4GWRA

Crystal structure of the second catalytic domain of protein disulfide isomerase p5
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
112
structure length
112
Chain Sequence
DVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords Protein disulfide-isomerase A6
publication title To be published
rcsb
source organism Homo sapiens
total genus 37
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4gwrA00
5G30A 5CRDA 2B7JA 5F06A 2FWHA 3ZZXA 5CP1A 4EE0A 2K8SA 4MZWA 1ZL9A 4KSMA 2YOIA 13GSA 3EURA 4POKA 1OAZA 3UJ1A 1Q4JA 1LU4A 1GLQA 5CRHA 3C73A 4TXOB 3WT1A 2B5XA 3O6TA 1XW5A 4D73A 4YQVA 1U3IA 3MWHA 2LTKA 5J3RA 4GLTA 1Z5YE 3O3TA 4K1FA 2LUSA 2AJQB 4EUYA 3Q19A 4GTUA 2IN3A 2N5FA 5AIXA 1A8LA 4K7NA 3E0UA 5C04A 3ZMLA 4PQ1A 5ENUA 3TGZA 4XS6A 3FR9A 1DUGA 2GZPA 2QGVA 1U87A 2XPDA 1Q98A 1O73A 2OE1A 3HCZA 3SBCA 4NHWA 3E3EA 1HNBA 1EV9A 4YQUA 5F0GA 3PINA 3BJ5A 4PNGA 1W4VA 17GSA 4ID0A 5B8AA 5DCGA 2JACA 2YCDA 1NHYA 2NVLA 3J7Yk 2B5YA 4Q5FA 2LS5A 4ZB8A 3IA1A 3H79A 2IFQA 3CTGA 1WP0A 3D21A 3E9JB 2CAQA 2CZ3A 1ZYEA 2YWNA 5FHIA 1U88A 2G0FA 2HZEA 3CTFA 4HS1A 1SU9A 4I6XA 3FZ4A 2O87A 2K18A 4LMWA 4IQAA 3HY2A 4QL7A 1ML6A 3HZ4A 4KX4A 3IOSA 4EO3A 5AIVA 3ME8A 2L57A 1YEXA 5CO3A 3CSJA 4PURA 1RQMA 2C4JA 3F63A 2JZSA 1FOVA 4TR0A 2HZFA 3CSHA 3QFAC 3RAZA 3KZQA 1EOGA 4YAPA 1JZOA 3ERWA 4ZL9A 3QR6A 3LGCA 5GAND 2VM2A 3L4NA 3VPQA 3HVSA 1CQHA 1OC3A 2LRCA 3RDWA 1A2MA 4V2LA 1F9MA 2FNOA 1M2BA 1TI1A 4IQ1A 2H6XA 1K3LA 4HU9A 1B4PA 2HLSA 1O8XA 4JBBA 1PKZA 1HQOA 1GNWA 2B7KA 2LNSA 4ML1A 1PGTA 4L0UA 5E4WA 4J56E 2PWJA 4AGSA 1TRSA 2DJJA 4GSNA 4DEJA 4IJ3A 2G2QA 2B1KA 4EDYA 5JCGA 3P7XA 5ECOB 5IMDA 5HFKA 4XS4A 3WYWA 3GTUA 1K0AA 1XOBA 1SD8A 2HSHA 2MBSA 3I9V2 5D73A 1XPVA 3GSSA 2F8FA 2R6KA 1QMVA 2K8VA 3S9FA 1V98A 5ECMB 5LNKe 1HYUA 3A3TA 1GSYA 4XS1A 3WD6A 8GSSA 4G9HA 4GSTA 4GF0A 4RI6A 4KGIA 2O8VB 1G7OA 2VD1A 4IGJA 3FHKA 3APQA 3KH9A 1O81A 2IMIA 3VI5A 3G9BA 1QFNA 5COHA 1LJRA 5DBQA 4MF6A 3Q74A 1SL2B 3HJOA 1WE0A 3IXRA 1JZRA 1G0TA 4JEDA 12GSA 3QMXA 2LRNA 3MSZA 5F05A 4AJ8A 3DVXA 1TW9A 2H1BA 3EMPA 3LSZA 2H71A 4GWRA 3NZNA 1KNGA 1TRWA 2YZUA 1WOUA 3FR3A 1JHBA 1EWXA 1XZOA 2IPAA 5GSSA 3EVIA 4NMUA 2PU9C 1Z6MA 3QCPA 2ON7A 4KA0A 2H70A 1EEMA 1THXA 1XWBA 6GSYA 4MF7A 4PQHA 1X5EA 1FHEA 1PSQA 1FB0A 3PR8A 3GH9A 2P5RA 5AISA 1M0UA 4NHZA 4YH2A 5J4UA 2P31A 1TU7A 2FGXA 2LKUA 4WEYA 2GSRA 3G7YA 3D4MA 2HI7A 1BQ7A 4L5OA 2X8CA 2CT6A 2OBIA 4WR5A 4WBRD 4V1Ap 1EP8A 2FCHA 2L4CA 1F3BA 1V9WA 4F9ZA 2VAFA 4PUFC 2A2SA 4ZL7A 5D9XA 4F82A 1X9WB 2B1LA 2H0IA 3J7Yb 1WWJA 1Z3EA 1SJZA 1ERWA 4CW9A 4P3YB 2FUG2 4PXOA 4ILFA 2LJKA 1FW1A 4O92A 1SL1B 6GSTA 4AF2A 1GUHA 1N2AA 4ECJA 2LSTA 4WF5A 2GT5A 4ECCA 2CVBA 3L9VA 2I9HA 3KMOA 4J57E 3KTLA 3LWAA 4GCIA 4MH2A 2YPMA 2VL2C 4BWQA 4POMA 1KEBA 2VLTA 1PRXA 4JRRA 4RQXA 1GSFA 5J9CA 22GSA 2R3XA 2GDRA 4TRXA 5D96A 4HZ4A 2VIMA 2GS3A 4OFNA 3GMFA 1DSBA 2OACA 1GNEA 4E8EA 4HQZA 4DSSB 5G1LA 1V40A 1XOAA 1I9DA 3ZYWA 4DSRA 2OA7A 4KDUA 3DGQA 2K6VA 3RHBA 3GHAA 3VLNA 2LRTA 1XFLA 4IN0A 3TJKA 1UC7A 4OMVA 3DD3A 4GQFA 1TU8A 4ZL8A 1BYEA 2DMLA 5AGYA 2V6KA 2XC2A 3HD5A 2HRFA 4MJEA 2F3MA 3IC4A 1PQNA 1YF0A 4IVFA 4TR1A 2DLXA 1QXHA 3VWVA 3M9JA 4MZCA 4HJMA 3TRXA 3R2QA 5J5NA 2VM1A 5EPFA 3LJRA 3FR6A 2CZ2A 2LV3A 3LQ7A 1B48A 3HVXA 3FK8A 2AV4A 1YF1A 1LBKA 2ES7A 3DMLA 3Q18A 3KM6A 5EL8A 1AAZA 3CYNA 3UIWA 3VK9A 2H19A 2I4AA 3TKQA 2H74A 5DJLA 3D0ZA 5IIZA 3TJJA 4BA7A 2B6MA 3TDGA 4OCEA 3ZREA 4KE3A 1T1VA 4I2TA 5CRWA 1K0NA 2YNXA 4PUAA 3H93A 3TRQA 4POBA 1BAYA 1W89A 4OO4A 1OE7A 2ZCTA 3HKRA 2I81A 5HQPA 1ZGNA 2GQMA 20GSA 1XXUA 3GKMA 2N5AA 4LLRA 1ERUA 3EWLA 2V41A 3DWVA 1PKWA 2YV7A 3V1WA 2MZCA 3FZAA 1R26A 4D73B 2RM5A 1E6BA 2L4QA 1PL1A 1RK4A 2IIYA 3QFBC 1PX6A 2L59A 1GSUA 4TN8A 3U5RE 1K0MA 1K0OA 3IHQA 3IV4A 2PBJA 1Z6NA 2YZHA 4NAXA 4KNDA 2CAIA 5IQYA 4FO5A 1V57A 4ZBBA 3P8WA 1GWCA 3TOTA 5KEJA 3L9UA 5IMVA 1AIUA 3NOFA 3P2AA 3CMIA 1M9BA 2X99A 1MDKA 2GSSA 4KB3A 5C00A 1A0FA 4TOPA 4ML6A 1MDIA 2YN1A 1UA5A 3FZ5A 4G2EA 2H0GA 5A4UA 2KP2A 1CQGA 1EGOA 3HJPA 2PUKC 2HXKA 2IFQB 3OR5A 2V2GA 1VGLA 2DC5A 2QSIA 2DJ2A 1QGVA 5ECLB 2HZEB 3GRXA 3GSTA 5ABRA 4FYUA 4N0VA 4HDEA 3A2XA 3CRTA 5ECKB 1GL8A 1U3AA 1SKSB 3TRPA 1UVZA 1M2DA 1SENA 1PL2A 3GURA 4BVYA 1AUCA 2WFCA 5INYA 2LNTA 2L6DA 2YV9A 2VL3A 4XCSA 2N5BA 1NSWA 2JSZA 2C0DA 1S3AA 1JLWA 3M8NA 5HFIA 2OJLA 2F9SA 2RIIA 3KJYA 6GSXA 2CA8A 1C72A 1T4YA 2GGTA 2C3NA 2KUCA 1YJ6A 3C8EA 11GSA 4QL9A 1J08A 2VO4A 2CVKA 3M3MA 3GN3A 4IP6A 5H5RA 4RQRA 3QDNA 5D9TA 2A4VA 2GQLA 4N30A 2WJUA 1DBYA 3Q6OA 2EC4A 5KN3A 1USBA 3TKPA 5IMAA 2VLUA 5CNWA 3HYPA 2YP6A 3FRCA 3VWWA 2L5LA 1XBSA 1GLPA 3N5OA 3C1RA 5ID2A 5IOWA 4XS4B 2VCWA 2O89A 4BPYA 2RUEA 1O8WA 4IKHA 4TW5A 4OFTA 4OWYA 2IMDA 3GTUB 1X5DA 1ZCPA 4MJAA 1S3DA 1F6MC 2O7KA 5D9WA 5F8BA 1OVNA 2NDOA 3D5JA 2R2JA 1ZZYA 1WJKA 1TP9A 5IMZA 1FVKA 4N11A 1PMTA 4IELA 19GSA 4FYCA 3FW2A 3HHVA 3LXZA 2YWOA 1ZYQB 2BJXA 1GSDA 4ZIJA 4JE1A 2M46A 2OBKA 3ZL5A 1AC1A 1M9AA 3W6GA 2J23A 4OFMA 5ECNB 4K7IA 3H4KA 3D22A 4F03A 5AN1A 4FH8A 5IO2A 3ZVJD 4PGTA 5H5QA 1MD3A 4L8EA 3EINA 4AJ6A 1HNAA 2WRTA 3F4TA 1OC9A 2OADA 1BJXA 2GQKA 2IJYA 2L5OA 3P90A 2R37A 1EOHA 2VCTA 3LYKA 1T7PB 4WF4A 3GIXA 2WB9A 2XHFA 3C1SA 1A0RP 5ELGA 1ABAA 4Q5RA 1T4ZA 2GT6A 2HNLA 4J2FA 1SK0A 2MMOA 2XPEA 3DKSA 1XWKA 4DVCA 3G7JA 3GL3A 1VF4A 3LXTA 4TR3A 5KN1A 4HI7A 2MMZA 3RHCA 5A4WA 1EV4A 5FT3A 1O7UA 1YY7A 2YWIA 1QQ2A 2AUVA 5DALA 4MH3A 4I8BA 5B8BA 5HR1A 5KN0A 2M80A 4HEA2 1H4OA 3F6FA 3TJFA 1TDIA 3M9KA 4OO5A 5DAKA 2TRCP 1WIKA 2VL2A 1GTBA 4V1Ag 2H0HA 2OKAA 1AQVA 5LCZA 1K0CA 2LQOA 4O7HA 2DIZA 2WCIA 2GZZA 2A2RA 1V2AA 3WT2A 1VRSD 3ZFBA 1JFUA 1GSEA 1SK2A 1ERTA 3HDCA 3KTBA 2NTOA 3F9UA 1T00A 4KDYA 5G31A 1OC8A 4FYBA 4K8MA 4ZB6A 2LQQA 2D2ZA 4EXJA 4XHMA 1SYRA 1SL0B 3UMAA 3UBLA 2IMFA 2EIQA 2GVPA 1SK1A 1VF1A 4BVXA 3VFIA 1Z7PA 3GL5A 2E7PA 3DIEA 4N0ZA 5ECQB 5EVOA 4MJCA 1BEDA 1E2YA 4L0WA 1EP7A 5B7CA 3IAS2 4ISDA 5DJMA 3TB2A 1ZMAA 1SYXA 2L6CA 2RLIA 4EC0A 1O85A 2AAWA 2PN8A 2H72A 2X8HA 3DRNA 3I6AA 1TK0B 3ERFA 1YKCA 1G6WA 3SWLA 2V32A 1M7TA 1NM3A 1XVWA 3A2WA 4HQSA 1A8YA 3TKRA 3GX8A 1YEPA 4TR1B 4DSQA 2ZNMA 3IR4A 1GUKA 3HA9A 1VF3A 1PN9A 4XRDA 2CV4A 2KLXA 3KGKA 4WBJA 5J9BA 2HRNA 4K0NA 3H8QA 5JWRB 2E2GA 3VWUA 4TXVA 4F0BA 3RBTA 5CYYA 4MF5A 2P5QA 2H01A 3IE3A 2VCVA 2GZYA 5JWOB 3CSIA 2AYTA 1THOA 4K6XA 1T3BA 1M99A 5F07A 4NV2A 4ACSA 2H1GA 3ERGA 3IK7A 1M2AA 2YJHA 2JZRA 4WKWA 1ZOFA 3D6IA 1XVQA 2YWMA 4GQCA 1AQWA 2ALBA 6GSSA 4IBPA 3IBHA 3EU3A 2H6YA 2YANA 3FKFA 2I1UA 3ED3A 3GX0A 3UARA 1F37A 4EDZA 5ECHB 5GSTA 3GFKA 4X43A 3K8NA 3ZIVA 4BL7A 1KTEA 18GSA 1MTCA 4PNFA 1OKDA 4KW6A 5DQYA 1PX7A 2PPTA 1OE8A 2C80A 2H73A 3UBKA 3ZITA 1QUWA 2EIOA 5CRGA 4PQIA 5ECIB 5ECPB 4ECBA 4MPGA 2FA4A 3RPPA 5G2ZA 3TJBA 1GRXA 1S3CA 9GSSA 1K3YA 4K0GA 1WMJA 1PD21 1SKWB 3HVVA 3HZ8A 4EL1A 4JR4A 1TTZA 4NV5A 3M1GA 4JR6A 3DYRA 1RW1A 1A2LA 3N9JA 2LJRA 1SJ6A 3M0FA 2I3YA 1DE1A 1EGRA 2NPBA 5B6MA 4MABA 5DDLA 1ILOA 4MDCA 4GSSA 3KD0A 2OE3A 1B4QA 1YKAA 3ZLPA 1F2EA 2DJ3A 5HR3A 1TK5B 4XTSA 3C71A 2LEGA 4LMVA 4IJIA 2V6OA 4KDXA 3VWXA 1BX9A 2R5GA 3HJMA 3ZVJA 6GSUA 1OKTA 1TKDB 5IOXA 2X8GA 4MPFA 2VLVA 3F6DA 3L78A 4MLYA 4XRAA 1X5CA 1EZKA 4K7OA 5JCUA 2C1YA 2CX3A 3U6VA 3UEMA 2PVOC 3UVHA 2J9HA 1Y6EA 1TK8B 4GRFA 2FA8A 2AHEA 5JCWA 2VCZA 1TI3A 1HNCA 5HR0A 3UAPA 2FY6A 1OYJA 2F51A 3GYKA 1MD4A 4KSOA 6GSWA 3CBUA 2JL4A 4YQMA 1GULA 4NPBA 4G19A 2GSTA 4EVMA 3NIVA 4TXOA 1YQ1A 1NW2A 1FB6A 3IAM2 5EY6A 3LFLA 4QQ7A 1ACVA 1GTAA 2HFDA 2P0GA 3C7MA 5HFGA 1SKRB 2M72A 4ULXA 3BCKA 3FYGA 3DVWA 3QD9A 6GSVA 2TRXA 2GTUA 1R5PA 2JZTA 1VF2A 1TOFA 2FWGA 3EC3A 3F3RA 1B9YC 3F3QA 2CVDA 1R5AA 2H8LA 2XBIA 3GV1A 4RUVA 3A2VA 2BTOT 3IPZA 2OE0A 2MYGA 3ZIJA 1B9XC 5DVBA 3A5WA 2ON5A 4I5QA 3D4TA 5ID2B 1G6YA 3APSA 1XWAA 4KCEA 2H66A 2QKEA 3GNJA 1ERVA 2ZUPA 2WDUA 4EKZA 5IO0A 4KCAA 3F4RA 2R4VA 3KP9A 2TIRA 3TJGA 10GSA 5IM9A 1XW9A 5E59A 1KBNA 4TVEA 4MMMA 1GTUA 3LORA 3VI7A 5GZZB 3VURA 2AB6A 2DBCA 2EIRA 1A24A 4HU7A 2KHPA 1XWGA 2HT9A 4EF0A 4LL4B 4ZB9A 1JLVA 2FWEA 1BG5A 3H1NA 5L71A 1GUMA 3EU4A 4HJ2A 4NWYA 4OD7A 2VD0A 3KMNA 3L0HA 2H1DA 1OC9B 1XCCA 4IHUA 1IYHA 4I2UA 1MEKA 2PMTA 3LG6A 4GXZA 5LD0A 3MDKA 2JSYA 1H75A 3QOUA 3BD2A 1QK8A 1NHOA 2WULA 3US3A 5ECRB 1Y25A 2VOCA 3MAKA 1XWCA 2DIYA 2DJ0A 5H5SA 4N10A 1TRUA 3TOUA 3VPTA 2E2MA 4MA9A 5DQSA 3TUEA 3WGXA 4MK3A 5DALB 5ECSA 4F2IA 4ZBDA 3FEUA 3IK9A 1XIYA 2C0GA 4Q5QA 3AY8A 5DAKB 2C3QA 3WGEA 1K0DA 4NXIA 3PGTA 5A4VA 4K2DA 3QAGA 2H1AA 4KAEA 2FWFA 3CRUA 4WETA 2IMEA 3I43A 2FD3A 1V58A 4KH7A 5KN2A 3QAWA 1A23A 4BWSA 3GH6A 2QC7A 5HR2A 4ZXGA 2O85A 3JCML 2B5EA 2GSQA 1ST9A 4IW9A 4MZBA 2VUPA 1FVJA 3KCMA 2BMXA 2VCXA 3G7IA 1TRVA 3KIJA 2E0QA 3DEXA 1SD9A 3ME7A 3PH9A 4ZBAA 1ON4A 1Z9HA 5JWQB 3KEBA 2C0FA 2RUFA 2RM6A 4I97A 4XIHA 4X0XA 4O5RA 1GSSA 4HUAA 1GSQA 3ZFLA 4FIWA 2LJAA 4MJBA 2KOKA 3GKXA 3LEFA 2CX4A 3GA4A 14GSA 4RI7A 3WGDA 1URMA 3F4SA 4WXTA 1FO5A 2H75A 4AJ7A 1X9SB 1GH2A 2MMAA 3TKSE 4IP1A 3L9SA 5A5KA 2Z9SA 4G10A 5G5EA 5G1KA 2GLRA 2F8AA 4O32A 5DCHA 1F3AA 3F0IA 1AQXA 1X9MB 3KP8A 1AW9A 3TKSA 1WRYA 2MMNA 3BOAA 1J9BA 3F8UA 4WR4A 1G7EA 5IMCA 2HSYA 1K0BA 3EMXA 3HXSA 4HZ2A 1J0FA 3FZ9A 3EE2A 1FG4A 4OCFA 3QAVA 2X64A 5G5FA 2JU5A 4TKYA 4JZQA 3APOA 5IPGA 4F0CA 1O6JA 2KP1A 3GKKA 4TR4A 1FAAA 1UN2A 2WS2A 2CQ9A 1EEJA 1SJIA 4CHSA 4MP4A 2PGTA 3QPMA 1X0RA 3IRAA 4LA1A 1TJDA 5D93A 2WGRA 2DMMA 2DJ1A 4KUNA 1Z7RA 2IWTA 4H86A 1R4WA 3DXBA 3BCIA 2HYXA 2K9FA 2DJKA 1HD2A 1GTIA 3CXGA 4ZILA 3UOMA 2V1MA 1IYIA 3ISOA 2PVQA 1U6TA 3O76A 4CDOA 2HE3A 1I5GA 4X1UA 2REMA 5IMFA 7GSSA 1XW6A 3ZMKA 5ELAA 4V2MA 3W8JA 2FLSA 4DSSA 3TKSC 1B8XA 3ZTLA 1DE2A 3BBYA 1TXXA 2PERA 4LL1B 2VL9A 5IPHA 2H30A 1N8JA 1JZDA 4POLA 2VCQA 3EYTA 1JZWA 2C3TA 16GSA 2XBQA 2FHEA 3I69A 2C0EA 2H6ZA 4JU5A 4L5LA 3KH7A 3FY7A 2MBTA 3RPNA 3ZRDA 5CAXA 2H76A 4YAVA 1YDKA 5J41A 3MNGA 5D9VA 3GKNA 5CREA 2B3SA 4PX1A 4Q5NA 1A2JA 4ECIA 3IDVA 3W8SA 4E8HA 3UL3A 5B6NA 4Z7XA 5D8IA 1R7HA 1WPIA 2WZ9A 2C8UA 3LYPA 2YJ7A 4V2NA 1MDJA 2IL3A 1T8EB 4HOJA 1YZXA 4IS0A 4K9ZA 3TCOA 1AXDA 5GAPD 1K3OA 2NBSA 1PA3A 2IMKA 3KXOA 3GUSA 2DSAA 1GP1A 2JADA 3UVTA 5FWGA 4MCUA
chains in the Genus database with same CATH superfamily
5G30A 5CRDA 2B7JA 5F06A 2FWHA 3ZZXA 5CP1A 4EE0A 2K8SA 4MZWA 1ZL9A 4KSMA 2YOIA 13GSA 3EURA 4POKA 1OAZA 3UJ1A 1Q4JA 1LU4A 1GLQA 5CRHA 3C73A 4TXOB 3WT1A 2B5XA 3O6TA 4MNNA 1XW5A 4D73A 4YQVA 1U3IA 3MWHA 2LTKA 5J3RA 4GLTA 1Z5YE 3O3TA 4K1FA 2LUSA 2AJQB 4EUYA 3Q19A 4GTUA 2IN3A 2N5FA 5AIXA 1A8LA 4K7NA 3E0UA 5C04A 1ZYNA 3ZMLA 4PQ1A 5ENUA 3TGZA 4XS6A 3FR9A 1DUGA 2GZPA 2QGVA 1U87A 2XPDA 1Q98A 1O73A 2OE1A 4G0IA 3HCZA 3SBCA 4NHWA 3E3EA 1HNBA 1EV9A 4YQUA 5F0GA 3PINA 3BJ5A 4PNGA 1W4VA 17GSA 4ID0A 5B8AA 5DCGA 2JACA 2YCDA 1NHYA 2NVLA 3J7Yk 2B5YA 4Q5FA 2LS5A 4ZB8A 3IA1A 3H79A 2IFQA 3CTGA 1WP0A 3D21A 3E9JB 2CAQA 2CZ3A 1ZYEA 2YWNA 5FHIA 1U88A 2G0FA 2HZEA 3CTFA 4HS1A 1SU9A 4I6XA 3FZ4A 2O87A 2K18A 4LMWA 4IQAA 3HY2A 4QL7A 1ML6A 3MYDA 3HZ4A 4KX4A 3IOSA 4EO3A 5AIVA 3ME8A 2L57A 1YEXA 5CO3A 3CSJA 4PURA 1RQMA 2C4JA 3F63A 2JZSA 1FOVA 4TR0A 2HZFA 3CSHA 3QFAC 3RAZA 3KZQA 1EOGA 4YAPA 1JZOA 3ERWA 3LW9A 4ZL9A 3QR6A 3LGCA 5GAND 2VM2A 3L4NA 3VPQA 3HVSA 1CQHA 1OC3A 2LRCA 3RDWA 1A2MA 4V2LA 1F9MA 2FNOA 1M2BA 1TI1A 4IQ1A 2H6XA 1K3LA 4HU9A 1B4PA 2HLSA 1O8XA 4JBBA 1PKZA 1HQOA 1GNWA 2B7KA 2LNSA 4ML1A 1PGTA 4L0UA 5E4WA 4J56E 2PWJA 4AGSA 1TRSA 2DJJA 4GSNA 4DEJA 4IJ3A 2G2QA 2B1KA 4EDYA 5JCGA 3P7XA 5ECOB 5IMDA 5HFKA 2R0CA 4XS4A 3WYWA 3GTUA 1K0AA 1XOBA 1SD8A 2HSHA 2MBSA 3I9V2 5D73A 1XPVA 3GSSA 2F8FA 2R6KA 1QMVA 2K8VA 3S9FA 1V98A 5ECMB 5LNKe 1HYUA 3A3TA 1GSYA 4XS1A 3WD6A 8GSSA 4G9HA 4GSTA 4GF0A 4RI6A 4KGIA 2O8VB 1G7OA 2VD1A 4IGJA 3FHKA 3APQA 3KH9A 1O81A 2IMIA 3VI5A 3G9BA 1QFNA 5COHA 1LJRA 5DBQA 4MF6A 3Q74A 1SL2B 2DKHA 2R0PA 3HJOA 1WE0A 3IXRA 1JZRA 1G0TA 4USSA 4JEDA 3IC8A 12GSA 3QMXA 2LRNA 3MSZA 5F05A 4AJ8A 3DVXA 1TW9A 2H1BA 3EMPA 3LSZA 2H71A 4GWRA 3NZNA 1KNGA 1TRWA 2YZUA 1WOUA 3FR3A 1JHBA 1EWXA 1XZOA 2IPAA 5GSSA 3EVIA 4NMUA 2PU9C 1Z6MA 3QCPA 2ON7A 4KA0A 2H70A 1EEMA 1THXA 1XWBA 6GSYA 4MF7A 4PQHA 1X5EA 1FHEA 1PSQA 1FB0A 3PR8A 3GH9A 2P5RA 5AISA 1M0UA 4NHZA 4YH2A 5J4UA 2P31A 1TU7A 2FGXA 2LKUA 3MIXA 4WEYA 2GSRA 3G7YA 3D4MA 2HI7A 1BQ7A 4L5OA 2X8CA 2CT6A 2OBIA 4WR5A 4WBRD 4V1Ap 1EP8A 2FCHA 2L4CA 1F3BA 1V9WA 4CY6A 4F9ZA 2VAFA 4PUFC 2A2SA 4ZL7A 5D9XA 4F82A 1X9WB 2B1LA 3IHGA 2H0IA 3J7Yb 1WWJA 1Z3EA 1SJZA 1ERWA 4CW9A 4P3YB 2FUG2 4PXOA 4ILFA 2LJKA 1FW1A 4O92A 1SL1B 6GSTA 4AF2A 1GUHA 1N2AA 4ECJA 2LSTA 4WF5A 2GT5A 4ECCA 2CVBA 3L9VA 2I9HA 3KMOA 4J57E 3KTLA 3LWAA 4GCIA 4MH2A 2YPMA 2VL2C 4BWQA 4POMA 1KEBA 2VLTA 1PRXA 4JRRA 4RQXA 1GSFA 5J9CA 22GSA 2R3XA 2GDRA 4TRXA 5D96A 4HZ4A 2VIMA 2GS3A 4OFNA 4EIQA 3GMFA 1DSBA 2OACA 1GNEA 4E8EA 4HQZA 4DSSB 5G1LA 1V40A 1XOAA 1I9DA 3ZYWA 4DSRA 2OA7A 4KDUA 3DGQA 2K6VA 3RHBA 3GHAA 3VLNA 2LRTA 1XFLA 4IN0A 3TJKA 1UC7A 4OMVA 3DD3A 4GQFA 1TU8A 4ZL8A 1BYEA 2DMLA 5AGYA 2V6KA 2XC2A 3HD5A 2R0GA 2HRFA 4MJEA 2F3MA 3IC4A 1PQNA 1YF0A 4IVFA 4TR1A 2DLXA 1QXHA 3VWVA 1XG8A 3M9JA 4MZCA 4HJMA 3TRXA 3R2QA 5J5NA 2VM1A 5EPFA 3LJRA 4ICYA 3FR6A 2CZ2A 2LV3A 3LQ7A 1B48A 3HVXA 3FK8A 2AV4A 1YF1A 1LBKA 2ES7A 3DMLA 3Q18A 3KM6A 5EL8A 1AAZA 3CYNA 3UIWA 3VK9A 2H19A 2I4AA 3TKQA 2H74A 5DJLA 3D0ZA 5IIZA 3TJJA 4BA7A 2B6MA 3TDGA 4OCEA 3ZREA 4KE3A 1T1VA 2DKIA 4I2TA 5CRWA 1K0NA 2YNXA 4PUAA 3H93A 3TRQA 4POBA 1BAYA 1W89A 4OO4A 1OE7A 2ZCTA 3HKRA 2I81A 5HQPA 1ZGNA 2GQMA 20GSA 1XXUA 3GKMA 2N5AA 4LLRA 4YKFA 1ERUA 3EWLA 2V41A 5KOWA 3DWVA 1PKWA 2YV7A 3V1WA 2MZCA 3FZAA 1R26A 3HVNA 4D73B 2RM5A 1E6BA 2L4QA 1PL1A 1RK4A 2IIYA 3QFBC 1PX6A 2L59A 1GSUA 4TN8A 3U5RE 1K0MA 1K0OA 3IHQA 3IV4A 2PBJA 1Z6NA 2YZHA 4NAXA 4KNDA 2CAIA 5IQYA 4FO5A 1V57A 4ZBBA 3P8WA 1GWCA 3TOTA 5KEJA 3L9UA 5IMVA 1AIUA 3NOFA 3P2AA 3CMIA 1M9BA 2X99A 1MDKA 2GSSA 4KB3A 5C00A 1A0FA 4TOPA 4ML6A 4O5UA 1MDIA 2YN1A 1UA5A 3FZ5A 4G2EA 2H0GA 5A4UA 2KP2A 1CQGA 1EGOA 3HJPA 2PUKC 2HXKA 2IFQB 4BVYB 3OR5A 2V2GA 1VGLA 1ZYPA 2DC5A 2QSIA 2DJ2A 1QGVA 5ECLB 2HZEB 3GRXA 3GSTA 5ABRA 3PPUA 4FYUA 4N0VA 4HDEA 3A2XA 3CRTA 5ECKB 1GL8A 1U3AA 1SKSB 3TRPA 1UVZA 1M2DA 1SENA 1PL2A 3GURA 4BVYA 1AUCA 2WFCA 5INYA 2LNTA 2L6DA 2YV9A 2VL3A 4XCSA 2N5BA 1NSWA 2QA1A 2JSZA 2C0DA 1S3AA 1JLWA 3M8NA 5HFIA 2OJLA 2F9SA 2RIIA 3KJYA 6GSXA 2CA8A 1C72A 1T4YA 2GGTA 2C3NA 2KUCA 1YJ6A 4PTSA 3C8EA 11GSA 4QL9A 1J08A 2VO4A 2CVKA 3M3MA 3GN3A 4IP6A 5H5RA 4RQRA 3QDNA 5D9TA 2A4VA 2GQLA 4N30A 2WJUA 1DBYA 3Q6OA 2EC4A 5KN3A 1USBA 3TKPA 5IMAA 2VLUA 5CNWA 3HYPA 2YP6A 3FRCA 3VWWA 2L5LA 1XBSA 1GLPA 4BIKA 3N5OA 3C1RA 2HSMA 5ID2A 5IOWA 4XS4B 2VCWA 2O89A 4BPYA 2RUEA 1O8WA 4IKHA 4TW5A 4OFTA 4OWYA 2IMDA 3GTUB 1X5DA 1ZCPA 4MJAA 1S3DA 1F6MC 2O7KA 5D9WA 5F8BA 1OVNA 2NDOA 3D5JA 2R2JA 1ZZYA 1WJKA 1TP9A 5IMZA 1FVKA 4N11A 1PMTA 4IELA 19GSA 4FYCA 3FW2A 3HHVA 3LXZA 2YWOA 1ZYQB 2BJXA 1GSDA 4ZIJA 4JE1A 2M46A 2OBKA 3ZL5A 1AC1A 1M9AA 3W6GA 2J23A 4OFMA 2X4AA 5ECNB 4K7IA 3H4KA 3D22A 4F03A 5AN1A 4FH8A 5IO2A 2UZ8A 3ZVJD 4PGTA 5H5QA 1MD3A 4L8EA 3EINA 4AJ6A 1HNAA 2WRTA 3F4TA 1OC9A 2OADA 1BJXA 2GQKA 2IJYA 2L5OA 3P90A 2R37A 1EOHA 2VCTA 3LYKA 1T7PB 4WF4A 3GIXA 2WB9A 2XHFA 3C1SA 1A0RP 5ELGA 1ABAA 4Q5RA 3CQFA 1T4ZA 2GT6A 2HNLA 4J2FA 1SK0A 2MMOA 2XPEA 3A5IA 3DKSA 1XWKA 4DVCA 3G7JA 3GL3A 1VF4A 3LXTA 4TR3A 5KN1A 4HI7A 2MMZA 3RHCA 5A4WA 1EV4A 5FT3A 1O7UA 1YY7A 2YWIA 1QQ2A 2AUVA 5DALA 4EIPA 4MH3A 4I8BA 5B8BA 5HR1A 5KN0A 2M80A 4HEA2 1H4OA 3F6FA 3TJFA 1TDIA 3M9KA 4OO5A 5DAKA 2TRCP 1WIKA 2VL2A 1GTBA 4V1Ag 2H0HA 2OKAA 1AQVA 5LCZA 1K0CA 2LQOA 4O7HA 2DIZA 2WCIA 2GZZA 2A2RA 2A4HA 1V2AA 3WT2A 1VRSD 3ZFBA 1JFUA 1GSEA 1SK2A 1ERTA 3HDCA 3KTBA 2NTOA 3F9UA 1M3JA 1T00A 4KDYA 5G31A 1OC8A 4FYBA 4K8MA 4ZB6A 2LQQA 2D2ZA 4EXJA 4XHMA 1SYRA 1SL0B 3UMAA 3UBLA 2IMFA 2EIQA 2QA2A 4K2XA 2GVPA 1SK1A 1VF1A 3EPTA 4BVXA 3VFIA 1Z7PA 3GL5A 2E7PA 3DIEA 4N0ZA 5ECQB 5EVOA 4MJCA 1BEDA 1E2YA 4L0WA 1EP7A 5B7CA 3IAS2 4ISDA 5DJMA 3TB2A 1ZMAA 1SYXA 2L6CA 2RLIA 4EC0A 1O85A 2AAWA 2PN8A 2H72A 2X8HA 3DRNA 3I6AA 1TK0B 3ERFA 1YKCA 1G6WA 3SWLA 2V32A 1M7TA 1NM3A 1XVWA 3A2WA 4HQSA 1A8YA 3TKRA 3GX8A 1YEPA 4TR1B 4DSQA 2ZNMA 3IR4A 1GUKA 3HA9A 1VF3A 1PN9A 4XRDA 2CV4A 2KLXA 3KGKA 4WBJA 5J9BA 2HRNA 4K0NA 3H8QA 5JWRB 2E2GA 3VWUA 4TXVA 4F0BA 3RBTA 5CYYA 4MF5A 2P5QA 2H01A 3IE3A 2VCVA 2GZYA 5JWOB 3CSIA 2AYTA 1THOA 4K6XA 1T3BA 1M99A 4NV2A 5F07A 4ACSA 2H1GA 3ERGA 3IK7A 1M2AA 2YJHA 2JZRA 4WKWA 1ZOFA 3D6IA 1XVQA 2YWMA 4GQCA 1AQWA 2ALBA 6GSSA 4IBPA 3IBHA 3EU3A 2H6YA 2YANA 3FKFA 2I1UA 3ED3A 3GX0A 3UARA 1F37A 4EDZA 5ECHB 5GSTA 3GFKA 4X43A 3K8NA 3ZIVA 4BL7A 1KTEA 18GSA 1MTCA 4PNFA 1OKDA 4KW6A 5DQYA 5BRTA 1PX7A 2PPTA 5KOXA 1OE8A 2C80A 2H73A 3UBKA 3ZITA 1QUWA 2EIOA 5CRGA 4HSCX 4PQIA 5ECIB 5ECPB 4ECBA 4MPGA 2FA4A 3RPPA 5G2ZA 3TJBA 1GRXA 1S3CA 9GSSA 1K3YA 4K0GA 1WMJA 1PD21 1SKWB 3HVVA 3HZ8A 4EL1A 4JR4A 1TTZA 4NV5A 3M1GA 4JR6A 3DYRA 1RW1A 1A2LA 3N9JA 2LJRA 1SJ6A 3M0FA 2I3YA 1DE1A 1EGRA 2NPBA 5B6MA 4MABA 5DDLA 1ILOA 4MDCA 4GSSA 3KD0A 2OE3A 1B4QA 1YKAA 3ZLPA 1F2EA 2DJ3A 5HR3A 1TK5B 4XTSA 3C71A 2LEGA 4LMVA 4IJIA 2V6OA 4KDXA 3VWXA 1BX9A 2R5GA 3HJMA 3ZVJA 6GSUA 1OKTA 1TKDB 5IOXA 2X8GA 4MPFA 2VLVA 3F6DA 3L78A 4MLYA 4XRAA 1X5CA 1EZKA 4K7OA 5JCUA 2C1YA 2CX3A 3U6VA 3UEMA 2PVOC 3UVHA 2J9HA 1Y6EA 1TK8B 4GRFA 2FA8A 2AHEA 5JCWA 2VCZA 1TI3A 1HNCA 5HR0A 3UAPA 2FY6A 1OYJA 2F51A 3GYKA 1MD4A 4KSOA 6GSWA 3CBUA 2JL4A 4YQMA 1GULA 4NPBA 4G19A 2GSTA 4EVMA 3NIVA 4TXOA 1YQ1A 1S3RA 1NW2A 1FB6A 3IAM2 5EY6A 3LFLA 4QQ7A 1ACVA 1GTAA 2HFDA 2P0GA 3C7MA 5HFGA 1SKRB 2M72A 4ULXA 3BCKA 3FYGA 3DVWA 3QD9A 6GSVA 2TRXA 2GTUA 1R5PA 4Z2RA 2JZTA 1VF2A 1TOFA 2FWGA 3EC3A 3F3RA 1B9YC 3F3QA 2CVDA 1R5AA 2H8LA 2XBIA 3GV1A 4RUVA 3A2VA 1PFOA 2BTOT 4FQUA 3IPZA 2OE0A 2MYGA 3ZIJA 1B9XC 5DVBA 3A5WA 2ON5A 4I5QA 3D4TA 5ID2B 1G6YA 3APSA 1XWAA 4KCEA 2H66A 2QKEA 3GNJA 1ERVA 2ZUPA 2WDUA 4EKZA 5IO0A 4KCAA 3F4RA 2R4VA 3KP9A 2TIRA 3TJGA 10GSA 5IM9A 1XW9A 5E59A 1KBNA 4TVEA 4MMMA 4CY8A 1GTUA 3LORA 3VI7A 5GZZB 3VURA 2AB6A 2DBCA 2EIRA 1A24A 4HU7A 2KHPA 1XWGA 2HT9A 4EF0A 4LL4B 4ZB9A 1JLVA 2FWEA 4X4JA 1BG5A 3H1NA 5L71A 1GUMA 3EU4A 4HJ2A 4NWYA 4OD7A 2VD0A 3KMNA 3L0HA 2H1DA 1OC9B 1XCCA 4IHUA 1IYHA 4I2UA 1MEKA 2PMTA 3LG6A 4GXZA 5LD0A 3MDKA 2JSYA 1H75A 3QOUA 3BD2A 1QK8A 1NHOA 2WULA 3US3A 5ECRB 1Y25A 2X49A 2VOCA 3MAKA 1XWCA 2DIYA 2DJ0A 5H5SA 4N10A 1TRUA 3TOUA 3VPTA 2E2MA 4MA9A 5DQSA 3TUEA 3WGXA 4YKGA 4MK3A 2HRKA 5DALB 5ECSA 4F2IA 4ZBDA 3FEUA 3IK9A 1XIYA 2C0GA 4Q5QA 3AY8A 5DAKB 4A5PA 1PN0A 2C3QA 3WGEA 1K0DA 4NXIA 3PGTA 5A4VA 4K2DA 3QAGA 2H1AA 4KAEA 2FWFA 3CRUA 4WETA 2IMEA 3I43A 2FD3A 1V58A 4KH7A 5KN2A 3QAWA 1A23A 2A2PA 4BWSA 3GH6A 2QC7A 5HR2A 4ZXGA 2O85A 3FMWA 3JCML 4O5QA 2B5EA 2GSQA 1ST9A 4IW9A 4MZBA 2VUPA 1FVJA 3KCMA 2BMXA 2VCXA 3G7IA 1TRVA 3KIJA 2E0QA 3DEXA 1SD9A 3ME7A 3PH9A 4ZBAA 1ON4A 1Z9HA 5JWQB 3KEBA 2C0FA 2RUFA 2RM6A 4I97A 4XIHA 4X0XA 4O5RA 1GSSA 4HUAA 1GSQA 3ZFLA 4FIWA 2LJAA 4MJBA 2KOKA 3R3EA 3GKXA 3LEFA 2CX4A 3GA4A 14GSA 4BVXB 4RI7A 3WGDA 1URMA 3F4SA 4WXTA 1FO5A 2H75A 4AJ7A 1X9SB 1GH2A 2MMAA 4G0KA 3TKSE 4IP1A 1M3IA 3L9SA 5A5KA 2Z9SA 4G10A 5G5EA 5G1KA 2GLRA 2F8AA 4O32A 5DCHA 1F3AA 3F0IA 1AQXA 1X9MB 3KP8A 1AW9A 3TKSA 1WRYA 2MMNA 3BOAA 1J9BA 3F8UA 4WR4A 1G7EA 5IMCA 2HSYA 1K0BA 3EMXA 3HXSA 4HZ2A 1J0FA 3FZ9A 3EE2A 1FG4A 4OCFA 3QAVA 2X64A 5G5FA 2JU5A 4TKYA 4JZQA 3APOA 5IPGA 4F0CA 1O6JA 2KP1A 3GKKA 4TR4A 1FAAA 1UN2A 2WS2A 2CQ9A 1EEJA 1SJIA 4CHSA 4K5SA 4Z2UA 4MP4A 2PGTA 3QPMA 1X0RA 4G0LA 3IRAA 4LA1A 4KF9A 1TJDA 5D93A 2WGRA 2DMMA 2DJ1A 4KUNA 1Z7RA 2IWTA 4H86A 4Z2TA 1R4WA 3DXBA 3BCIA 2HYXA 2K9FA 2DJKA 1HD2A 1GTIA 3CXGA 4ZILA 3UOMA 2V1MA 1IYIA 3ISOA 2PVQA 1U6TA 3O76A 4CDOA 2HE3A 1I5GA 4X1UA 2REMA 5IMFA 4BL7B 1XW6A 7GSSA 3ZMKA 5ELAA 4V2MA 3W8JA 2FLSA 4DSSA 3TKSC 1B8XA 3ZTLA 1DE2A 3BBYA 1TXXA 2PERA 4LL1B 2VL9A 5IPHA 2H30A 1N8JA 1JZDA 4POLA 2VCQA 3EYTA 1JZWA 2C3TA 16GSA 2XBQA 2FHEA 3I69A 2C0EA 2H6ZA 4JU5A 4L5LA 3KH7A 3FY7A 2MBTA 3RPNA 3ZRDA 5CAXA 2H76A 4YAVA 1YDKA 5J41A 3MNGA 5D9VA 3GKNA 5CREA 2B3SA 4PX1A 4Q5NA 1A2JA 4ECIA 3IDVA 3W8SA 4E8HA 3UL3A 5B6NA 4Z7XA 5D8IA 1R7HA 1WPIA 2WZ9A 2C8UA 3LYPA 2YJ7A 4V2NA 1MDJA 2IL3A 1T8EB 4HOJA 1FOHA 1YZXA 4K5RA 4IS0A 4K9ZA 3TCOA 1AXDA 5GAPD 5BMUA 1K3OA 2NBSA 1PA3A 2IMKA 3KXOA 3GUSA 2DSAA 1GP1A 2JADA 3UVTA 2HRAA 5FWGA 4MCUA
chains in the Genus database with same CATH topology
5G30A 5CRDA 2B7JA 5F06A 2FWHA 3ZZXA 5CP1A 4EE0A 2K8SA 4MZWA 1ZL9A 4KSMA 2YOIA 13GSA 3EURA 4POKA 1OAZA 3UJ1A 1Q4JA 1LU4A 1GLQA 5CRHA 3C73A 4TXOB 3WT1A 2B5XA 3O6TA 4MNNA 1XW5A 4D73A 4YQVA 1U3IA 3MWHA 2LTKA 5J3RA 4GLTA 1Z5YE 3O3TA 4K1FA 2LUSA 2AJQB 4EUYA 3Q19A 4GTUA 2IN3A 2N5FA 5AIXA 1A8LA 4K7NA 3E0UA 5C04A 1ZYNA 3ZMLA 4PQ1A 5ENUA 3TGZA 4XS6A 3FR9A 1DUGA 2GZPA 2QGVA 1U87A 2XPDA 1Q98A 1O73A 2OE1A 4G0IA 3HCZA 3SBCA 4NHWA 3E3EA 1HNBA 1EV9A 4YQUA 5F0GA 3PINA 3BJ5A 4PNGA 1W4VA 17GSA 4ID0A 5B8AA 5DCGA 2JACA 2YCDA 1NHYA 2NVLA 3J7Yk 2B5YA 4Q5FA 2LS5A 4ZB8A 3IA1A 3H79A 2IFQA 3CTGA 1WP0A 3D21A 3E9JB 2CAQA 2CZ3A 1ZYEA 2YWNA 5FHIA 1U88A 2G0FA 2HZEA 3CTFA 4HS1A 1SU9A 4I6XA 3FZ4A 2O87A 2K18A 4LMWA 4IQAA 3HY2A 4QL7A 1ML6A 3MYDA 3HZ4A 4KX4A 3IOSA 4EO3A 5AIVA 3ME8A 2L57A 1YEXA 5CO3A 3CSJA 4PURA 1RQMA 2C4JA 3F63A 2JZSA 1FOVA 4TR0A 2HZFA 3CSHA 3QFAC 3RAZA 3KZQA 1EOGA 4YAPA 1JZOA 3ERWA 3LW9A 4ZL9A 3QR6A 3LGCA 5GAND 2VM2A 3L4NA 3VPQA 3HVSA 1CQHA 1OC3A 2LRCA 3RDWA 1A2MA 4V2LA 1F9MA 2FNOA 1M2BA 1TI1A 4IQ1A 2H6XA 1K3LA 4HU9A 1B4PA 2HLSA 1O8XA 4JBBA 1PKZA 1HQOA 1GNWA 2B7KA 2LNSA 4ML1A 1PGTA 4L0UA 5E4WA 4J56E 2PWJA 4AGSA 1TRSA 2DJJA 4GSNA 4DEJA 4IJ3A 2G2QA 2B1KA 4EDYA 5JCGA 3P7XA 5ECOB 5IMDA 5HFKA 2R0CA 4XS4A 3WYWA 3GTUA 1K0AA 1XOBA 1SD8A 2HSHA 2MBSA 3I9V2 5D73A 1XPVA 3GSSA 2F8FA 2R6KA 1QMVA 2K8VA 3S9FA 1V98A 5ECMB 5LNKe 1HYUA 3A3TA 1GSYA 4XS1A 3WD6A 8GSSA 4G9HA 4GSTA 4GF0A 4RI6A 4KGIA 2O8VB 1G7OA 2VD1A 4IGJA 3FHKA 3APQA 3KH9A 1O81A 2IMIA 3VI5A 3G9BA 1QFNA 5COHA 1LJRA 5DBQA 4MF6A 3Q74A 1SL2B 2DKHA 2R0PA 3HJOA 1WE0A 3IXRA 1JZRA 1G0TA 4USSA 4JEDA 3IC8A 12GSA 3QMXA 2LRNA 3MSZA 5F05A 4AJ8A 3DVXA 1TW9A 2H1BA 3EMPA 3LSZA 2H71A 4GWRA 3NZNA 1KNGA 1TRWA 2YZUA 1WOUA 3FR3A 1JHBA 1EWXA 1XZOA 2IPAA 5GSSA 3EVIA 4NMUA 2PU9C 1Z6MA 3QCPA 2ON7A 4KA0A 2H70A 1EEMA 1THXA 1XWBA 6GSYA 4MF7A 4PQHA 1X5EA 1FHEA 1PSQA 1FB0A 3PR8A 3GH9A 2P5RA 5AISA 1M0UA 4NHZA 4YH2A 5J4UA 2P31A 1TU7A 2FGXA 2LKUA 3MIXA 4WEYA 2GSRA 3G7YA 3D4MA 2HI7A 1BQ7A 4L5OA 2X8CA 2CT6A 2OBIA 4WR5A 4WBRD 4V1Ap 1EP8A 2FCHA 2L4CA 1F3BA 1V9WA 4CY6A 4F9ZA 2VAFA 4PUFC 2A2SA 4ZL7A 5D9XA 4F82A 1X9WB 2B1LA 3IHGA 2H0IA 3J7Yb 1WWJA 1Z3EA 1SJZA 1ERWA 4CW9A 4P3YB 2FUG2 4PXOA 4ILFA 2LJKA 1FW1A 4O92A 1SL1B 6GSTA 4AF2A 1GUHA 1N2AA 4ECJA 2LSTA 4WF5A 2GT5A 4ECCA 2CVBA 3L9VA 2I9HA 3KMOA 4J57E 3KTLA 3LWAA 4GCIA 4MH2A 2YPMA 2VL2C 4BWQA 4POMA 1KEBA 2VLTA 1PRXA 4JRRA 4RQXA 1GSFA 5J9CA 22GSA 2R3XA 2GDRA 4TRXA 5D96A 4HZ4A 2VIMA 2GS3A 4OFNA 4EIQA 3GMFA 1DSBA 2OACA 1GNEA 4E8EA 4HQZA 4DSSB 5G1LA 1V40A 1XOAA 1I9DA 3ZYWA 4DSRA 2OA7A 4KDUA 3DGQA 2K6VA 3RHBA 3GHAA 3VLNA 2LRTA 1XFLA 4IN0A 3TJKA 1UC7A 4OMVA 3DD3A 4GQFA 1TU8A 4ZL8A 1BYEA 2DMLA 5AGYA 2V6KA 2XC2A 3HD5A 2R0GA 2HRFA 4MJEA 2F3MA 3IC4A 1PQNA 1YF0A 4IVFA 4TR1A 2DLXA 1QXHA 3VWVA 3M9JA 4MZCA 4HJMA 3TRXA 3R2QA 5J5NA 2VM1A 5EPFA 3LJRA 4ICYA 3FR6A 2CZ2A 2LV3A 3LQ7A 1B48A 3HVXA 3FK8A 2AV4A 1YF1A 1LBKA 2ES7A 3DMLA 3Q18A 3KM6A 5EL8A 1AAZA 3CYNA 3UIWA 3VK9A 2H19A 2I4AA 3TKQA 2H74A 5DJLA 3D0ZA 5IIZA 3TJJA 4BA7A 2B6MA 3TDGA 4OCEA 3ZREA 4KE3A 1T1VA 2DKIA 4I2TA 5CRWA 1K0NA 2YNXA 4PUAA 3H93A 3TRQA 4POBA 1BAYA 1W89A 4OO4A 1OE7A 2ZCTA 3HKRA 2I81A 5HQPA 1ZGNA 2GQMA 20GSA 1XXUA 3GKMA 2N5AA 4LLRA 4YKFA 1ERUA 3EWLA 2V41A 5KOWA 3DWVA 1PKWA 2YV7A 3V1WA 2MZCA 3FZAA 1R26A 4D73B 2RM5A 1E6BA 2L4QA 1PL1A 1RK4A 2IIYA 3QFBC 1PX6A 2L59A 1GSUA 4TN8A 3U5RE 1K0MA 1K0OA 3IHQA 3IV4A 2PBJA 1Z6NA 2YZHA 4NAXA 4KNDA 2CAIA 5IQYA 4FO5A 1V57A 4ZBBA 3P8WA 1GWCA 3TOTA 5KEJA 3L9UA 5IMVA 1AIUA 3NOFA 3P2AA 3CMIA 1M9BA 2X99A 1MDKA 2GSSA 4KB3A 5C00A 1A0FA 4TOPA 4ML6A 4O5UA 1MDIA 2YN1A 1UA5A 3FZ5A 4G2EA 2H0GA 5A4UA 2KP2A 1CQGA 1EGOA 3HJPA 2PUKC 2HXKA 2IFQB 4BVYB 3OR5A 2V2GA 1VGLA 1ZYPA 2DC5A 2QSIA 2DJ2A 1QGVA 5ECLB 2HZEB 3GRXA 3GSTA 5ABRA 3PPUA 4FYUA 4N0VA 4HDEA 3A2XA 3CRTA 5ECKB 1GL8A 1U3AA 1SKSB 3TRPA 1UVZA 1M2DA 1SENA 1PL2A 3GURA 4BVYA 1AUCA 2WFCA 5INYA 2LNTA 2L6DA 2YV9A 2VL3A 4XCSA 2N5BA 1NSWA 2QA1A 2JSZA 2C0DA 1S3AA 1JLWA 3M8NA 5HFIA 2OJLA 2F9SA 2RIIA 3KJYA 6GSXA 2CA8A 1C72A 1T4YA 2GGTA 2C3NA 2KUCA 1YJ6A 4PTSA 3C8EA 11GSA 4QL9A 1J08A 2VO4A 2CVKA 3M3MA 3GN3A 4IP6A 5H5RA 4RQRA 3QDNA 5D9TA 2A4VA 2GQLA 4N30A 2WJUA 1DBYA 3Q6OA 2EC4A 5KN3A 1USBA 3TKPA 5IMAA 2VLUA 5CNWA 3HYPA 2YP6A 3FRCA 3VWWA 2L5LA 1XBSA 1GLPA 3N5OA 3C1RA 2HSMA 5ID2A 5IOWA 4XS4B 2VCWA 2O89A 4BPYA 2RUEA 1O8WA 4IKHA 4TW5A 4OFTA 4OWYA 2IMDA 3GTUB 1X5DA 1ZCPA 4MJAA 1S3DA 1F6MC 2O7KA 5D9WA 5F8BA 1OVNA 2NDOA 3D5JA 2R2JA 1ZZYA 1WJKA 1TP9A 5IMZA 1FVKA 4N11A 1PMTA 4IELA 19GSA 4FYCA 3FW2A 3HHVA 3LXZA 2YWOA 1ZYQB 2BJXA 1GSDA 4ZIJA 4JE1A 2M46A 2OBKA 3ZL5A 1AC1A 1M9AA 3W6GA 2J23A 4OFMA 2X4AA 5ECNB 4K7IA 3H4KA 3D22A 4F03A 5AN1A 4FH8A 5IO2A 2UZ8A 3ZVJD 4PGTA 5H5QA 1MD3A 4L8EA 3EINA 4AJ6A 1HNAA 2WRTA 3F4TA 1OC9A 2OADA 1BJXA 2GQKA 2IJYA 2L5OA 3P90A 2R37A 1EOHA 2VCTA 3LYKA 1T7PB 4WF4A 3GIXA 2WB9A 2XHFA 3C1SA 1A0RP 5ELGA 1ABAA 4Q5RA 1T4ZA 2GT6A 2HNLA 4J2FA 1SK0A 2MMOA 2XPEA 3A5IA 3DKSA 1XWKA 4DVCA 3G7JA 3GL3A 1VF4A 3LXTA 4TR3A 5KN1A 4HI7A 2MMZA 3RHCA 5A4WA 1EV4A 5FT3A 1O7UA 1YY7A 2YWIA 1QQ2A 2AUVA 5DALA 4EIPA 4MH3A 4I8BA 5B8BA 5HR1A 5KN0A 2M80A 4HEA2 1H4OA 3F6FA 3TJFA 1TDIA 3M9KA 4OO5A 5DAKA 2TRCP 1WIKA 2VL2A 1GTBA 4V1Ag 2H0HA 2OKAA 1AQVA 5LCZA 1K0CA 2LQOA 4O7HA 2DIZA 2WCIA 2GZZA 2A2RA 2A4HA 1V2AA 3WT2A 1VRSD 3ZFBA 1JFUA 1GSEA 1SK2A 1ERTA 3HDCA 3KTBA 2NTOA 3F9UA 1T00A 4KDYA 5G31A 1OC8A 4FYBA 4K8MA 4ZB6A 2LQQA 2D2ZA 4EXJA 4XHMA 1SYRA 1SL0B 3UMAA 3UBLA 2IMFA 2EIQA 2QA2A 4K2XA 2GVPA 1SK1A 1VF1A 3EPTA 4BVXA 3VFIA 1Z7PA 3GL5A 2E7PA 3DIEA 4N0ZA 5ECQB 5EVOA 4MJCA 1BEDA 1E2YA 4L0WA 1EP7A 5B7CA 3IAS2 4ISDA 5DJMA 3TB2A 1ZMAA 1SYXA 2L6CA 2RLIA 4EC0A 1O85A 2AAWA 2PN8A 2H72A 2X8HA 3DRNA 3I6AA 1TK0B 3ERFA 1YKCA 1G6WA 3SWLA 2V32A 1M7TA 1NM3A 1XVWA 3A2WA 4HQSA 1A8YA 3TKRA 3GX8A 1YEPA 4TR1B 4DSQA 2ZNMA 3IR4A 1GUKA 3HA9A 1VF3A 1PN9A 4XRDA 2CV4A 2KLXA 3KGKA 4WBJA 5J9BA 2HRNA 4K0NA 3H8QA 5JWRB 2E2GA 3VWUA 4TXVA 4F0BA 3RBTA 5CYYA 4MF5A 2P5QA 2H01A 3IE3A 2VCVA 2GZYA 5JWOB 3CSIA 2AYTA 1THOA 4K6XA 1T3BA 1M99A 4NV2A 5F07A 4ACSA 2H1GA 3ERGA 3IK7A 1M2AA 2YJHA 2JZRA 4WKWA 1ZOFA 3D6IA 1XVQA 2YWMA 4GQCA 1AQWA 2ALBA 6GSSA 4IBPA 3IBHA 3EU3A 2H6YA 2YANA 3FKFA 2I1UA 3ED3A 3GX0A 3UARA 1F37A 4EDZA 5ECHB 5GSTA 3GFKA 4X43A 3K8NA 3ZIVA 4BL7A 1KTEA 18GSA 1MTCA 4PNFA 1OKDA 4KW6A 5DQYA 5BRTA 1PX7A 2PPTA 5KOXA 1OE8A 2C80A 2H73A 3UBKA 3ZITA 1QUWA 2EIOA 5CRGA 4PQIA 5ECIB 5ECPB 4ECBA 4MPGA 2FA4A 3RPPA 5G2ZA 3TJBA 1GRXA 1S3CA 9GSSA 1K3YA 4K0GA 1WMJA 1PD21 1SKWB 3HVVA 3HZ8A 4EL1A 4JR4A 1TTZA 4NV5A 3M1GA 4JR6A 3DYRA 1RW1A 1A2LA 3N9JA 2LJRA 1SJ6A 3M0FA 2I3YA 1DE1A 1EGRA 2NPBA 5B6MA 4MABA 5DDLA 1ILOA 4MDCA 4GSSA 3KD0A 2OE3A 1B4QA 1YKAA 3ZLPA 1F2EA 2DJ3A 5HR3A 1TK5B 4XTSA 3C71A 2LEGA 4LMVA 4IJIA 2V6OA 4KDXA 3VWXA 1BX9A 2R5GA 3HJMA 3ZVJA 6GSUA 1OKTA 1TKDB 5IOXA 2X8GA 4MPFA 2VLVA 3F6DA 3L78A 4MLYA 4XRAA 1X5CA 1EZKA 4K7OA 5JCUA 2C1YA 2CX3A 3U6VA 3UEMA 2PVOC 3UVHA 2J9HA 1Y6EA 1TK8B 4GRFA 2FA8A 2AHEA 5JCWA 2VCZA 1TI3A 1HNCA 5HR0A 3UAPA 2FY6A 1OYJA 2F51A 3GYKA 1MD4A 4KSOA 6GSWA 3CBUA 2JL4A 4YQMA 1GULA 4NPBA 4G19A 2GSTA 4EVMA 3NIVA 4TXOA 1YQ1A 1NW2A 1FB6A 3IAM2 5EY6A 3LFLA 4QQ7A 1ACVA 1GTAA 2HFDA 2P0GA 3C7MA 5HFGA 1SKRB 2M72A 4ULXA 3BCKA 3FYGA 3DVWA 3QD9A 6GSVA 2TRXA 2GTUA 1R5PA 4Z2RA 2JZTA 1VF2A 1TOFA 2FWGA 3EC3A 3F3RA 1B9YC 3F3QA 2CVDA 1R5AA 2H8LA 2XBIA 3GV1A 4RUVA 3A2VA 2BTOT 4FQUA 3IPZA 2OE0A 2MYGA 3ZIJA 1B9XC 5DVBA 3A5WA 2ON5A 4I5QA 3D4TA 5ID2B 1G6YA 3APSA 1XWAA 4KCEA 2H66A 2QKEA 3GNJA 1ERVA 2ZUPA 2WDUA 4EKZA 5IO0A 4KCAA 3F4RA 2R4VA 3KP9A 2TIRA 3TJGA 10GSA 5IM9A 1XW9A 5E59A 1KBNA 4TVEA 4MMMA 4CY8A 1GTUA 3LORA 3VI7A 5GZZB 3VURA 2AB6A 2DBCA 2EIRA 1A24A 4HU7A 2KHPA 1XWGA 2HT9A 4EF0A 4LL4B 4ZB9A 1JLVA 2FWEA 4X4JA 1BG5A 3H1NA 5L71A 1GUMA 3EU4A 4HJ2A 4NWYA 4OD7A 2VD0A 3KMNA 3L0HA 2H1DA 1OC9B 1XCCA 4IHUA 1IYHA 4I2UA 1MEKA 2PMTA 3LG6A 4GXZA 5LD0A 3MDKA 2JSYA 1H75A 3QOUA 3BD2A 1QK8A 1NHOA 2WULA 3US3A 5ECRB 1Y25A 2X49A 2VOCA 3MAKA 1XWCA 2DIYA 2DJ0A 5H5SA 4N10A 1TRUA 3TOUA 3VPTA 2E2MA 4MA9A 5DQSA 3TUEA 3WGXA 4YKGA 4MK3A 2HRKA 5DALB 5ECSA 4F2IA 4ZBDA 3FEUA 3IK9A 1XIYA 2C0GA 4Q5QA 3AY8A 5DAKB 4A5PA 1PN0A 2C3QA 3WGEA 1K0DA 4NXIA 3PGTA 5A4VA 4K2DA 3QAGA 2H1AA 4KAEA 2FWFA 3CRUA 4WETA 2IMEA 3I43A 2FD3A 1V58A 4KH7A 5KN2A 3QAWA 1A23A 2A2PA 4BWSA 3GH6A 2QC7A 5HR2A 4ZXGA 2O85A 3FMWA 3JCML 4O5QA 2B5EA 2GSQA 1ST9A 4IW9A 4MZBA 2VUPA 1FVJA 3KCMA 2BMXA 2VCXA 3G7IA 1TRVA 3KIJA 2E0QA 3DEXA 1SD9A 3ME7A 3PH9A 4ZBAA 1ON4A 1Z9HA 5JWQB 3KEBA 2C0FA 2RUFA 2RM6A 4I97A 4XIHA 4X0XA 4O5RA 1GSSA 4HUAA 1GSQA 3ZFLA 4FIWA 2LJAA 4MJBA 2KOKA 3R3EA 3GKXA 3LEFA 2CX4A 3GA4A 14GSA 4BVXB 4RI7A 3WGDA 1URMA 3F4SA 4WXTA 1FO5A 2H75A 4AJ7A 1X9SB 1GH2A 2MMAA 4G0KA 3TKSE 4IP1A 3L9SA 5A5KA 2Z9SA 4G10A 5G5EA 5G1KA 2GLRA 2F8AA 4O32A 5DCHA 1F3AA 3F0IA 1AQXA 1X9MB 3KP8A 1AW9A 3TKSA 1WRYA 2MMNA 3BOAA 1J9BA 3F8UA 4WR4A 1G7EA 5IMCA 2HSYA 1K0BA 3EMXA 3HXSA 4HZ2A 1J0FA 3FZ9A 3EE2A 1FG4A 4OCFA 3QAVA 2X64A 5G5FA 2JU5A 4TKYA 4JZQA 3APOA 5IPGA 4F0CA 1O6JA 2KP1A 3GKKA 4TR4A 1FAAA 1UN2A 2WS2A 2CQ9A 1EEJA 1SJIA 4CHSA 4K5SA 4Z2UA 4MP4A 2PGTA 3QPMA 1X0RA 4G0LA 3IRAA 4LA1A 4KF9A 1TJDA 5D93A 2WGRA 2DMMA 2DJ1A 4KUNA 1Z7RA 2IWTA 4H86A 4Z2TA 1R4WA 3DXBA 3BCIA 2HYXA 2K9FA 2DJKA 1HD2A 1GTIA 3CXGA 4ZILA 3UOMA 2V1MA 1IYIA 3ISOA 2PVQA 1U6TA 3O76A 4CDOA 2HE3A 1I5GA 4X1UA 2REMA 5IMFA 4BL7B 1XW6A 7GSSA 3ZMKA 5ELAA 4V2MA 3W8JA 2FLSA 4DSSA 3TKSC 1B8XA 3ZTLA 1DE2A 3BBYA 1TXXA 2PERA 4LL1B 2VL9A 5IPHA 2H30A 1N8JA 1JZDA 4POLA 2VCQA 3EYTA 1JZWA 2C3TA 16GSA 2XBQA 2FHEA 3I69A 2C0EA 2H6ZA 4JU5A 4L5LA 3KH7A 3FY7A 2MBTA 3RPNA 3ZRDA 5CAXA 2H76A 4YAVA 1YDKA 5J41A 3MNGA 5D9VA 3GKNA 5CREA 2B3SA 4PX1A 4Q5NA 1A2JA 4ECIA 3IDVA 3W8SA 4E8HA 3UL3A 5B6NA 4Z7XA 5D8IA 1R7HA 1WPIA 2WZ9A 2C8UA 3LYPA 2YJ7A 4V2NA 1MDJA 2IL3A 1T8EB 4HOJA 1FOHA 1YZXA 4K5RA 4IS0A 4K9ZA 3TCOA 1AXDA 5GAPD 5BMUA 1K3OA 2NBSA 1PA3A 2IMKA 3KXOA 3GUSA 2DSAA 1GP1A 2JADA 3UVTA 2HRAA 5FWGA 4MCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G30 A;  5CRD A;  2B7J A;  5F06 A;  2FWH A;  3ZZX A;  5CP1 A;  4EE0 A;  2K8S A;  4MZW A;  1ZL9 A;  4KSM A;  2YOI A;  13GS A;  3EUR A;  4POK A;  1OAZ A;  3UJ1 A;  1Q4J A;  1LU4 A;  1GLQ A;  5CRH A;  3C73 A;  4TXO B;  3WT1 A;  2B5X A;  3O6T A;  1XW5 A;  4D73 A;  4YQV A;  1U3I A;  3MWH A;  2LTK A;  5J3R A;  4GLT A;  1Z5Y E;  3O3T A;  4K1F A;  2LUS A;  2AJQ B;  4EUY A;  3Q19 A;  4GTU A;  2IN3 A;  2N5F A;  5AIX A;  1A8L A;  4K7N A;  3E0U A;  5C04 A;  3ZML A;  4PQ1 A;  5ENU A;  3TGZ A;  4XS6 A;  3FR9 A;  1DUG A;  2GZP A;  2QGV A;  1U87 A;  2XPD A;  1Q98 A;  1O73 A;  2OE1 A;  3HCZ A;  3SBC A;  4NHW A;  3E3E A;  1HNB A;  1EV9 A;  4YQU A;  5F0G A;  3PIN A;  3BJ5 A;  4PNG A;  1W4V A;  17GS A;  4ID0 A;  5B8A A;  5DCG A;  2JAC A;  2YCD A;  1NHY A;  2NVL A;  3J7Y k;  2B5Y A;  4Q5F A;  2LS5 A;  4ZB8 A;  3IA1 A;  3H79 A;  2IFQ A;  3CTG A;  1WP0 A;  3D21 A;  3E9J B;  2CAQ A;  2CZ3 A;  1ZYE A;  2YWN A;  5FHI A;  1U88 A;  2G0F A;  2HZE A;  3CTF A;  4HS1 A;  1SU9 A;  4I6X A;  3FZ4 A;  2O87 A;  2K18 A;  4LMW A;  4IQA A;  3HY2 A;  4QL7 A;  1ML6 A;  3HZ4 A;  4KX4 A;  3IOS A;  4EO3 A;  5AIV A;  3ME8 A;  2L57 A;  1YEX A;  5CO3 A;  3CSJ A;  4PUR A;  1RQM A;  2C4J A;  3F63 A;  2JZS A;  1FOV A;  4TR0 A;  2HZF A;  3CSH A;  3QFA C;  3RAZ A;  3KZQ A;  1EOG A;  4YAP A;  1JZO A;  3ERW A;  4ZL9 A;  3QR6 A;  3LGC A;  5GAN D;  2VM2 A;  3L4N A;  3VPQ A;  3HVS A;  1CQH A;  1OC3 A;  2LRC A;  3RDW A;  1A2M A;  4V2L A;  1F9M A;  2FNO A;  1M2B A;  1TI1 A;  4IQ1 A;  2H6X A;  1K3L A;  4HU9 A;  1B4P A;  2HLS A;  1O8X A;  4JBB A;  1PKZ A;  1HQO A;  1GNW A;  2B7K A;  2LNS A;  4ML1 A;  1PGT A;  4L0U A;  5E4W A;  4J56 E;  2PWJ A;  4AGS A;  1TRS A;  2DJJ A;  4GSN A;  4DEJ A;  4IJ3 A;  2G2Q A;  2B1K A;  4EDY A;  5JCG A;  3P7X A;  5ECO B;  5IMD A;  5HFK A;  4XS4 A;  3WYW A;  3GTU A;  1K0A A;  1XOB A;  1SD8 A;  2HSH A;  2MBS A;  3I9V 2;  5D73 A;  1XPV A;  3GSS A;  2F8F A;  2R6K A;  1QMV A;  2K8V A;  3S9F A;  1V98 A;  5ECM B;  5LNK e;  1HYU A;  3A3T A;  1GSY A;  4XS1 A;  3WD6 A;  8GSS A;  4G9H A;  4GST A;  4GF0 A;  4RI6 A;  4KGI A;  2O8V B;  1G7O A;  2VD1 A;  4IGJ A;  3FHK A;  3APQ A;  3KH9 A;  1O81 A;  2IMI A;  3VI5 A;  3G9B A;  1QFN A;  5COH A;  1LJR A;  5DBQ A;  4MF6 A;  3Q74 A;  1SL2 B;  3HJO A;  1WE0 A;  3IXR A;  1JZR A;  1G0T A;  4JED A;  12GS A;  3QMX A;  2LRN A;  3MSZ A;  5F05 A;  4AJ8 A;  3DVX A;  1TW9 A;  2H1B A;  3EMP A;  3LSZ A;  2H71 A;  4GWR A;  3NZN A;  1KNG A;  1TRW A;  2YZU A;  1WOU A;  3FR3 A;  1JHB A;  1EWX A;  1XZO A;  2IPA A;  5GSS A;  3EVI A;  4NMU A;  2PU9 C;  1Z6M A;  3QCP A;  2ON7 A;  4KA0 A;  2H70 A;  1EEM A;  1THX A;  1XWB A;  6GSY A;  4MF7 A;  4PQH A;  1X5E A;  1FHE A;  1PSQ A;  1FB0 A;  3PR8 A;  3GH9 A;  2P5R A;  5AIS A;  1M0U A;  4NHZ A;  4YH2 A;  5J4U A;  2P31 A;  1TU7 A;  2FGX A;  2LKU A;  4WEY A;  2GSR A;  3G7Y A;  3D4M A;  2HI7 A;  1BQ7 A;  4L5O A;  2X8C A;  2CT6 A;  2OBI A;  4WR5 A;  4WBR D;  4V1A p;  1EP8 A;  2FCH A;  2L4C A;  1F3B A;  1V9W A;  4F9Z A;  2VAF A;  4PUF C;  2A2S A;  4ZL7 A;  5D9X A;  4F82 A;  1X9W B;  2B1L A;  2H0I A;  3J7Y b;  1WWJ A;  1Z3E A;  1SJZ A;  1ERW A;  4CW9 A;  4P3Y B;  2FUG 2;  4PXO A;  4ILF A;  2LJK A;  1FW1 A;  4O92 A;  1SL1 B;  6GST A;  4AF2 A;  1GUH A;  1N2A A;  4ECJ A;  2LST A;  4WF5 A;  2GT5 A;  4ECC A;  2CVB A;  3L9V A;  2I9H A;  3KMO A;  4J57 E;  3KTL A;  3LWA A;  4GCI A;  4MH2 A;  2YPM A;  2VL2 C;  4BWQ A;  4POM A;  1KEB A;  2VLT A;  1PRX A;  4JRR A;  4RQX A;  1GSF A;  5J9C A;  22GS A;  2R3X A;  2GDR A;  4TRX A;  5D96 A;  4HZ4 A;  2VIM A;  2GS3 A;  4OFN A;  3GMF A;  1DSB A;  2OAC A;  1GNE A;  4E8E A;  4HQZ A;  4DSS B;  5G1L A;  1V40 A;  1XOA A;  1I9D A;  3ZYW A;  4DSR A;  2OA7 A;  4KDU A;  3DGQ A;  2K6V A;  3RHB A;  3GHA A;  3VLN A;  2LRT A;  1XFL A;  4IN0 A;  3TJK A;  1UC7 A;  4OMV A;  3DD3 A;  4GQF A;  1TU8 A;  4ZL8 A;  1BYE A;  2DML A;  5AGY A;  2V6K A;  2XC2 A;  3HD5 A;  2HRF A;  4MJE A;  2F3M A;  3IC4 A;  1PQN A;  1YF0 A;  4IVF A;  4TR1 A;  2DLX A;  1QXH A;  3VWV A;  3M9J A;  4MZC A;  4HJM A;  3TRX A;  3R2Q A;  5J5N A;  2VM1 A;  5EPF A;  3LJR A;  3FR6 A;  2CZ2 A;  2LV3 A;  3LQ7 A;  1B48 A;  3HVX A;  3FK8 A;  2AV4 A;  1YF1 A;  1LBK A;  2ES7 A;  3DML A;  3Q18 A;  3KM6 A;  5EL8 A;  1AAZ A;  3CYN A;  3UIW A;  3VK9 A;  2H19 A;  2I4A A;  3TKQ A;  2H74 A;  5DJL A;  3D0Z A;  5IIZ A;  3TJJ A;  4BA7 A;  2B6M A;  3TDG A;  4OCE A;  3ZRE A;  4KE3 A;  1T1V A;  4I2T A;  5CRW A;  1K0N A;  2YNX A;  4PUA A;  3H93 A;  3TRQ A;  4POB A;  1BAY A;  1W89 A;  4OO4 A;  1OE7 A;  2ZCT A;  3HKR A;  2I81 A;  5HQP A;  1ZGN A;  2GQM A;  20GS A;  1XXU A;  3GKM A;  2N5A A;  4LLR A;  1ERU A;  3EWL A;  2V41 A;  3DWV A;  1PKW A;  2YV7 A;  3V1W A;  2MZC A;  3FZA A;  1R26 A;  4D73 B;  2RM5 A;  1E6B A;  2L4Q A;  1PL1 A;  1RK4 A;  2IIY A;  3QFB C;  1PX6 A;  2L59 A;  1GSU A;  4TN8 A;  3U5R E;  1K0M A;  1K0O A;  3IHQ A;  3IV4 A;  2PBJ A;  1Z6N A;  2YZH A;  4NAX A;  4KND A;  2CAI A;  5IQY A;  4FO5 A;  1V57 A;  4ZBB A;  3P8W A;  1GWC A;  3TOT A;  5KEJ A;  3L9U A;  5IMV A;  1AIU A;  3NOF A;  3P2A A;  3CMI A;  1M9B A;  2X99 A;  1MDK A;  2GSS A;  4KB3 A;  5C00 A;  1A0F A;  4TOP A;  4ML6 A;  1MDI A;  2YN1 A;  1UA5 A;  3FZ5 A;  4G2E A;  2H0G A;  5A4U A;  2KP2 A;  1CQG A;  1EGO A;  3HJP A;  2PUK C;  2HXK A;  2IFQ B;  3OR5 A;  2V2G A;  1VGL A;  2DC5 A;  2QSI A;  2DJ2 A;  1QGV A;  5ECL B;  2HZE B;  3GRX A;  3GST A;  5ABR A;  4FYU A;  4N0V A;  4HDE A;  3A2X A;  3CRT A;  5ECK B;  1GL8 A;  1U3A A;  1SKS B;  3TRP A;  1UVZ A;  1M2D A;  1SEN A;  1PL2 A;  3GUR A;  4BVY A;  1AUC A;  2WFC A;  5INY A;  2LNT A;  2L6D A;  2YV9 A;  2VL3 A;  4XCS A;  2N5B A;  1NSW A;  2JSZ A;  2C0D A;  1S3A A;  1JLW A;  3M8N A;  5HFI A;  2OJL A;  2F9S A;  2RII A;  3KJY A;  6GSX A;  2CA8 A;  1C72 A;  1T4Y A;  2GGT A;  2C3N A;  2KUC A;  1YJ6 A;  3C8E A;  11GS A;  4QL9 A;  1J08 A;  2VO4 A;  2CVK A;  3M3M A;  3GN3 A;  4IP6 A;  5H5R A;  4RQR A;  3QDN A;  5D9T A;  2A4V A;  2GQL A;  4N30 A;  2WJU A;  1DBY A;  3Q6O A;  2EC4 A;  5KN3 A;  1USB A;  3TKP A;  5IMA A;  2VLU A;  5CNW A;  3HYP A;  2YP6 A;  3FRC A;  3VWW A;  2L5L A;  1XBS A;  1GLP A;  3N5O A;  3C1R A;  5ID2 A;  5IOW A;  4XS4 B;  2VCW A;  2O89 A;  4BPY A;  2RUE A;  1O8W A;  4IKH A;  4TW5 A;  4OFT A;  4OWY A;  2IMD A;  3GTU B;  1X5D A;  1ZCP A;  4MJA A;  1S3D A;  1F6M C;  2O7K A;  5D9W A;  5F8B A;  1OVN A;  2NDO A;  3D5J A;  2R2J A;  1ZZY A;  1WJK A;  1TP9 A;  5IMZ A;  1FVK A;  4N11 A;  1PMT A;  4IEL A;  19GS A;  4FYC A;  3FW2 A;  3HHV A;  3LXZ A;  2YWO A;  1ZYQ B;  2BJX A;  1GSD A;  4ZIJ A;  4JE1 A;  2M46 A;  2OBK A;  3ZL5 A;  1AC1 A;  1M9A A;  3W6G A;  2J23 A;  4OFM A;  5ECN B;  4K7I A;  3H4K A;  3D22 A;  4F03 A;  5AN1 A;  4FH8 A;  5IO2 A;  3ZVJ D;  4PGT A;  5H5Q A;  1MD3 A;  4L8E A;  3EIN A;  4AJ6 A;  1HNA A;  2WRT A;  3F4T A;  1OC9 A;  2OAD A;  1BJX A;  2GQK A;  2IJY A;  2L5O A;  3P90 A;  2R37 A;  1EOH A;  2VCT A;  3LYK A;  1T7P B;  4WF4 A;  3GIX A;  2WB9 A;  2XHF A;  3C1S A;  1A0R P;  5ELG A;  1ABA A;  4Q5R A;  1T4Z A;  2GT6 A;  2HNL A;  4J2F A;  1SK0 A;  2MMO A;  2XPE A;  3DKS A;  1XWK A;  4DVC A;  3G7J A;  3GL3 A;  1VF4 A;  3LXT A;  4TR3 A;  5KN1 A;  4HI7 A;  2MMZ A;  3RHC A;  5A4W A;  1EV4 A;  5FT3 A;  1O7U A;  1YY7 A;  2YWI A;  1QQ2 A;  2AUV A;  5DAL A;  4MH3 A;  4I8B A;  5B8B A;  5HR1 A;  5KN0 A;  2M80 A;  4HEA 2;  1H4O A;  3F6F A;  3TJF A;  1TDI A;  3M9K A;  4OO5 A;  5DAK A;  2TRC P;  1WIK A;  2VL2 A;  1GTB A;  4V1A g;  2H0H A;  2OKA A;  1AQV A;  5LCZ A;  1K0C A;  2LQO A;  4O7H A;  2DIZ A;  2WCI A;  2GZZ A;  2A2R A;  1V2A A;  3WT2 A;  1VRS D;  3ZFB A;  1JFU A;  1GSE A;  1SK2 A;  1ERT A;  3HDC A;  3KTB A;  2NTO A;  3F9U A;  1T00 A;  4KDY A;  5G31 A;  1OC8 A;  4FYB A;  4K8M A;  4ZB6 A;  2LQQ A;  2D2Z A;  4EXJ A;  4XHM A;  1SYR A;  1SL0 B;  3UMA A;  3UBL A;  2IMF A;  2EIQ A;  2GVP A;  1SK1 A;  1VF1 A;  4BVX A;  3VFI A;  1Z7P A;  3GL5 A;  2E7P A;  3DIE A;  4N0Z A;  5ECQ B;  5EVO A;  4MJC A;  1BED A;  1E2Y A;  4L0W A;  1EP7 A;  5B7C A;  3IAS 2;  4ISD A;  5DJM A;  3TB2 A;  1ZMA A;  1SYX A;  2L6C A;  2RLI A;  4EC0 A;  1O85 A;  2AAW A;  2PN8 A;  2H72 A;  2X8H A;  3DRN A;  3I6A A;  1TK0 B;  3ERF A;  1YKC A;  1G6W A;  3SWL A;  2V32 A;  1M7T A;  1NM3 A;  1XVW A;  3A2W A;  4HQS A;  1A8Y A;  3TKR A;  3GX8 A;  1YEP A;  4TR1 B;  4DSQ A;  2ZNM A;  3IR4 A;  1GUK A;  3HA9 A;  1VF3 A;  1PN9 A;  4XRD A;  2CV4 A;  2KLX A;  3KGK A;  4WBJ A;  5J9B A;  2HRN A;  4K0N A;  3H8Q A;  5JWR B;  2E2G A;  3VWU A;  4TXV A;  4F0B A;  3RBT A;  5CYY A;  4MF5 A;  2P5Q A;  2H01 A;  3IE3 A;  2VCV A;  2GZY A;  5JWO B;  3CSI A;  2AYT A;  1THO A;  4K6X A;  1T3B A;  1M99 A;  5F07 A;  4NV2 A;  4ACS A;  2H1G A;  3ERG A;  3IK7 A;  1M2A A;  2YJH A;  2JZR A;  4WKW A;  1ZOF A;  3D6I A;  1XVQ A;  2YWM A;  4GQC A;  1AQW A;  2ALB A;  6GSS A;  4IBP A;  3IBH A;  3EU3 A;  2H6Y A;  2YAN A;  3FKF A;  2I1U A;  3ED3 A;  3GX0 A;  3UAR A;  1F37 A;  4EDZ A;  5ECH B;  5GST A;  3GFK A;  4X43 A;  3K8N A;  3ZIV A;  4BL7 A;  1KTE A;  18GS A;  1MTC A;  4PNF A;  1OKD A;  4KW6 A;  5DQY A;  1PX7 A;  2PPT A;  1OE8 A;  2C80 A;  2H73 A;  3UBK A;  3ZIT A;  1QUW A;  2EIO A;  5CRG A;  4PQI A;  5ECI B;  5ECP B;  4ECB A;  4MPG A;  2FA4 A;  3RPP A;  5G2Z A;  3TJB A;  1GRX A;  1S3C A;  9GSS A;  1K3Y A;  4K0G A;  1WMJ A;  1PD2 1;  1SKW B;  3HVV A;  3HZ8 A;  4EL1 A;  4JR4 A;  1TTZ A;  4NV5 A;  3M1G A;  4JR6 A;  3DYR A;  1RW1 A;  1A2L A;  3N9J A;  2LJR A;  1SJ6 A;  3M0F A;  2I3Y A;  1DE1 A;  1EGR A;  2NPB A;  5B6M A;  4MAB A;  5DDL A;  1ILO A;  4MDC A;  4GSS A;  3KD0 A;  2OE3 A;  1B4Q A;  1YKA A;  3ZLP A;  1F2E A;  2DJ3 A;  5HR3 A;  1TK5 B;  4XTS A;  3C71 A;  2LEG A;  4LMV A;  4IJI A;  2V6O A;  4KDX A;  3VWX A;  1BX9 A;  2R5G A;  3HJM A;  3ZVJ A;  6GSU A;  1OKT A;  1TKD B;  5IOX A;  2X8G A;  4MPF A;  2VLV A;  3F6D A;  3L78 A;  4MLY A;  4XRA A;  1X5C A;  1EZK A;  4K7O A;  5JCU A;  2C1Y A;  2CX3 A;  3U6V A;  3UEM A;  2PVO C;  3UVH A;  2J9H A;  1Y6E A;  1TK8 B;  4GRF A;  2FA8 A;  2AHE A;  5JCW A;  2VCZ A;  1TI3 A;  1HNC A;  5HR0 A;  3UAP A;  2FY6 A;  1OYJ A;  2F51 A;  3GYK A;  1MD4 A;  4KSO A;  6GSW A;  3CBU A;  2JL4 A;  4YQM A;  1GUL A;  4NPB A;  4G19 A;  2GST A;  4EVM A;  3NIV A;  4TXO A;  1YQ1 A;  1NW2 A;  1FB6 A;  3IAM 2;  5EY6 A;  3LFL A;  4QQ7 A;  1ACV A;  1GTA A;  2HFD A;  2P0G A;  3C7M A;  5HFG A;  1SKR B;  2M72 A;  4ULX A;  3BCK A;  3FYG A;  3DVW A;  3QD9 A;  6GSV A;  2TRX A;  2GTU A;  1R5P A;  2JZT A;  1VF2 A;  1TOF A;  2FWG A;  3EC3 A;  3F3R A;  1B9Y C;  3F3Q A;  2CVD A;  1R5A A;  2H8L A;  2XBI A;  3GV1 A;  4RUV A;  3A2V A;  2BTO T;  3IPZ A;  2OE0 A;  2MYG A;  3ZIJ A;  1B9X C;  5DVB A;  3A5W A;  2ON5 A;  4I5Q A;  3D4T A;  5ID2 B;  1G6Y A;  3APS A;  1XWA A;  4KCE A;  2H66 A;  2QKE A;  3GNJ A;  1ERV A;  2ZUP A;  2WDU A;  4EKZ A;  5IO0 A;  4KCA A;  3F4R A;  2R4V A;  3KP9 A;  2TIR A;  3TJG A;  10GS A;  5IM9 A;  1XW9 A;  5E59 A;  1KBN A;  4TVE A;  4MMM A;  1GTU A;  3LOR A;  3VI7 A;  5GZZ B;  3VUR A;  2AB6 A;  2DBC A;  2EIR A;  1A24 A;  4HU7 A;  2KHP A;  1XWG A;  2HT9 A;  4EF0 A;  4LL4 B;  4ZB9 A;  1JLV A;  2FWE A;  1BG5 A;  3H1N A;  5L71 A;  1GUM A;  3EU4 A;  4HJ2 A;  4NWY A;  4OD7 A;  2VD0 A;  3KMN A;  3L0H A;  2H1D A;  1OC9 B;  1XCC A;  4IHU A;  1IYH A;  4I2U A;  1MEK A;  2PMT A;  3LG6 A;  4GXZ A;  5LD0 A;  3MDK A;  2JSY A;  1H75 A;  3QOU A;  3BD2 A;  1QK8 A;  1NHO A;  2WUL A;  3US3 A;  5ECR B;  1Y25 A;  2VOC A;  3MAK A;  1XWC A;  2DIY A;  2DJ0 A;  5H5S A;  4N10 A;  1TRU A;  3TOU A;  3VPT A;  2E2M A;  4MA9 A;  5DQS A;  3TUE A;  3WGX A;  4MK3 A;  5DAL B;  5ECS A;  4F2I A;  4ZBD A;  3FEU A;  3IK9 A;  1XIY A;  2C0G A;  4Q5Q A;  3AY8 A;  5DAK B;  2C3Q A;  3WGE A;  1K0D A;  4NXI A;  3PGT A;  5A4V A;  4K2D A;  3QAG A;  2H1A A;  4KAE A;  2FWF A;  3CRU A;  4WET A;  2IME A;  3I43 A;  2FD3 A;  1V58 A;  4KH7 A;  5KN2 A;  3QAW A;  1A23 A;  4BWS A;  3GH6 A;  2QC7 A;  5HR2 A;  4ZXG A;  2O85 A;  3JCM L;  2B5E A;  2GSQ A;  1ST9 A;  4IW9 A;  4MZB A;  2VUP A;  1FVJ A;  3KCM A;  2BMX A;  2VCX A;  3G7I A;  1TRV A;  3KIJ A;  2E0Q A;  3DEX A;  1SD9 A;  3ME7 A;  3PH9 A;  4ZBA A;  1ON4 A;  1Z9H A;  5JWQ B;  3KEB A;  2C0F A;  2RUF A;  2RM6 A;  4I97 A;  4XIH A;  4X0X A;  4O5R A;  1GSS A;  4HUA A;  1GSQ A;  3ZFL A;  4FIW A;  2LJA A;  4MJB A;  2KOK A;  3GKX A;  3LEF A;  2CX4 A;  3GA4 A;  14GS A;  4RI7 A;  3WGD A;  1URM A;  3F4S A;  4WXT A;  1FO5 A;  2H75 A;  4AJ7 A;  1X9S B;  1GH2 A;  2MMA A;  3TKS E;  4IP1 A;  3L9S A;  5A5K A;  2Z9S A;  4G10 A;  5G5E A;  5G1K A;  2GLR A;  2F8A A;  4O32 A;  5DCH A;  1F3A A;  3F0I A;  1AQX A;  1X9M B;  3KP8 A;  1AW9 A;  3TKS A;  1WRY A;  2MMN A;  3BOA A;  1J9B A;  3F8U A;  4WR4 A;  1G7E A;  5IMC A;  2HSY A;  1K0B A;  3EMX A;  3HXS A;  4HZ2 A;  1J0F A;  3FZ9 A;  3EE2 A;  1FG4 A;  4OCF A;  3QAV A;  2X64 A;  5G5F A;  2JU5 A;  4TKY A;  4JZQ A;  3APO A;  5IPG A;  4F0C A;  1O6J A;  2KP1 A;  3GKK A;  4TR4 A;  1FAA A;  1UN2 A;  2WS2 A;  2CQ9 A;  1EEJ A;  1SJI A;  4CHS A;  4MP4 A;  2PGT A;  3QPM A;  1X0R A;  3IRA A;  4LA1 A;  1TJD A;  5D93 A;  2WGR A;  2DMM A;  2DJ1 A;  4KUN A;  1Z7R A;  2IWT A;  4H86 A;  1R4W A;  3DXB A;  3BCI A;  2HYX A;  2K9F A;  2DJK A;  1HD2 A;  1GTI A;  3CXG A;  4ZIL A;  3UOM A;  2V1M A;  1IYI A;  3ISO A;  2PVQ A;  1U6T A;  3O76 A;  4CDO A;  2HE3 A;  1I5G A;  4X1U A;  2REM A;  5IMF A;  7GSS A;  1XW6 A;  3ZMK A;  5ELA A;  4V2M A;  3W8J A;  2FLS A;  4DSS A;  3TKS C;  1B8X A;  3ZTL A;  1DE2 A;  3BBY A;  1TXX A;  2PER A;  4LL1 B;  2VL9 A;  5IPH A;  2H30 A;  1N8J A;  1JZD A;  4POL A;  2VCQ A;  3EYT A;  1JZW A;  2C3T A;  16GS A;  2XBQ A;  2FHE A;  3I69 A;  2C0E A;  2H6Z A;  4JU5 A;  4L5L A;  3KH7 A;  3FY7 A;  2MBT A;  3RPN A;  3ZRD A;  5CAX A;  2H76 A;  4YAV A;  1YDK A;  5J41 A;  3MNG A;  5D9V A;  3GKN A;  5CRE A;  2B3S A;  4PX1 A;  4Q5N A;  1A2J A;  4ECI A;  3IDV A;  3W8S A;  4E8H A;  3UL3 A;  5B6N A;  4Z7X A;  5D8I A;  1R7H A;  1WPI A;  2WZ9 A;  2C8U A;  3LYP A;  2YJ7 A;  4V2N A;  1MDJ A;  2IL3 A;  1T8E B;  4HOJ A;  1YZX A;  4IS0 A;  4K9Z A;  3TCO A;  1AXD A;  5GAP D;  1K3O A;  2NBS A;  1PA3 A;  2IMK A;  3KXO A;  3GUS A;  2DSA A;  1GP1 A;  2JAD A;  3UVT A;  5FWG A;  4MCU A; 
#chains in the Genus database with same CATH topology
 5G30 A;  5CRD A;  2B7J A;  5F06 A;  2FWH A;  3ZZX A;  5CP1 A;  4EE0 A;  2K8S A;  4MZW A;  1ZL9 A;  4KSM A;  2YOI A;  13GS A;  3EUR A;  4POK A;  1OAZ A;  3UJ1 A;  1Q4J A;  1LU4 A;  1GLQ A;  5CRH A;  3C73 A;  4TXO B;  3WT1 A;  2B5X A;  3O6T A;  4MNN A;  1XW5 A;  4D73 A;  4YQV A;  1U3I A;  3MWH A;  2LTK A;  5J3R A;  4GLT A;  1Z5Y E;  3O3T A;  4K1F A;  2LUS A;  2AJQ B;  4EUY A;  3Q19 A;  4GTU A;  2IN3 A;  2N5F A;  5AIX A;  1A8L A;  4K7N A;  3E0U A;  5C04 A;  1ZYN A;  3ZML A;  4PQ1 A;  5ENU A;  3TGZ A;  4XS6 A;  3FR9 A;  1DUG A;  2GZP A;  2QGV A;  1U87 A;  2XPD A;  1Q98 A;  1O73 A;  2OE1 A;  4G0I A;  3HCZ A;  3SBC A;  4NHW A;  3E3E A;  1HNB A;  1EV9 A;  4YQU A;  5F0G A;  3PIN A;  3BJ5 A;  4PNG A;  1W4V A;  17GS A;  4ID0 A;  5B8A A;  5DCG A;  2JAC A;  2YCD A;  1NHY A;  2NVL A;  3J7Y k;  2B5Y A;  4Q5F A;  2LS5 A;  4ZB8 A;  3IA1 A;  3H79 A;  2IFQ A;  3CTG A;  1WP0 A;  3D21 A;  3E9J B;  2CAQ A;  2CZ3 A;  1ZYE A;  2YWN A;  5FHI A;  1U88 A;  2G0F A;  2HZE A;  3CTF A;  4HS1 A;  1SU9 A;  4I6X A;  3FZ4 A;  2O87 A;  2K18 A;  4LMW A;  4IQA A;  3HY2 A;  4QL7 A;  1ML6 A;  3MYD A;  3HZ4 A;  4KX4 A;  3IOS A;  4EO3 A;  5AIV A;  3ME8 A;  2L57 A;  1YEX A;  5CO3 A;  3CSJ A;  4PUR A;  1RQM A;  2C4J A;  3F63 A;  2JZS A;  1FOV A;  4TR0 A;  2HZF A;  3CSH A;  3QFA C;  3RAZ A;  3KZQ A;  1EOG A;  4YAP A;  1JZO A;  3ERW A;  3LW9 A;  4ZL9 A;  3QR6 A;  3LGC A;  5GAN D;  2VM2 A;  3L4N A;  3VPQ A;  3HVS A;  1CQH A;  1OC3 A;  2LRC A;  3RDW A;  1A2M A;  4V2L A;  1F9M A;  2FNO A;  1M2B A;  1TI1 A;  4IQ1 A;  2H6X A;  1K3L A;  4HU9 A;  1B4P A;  2HLS A;  1O8X A;  4JBB A;  1PKZ A;  1HQO A;  1GNW A;  2B7K A;  2LNS A;  4ML1 A;  1PGT A;  4L0U A;  5E4W A;  4J56 E;  2PWJ A;  4AGS A;  1TRS A;  2DJJ A;  4GSN A;  4DEJ A;  4IJ3 A;  2G2Q A;  2B1K A;  4EDY A;  5JCG A;  3P7X A;  5ECO B;  5IMD A;  5HFK A;  2R0C A;  4XS4 A;  3WYW A;  3GTU A;  1K0A A;  1XOB A;  1SD8 A;  2HSH A;  2MBS A;  3I9V 2;  5D73 A;  1XPV A;  3GSS A;  2F8F A;  2R6K A;  1QMV A;  2K8V A;  3S9F A;  1V98 A;  5ECM B;  5LNK e;  1HYU A;  3A3T A;  1GSY A;  4XS1 A;  3WD6 A;  8GSS A;  4G9H A;  4GST A;  4GF0 A;  4RI6 A;  4KGI A;  2O8V B;  1G7O A;  2VD1 A;  4IGJ A;  3FHK A;  3APQ A;  3KH9 A;  1O81 A;  2IMI A;  3VI5 A;  3G9B A;  1QFN A;  5COH A;  1LJR A;  5DBQ A;  4MF6 A;  3Q74 A;  1SL2 B;  2DKH A;  2R0P A;  3HJO A;  1WE0 A;  3IXR A;  1JZR A;  1G0T A;  4USS A;  4JED A;  3IC8 A;  12GS A;  3QMX A;  2LRN A;  3MSZ A;  5F05 A;  4AJ8 A;  3DVX A;  1TW9 A;  2H1B A;  3EMP A;  3LSZ A;  2H71 A;  4GWR A;  3NZN A;  1KNG A;  1TRW A;  2YZU A;  1WOU A;  3FR3 A;  1JHB A;  1EWX A;  1XZO A;  2IPA A;  5GSS A;  3EVI A;  4NMU A;  2PU9 C;  1Z6M A;  3QCP A;  2ON7 A;  4KA0 A;  2H70 A;  1EEM A;  1THX A;  1XWB A;  6GSY A;  4MF7 A;  4PQH A;  1X5E A;  1FHE A;  1PSQ A;  1FB0 A;  3PR8 A;  3GH9 A;  2P5R A;  5AIS A;  1M0U A;  4NHZ A;  4YH2 A;  5J4U A;  2P31 A;  1TU7 A;  2FGX A;  2LKU A;  3MIX A;  4WEY A;  2GSR A;  3G7Y A;  3D4M A;  2HI7 A;  1BQ7 A;  4L5O A;  2X8C A;  2CT6 A;  2OBI A;  4WR5 A;  4WBR D;  4V1A p;  1EP8 A;  2FCH A;  2L4C A;  1F3B A;  1V9W A;  4CY6 A;  4F9Z A;  2VAF A;  4PUF C;  2A2S A;  4ZL7 A;  5D9X A;  4F82 A;  1X9W B;  2B1L A;  3IHG A;  2H0I A;  3J7Y b;  1WWJ A;  1Z3E A;  1SJZ A;  1ERW A;  4CW9 A;  4P3Y B;  2FUG 2;  4PXO A;  4ILF A;  2LJK A;  1FW1 A;  4O92 A;  1SL1 B;  6GST A;  4AF2 A;  1GUH A;  1N2A A;  4ECJ A;  2LST A;  4WF5 A;  2GT5 A;  4ECC A;  2CVB A;  3L9V A;  2I9H A;  3KMO A;  4J57 E;  3KTL A;  3LWA A;  4GCI A;  4MH2 A;  2YPM A;  2VL2 C;  4BWQ A;  4POM A;  1KEB A;  2VLT A;  1PRX A;  4JRR A;  4RQX A;  1GSF A;  5J9C A;  22GS A;  2R3X A;  2GDR A;  4TRX A;  5D96 A;  4HZ4 A;  2VIM A;  2GS3 A;  4OFN A;  4EIQ A;  3GMF A;  1DSB A;  2OAC A;  1GNE A;  4E8E A;  4HQZ A;  4DSS B;  5G1L A;  1V40 A;  1XOA A;  1I9D A;  3ZYW A;  4DSR A;  2OA7 A;  4KDU A;  3DGQ A;  2K6V A;  3RHB A;  3GHA A;  3VLN A;  2LRT A;  1XFL A;  4IN0 A;  3TJK A;  1UC7 A;  4OMV A;  3DD3 A;  4GQF A;  1TU8 A;  4ZL8 A;  1BYE A;  2DML A;  5AGY A;  2V6K A;  2XC2 A;  3HD5 A;  2R0G A;  2HRF A;  4MJE A;  2F3M A;  3IC4 A;  1PQN A;  1YF0 A;  4IVF A;  4TR1 A;  2DLX A;  1QXH A;  3VWV A;  1XG8 A;  3M9J A;  4MZC A;  4HJM A;  3TRX A;  3R2Q A;  5J5N A;  2VM1 A;  5EPF A;  3LJR A;  4ICY A;  3FR6 A;  2CZ2 A;  2LV3 A;  3LQ7 A;  1B48 A;  3HVX A;  3FK8 A;  2AV4 A;  1YF1 A;  1LBK A;  2ES7 A;  3DML A;  3Q18 A;  3KM6 A;  5EL8 A;  1AAZ A;  3CYN A;  3UIW A;  3VK9 A;  2H19 A;  2I4A A;  3TKQ A;  2H74 A;  5DJL A;  3D0Z A;  5IIZ A;  3TJJ A;  4BA7 A;  2B6M A;  3TDG A;  4OCE A;  3ZRE A;  4KE3 A;  1T1V A;  2DKI A;  4I2T A;  5CRW A;  1K0N A;  2YNX A;  4PUA A;  3H93 A;  3TRQ A;  4POB A;  1BAY A;  1W89 A;  4OO4 A;  1OE7 A;  2ZCT A;  3HKR A;  2I81 A;  5HQP A;  1ZGN A;  2GQM A;  20GS A;  1XXU A;  3GKM A;  2N5A A;  4LLR A;  4YKF A;  1ERU A;  3EWL A;  2V41 A;  5KOW A;  3DWV A;  1PKW A;  2YV7 A;  3V1W A;  2MZC A;  3FZA A;  1R26 A;  3HVN A;  4D73 B;  2RM5 A;  1E6B A;  2L4Q A;  1PL1 A;  1RK4 A;  2IIY A;  3QFB C;  1PX6 A;  2L59 A;  1GSU A;  4TN8 A;  3U5R E;  1K0M A;  1K0O A;  3IHQ A;  3IV4 A;  2PBJ A;  1Z6N A;  2YZH A;  4NAX A;  4KND A;  2CAI A;  5IQY A;  4FO5 A;  1V57 A;  4ZBB A;  3P8W A;  1GWC A;  3TOT A;  5KEJ A;  3L9U A;  5IMV A;  1AIU A;  3NOF A;  3P2A A;  3CMI A;  1M9B A;  2X99 A;  1MDK A;  2GSS A;  4KB3 A;  5C00 A;  1A0F A;  4TOP A;  4ML6 A;  4O5U A;  1MDI A;  2YN1 A;  1UA5 A;  3FZ5 A;  4G2E A;  2H0G A;  5A4U A;  2KP2 A;  1CQG A;  1EGO A;  3HJP A;  2PUK C;  2HXK A;  2IFQ B;  4BVY B;  3OR5 A;  2V2G A;  1VGL A;  1ZYP A;  2DC5 A;  2QSI A;  2DJ2 A;  1QGV A;  5ECL B;  2HZE B;  3GRX A;  3GST A;  5ABR A;  3PPU A;  4FYU A;  4N0V A;  4HDE A;  3A2X A;  3CRT A;  5ECK B;  1GL8 A;  1U3A A;  1SKS B;  3TRP A;  1UVZ A;  1M2D A;  1SEN A;  1PL2 A;  3GUR A;  4BVY A;  1AUC A;  2WFC A;  5INY A;  2LNT A;  2L6D A;  2YV9 A;  2VL3 A;  4XCS A;  2N5B A;  1NSW A;  2QA1 A;  2JSZ A;  2C0D A;  1S3A A;  1JLW A;  3M8N A;  5HFI A;  2OJL A;  2F9S A;  2RII A;  3KJY A;  6GSX A;  2CA8 A;  1C72 A;  1T4Y A;  2GGT A;  2C3N A;  2KUC A;  1YJ6 A;  4PTS A;  3C8E A;  11GS A;  4QL9 A;  1J08 A;  2VO4 A;  2CVK A;  3M3M A;  3GN3 A;  4IP6 A;  5H5R A;  4RQR A;  3QDN A;  5D9T A;  2A4V A;  2GQL A;  4N30 A;  2WJU A;  1DBY A;  3Q6O A;  2EC4 A;  5KN3 A;  1USB A;  3TKP A;  5IMA A;  2VLU A;  5CNW A;  3HYP A;  2YP6 A;  3FRC A;  3VWW A;  2L5L A;  1XBS A;  1GLP A;  4BIK A;  3N5O A;  3C1R A;  2HSM A;  5ID2 A;  5IOW A;  4XS4 B;  2VCW A;  2O89 A;  4BPY A;  2RUE A;  1O8W A;  4IKH A;  4TW5 A;  4OFT A;  4OWY A;  2IMD A;  3GTU B;  1X5D A;  1ZCP A;  4MJA A;  1S3D A;  1F6M C;  2O7K A;  5D9W A;  5F8B A;  1OVN A;  2NDO A;  3D5J A;  2R2J A;  1ZZY A;  1WJK A;  1TP9 A;  5IMZ A;  1FVK A;  4N11 A;  1PMT A;  4IEL A;  19GS A;  4FYC A;  3FW2 A;  3HHV A;  3LXZ A;  2YWO A;  1ZYQ B;  2BJX A;  1GSD A;  4ZIJ A;  4JE1 A;  2M46 A;  2OBK A;  3ZL5 A;  1AC1 A;  1M9A A;  3W6G A;  2J23 A;  4OFM A;  2X4A A;  5ECN B;  4K7I A;  3H4K A;  3D22 A;  4F03 A;  5AN1 A;  4FH8 A;  5IO2 A;  2UZ8 A;  3ZVJ D;  4PGT A;  5H5Q A;  1MD3 A;  4L8E A;  3EIN A;  4AJ6 A;  1HNA A;  2WRT A;  3F4T A;  1OC9 A;  2OAD A;  1BJX A;  2GQK A;  2IJY A;  2L5O A;  3P90 A;  2R37 A;  1EOH A;  2VCT A;  3LYK A;  1T7P B;  4WF4 A;  3GIX A;  2WB9 A;  2XHF A;  3C1S A;  1A0R P;  5ELG A;  1ABA A;  4Q5R A;  3CQF A;  1T4Z A;  2GT6 A;  2HNL A;  4J2F A;  1SK0 A;  2MMO A;  2XPE A;  3A5I A;  3DKS A;  1XWK A;  4DVC A;  3G7J A;  3GL3 A;  1VF4 A;  3LXT A;  4TR3 A;  5KN1 A;  4HI7 A;  2MMZ A;  3RHC A;  5A4W A;  1EV4 A;  5FT3 A;  1O7U A;  1YY7 A;  2YWI A;  1QQ2 A;  2AUV A;  5DAL A;  4EIP A;  4MH3 A;  4I8B A;  5B8B A;  5HR1 A;  5KN0 A;  2M80 A;  4HEA 2;  1H4O A;  3F6F A;  3TJF A;  1TDI A;  3M9K A;  4OO5 A;  5DAK A;  2TRC P;  1WIK A;  2VL2 A;  1GTB A;  4V1A g;  2H0H A;  2OKA A;  1AQV A;  5LCZ A;  1K0C A;  2LQO A;  4O7H A;  2DIZ A;  2WCI A;  2GZZ A;  2A2R A;  2A4H A;  1V2A A;  3WT2 A;  1VRS D;  3ZFB A;  1JFU A;  1GSE A;  1SK2 A;  1ERT A;  3HDC A;  3KTB A;  2NTO A;  3F9U A;  1M3J A;  1T00 A;  4KDY A;  5G31 A;  1OC8 A;  4FYB A;  4K8M A;  4ZB6 A;  2LQQ A;  2D2Z A;  4EXJ A;  4XHM A;  1SYR A;  1SL0 B;  3UMA A;  3UBL A;  2IMF A;  2EIQ A;  2QA2 A;  4K2X A;  2GVP A;  1SK1 A;  1VF1 A;  3EPT A;  4BVX A;  3VFI A;  1Z7P A;  3GL5 A;  2E7P A;  3DIE A;  4N0Z A;  5ECQ B;  5EVO A;  4MJC A;  1BED A;  1E2Y A;  4L0W A;  1EP7 A;  5B7C A;  3IAS 2;  4ISD A;  5DJM A;  3TB2 A;  1ZMA A;  1SYX A;  2L6C A;  2RLI A;  4EC0 A;  1O85 A;  2AAW A;  2PN8 A;  2H72 A;  2X8H A;  3DRN A;  3I6A A;  1TK0 B;  3ERF A;  1YKC A;  1G6W A;  3SWL A;  2V32 A;  1M7T A;  1NM3 A;  1XVW A;  3A2W A;  4HQS A;  1A8Y A;  3TKR A;  3GX8 A;  1YEP A;  4TR1 B;  4DSQ A;  2ZNM A;  3IR4 A;  1GUK A;  3HA9 A;  1VF3 A;  1PN9 A;  4XRD A;  2CV4 A;  2KLX A;  3KGK A;  4WBJ A;  5J9B A;  2HRN A;  4K0N A;  3H8Q A;  5JWR B;  2E2G A;  3VWU A;  4TXV A;  4F0B A;  3RBT A;  5CYY A;  4MF5 A;  2P5Q A;  2H01 A;  3IE3 A;  2VCV A;  2GZY A;  5JWO B;  3CSI A;  2AYT A;  1THO A;  4K6X A;  1T3B A;  1M99 A;  4NV2 A;  5F07 A;  4ACS A;  2H1G A;  3ERG A;  3IK7 A;  1M2A A;  2YJH A;  2JZR A;  4WKW A;  1ZOF A;  3D6I A;  1XVQ A;  2YWM A;  4GQC A;  1AQW A;  2ALB A;  6GSS A;  4IBP A;  3IBH A;  3EU3 A;  2H6Y A;  2YAN A;  3FKF A;  2I1U A;  3ED3 A;  3GX0 A;  3UAR A;  1F37 A;  4EDZ A;  5ECH B;  5GST A;  3GFK A;  4X43 A;  3K8N A;  3ZIV A;  4BL7 A;  1KTE A;  18GS A;  1MTC A;  4PNF A;  1OKD A;  4KW6 A;  5DQY A;  5BRT A;  1PX7 A;  2PPT A;  5KOX A;  1OE8 A;  2C80 A;  2H73 A;  3UBK A;  3ZIT A;  1QUW A;  2EIO A;  5CRG A;  4HSC X;  4PQI A;  5ECI B;  5ECP B;  4ECB A;  4MPG A;  2FA4 A;  3RPP A;  5G2Z A;  3TJB A;  1GRX A;  1S3C A;  9GSS A;  1K3Y A;  4K0G A;  1WMJ A;  1PD2 1;  1SKW B;  3HVV A;  3HZ8 A;  4EL1 A;  4JR4 A;  1TTZ A;  4NV5 A;  3M1G A;  4JR6 A;  3DYR A;  1RW1 A;  1A2L A;  3N9J A;  2LJR A;  1SJ6 A;  3M0F A;  2I3Y A;  1DE1 A;  1EGR A;  2NPB A;  5B6M A;  4MAB A;  5DDL A;  1ILO A;  4MDC A;  4GSS A;  3KD0 A;  2OE3 A;  1B4Q A;  1YKA A;  3ZLP A;  1F2E A;  2DJ3 A;  5HR3 A;  1TK5 B;  4XTS A;  3C71 A;  2LEG A;  4LMV A;  4IJI A;  2V6O A;  4KDX A;  3VWX A;  1BX9 A;  2R5G A;  3HJM A;  3ZVJ A;  6GSU A;  1OKT A;  1TKD B;  5IOX A;  2X8G A;  4MPF A;  2VLV A;  3F6D A;  3L78 A;  4MLY A;  4XRA A;  1X5C A;  1EZK A;  4K7O A;  5JCU A;  2C1Y A;  2CX3 A;  3U6V A;  3UEM A;  2PVO C;  3UVH A;  2J9H A;  1Y6E A;  1TK8 B;  4GRF A;  2FA8 A;  2AHE A;  5JCW A;  2VCZ A;  1TI3 A;  1HNC A;  5HR0 A;  3UAP A;  2FY6 A;  1OYJ A;  2F51 A;  3GYK A;  1MD4 A;  4KSO A;  6GSW A;  3CBU A;  2JL4 A;  4YQM A;  1GUL A;  4NPB A;  4G19 A;  2GST A;  4EVM A;  3NIV A;  4TXO A;  1YQ1 A;  1S3R A;  1NW2 A;  1FB6 A;  3IAM 2;  5EY6 A;  3LFL A;  4QQ7 A;  1ACV A;  1GTA A;  2HFD A;  2P0G A;  3C7M A;  5HFG A;  1SKR B;  2M72 A;  4ULX A;  3BCK A;  3FYG A;  3DVW A;  3QD9 A;  6GSV A;  2TRX A;  2GTU A;  1R5P A;  4Z2R A;  2JZT A;  1VF2 A;  1TOF A;  2FWG A;  3EC3 A;  3F3R A;  1B9Y C;  3F3Q A;  2CVD A;  1R5A A;  2H8L A;  2XBI A;  3GV1 A;  4RUV A;  3A2V A;  1PFO A;  2BTO T;  4FQU A;  3IPZ A;  2OE0 A;  2MYG A;  3ZIJ A;  1B9X C;  5DVB A;  3A5W A;  2ON5 A;  4I5Q A;  3D4T A;  5ID2 B;  1G6Y A;  3APS A;  1XWA A;  4KCE A;  2H66 A;  2QKE A;  3GNJ A;  1ERV A;  2ZUP A;  2WDU A;  4EKZ A;  5IO0 A;  4KCA A;  3F4R A;  2R4V A;  3KP9 A;  2TIR A;  3TJG A;  10GS A;  5IM9 A;  1XW9 A;  5E59 A;  1KBN A;  4TVE A;  4MMM A;  4CY8 A;  1GTU A;  3LOR A;  3VI7 A;  5GZZ B;  3VUR A;  2AB6 A;  2DBC A;  2EIR A;  1A24 A;  4HU7 A;  2KHP A;  1XWG A;  2HT9 A;  4EF0 A;  4LL4 B;  4ZB9 A;  1JLV A;  2FWE A;  4X4J A;  1BG5 A;  3H1N A;  5L71 A;  1GUM A;  3EU4 A;  4HJ2 A;  4NWY A;  4OD7 A;  2VD0 A;  3KMN A;  3L0H A;  2H1D A;  1OC9 B;  1XCC A;  4IHU A;  1IYH A;  4I2U A;  1MEK A;  2PMT A;  3LG6 A;  4GXZ A;  5LD0 A;  3MDK A;  2JSY A;  1H75 A;  3QOU A;  3BD2 A;  1QK8 A;  1NHO A;  2WUL A;  3US3 A;  5ECR B;  1Y25 A;  2X49 A;  2VOC A;  3MAK A;  1XWC A;  2DIY A;  2DJ0 A;  5H5S A;  4N10 A;  1TRU A;  3TOU A;  3VPT A;  2E2M A;  4MA9 A;  5DQS A;  3TUE A;  3WGX A;  4YKG A;  4MK3 A;  2HRK A;  5DAL B;  5ECS A;  4F2I A;  4ZBD A;  3FEU A;  3IK9 A;  1XIY A;  2C0G A;  4Q5Q A;  3AY8 A;  5DAK B;  4A5P A;  1PN0 A;  2C3Q A;  3WGE A;  1K0D A;  4NXI A;  3PGT A;  5A4V A;  4K2D A;  3QAG A;  2H1A A;  4KAE A;  2FWF A;  3CRU A;  4WET A;  2IME A;  3I43 A;  2FD3 A;  1V58 A;  4KH7 A;  5KN2 A;  3QAW A;  1A23 A;  2A2P A;  4BWS A;  3GH6 A;  2QC7 A;  5HR2 A;  4ZXG A;  2O85 A;  3FMW A;  3JCM L;  4O5Q A;  2B5E A;  2GSQ A;  1ST9 A;  4IW9 A;  4MZB A;  2VUP A;  1FVJ A;  3KCM A;  2BMX A;  2VCX A;  3G7I A;  1TRV A;  3KIJ A;  2E0Q A;  3DEX A;  1SD9 A;  3ME7 A;  3PH9 A;  4ZBA A;  1ON4 A;  1Z9H A;  5JWQ B;  3KEB A;  2C0F A;  2RUF A;  2RM6 A;  4I97 A;  4XIH A;  4X0X A;  4O5R A;  1GSS A;  4HUA A;  1GSQ A;  3ZFL A;  4FIW A;  2LJA A;  4MJB A;  2KOK A;  3R3E A;  3GKX A;  3LEF A;  2CX4 A;  3GA4 A;  14GS A;  4BVX B;  4RI7 A;  3WGD A;  1URM A;  3F4S A;  4WXT A;  1FO5 A;  2H75 A;  4AJ7 A;  1X9S B;  1GH2 A;  2MMA A;  4G0K A;  3TKS E;  4IP1 A;  1M3I A;  3L9S A;  5A5K A;  2Z9S A;  4G10 A;  5G5E A;  5G1K A;  2GLR A;  2F8A A;  4O32 A;  5DCH A;  1F3A A;  3F0I A;  1AQX A;  1X9M B;  3KP8 A;  1AW9 A;  3TKS A;  1WRY A;  2MMN A;  3BOA A;  1J9B A;  3F8U A;  4WR4 A;  1G7E A;  5IMC A;  2HSY A;  1K0B A;  3EMX A;  3HXS A;  4HZ2 A;  1J0F A;  3FZ9 A;  3EE2 A;  1FG4 A;  4OCF A;  3QAV A;  2X64 A;  5G5F A;  2JU5 A;  4TKY A;  4JZQ A;  3APO A;  5IPG A;  4F0C A;  1O6J A;  2KP1 A;  3GKK A;  4TR4 A;  1FAA A;  1UN2 A;  2WS2 A;  2CQ9 A;  1EEJ A;  1SJI A;  4CHS A;  4K5S A;  4Z2U A;  4MP4 A;  2PGT A;  3QPM A;  1X0R A;  4G0L A;  3IRA A;  4LA1 A;  4KF9 A;  1TJD A;  5D93 A;  2WGR A;  2DMM A;  2DJ1 A;  4KUN A;  1Z7R A;  2IWT A;  4H86 A;  4Z2T A;  1R4W A;  3DXB A;  3BCI A;  2HYX A;  2K9F A;  2DJK A;  1HD2 A;  1GTI A;  3CXG A;  4ZIL A;  3UOM A;  2V1M A;  1IYI A;  3ISO A;  2PVQ A;  1U6T A;  3O76 A;  4CDO A;  2HE3 A;  1I5G A;  4X1U A;  2REM A;  5IMF A;  4BL7 B;  1XW6 A;  7GSS A;  3ZMK A;  5ELA A;  4V2M A;  3W8J A;  2FLS A;  4DSS A;  3TKS C;  1B8X A;  3ZTL A;  1DE2 A;  3BBY A;  1TXX A;  2PER A;  4LL1 B;  2VL9 A;  5IPH A;  2H30 A;  1N8J A;  1JZD A;  4POL A;  2VCQ A;  3EYT A;  1JZW A;  2C3T A;  16GS A;  2XBQ A;  2FHE A;  3I69 A;  2C0E A;  2H6Z A;  4JU5 A;  4L5L A;  3KH7 A;  3FY7 A;  2MBT A;  3RPN A;  3ZRD A;  5CAX A;  2H76 A;  4YAV A;  1YDK A;  5J41 A;  3MNG A;  5D9V A;  3GKN A;  5CRE A;  2B3S A;  4PX1 A;  4Q5N A;  1A2J A;  4ECI A;  3IDV A;  3W8S A;  4E8H A;  3UL3 A;  5B6N A;  4Z7X A;  5D8I A;  1R7H A;  1WPI A;  2WZ9 A;  2C8U A;  3LYP A;  2YJ7 A;  4V2N A;  1MDJ A;  2IL3 A;  1T8E B;  4HOJ A;  1FOH A;  1YZX A;  4K5R A;  4IS0 A;  4K9Z A;  3TCO A;  1AXD A;  5GAP D;  5BMU A;  1K3O A;  2NBS A;  1PA3 A;  2IMK A;  3KXO A;  3GUS A;  2DSA A;  1GP1 A;  2JAD A;  3UVT A;  2HRA A;  5FWG A;  4MCU A; 
#chains in the Genus database with same CATH homology
 5G30 A;  5CRD A;  2B7J A;  5F06 A;  2FWH A;  3ZZX A;  5CP1 A;  4EE0 A;  2K8S A;  4MZW A;  1ZL9 A;  4KSM A;  2YOI A;  13GS A;  3EUR A;  4POK A;  1OAZ A;  3UJ1 A;  1Q4J A;  1LU4 A;  1GLQ A;  5CRH A;  3C73 A;  4TXO B;  3WT1 A;  2B5X A;  3O6T A;  4MNN A;  1XW5 A;  4D73 A;  4YQV A;  1U3I A;  3MWH A;  2LTK A;  5J3R A;  4GLT A;  1Z5Y E;  3O3T A;  4K1F A;  2LUS A;  2AJQ B;  4EUY A;  3Q19 A;  4GTU A;  2IN3 A;  2N5F A;  5AIX A;  1A8L A;  4K7N A;  3E0U A;  5C04 A;  1ZYN A;  3ZML A;  4PQ1 A;  5ENU A;  3TGZ A;  4XS6 A;  3FR9 A;  1DUG A;  2GZP A;  2QGV A;  1U87 A;  2XPD A;  1Q98 A;  1O73 A;  2OE1 A;  4G0I A;  3HCZ A;  3SBC A;  4NHW A;  3E3E A;  1HNB A;  1EV9 A;  4YQU A;  5F0G A;  3PIN A;  3BJ5 A;  4PNG A;  1W4V A;  17GS A;  4ID0 A;  5B8A A;  5DCG A;  2JAC A;  2YCD A;  1NHY A;  2NVL A;  3J7Y k;  2B5Y A;  4Q5F A;  2LS5 A;  4ZB8 A;  3IA1 A;  3H79 A;  2IFQ A;  3CTG A;  1WP0 A;  3D21 A;  3E9J B;  2CAQ A;  2CZ3 A;  1ZYE A;  2YWN A;  5FHI A;  1U88 A;  2G0F A;  2HZE A;  3CTF A;  4HS1 A;  1SU9 A;  4I6X A;  3FZ4 A;  2O87 A;  2K18 A;  4LMW A;  4IQA A;  3HY2 A;  4QL7 A;  1ML6 A;  3MYD A;  3HZ4 A;  4KX4 A;  3IOS A;  4EO3 A;  5AIV A;  3ME8 A;  2L57 A;  1YEX A;  5CO3 A;  3CSJ A;  4PUR A;  1RQM A;  2C4J A;  3F63 A;  2JZS A;  1FOV A;  4TR0 A;  2HZF A;  3CSH A;  3QFA C;  3RAZ A;  3KZQ A;  1EOG A;  4YAP A;  1JZO A;  3ERW A;  3LW9 A;  4ZL9 A;  3QR6 A;  3LGC A;  5GAN D;  2VM2 A;  3L4N A;  3VPQ A;  3HVS A;  1CQH A;  1OC3 A;  2LRC A;  3RDW A;  1A2M A;  4V2L A;  1F9M A;  2FNO A;  1M2B A;  1TI1 A;  4IQ1 A;  2H6X A;  1K3L A;  4HU9 A;  1B4P A;  2HLS A;  1O8X A;  4JBB A;  1PKZ A;  1HQO A;  1GNW A;  2B7K A;  2LNS A;  4ML1 A;  1PGT A;  4L0U A;  5E4W A;  4J56 E;  2PWJ A;  4AGS A;  1TRS A;  2DJJ A;  4GSN A;  4DEJ A;  4IJ3 A;  2G2Q A;  2B1K A;  4EDY A;  5JCG A;  3P7X A;  5ECO B;  5IMD A;  5HFK A;  2R0C A;  4XS4 A;  3WYW A;  3GTU A;  1K0A A;  1XOB A;  1SD8 A;  2HSH A;  2MBS A;  3I9V 2;  5D73 A;  1XPV A;  3GSS A;  2F8F A;  2R6K A;  1QMV A;  2K8V A;  3S9F A;  1V98 A;  5ECM B;  5LNK e;  1HYU A;  3A3T A;  1GSY A;  4XS1 A;  3WD6 A;  8GSS A;  4G9H A;  4GST A;  4GF0 A;  4RI6 A;  4KGI A;  2O8V B;  1G7O A;  2VD1 A;  4IGJ A;  3FHK A;  3APQ A;  3KH9 A;  1O81 A;  2IMI A;  3VI5 A;  3G9B A;  1QFN A;  5COH A;  1LJR A;  5DBQ A;  4MF6 A;  3Q74 A;  1SL2 B;  2DKH A;  2R0P A;  3HJO A;  1WE0 A;  3IXR A;  1JZR A;  1G0T A;  4USS A;  4JED A;  3IC8 A;  12GS A;  3QMX A;  2LRN A;  3MSZ A;  5F05 A;  4AJ8 A;  3DVX A;  1TW9 A;  2H1B A;  3EMP A;  3LSZ A;  2H71 A;  4GWR A;  3NZN A;  1KNG A;  1TRW A;  2YZU A;  1WOU A;  3FR3 A;  1JHB A;  1EWX A;  1XZO A;  2IPA A;  5GSS A;  3EVI A;  4NMU A;  2PU9 C;  1Z6M A;  3QCP A;  2ON7 A;  4KA0 A;  2H70 A;  1EEM A;  1THX A;  1XWB A;  6GSY A;  4MF7 A;  4PQH A;  1X5E A;  1FHE A;  1PSQ A;  1FB0 A;  3PR8 A;  3GH9 A;  2P5R A;  5AIS A;  1M0U A;  4NHZ A;  4YH2 A;  5J4U A;  2P31 A;  1TU7 A;  2FGX A;  2LKU A;  3MIX A;  4WEY A;  2GSR A;  3G7Y A;  3D4M A;  2HI7 A;  1BQ7 A;  4L5O A;  2X8C A;  2CT6 A;  2OBI A;  4WR5 A;  4WBR D;  4V1A p;  1EP8 A;  2FCH A;  2L4C A;  1F3B A;  1V9W A;  4CY6 A;  4F9Z A;  2VAF A;  4PUF C;  2A2S A;  4ZL7 A;  5D9X A;  4F82 A;  1X9W B;  2B1L A;  3IHG A;  2H0I A;  3J7Y b;  1WWJ A;  1Z3E A;  1SJZ A;  1ERW A;  4CW9 A;  4P3Y B;  2FUG 2;  4PXO A;  4ILF A;  2LJK A;  1FW1 A;  4O92 A;  1SL1 B;  6GST A;  4AF2 A;  1GUH A;  1N2A A;  4ECJ A;  2LST A;  4WF5 A;  2GT5 A;  4ECC A;  2CVB A;  3L9V A;  2I9H A;  3KMO A;  4J57 E;  3KTL A;  3LWA A;  4GCI A;  4MH2 A;  2YPM A;  2VL2 C;  4BWQ A;  4POM A;  1KEB A;  2VLT A;  1PRX A;  4JRR A;  4RQX A;  1GSF A;  5J9C A;  22GS A;  2R3X A;  2GDR A;  4TRX A;  5D96 A;  4HZ4 A;  2VIM A;  2GS3 A;  4OFN A;  4EIQ A;  3GMF A;  1DSB A;  2OAC A;  1GNE A;  4E8E A;  4HQZ A;  4DSS B;  5G1L A;  1V40 A;  1XOA A;  1I9D A;  3ZYW A;  4DSR A;  2OA7 A;  4KDU A;  3DGQ A;  2K6V A;  3RHB A;  3GHA A;  3VLN A;  2LRT A;  1XFL A;  4IN0 A;  3TJK A;  1UC7 A;  4OMV A;  3DD3 A;  4GQF A;  1TU8 A;  4ZL8 A;  1BYE A;  2DML A;  5AGY A;  2V6K A;  2XC2 A;  3HD5 A;  2R0G A;  2HRF A;  4MJE A;  2F3M A;  3IC4 A;  1PQN A;  1YF0 A;  4IVF A;  4TR1 A;  2DLX A;  1QXH A;  3VWV A;  3M9J A;  4MZC A;  4HJM A;  3TRX A;  3R2Q A;  5J5N A;  2VM1 A;  5EPF A;  3LJR A;  4ICY A;  3FR6 A;  2CZ2 A;  2LV3 A;  3LQ7 A;  1B48 A;  3HVX A;  3FK8 A;  2AV4 A;  1YF1 A;  1LBK A;  2ES7 A;  3DML A;  3Q18 A;  3KM6 A;  5EL8 A;  1AAZ A;  3CYN A;  3UIW A;  3VK9 A;  2H19 A;  2I4A A;  3TKQ A;  2H74 A;  5DJL A;  3D0Z A;  5IIZ A;  3TJJ A;  4BA7 A;  2B6M A;  3TDG A;  4OCE A;  3ZRE A;  4KE3 A;  1T1V A;  2DKI A;  4I2T A;  5CRW A;  1K0N A;  2YNX A;  4PUA A;  3H93 A;  3TRQ A;  4POB A;  1BAY A;  1W89 A;  4OO4 A;  1OE7 A;  2ZCT A;  3HKR A;  2I81 A;  5HQP A;  1ZGN A;  2GQM A;  20GS A;  1XXU A;  3GKM A;  2N5A A;  4LLR A;  4YKF A;  1ERU A;  3EWL A;  2V41 A;  5KOW A;  3DWV A;  1PKW A;  2YV7 A;  3V1W A;  2MZC A;  3FZA A;  1R26 A;  4D73 B;  2RM5 A;  1E6B A;  2L4Q A;  1PL1 A;  1RK4 A;  2IIY A;  3QFB C;  1PX6 A;  2L59 A;  1GSU A;  4TN8 A;  3U5R E;  1K0M A;  1K0O A;  3IHQ A;  3IV4 A;  2PBJ A;  1Z6N A;  2YZH A;  4NAX A;  4KND A;  2CAI A;  5IQY A;  4FO5 A;  1V57 A;  4ZBB A;  3P8W A;  1GWC A;  3TOT A;  5KEJ A;  3L9U A;  5IMV A;  1AIU A;  3NOF A;  3P2A A;  3CMI A;  1M9B A;  2X99 A;  1MDK A;  2GSS A;  4KB3 A;  5C00 A;  1A0F A;  4TOP A;  4ML6 A;  4O5U A;  1MDI A;  2YN1 A;  1UA5 A;  3FZ5 A;  4G2E A;  2H0G A;  5A4U A;  2KP2 A;  1CQG A;  1EGO A;  3HJP A;  2PUK C;  2HXK A;  2IFQ B;  4BVY B;  3OR5 A;  2V2G A;  1VGL A;  1ZYP A;  2DC5 A;  2QSI A;  2DJ2 A;  1QGV A;  5ECL B;  2HZE B;  3GRX A;  3GST A;  5ABR A;  3PPU A;  4FYU A;  4N0V A;  4HDE A;  3A2X A;  3CRT A;  5ECK B;  1GL8 A;  1U3A A;  1SKS B;  3TRP A;  1UVZ A;  1M2D A;  1SEN A;  1PL2 A;  3GUR A;  4BVY A;  1AUC A;  2WFC A;  5INY A;  2LNT A;  2L6D A;  2YV9 A;  2VL3 A;  4XCS A;  2N5B A;  1NSW A;  2QA1 A;  2JSZ A;  2C0D A;  1S3A A;  1JLW A;  3M8N A;  5HFI A;  2OJL A;  2F9S A;  2RII A;  3KJY A;  6GSX A;  2CA8 A;  1C72 A;  1T4Y A;  2GGT A;  2C3N A;  2KUC A;  1YJ6 A;  4PTS A;  3C8E A;  11GS A;  4QL9 A;  1J08 A;  2VO4 A;  2CVK A;  3M3M A;  3GN3 A;  4IP6 A;  5H5R A;  4RQR A;  3QDN A;  5D9T A;  2A4V A;  2GQL A;  4N30 A;  2WJU A;  1DBY A;  3Q6O A;  2EC4 A;  5KN3 A;  1USB A;  3TKP A;  5IMA A;  2VLU A;  5CNW A;  3HYP A;  2YP6 A;  3FRC A;  3VWW A;  2L5L A;  1XBS A;  1GLP A;  3N5O A;  3C1R A;  2HSM A;  5ID2 A;  5IOW A;  4XS4 B;  2VCW A;  2O89 A;  4BPY A;  2RUE A;  1O8W A;  4IKH A;  4TW5 A;  4OFT A;  4OWY A;  2IMD A;  3GTU B;  1X5D A;  1ZCP A;  4MJA A;  1S3D A;  1F6M C;  2O7K A;  5D9W A;  5F8B A;  1OVN A;  2NDO A;  3D5J A;  2R2J A;  1ZZY A;  1WJK A;  1TP9 A;  5IMZ A;  1FVK A;  4N11 A;  1PMT A;  4IEL A;  19GS A;  4FYC A;  3FW2 A;  3HHV A;  3LXZ A;  2YWO A;  1ZYQ B;  2BJX A;  1GSD A;  4ZIJ A;  4JE1 A;  2M46 A;  2OBK A;  3ZL5 A;  1AC1 A;  1M9A A;  3W6G A;  2J23 A;  4OFM A;  2X4A A;  5ECN B;  4K7I A;  3H4K A;  3D22 A;  4F03 A;  5AN1 A;  4FH8 A;  5IO2 A;  2UZ8 A;  3ZVJ D;  4PGT A;  5H5Q A;  1MD3 A;  4L8E A;  3EIN A;  4AJ6 A;  1HNA A;  2WRT A;  3F4T A;  1OC9 A;  2OAD A;  1BJX A;  2GQK A;  2IJY A;  2L5O A;  3P90 A;  2R37 A;  1EOH A;  2VCT A;  3LYK A;  1T7P B;  4WF4 A;  3GIX A;  2WB9 A;  2XHF A;  3C1S A;  1A0R P;  5ELG A;  1ABA A;  4Q5R A;  1T4Z A;  2GT6 A;  2HNL A;  4J2F A;  1SK0 A;  2MMO A;  2XPE A;  3A5I A;  3DKS A;  1XWK A;  4DVC A;  3G7J A;  3GL3 A;  1VF4 A;  3LXT A;  4TR3 A;  5KN1 A;  4HI7 A;  2MMZ A;  3RHC A;  5A4W A;  1EV4 A;  5FT3 A;  1O7U A;  1YY7 A;  2YWI A;  1QQ2 A;  2AUV A;  5DAL A;  4EIP A;  4MH3 A;  4I8B A;  5B8B A;  5HR1 A;  5KN0 A;  2M80 A;  4HEA 2;  1H4O A;  3F6F A;  3TJF A;  1TDI A;  3M9K A;  4OO5 A;  5DAK A;  2TRC P;  1WIK A;  2VL2 A;  1GTB A;  4V1A g;  2H0H A;  2OKA A;  1AQV A;  5LCZ A;  1K0C A;  2LQO A;  4O7H A;  2DIZ A;  2WCI A;  2GZZ A;  2A2R A;  2A4H A;  1V2A A;  3WT2 A;  1VRS D;  3ZFB A;  1JFU A;  1GSE A;  1SK2 A;  1ERT A;  3HDC A;  3KTB A;  2NTO A;  3F9U A;  1T00 A;  4KDY A;  5G31 A;  1OC8 A;  4FYB A;  4K8M A;  4ZB6 A;  2LQQ A;  2D2Z A;  4EXJ A;  4XHM A;  1SYR A;  1SL0 B;  3UMA A;  3UBL A;  2IMF A;  2EIQ A;  2QA2 A;  4K2X A;  2GVP A;  1SK1 A;  1VF1 A;  3EPT A;  4BVX A;  3VFI A;  1Z7P A;  3GL5 A;  2E7P A;  3DIE A;  4N0Z A;  5ECQ B;  5EVO A;  4MJC A;  1BED A;  1E2Y A;  4L0W A;  1EP7 A;  5B7C A;  3IAS 2;  4ISD A;  5DJM A;  3TB2 A;  1ZMA A;  1SYX A;  2L6C A;  2RLI A;  4EC0 A;  1O85 A;  2AAW A;  2PN8 A;  2H72 A;  2X8H A;  3DRN A;  3I6A A;  1TK0 B;  3ERF A;  1YKC A;  1G6W A;  3SWL A;  2V32 A;  1M7T A;  1NM3 A;  1XVW A;  3A2W A;  4HQS A;  1A8Y A;  3TKR A;  3GX8 A;  1YEP A;  4TR1 B;  4DSQ A;  2ZNM A;  3IR4 A;  1GUK A;  3HA9 A;  1VF3 A;  1PN9 A;  4XRD A;  2CV4 A;  2KLX A;  3KGK A;  4WBJ A;  5J9B A;  2HRN A;  4K0N A;  3H8Q A;  5JWR B;  2E2G A;  3VWU A;  4TXV A;  4F0B A;  3RBT A;  5CYY A;  4MF5 A;  2P5Q A;  2H01 A;  3IE3 A;  2VCV A;  2GZY A;  5JWO B;  3CSI A;  2AYT A;  1THO A;  4K6X A;  1T3B A;  1M99 A;  4NV2 A;  5F07 A;  4ACS A;  2H1G A;  3ERG A;  3IK7 A;  1M2A A;  2YJH A;  2JZR A;  4WKW A;  1ZOF A;  3D6I A;  1XVQ A;  2YWM A;  4GQC A;  1AQW A;  2ALB A;  6GSS A;  4IBP A;  3IBH A;  3EU3 A;  2H6Y A;  2YAN A;  3FKF A;  2I1U A;  3ED3 A;  3GX0 A;  3UAR A;  1F37 A;  4EDZ A;  5ECH B;  5GST A;  3GFK A;  4X43 A;  3K8N A;  3ZIV A;  4BL7 A;  1KTE A;  18GS A;  1MTC A;  4PNF A;  1OKD A;  4KW6 A;  5DQY A;  5BRT A;  1PX7 A;  2PPT A;  5KOX A;  1OE8 A;  2C80 A;  2H73 A;  3UBK A;  3ZIT A;  1QUW A;  2EIO A;  5CRG A;  4PQI A;  5ECI B;  5ECP B;  4ECB A;  4MPG A;  2FA4 A;  3RPP A;  5G2Z A;  3TJB A;  1GRX A;  1S3C A;  9GSS A;  1K3Y A;  4K0G A;  1WMJ A;  1PD2 1;  1SKW B;  3HVV A;  3HZ8 A;  4EL1 A;  4JR4 A;  1TTZ A;  4NV5 A;  3M1G A;  4JR6 A;  3DYR A;  1RW1 A;  1A2L A;  3N9J A;  2LJR A;  1SJ6 A;  3M0F A;  2I3Y A;  1DE1 A;  1EGR A;  2NPB A;  5B6M A;  4MAB A;  5DDL A;  1ILO A;  4MDC A;  4GSS A;  3KD0 A;  2OE3 A;  1B4Q A;  1YKA A;  3ZLP A;  1F2E A;  2DJ3 A;  5HR3 A;  1TK5 B;  4XTS A;  3C71 A;  2LEG A;  4LMV A;  4IJI A;  2V6O A;  4KDX A;  3VWX A;  1BX9 A;  2R5G A;  3HJM A;  3ZVJ A;  6GSU A;  1OKT A;  1TKD B;  5IOX A;  2X8G A;  4MPF A;  2VLV A;  3F6D A;  3L78 A;  4MLY A;  4XRA A;  1X5C A;  1EZK A;  4K7O A;  5JCU A;  2C1Y A;  2CX3 A;  3U6V A;  3UEM A;  2PVO C;  3UVH A;  2J9H A;  1Y6E A;  1TK8 B;  4GRF A;  2FA8 A;  2AHE A;  5JCW A;  2VCZ A;  1TI3 A;  1HNC A;  5HR0 A;  3UAP A;  2FY6 A;  1OYJ A;  2F51 A;  3GYK A;  1MD4 A;  4KSO A;  6GSW A;  3CBU A;  2JL4 A;  4YQM A;  1GUL A;  4NPB A;  4G19 A;  2GST A;  4EVM A;  3NIV A;  4TXO A;  1YQ1 A;  1NW2 A;  1FB6 A;  3IAM 2;  5EY6 A;  3LFL A;  4QQ7 A;  1ACV A;  1GTA A;  2HFD A;  2P0G A;  3C7M A;  5HFG A;  1SKR B;  2M72 A;  4ULX A;  3BCK A;  3FYG A;  3DVW A;  3QD9 A;  6GSV A;  2TRX A;  2GTU A;  1R5P A;  4Z2R A;  2JZT A;  1VF2 A;  1TOF A;  2FWG A;  3EC3 A;  3F3R A;  1B9Y C;  3F3Q A;  2CVD A;  1R5A A;  2H8L A;  2XBI A;  3GV1 A;  4RUV A;  3A2V A;  2BTO T;  4FQU A;  3IPZ A;  2OE0 A;  2MYG A;  3ZIJ A;  1B9X C;  5DVB A;  3A5W A;  2ON5 A;  4I5Q A;  3D4T A;  5ID2 B;  1G6Y A;  3APS A;  1XWA A;  4KCE A;  2H66 A;  2QKE A;  3GNJ A;  1ERV A;  2ZUP A;  2WDU A;  4EKZ A;  5IO0 A;  4KCA A;  3F4R A;  2R4V A;  3KP9 A;  2TIR A;  3TJG A;  10GS A;  5IM9 A;  1XW9 A;  5E59 A;  1KBN A;  4TVE A;  4MMM A;  4CY8 A;  1GTU A;  3LOR A;  3VI7 A;  5GZZ B;  3VUR A;  2AB6 A;  2DBC A;  2EIR A;  1A24 A;  4HU7 A;  2KHP A;  1XWG A;  2HT9 A;  4EF0 A;  4LL4 B;  4ZB9 A;  1JLV A;  2FWE A;  4X4J A;  1BG5 A;  3H1N A;  5L71 A;  1GUM A;  3EU4 A;  4HJ2 A;  4NWY A;  4OD7 A;  2VD0 A;  3KMN A;  3L0H A;  2H1D A;  1OC9 B;  1XCC A;  4IHU A;  1IYH A;  4I2U A;  1MEK A;  2PMT A;  3LG6 A;  4GXZ A;  5LD0 A;  3MDK A;  2JSY A;  1H75 A;  3QOU A;  3BD2 A;  1QK8 A;  1NHO A;  2WUL A;  3US3 A;  5ECR B;  1Y25 A;  2X49 A;  2VOC A;  3MAK A;  1XWC A;  2DIY A;  2DJ0 A;  5H5S A;  4N10 A;  1TRU A;  3TOU A;  3VPT A;  2E2M A;  4MA9 A;  5DQS A;  3TUE A;  3WGX A;  4YKG A;  4MK3 A;  2HRK A;  5DAL B;  5ECS A;  4F2I A;  4ZBD A;  3FEU A;  3IK9 A;  1XIY A;  2C0G A;  4Q5Q A;  3AY8 A;  5DAK B;  4A5P A;  1PN0 A;  2C3Q A;  3WGE A;  1K0D A;  4NXI A;  3PGT A;  5A4V A;  4K2D A;  3QAG A;  2H1A A;  4KAE A;  2FWF A;  3CRU A;  4WET A;  2IME A;  3I43 A;  2FD3 A;  1V58 A;  4KH7 A;  5KN2 A;  3QAW A;  1A23 A;  2A2P A;  4BWS A;  3GH6 A;  2QC7 A;  5HR2 A;  4ZXG A;  2O85 A;  3FMW A;  3JCM L;  4O5Q A;  2B5E A;  2GSQ A;  1ST9 A;  4IW9 A;  4MZB A;  2VUP A;  1FVJ A;  3KCM A;  2BMX A;  2VCX A;  3G7I A;  1TRV A;  3KIJ A;  2E0Q A;  3DEX A;  1SD9 A;  3ME7 A;  3PH9 A;  4ZBA A;  1ON4 A;  1Z9H A;  5JWQ B;  3KEB A;  2C0F A;  2RUF A;  2RM6 A;  4I97 A;  4XIH A;  4X0X A;  4O5R A;  1GSS A;  4HUA A;  1GSQ A;  3ZFL A;  4FIW A;  2LJA A;  4MJB A;  2KOK A;  3R3E A;  3GKX A;  3LEF A;  2CX4 A;  3GA4 A;  14GS A;  4BVX B;  4RI7 A;  3WGD A;  1URM A;  3F4S A;  4WXT A;  1FO5 A;  2H75 A;  4AJ7 A;  1X9S B;  1GH2 A;  2MMA A;  4G0K A;  3TKS E;  4IP1 A;  3L9S A;  5A5K A;  2Z9S A;  4G10 A;  5G5E A;  5G1K A;  2GLR A;  2F8A A;  4O32 A;  5DCH A;  1F3A A;  3F0I A;  1AQX A;  1X9M B;  3KP8 A;  1AW9 A;  3TKS A;  1WRY A;  2MMN A;  3BOA A;  1J9B A;  3F8U A;  4WR4 A;  1G7E A;  5IMC A;  2HSY A;  1K0B A;  3EMX A;  3HXS A;  4HZ2 A;  1J0F A;  3FZ9 A;  3EE2 A;  1FG4 A;  4OCF A;  3QAV A;  2X64 A;  5G5F A;  2JU5 A;  4TKY A;  4JZQ A;  3APO A;  5IPG A;  4F0C A;  1O6J A;  2KP1 A;  3GKK A;  4TR4 A;  1FAA A;  1UN2 A;  2WS2 A;  2CQ9 A;  1EEJ A;  1SJI A;  4CHS A;  4K5S A;  4Z2U A;  4MP4 A;  2PGT A;  3QPM A;  1X0R A;  4G0L A;  3IRA A;  4LA1 A;  4KF9 A;  1TJD A;  5D93 A;  2WGR A;  2DMM A;  2DJ1 A;  4KUN A;  1Z7R A;  2IWT A;  4H86 A;  4Z2T A;  1R4W A;  3DXB A;  3BCI A;  2HYX A;  2K9F A;  2DJK A;  1HD2 A;  1GTI A;  3CXG A;  4ZIL A;  3UOM A;  2V1M A;  1IYI A;  3ISO A;  2PVQ A;  1U6T A;  3O76 A;  4CDO A;  2HE3 A;  1I5G A;  4X1U A;  2REM A;  5IMF A;  4BL7 B;  1XW6 A;  7GSS A;  3ZMK A;  5ELA A;  4V2M A;  3W8J A;  2FLS A;  4DSS A;  3TKS C;  1B8X A;  3ZTL A;  1DE2 A;  3BBY A;  1TXX A;  2PER A;  4LL1 B;  2VL9 A;  5IPH A;  2H30 A;  1N8J A;  1JZD A;  4POL A;  2VCQ A;  3EYT A;  1JZW A;  2C3T A;  16GS A;  2XBQ A;  2FHE A;  3I69 A;  2C0E A;  2H6Z A;  4JU5 A;  4L5L A;  3KH7 A;  3FY7 A;  2MBT A;  3RPN A;  3ZRD A;  5CAX A;  2H76 A;  4YAV A;  1YDK A;  5J41 A;  3MNG A;  5D9V A;  3GKN A;  5CRE A;  2B3S A;  4PX1 A;  4Q5N A;  1A2J A;  4ECI A;  3IDV A;  3W8S A;  4E8H A;  3UL3 A;  5B6N A;  4Z7X A;  5D8I A;  1R7H A;  1WPI A;  2WZ9 A;  2C8U A;  3LYP A;  2YJ7 A;  4V2N A;  1MDJ A;  2IL3 A;  1T8E B;  4HOJ A;  1FOH A;  1YZX A;  4K5R A;  4IS0 A;  4K9Z A;  3TCO A;  1AXD A;  5GAP D;  5BMU A;  1K3O A;  2NBS A;  1PA3 A;  2IMK A;  3KXO A;  3GUS A;  2DSA A;  1GP1 A;  2JAD A;  3UVT A;  2HRA A;  5FWG A;  4MCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...