4GWRA

Crystal structure of the second catalytic domain of protein disulfide isomerase p5
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
112
structure length
112
Chain Sequence
b'DVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein disulfide-isomerase A6
publication title To be published
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 37
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4gwrA00
4D73B 3G9BA 1XPVA 4IELA 2GQKA 2JZRA 3F3QA 5F0GA 1XWKA 3IC4A 3A3TA 3HDCA 4AF2A 1ML6A 1UVZA 2DJ1A 1ZMAA 2VOCA 3GFKA 3NOFA 1DUGA 1J08A 3FK8A 1ZZYA 5H5RA 3ZIJA 2HSYA 1VF4A 2NPBA 2JZSA 2VL2C 3FYGA 1B4PA 2YCDA 3P90A 4K8MA 2P0GA 1G6WA 2IPAA 3IK9A 2KHPA 3TKSE 4I8BA 2VCTA 4MZBA 1GRXA 1PRXA 5ECKB 4NWYA 2LS5A 1OYJA 2HI7A 1SJZA 1V2AA 2OADA 3HJOA 1TTZA 3VWWA 3MWHA 1QUWA 2IIYA 1XIYA 1M2DA 3GRXA 4K2DA 13GSA 4E8HA 4O7HA 3VLNA 4QL7A 1GH2A 1V58A 2IJYA 2V6OA 3N9JA 4EVMA 2DMMA 1OE8A 5ECMB 1ERWA 4KW6A 2CAIA 1Y6EA 3CSIA 1X5EA 4DSSA 5IOXA 3KH9A 1FHEA 1IYHA 2VM1A 2DBCA 4HQZA 5ELAA 4WXTA 1N2AA 3QFAC 4MH3A 5B7CA 3TCOA 5G1KA 5IIZA 4ILFA 2WFCA 1M7TA 2OE0A 5FHIA 1PL1A 1WPIA 5EVOA 1XWCA 4L5LA 1S3AA 2H66A 3F6DA 3DMLA 5IMVA 4GSTA 3TJBA 4MPFA 2YV7A 3DD3A 4KDUA 4EF0A 2K8SA 4LL1B 1PX7A 4KDYA 3P2AA 3QDNA 1AW9A 3KTLA 1EZKA 1AQVA 4O92A 4OMVA 4MCUA 5B6MA 2PVQA 1WRYA 2R2JA 2XBQA 5IQYA 4WBJA 1GTUA 5DAKA 1OE7A 3HZ8A 1YEPA 4BWQA 2H76A 1Q4JA 2CQ9A 4GSSA 1GLQA 2A2SA 3KJYA 2V41A 1AQXA 4J2FA 1JZWA 2HZFA 2QGVA 2P5RA 4XS6A 2N5AA 1VRSD 5EPFA 2H0IA 4NAXA 3ED3A 3GKKA 5EY6A 19GSA 3ZITA 3QPMA 4IBPA 2V2GA 3H1NA 3ZYWA 2E2GA 4FO5A 1QQ2A 3E9JB 2YZUA 1PX6A 1PQNA 1X9MB 1PD21 4GCIA 3H8QA 3F63A 3ZL5A 4GQCA 3LORA 2B7KA 1SYRA 3FR3A 5DALB 5ELGA 5IMDA 3GYKA 1YKCA 4XS1A 4IW9A 3PR8A 3HVSA 2MMAA 2ALBA 2H71A 2H73A 1GNWA 3BJ5A 5G5EA 2HXKA 1SU9A 2YWMA 1C72A 4TR4A 2VD1A 2CVDA 4GXZA 4N30A 3H93A 1YEXA 5H5QA 1Z5YE 2GT5A 1UC7A 3EE2A 2OBKA 2XBIA 2OE1A 2QSIA 1TI3A 2O87A 5CREA 4ACSA 4ZILA 4O32A 2E0QA 2RM5A 2ON5A 2HFDA 4IQ1A 1FAAA 4WF5A 1U3IA 2I3YA 2VUPA 3KP9A 5J9BA 4QL9A 2F51A 3FR6A 2O89A 4P3YB 3FR9A 2RLIA 2A4VA 4IKHA 5ECOB 3LYKA 1A23A 3J7Yk 4TXOB 2FCHA 4GSNA 3A2WA 4XS4B 2V32A 3LYPA 4TR1B 4IP6A 1HNAA 1HD2A 1XWGA 2FLSA 1T4ZA 2H0HA 5AIVA 3DVWA 1A8YA 1XWAA 5E4WA 2IL3A 1R7HA 2IFQB 2M80A 2MZCA 1YJ6A 2WDUA 4ECBA 3EURA 3DGQA 5G1LA 4JR6A 3DKSA 1YDKA 3ME8A 2TRXA 2OBIA 5CNWA 1ACVA 3I69A 5HR2A 2YJHA 1XCCA 4HUAA 1VF3A 3N5OA 3GHAA 4EC0A 4O5RA 2B5EA 1ON4A 3LG6A 3E3EA 2X8HA 3C7MA 4ZB6A 3EC3A 2PUKC 3ZRDA 1G7EA 1NHOA 6GSTA 3GN3A 3RAZA 1XW9A 2LV3A 3AY8A 4Z7XA 1AAZA 1RQMA 3UVTA 2H01A 4ULXA 3U6VA 1K0OA 4QQ7A 2LJRA 5HFKA 2WZ9A 3GV1A 2AYTA 1YF0A 4JE1A 3KXOA 4F2IA 2HRFA 3L78A 4K7NA 1ERUA 3QCPA 3QR6A 2LRNA 1NW2A 4G9HA 3CMIA 5D9TA 3C1SA 1UA5A 4OD7A 3CTGA 1GLPA 5IMFA 3HXSA 2LJAA 2CX4A 4HOJA 3D6IA 1XWBA 10GSA 2J9HA 4F0BA 4ZBDA 5ECPB 3Q19A 4LMVA 1WE0A 3LSZA 3G7IA 4POLA 3EMPA 5JWOB 2KUCA 5IO2A 1OC9B 1JZDA 3RPPA 2RUFA 3TRPA 4ID0A 2LUSA 3HHVA 1GSQA 3TJFA 2FA8A 2NTOA 2N5FA 3IXRA 2F9SA 1USBA 5IPHA 1TK8B 4L0WA 1PL2A 1JZOA 4I2TA 3IK7A 1M0UA 4EL1A 2VD0A 2L59A 5EL8A 3PINA 5CAXA 4HI7A 3IBHA 3LWAA 3APSA 5L71A 2IMIA 3FW2A 3D4MA 3GMFA 1SD8A 2CT6A 3LFLA 3O6TA 1O8WA 3GURA 1SL1B 3TB2A 3UOMA 1ZL9A 5INYA 2VIMA 3M3MA 1MD4A 3RHCA 4JU5A 4AJ8A 2MYGA 1GWCA 3EYTA 1U88A 2Z9SA 1A0FA 1WP0A 1V40A 3F4RA 3VWXA 2ZCTA 2B1KA 2FNOA 2H74A 4NMUA 3O76A 4KDXA 1GTAA 2OKAA 3RDWA 4G10A 2R4VA 5F8BA 3K8NA 1SK1A 2GSQA 2C8UA 4HU7A 2GTUA 3GTUB 2MBTA 2L5OA 6GSXA 2DJ0A 4V1Ag 3TKSC 2PWJA 1TK5B 1F3BA 1K0DA 5G2ZA 9GSSA 3DYRA 1FB6A 3NIVA 2PBJA 4MF7A 6GSYA 1S3DA 2H75A 5F05A 1BJXA 4TXOA 2YWOA 4XS4A 3WT1A 4GF0A 4TR1A 2ON7A 4ZXGA 1BAYA 3VPTA 5J3RA 2C4JA 4FIWA 1BG5A 3P7XA 4WKWA 3IA1A 3DXBA 4ZL7A 4PX1A 5GZZB 2VAFA 1GULA 3APOA 18GSA 3EMXA 5FWGA 4MP4A 5JWRB 2PPTA 4EO3A 2L6CA 2CX3A 4PNGA 1WOUA 3WGDA 3FKFA 4L5OA 5CRHA 4WR5A 5CP1A 1GTBA 5A4WA 4TR3A 3JCML 1X9WB 1T4YA 3A2XA 4TOPA 4V2LA 4ZB8A 5ABRA 1TRVA 2GS3A 2C3NA 5HR0A 4KE3A 5JWQB 3ERWA 6GSWA 1Z6MA 4IN0A 4AJ6A 1SK2A 1K0NA 2QC7A 5IM9A 1AUCA 5ID2B 5B8AA 5F06A 3U5RE 11GSA 2DJJA 4NV5A 3F3RA 1F3AA 5ECHB 1A24A 3VWVA 3ERFA 3M1GA 4IVFA 2X8GA 3TRXA 1N8JA 3L9UA 3EINA 5HFGA 4KGIA 3TDGA 4ZL9A 4GLTA 2G2QA 1LJRA 2V1MA 1T1VA 2QKEA 2A2RA 1QFNA 5IOWA 2AJQB 2YPMA 2B7JA 3KTBA 3F6FA 2HYXA 2RM6A 3GL3A 5IO0A 5C00A 4OFTA 4K6XA 1DE1A 4NHZA 4YH2A 5GSSA 5B6NA 5D93A 1K3LA 3GUSA 4HS1A 5DCHA 3RPNA 4TR0A 1AIUA 2HT9A 4OO5A 5D73A 3KZQA 1OKTA 4XCSA 2GSSA 3DVXA 1TDIA 3KEBA 2HZEB 1FG4A 2R37A 2GVPA 3ZZXA 1PSQA 2H0GA 2ZNMA 4CDOA 1GSSA 2LSTA 1EP8A 1SKSB 1U87A 3IPZA 3CTFA 1QGVA 4MH2A 2FWHA 4ZBAA 2VL2A 4EKZA 2OACA 5ECIB 1IYIA 5F07A 4TVEA 4PUFC 3WGXA 1XW6A 3M9JA 3GSSA 1RK4A 4BPYA 4MJBA 3KGKA 2JADA 1I5GA 1X0RA 1K0MA 1GP1A 1B8XA 2NVLA 3H79A 1M2BA 3VWUA 2PU9C 5COHA 2R3XA 1JHBA 1HNBA 3SWLA 1QXHA 1AQWA 3UAPA 5A5KA 4KCEA 5IMCA 3GX8A 1XBSA 4GRFA 4J57E 1PN9A 3HCZA 2RIIA 2NDOA 4Q5RA 2GQLA 5IPGA 1EEMA 2VCVA 1A2MA 2HE3A 1BX9A 4POBA 4PQHA 4D73A 1O8XA 1EV9A 14GSA 4MK3A 1W89A 2KLXA 3G7JA 1EEJA 5HFIA 2K18A 4F0CA 2YOIA 4ZL8A 4HZ2A 3IAS2 3UARA 2YV9A 1MEKA 1MTCA 1K0CA 3A5WA 3BOAA 2YANA 1G6YA 2MMZA 4BVXA 4PURA 4ZIJA 2P5QA 2BJXA 2H30A 2WJUA 2LNSA 1GTIA 3UVHA 3NZNA 3D5JA 3GH6A 12GSA 1URMA 3L0HA 2E7PA 2K8VA 2WS2A 3MNGA 2GZYA 3D22A 4ML1A 5G30A 4NHWA 2EIQA 2CZ3A 3I6AA 1H4OA 1B9YC 1KBNA 4GQFA 4IP1A 1F9MA 4FYUA 3BCKA 5A4VA 2GSRA 4YQVA 1XVWA 1GSUA 3Q18A 5DDLA 4Q5QA 3UBKA 1XOAA 3FZ5A 2WGRA 1T00A 3QAGA 3FY7A 3C73A 3C71A 5H5SA 2YWNA 4KUNA 4V2NA 1EOHA 1E2YA 4LA1A 2XPEA 4N0VA 1ZYEA 5JCUA 2PERA 2R6KA 3I43A 3FZAA 3QMXA 4I2UA 17GSA 1F6MC 20GSA 1XFLA 3M8NA 1KTEA 3VFIA 2IMEA 2GT6A 4MJCA 3QFBC 4FYCA 1M2AA 1WIKA 5ECQB 5J4UA 3ZMLA 2LJKA 1V98A 2IMDA 1O7UA 4IS0A 1PMTA 5DQSA 3CSJA 1XZOA 4CW9A 2HRNA 3LXTA 3ERGA 2KOKA 4EXJA 1R26A 2J23A 1MDIA 5CRWA 1AC1A 1THOA 2LKUA 4EDZA 2CVBA 2HNLA 2I4AA 2JSZA 4G19A 3LEFA 2EIRA 4OFMA 3GSTA 2VLTA 2FUG2 1HNCA 5KN1A 3GA4A 4MJAA 2VCZA 2D2ZA 4WEYA 5GSTA 4PGTA 2X64A 3A2VA 3ZFLA 5DVBA 1PA3A 3H4KA 2VL9A 1DBYA 1SD9A 5CRDA 4YAVA 2HZEA 2R5GA 1EP7A 3HKRA 2H70A 2DJ2A 4IHUA 2G0FA 3F4TA 1PKZA 5JCWA 5HQPA 3GIXA 3HYPA 5DQYA 1MDKA 2H1BA 1H75A 3UEMA 5ECSA 2C3TA 2VL3A 5LCZA 4XIHA 2AAWA 2MMNA 1DE2A 5E59A 5DALA 4ZBBA 4EE0A 1M9BA 2FA4A 1X9SB 3L4NA 1GUHA 4YQUA 2IMKA 2B6MA 3ISOA 4V2MA 2DIYA 3ZVJD 4F9ZA 4LL4B 3D4TA 3EVIA 1V9WA 2DSAA 1X5CA 4ECIA 3UIWA 1F37A 1XVQA 4K7IA 5KEJA 2LEGA 2LTKA 3CRTA 4EDYA 2GGTA 2LQQA 1PKWA 4KAEA 4MA9A 3KMNA 3GNJA 3FRCA 4H86A 2YN1A 16GSA 3UBLA 1Z6NA 4Q5FA 2AV4A 2TIRA 3VPQA 3P8WA 3EWLA 1Y25A 2H8LA 4L8EA 3MSZA 3FZ9A 1B9XC 3LQ7A 4J56E 2H1GA 4BVYA 1T8EB 1S3CA 4ISDA 5LNKe 1R5AA 1W4VA 3BD2A 1XOBA 7GSSA 3DRNA 5J9CA 1QK8A 2GLRA 1GUKA 3DWVA 1YF1A 4WR4A 3KD0A 2YWIA 4JZQA 4DSRA 1GL8A 1ZCPA 3UMAA 2GSTA 2C3QA 8GSSA 1GSFA 3I9V2 1YZXA 1SKWB 1U6TA 1TXXA 1TRWA 2ZUPA 1F2EA 4HZ4A 2IMFA 2L6DA 2IFQA 2PN8A 1DSBA 1AXDA 1TJDA 3C8EA 4F03A 3HVVA 4KNDA 3ZREA 1U3AA 2GZZA 2FY6A 3TRQA 2RUEA 2WULA 1TK0B 4E8EA 2HLSA 4BA7A 5D9XA 1TOFA 2B5YA 1XXUA 3J7Yb 1VF1A 2YNXA 3LXZA 5J5NA 6GSVA 5CO3A 5ECRB 3ZLPA 2DMLA 3MAKA 3KIJA 2C1YA 2DJ3A 4DEJA 2FWGA 5D9WA 2NBSA 5GAPD 2AUVA 2PGTA 2YJ7A 2LQOA 1O85A 4K9ZA 2F3MA 2DLXA 1ST9A 1SL0B 1J9BA 1TW9A 2H6XA 4NV2A 1J0FA 1FOVA 1ABAA 6GSSA 1M99A 5DBQA 3PGTA 5LD0A 1SL2B 1O6JA 2HSHA 5GAND 4N0ZA 1NM3A 3F9UA 5KN3A 3HVXA 2H72A 4PXOA 4LMWA 4HEA2 1T7PB 3TJGA 5B8BA 4KA0A 1VGLA 3SBCA 2LRCA 4K0GA 1FB0A 3F4SA 3UJ1A 4PQ1A 3FEUA 2L5LA 3L9VA 4Q5NA 1A2LA 1WMJA 4X0XA 4ZB9A 4KB3A 1SYXA 3TKPA 2O7KA 4K1FA 4HQSA 1B48A 4MMMA 3IR4A 1CQHA 1OC9A 2K9FA 4XTSA 3IHQA 3F0IA 5ENUA 1Z7PA 3TKSA 4HDEA 2XC2A 1YY7A 2JACA 3TKQA 4MF6A 3KP8A 3ME7A 2LNTA 4DVCA 5FT3A 2FHEA 2VCWA 2FWFA 2C0EA 2KP2A 1A8LA 1ZYQB 3GH9A 4RI7A 1M9AA 1TI1A 3GKMA 4WBRD 4TKYA 2JZTA 3GL5A 4YQMA 2DC5A 3IDVA 1I9DA 1ILOA 1FO5A 1O73A 4F82A 4JEDA 3TJJA 3WYWA 2OJLA 1HYUA 2AHEA 2WRTA 1FVJA 1G7OA 5AIXA 4KSOA 4TRXA 2L4QA 2EIOA 3IRAA 3ZFBA 1YKAA 1OKDA 5CYYA 4EUYA 4OCEA 3BCIA 2I9HA 1BYEA 2P31A 1TRUA 4OFNA 5KN2A 1SKRB 1MD3A 3W6GA 5IMAA 4OWYA 4N11A 4NXIA 1NSWA 1Z9HA 3GKXA 4RI6A 1WWJA 3QAWA 4POMA 1Z7RA 3WT2A 3IOSA 3KCMA 1UN2A 3GTUA 3W8SA 1K0BA 5IMZA 2DIZA 1TRSA 4XHMA 6GSUA 1JZRA 2ES7A 4V1Ap 3TOUA 3QAVA 4MDCA 2LRTA 2L57A 2F8FA 4YAPA 2FGXA 4CHSA 2C0DA 4KH7A 4HU9A 4KSMA 1OAZA 1SK0A 2EC4A 3QD9A 1GSEA 5DJMA 4G2EA 2BMXA 2B5XA 3CXGA 4RUVA 1FVKA 1EV4A 1KEBA 3QOUA 3IV4A 3M9KA 1EGOA 2PVOC 2I1UA 4AGSA 4I6XA 2OA7A 3TOTA 5DCGA 5AGYA 1SJIA 1K3YA 4HJ2A 2B1LA 5AISA 5C04A 2DJKA 3DEXA 1PGTA 1YQ1A 5AN1A 1TKDB 3C1RA 5G31A 5JCGA 2F8AA 4N10A 4FYBA 4I5QA 2AB6A 3V1WA 4OO4A 4JBBA 2C0GA 1TU7A 2TRCP 1GSYA 3HJMA 2MBSA 2H1DA 2IN3A 5D8IA 1THXA 3KM6A 1K0AA 2H6YA 4KCAA 3F8UA 5CRGA 1E6BA 3RHBA 3Q6OA 4TN8A 3HD5A 2VO4A 3LGCA 2K6VA 3TUEA 3GX0A 3E0UA 5ID2A 3FZ4A 1GUMA 4KX4A 1LU4A 1JLWA 2O85A 1EGRA 2KP1A 4X1UA 1VF2A 2I81A 3EU3A 4XRAA 3IAM2 3TKRA 1GNEA 3HY2A 2WB9A 2JSYA 2IWTA 2GQMA 1R5PA 2B3SA 3CBUA 1OC3A 1OC8A 2X99A 3L9SA 1OVNA 2JL4A 2VCQA 2N5BA 3GKNA 1HQOA 4WF4A 1NHYA 2V6KA 4BL7A 4PQIA 3HZ4A 1Q98A 4TXVA 3CSHA 4LLRA 4DSSB 1CQGA 3PH9A 1V57A 4MPGA 3HA9A 3HJPA 3IE3A 3FHKA 5ECNB 3DIEA 4MJEA 2M46A 4PUAA 4OCFA 4MABA 2L4CA 3UL3A 5A4UA 4HJMA 1K3OA 4JR4A 4K7OA 1MDJA 2H6ZA 2XPDA 4AJ7A 1GSDA 2YP6A 2MMOA 1RW1A 1EWXA 5HR1A 4IGJA 3W8JA 2VLUA 2CAQA 1A2JA 3EU4A 2XHFA 1EOGA 2GZPA 2M72A 3ZIVA 3ZVJA 1ZOFA 2CZ2A 1JFUA 4L0UA 4POKA 3APQA 2CV4A 4MZCA 5KN0A 1SENA 2PMTA 4WETA 3D0ZA 1TP9A 2VCXA 3TJKA 5DAKB 1T3BA 1ZGNA 1WJKA 5ECLB 2YZHA 2O8VB 3M0FA 4X43A 2WCIA 4NPBA 2BTOT 3D21A 4DSQA 2VM2A 3RBTA 3ZMKA 4ECJA 3LJRA 5HR3A 4MZWA 3OR5A 2VLVA 1XW5A 2REMA 4MLYA 3S9FA 5D96A 2E2MA 4MF5A 1LBKA 4K0NA 3R2QA 22GSA 3VK9A 4I97A 1B4QA 4ML6A 3CYNA 1JLVA 3US3A 2X8CA 4PNFA 1O81A 1G0TA 2OE3A 2GDRA 4JRRA 1KNGA 2JU5A 2H1AA 1QMVA 3MDKA 1FW1A 1ERTA 2FWEA 2C80A 4TW5A 4RQRA 4IQAA 3G7YA 1BEDA 1SJ6A 3Q74A 4ECCA 3WD6A 3VI7A 5DJLA 3WGEA 2FD3A 1A0RP 3TGZA 4RQXA 2C0FA 3BBYA 4XRDA 4GWRA 4BWSA 2CVKA 3O3TA 4GTUA 1R4WA 4IJ3A 5G5FA 4IJIA 3VI5A 4FH8A 1ERVA 3CRUA 5D9VA 3KH7A 2CA8A 3KMOA 1Z3EA 1BQ7A 2H19A 5J41A 3VURA 1TU8A 1X5DA 3ZTLA
chains in the Genus database with same CATH superfamily
4D73B 3G9BA 1XPVA 4IELA 2GQKA 2JZRA 3F3QA 5F0GA 1XWKA 3IC4A 3A3TA 3HDCA 4AF2A 1ML6A 1UVZA 2DJ1A 1ZMAA 2VOCA 3GFKA 3NOFA 1DUGA 1J08A 3FK8A 1ZZYA 5H5RA 3ZIJA 2HSYA 1VF4A 4BVXB 2NPBA 2JZSA 2VL2C 3FYGA 1B4PA 4K2XA 2YCDA 3P90A 4K8MA 2P0GA 1G6WA 2IPAA 3IK9A 2KHPA 3TKSE 4I8BA 2VCTA 4MZBA 1GRXA 1PRXA 5ECKB 3R3EA 4NWYA 2LS5A 1OYJA 2HI7A 1SJZA 1V2AA 2OADA 3HJOA 1TTZA 3VWWA 3MWHA 1QUWA 2IIYA 1XIYA 1M2DA 3GRXA 4K2DA 13GSA 4E8HA 4O7HA 3VLNA 4QL7A 1GH2A 1V58A 2IJYA 2V6OA 3N9JA 4EVMA 2DMMA 1OE8A 5ECMB 1ERWA 4KW6A 2CAIA 1Y6EA 3CSIA 1X5EA 4DSSA 5IOXA 3KH9A 1FHEA 1IYHA 2VM1A 2DBCA 4HQZA 5ELAA 4WXTA 1N2AA 3QFAC 4MH3A 5B7CA 3TCOA 5G1KA 5IIZA 4ILFA 2WFCA 1M7TA 2OE0A 5FHIA 1PL1A 1WPIA 5EVOA 1XWCA 4L5LA 1S3AA 2H66A 3F6DA 3DMLA 5IMVA 4GSTA 3TJBA 4MPFA 2YV7A 3CQFA 3DD3A 4KDUA 4EF0A 2K8SA 1ZYPA 4PTSA 4LL1B 1PX7A 4KDYA 3P2AA 3QDNA 1AW9A 3KTLA 1EZKA 1AQVA 4O92A 4OMVA 4MCUA 5B6MA 2PVQA 1WRYA 2R2JA 2XBQA 5IQYA 4WBJA 1GTUA 5DAKA 1OE7A 3HZ8A 1YEPA 4BWQA 2H76A 1Q4JA 2CQ9A 4GSSA 1GLQA 2A2SA 3KJYA 2V41A 1AQXA 4J2FA 1JZWA 2HZFA 2QGVA 2P5RA 4XS6A 2N5AA 1VRSD 5EPFA 2H0IA 4NAXA 3ED3A 3GKKA 5EY6A 19GSA 3ZITA 3QPMA 4IBPA 2V2GA 3H1NA 3ZYWA 2E2GA 4FO5A 1QQ2A 3E9JB 2YZUA 1PX6A 1PQNA 1X9MB 1PD21 4GCIA 3H8QA 3F63A 3ZL5A 4GQCA 3LORA 2B7KA 1SYRA 3FR3A 5DALB 5ELGA 5IMDA 3GYKA 1YKCA 4XS1A 4IW9A 3PR8A 3HVSA 4O5UA 2MMAA 2ALBA 2H71A 2H73A 1GNWA 3BJ5A 5G5EA 2HXKA 1SU9A 2YWMA 1C72A 4TR4A 2VD1A 2CVDA 4GXZA 4N30A 3H93A 1YEXA 5H5QA 1Z5YE 2GT5A 4YKGA 1UC7A 3EE2A 2OBKA 2XBIA 2OE1A 2QSIA 1TI3A 2O87A 5CREA 4Z2UA 4ACSA 4ZILA 4O32A 2E0QA 2RM5A 2ON5A 2HFDA 4IQ1A 1FAAA 4WF5A 1U3IA 2I3YA 2VUPA 3KP9A 5J9BA 4QL9A 2F51A 3FR6A 2O89A 4P3YB 3FR9A 2RLIA 2A4VA 4IKHA 5ECOB 3LYKA 1A23A 3J7Yk 4TXOB 2FCHA 4GSNA 3A2WA 4XS4B 2X4AA 2V32A 3LYPA 4TR1B 4IP6A 1HNAA 1HD2A 1XWGA 2FLSA 1T4ZA 2H0HA 5AIVA 3DVWA 1A8YA 1XWAA 5E4WA 2IL3A 1R7HA 2IFQB 2M80A 2MZCA 1YJ6A 2WDUA 4ECBA 3EURA 3DGQA 3IHGA 5G1LA 4JR6A 3DKSA 1YDKA 3ME8A 2TRXA 2OBIA 5CNWA 1ACVA 3I69A 5HR2A 2YJHA 1XCCA 4HUAA 1VF3A 3N5OA 3GHAA 4EC0A 4O5RA 2B5EA 1ON4A 3LG6A 3E3EA 2X8HA 3C7MA 4ZB6A 3EC3A 2PUKC 3ZRDA 1G7EA 1NHOA 6GSTA 3GN3A 3RAZA 1XW9A 2LV3A 3AY8A 4Z7XA 1AAZA 1RQMA 3UVTA 2H01A 4ULXA 3U6VA 1K0OA 4QQ7A 2LJRA 5HFKA 2WZ9A 3GV1A 2AYTA 1YF0A 4JE1A 3KXOA 4F2IA 2HRFA 3L78A 4K7NA 1ERUA 3QCPA 3QR6A 2LRNA 2R0PA 1NW2A 4G9HA 3CMIA 5D9TA 3C1SA 1UA5A 4OD7A 3CTGA 1GLPA 5IMFA 3HXSA 2LJAA 2CX4A 4HOJA 3D6IA 1XWBA 10GSA 2J9HA 4F0BA 4ZBDA 5ECPB 3Q19A 4LMVA 1S3RA 1WE0A 3LSZA 3G7IA 4POLA 3EMPA 5JWOB 2KUCA 5IO2A 1OC9B 1JZDA 3RPPA 2RUFA 3TRPA 4ID0A 2LUSA 3HHVA 1GSQA 3TJFA 2FA8A 2NTOA 2N5FA 3IXRA 4FQUA 2F9SA 1USBA 5IPHA 1TK8B 4L0WA 1PL2A 1JZOA 4I2TA 3IK7A 1M0UA 4EL1A 2VD0A 2L59A 5EL8A 3PINA 2R0GA 5CAXA 4HI7A 3IBHA 3LWAA 3APSA 5L71A 2IMIA 3FW2A 3D4MA 3GMFA 1SD8A 2CT6A 3LFLA 3O6TA 1O8WA 3GURA 1SL1B 3TB2A 3UOMA 1ZL9A 5INYA 2VIMA 3M3MA 1MD4A 3RHCA 4JU5A 4AJ8A 2MYGA 1GWCA 3EYTA 1U88A 2Z9SA 1A0FA 1WP0A 1V40A 3F4RA 3VWXA 2ZCTA 2B1KA 2FNOA 2H74A 4NMUA 3O76A 4KDXA 1GTAA 2OKAA 3RDWA 4G10A 2R4VA 5F8BA 3K8NA 1SK1A 2GSQA 2C8UA 4HU7A 2GTUA 3GTUB 2MBTA 2L5OA 6GSXA 2DJ0A 4V1Ag 3TKSC 2PWJA 1TK5B 1F3BA 1K0DA 5G2ZA 9GSSA 3DYRA 1FB6A 3NIVA 2PBJA 4MF7A 6GSYA 1S3DA 2H75A 5F05A 1BJXA 4TXOA 2YWOA 4XS4A 3WT1A 4GF0A 4TR1A 2ON7A 4ZXGA 1BAYA 3VPTA 5J3RA 2C4JA 4FIWA 1BG5A 3P7XA 4WKWA 3IA1A 3DXBA 4ZL7A 4PX1A 5GZZB 2VAFA 1GULA 3APOA 18GSA 3EMXA 5FWGA 4MP4A 5JWRB 2PPTA 4EO3A 4G0LA 2L6CA 2CX3A 4PNGA 1WOUA 3WGDA 3FKFA 4L5OA 5CRHA 4WR5A 5CP1A 1GTBA 5A4WA 4TR3A 3JCML 1X9WB 1T4YA 3A2XA 4TOPA 4V2LA 4ZB8A 5ABRA 1TRVA 2GS3A 2C3NA 5HR0A 4KE3A 5JWQB 3ERWA 6GSWA 1Z6MA 4IN0A 4AJ6A 1SK2A 1K0NA 2QC7A 4HSCX 5IM9A 1AUCA 5ID2B 5B8AA 5F06A 3U5RE 11GSA 2DJJA 4NV5A 3F3RA 1F3AA 5ECHB 1A24A 3VWVA 3ERFA 3M1GA 4IVFA 2X8GA 3TRXA 1N8JA 3L9UA 3EINA 5HFGA 4KGIA 3TDGA 4ZL9A 4GLTA 3MYDA 2G2QA 1LJRA 2V1MA 1T1VA 2QKEA 2A2RA 1QFNA 5IOWA 2AJQB 2YPMA 2B7JA 3KTBA 3F6FA 2HYXA 2RM6A 3GL3A 5IO0A 5C00A 4OFTA 4K6XA 1DE1A 4NHZA 4YH2A 5GSSA 5B6NA 5D93A 1K3LA 3GUSA 4HS1A 2DKHA 5DCHA 3RPNA 4TR0A 1AIUA 2HT9A 4OO5A 5D73A 3KZQA 1OKTA 4XCSA 2GSSA 3DVXA 1TDIA 3KEBA 2HZEB 1FG4A 2R37A 2GVPA 3ZZXA 1PSQA 2H0GA 2ZNMA 4CDOA 1GSSA 2LSTA 1EP8A 1SKSB 1U87A 3IPZA 3CTFA 1QGVA 4MH2A 2QA1A 2FWHA 4ZBAA 2VL2A 4EKZA 2OACA 5ECIB 1IYIA 5F07A 4TVEA 4PUFC 3WGXA 1XW6A 3M9JA 3GSSA 1RK4A 4BPYA 4MJBA 3KGKA 2JADA 1I5GA 1X0RA 1K0MA 1GP1A 1B8XA 2NVLA 3H79A 1M2BA 3VWUA 2PU9C 5COHA 2R3XA 1JHBA 1HNBA 3SWLA 1QXHA 1AQWA 3UAPA 5A5KA 4KCEA 5IMCA 3GX8A 1XBSA 4GRFA 4J57E 1PN9A 3HCZA 2RIIA 2NDOA 4Q5RA 2GQLA 5IPGA 1EEMA 2A2PA 2VCVA 1A2MA 5KOWA 2HE3A 1BX9A 4POBA 4PQHA 4D73A 1O8XA 4BVYB 1EV9A 14GSA 4MK3A 1W89A 2KLXA 3G7JA 1EEJA 5HFIA 2K18A 4F0CA 2HRKA 2YOIA 4ZL8A 4HZ2A 3IAS2 3UARA 2YV9A 1MEKA 1MTCA 1K0CA 3A5WA 3BOAA 2YANA 1G6YA 2MMZA 4BVXA 4PURA 4ZIJA 2P5QA 2BJXA 2H30A 2WJUA 2LNSA 1GTIA 3UVHA 3NZNA 3D5JA 3GH6A 12GSA 1URMA 3L0HA 2E7PA 2K8VA 2WS2A 1M3IA 3MNGA 2GZYA 3D22A 4ML1A 5G30A 4NHWA 2EIQA 2CZ3A 3I6AA 1H4OA 1B9YC 1KBNA 4GQFA 4IP1A 1F9MA 4FYUA 3BCKA 5A4VA 2GSRA 4YQVA 1XVWA 1GSUA 3Q18A 5DDLA 4Q5QA 3UBKA 1XOAA 3FZ5A 2WGRA 1T00A 3QAGA 3FY7A 3C73A 3C71A 5H5SA 2YWNA 4KUNA 4V2NA 1EOHA 1E2YA 4LA1A 2XPEA 4N0VA 1ZYEA 5JCUA 2PERA 2R6KA 3I43A 3FZAA 3QMXA 4I2UA 17GSA 1F6MC 20GSA 1XFLA 3M8NA 1KTEA 3VFIA 2IMEA 2GT6A 4MJCA 3QFBC 4FYCA 1M2AA 1WIKA 5ECQB 5J4UA 3ZMLA 2LJKA 1V98A 2IMDA 1O7UA 4IS0A 1PMTA 5DQSA 3CSJA 1XZOA 4CW9A 2HRNA 3LXTA 3ERGA 2KOKA 4EXJA 1R26A 2J23A 1MDIA 5CRWA 4Z2TA 1AC1A 1THOA 2LKUA 4EDZA 2CVBA 2HNLA 2I4AA 2JSZA 4G19A 3LEFA 2EIRA 4OFMA 3GSTA 2VLTA 2FUG2 1HNCA 5KN1A 3GA4A 4MJAA 2VCZA 2D2ZA 4WEYA 5GSTA 4PGTA 2X64A 3EPTA 3A2VA 3ZFLA 5DVBA 1PA3A 3H4KA 2VL9A 1DBYA 2QA2A 1SD9A 5CRDA 4YAVA 2HSMA 2HZEA 2R5GA 1EP7A 3HKRA 1PN0A 2H70A 2DJ2A 4IHUA 2G0FA 3F4TA 1PKZA 5JCWA 5HQPA 3GIXA 3HYPA 5DQYA 1MDKA 2H1BA 1H75A 3UEMA 5ECSA 3A5IA 2C3TA 2VL3A 5LCZA 4X4JA 4XIHA 2AAWA 2MMNA 1DE2A 5E59A 5DALA 4ZBBA 4EE0A 1M9BA 2FA4A 3HVNA 1X9SB 3L4NA 1GUHA 4YQUA 2IMKA 2B6MA 3ISOA 4V2MA 2DIYA 3ZVJD 4F9ZA 4LL4B 3D4TA 3EVIA 1V9WA 2DSAA 1X5CA 4ECIA 3UIWA 1F37A 1XVQA 4K7IA 5KEJA 2LEGA 2LTKA 3CRTA 4EDYA 2GGTA 2LQQA 1PKWA 4KAEA 4MA9A 3KMNA 3GNJA 3FRCA 4H86A 2YN1A 16GSA 3UBLA 1Z6NA 4Q5FA 2AV4A 2TIRA 3VPQA 3P8WA 3EWLA 4CY8A 1Y25A 2H8LA 4L8EA 3MSZA 3FZ9A 2A4HA 1B9XC 3LQ7A 4J56E 2H1GA 4BVYA 1T8EB 1S3CA 4ISDA 5LNKe 1R5AA 1W4VA 3BD2A 4KF9A 1XOBA 7GSSA 3DRNA 5J9CA 1QK8A 2GLRA 1GUKA 3DWVA 1YF1A 4WR4A 3KD0A 2YWIA 4JZQA 4DSRA 1GL8A 1ZCPA 3UMAA 2GSTA 2C3QA 8GSSA 1GSFA 3I9V2 1YZXA 1SKWB 1U6TA 1TXXA 1TRWA 2ZUPA 4Z2RA 1F2EA 4HZ4A 2IMFA 2L6DA 2IFQA 2PN8A 1DSBA 1AXDA 2HRAA 1TJDA 3C8EA 4F03A 3HVVA 4KNDA 3ZREA 1U3AA 2GZZA 2FY6A 3TRQA 2RUEA 2WULA 1TK0B 4E8EA 2HLSA 4BA7A 5D9XA 1TOFA 2B5YA 1XXUA 3J7Yb 1VF1A 2YNXA 3LXZA 5J5NA 6GSVA 5CO3A 5ECRB 3ZLPA 2DMLA 3MAKA 3KIJA 2C1YA 2DJ3A 4DEJA 2FWGA 3PPUA 5D9WA 2NBSA 5GAPD 2AUVA 2PGTA 2YJ7A 2LQOA 1O85A 4K9ZA 2F3MA 1PFOA 2DLXA 4EIPA 1ST9A 1SL0B 1J9BA 1TW9A 2H6XA 4K5RA 4NV2A 1J0FA 1FOVA 1ZYNA 1ABAA 6GSSA 1M99A 5DBQA 3PGTA 5LD0A 1SL2B 1O6JA 2HSHA 5GAND 4N0ZA 1NM3A 3F9UA 5KN3A 3HVXA 2H72A 4PXOA 4LMWA 4HEA2 1T7PB 3TJGA 5B8BA 4KA0A 1VGLA 3SBCA 2LRCA 4K0GA 1FB0A 3F4SA 3UJ1A 4PQ1A 3FEUA 2L5LA 4BL7B 3L9VA 4Q5NA 1A2LA 1WMJA 4X0XA 4ZB9A 4KB3A 1SYXA 3TKPA 2O7KA 4K1FA 4HQSA 3MIXA 1B48A 4MMMA 4A5PA 3IR4A 1CQHA 1OC9A 2K9FA 4XTSA 3IHQA 2DKIA 3F0IA 5ENUA 1Z7PA 3TKSA 4HDEA 2XC2A 1YY7A 2JACA 3TKQA 4MF6A 5BRTA 3KP8A 2UZ8A 3ME7A 2LNTA 4DVCA 5FT3A 2FHEA 2VCWA 2FWFA 2C0EA 2KP2A 1A8LA 1ZYQB 4G0IA 3GH9A 4RI7A 1M9AA 1TI1A 3GKMA 4WBRD 4BIKA 4TKYA 2JZTA 3GL5A 4YQMA 2DC5A 3IDVA 1I9DA 1ILOA 1FO5A 1O73A 4F82A 4JEDA 3TJJA 3WYWA 2OJLA 1HYUA 2AHEA 2WRTA 1FVJA 1G7OA 5AIXA 4KSOA 4TRXA 2L4QA 2EIOA 3IRAA 3ZFBA 1YKAA 1OKDA 5CYYA 3IC8A 4EUYA 4OCEA 3BCIA 2I9HA 1BYEA 2P31A 1TRUA 4OFNA 5KN2A 1SKRB 1MD3A 3W6GA 5IMAA 4OWYA 4N11A 4NXIA 1NSWA 1Z9HA 3GKXA 4RI6A 1WWJA 3QAWA 4POMA 1Z7RA 3WT2A 3IOSA 3KCMA 1UN2A 3GTUA 3W8SA 1K0BA 5IMZA 2DIZA 1TRSA 4XHMA 6GSUA 1JZRA 2ES7A 4V1Ap 3TOUA 3QAVA 4MDCA 2LRTA 2L57A 2F8FA 4YAPA 4K5SA 2FGXA 4CHSA 2C0DA 4KH7A 4HU9A 4KSMA 1OAZA 1SK0A 2EC4A 3QD9A 1GSEA 5DJMA 4ICYA 4G2EA 2BMXA 2B5XA 3CXGA 4RUVA 1FVKA 4YKFA 1EV4A 1KEBA 3QOUA 3IV4A 3M9KA 1EGOA 2PVOC 4O5QA 2I1UA 4AGSA 4I6XA 4MNNA 2OA7A 3TOTA 5DCGA 5AGYA 1SJIA 1K3YA 4HJ2A 2B1LA 5AISA 5C04A 2DJKA 3DEXA 1PGTA 1YQ1A 5AN1A 4USSA 1TKDB 3C1RA 5G31A 5JCGA 2F8AA 4N10A 4FYBA 4I5QA 2AB6A 3V1WA 4OO4A 4JBBA 2C0GA 1TU7A 1M3JA 2TRCP 1GSYA 3HJMA 2MBSA 2H1DA 2IN3A 5D8IA 1THXA 3KM6A 1K0AA 2H6YA 4KCAA 3F8UA 5CRGA 3LW9A 1E6BA 3RHBA 3Q6OA 4TN8A 3HD5A 2VO4A 3LGCA 2K6VA 3TUEA 3GX0A 3E0UA 5ID2A 3FZ4A 1GUMA 1FOHA 4KX4A 1LU4A 1JLWA 2O85A 1EGRA 3FMWA 2KP1A 4X1UA 1VF2A 2I81A 3EU3A 4XRAA 3IAM2 3TKRA 1GNEA 3HY2A 2WB9A 2JSYA 2IWTA 2GQMA 1R5PA 2B3SA 3CBUA 1OC3A 1OC8A 2X99A 3L9SA 1OVNA 2JL4A 4CY6A 2VCQA 2N5BA 3GKNA 1HQOA 4WF4A 1NHYA 2V6KA 4BL7A 2X49A 4PQIA 3HZ4A 1Q98A 4TXVA 3CSHA 4LLRA 4DSSB 1CQGA 3PH9A 1V57A 4MPGA 4EIQA 3HA9A 3HJPA 3IE3A 3FHKA 5ECNB 3DIEA 4MJEA 2M46A 4PUAA 4OCFA 4MABA 2L4CA 3UL3A 5A4UA 4HJMA 1K3OA 4JR4A 4K7OA 5KOXA 1MDJA 2H6ZA 2XPDA 4AJ7A 1GSDA 2YP6A 2MMOA 1RW1A 1EWXA 5HR1A 4IGJA 3W8JA 2VLUA 2CAQA 1A2JA 3EU4A 2XHFA 1EOGA 2GZPA 2M72A 3ZIVA 3ZVJA 1ZOFA 2CZ2A 1JFUA 4L0UA 4POKA 3APQA 2CV4A 4MZCA 5KN0A 1SENA 2PMTA 4WETA 3D0ZA 1TP9A 2VCXA 3TJKA 1XG8A 5DAKB 1T3BA 1ZGNA 1WJKA 5ECLB 2YZHA 2O8VB 3M0FA 4X43A 2WCIA 4NPBA 2BTOT 3D21A 4DSQA 2VM2A 3RBTA 3ZMKA 4ECJA 3LJRA 5HR3A 4MZWA 3OR5A 2VLVA 1XW5A 2REMA 4MLYA 3S9FA 5D96A 2E2MA 4MF5A 1LBKA 4K0NA 3R2QA 22GSA 3VK9A 4I97A 1B4QA 4ML6A 3CYNA 1JLVA 3US3A 2X8CA 4PNFA 1O81A 1G0TA 2OE3A 2GDRA 4JRRA 1KNGA 2JU5A 2H1AA 1QMVA 3MDKA 1FW1A 1ERTA 2FWEA 2C80A 4TW5A 4RQRA 4IQAA 3G7YA 1BEDA 1SJ6A 3Q74A 4ECCA 3WD6A 3VI7A 5DJLA 5BMUA 3WGEA 2FD3A 1A0RP 3TGZA 4RQXA 2C0FA 3BBYA 4XRDA 4GWRA 4BWSA 2CVKA 3O3TA 4GTUA 1R4WA 4IJ3A 5G5FA 4IJIA 3VI5A 4FH8A 1ERVA 3CRUA 5D9VA 3KH7A 2CA8A 3KMOA 1Z3EA 1BQ7A 2H19A 5J41A 2R0CA 3VURA 1TU8A 1X5DA 4G0KA 3ZTLA
chains in the Genus database with same CATH topology
4D73B 3G9BA 1XPVA 4IELA 2GQKA 2JZRA 3F3QA 5F0GA 1XWKA 3IC4A 3A3TA 3HDCA 4AF2A 1ML6A 1UVZA 2DJ1A 1ZMAA 2VOCA 3GFKA 3NOFA 1DUGA 1J08A 3FK8A 1ZZYA 5H5RA 3ZIJA 2HSYA 1VF4A 4BVXB 2NPBA 2JZSA 2VL2C 3FYGA 1B4PA 4K2XA 2YCDA 3P90A 4K8MA 2P0GA 1G6WA 2IPAA 3IK9A 2KHPA 3TKSE 4I8BA 2VCTA 4MZBA 1GRXA 1PRXA 5ECKB 3R3EA 4NWYA 2LS5A 1OYJA 2HI7A 1SJZA 1V2AA 2OADA 3HJOA 1TTZA 3VWWA 3MWHA 1QUWA 2IIYA 1XIYA 1M2DA 3GRXA 4K2DA 13GSA 4E8HA 4O7HA 3VLNA 4QL7A 1GH2A 1V58A 2IJYA 2V6OA 3N9JA 4EVMA 2DMMA 1OE8A 5ECMB 1ERWA 4KW6A 2CAIA 1Y6EA 3CSIA 1X5EA 4DSSA 5IOXA 3KH9A 1FHEA 1IYHA 2VM1A 2DBCA 4HQZA 5ELAA 4WXTA 1N2AA 3QFAC 4MH3A 5B7CA 3TCOA 5G1KA 5IIZA 4ILFA 2WFCA 1M7TA 2OE0A 5FHIA 1PL1A 1WPIA 5EVOA 1XWCA 4L5LA 1S3AA 2H66A 3F6DA 3DMLA 5IMVA 4GSTA 3TJBA 4MPFA 2YV7A 3DD3A 4KDUA 4EF0A 2K8SA 1ZYPA 4PTSA 4LL1B 1PX7A 4KDYA 3P2AA 3QDNA 1AW9A 3KTLA 1EZKA 1AQVA 4O92A 4OMVA 4MCUA 5B6MA 2PVQA 1WRYA 2R2JA 2XBQA 5IQYA 4WBJA 1GTUA 5DAKA 1OE7A 3HZ8A 1YEPA 4BWQA 2H76A 1Q4JA 2CQ9A 4GSSA 1GLQA 2A2SA 3KJYA 2V41A 1AQXA 4J2FA 1JZWA 2HZFA 2QGVA 2P5RA 4XS6A 2N5AA 1VRSD 5EPFA 2H0IA 4NAXA 3ED3A 3GKKA 5EY6A 19GSA 3ZITA 3QPMA 4IBPA 2V2GA 3H1NA 3ZYWA 2E2GA 4FO5A 1QQ2A 3E9JB 2YZUA 1PX6A 1PQNA 1X9MB 1PD21 4GCIA 3H8QA 3F63A 3ZL5A 4GQCA 3LORA 2B7KA 1SYRA 3FR3A 5DALB 5ELGA 5IMDA 3GYKA 1YKCA 4XS1A 4IW9A 3PR8A 3HVSA 4O5UA 2MMAA 2ALBA 2H71A 2H73A 1GNWA 3BJ5A 5G5EA 2HXKA 1SU9A 2YWMA 1C72A 4TR4A 2VD1A 2CVDA 4GXZA 4N30A 3H93A 1YEXA 5H5QA 1Z5YE 2GT5A 4YKGA 1UC7A 3EE2A 2OBKA 2XBIA 2OE1A 2QSIA 1TI3A 2O87A 5CREA 4Z2UA 4ACSA 4ZILA 4O32A 2E0QA 2RM5A 2ON5A 2HFDA 4IQ1A 1FAAA 4WF5A 1U3IA 2I3YA 2VUPA 3KP9A 5J9BA 4QL9A 2F51A 3FR6A 2O89A 4P3YB 3FR9A 2RLIA 2A4VA 4IKHA 5ECOB 3LYKA 1A23A 3J7Yk 4TXOB 2FCHA 4GSNA 3A2WA 4XS4B 2X4AA 2V32A 3LYPA 4TR1B 4IP6A 1HNAA 1HD2A 1XWGA 2FLSA 1T4ZA 2H0HA 5AIVA 3DVWA 1A8YA 1XWAA 5E4WA 2IL3A 1R7HA 2IFQB 2M80A 2MZCA 1YJ6A 2WDUA 4ECBA 3EURA 3DGQA 3IHGA 5G1LA 4JR6A 3DKSA 1YDKA 3ME8A 2TRXA 2OBIA 5CNWA 1ACVA 3I69A 5HR2A 2YJHA 1XCCA 4HUAA 1VF3A 3N5OA 3GHAA 4EC0A 4O5RA 2B5EA 1ON4A 3LG6A 3E3EA 2X8HA 3C7MA 4ZB6A 3EC3A 2PUKC 3ZRDA 1G7EA 1NHOA 6GSTA 3GN3A 3RAZA 1XW9A 2LV3A 3AY8A 4Z7XA 1AAZA 1RQMA 3UVTA 2H01A 4ULXA 3U6VA 1K0OA 4QQ7A 2LJRA 5HFKA 2WZ9A 3GV1A 2AYTA 1YF0A 4JE1A 3KXOA 4F2IA 2HRFA 3L78A 4K7NA 1ERUA 3QCPA 3QR6A 2LRNA 2R0PA 1NW2A 4G9HA 3CMIA 5D9TA 3C1SA 1UA5A 4OD7A 3CTGA 1GLPA 5IMFA 3HXSA 2LJAA 2CX4A 4HOJA 3D6IA 1XWBA 10GSA 2J9HA 4F0BA 4ZBDA 5ECPB 3Q19A 4LMVA 1WE0A 3LSZA 3G7IA 4POLA 3EMPA 5JWOB 2KUCA 5IO2A 1OC9B 1JZDA 3RPPA 2RUFA 3TRPA 4ID0A 2LUSA 3HHVA 1GSQA 3TJFA 2FA8A 2NTOA 2N5FA 3IXRA 4FQUA 2F9SA 1USBA 5IPHA 1TK8B 4L0WA 1PL2A 1JZOA 4I2TA 3IK7A 1M0UA 4EL1A 2VD0A 2L59A 5EL8A 3PINA 2R0GA 5CAXA 4HI7A 3IBHA 3LWAA 3APSA 5L71A 2IMIA 3FW2A 3D4MA 3GMFA 1SD8A 2CT6A 3LFLA 3O6TA 1O8WA 3GURA 1SL1B 3TB2A 3UOMA 1ZL9A 5INYA 2VIMA 3M3MA 1MD4A 3RHCA 4JU5A 4AJ8A 2MYGA 1GWCA 3EYTA 1U88A 2Z9SA 1A0FA 1WP0A 1V40A 3F4RA 3VWXA 2ZCTA 2B1KA 2FNOA 2H74A 4NMUA 3O76A 4KDXA 1GTAA 2OKAA 3RDWA 4G10A 2R4VA 5F8BA 3K8NA 1SK1A 2GSQA 2C8UA 4HU7A 2GTUA 3GTUB 2MBTA 2L5OA 6GSXA 2DJ0A 4V1Ag 3TKSC 2PWJA 1TK5B 1F3BA 1K0DA 5G2ZA 9GSSA 3DYRA 1FB6A 3NIVA 2PBJA 4MF7A 6GSYA 1S3DA 2H75A 5F05A 1BJXA 4TXOA 2YWOA 4XS4A 3WT1A 4GF0A 4TR1A 2ON7A 4ZXGA 1BAYA 3VPTA 5J3RA 2C4JA 4FIWA 1BG5A 3P7XA 4WKWA 3IA1A 3DXBA 4ZL7A 4PX1A 5GZZB 2VAFA 1GULA 3APOA 18GSA 3EMXA 5FWGA 4MP4A 5JWRB 2PPTA 4EO3A 4G0LA 2L6CA 2CX3A 4PNGA 1WOUA 3WGDA 3FKFA 4L5OA 5CRHA 4WR5A 5CP1A 1GTBA 5A4WA 4TR3A 3JCML 1X9WB 1T4YA 3A2XA 4TOPA 4V2LA 4ZB8A 5ABRA 1TRVA 2GS3A 2C3NA 5HR0A 4KE3A 5JWQB 3ERWA 6GSWA 1Z6MA 4IN0A 4AJ6A 1SK2A 1K0NA 2QC7A 5IM9A 1AUCA 5ID2B 5B8AA 5F06A 3U5RE 11GSA 2DJJA 4NV5A 3F3RA 1F3AA 5ECHB 1A24A 3VWVA 3ERFA 3M1GA 4IVFA 2X8GA 3TRXA 1N8JA 3L9UA 3EINA 5HFGA 4KGIA 3TDGA 4ZL9A 4GLTA 3MYDA 2G2QA 1LJRA 2V1MA 1T1VA 2QKEA 2A2RA 1QFNA 5IOWA 2AJQB 2YPMA 2B7JA 3KTBA 3F6FA 2HYXA 2RM6A 3GL3A 5IO0A 5C00A 4OFTA 4K6XA 1DE1A 4NHZA 4YH2A 5GSSA 5B6NA 5D93A 1K3LA 3GUSA 4HS1A 2DKHA 5DCHA 3RPNA 4TR0A 1AIUA 2HT9A 4OO5A 5D73A 3KZQA 1OKTA 4XCSA 2GSSA 3DVXA 1TDIA 3KEBA 2HZEB 1FG4A 2R37A 2GVPA 3ZZXA 1PSQA 2H0GA 2ZNMA 4CDOA 1GSSA 2LSTA 1EP8A 1SKSB 1U87A 3IPZA 3CTFA 1QGVA 4MH2A 2QA1A 2FWHA 4ZBAA 2VL2A 4EKZA 2OACA 5ECIB 1IYIA 5F07A 4TVEA 4PUFC 3WGXA 1XW6A 3M9JA 3GSSA 1RK4A 4BPYA 4MJBA 3KGKA 2JADA 1I5GA 1X0RA 1K0MA 1GP1A 1B8XA 2NVLA 3H79A 1M2BA 3VWUA 2PU9C 5COHA 2R3XA 1JHBA 1HNBA 3SWLA 1QXHA 1AQWA 3UAPA 5A5KA 4KCEA 5IMCA 3GX8A 1XBSA 4GRFA 4J57E 1PN9A 3HCZA 2RIIA 2NDOA 4Q5RA 2GQLA 5IPGA 1EEMA 2A2PA 2VCVA 1A2MA 5KOWA 2HE3A 1BX9A 4POBA 4PQHA 4D73A 1O8XA 4BVYB 1EV9A 14GSA 4MK3A 1W89A 2KLXA 3G7JA 1EEJA 5HFIA 2K18A 4F0CA 2HRKA 2YOIA 4ZL8A 4HZ2A 3IAS2 3UARA 2YV9A 1MEKA 1MTCA 1K0CA 3A5WA 3BOAA 2YANA 1G6YA 2MMZA 4BVXA 4PURA 4ZIJA 2P5QA 2BJXA 2H30A 2WJUA 2LNSA 1GTIA 3UVHA 3NZNA 3D5JA 3GH6A 12GSA 1URMA 3L0HA 2E7PA 2K8VA 2WS2A 3MNGA 2GZYA 3D22A 4ML1A 5G30A 4NHWA 2EIQA 2CZ3A 3I6AA 1H4OA 1B9YC 1KBNA 4GQFA 4IP1A 1F9MA 4FYUA 3BCKA 5A4VA 2GSRA 4YQVA 1XVWA 1GSUA 3Q18A 5DDLA 4Q5QA 3UBKA 1XOAA 3FZ5A 2WGRA 1T00A 3QAGA 3FY7A 3C73A 3C71A 5H5SA 2YWNA 4KUNA 4V2NA 1EOHA 1E2YA 4LA1A 2XPEA 4N0VA 1ZYEA 5JCUA 2PERA 2R6KA 3I43A 3FZAA 3QMXA 4I2UA 17GSA 1F6MC 20GSA 1XFLA 3M8NA 1KTEA 3VFIA 2IMEA 2GT6A 4MJCA 3QFBC 4FYCA 1M2AA 1WIKA 5ECQB 5J4UA 3ZMLA 2LJKA 1V98A 2IMDA 1O7UA 4IS0A 1PMTA 5DQSA 3CSJA 1XZOA 4CW9A 2HRNA 3LXTA 3ERGA 2KOKA 4EXJA 1R26A 2J23A 1MDIA 5CRWA 4Z2TA 1AC1A 1THOA 2LKUA 4EDZA 2CVBA 2HNLA 2I4AA 2JSZA 4G19A 3LEFA 2EIRA 4OFMA 3GSTA 2VLTA 2FUG2 1HNCA 5KN1A 3GA4A 4MJAA 2VCZA 2D2ZA 4WEYA 5GSTA 4PGTA 2X64A 3EPTA 3A2VA 3ZFLA 5DVBA 1PA3A 3H4KA 2VL9A 1DBYA 2QA2A 1SD9A 5CRDA 4YAVA 2HSMA 2HZEA 2R5GA 1EP7A 3HKRA 1PN0A 2H70A 2DJ2A 4IHUA 2G0FA 3F4TA 1PKZA 5JCWA 5HQPA 3GIXA 3HYPA 5DQYA 1MDKA 2H1BA 1H75A 3UEMA 5ECSA 3A5IA 2C3TA 2VL3A 5LCZA 4X4JA 4XIHA 2AAWA 2MMNA 1DE2A 5E59A 5DALA 4ZBBA 4EE0A 1M9BA 2FA4A 1X9SB 3L4NA 1GUHA 4YQUA 2IMKA 2B6MA 3ISOA 4V2MA 2DIYA 3ZVJD 4F9ZA 4LL4B 3D4TA 3EVIA 1V9WA 2DSAA 1X5CA 4ECIA 3UIWA 1F37A 1XVQA 4K7IA 5KEJA 2LEGA 2LTKA 3CRTA 4EDYA 2GGTA 2LQQA 1PKWA 4KAEA 4MA9A 3KMNA 3GNJA 3FRCA 4H86A 2YN1A 16GSA 3UBLA 1Z6NA 4Q5FA 2AV4A 2TIRA 3VPQA 3P8WA 3EWLA 4CY8A 1Y25A 2H8LA 4L8EA 3MSZA 3FZ9A 2A4HA 1B9XC 3LQ7A 4J56E 2H1GA 4BVYA 1T8EB 1S3CA 4ISDA 5LNKe 1R5AA 1W4VA 3BD2A 4KF9A 1XOBA 7GSSA 3DRNA 5J9CA 1QK8A 2GLRA 1GUKA 3DWVA 1YF1A 4WR4A 3KD0A 2YWIA 4JZQA 4DSRA 1GL8A 1ZCPA 3UMAA 2GSTA 2C3QA 8GSSA 1GSFA 3I9V2 1YZXA 1SKWB 1U6TA 1TXXA 1TRWA 2ZUPA 4Z2RA 1F2EA 4HZ4A 2IMFA 2L6DA 2IFQA 2PN8A 1DSBA 1AXDA 2HRAA 1TJDA 3C8EA 4F03A 3HVVA 4KNDA 3ZREA 1U3AA 2GZZA 2FY6A 3TRQA 2RUEA 2WULA 1TK0B 4E8EA 2HLSA 4BA7A 5D9XA 1TOFA 2B5YA 1XXUA 3J7Yb 1VF1A 2YNXA 3LXZA 5J5NA 6GSVA 5CO3A 5ECRB 3ZLPA 2DMLA 3MAKA 3KIJA 2C1YA 2DJ3A 4DEJA 2FWGA 3PPUA 5D9WA 2NBSA 5GAPD 2AUVA 2PGTA 2YJ7A 2LQOA 1O85A 4K9ZA 2F3MA 2DLXA 4EIPA 1ST9A 1SL0B 1J9BA 1TW9A 2H6XA 4K5RA 4NV2A 1J0FA 1FOVA 1ZYNA 1ABAA 6GSSA 1M99A 5DBQA 3PGTA 5LD0A 1SL2B 1O6JA 2HSHA 5GAND 4N0ZA 1NM3A 3F9UA 5KN3A 3HVXA 2H72A 4PXOA 4LMWA 4HEA2 1T7PB 3TJGA 5B8BA 4KA0A 1VGLA 3SBCA 2LRCA 4K0GA 1FB0A 3F4SA 3UJ1A 4PQ1A 3FEUA 2L5LA 4BL7B 3L9VA 4Q5NA 1A2LA 1WMJA 4X0XA 4ZB9A 4KB3A 1SYXA 3TKPA 2O7KA 4K1FA 4HQSA 3MIXA 1B48A 4MMMA 4A5PA 3IR4A 1CQHA 1OC9A 2K9FA 4XTSA 3IHQA 2DKIA 3F0IA 5ENUA 1Z7PA 3TKSA 4HDEA 2XC2A 1YY7A 2JACA 3TKQA 4MF6A 5BRTA 3KP8A 2UZ8A 3ME7A 2LNTA 4DVCA 5FT3A 2FHEA 2VCWA 2FWFA 2C0EA 2KP2A 1A8LA 1ZYQB 4G0IA 3GH9A 4RI7A 1M9AA 1TI1A 3GKMA 4WBRD 4TKYA 2JZTA 3GL5A 4YQMA 2DC5A 3IDVA 1I9DA 1ILOA 1FO5A 1O73A 4F82A 4JEDA 3TJJA 3WYWA 2OJLA 1HYUA 2AHEA 2WRTA 1FVJA 1G7OA 5AIXA 4KSOA 4TRXA 2L4QA 2EIOA 3IRAA 3ZFBA 1YKAA 1OKDA 5CYYA 3IC8A 4EUYA 4OCEA 3BCIA 2I9HA 1BYEA 2P31A 1TRUA 4OFNA 5KN2A 1SKRB 1MD3A 3W6GA 5IMAA 4OWYA 4N11A 4NXIA 1NSWA 1Z9HA 3GKXA 4RI6A 1WWJA 3QAWA 4POMA 1Z7RA 3WT2A 3IOSA 3KCMA 1UN2A 3GTUA 3W8SA 1K0BA 5IMZA 2DIZA 1TRSA 4XHMA 6GSUA 1JZRA 2ES7A 4V1Ap 3TOUA 3QAVA 4MDCA 2LRTA 2L57A 2F8FA 4YAPA 4K5SA 2FGXA 4CHSA 2C0DA 4KH7A 4HU9A 4KSMA 1OAZA 1SK0A 2EC4A 3QD9A 1GSEA 5DJMA 4ICYA 4G2EA 2BMXA 2B5XA 3CXGA 4RUVA 1FVKA 4YKFA 1EV4A 1KEBA 3QOUA 3IV4A 3M9KA 1EGOA 2PVOC 4O5QA 2I1UA 4AGSA 4I6XA 4MNNA 2OA7A 3TOTA 5DCGA 5AGYA 1SJIA 1K3YA 4HJ2A 2B1LA 5AISA 5C04A 2DJKA 3DEXA 1PGTA 1YQ1A 5AN1A 4USSA 1TKDB 3C1RA 5G31A 5JCGA 2F8AA 4N10A 4FYBA 4I5QA 2AB6A 3V1WA 4OO4A 4JBBA 2C0GA 1TU7A 2TRCP 1GSYA 3HJMA 2MBSA 2H1DA 2IN3A 5D8IA 1THXA 3KM6A 1K0AA 2H6YA 4KCAA 3F8UA 5CRGA 3LW9A 1E6BA 3RHBA 3Q6OA 4TN8A 3HD5A 2VO4A 3LGCA 2K6VA 3TUEA 3GX0A 3E0UA 5ID2A 3FZ4A 1GUMA 1FOHA 4KX4A 1LU4A 1JLWA 2O85A 1EGRA 3FMWA 2KP1A 4X1UA 1VF2A 2I81A 3EU3A 4XRAA 3IAM2 3TKRA 1GNEA 3HY2A 2WB9A 2JSYA 2IWTA 2GQMA 1R5PA 2B3SA 3CBUA 1OC3A 1OC8A 2X99A 3L9SA 1OVNA 2JL4A 4CY6A 2VCQA 2N5BA 3GKNA 1HQOA 4WF4A 1NHYA 2V6KA 4BL7A 2X49A 4PQIA 3HZ4A 1Q98A 4TXVA 3CSHA 4LLRA 4DSSB 1CQGA 3PH9A 1V57A 4MPGA 4EIQA 3HA9A 3HJPA 3IE3A 3FHKA 5ECNB 3DIEA 4MJEA 2M46A 4PUAA 4OCFA 4MABA 2L4CA 3UL3A 5A4UA 4HJMA 1K3OA 4JR4A 4K7OA 5KOXA 1MDJA 2H6ZA 2XPDA 4AJ7A 1GSDA 2YP6A 2MMOA 1RW1A 1EWXA 5HR1A 4IGJA 3W8JA 2VLUA 2CAQA 1A2JA 3EU4A 2XHFA 1EOGA 2GZPA 2M72A 3ZIVA 3ZVJA 1ZOFA 2CZ2A 1JFUA 4L0UA 4POKA 3APQA 2CV4A 4MZCA 5KN0A 1SENA 2PMTA 4WETA 3D0ZA 1TP9A 2VCXA 3TJKA 5DAKB 1T3BA 1ZGNA 1WJKA 5ECLB 2YZHA 2O8VB 3M0FA 4X43A 2WCIA 4NPBA 2BTOT 3D21A 4DSQA 2VM2A 3RBTA 3ZMKA 4ECJA 3LJRA 5HR3A 4MZWA 3OR5A 2VLVA 1XW5A 2REMA 4MLYA 3S9FA 5D96A 2E2MA 4MF5A 1LBKA 4K0NA 3R2QA 22GSA 3VK9A 4I97A 1B4QA 4ML6A 3CYNA 1JLVA 3US3A 2X8CA 4PNFA 1O81A 1G0TA 2OE3A 2GDRA 4JRRA 1KNGA 2JU5A 2H1AA 1QMVA 3MDKA 1FW1A 1ERTA 2FWEA 2C80A 4TW5A 4RQRA 4IQAA 3G7YA 1BEDA 1SJ6A 3Q74A 4ECCA 3WD6A 3VI7A 5DJLA 5BMUA 3WGEA 2FD3A 1A0RP 3TGZA 4RQXA 2C0FA 3BBYA 4XRDA 4GWRA 4BWSA 2CVKA 3O3TA 4GTUA 1R4WA 4IJ3A 5G5FA 4IJIA 3VI5A 4FH8A 1ERVA 3CRUA 5D9VA 3KH7A 2CA8A 3KMOA 1Z3EA 1BQ7A 2H19A 5J41A 2R0CA 3VURA 1TU8A 1X5DA 4G0KA 3ZTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D73 B;  3G9B A;  1XPV A;  4IEL A;  2GQK A;  2JZR A;  3F3Q A;  5F0G A;  1XWK A;  3IC4 A;  3A3T A;  3HDC A;  4AF2 A;  1ML6 A;  1UVZ A;  2DJ1 A;  1ZMA A;  2VOC A;  3GFK A;  3NOF A;  1DUG A;  1J08 A;  3FK8 A;  1ZZY A;  5H5R A;  3ZIJ A;  2HSY A;  1VF4 A;  2NPB A;  2JZS A;  2VL2 C;  3FYG A;  1B4P A;  2YCD A;  3P90 A;  4K8M A;  2P0G A;  1G6W A;  2IPA A;  3IK9 A;  2KHP A;  3TKS E;  4I8B A;  2VCT A;  4MZB A;  1GRX A;  1PRX A;  5ECK B;  4NWY A;  2LS5 A;  1OYJ A;  2HI7 A;  1SJZ A;  1V2A A;  2OAD A;  3HJO A;  1TTZ A;  3VWW A;  3MWH A;  1QUW A;  2IIY A;  1XIY A;  1M2D A;  3GRX A;  4K2D A;  13GS A;  4E8H A;  4O7H A;  3VLN A;  4QL7 A;  1GH2 A;  1V58 A;  2IJY A;  2V6O A;  3N9J A;  4EVM A;  2DMM A;  1OE8 A;  5ECM B;  1ERW A;  4KW6 A;  2CAI A;  1Y6E A;  3CSI A;  1X5E A;  4DSS A;  5IOX A;  3KH9 A;  1FHE A;  1IYH A;  2VM1 A;  2DBC A;  4HQZ A;  5ELA A;  4WXT A;  1N2A A;  3QFA C;  4MH3 A;  5B7C A;  3TCO A;  5G1K A;  5IIZ A;  4ILF A;  2WFC A;  1M7T A;  2OE0 A;  5FHI A;  1PL1 A;  1WPI A;  5EVO A;  1XWC A;  4L5L A;  1S3A A;  2H66 A;  3F6D A;  3DML A;  5IMV A;  4GST A;  3TJB A;  4MPF A;  2YV7 A;  3DD3 A;  4KDU A;  4EF0 A;  2K8S A;  4LL1 B;  1PX7 A;  4KDY A;  3P2A A;  3QDN A;  1AW9 A;  3KTL A;  1EZK A;  1AQV A;  4O92 A;  4OMV A;  4MCU A;  5B6M A;  2PVQ A;  1WRY A;  2R2J A;  2XBQ A;  5IQY A;  4WBJ A;  1GTU A;  5DAK A;  1OE7 A;  3HZ8 A;  1YEP A;  4BWQ A;  2H76 A;  1Q4J A;  2CQ9 A;  4GSS A;  1GLQ A;  2A2S A;  3KJY A;  2V41 A;  1AQX A;  4J2F A;  1JZW A;  2HZF A;  2QGV A;  2P5R A;  4XS6 A;  2N5A A;  1VRS D;  5EPF A;  2H0I A;  4NAX A;  3ED3 A;  3GKK A;  5EY6 A;  19GS A;  3ZIT A;  3QPM A;  4IBP A;  2V2G A;  3H1N A;  3ZYW A;  2E2G A;  4FO5 A;  1QQ2 A;  3E9J B;  2YZU A;  1PX6 A;  1PQN A;  1X9M B;  1PD2 1;  4GCI A;  3H8Q A;  3F63 A;  3ZL5 A;  4GQC A;  3LOR A;  2B7K A;  1SYR A;  3FR3 A;  5DAL B;  5ELG A;  5IMD A;  3GYK A;  1YKC A;  4XS1 A;  4IW9 A;  3PR8 A;  3HVS A;  2MMA A;  2ALB A;  2H71 A;  2H73 A;  1GNW A;  3BJ5 A;  5G5E A;  2HXK A;  1SU9 A;  2YWM A;  1C72 A;  4TR4 A;  2VD1 A;  2CVD A;  4GXZ A;  4N30 A;  3H93 A;  1YEX A;  5H5Q A;  1Z5Y E;  2GT5 A;  1UC7 A;  3EE2 A;  2OBK A;  2XBI A;  2OE1 A;  2QSI A;  1TI3 A;  2O87 A;  5CRE A;  4ACS A;  4ZIL A;  4O32 A;  2E0Q A;  2RM5 A;  2ON5 A;  2HFD A;  4IQ1 A;  1FAA A;  4WF5 A;  1U3I A;  2I3Y A;  2VUP A;  3KP9 A;  5J9B A;  4QL9 A;  2F51 A;  3FR6 A;  2O89 A;  4P3Y B;  3FR9 A;  2RLI A;  2A4V A;  4IKH A;  5ECO B;  3LYK A;  1A23 A;  3J7Y k;  4TXO B;  2FCH A;  4GSN A;  3A2W A;  4XS4 B;  2V32 A;  3LYP A;  4TR1 B;  4IP6 A;  1HNA A;  1HD2 A;  1XWG A;  2FLS A;  1T4Z A;  2H0H A;  5AIV A;  3DVW A;  1A8Y A;  1XWA A;  5E4W A;  2IL3 A;  1R7H A;  2IFQ B;  2M80 A;  2MZC A;  1YJ6 A;  2WDU A;  4ECB A;  3EUR A;  3DGQ A;  5G1L A;  4JR6 A;  3DKS A;  1YDK A;  3ME8 A;  2TRX A;  2OBI A;  5CNW A;  1ACV A;  3I69 A;  5HR2 A;  2YJH A;  1XCC A;  4HUA A;  1VF3 A;  3N5O A;  3GHA A;  4EC0 A;  4O5R A;  2B5E A;  1ON4 A;  3LG6 A;  3E3E A;  2X8H A;  3C7M A;  4ZB6 A;  3EC3 A;  2PUK C;  3ZRD A;  1G7E A;  1NHO A;  6GST A;  3GN3 A;  3RAZ A;  1XW9 A;  2LV3 A;  3AY8 A;  4Z7X A;  1AAZ A;  1RQM A;  3UVT A;  2H01 A;  4ULX A;  3U6V A;  1K0O A;  4QQ7 A;  2LJR A;  5HFK A;  2WZ9 A;  3GV1 A;  2AYT A;  1YF0 A;  4JE1 A;  3KXO A;  4F2I A;  2HRF A;  3L78 A;  4K7N A;  1ERU A;  3QCP A;  3QR6 A;  2LRN A;  1NW2 A;  4G9H A;  3CMI A;  5D9T A;  3C1S A;  1UA5 A;  4OD7 A;  3CTG A;  1GLP A;  5IMF A;  3HXS A;  2LJA A;  2CX4 A;  4HOJ A;  3D6I A;  1XWB A;  10GS A;  2J9H A;  4F0B A;  4ZBD A;  5ECP B;  3Q19 A;  4LMV A;  1WE0 A;  3LSZ A;  3G7I A;  4POL A;  3EMP A;  5JWO B;  2KUC A;  5IO2 A;  1OC9 B;  1JZD A;  3RPP A;  2RUF A;  3TRP A;  4ID0 A;  2LUS A;  3HHV A;  1GSQ A;  3TJF A;  2FA8 A;  2NTO A;  2N5F A;  3IXR A;  2F9S A;  1USB A;  5IPH A;  1TK8 B;  4L0W A;  1PL2 A;  1JZO A;  4I2T A;  3IK7 A;  1M0U A;  4EL1 A;  2VD0 A;  2L59 A;  5EL8 A;  3PIN A;  5CAX A;  4HI7 A;  3IBH A;  3LWA A;  3APS A;  5L71 A;  2IMI A;  3FW2 A;  3D4M A;  3GMF A;  1SD8 A;  2CT6 A;  3LFL A;  3O6T A;  1O8W A;  3GUR A;  1SL1 B;  3TB2 A;  3UOM A;  1ZL9 A;  5INY A;  2VIM A;  3M3M A;  1MD4 A;  3RHC A;  4JU5 A;  4AJ8 A;  2MYG A;  1GWC A;  3EYT A;  1U88 A;  2Z9S A;  1A0F A;  1WP0 A;  1V40 A;  3F4R A;  3VWX A;  2ZCT A;  2B1K A;  2FNO A;  2H74 A;  4NMU A;  3O76 A;  4KDX A;  1GTA A;  2OKA A;  3RDW A;  4G10 A;  2R4V A;  5F8B A;  3K8N A;  1SK1 A;  2GSQ A;  2C8U A;  4HU7 A;  2GTU A;  3GTU B;  2MBT A;  2L5O A;  6GSX A;  2DJ0 A;  4V1A g;  3TKS C;  2PWJ A;  1TK5 B;  1F3B A;  1K0D A;  5G2Z A;  9GSS A;  3DYR A;  1FB6 A;  3NIV A;  2PBJ A;  4MF7 A;  6GSY A;  1S3D A;  2H75 A;  5F05 A;  1BJX A;  4TXO A;  2YWO A;  4XS4 A;  3WT1 A;  4GF0 A;  4TR1 A;  2ON7 A;  4ZXG A;  1BAY A;  3VPT A;  5J3R A;  2C4J A;  4FIW A;  1BG5 A;  3P7X A;  4WKW A;  3IA1 A;  3DXB A;  4ZL7 A;  4PX1 A;  5GZZ B;  2VAF A;  1GUL A;  3APO A;  18GS A;  3EMX A;  5FWG A;  4MP4 A;  5JWR B;  2PPT A;  4EO3 A;  2L6C A;  2CX3 A;  4PNG A;  1WOU A;  3WGD A;  3FKF A;  4L5O A;  5CRH A;  4WR5 A;  5CP1 A;  1GTB A;  5A4W A;  4TR3 A;  3JCM L;  1X9W B;  1T4Y A;  3A2X A;  4TOP A;  4V2L A;  4ZB8 A;  5ABR A;  1TRV A;  2GS3 A;  2C3N A;  5HR0 A;  4KE3 A;  5JWQ B;  3ERW A;  6GSW A;  1Z6M A;  4IN0 A;  4AJ6 A;  1SK2 A;  1K0N A;  2QC7 A;  5IM9 A;  1AUC A;  5ID2 B;  5B8A A;  5F06 A;  3U5R E;  11GS A;  2DJJ A;  4NV5 A;  3F3R A;  1F3A A;  5ECH B;  1A24 A;  3VWV A;  3ERF A;  3M1G A;  4IVF A;  2X8G A;  3TRX A;  1N8J A;  3L9U A;  3EIN A;  5HFG A;  4KGI A;  3TDG A;  4ZL9 A;  4GLT A;  2G2Q A;  1LJR A;  2V1M A;  1T1V A;  2QKE A;  2A2R A;  1QFN A;  5IOW A;  2AJQ B;  2YPM A;  2B7J A;  3KTB A;  3F6F A;  2HYX A;  2RM6 A;  3GL3 A;  5IO0 A;  5C00 A;  4OFT A;  4K6X A;  1DE1 A;  4NHZ A;  4YH2 A;  5GSS A;  5B6N A;  5D93 A;  1K3L A;  3GUS A;  4HS1 A;  5DCH A;  3RPN A;  4TR0 A;  1AIU A;  2HT9 A;  4OO5 A;  5D73 A;  3KZQ A;  1OKT A;  4XCS A;  2GSS A;  3DVX A;  1TDI A;  3KEB A;  2HZE B;  1FG4 A;  2R37 A;  2GVP A;  3ZZX A;  1PSQ A;  2H0G A;  2ZNM A;  4CDO A;  1GSS A;  2LST A;  1EP8 A;  1SKS B;  1U87 A;  3IPZ A;  3CTF A;  1QGV A;  4MH2 A;  2FWH A;  4ZBA A;  2VL2 A;  4EKZ A;  2OAC A;  5ECI B;  1IYI A;  5F07 A;  4TVE A;  4PUF C;  3WGX A;  1XW6 A;  3M9J A;  3GSS A;  1RK4 A;  4BPY A;  4MJB A;  3KGK A;  2JAD A;  1I5G A;  1X0R A;  1K0M A;  1GP1 A;  1B8X A;  2NVL A;  3H79 A;  1M2B A;  3VWU A;  2PU9 C;  5COH A;  2R3X A;  1JHB A;  1HNB A;  3SWL A;  1QXH A;  1AQW A;  3UAP A;  5A5K A;  4KCE A;  5IMC A;  3GX8 A;  1XBS A;  4GRF A;  4J57 E;  1PN9 A;  3HCZ A;  2RII A;  2NDO A;  4Q5R A;  2GQL A;  5IPG A;  1EEM A;  2VCV A;  1A2M A;  2HE3 A;  1BX9 A;  4POB A;  4PQH A;  4D73 A;  1O8X A;  1EV9 A;  14GS A;  4MK3 A;  1W89 A;  2KLX A;  3G7J A;  1EEJ A;  5HFI A;  2K18 A;  4F0C A;  2YOI A;  4ZL8 A;  4HZ2 A;  3IAS 2;  3UAR A;  2YV9 A;  1MEK A;  1MTC A;  1K0C A;  3A5W A;  3BOA A;  2YAN A;  1G6Y A;  2MMZ A;  4BVX A;  4PUR A;  4ZIJ A;  2P5Q A;  2BJX A;  2H30 A;  2WJU A;  2LNS A;  1GTI A;  3UVH A;  3NZN A;  3D5J A;  3GH6 A;  12GS A;  1URM A;  3L0H A;  2E7P A;  2K8V A;  2WS2 A;  3MNG A;  2GZY A;  3D22 A;  4ML1 A;  5G30 A;  4NHW A;  2EIQ A;  2CZ3 A;  3I6A A;  1H4O A;  1B9Y C;  1KBN A;  4GQF A;  4IP1 A;  1F9M A;  4FYU A;  3BCK A;  5A4V A;  2GSR A;  4YQV A;  1XVW A;  1GSU A;  3Q18 A;  5DDL A;  4Q5Q A;  3UBK A;  1XOA A;  3FZ5 A;  2WGR A;  1T00 A;  3QAG A;  3FY7 A;  3C73 A;  3C71 A;  5H5S A;  2YWN A;  4KUN A;  4V2N A;  1EOH A;  1E2Y A;  4LA1 A;  2XPE A;  4N0V A;  1ZYE A;  5JCU A;  2PER A;  2R6K A;  3I43 A;  3FZA A;  3QMX A;  4I2U A;  17GS A;  1F6M C;  20GS A;  1XFL A;  3M8N A;  1KTE A;  3VFI A;  2IME A;  2GT6 A;  4MJC A;  3QFB C;  4FYC A;  1M2A A;  1WIK A;  5ECQ B;  5J4U A;  3ZML A;  2LJK A;  1V98 A;  2IMD A;  1O7U A;  4IS0 A;  1PMT A;  5DQS A;  3CSJ A;  1XZO A;  4CW9 A;  2HRN A;  3LXT A;  3ERG A;  2KOK A;  4EXJ A;  1R26 A;  2J23 A;  1MDI A;  5CRW A;  1AC1 A;  1THO A;  2LKU A;  4EDZ A;  2CVB A;  2HNL A;  2I4A A;  2JSZ A;  4G19 A;  3LEF A;  2EIR A;  4OFM A;  3GST A;  2VLT A;  2FUG 2;  1HNC A;  5KN1 A;  3GA4 A;  4MJA A;  2VCZ A;  2D2Z A;  4WEY A;  5GST A;  4PGT A;  2X64 A;  3A2V A;  3ZFL A;  5DVB A;  1PA3 A;  3H4K A;  2VL9 A;  1DBY A;  1SD9 A;  5CRD A;  4YAV A;  2HZE A;  2R5G A;  1EP7 A;  3HKR A;  2H70 A;  2DJ2 A;  4IHU A;  2G0F A;  3F4T A;  1PKZ A;  5JCW A;  5HQP A;  3GIX A;  3HYP A;  5DQY A;  1MDK A;  2H1B A;  1H75 A;  3UEM A;  5ECS A;  2C3T A;  2VL3 A;  5LCZ A;  4XIH A;  2AAW A;  2MMN A;  1DE2 A;  5E59 A;  5DAL A;  4ZBB A;  4EE0 A;  1M9B A;  2FA4 A;  1X9S B;  3L4N A;  1GUH A;  4YQU A;  2IMK A;  2B6M A;  3ISO A;  4V2M A;  2DIY A;  3ZVJ D;  4F9Z A;  4LL4 B;  3D4T A;  3EVI A;  1V9W A;  2DSA A;  1X5C A;  4ECI A;  3UIW A;  1F37 A;  1XVQ A;  4K7I A;  5KEJ A;  2LEG A;  2LTK A;  3CRT A;  4EDY A;  2GGT A;  2LQQ A;  1PKW A;  4KAE A;  4MA9 A;  3KMN A;  3GNJ A;  3FRC A;  4H86 A;  2YN1 A;  16GS A;  3UBL A;  1Z6N A;  4Q5F A;  2AV4 A;  2TIR A;  3VPQ A;  3P8W A;  3EWL A;  1Y25 A;  2H8L A;  4L8E A;  3MSZ A;  3FZ9 A;  1B9X C;  3LQ7 A;  4J56 E;  2H1G A;  4BVY A;  1T8E B;  1S3C A;  4ISD A;  5LNK e;  1R5A A;  1W4V A;  3BD2 A;  1XOB A;  7GSS A;  3DRN A;  5J9C A;  1QK8 A;  2GLR A;  1GUK A;  3DWV A;  1YF1 A;  4WR4 A;  3KD0 A;  2YWI A;  4JZQ A;  4DSR A;  1GL8 A;  1ZCP A;  3UMA A;  2GST A;  2C3Q A;  8GSS A;  1GSF A;  3I9V 2;  1YZX A;  1SKW B;  1U6T A;  1TXX A;  1TRW A;  2ZUP A;  1F2E A;  4HZ4 A;  2IMF A;  2L6D A;  2IFQ A;  2PN8 A;  1DSB A;  1AXD A;  1TJD A;  3C8E A;  4F03 A;  3HVV A;  4KND A;  3ZRE A;  1U3A A;  2GZZ A;  2FY6 A;  3TRQ A;  2RUE A;  2WUL A;  1TK0 B;  4E8E A;  2HLS A;  4BA7 A;  5D9X A;  1TOF A;  2B5Y A;  1XXU A;  3J7Y b;  1VF1 A;  2YNX A;  3LXZ A;  5J5N A;  6GSV A;  5CO3 A;  5ECR B;  3ZLP A;  2DML A;  3MAK A;  3KIJ A;  2C1Y A;  2DJ3 A;  4DEJ A;  2FWG A;  5D9W A;  2NBS A;  5GAP D;  2AUV A;  2PGT A;  2YJ7 A;  2LQO A;  1O85 A;  4K9Z A;  2F3M A;  2DLX A;  1ST9 A;  1SL0 B;  1J9B A;  1TW9 A;  2H6X A;  4NV2 A;  1J0F A;  1FOV A;  1ABA A;  6GSS A;  1M99 A;  5DBQ A;  3PGT A;  5LD0 A;  1SL2 B;  1O6J A;  2HSH A;  5GAN D;  4N0Z A;  1NM3 A;  3F9U A;  5KN3 A;  3HVX A;  2H72 A;  4PXO A;  4LMW A;  4HEA 2;  1T7P B;  3TJG A;  5B8B A;  4KA0 A;  1VGL A;  3SBC A;  2LRC A;  4K0G A;  1FB0 A;  3F4S A;  3UJ1 A;  4PQ1 A;  3FEU A;  2L5L A;  3L9V A;  4Q5N A;  1A2L A;  1WMJ A;  4X0X A;  4ZB9 A;  4KB3 A;  1SYX A;  3TKP A;  2O7K A;  4K1F A;  4HQS A;  1B48 A;  4MMM A;  3IR4 A;  1CQH A;  1OC9 A;  2K9F A;  4XTS A;  3IHQ A;  3F0I A;  5ENU A;  1Z7P A;  3TKS A;  4HDE A;  2XC2 A;  1YY7 A;  2JAC A;  3TKQ A;  4MF6 A;  3KP8 A;  3ME7 A;  2LNT A;  4DVC A;  5FT3 A;  2FHE A;  2VCW A;  2FWF A;  2C0E A;  2KP2 A;  1A8L A;  1ZYQ B;  3GH9 A;  4RI7 A;  1M9A A;  1TI1 A;  3GKM A;  4WBR D;  4TKY A;  2JZT A;  3GL5 A;  4YQM A;  2DC5 A;  3IDV A;  1I9D A;  1ILO A;  1FO5 A;  1O73 A;  4F82 A;  4JED A;  3TJJ A;  3WYW A;  2OJL A;  1HYU A;  2AHE A;  2WRT A;  1FVJ A;  1G7O A;  5AIX A;  4KSO A;  4TRX A;  2L4Q A;  2EIO A;  3IRA A;  3ZFB A;  1YKA A;  1OKD A;  5CYY A;  4EUY A;  4OCE A;  3BCI A;  2I9H A;  1BYE A;  2P31 A;  1TRU A;  4OFN A;  5KN2 A;  1SKR B;  1MD3 A;  3W6G A;  5IMA A;  4OWY A;  4N11 A;  4NXI A;  1NSW A;  1Z9H A;  3GKX A;  4RI6 A;  1WWJ A;  3QAW A;  4POM A;  1Z7R A;  3WT2 A;  3IOS A;  3KCM A;  1UN2 A;  3GTU A;  3W8S A;  1K0B A;  5IMZ A;  2DIZ A;  1TRS A;  4XHM A;  6GSU A;  1JZR A;  2ES7 A;  4V1A p;  3TOU A;  3QAV A;  4MDC A;  2LRT A;  2L57 A;  2F8F A;  4YAP A;  2FGX A;  4CHS A;  2C0D A;  4KH7 A;  4HU9 A;  4KSM A;  1OAZ A;  1SK0 A;  2EC4 A;  3QD9 A;  1GSE A;  5DJM A;  4G2E A;  2BMX A;  2B5X A;  3CXG A;  4RUV A;  1FVK A;  1EV4 A;  1KEB A;  3QOU A;  3IV4 A;  3M9K A;  1EGO A;  2PVO C;  2I1U A;  4AGS A;  4I6X A;  2OA7 A;  3TOT A;  5DCG A;  5AGY A;  1SJI A;  1K3Y A;  4HJ2 A;  2B1L A;  5AIS A;  5C04 A;  2DJK A;  3DEX A;  1PGT A;  1YQ1 A;  5AN1 A;  1TKD B;  3C1R A;  5G31 A;  5JCG A;  2F8A A;  4N10 A;  4FYB A;  4I5Q A;  2AB6 A;  3V1W A;  4OO4 A;  4JBB A;  2C0G A;  1TU7 A;  2TRC P;  1GSY A;  3HJM A;  2MBS A;  2H1D A;  2IN3 A;  5D8I A;  1THX A;  3KM6 A;  1K0A A;  2H6Y A;  4KCA A;  3F8U A;  5CRG A;  1E6B A;  3RHB A;  3Q6O A;  4TN8 A;  3HD5 A;  2VO4 A;  3LGC A;  2K6V A;  3TUE A;  3GX0 A;  3E0U A;  5ID2 A;  3FZ4 A;  1GUM A;  4KX4 A;  1LU4 A;  1JLW A;  2O85 A;  1EGR A;  2KP1 A;  4X1U A;  1VF2 A;  2I81 A;  3EU3 A;  4XRA A;  3IAM 2;  3TKR A;  1GNE A;  3HY2 A;  2WB9 A;  2JSY A;  2IWT A;  2GQM A;  1R5P A;  2B3S A;  3CBU A;  1OC3 A;  1OC8 A;  2X99 A;  3L9S A;  1OVN A;  2JL4 A;  2VCQ A;  2N5B A;  3GKN A;  1HQO A;  4WF4 A;  1NHY A;  2V6K A;  4BL7 A;  4PQI A;  3HZ4 A;  1Q98 A;  4TXV A;  3CSH A;  4LLR A;  4DSS B;  1CQG A;  3PH9 A;  1V57 A;  4MPG A;  3HA9 A;  3HJP A;  3IE3 A;  3FHK A;  5ECN B;  3DIE A;  4MJE A;  2M46 A;  4PUA A;  4OCF A;  4MAB A;  2L4C A;  3UL3 A;  5A4U A;  4HJM A;  1K3O A;  4JR4 A;  4K7O A;  1MDJ A;  2H6Z A;  2XPD A;  4AJ7 A;  1GSD A;  2YP6 A;  2MMO A;  1RW1 A;  1EWX A;  5HR1 A;  4IGJ A;  3W8J A;  2VLU A;  2CAQ A;  1A2J A;  3EU4 A;  2XHF A;  1EOG A;  2GZP A;  2M72 A;  3ZIV A;  3ZVJ A;  1ZOF A;  2CZ2 A;  1JFU A;  4L0U A;  4POK A;  3APQ A;  2CV4 A;  4MZC A;  5KN0 A;  1SEN A;  2PMT A;  4WET A;  3D0Z A;  1TP9 A;  2VCX A;  3TJK A;  5DAK B;  1T3B A;  1ZGN A;  1WJK A;  5ECL B;  2YZH A;  2O8V B;  3M0F A;  4X43 A;  2WCI A;  4NPB A;  2BTO T;  3D21 A;  4DSQ A;  2VM2 A;  3RBT A;  3ZMK A;  4ECJ A;  3LJR A;  5HR3 A;  4MZW A;  3OR5 A;  2VLV A;  1XW5 A;  2REM A;  4MLY A;  3S9F A;  5D96 A;  2E2M A;  4MF5 A;  1LBK A;  4K0N A;  3R2Q A;  22GS A;  3VK9 A;  4I97 A;  1B4Q A;  4ML6 A;  3CYN A;  1JLV A;  3US3 A;  2X8C A;  4PNF A;  1O81 A;  1G0T A;  2OE3 A;  2GDR A;  4JRR A;  1KNG A;  2JU5 A;  2H1A A;  1QMV A;  3MDK A;  1FW1 A;  1ERT A;  2FWE A;  2C80 A;  4TW5 A;  4RQR A;  4IQA A;  3G7Y A;  1BED A;  1SJ6 A;  3Q74 A;  4ECC A;  3WD6 A;  3VI7 A;  5DJL A;  3WGE A;  2FD3 A;  1A0R P;  3TGZ A;  4RQX A;  2C0F A;  3BBY A;  4XRD A;  4GWR A;  4BWS A;  2CVK A;  3O3T A;  4GTU A;  1R4W A;  4IJ3 A;  5G5F A;  4IJI A;  3VI5 A;  4FH8 A;  1ERV A;  3CRU A;  5D9V A;  3KH7 A;  2CA8 A;  3KMO A;  1Z3E A;  1BQ7 A;  2H19 A;  5J41 A;  3VUR A;  1TU8 A;  1X5D A;  3ZTL A; 
#chains in the Genus database with same CATH topology
 4D73 B;  3G9B A;  1XPV A;  4IEL A;  2GQK A;  2JZR A;  3F3Q A;  5F0G A;  1XWK A;  3IC4 A;  3A3T A;  3HDC A;  4AF2 A;  1ML6 A;  1UVZ A;  2DJ1 A;  1ZMA A;  2VOC A;  3GFK A;  3NOF A;  1DUG A;  1J08 A;  3FK8 A;  1ZZY A;  5H5R A;  3ZIJ A;  2HSY A;  1VF4 A;  4BVX B;  2NPB A;  2JZS A;  2VL2 C;  3FYG A;  1B4P A;  4K2X A;  2YCD A;  3P90 A;  4K8M A;  2P0G A;  1G6W A;  2IPA A;  3IK9 A;  2KHP A;  3TKS E;  4I8B A;  2VCT A;  4MZB A;  1GRX A;  1PRX A;  5ECK B;  3R3E A;  4NWY A;  2LS5 A;  1OYJ A;  2HI7 A;  1SJZ A;  1V2A A;  2OAD A;  3HJO A;  1TTZ A;  3VWW A;  3MWH A;  1QUW A;  2IIY A;  1XIY A;  1M2D A;  3GRX A;  4K2D A;  13GS A;  4E8H A;  4O7H A;  3VLN A;  4QL7 A;  1GH2 A;  1V58 A;  2IJY A;  2V6O A;  3N9J A;  4EVM A;  2DMM A;  1OE8 A;  5ECM B;  1ERW A;  4KW6 A;  2CAI A;  1Y6E A;  3CSI A;  1X5E A;  4DSS A;  5IOX A;  3KH9 A;  1FHE A;  1IYH A;  2VM1 A;  2DBC A;  4HQZ A;  5ELA A;  4WXT A;  1N2A A;  3QFA C;  4MH3 A;  5B7C A;  3TCO A;  5G1K A;  5IIZ A;  4ILF A;  2WFC A;  1M7T A;  2OE0 A;  5FHI A;  1PL1 A;  1WPI A;  5EVO A;  1XWC A;  4L5L A;  1S3A A;  2H66 A;  3F6D A;  3DML A;  5IMV A;  4GST A;  3TJB A;  4MPF A;  2YV7 A;  3CQF A;  3DD3 A;  4KDU A;  4EF0 A;  2K8S A;  1ZYP A;  4PTS A;  4LL1 B;  1PX7 A;  4KDY A;  3P2A A;  3QDN A;  1AW9 A;  3KTL A;  1EZK A;  1AQV A;  4O92 A;  4OMV A;  4MCU A;  5B6M A;  2PVQ A;  1WRY A;  2R2J A;  2XBQ A;  5IQY A;  4WBJ A;  1GTU A;  5DAK A;  1OE7 A;  3HZ8 A;  1YEP A;  4BWQ A;  2H76 A;  1Q4J A;  2CQ9 A;  4GSS A;  1GLQ A;  2A2S A;  3KJY A;  2V41 A;  1AQX A;  4J2F A;  1JZW A;  2HZF A;  2QGV A;  2P5R A;  4XS6 A;  2N5A A;  1VRS D;  5EPF A;  2H0I A;  4NAX A;  3ED3 A;  3GKK A;  5EY6 A;  19GS A;  3ZIT A;  3QPM A;  4IBP A;  2V2G A;  3H1N A;  3ZYW A;  2E2G A;  4FO5 A;  1QQ2 A;  3E9J B;  2YZU A;  1PX6 A;  1PQN A;  1X9M B;  1PD2 1;  4GCI A;  3H8Q A;  3F63 A;  3ZL5 A;  4GQC A;  3LOR A;  2B7K A;  1SYR A;  3FR3 A;  5DAL B;  5ELG A;  5IMD A;  3GYK A;  1YKC A;  4XS1 A;  4IW9 A;  3PR8 A;  3HVS A;  4O5U A;  2MMA A;  2ALB A;  2H71 A;  2H73 A;  1GNW A;  3BJ5 A;  5G5E A;  2HXK A;  1SU9 A;  2YWM A;  1C72 A;  4TR4 A;  2VD1 A;  2CVD A;  4GXZ A;  4N30 A;  3H93 A;  1YEX A;  5H5Q A;  1Z5Y E;  2GT5 A;  4YKG A;  1UC7 A;  3EE2 A;  2OBK A;  2XBI A;  2OE1 A;  2QSI A;  1TI3 A;  2O87 A;  5CRE A;  4Z2U A;  4ACS A;  4ZIL A;  4O32 A;  2E0Q A;  2RM5 A;  2ON5 A;  2HFD A;  4IQ1 A;  1FAA A;  4WF5 A;  1U3I A;  2I3Y A;  2VUP A;  3KP9 A;  5J9B A;  4QL9 A;  2F51 A;  3FR6 A;  2O89 A;  4P3Y B;  3FR9 A;  2RLI A;  2A4V A;  4IKH A;  5ECO B;  3LYK A;  1A23 A;  3J7Y k;  4TXO B;  2FCH A;  4GSN A;  3A2W A;  4XS4 B;  2X4A A;  2V32 A;  3LYP A;  4TR1 B;  4IP6 A;  1HNA A;  1HD2 A;  1XWG A;  2FLS A;  1T4Z A;  2H0H A;  5AIV A;  3DVW A;  1A8Y A;  1XWA A;  5E4W A;  2IL3 A;  1R7H A;  2IFQ B;  2M80 A;  2MZC A;  1YJ6 A;  2WDU A;  4ECB A;  3EUR A;  3DGQ A;  3IHG A;  5G1L A;  4JR6 A;  3DKS A;  1YDK A;  3ME8 A;  2TRX A;  2OBI A;  5CNW A;  1ACV A;  3I69 A;  5HR2 A;  2YJH A;  1XCC A;  4HUA A;  1VF3 A;  3N5O A;  3GHA A;  4EC0 A;  4O5R A;  2B5E A;  1ON4 A;  3LG6 A;  3E3E A;  2X8H A;  3C7M A;  4ZB6 A;  3EC3 A;  2PUK C;  3ZRD A;  1G7E A;  1NHO A;  6GST A;  3GN3 A;  3RAZ A;  1XW9 A;  2LV3 A;  3AY8 A;  4Z7X A;  1AAZ A;  1RQM A;  3UVT A;  2H01 A;  4ULX A;  3U6V A;  1K0O A;  4QQ7 A;  2LJR A;  5HFK A;  2WZ9 A;  3GV1 A;  2AYT A;  1YF0 A;  4JE1 A;  3KXO A;  4F2I A;  2HRF A;  3L78 A;  4K7N A;  1ERU A;  3QCP A;  3QR6 A;  2LRN A;  2R0P A;  1NW2 A;  4G9H A;  3CMI A;  5D9T A;  3C1S A;  1UA5 A;  4OD7 A;  3CTG A;  1GLP A;  5IMF A;  3HXS A;  2LJA A;  2CX4 A;  4HOJ A;  3D6I A;  1XWB A;  10GS A;  2J9H A;  4F0B A;  4ZBD A;  5ECP B;  3Q19 A;  4LMV A;  1S3R A;  1WE0 A;  3LSZ A;  3G7I A;  4POL A;  3EMP A;  5JWO B;  2KUC A;  5IO2 A;  1OC9 B;  1JZD A;  3RPP A;  2RUF A;  3TRP A;  4ID0 A;  2LUS A;  3HHV A;  1GSQ A;  3TJF A;  2FA8 A;  2NTO A;  2N5F A;  3IXR A;  4FQU A;  2F9S A;  1USB A;  5IPH A;  1TK8 B;  4L0W A;  1PL2 A;  1JZO A;  4I2T A;  3IK7 A;  1M0U A;  4EL1 A;  2VD0 A;  2L59 A;  5EL8 A;  3PIN A;  2R0G A;  5CAX A;  4HI7 A;  3IBH A;  3LWA A;  3APS A;  5L71 A;  2IMI A;  3FW2 A;  3D4M A;  3GMF A;  1SD8 A;  2CT6 A;  3LFL A;  3O6T A;  1O8W A;  3GUR A;  1SL1 B;  3TB2 A;  3UOM A;  1ZL9 A;  5INY A;  2VIM A;  3M3M A;  1MD4 A;  3RHC A;  4JU5 A;  4AJ8 A;  2MYG A;  1GWC A;  3EYT A;  1U88 A;  2Z9S A;  1A0F A;  1WP0 A;  1V40 A;  3F4R A;  3VWX A;  2ZCT A;  2B1K A;  2FNO A;  2H74 A;  4NMU A;  3O76 A;  4KDX A;  1GTA A;  2OKA A;  3RDW A;  4G10 A;  2R4V A;  5F8B A;  3K8N A;  1SK1 A;  2GSQ A;  2C8U A;  4HU7 A;  2GTU A;  3GTU B;  2MBT A;  2L5O A;  6GSX A;  2DJ0 A;  4V1A g;  3TKS C;  2PWJ A;  1TK5 B;  1F3B A;  1K0D A;  5G2Z A;  9GSS A;  3DYR A;  1FB6 A;  3NIV A;  2PBJ A;  4MF7 A;  6GSY A;  1S3D A;  2H75 A;  5F05 A;  1BJX A;  4TXO A;  2YWO A;  4XS4 A;  3WT1 A;  4GF0 A;  4TR1 A;  2ON7 A;  4ZXG A;  1BAY A;  3VPT A;  5J3R A;  2C4J A;  4FIW A;  1BG5 A;  3P7X A;  4WKW A;  3IA1 A;  3DXB A;  4ZL7 A;  4PX1 A;  5GZZ B;  2VAF A;  1GUL A;  3APO A;  18GS A;  3EMX A;  5FWG A;  4MP4 A;  5JWR B;  2PPT A;  4EO3 A;  4G0L A;  2L6C A;  2CX3 A;  4PNG A;  1WOU A;  3WGD A;  3FKF A;  4L5O A;  5CRH A;  4WR5 A;  5CP1 A;  1GTB A;  5A4W A;  4TR3 A;  3JCM L;  1X9W B;  1T4Y A;  3A2X A;  4TOP A;  4V2L A;  4ZB8 A;  5ABR A;  1TRV A;  2GS3 A;  2C3N A;  5HR0 A;  4KE3 A;  5JWQ B;  3ERW A;  6GSW A;  1Z6M A;  4IN0 A;  4AJ6 A;  1SK2 A;  1K0N A;  2QC7 A;  4HSC X;  5IM9 A;  1AUC A;  5ID2 B;  5B8A A;  5F06 A;  3U5R E;  11GS A;  2DJJ A;  4NV5 A;  3F3R A;  1F3A A;  5ECH B;  1A24 A;  3VWV A;  3ERF A;  3M1G A;  4IVF A;  2X8G A;  3TRX A;  1N8J A;  3L9U A;  3EIN A;  5HFG A;  4KGI A;  3TDG A;  4ZL9 A;  4GLT A;  3MYD A;  2G2Q A;  1LJR A;  2V1M A;  1T1V A;  2QKE A;  2A2R A;  1QFN A;  5IOW A;  2AJQ B;  2YPM A;  2B7J A;  3KTB A;  3F6F A;  2HYX A;  2RM6 A;  3GL3 A;  5IO0 A;  5C00 A;  4OFT A;  4K6X A;  1DE1 A;  4NHZ A;  4YH2 A;  5GSS A;  5B6N A;  5D93 A;  1K3L A;  3GUS A;  4HS1 A;  2DKH A;  5DCH A;  3RPN A;  4TR0 A;  1AIU A;  2HT9 A;  4OO5 A;  5D73 A;  3KZQ A;  1OKT A;  4XCS A;  2GSS A;  3DVX A;  1TDI A;  3KEB A;  2HZE B;  1FG4 A;  2R37 A;  2GVP A;  3ZZX A;  1PSQ A;  2H0G A;  2ZNM A;  4CDO A;  1GSS A;  2LST A;  1EP8 A;  1SKS B;  1U87 A;  3IPZ A;  3CTF A;  1QGV A;  4MH2 A;  2QA1 A;  2FWH A;  4ZBA A;  2VL2 A;  4EKZ A;  2OAC A;  5ECI B;  1IYI A;  5F07 A;  4TVE A;  4PUF C;  3WGX A;  1XW6 A;  3M9J A;  3GSS A;  1RK4 A;  4BPY A;  4MJB A;  3KGK A;  2JAD A;  1I5G A;  1X0R A;  1K0M A;  1GP1 A;  1B8X A;  2NVL A;  3H79 A;  1M2B A;  3VWU A;  2PU9 C;  5COH A;  2R3X A;  1JHB A;  1HNB A;  3SWL A;  1QXH A;  1AQW A;  3UAP A;  5A5K A;  4KCE A;  5IMC A;  3GX8 A;  1XBS A;  4GRF A;  4J57 E;  1PN9 A;  3HCZ A;  2RII A;  2NDO A;  4Q5R A;  2GQL A;  5IPG A;  1EEM A;  2A2P A;  2VCV A;  1A2M A;  5KOW A;  2HE3 A;  1BX9 A;  4POB A;  4PQH A;  4D73 A;  1O8X A;  4BVY B;  1EV9 A;  14GS A;  4MK3 A;  1W89 A;  2KLX A;  3G7J A;  1EEJ A;  5HFI A;  2K18 A;  4F0C A;  2HRK A;  2YOI A;  4ZL8 A;  4HZ2 A;  3IAS 2;  3UAR A;  2YV9 A;  1MEK A;  1MTC A;  1K0C A;  3A5W A;  3BOA A;  2YAN A;  1G6Y A;  2MMZ A;  4BVX A;  4PUR A;  4ZIJ A;  2P5Q A;  2BJX A;  2H30 A;  2WJU A;  2LNS A;  1GTI A;  3UVH A;  3NZN A;  3D5J A;  3GH6 A;  12GS A;  1URM A;  3L0H A;  2E7P A;  2K8V A;  2WS2 A;  1M3I A;  3MNG A;  2GZY A;  3D22 A;  4ML1 A;  5G30 A;  4NHW A;  2EIQ A;  2CZ3 A;  3I6A A;  1H4O A;  1B9Y C;  1KBN A;  4GQF A;  4IP1 A;  1F9M A;  4FYU A;  3BCK A;  5A4V A;  2GSR A;  4YQV A;  1XVW A;  1GSU A;  3Q18 A;  5DDL A;  4Q5Q A;  3UBK A;  1XOA A;  3FZ5 A;  2WGR A;  1T00 A;  3QAG A;  3FY7 A;  3C73 A;  3C71 A;  5H5S A;  2YWN A;  4KUN A;  4V2N A;  1EOH A;  1E2Y A;  4LA1 A;  2XPE A;  4N0V A;  1ZYE A;  5JCU A;  2PER A;  2R6K A;  3I43 A;  3FZA A;  3QMX A;  4I2U A;  17GS A;  1F6M C;  20GS A;  1XFL A;  3M8N A;  1KTE A;  3VFI A;  2IME A;  2GT6 A;  4MJC A;  3QFB C;  4FYC A;  1M2A A;  1WIK A;  5ECQ B;  5J4U A;  3ZML A;  2LJK A;  1V98 A;  2IMD A;  1O7U A;  4IS0 A;  1PMT A;  5DQS A;  3CSJ A;  1XZO A;  4CW9 A;  2HRN A;  3LXT A;  3ERG A;  2KOK A;  4EXJ A;  1R26 A;  2J23 A;  1MDI A;  5CRW A;  4Z2T A;  1AC1 A;  1THO A;  2LKU A;  4EDZ A;  2CVB A;  2HNL A;  2I4A A;  2JSZ A;  4G19 A;  3LEF A;  2EIR A;  4OFM A;  3GST A;  2VLT A;  2FUG 2;  1HNC A;  5KN1 A;  3GA4 A;  4MJA A;  2VCZ A;  2D2Z A;  4WEY A;  5GST A;  4PGT A;  2X64 A;  3EPT A;  3A2V A;  3ZFL A;  5DVB A;  1PA3 A;  3H4K A;  2VL9 A;  1DBY A;  2QA2 A;  1SD9 A;  5CRD A;  4YAV A;  2HSM A;  2HZE A;  2R5G A;  1EP7 A;  3HKR A;  1PN0 A;  2H70 A;  2DJ2 A;  4IHU A;  2G0F A;  3F4T A;  1PKZ A;  5JCW A;  5HQP A;  3GIX A;  3HYP A;  5DQY A;  1MDK A;  2H1B A;  1H75 A;  3UEM A;  5ECS A;  3A5I A;  2C3T A;  2VL3 A;  5LCZ A;  4X4J A;  4XIH A;  2AAW A;  2MMN A;  1DE2 A;  5E59 A;  5DAL A;  4ZBB A;  4EE0 A;  1M9B A;  2FA4 A;  3HVN A;  1X9S B;  3L4N A;  1GUH A;  4YQU A;  2IMK A;  2B6M A;  3ISO A;  4V2M A;  2DIY A;  3ZVJ D;  4F9Z A;  4LL4 B;  3D4T A;  3EVI A;  1V9W A;  2DSA A;  1X5C A;  4ECI A;  3UIW A;  1F37 A;  1XVQ A;  4K7I A;  5KEJ A;  2LEG A;  2LTK A;  3CRT A;  4EDY A;  2GGT A;  2LQQ A;  1PKW A;  4KAE A;  4MA9 A;  3KMN A;  3GNJ A;  3FRC A;  4H86 A;  2YN1 A;  16GS A;  3UBL A;  1Z6N A;  4Q5F A;  2AV4 A;  2TIR A;  3VPQ A;  3P8W A;  3EWL A;  4CY8 A;  1Y25 A;  2H8L A;  4L8E A;  3MSZ A;  3FZ9 A;  2A4H A;  1B9X C;  3LQ7 A;  4J56 E;  2H1G A;  4BVY A;  1T8E B;  1S3C A;  4ISD A;  5LNK e;  1R5A A;  1W4V A;  3BD2 A;  4KF9 A;  1XOB A;  7GSS A;  3DRN A;  5J9C A;  1QK8 A;  2GLR A;  1GUK A;  3DWV A;  1YF1 A;  4WR4 A;  3KD0 A;  2YWI A;  4JZQ A;  4DSR A;  1GL8 A;  1ZCP A;  3UMA A;  2GST A;  2C3Q A;  8GSS A;  1GSF A;  3I9V 2;  1YZX A;  1SKW B;  1U6T A;  1TXX A;  1TRW A;  2ZUP A;  4Z2R A;  1F2E A;  4HZ4 A;  2IMF A;  2L6D A;  2IFQ A;  2PN8 A;  1DSB A;  1AXD A;  2HRA A;  1TJD A;  3C8E A;  4F03 A;  3HVV A;  4KND A;  3ZRE A;  1U3A A;  2GZZ A;  2FY6 A;  3TRQ A;  2RUE A;  2WUL A;  1TK0 B;  4E8E A;  2HLS A;  4BA7 A;  5D9X A;  1TOF A;  2B5Y A;  1XXU A;  3J7Y b;  1VF1 A;  2YNX A;  3LXZ A;  5J5N A;  6GSV A;  5CO3 A;  5ECR B;  3ZLP A;  2DML A;  3MAK A;  3KIJ A;  2C1Y A;  2DJ3 A;  4DEJ A;  2FWG A;  3PPU A;  5D9W A;  2NBS A;  5GAP D;  2AUV A;  2PGT A;  2YJ7 A;  2LQO A;  1O85 A;  4K9Z A;  2F3M A;  1PFO A;  2DLX A;  4EIP A;  1ST9 A;  1SL0 B;  1J9B A;  1TW9 A;  2H6X A;  4K5R A;  4NV2 A;  1J0F A;  1FOV A;  1ZYN A;  1ABA A;  6GSS A;  1M99 A;  5DBQ A;  3PGT A;  5LD0 A;  1SL2 B;  1O6J A;  2HSH A;  5GAN D;  4N0Z A;  1NM3 A;  3F9U A;  5KN3 A;  3HVX A;  2H72 A;  4PXO A;  4LMW A;  4HEA 2;  1T7P B;  3TJG A;  5B8B A;  4KA0 A;  1VGL A;  3SBC A;  2LRC A;  4K0G A;  1FB0 A;  3F4S A;  3UJ1 A;  4PQ1 A;  3FEU A;  2L5L A;  4BL7 B;  3L9V A;  4Q5N A;  1A2L A;  1WMJ A;  4X0X A;  4ZB9 A;  4KB3 A;  1SYX A;  3TKP A;  2O7K A;  4K1F A;  4HQS A;  3MIX A;  1B48 A;  4MMM A;  4A5P A;  3IR4 A;  1CQH A;  1OC9 A;  2K9F A;  4XTS A;  3IHQ A;  2DKI A;  3F0I A;  5ENU A;  1Z7P A;  3TKS A;  4HDE A;  2XC2 A;  1YY7 A;  2JAC A;  3TKQ A;  4MF6 A;  5BRT A;  3KP8 A;  2UZ8 A;  3ME7 A;  2LNT A;  4DVC A;  5FT3 A;  2FHE A;  2VCW A;  2FWF A;  2C0E A;  2KP2 A;  1A8L A;  1ZYQ B;  4G0I A;  3GH9 A;  4RI7 A;  1M9A A;  1TI1 A;  3GKM A;  4WBR D;  4BIK A;  4TKY A;  2JZT A;  3GL5 A;  4YQM A;  2DC5 A;  3IDV A;  1I9D A;  1ILO A;  1FO5 A;  1O73 A;  4F82 A;  4JED A;  3TJJ A;  3WYW A;  2OJL A;  1HYU A;  2AHE A;  2WRT A;  1FVJ A;  1G7O A;  5AIX A;  4KSO A;  4TRX A;  2L4Q A;  2EIO A;  3IRA A;  3ZFB A;  1YKA A;  1OKD A;  5CYY A;  3IC8 A;  4EUY A;  4OCE A;  3BCI A;  2I9H A;  1BYE A;  2P31 A;  1TRU A;  4OFN A;  5KN2 A;  1SKR B;  1MD3 A;  3W6G A;  5IMA A;  4OWY A;  4N11 A;  4NXI A;  1NSW A;  1Z9H A;  3GKX A;  4RI6 A;  1WWJ A;  3QAW A;  4POM A;  1Z7R A;  3WT2 A;  3IOS A;  3KCM A;  1UN2 A;  3GTU A;  3W8S A;  1K0B A;  5IMZ A;  2DIZ A;  1TRS A;  4XHM A;  6GSU A;  1JZR A;  2ES7 A;  4V1A p;  3TOU A;  3QAV A;  4MDC A;  2LRT A;  2L57 A;  2F8F A;  4YAP A;  4K5S A;  2FGX A;  4CHS A;  2C0D A;  4KH7 A;  4HU9 A;  4KSM A;  1OAZ A;  1SK0 A;  2EC4 A;  3QD9 A;  1GSE A;  5DJM A;  4ICY A;  4G2E A;  2BMX A;  2B5X A;  3CXG A;  4RUV A;  1FVK A;  4YKF A;  1EV4 A;  1KEB A;  3QOU A;  3IV4 A;  3M9K A;  1EGO A;  2PVO C;  4O5Q A;  2I1U A;  4AGS A;  4I6X A;  4MNN A;  2OA7 A;  3TOT A;  5DCG A;  5AGY A;  1SJI A;  1K3Y A;  4HJ2 A;  2B1L A;  5AIS A;  5C04 A;  2DJK A;  3DEX A;  1PGT A;  1YQ1 A;  5AN1 A;  4USS A;  1TKD B;  3C1R A;  5G31 A;  5JCG A;  2F8A A;  4N10 A;  4FYB A;  4I5Q A;  2AB6 A;  3V1W A;  4OO4 A;  4JBB A;  2C0G A;  1TU7 A;  1M3J A;  2TRC P;  1GSY A;  3HJM A;  2MBS A;  2H1D A;  2IN3 A;  5D8I A;  1THX A;  3KM6 A;  1K0A A;  2H6Y A;  4KCA A;  3F8U A;  5CRG A;  3LW9 A;  1E6B A;  3RHB A;  3Q6O A;  4TN8 A;  3HD5 A;  2VO4 A;  3LGC A;  2K6V A;  3TUE A;  3GX0 A;  3E0U A;  5ID2 A;  3FZ4 A;  1GUM A;  1FOH A;  4KX4 A;  1LU4 A;  1JLW A;  2O85 A;  1EGR A;  3FMW A;  2KP1 A;  4X1U A;  1VF2 A;  2I81 A;  3EU3 A;  4XRA A;  3IAM 2;  3TKR A;  1GNE A;  3HY2 A;  2WB9 A;  2JSY A;  2IWT A;  2GQM A;  1R5P A;  2B3S A;  3CBU A;  1OC3 A;  1OC8 A;  2X99 A;  3L9S A;  1OVN A;  2JL4 A;  4CY6 A;  2VCQ A;  2N5B A;  3GKN A;  1HQO A;  4WF4 A;  1NHY A;  2V6K A;  4BL7 A;  2X49 A;  4PQI A;  3HZ4 A;  1Q98 A;  4TXV A;  3CSH A;  4LLR A;  4DSS B;  1CQG A;  3PH9 A;  1V57 A;  4MPG A;  4EIQ A;  3HA9 A;  3HJP A;  3IE3 A;  3FHK A;  5ECN B;  3DIE A;  4MJE A;  2M46 A;  4PUA A;  4OCF A;  4MAB A;  2L4C A;  3UL3 A;  5A4U A;  4HJM A;  1K3O A;  4JR4 A;  4K7O A;  5KOX A;  1MDJ A;  2H6Z A;  2XPD A;  4AJ7 A;  1GSD A;  2YP6 A;  2MMO A;  1RW1 A;  1EWX A;  5HR1 A;  4IGJ A;  3W8J A;  2VLU A;  2CAQ A;  1A2J A;  3EU4 A;  2XHF A;  1EOG A;  2GZP A;  2M72 A;  3ZIV A;  3ZVJ A;  1ZOF A;  2CZ2 A;  1JFU A;  4L0U A;  4POK A;  3APQ A;  2CV4 A;  4MZC A;  5KN0 A;  1SEN A;  2PMT A;  4WET A;  3D0Z A;  1TP9 A;  2VCX A;  3TJK A;  1XG8 A;  5DAK B;  1T3B A;  1ZGN A;  1WJK A;  5ECL B;  2YZH A;  2O8V B;  3M0F A;  4X43 A;  2WCI A;  4NPB A;  2BTO T;  3D21 A;  4DSQ A;  2VM2 A;  3RBT A;  3ZMK A;  4ECJ A;  3LJR A;  5HR3 A;  4MZW A;  3OR5 A;  2VLV A;  1XW5 A;  2REM A;  4MLY A;  3S9F A;  5D96 A;  2E2M A;  4MF5 A;  1LBK A;  4K0N A;  3R2Q A;  22GS A;  3VK9 A;  4I97 A;  1B4Q A;  4ML6 A;  3CYN A;  1JLV A;  3US3 A;  2X8C A;  4PNF A;  1O81 A;  1G0T A;  2OE3 A;  2GDR A;  4JRR A;  1KNG A;  2JU5 A;  2H1A A;  1QMV A;  3MDK A;  1FW1 A;  1ERT A;  2FWE A;  2C80 A;  4TW5 A;  4RQR A;  4IQA A;  3G7Y A;  1BED A;  1SJ6 A;  3Q74 A;  4ECC A;  3WD6 A;  3VI7 A;  5DJL A;  5BMU A;  3WGE A;  2FD3 A;  1A0R P;  3TGZ A;  4RQX A;  2C0F A;  3BBY A;  4XRD A;  4GWR A;  4BWS A;  2CVK A;  3O3T A;  4GTU A;  1R4W A;  4IJ3 A;  5G5F A;  4IJI A;  3VI5 A;  4FH8 A;  1ERV A;  3CRU A;  5D9V A;  3KH7 A;  2CA8 A;  3KMO A;  1Z3E A;  1BQ7 A;  2H19 A;  5J41 A;  2R0C A;  3VUR A;  1TU8 A;  1X5D A;  4G0K A;  3ZTL A; 
#chains in the Genus database with same CATH homology
 4D73 B;  3G9B A;  1XPV A;  4IEL A;  2GQK A;  2JZR A;  3F3Q A;  5F0G A;  1XWK A;  3IC4 A;  3A3T A;  3HDC A;  4AF2 A;  1ML6 A;  1UVZ A;  2DJ1 A;  1ZMA A;  2VOC A;  3GFK A;  3NOF A;  1DUG A;  1J08 A;  3FK8 A;  1ZZY A;  5H5R A;  3ZIJ A;  2HSY A;  1VF4 A;  4BVX B;  2NPB A;  2JZS A;  2VL2 C;  3FYG A;  1B4P A;  4K2X A;  2YCD A;  3P90 A;  4K8M A;  2P0G A;  1G6W A;  2IPA A;  3IK9 A;  2KHP A;  3TKS E;  4I8B A;  2VCT A;  4MZB A;  1GRX A;  1PRX A;  5ECK B;  3R3E A;  4NWY A;  2LS5 A;  1OYJ A;  2HI7 A;  1SJZ A;  1V2A A;  2OAD A;  3HJO A;  1TTZ A;  3VWW A;  3MWH A;  1QUW A;  2IIY A;  1XIY A;  1M2D A;  3GRX A;  4K2D A;  13GS A;  4E8H A;  4O7H A;  3VLN A;  4QL7 A;  1GH2 A;  1V58 A;  2IJY A;  2V6O A;  3N9J A;  4EVM A;  2DMM A;  1OE8 A;  5ECM B;  1ERW A;  4KW6 A;  2CAI A;  1Y6E A;  3CSI A;  1X5E A;  4DSS A;  5IOX A;  3KH9 A;  1FHE A;  1IYH A;  2VM1 A;  2DBC A;  4HQZ A;  5ELA A;  4WXT A;  1N2A A;  3QFA C;  4MH3 A;  5B7C A;  3TCO A;  5G1K A;  5IIZ A;  4ILF A;  2WFC A;  1M7T A;  2OE0 A;  5FHI A;  1PL1 A;  1WPI A;  5EVO A;  1XWC A;  4L5L A;  1S3A A;  2H66 A;  3F6D A;  3DML A;  5IMV A;  4GST A;  3TJB A;  4MPF A;  2YV7 A;  3DD3 A;  4KDU A;  4EF0 A;  2K8S A;  1ZYP A;  4PTS A;  4LL1 B;  1PX7 A;  4KDY A;  3P2A A;  3QDN A;  1AW9 A;  3KTL A;  1EZK A;  1AQV A;  4O92 A;  4OMV A;  4MCU A;  5B6M A;  2PVQ A;  1WRY A;  2R2J A;  2XBQ A;  5IQY A;  4WBJ A;  1GTU A;  5DAK A;  1OE7 A;  3HZ8 A;  1YEP A;  4BWQ A;  2H76 A;  1Q4J A;  2CQ9 A;  4GSS A;  1GLQ A;  2A2S A;  3KJY A;  2V41 A;  1AQX A;  4J2F A;  1JZW A;  2HZF A;  2QGV A;  2P5R A;  4XS6 A;  2N5A A;  1VRS D;  5EPF A;  2H0I A;  4NAX A;  3ED3 A;  3GKK A;  5EY6 A;  19GS A;  3ZIT A;  3QPM A;  4IBP A;  2V2G A;  3H1N A;  3ZYW A;  2E2G A;  4FO5 A;  1QQ2 A;  3E9J B;  2YZU A;  1PX6 A;  1PQN A;  1X9M B;  1PD2 1;  4GCI A;  3H8Q A;  3F63 A;  3ZL5 A;  4GQC A;  3LOR A;  2B7K A;  1SYR A;  3FR3 A;  5DAL B;  5ELG A;  5IMD A;  3GYK A;  1YKC A;  4XS1 A;  4IW9 A;  3PR8 A;  3HVS A;  4O5U A;  2MMA A;  2ALB A;  2H71 A;  2H73 A;  1GNW A;  3BJ5 A;  5G5E A;  2HXK A;  1SU9 A;  2YWM A;  1C72 A;  4TR4 A;  2VD1 A;  2CVD A;  4GXZ A;  4N30 A;  3H93 A;  1YEX A;  5H5Q A;  1Z5Y E;  2GT5 A;  4YKG A;  1UC7 A;  3EE2 A;  2OBK A;  2XBI A;  2OE1 A;  2QSI A;  1TI3 A;  2O87 A;  5CRE A;  4Z2U A;  4ACS A;  4ZIL A;  4O32 A;  2E0Q A;  2RM5 A;  2ON5 A;  2HFD A;  4IQ1 A;  1FAA A;  4WF5 A;  1U3I A;  2I3Y A;  2VUP A;  3KP9 A;  5J9B A;  4QL9 A;  2F51 A;  3FR6 A;  2O89 A;  4P3Y B;  3FR9 A;  2RLI A;  2A4V A;  4IKH A;  5ECO B;  3LYK A;  1A23 A;  3J7Y k;  4TXO B;  2FCH A;  4GSN A;  3A2W A;  4XS4 B;  2X4A A;  2V32 A;  3LYP A;  4TR1 B;  4IP6 A;  1HNA A;  1HD2 A;  1XWG A;  2FLS A;  1T4Z A;  2H0H A;  5AIV A;  3DVW A;  1A8Y A;  1XWA A;  5E4W A;  2IL3 A;  1R7H A;  2IFQ B;  2M80 A;  2MZC A;  1YJ6 A;  2WDU A;  4ECB A;  3EUR A;  3DGQ A;  3IHG A;  5G1L A;  4JR6 A;  3DKS A;  1YDK A;  3ME8 A;  2TRX A;  2OBI A;  5CNW A;  1ACV A;  3I69 A;  5HR2 A;  2YJH A;  1XCC A;  4HUA A;  1VF3 A;  3N5O A;  3GHA A;  4EC0 A;  4O5R A;  2B5E A;  1ON4 A;  3LG6 A;  3E3E A;  2X8H A;  3C7M A;  4ZB6 A;  3EC3 A;  2PUK C;  3ZRD A;  1G7E A;  1NHO A;  6GST A;  3GN3 A;  3RAZ A;  1XW9 A;  2LV3 A;  3AY8 A;  4Z7X A;  1AAZ A;  1RQM A;  3UVT A;  2H01 A;  4ULX A;  3U6V A;  1K0O A;  4QQ7 A;  2LJR A;  5HFK A;  2WZ9 A;  3GV1 A;  2AYT A;  1YF0 A;  4JE1 A;  3KXO A;  4F2I A;  2HRF A;  3L78 A;  4K7N A;  1ERU A;  3QCP A;  3QR6 A;  2LRN A;  2R0P A;  1NW2 A;  4G9H A;  3CMI A;  5D9T A;  3C1S A;  1UA5 A;  4OD7 A;  3CTG A;  1GLP A;  5IMF A;  3HXS A;  2LJA A;  2CX4 A;  4HOJ A;  3D6I A;  1XWB A;  10GS A;  2J9H A;  4F0B A;  4ZBD A;  5ECP B;  3Q19 A;  4LMV A;  1WE0 A;  3LSZ A;  3G7I A;  4POL A;  3EMP A;  5JWO B;  2KUC A;  5IO2 A;  1OC9 B;  1JZD A;  3RPP A;  2RUF A;  3TRP A;  4ID0 A;  2LUS A;  3HHV A;  1GSQ A;  3TJF A;  2FA8 A;  2NTO A;  2N5F A;  3IXR A;  4FQU A;  2F9S A;  1USB A;  5IPH A;  1TK8 B;  4L0W A;  1PL2 A;  1JZO A;  4I2T A;  3IK7 A;  1M0U A;  4EL1 A;  2VD0 A;  2L59 A;  5EL8 A;  3PIN A;  2R0G A;  5CAX A;  4HI7 A;  3IBH A;  3LWA A;  3APS A;  5L71 A;  2IMI A;  3FW2 A;  3D4M A;  3GMF A;  1SD8 A;  2CT6 A;  3LFL A;  3O6T A;  1O8W A;  3GUR A;  1SL1 B;  3TB2 A;  3UOM A;  1ZL9 A;  5INY A;  2VIM A;  3M3M A;  1MD4 A;  3RHC A;  4JU5 A;  4AJ8 A;  2MYG A;  1GWC A;  3EYT A;  1U88 A;  2Z9S A;  1A0F A;  1WP0 A;  1V40 A;  3F4R A;  3VWX A;  2ZCT A;  2B1K A;  2FNO A;  2H74 A;  4NMU A;  3O76 A;  4KDX A;  1GTA A;  2OKA A;  3RDW A;  4G10 A;  2R4V A;  5F8B A;  3K8N A;  1SK1 A;  2GSQ A;  2C8U A;  4HU7 A;  2GTU A;  3GTU B;  2MBT A;  2L5O A;  6GSX A;  2DJ0 A;  4V1A g;  3TKS C;  2PWJ A;  1TK5 B;  1F3B A;  1K0D A;  5G2Z A;  9GSS A;  3DYR A;  1FB6 A;  3NIV A;  2PBJ A;  4MF7 A;  6GSY A;  1S3D A;  2H75 A;  5F05 A;  1BJX A;  4TXO A;  2YWO A;  4XS4 A;  3WT1 A;  4GF0 A;  4TR1 A;  2ON7 A;  4ZXG A;  1BAY A;  3VPT A;  5J3R A;  2C4J A;  4FIW A;  1BG5 A;  3P7X A;  4WKW A;  3IA1 A;  3DXB A;  4ZL7 A;  4PX1 A;  5GZZ B;  2VAF A;  1GUL A;  3APO A;  18GS A;  3EMX A;  5FWG A;  4MP4 A;  5JWR B;  2PPT A;  4EO3 A;  4G0L A;  2L6C A;  2CX3 A;  4PNG A;  1WOU A;  3WGD A;  3FKF A;  4L5O A;  5CRH A;  4WR5 A;  5CP1 A;  1GTB A;  5A4W A;  4TR3 A;  3JCM L;  1X9W B;  1T4Y A;  3A2X A;  4TOP A;  4V2L A;  4ZB8 A;  5ABR A;  1TRV A;  2GS3 A;  2C3N A;  5HR0 A;  4KE3 A;  5JWQ B;  3ERW A;  6GSW A;  1Z6M A;  4IN0 A;  4AJ6 A;  1SK2 A;  1K0N A;  2QC7 A;  5IM9 A;  1AUC A;  5ID2 B;  5B8A A;  5F06 A;  3U5R E;  11GS A;  2DJJ A;  4NV5 A;  3F3R A;  1F3A A;  5ECH B;  1A24 A;  3VWV A;  3ERF A;  3M1G A;  4IVF A;  2X8G A;  3TRX A;  1N8J A;  3L9U A;  3EIN A;  5HFG A;  4KGI A;  3TDG A;  4ZL9 A;  4GLT A;  3MYD A;  2G2Q A;  1LJR A;  2V1M A;  1T1V A;  2QKE A;  2A2R A;  1QFN A;  5IOW A;  2AJQ B;  2YPM A;  2B7J A;  3KTB A;  3F6F A;  2HYX A;  2RM6 A;  3GL3 A;  5IO0 A;  5C00 A;  4OFT A;  4K6X A;  1DE1 A;  4NHZ A;  4YH2 A;  5GSS A;  5B6N A;  5D93 A;  1K3L A;  3GUS A;  4HS1 A;  2DKH A;  5DCH A;  3RPN A;  4TR0 A;  1AIU A;  2HT9 A;  4OO5 A;  5D73 A;  3KZQ A;  1OKT A;  4XCS A;  2GSS A;  3DVX A;  1TDI A;  3KEB A;  2HZE B;  1FG4 A;  2R37 A;  2GVP A;  3ZZX A;  1PSQ A;  2H0G A;  2ZNM A;  4CDO A;  1GSS A;  2LST A;  1EP8 A;  1SKS B;  1U87 A;  3IPZ A;  3CTF A;  1QGV A;  4MH2 A;  2QA1 A;  2FWH A;  4ZBA A;  2VL2 A;  4EKZ A;  2OAC A;  5ECI B;  1IYI A;  5F07 A;  4TVE A;  4PUF C;  3WGX A;  1XW6 A;  3M9J A;  3GSS A;  1RK4 A;  4BPY A;  4MJB A;  3KGK A;  2JAD A;  1I5G A;  1X0R A;  1K0M A;  1GP1 A;  1B8X A;  2NVL A;  3H79 A;  1M2B A;  3VWU A;  2PU9 C;  5COH A;  2R3X A;  1JHB A;  1HNB A;  3SWL A;  1QXH A;  1AQW A;  3UAP A;  5A5K A;  4KCE A;  5IMC A;  3GX8 A;  1XBS A;  4GRF A;  4J57 E;  1PN9 A;  3HCZ A;  2RII A;  2NDO A;  4Q5R A;  2GQL A;  5IPG A;  1EEM A;  2A2P A;  2VCV A;  1A2M A;  5KOW A;  2HE3 A;  1BX9 A;  4POB A;  4PQH A;  4D73 A;  1O8X A;  4BVY B;  1EV9 A;  14GS A;  4MK3 A;  1W89 A;  2KLX A;  3G7J A;  1EEJ A;  5HFI A;  2K18 A;  4F0C A;  2HRK A;  2YOI A;  4ZL8 A;  4HZ2 A;  3IAS 2;  3UAR A;  2YV9 A;  1MEK A;  1MTC A;  1K0C A;  3A5W A;  3BOA A;  2YAN A;  1G6Y A;  2MMZ A;  4BVX A;  4PUR A;  4ZIJ A;  2P5Q A;  2BJX A;  2H30 A;  2WJU A;  2LNS A;  1GTI A;  3UVH A;  3NZN A;  3D5J A;  3GH6 A;  12GS A;  1URM A;  3L0H A;  2E7P A;  2K8V A;  2WS2 A;  3MNG A;  2GZY A;  3D22 A;  4ML1 A;  5G30 A;  4NHW A;  2EIQ A;  2CZ3 A;  3I6A A;  1H4O A;  1B9Y C;  1KBN A;  4GQF A;  4IP1 A;  1F9M A;  4FYU A;  3BCK A;  5A4V A;  2GSR A;  4YQV A;  1XVW A;  1GSU A;  3Q18 A;  5DDL A;  4Q5Q A;  3UBK A;  1XOA A;  3FZ5 A;  2WGR A;  1T00 A;  3QAG A;  3FY7 A;  3C73 A;  3C71 A;  5H5S A;  2YWN A;  4KUN A;  4V2N A;  1EOH A;  1E2Y A;  4LA1 A;  2XPE A;  4N0V A;  1ZYE A;  5JCU A;  2PER A;  2R6K A;  3I43 A;  3FZA A;  3QMX A;  4I2U A;  17GS A;  1F6M C;  20GS A;  1XFL A;  3M8N A;  1KTE A;  3VFI A;  2IME A;  2GT6 A;  4MJC A;  3QFB C;  4FYC A;  1M2A A;  1WIK A;  5ECQ B;  5J4U A;  3ZML A;  2LJK A;  1V98 A;  2IMD A;  1O7U A;  4IS0 A;  1PMT A;  5DQS A;  3CSJ A;  1XZO A;  4CW9 A;  2HRN A;  3LXT A;  3ERG A;  2KOK A;  4EXJ A;  1R26 A;  2J23 A;  1MDI A;  5CRW A;  4Z2T A;  1AC1 A;  1THO A;  2LKU A;  4EDZ A;  2CVB A;  2HNL A;  2I4A A;  2JSZ A;  4G19 A;  3LEF A;  2EIR A;  4OFM A;  3GST A;  2VLT A;  2FUG 2;  1HNC A;  5KN1 A;  3GA4 A;  4MJA A;  2VCZ A;  2D2Z A;  4WEY A;  5GST A;  4PGT A;  2X64 A;  3EPT A;  3A2V A;  3ZFL A;  5DVB A;  1PA3 A;  3H4K A;  2VL9 A;  1DBY A;  2QA2 A;  1SD9 A;  5CRD A;  4YAV A;  2HSM A;  2HZE A;  2R5G A;  1EP7 A;  3HKR A;  1PN0 A;  2H70 A;  2DJ2 A;  4IHU A;  2G0F A;  3F4T A;  1PKZ A;  5JCW A;  5HQP A;  3GIX A;  3HYP A;  5DQY A;  1MDK A;  2H1B A;  1H75 A;  3UEM A;  5ECS A;  3A5I A;  2C3T A;  2VL3 A;  5LCZ A;  4X4J A;  4XIH A;  2AAW A;  2MMN A;  1DE2 A;  5E59 A;  5DAL A;  4ZBB A;  4EE0 A;  1M9B A;  2FA4 A;  1X9S B;  3L4N A;  1GUH A;  4YQU A;  2IMK A;  2B6M A;  3ISO A;  4V2M A;  2DIY A;  3ZVJ D;  4F9Z A;  4LL4 B;  3D4T A;  3EVI A;  1V9W A;  2DSA A;  1X5C A;  4ECI A;  3UIW A;  1F37 A;  1XVQ A;  4K7I A;  5KEJ A;  2LEG A;  2LTK A;  3CRT A;  4EDY A;  2GGT A;  2LQQ A;  1PKW A;  4KAE A;  4MA9 A;  3KMN A;  3GNJ A;  3FRC A;  4H86 A;  2YN1 A;  16GS A;  3UBL A;  1Z6N A;  4Q5F A;  2AV4 A;  2TIR A;  3VPQ A;  3P8W A;  3EWL A;  4CY8 A;  1Y25 A;  2H8L A;  4L8E A;  3MSZ A;  3FZ9 A;  2A4H A;  1B9X C;  3LQ7 A;  4J56 E;  2H1G A;  4BVY A;  1T8E B;  1S3C A;  4ISD A;  5LNK e;  1R5A A;  1W4V A;  3BD2 A;  4KF9 A;  1XOB A;  7GSS A;  3DRN A;  5J9C A;  1QK8 A;  2GLR A;  1GUK A;  3DWV A;  1YF1 A;  4WR4 A;  3KD0 A;  2YWI A;  4JZQ A;  4DSR A;  1GL8 A;  1ZCP A;  3UMA A;  2GST A;  2C3Q A;  8GSS A;  1GSF A;  3I9V 2;  1YZX A;  1SKW B;  1U6T A;  1TXX A;  1TRW A;  2ZUP A;  4Z2R A;  1F2E A;  4HZ4 A;  2IMF A;  2L6D A;  2IFQ A;  2PN8 A;  1DSB A;  1AXD A;  2HRA A;  1TJD A;  3C8E A;  4F03 A;  3HVV A;  4KND A;  3ZRE A;  1U3A A;  2GZZ A;  2FY6 A;  3TRQ A;  2RUE A;  2WUL A;  1TK0 B;  4E8E A;  2HLS A;  4BA7 A;  5D9X A;  1TOF A;  2B5Y A;  1XXU A;  3J7Y b;  1VF1 A;  2YNX A;  3LXZ A;  5J5N A;  6GSV A;  5CO3 A;  5ECR B;  3ZLP A;  2DML A;  3MAK A;  3KIJ A;  2C1Y A;  2DJ3 A;  4DEJ A;  2FWG A;  3PPU A;  5D9W A;  2NBS A;  5GAP D;  2AUV A;  2PGT A;  2YJ7 A;  2LQO A;  1O85 A;  4K9Z A;  2F3M A;  2DLX A;  4EIP A;  1ST9 A;  1SL0 B;  1J9B A;  1TW9 A;  2H6X A;  4K5R A;  4NV2 A;  1J0F A;  1FOV A;  1ZYN A;  1ABA A;  6GSS A;  1M99 A;  5DBQ A;  3PGT A;  5LD0 A;  1SL2 B;  1O6J A;  2HSH A;  5GAN D;  4N0Z A;  1NM3 A;  3F9U A;  5KN3 A;  3HVX A;  2H72 A;  4PXO A;  4LMW A;  4HEA 2;  1T7P B;  3TJG A;  5B8B A;  4KA0 A;  1VGL A;  3SBC A;  2LRC A;  4K0G A;  1FB0 A;  3F4S A;  3UJ1 A;  4PQ1 A;  3FEU A;  2L5L A;  4BL7 B;  3L9V A;  4Q5N A;  1A2L A;  1WMJ A;  4X0X A;  4ZB9 A;  4KB3 A;  1SYX A;  3TKP A;  2O7K A;  4K1F A;  4HQS A;  3MIX A;  1B48 A;  4MMM A;  4A5P A;  3IR4 A;  1CQH A;  1OC9 A;  2K9F A;  4XTS A;  3IHQ A;  2DKI A;  3F0I A;  5ENU A;  1Z7P A;  3TKS A;  4HDE A;  2XC2 A;  1YY7 A;  2JAC A;  3TKQ A;  4MF6 A;  5BRT A;  3KP8 A;  2UZ8 A;  3ME7 A;  2LNT A;  4DVC A;  5FT3 A;  2FHE A;  2VCW A;  2FWF A;  2C0E A;  2KP2 A;  1A8L A;  1ZYQ B;  4G0I A;  3GH9 A;  4RI7 A;  1M9A A;  1TI1 A;  3GKM A;  4WBR D;  4TKY A;  2JZT A;  3GL5 A;  4YQM A;  2DC5 A;  3IDV A;  1I9D A;  1ILO A;  1FO5 A;  1O73 A;  4F82 A;  4JED A;  3TJJ A;  3WYW A;  2OJL A;  1HYU A;  2AHE A;  2WRT A;  1FVJ A;  1G7O A;  5AIX A;  4KSO A;  4TRX A;  2L4Q A;  2EIO A;  3IRA A;  3ZFB A;  1YKA A;  1OKD A;  5CYY A;  3IC8 A;  4EUY A;  4OCE A;  3BCI A;  2I9H A;  1BYE A;  2P31 A;  1TRU A;  4OFN A;  5KN2 A;  1SKR B;  1MD3 A;  3W6G A;  5IMA A;  4OWY A;  4N11 A;  4NXI A;  1NSW A;  1Z9H A;  3GKX A;  4RI6 A;  1WWJ A;  3QAW A;  4POM A;  1Z7R A;  3WT2 A;  3IOS A;  3KCM A;  1UN2 A;  3GTU A;  3W8S A;  1K0B A;  5IMZ A;  2DIZ A;  1TRS A;  4XHM A;  6GSU A;  1JZR A;  2ES7 A;  4V1A p;  3TOU A;  3QAV A;  4MDC A;  2LRT A;  2L57 A;  2F8F A;  4YAP A;  4K5S A;  2FGX A;  4CHS A;  2C0D A;  4KH7 A;  4HU9 A;  4KSM A;  1OAZ A;  1SK0 A;  2EC4 A;  3QD9 A;  1GSE A;  5DJM A;  4ICY A;  4G2E A;  2BMX A;  2B5X A;  3CXG A;  4RUV A;  1FVK A;  4YKF A;  1EV4 A;  1KEB A;  3QOU A;  3IV4 A;  3M9K A;  1EGO A;  2PVO C;  4O5Q A;  2I1U A;  4AGS A;  4I6X A;  4MNN A;  2OA7 A;  3TOT A;  5DCG A;  5AGY A;  1SJI A;  1K3Y A;  4HJ2 A;  2B1L A;  5AIS A;  5C04 A;  2DJK A;  3DEX A;  1PGT A;  1YQ1 A;  5AN1 A;  4USS A;  1TKD B;  3C1R A;  5G31 A;  5JCG A;  2F8A A;  4N10 A;  4FYB A;  4I5Q A;  2AB6 A;  3V1W A;  4OO4 A;  4JBB A;  2C0G A;  1TU7 A;  2TRC P;  1GSY A;  3HJM A;  2MBS A;  2H1D A;  2IN3 A;  5D8I A;  1THX A;  3KM6 A;  1K0A A;  2H6Y A;  4KCA A;  3F8U A;  5CRG A;  3LW9 A;  1E6B A;  3RHB A;  3Q6O A;  4TN8 A;  3HD5 A;  2VO4 A;  3LGC A;  2K6V A;  3TUE A;  3GX0 A;  3E0U A;  5ID2 A;  3FZ4 A;  1GUM A;  1FOH A;  4KX4 A;  1LU4 A;  1JLW A;  2O85 A;  1EGR A;  3FMW A;  2KP1 A;  4X1U A;  1VF2 A;  2I81 A;  3EU3 A;  4XRA A;  3IAM 2;  3TKR A;  1GNE A;  3HY2 A;  2WB9 A;  2JSY A;  2IWT A;  2GQM A;  1R5P A;  2B3S A;  3CBU A;  1OC3 A;  1OC8 A;  2X99 A;  3L9S A;  1OVN A;  2JL4 A;  4CY6 A;  2VCQ A;  2N5B A;  3GKN A;  1HQO A;  4WF4 A;  1NHY A;  2V6K A;  4BL7 A;  2X49 A;  4PQI A;  3HZ4 A;  1Q98 A;  4TXV A;  3CSH A;  4LLR A;  4DSS B;  1CQG A;  3PH9 A;  1V57 A;  4MPG A;  4EIQ A;  3HA9 A;  3HJP A;  3IE3 A;  3FHK A;  5ECN B;  3DIE A;  4MJE A;  2M46 A;  4PUA A;  4OCF A;  4MAB A;  2L4C A;  3UL3 A;  5A4U A;  4HJM A;  1K3O A;  4JR4 A;  4K7O A;  5KOX A;  1MDJ A;  2H6Z A;  2XPD A;  4AJ7 A;  1GSD A;  2YP6 A;  2MMO A;  1RW1 A;  1EWX A;  5HR1 A;  4IGJ A;  3W8J A;  2VLU A;  2CAQ A;  1A2J A;  3EU4 A;  2XHF A;  1EOG A;  2GZP A;  2M72 A;  3ZIV A;  3ZVJ A;  1ZOF A;  2CZ2 A;  1JFU A;  4L0U A;  4POK A;  3APQ A;  2CV4 A;  4MZC A;  5KN0 A;  1SEN A;  2PMT A;  4WET A;  3D0Z A;  1TP9 A;  2VCX A;  3TJK A;  5DAK B;  1T3B A;  1ZGN A;  1WJK A;  5ECL B;  2YZH A;  2O8V B;  3M0F A;  4X43 A;  2WCI A;  4NPB A;  2BTO T;  3D21 A;  4DSQ A;  2VM2 A;  3RBT A;  3ZMK A;  4ECJ A;  3LJR A;  5HR3 A;  4MZW A;  3OR5 A;  2VLV A;  1XW5 A;  2REM A;  4MLY A;  3S9F A;  5D96 A;  2E2M A;  4MF5 A;  1LBK A;  4K0N A;  3R2Q A;  22GS A;  3VK9 A;  4I97 A;  1B4Q A;  4ML6 A;  3CYN A;  1JLV A;  3US3 A;  2X8C A;  4PNF A;  1O81 A;  1G0T A;  2OE3 A;  2GDR A;  4JRR A;  1KNG A;  2JU5 A;  2H1A A;  1QMV A;  3MDK A;  1FW1 A;  1ERT A;  2FWE A;  2C80 A;  4TW5 A;  4RQR A;  4IQA A;  3G7Y A;  1BED A;  1SJ6 A;  3Q74 A;  4ECC A;  3WD6 A;  3VI7 A;  5DJL A;  5BMU A;  3WGE A;  2FD3 A;  1A0R P;  3TGZ A;  4RQX A;  2C0F A;  3BBY A;  4XRD A;  4GWR A;  4BWS A;  2CVK A;  3O3T A;  4GTU A;  1R4W A;  4IJ3 A;  5G5F A;  4IJI A;  3VI5 A;  4FH8 A;  1ERV A;  3CRU A;  5D9V A;  3KH7 A;  2CA8 A;  3KMO A;  1Z3E A;  1BQ7 A;  2H19 A;  5J41 A;  2R0C A;  3VUR A;  1TU8 A;  1X5D A;  4G0K A;  3ZTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...