F63 A;  3D0Z A;  1V40 A;  1G0T A;  1XWG A;  14GS A;  4IN0 A;  2GT6 A;  1Y6E A;  1B4P A;  5ELG A;  2R0G A;  6GSY A;  3VPT A;  2WCI A;  5ECQ B;  2RLI A;  4EC0 A;  1THX A;  3APS A;  1GSU A;  3L9U A;  2MMO A;  1B9X C;  5B6M A;  4PXO A;  1FB6 A;  1ACV A;  4IJI A;  2VOC A;  4PQ1 A;  4BL7 B;  2PUK C;  4MLY A;  2WJU A;  1ZYN A;  4MH3 A;  3LXT A;  1OC8 A;  4PQH A;  4O32 A;  4Q5N A;  1A8L A;  5JCU A;  2R3X A;  1T3B A;  4YAP A;  5IIZ A;  3HA9 A;  1H75 A;  3G7Y A;  2DJ3 A;  1OYJ A;  4HEA 2;  4POB A;  3CXG A;  2GTU A;  1NM3 A;  2MBT A;  3H93 A;  3TKS A;  3IV4 A;  1FVJ A;  18GS A;  1XWA A;  3TJF A;  4JE1 A;  6GSU A;  3ZFL A;  1Z9H A;  2PVO C;  1AIU A;  3HHV A;  3NOF A;  1FOH A;  1GSE A;  2CAI A;  2YJ7 A;  4E8H A;  3LEF A;  1VRS D;  4TW5 A;  4EIP A;  1MDK A;  2NTO A;  1BQ7 A;  2MMZ A;  3TUE A;  5HFI A;  3UJ1 A;  3U6V A;  2E2G A;  2FWE A;  5ELA A;  2WB9 A;  1F3B A;  1SKR B;  2CX4 A;  2YJH A;  1EZK A;  2MMN A;  3GN3 A;  1PA3 A;  5H5R A;  2H0G A;  2YV9 A;  3KMO A;  3FR9 A;  4WEY A;  2PPT A;  2HYX A;  4JBB A;  4F82 A;  3IOS A;  4XS6 A;  3QFA C;  5IM9 A;  1PQN A;  1A2M A;  5ECH B;  1XOB A;  4ILF A;  2FWF A;  2LQQ A;  1GLP A;  3LJR A;  4KH7 A;  1PGT A;  3N5O A;  5G31 A;  4D73 A;  1VF2 A;  2F51 A;  3VWU A;  3APQ A;  3TJK A;  1AQV A;  2LNS A;  3PGT A;  1Z7R A;  4IQ1 A;  1XVW A;  1GL8 A;  5A5K A;  3KTB A;  2R0C A;  4MAB A;  5E59 A;  2DIZ A;  3ERF A;  1XWB A;  2XPE A;  4NV5 A;  3ZIT A;  4TN8 A;  3KIJ A;  2X64 A;  1OKT A;  1QMV A;  5KOX A;  3IDV A;  3KH9 A;  3C73 A;  2YAN A;  4K5S A;  3WD6 A;  2GT5 A;  4PUF C;  2KP1 A;  5GZZ B;  2H1D A;  5C04 A;  1K3O A;  3TRQ A;  2MYG A;  4J56 E;  3GL3 A;  3MSZ A;  5AN1 A;  1BJX A;  2HFD A;  4I2T A;  5COH A;  1GTI A;  1CQG A;  1JZR A;  3IC8 A;  5ECS A;  3WT2 A;  2L4Q A;  4HU9 A;  1K0D A;  5J3R A;  3GUR A;  3FR6 A;  1X0R A;  5GST A;  1GTU A;  4PUA A;  1N2A A;  3IK9 A;  2H76 A;  3FMW A;  1YEP A;  2XC2 A;  5G5F A;  2RII A;  2B7J A;  5H5Q A;  2GGT A;  2L6D A;  2R4V A;  3FKF A;  3IHQ A;  2FD3 A;  4KCE A;  2F8A A;  5G30 A;  4YAV A;  3D5J A;  5KOW A;  3M8N A;  1YQ1 A;  3FRC A;  2GQK A;  4OFN A;  3ZMK A;  4RQX A;  2KOK A;  3CRT A;  4KE3 A;  1PL1 A;  4LA1 A;  4NHW A;  1U87 A;  1JLW A;  1Q98 A;  2HRF A;  4MF7 A;  3U5R E;  3MAK A;  4EVM A;  4MZC A;  1QUW A;  4GWR A;  2HZE A;  1B8X A;  3ZYW A;  2YNX A;  4PQI A;  2NVL A;  3IR4 A;  3VUR A;  2JZR A;  1MDI A;  4FH8 A;  2NPB A;  2H71 A;  5ECK B;  4EXJ A;  5ABR A;  2AJQ B;  1BYE A;  1Z3E A;  4LMV A;  2D2Z A;  1FAA A;  1Z5Y E;  4MF6 A;  1F2E A;  3IAS 2;  4I8B A;  1XPV A;  2PER A;  4XS1 A;  2HZE B;  5INY A;  2X8C A;  4JU5 A;  5G1L A;  1O8X A;  4K2X A;  2B1L A;  1K0O A;  2CT6 A;  4EIQ A;  3LGC A;  1T00 A;  3ED3 A;  4TXO A;  4TR0 A;  4F2I A;  4RUV A;  1DUG A;  2LST A;  4KA0 A;  2C0F A;  2HXK A;  1R5A A;  3D4M A;  1SEN A;  2YP6 A;  5ID2 A;  4K9Z A;  2FHE A;  3TDG A;  1M99 A;  3TOU A;  4QL7 A;  4GF0 A;  2VM2 A;  4TXO B;  1SL0 B;  3US3 A;  4NHZ A;  5B7C A;  2EIQ A;  3TGZ A;  1WRY A;  1QXH A;  2H66 A;  1M0U A;  3F0I A;  2AV4 A;  4GSN A;  3GH6 A;  1XWK A;  5ID2 B;  4LL1 B;  3BOA A;  3P90 A;  3MYD A;  3APO A;  5A4V A;  2Z9S A;  1J08 A;  20GS A;  1PL2 A;  1S3A A;  4XCS A;  2YWM A;  1PKZ A;  2GZZ A;  4DSS A;  3C1S A;  5CYY A;  3TKR A;  3KXO A;  1DBY A;  2IME A;  4FO5 A;  3EU4 A;  4EL1 A;  1RQM A;  1BAY A;  3C71 A;  1DSB A;  2BTO T;  1G7O A;  4MJA A;  4Z7X A;  5DAK B;  3A2X A;  1X5C A;  4V1A p;  4YH2 A;  2DC5 A;  4ZB8 A;  3OR5 A;  5D73 A;  3E0U A;  3KGK A;  1OE8 A;  4G0K A;  4DSS B;  1AW9 A;  5LNK e;  3VI5 A;  5C00 A;  5BMU A;  3UVH A;  1PMT A;  5J5N A;  4IVF A;  4EF0 A;  2C4J A;  2HRA A;  1PX7 A;  4F03 A;  1ZYP A;  5HR3 A;  1K0N A;  1R5P A;  5AGY A;  1EV4 A;  1SK2 A;  3LW9 A;  4KDU A;  1USB A;  2BMX A;  4WBR D;  1ON4 A;  3QMX A;  3RHB A;  1FHE A;  3FW2 A;  2V2G A;  5IMD A;  3M9J A;  4F0B A;  2OAC A;  3RDW A;  3LSZ A;  2I81 A;  1GWC A;  3TOT A;  4V2L A;  1ERT A;  3QAV A;  2HSH A;  1GNW A;  3FHK A;  5G2Z A;  5JWQ B;  2K6V A;  2WGR A;  1K0A A;  2OBI A;  4L0U A;  4X4J A;  4YQU A;  4ZL9 A;  2H0I A;  2O89 A;  5A4U A;  2A2S A;  4KDX A;  1I5G A;  5ECR B;  1AXD A;  5D9X A;  3F3Q A;  1VGL A;  3GFK A;  1PX6 A;  2MBS A;  2FGX A;  1QK8 A;  2QGV A;  4KF9 A;  4HOJ A;  3Q74 A;  2DJ2 A;  2VO4 A;  3UVT A;  5DQS A;  1XCC A;  4MK3 A;  3VWW A;  4USS A;  5IOW A;  1GSF A;  2L4C A;  7GSS A;  1EP7 A;  2LJR A;  3KD0 A;  2IMF A;  3GV1 A;  3UAP A;  6GSV A;  2CQ9 A;  3BJ5 A;  2LRT A;  2IMD A;  1HYU A;  3KH7 A;  2HE3 A;  2EIO A;  6GSX A;  4ACS A;  2XHF A;  3HZ4 A;  4CY6 A;  3FEU A;  4BPY A;  4DSR A;  3ERG A;  1F37 A;  2IFQ A;  2WZ9 A;  1MTC A;  2OE1 A;  1V9W A;  4KCA A;  5CNW A;  4NPB A;  1Q4J A;  5ECN B;  17GS A;  1TRS A;  5FWG A;  3DIE A;  1MD4 A;  2VCX A;  2XPD A;  4WET A;  10GS A;  4K5R A;  2O85 A;  2KUC A;  1X5E A;  1OC3 A;  4BA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...