3VFIA

Crystal structure of a metagenomic thioredoxin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
104
structure length
104
Chain Sequence
LRSLSDSDFQLEVRQHPDPIIIMFTGSWCQPCKKMKPTFEEMASQMEGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTMNKSDLRYWINNNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords thioredoxin
publication title Structure of a Metagenomic Thioredoxin
rcsb
source organism Silicibacter phage dss3phi2
total genus 30
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vfiA00
4AJ7A 2GT5A 3E0UA 1R26A 3P90A 5GAPD 4LLRA 3C8EA 5KN3A 4X43A 1QUWA 3TRXA 5ENUA 3VK9A 3TKQA 2ZNMA 4V2LA 1TP9A 5IMZA 2H30A 1JLWA 4TXOA 5E59A 5GSTA 2ON7A 3TKPA 4BPYA 3ED3A 1XWCA 4I2UA 2H71A 2YZHA 3CXGA 5DAKA 4AGSA 3EURA 3GV1A 2GZYA 3DVXA 1PMTA 4RQXA 1KBNA 2L6DA 4ILFA 1UA5A 1Z6MA 3QDNA 1G6YA 3IXRA 1BEDA 5D9TA 4N11A 1G7OA 3SWLA 3DKSA 2TRXA 3H1NA 3KMNA 1O73A 5AIXA 3BCIA 2DJ1A 1QGVA 1ERWA 2KOKA 1C72A 4YQVA 3QAWA 1XW6A 1ST9A 13GSA 3HHVA 1M0UA 1YEXA 2IPAA 1ZOFA 4KDUA 2AJQB 1TOFA 2L59A 2MYGA 1R7HA 2C0GA 3KD0A 1A2JA 4XS4A 2YV7A 3A2WA 1GUHA 4TVEA 3HJPA 4BL7A 1LBKA 3HYPA 5L71A 1ZMAA 1M2DA 2WZ9A 5EL8A 3M1GA 3G9BA 1FG4A 1YKCA 4TXOB 4K1FA 6GSWA 2H01A 3PH9A 5HR2A 1IYHA 4HQSA 3F4TA 4POMA 5DAKB 3M9KA 2DMLA 4WETA 5D96A 4OCFA 2LUSA 2LQQA 1QQ2A 1O85A 1B48A 2VD1A 3A2XA 2WGRA 3BBYA 2CQ9A 3LQ7A 3LGCA 2H1BA 3GKKA 4MJAA 5E4WA 2F3MA 1GP1A 2E2GA 16GSA 1JZDA 2IFQB 4MP4A 4EUYA 2VO4A 3DGQA 1FVJA 4HJ2A 1JHBA 1OE7A 3ZMLA 3ZYWA 4V1Ap 3QFAC 4WF4A 4IW9A 4P3YB 3EU4A 3CSHA 1ML6A 4XS4B 1YKAA 2JU5A 5B8BA 2DJ2A 4KCEA 4HDEA 1G6WA 4O32A 1AXDA 5J5NA 2LKUA 5HFIA 1ON4A 5DVBA 4L0UA 2FD3A 3MNGA 1SYXA 1XVWA 4ID0A 1GSFA 3VLNA 3HVXA 1TU8A 4WXTA 3QD9A 4N30A 4XS1A 4GCIA 4AJ6A 1XBSA 2LEGA 1AQWA 2LJKA 2HI7A 5J9BA 3IK9A 6GSUA 3UBKA 1PGTA 1OC3A 2ES7A 4NHWA 2FY6A 4HUAA 2OJLA 2X8GA 2KUCA 2FWGA 4MJCA 4EO3A 4K0GA 2LNTA 4MH2A 3FYGA 2DSAA 5A4VA 1VF1A 2KHPA 5J3RA 2JSYA 2H0GA 1N8JA 3PGTA 4O92A 3VURA 1GUKA 3F6DA 2A2RA 2LQOA 2LV3A 3FY7A 2LS5A 1ZGNA 2B1KA 4FYUA 4WR5A 4HI7A 1BYEA 1K0CA 2GGTA 3HXSA 2C0FA 1MEKA 4IELA 2H70A 2CV4A 2LTKA 2L5LA 3GUSA 3WT2A 4IP1A 3RPNA 2L4QA 4KSOA 3C7MA 5ECHB 5A5KA 1BAYA 4K9ZA 3QAGA 4ZIJA 3W8JA 1YF0A 3GRXA 3IHQA 2NDOA 3I43A 3VI7A 5ECKB 1XPVA 1E2YA 4PXOA 3VWUA 1G7EA 20GSA 4GWRA 4PQ1A 3KCMA 5JCUA 1MD4A 3R2QA 3GH6A 4Q5FA 3HKRA 4L5OA 2O7KA 1Z9HA 2GDRA 3GHAA 1A2LA 4J2FA 1TKDB 3KJYA 12GSA 3IBHA 2OACA 3GA4A 2CZ2A 3Q18A 1GLPA 2HZFA 1AQVA 3TRQA 2DJ0A 4ZL7A 1J9BA 3TDGA 4JEDA 4NPBA 2L4CA 2QC7A 5G5EA 1A2MA 4KA0A 2B5XA 3IAM2 3L9SA 1A0RP 3FR6A 5GZZB 1QMVA 2H0IA 4PX1A 4GSTA 3LXTA 3IV4A 3RHCA 2I3YA 2E2MA 3VWXA 3LEFA 2Z9SA 1U6TA 5ID2A 2HSYA 2VLUA 3UARA 5IPGA 3TKSC 3ZVJD 5H5RA 4QQ7A 1Q98A 4MDCA 5ABRA 1DBYA 4HEA2 1F6MC 2XBQA 1J0FA 2HLSA 1TXXA 4EXJA 2FGXA 2JSZA 1T8EB 1O81A 5D8IA 1AQXA 4BWSA 4TN8A 5G1LA 4GXZA 2H8LA 1TK8B 2C4JA 2H73A 1DE2A 2P31A 5IMAA 3LJRA 4ISDA 4JR4A 3WYWA 2X64A 3GN3A 1NHOA 4TR0A 4JE1A 3C1SA 2XC2A 3PR8A 4WR4A 4BWQA 4O7HA 1V58A 1SJIA 3PINA 2G0FA 2PBJA 2GZZA 2HRFA 2HT9A 1PKWA 3TB2A 3TRPA 3GH9A 2XBIA 2X99A 3APOA 3ZRDA 1JZOA 4LL1B 2R5GA 1V40A 2OKAA 5ID2B 3ISOA 5ECRB 1YY7A 1Z7RA 3W6GA 1O6JA 1HD2A 6GSXA 3LWAA 3GKXA 1XWAA 3F63A 4ZILA 1HNCA 9GSSA 4KSMA 4GQCA 1FO5A 2IL3A 5D93A 3ZZXA 4N0VA 1SK0A 1GSSA 2DIZA 3GSTA 2C3NA 3APSA 3UIWA 3DVWA 5IMFA 3DMLA 3RBTA 5DDLA 3FZ4A 5GAND 2V41A 1TI3A 1LJRA 2FHEA 3L9VA 3L78A 1KEBA 1F3AA 4MF5A 1NHYA 1OE8A 1S3DA 1TK0B 3G7IA 2AV4A 1T4YA 2G2QA 1SD8A 5G5FA 2A4VA 2C0EA 5ECOB 5HQPA 5INYA 1OC9A 3TGZA 1B4QA 1HQOA 1O8XA 2PMTA 2OADA 3ZREA 3F8UA 4PNFA 1BX9A 5ECPB 4G10A 1DE1A 1YDKA 3RHBA 3TJJA 4YH2A 2NVLA 1AIUA 4NWYA 1FAAA 1M7TA 2KP2A 2OA7A 4XHMA 4ML6A 1DUGA 4N10A 5B6MA 1GH2A 3EVIA 1WIKA 2EC4A 3QPMA 2CA8A 1M9BA 3GTUB 4ML1A 2VL3A 5G2ZA 4ZBDA 2WCIA 3W8SA 2EIOA 5KN0A 2YNXA 1J08A 2OBKA 3KGKA 1EGOA 3RPPA 4HU7A 2CVDA 3A5WA 3N5OA 4F2IA 2P5QA 5CO3A 2L6CA 3HJOA 1GNWA 1GSUA 1MDIA 2RUFA 4NMUA 4NV5A 3ZIJA 1Z5YE 2MMOA 5IOWA 3GL3A 4KDYA 1X9MB 1AC1A 3D5JA 5F07A 3TJGA 2R37A 4MZWA 1OC9B 2GSSA 1TRWA 1USBA 1SJ6A 3GYKA 3LYPA 2C8UA 4LMWA 3QCPA 3QFBC 4POBA 5JCGA 2DMMA 2QGVA 1X9WB 1ZYEA 4CDOA 1QXHA 4IJ3A 3GKNA 1T7PB 2IFQA 4RI6A 1T4ZA 4HU9A 5CAXA 2PN8A 4MZBA 1K0BA 1X5EA 1ZL9A 5HR0A 2DLXA 2JZTA 3U5RE 4O5RA 4MZCA 3P2AA 4ULXA 3DYRA 5IO0A 3KMOA 3TKSA 4Z7XA 1X9SB 2M46A 2VL2C 3IK7A 4GRFA 5AN1A 11GSA 4PQIA 4MABA 1EV4A 1ERUA 2IWTA 1SD9A 3UEMA 2FWEA 1GSQA 3HZ4A 4KX4A 4TRXA 1GNEA 4KDXA 2HXKA 2CX3A 4TR1A 3GX8A 3TUEA 5JWOB 5G30A 4KGIA 2O8VB 2WS2A 2E0QA 1H75A 2JZSA 3WT1A 5B8AA 1X5CA 1TDIA 7GSSA 4CW9A 5C04A 4PURA 2YJ7A 2P5RA 1PX7A 3TJFA 5HR3A 4IP6A 3FZAA 1EZKA 4NXIA 4LMVA 4KB3A 2RM5A 2GSQA 3CYNA 4LL4B 2HRNA 3C1RA 3WGXA 3P8WA 3H93A 1X0RA 3G7JA 5AIVA 2MZCA 2YPMA 3MSZA 1THOA 2F9SA 2IMFA 3L9UA 2ON5A 3GX0A 5DCGA 5HR1A 1Q4JA 4OCEA 1TRVA 3GL5A 4AJ8A 1OAZA 4GSNA 6GSYA 1R4WA 1SYRA 4JR6A 3EE2A 4ECJA 3FZ9A 2ZUPA 1T3BA 2GLRA 3TKSE 1VGLA 4MJBA 4EVMA 4I8BA 4MF7A 1PX6A 4CHSA 2VIMA 5DQSA 2VLTA 4TR1B 3VPTA 1SL1B 2VD0A 2B5EA 1M2AA 1WOUA 5G1KA 1GTBA 3E3EA 5JWRB 4IHUA 2CAIA 2RLIA 3M9JA 3N9JA 5FT3A 2WULA 4POLA 3DRNA 2HYXA 5DCHA 1SK1A 2VCWA 1RW1A 2LRCA 4QL9A 2K9FA 1ABAA 2WB9A 3RDWA 4FIWA 1HNBA 1XW9A 1O7UA 1RK4A 1F9MA 1CQHA 3GSSA 1EEJA 1EOHA 3MAKA 4YQMA 2JACA 2L5OA 4DSSA 1UVZA 4QL7A 1EP7A 5CNWA 22GSA 1GSYA 3L0HA 1TTZA 1EP8A 1WPIA 1MTCA 4NHZA 1A8LA 1GRXA 2LSTA 5IIZA 2CVKA 2H6ZA 4HQZA 1SJZA 5IQYA 2YP6A 4YAVA 5ELAA 3KXOA 1XXUA 3V1WA 1WP0A 2I1UA 5IMCA 1IYIA 3GMFA 3HZ8A 4ZXGA 1XWKA 2CX4A 5B6NA 2N5AA 3F6FA 3ERWA 2C0DA 4ZL8A 3I69A 2WDUA 4WBJA 3FR3A 1JFUA 2MBTA 4OMVA 3MWHA 3FK8A 1THXA 4EDZA 2XHFA 1K3YA 2I9HA 2VCZA 2XPDA 1YEPA 4NV2A 3M8NA 5CYYA 1X5DA 2GS3A 2M72A 4HZ2A 4DVCA 1GL8A 1GUMA 1MDJA 1XIYA 2L57A 2FLSA 2REMA 1AAZA 4DSSB 3D21A 1B4PA 4G9HA 4MF6A 3WD6A 2F51A 2X8CA 1B9XC 2LJAA 3EINA 5ELGA 1ERTA 1Z3EA 1QFNA 4F0BA 3EC3A 2KP1A 2YV9A 2VL2A 1H4OA 1S3AA 2MMAA 1SL0B 5GSSA 4PNGA 2VOCA 1KNGA 5KN1A 4F82A 2H74A 1N2AA 4PUFC 1WE0A 1CQGA 2M80A 6GSTA 4EDYA 2YANA 4OFNA 3IAS2 1EOGA 5LD0A 2RIIA 3Q19A 1TRSA 2N5BA 2PUKC 2DJKA 5DJLA 5FHIA 2FWFA 4GF0A 4ZB6A 4FH8A 3CTGA 1I5GA 2OE1A 2CT6A 4EC0A 18GSA 2D2ZA 1EGRA 1Z6NA 3D0ZA 2IMIA 2V32A 3VI5A 2VLVA 1XCCA 1PRXA 5ECQB 2IMKA 2B6MA 1FOVA 4JBBA 4EF0A 2OE3A 4L0WA 1M99A 3KH7A 3NOFA 2MMNA 2AYTA 1XOBA 3H79A 4EE0A 2B5YA 4IQ1A 1PSQA 4I6XA 5B7CA 2BJXA 5CRHA 4MJEA 1S3CA 3UAPA 4X1UA 5IMVA 2GSRA 2X8HA 1XZOA 4TXVA 1XVQA 4IKHA 3S9FA 5ECSA 4PGTA 4IQAA 5CRDA 1I9DA 1A0FA 2O85A 3QR6A 4MA9A 3LG6A 1HYUA 2PU9C 1A8YA 1NM3A 2V6OA 3GTUA 1EWXA 3FW2A 3O76A 1K0MA 1GWCA 1PN9A 2JADA 4YQUA 2YJHA 3H8QA 3VWWA 2QKEA 3O6TA 1A23A 2IMDA 1FB6A 2GT6A 4FYCA 4K6XA 4DSQA 4RI7A 5D9XA 3IC4A 3EWLA 5A4UA 6GSSA 2DC5A 4IGJA 2J9HA 1FW1A 1W4VA 3CRUA 1YZXA 4KNDA 3KZQA 4TR3A 5ECMB 3TJKA 3LORA 2GQLA 3APQA 5HFKA 3ZVJA 3TOUA 5KEJA 4WEYA 4DEJA 1K3OA 3L4NA 1XW5A 4EKZA 3ZLPA 4N0ZA 2FWHA 1JZRA 3Q6OA 2E7PA 2VUPA 3M0FA 5IMDA 2GSTA 1F2EA 3RAZA 2FNOA 2OBIA 4GQFA 2VAFA 1LU4A 1OC8A 2FCHA 4TR4A 4RUVA 5EPFA 2FA4A 2K8VA 3D4MA 2V1MA 2H66A 1V9WA 3CRTA 4V2NA 2ALBA 3LSZA 3GIXA 2IMEA 5ECNB 4ECIA 4ZBBA 3D6IA 2BMXA 3F3QA 3DWVA 1U3IA 3HVVA 4G19A 3Q74A 2PPTA 5DALA 3GNJA 4KAEA 2HFDA 5EVOA 1WJKA 1VF4A 4I97A 2H0HA 5CP1A 2YCDA 2LRTA 4K7IA 5JCWA 1SKWB 4G2EA 2VM1A 4X0XA 4OD7A 3F9UA 4F0CA 5D9VA 3KH9A 3US3A 5KN2A 1OVNA 2YN1A 3ME8A 1JZWA 4XIHA 3QAVA 3ME7A 1OKTA 3F4RA 2GTUA 1FB0A 2B1LA 5LNKe 4RQRA 4K8MA 1SENA 2VCTA 2IJYA 4OFMA 2PVOC 2TIRA 3LYKA 2R3XA 1OKDA 1PQNA 2K18A 4OO5A 1GLQA 2N5FA 4BVYA 2AB6A 3VPQA 2J23A 4OWYA 3KM6A 4LA1A 3IE3A 2FUG2 2H1GA 5H5QA 4D73A 1U3AA 5DBQA 3LFLA 3O3TA 3ZFBA 2H75A 4YAPA 4HZ4A 5DALB 3HCZA 1B8XA 3UBLA 2AAWA 5F0GA 4WBRD 3VWVA 3TJBA 2CAQA 4WF5A 4MPGA 5D73A 2RUEA 2HZEA 1SL2B 2XPEA 5IM9A 4HOJA 3ZITA 2PVQA 17GSA 4MPFA 4TOPA 3ZMKA 6GSVA 3EYTA 4I2TA 1PL1A 1XFLA 5ECIB 4KE3A 5EY6A 3HDCA 1VF3A 5CRWA 3KEBA 4FO5A 4AF2A 2VCQA 4BA7A 4ZBAA 1SK2A 2V6KA 2JL4A 1Z7PA 2YOIA 3IR4A 1Y25A 3TOTA 5A4WA 4HJMA 1NW2A 3P7XA 5JWQB 3SBCA 4F9ZA 2WJUA 4Q5RA 1K0NA 5AGYA 2VM2A 3C71A 2TRCP 3IDVA 4TKYA 3QOUA 2C3QA 3ERFA 1F3BA 3BJ5A 1T1VA 4H86A 1OYJA 1TJDA 1ZZYA 3BD2A 3CSIA 3K8NA 3KIJA 3NZNA 4D73B 1GTIA 3FRCA 3I9V2 1KTEA 1AW9A 3FHKA 2C3TA 1GSEA 1B9YC 3TKRA 2PERA 4PQHA 2K6VA 1XWGA 1URMA 2IN3A 19GSA 1PKZA 2HZEB 4ZB8A 2RM6A 4XRAA 5LCZA 4V1Ag 4ECCA 4IBPA 1O8WA 2YZUA 5J41A 4Q5QA 2CZ3A 1G0TA 2C1YA 2H19A 3HD5A 2P0GA 1UN2A 2WRTA 4JRRA 3TCOA 1M2BA 4EL1A 1XOAA 1UC7A 4GLTA 1SU9A 4F03A 1ILOA 1T00A 1K0AA 1PA3A 1K0OA 4MMMA 3J7Yk 4ECBA 3ERGA 4E8HA 5C00A 5AISA 1YF1A 1MDKA 2R4VA 1ERVA 1GTUA 4TW5A 3GKMA 4J57E 3IPZA 1VF2A 3EMPA 4GSSA 4HS1A 3FR9A 3UOMA 2LNSA 1ZCPA 2YWNA 5DJMA 1DSBA 3UVHA 3H4KA 1TU7A 5CREA 3BOAA 3CMIA 3ZTLA 2GVPA 4JZQA 4DSRA 4WKWA 1BG5A 4XTSA 2YWIA 3M3MA 3C73A 4K7OA 4V2MA 3FKFA 2K8SA 2B7KA 1TI1A 5IOXA 3UVTA 4IVFA 2H76A 4IN0A 1TK5B 4K2DA 3LXZA 3VFIA 2EIRA 3JCML 2JZRA 1YJ6A 5HFGA 3U6VA 3HVSA 3HY2A 2VL9A 1V2AA 4K7NA 5J9CA 1SKSB 4XCSA 4IJIA 3DIEA 2B3SA 3UMAA 4KH7A 3AY8A 3F3RA 5F05A 5CRGA 1U88A 4MK3A 1JLVA 2QSIA 1Y6EA 1XWBA 2AHEA 3UJ1A 3KTLA 2MBSA 1F37A 1PL2A 3HJMA 1HNAA 4PUAA 1TW9A 1A24A 1AUCA 5IO2A 3OR5A 4L8EA 2BTOT 1ACVA 1W89A 1EEMA 3WGDA 1ZYQB 3I6AA 2I81A 3J7Yb 4L5LA 4ZL9A 2CVBA 3GURA 5DQYA 3DD3A 1M9AA 2LJRA 4ACSA 3A2VA 2DJJA 5F06A 3HA9A 4JU5A 2VCVA 3D22A 1U87A 2WFCA 2NTOA 2MMZA 3IOSA 2I4AA 4XS6A 1BQ7A 2IIYA 5ECLB 8GSSA 1YQ1A 1VRSD 2GQMA 2O89A 4XRDA 1GTAA 3E9JB 3EU3A 3EMXA 3IA1A 1R5AA 5H5SA 4KW6A 1NSWA 2HNLA 3CSJA 2R6KA 3IRAA 4KCAA 1EV9A 2H1DA 2H72A 14GSA 4MCUA 2NPBA 3BCKA 1E6BA 2AUVA 2H6YA 4K0NA 2GZPA 2DBCA 1PD21 4OO4A 1GULA 4J56E 4IS0A 3WGEA 1V57A 2F8FA 5FWGA 2DIYA 1RQMA 1WRYA 2H6XA 3FEUA 3F4SA 4KUNA 3CTFA 4ZB9A 3ZIVA 3ZL5A 4FYBA 3A3TA 2KLXA 2OE0A 4I5QA 1K0DA 2FA8A 1R5PA 2HE3A 3DEXA 1MD3A 4BVXA 4MH3A 2V2GA 3MDKA 2NBSA 2B7JA 5G31A 2R2JA 2VCXA 1FHEA 2F8AA 3G7YA 1WWJA 5F8BA 4Q5NA 1BJXA 5IPHA 4E8EA 2EIQA 5COHA 4NAXA 3FZ5A 4POKA 1WMJA 3ZFLA 3UL3A 2LRNA 2YWOA 1K3LA 3DXBA 3QMXA 5D9WA 1FVKA 2PGTA 1SKRB 5J4UA 2H1AA 3KP9A 1TRUA 2C80A 3KP8A 2ZCTA 2A2SA 2PWJA 4MLYA 2HSHA 3D4TA 1GSDA 3GFKA 3KTBA 2O87A 3NIVA 4OFTA 4GTUA 1QK8A 10GSA 3CBUA 2YWMA 2GQKA 2DJ3A 1V98A 3F0IA
chains in the Genus database with same CATH superfamily
4AJ7A 5BMUA 2GT5A 3E0UA 1R26A 3P90A 5GAPD 3FMWA 4LLRA 3C8EA 5KN3A 4X43A 1QUWA 3TRXA 5ENUA 3VK9A 3TKQA 4BVXB 2ZNMA 4V2LA 1TP9A 5IMZA 2H30A 1JLWA 4TXOA 5E59A 5GSTA 2ON7A 3TKPA 4BPYA 3ED3A 4USSA 1XWCA 4I2UA 2H71A 2YZHA 3CXGA 5DAKA 4AGSA 3EURA 3GV1A 2GZYA 3DVXA 1PMTA 4RQXA 1KBNA 2L6DA 4ILFA 1UA5A 1Z6MA 3QDNA 1G6YA 3IXRA 1BEDA 5D9TA 4N11A 1G7OA 3SWLA 3DKSA 2TRXA 3H1NA 3KMNA 1O73A 5AIXA 3BCIA 2DJ1A 1QGVA 1ERWA 3MYDA 2KOKA 1C72A 4YQVA 3QAWA 1XW6A 1ST9A 13GSA 3HHVA 1M0UA 1YEXA 2IPAA 1ZOFA 4KDUA 2AJQB 1TOFA 2L59A 2MYGA 1R7HA 2C0GA 3KD0A 1A2JA 2HRAA 4XS4A 2YV7A 3A2WA 1GUHA 4TVEA 3HJPA 4BL7A 1LBKA 3HYPA 5L71A 1ZMAA 1M2DA 2WZ9A 5EL8A 3M1GA 3G9BA 1FG4A 1YKCA 4TXOB 4K1FA 6GSWA 2H01A 3PH9A 5HR2A 1IYHA 4HQSA 3F4TA 4POMA 5DAKB 3M9KA 2DKIA 2DMLA 4WETA 5D96A 4OCFA 2LUSA 2LQQA 1QQ2A 3HVNA 1O85A 1B48A 2VD1A 3A2XA 2WGRA 3BBYA 2CQ9A 3LQ7A 3LGCA 2H1BA 3GKKA 4MJAA 5E4WA 2F3MA 1GP1A 2E2GA 16GSA 1JZDA 2IFQB 4MP4A 4EUYA 2VO4A 3DGQA 1S3RA 1FVJA 4HJ2A 1JHBA 1OE7A 3ZMLA 3ZYWA 4V1Ap 4K5RA 3QFAC 4WF4A 4IW9A 4P3YB 3EU4A 3CSHA 1ML6A 4XS4B 1YKAA 2JU5A 5B8BA 2DJ2A 4KCEA 4HDEA 3R3EA 1G6WA 4O32A 4BL7B 1AXDA 5J5NA 2LKUA 5HFIA 4BIKA 1ON4A 5DVBA 4L0UA 2FD3A 3MNGA 1SYXA 1XVWA 4ID0A 1GSFA 3VLNA 3HVXA 1TU8A 4WXTA 3QD9A 4N30A 4XS1A 4GCIA 4AJ6A 1XBSA 2LEGA 1AQWA 2LJKA 2HI7A 5J9BA 3IK9A 6GSUA 3UBKA 1PGTA 1OC3A 2ES7A 4NHWA 2FY6A 4HUAA 2OJLA 2X8GA 2KUCA 2FWGA 4MJCA 4EO3A 4K0GA 2LNTA 3A5IA 4MH2A 3FYGA 2DSAA 5A4VA 1VF1A 2KHPA 5J3RA 2JSYA 2H0GA 1N8JA 3PGTA 2QA2A 4O92A 3VURA 1GUKA 3F6DA 2A2RA 2LQOA 2LV3A 3FY7A 2LS5A 1ZGNA 2B1KA 4FYUA 4WR5A 4HI7A 1BYEA 1K0CA 2GGTA 3HXSA 2C0FA 1MEKA 4IELA 2H70A 2CV4A 2LTKA 2L5LA 3GUSA 3WT2A 4IP1A 3RPNA 2L4QA 4KSOA 3C7MA 5ECHB 5A5KA 1BAYA 4K9ZA 3QAGA 4ZIJA 3W8JA 1YF0A 3GRXA 3IHQA 2NDOA 3I43A 3VI7A 5ECKB 1XPVA 1E2YA 4PXOA 3VWUA 1G7EA 20GSA 4GWRA 4PQ1A 3KCMA 5JCUA 1MD4A 3R2QA 3GH6A 4Q5FA 3HKRA 4L5OA 2O7KA 1Z9HA 2GDRA 3GHAA 1A2LA 4J2FA 1TKDB 3KJYA 12GSA 3IBHA 2OACA 3GA4A 2CZ2A 3Q18A 1GLPA 2HZFA 1AQVA 3TRQA 2DJ0A 4ZL7A 1J9BA 3TDGA 4JEDA 4NPBA 2L4CA 2QC7A 5G5EA 1A2MA 4KA0A 2B5XA 3IAM2 3L9SA 1A0RP 3FR6A 4HSCX 5GZZB 1QMVA 2H0IA 4PX1A 4GSTA 3LXTA 3IV4A 3RHCA 2I3YA 2E2MA 3VWXA 3LEFA 2Z9SA 1U6TA 5ID2A 2HSYA 2VLUA 3UARA 5IPGA 3TKSC 3ZVJD 5H5RA 4QQ7A 1Q98A 4MDCA 5ABRA 1DBYA 4HEA2 1F6MC 2XBQA 1J0FA 2HLSA 1TXXA 4EXJA 2FGXA 2JSZA 1T8EB 1O81A 5D8IA 1AQXA 4BWSA 4TN8A 5G1LA 4GXZA 2H8LA 1TK8B 2C4JA 2H73A 1DE2A 2P31A 5IMAA 3LJRA 4ISDA 4JR4A 3WYWA 2X64A 3GN3A 1NHOA 4G0KA 4TR0A 4JE1A 3C1SA 2XC2A 3PR8A 4WR4A 4BWQA 4O7HA 1V58A 1SJIA 3PINA 2G0FA 2PBJA 2GZZA 2HRFA 2HT9A 1PKWA 3TB2A 3TRPA 3GH9A 2XBIA 2X99A 3APOA 3ZRDA 1JZOA 4LL1B 2R5GA 1V40A 2OKAA 5ID2B 3ISOA 5ECRB 1YY7A 1Z7RA 3W6GA 1O6JA 1HD2A 6GSXA 3LWAA 3GKXA 1XWAA 3F63A 4ZILA 1XG8A 1HNCA 9GSSA 4KSMA 4GQCA 1FO5A 2IL3A 5D93A 3ZZXA 4N0VA 2X4AA 1SK0A 1GSSA 2DIZA 3GSTA 2C3NA 3APSA 3UIWA 3DVWA 5IMFA 3DMLA 3RBTA 5DDLA 3FZ4A 5GAND 2V41A 1TI3A 1LJRA 2FHEA 3L9VA 3L78A 1KEBA 1F3AA 4MF5A 1NHYA 1OE8A 1S3DA 1TK0B 3G7IA 2AV4A 1T4YA 2G2QA 1SD8A 5G5FA 2A4VA 2C0EA 5ECOB 5HQPA 5INYA 1OC9A 3TGZA 1B4QA 1HQOA 1O8XA 2PMTA 2OADA 4Z2RA 3ZREA 3F8UA 4PNFA 1BX9A 5ECPB 4G10A 1DE1A 1YDKA 3RHBA 3TJJA 4YH2A 2NVLA 4X4JA 1AIUA 4NWYA 1FAAA 1M7TA 2KP2A 2OA7A 4Z2UA 4XHMA 4ML6A 1DUGA 4N10A 5B6MA 1GH2A 3EVIA 1WIKA 2EC4A 3QPMA 2CA8A 1M9BA 3GTUB 4ML1A 2VL3A 5G2ZA 4ZBDA 2WCIA 3W8SA 2EIOA 5KN0A 2YNXA 1J08A 2OBKA 3KGKA 1EGOA 3RPPA 4HU7A 2CVDA 3A5WA 3N5OA 4F2IA 2P5QA 5CO3A 2L6CA 3HJOA 1GNWA 1GSUA 1MDIA 2RUFA 4NMUA 4NV5A 3ZIJA 1Z5YE 2MMOA 5IOWA 3GL3A 4KDYA 1X9MB 1AC1A 3D5JA 5F07A 3TJGA 1FOHA 2R37A 4MZWA 1OC9B 2GSSA 1TRWA 1USBA 1SJ6A 3GYKA 3LYPA 2C8UA 4LMWA 3QCPA 3QFBC 4POBA 5JCGA 2DMMA 2QGVA 1X9WB 1ZYEA 4CDOA 1QXHA 4IJ3A 3GKNA 1T7PB 2IFQA 4RI6A 1T4ZA 4HU9A 5CAXA 2PN8A 4MZBA 1K0BA 1X5EA 1ZL9A 5HR0A 2DLXA 2JZTA 3U5RE 4O5RA 4MZCA 3P2AA 4ULXA 3DYRA 5IO0A 3KMOA 3TKSA 4Z7XA 1X9SB 2M46A 2VL2C 3IK7A 4GRFA 5AN1A 11GSA 4PQIA 4MABA 1EV4A 1ERUA 2IWTA 1SD9A 3UEMA 2FWEA 1GSQA 3HZ4A 4KX4A 4TRXA 1GNEA 4KDXA 2HXKA 2CX3A 4TR1A 3GX8A 3TUEA 5JWOB 5G30A 4KGIA 2O8VB 2WS2A 2E0QA 1H75A 2JZSA 3WT1A 5B8AA 1X5CA 1TDIA 7GSSA 4CW9A 4CY6A 5C04A 4PURA 2YJ7A 2P5RA 1PX7A 3TJFA 5HR3A 4IP6A 3FZAA 1EZKA 4NXIA 4LMVA 4KB3A 2RM5A 2GSQA 3CYNA 4LL4B 2HRNA 3C1RA 3WGXA 3P8WA 3H93A 1X0RA 4K5SA 3G7JA 5AIVA 2MZCA 2YPMA 3MSZA 4BVYB 1THOA 2F9SA 2IMFA 3L9UA 2ON5A 3GX0A 5DCGA 5HR1A 1Q4JA 4OCEA 1TRVA 3GL5A 4AJ8A 1OAZA 4GSNA 6GSYA 1R4WA 1SYRA 4JR6A 3EE2A 4ECJA 3FZ9A 2ZUPA 1T3BA 2GLRA 3TKSE 1VGLA 4MJBA 4EVMA 4I8BA 4MF7A 1PX6A 4CHSA 2VIMA 5DQSA 2VLTA 4TR1B 3VPTA 1SL1B 2VD0A 2B5EA 1M2AA 1WOUA 5G1KA 1GTBA 3E3EA 5JWRB 4IHUA 2CAIA 2RLIA 3M9JA 3N9JA 5FT3A 2WULA 4POLA 4KF9A 4YKGA 3DRNA 2HYXA 5DCHA 1SK1A 2VCWA 1RW1A 2LRCA 4QL9A 2K9FA 1ABAA 2WB9A 3RDWA 4FIWA 1HNBA 1XW9A 1O7UA 1RK4A 1F9MA 1CQHA 3GSSA 1EEJA 1EOHA 3MAKA 4YQMA 2JACA 2L5OA 4DSSA 2UZ8A 1UVZA 4QL7A 1EP7A 5CNWA 22GSA 1GSYA 3L0HA 2HSMA 1TTZA 1EP8A 1WPIA 1MTCA 4NHZA 1A8LA 4EIPA 2LSTA 5IIZA 1GRXA 2CVKA 2H6ZA 4HQZA 1SJZA 5IQYA 2YP6A 4YAVA 5ELAA 3KXOA 1XXUA 3V1WA 1WP0A 2I1UA 5IMCA 1IYIA 3GMFA 3HZ8A 4ZXGA 1XWKA 2CX4A 5B6NA 2N5AA 3F6FA 3ERWA 2C0DA 2X49A 4ZL8A 3I69A 2WDUA 4WBJA 3FR3A 1JFUA 2MBTA 4OMVA 3MWHA 3FK8A 1THXA 3CQFA 2XHFA 4EDZA 1K3YA 2I9HA 2VCZA 2XPDA 1YEPA 4NV2A 4FQUA 3M8NA 1X5DA 2GS3A 5CYYA 2M72A 4HZ2A 4DVCA 1GL8A 1GUMA 1MDJA 1XIYA 2L57A 2FLSA 2REMA 1AAZA 4DSSB 3D21A 1B4PA 4G9HA 4MF6A 3WD6A 2F51A 2X8CA 1B9XC 2LJAA 3EINA 5ELGA 1ERTA 1Z3EA 1QFNA 4F0BA 3EC3A 2KP1A 2YV9A 2VL2A 1H4OA 1S3AA 2MMAA 1SL0B 5GSSA 4PNGA 2VOCA 1KNGA 5KN1A 4F82A 2H74A 1N2AA 4PUFC 1WE0A 1CQGA 2M80A 6GSTA 4EIQA 4EDYA 2YANA 1ZYPA 4OFNA 3IAS2 1EOGA 5LD0A 2RIIA 3IC8A 3Q19A 1TRSA 2N5BA 2PUKC 2DJKA 5DJLA 5FHIA 2FWFA 4GF0A 5BRTA 4ZB6A 4FH8A 3CTGA 1I5GA 2OE1A 2CT6A 3IHGA 4EC0A 18GSA 2D2ZA 1EGRA 1Z6NA 3D0ZA 2IMIA 2V32A 3VI5A 2VLVA 1XCCA 1PRXA 5ECQB 2IMKA 2B6MA 1FOVA 4JBBA 4EF0A 2OE3A 4L0WA 1M99A 3KH7A 3NOFA 2MMNA 2AYTA 1XOBA 3H79A 2R0PA 4EE0A 2B5YA 4IQ1A 1PSQA 4I6XA 5B7CA 2BJXA 5CRHA 4MJEA 1S3CA 3UAPA 4X1UA 5IMVA 2GSRA 2X8HA 1XZOA 4TXVA 1XVQA 4IKHA 3S9FA 5ECSA 4PGTA 2R0CA 4IQAA 5CRDA 1I9DA 1A0FA 2O85A 3QR6A 4MA9A 3LG6A 1HYUA 2PU9C 1A8YA 3EPTA 1NM3A 2V6OA 5KOXA 3GTUA 1EWXA 3FW2A 3O76A 1K0MA 1GWCA 1PN9A 2JADA 4YQUA 2A4HA 2YJHA 3H8QA 1M3IA 3VWWA 2QKEA 3O6TA 2QA1A 1A23A 2IMDA 1FB6A 2GT6A 4FYCA 4K6XA 4DSQA 4RI7A 5D9XA 3IC4A 3EWLA 5A4UA 6GSSA 2DC5A 4IGJA 2J9HA 1FW1A 1W4VA 3CRUA 1YZXA 4KNDA 3KZQA 4TR3A 5ECMB 3TJKA 3LORA 2GQLA 3APQA 5HFKA 3ZVJA 3TOUA 5KEJA 4WEYA 4DEJA 1K3OA 3L4NA 1XW5A 4EKZA 3ZLPA 4N0ZA 2FWHA 1JZRA 3Q6OA 2E7PA 2VUPA 3M0FA 5IMDA 2GSTA 1F2EA 3RAZA 2FNOA 2OBIA 4GQFA 2VAFA 1LU4A 1OC8A 2FCHA 4TR4A 4RUVA 5EPFA 2FA4A 2K8VA 3D4MA 2V1MA 2H66A 1V9WA 3CRTA 4V2NA 2ALBA 3LSZA 3GIXA 2IMEA 5ECNB 4ECIA 4ZBBA 3D6IA 2BMXA 3F3QA 4YKFA 3DWVA 1U3IA 3HVVA 4CY8A 4G19A 3Q74A 2PPTA 5DALA 3GNJA 4KAEA 2HFDA 5EVOA 1WJKA 1VF4A 4I97A 2H0HA 5CP1A 2YCDA 2LRTA 4K7IA 5JCWA 1SKWB 4G2EA 2VM1A 4X0XA 4OD7A 3F9UA 4F0CA 2R0GA 5D9VA 4O5UA 3KH9A 3US3A 5KN2A 1OVNA 2YN1A 3ME8A 1JZWA 4XIHA 3QAVA 3ME7A 1OKTA 3F4RA 2GTUA 1FB0A 4Z2TA 2B1LA 5LNKe 4RQRA 4K8MA 1SENA 2VCTA 2IJYA 4OFMA 2PVOC 2TIRA 3LYKA 2R3XA 1OKDA 1PQNA 2K18A 4OO5A 1GLQA 2N5FA 4BVYA 2AB6A 3VPQA 2J23A 4OWYA 4K2XA 3KM6A 4LA1A 1M3JA 3IE3A 2FUG2 2H1GA 5H5QA 4D73A 1U3AA 5DBQA 3LFLA 3O3TA 3ZFBA 2H75A 4PTSA 1PN0A 4YAPA 4HZ4A 5DALB 3HCZA 1B8XA 3UBLA 2AAWA 5F0GA 4WBRD 3VWVA 3TJBA 2CAQA 4WF5A 4MPGA 5D73A 2RUEA 2HZEA 1SL2B 2XPEA 5IM9A 2DKHA 4HOJA 3ZITA 2PVQA 17GSA 4MPFA 4TOPA 3ZMKA 6GSVA 3EYTA 3PPUA 4I2TA 1PL1A 1XFLA 5ECIB 4KE3A 4ICYA 5EY6A 3HDCA 1VF3A 5CRWA 3KEBA 4FO5A 4AF2A 2VCQA 4BA7A 4ZBAA 1SK2A 2V6KA 2JL4A 1Z7PA 2YOIA 3IR4A 1Y25A 3TOTA 5A4WA 4HJMA 1NW2A 3P7XA 5JWQB 3SBCA 4F9ZA 2WJUA 4Q5RA 1K0NA 5AGYA 2VM2A 3C71A 2TRCP 3IDVA 4TKYA 3QOUA 2C3QA 3ERFA 1F3BA 3BJ5A 1T1VA 4H86A 1OYJA 1TJDA 1ZZYA 3BD2A 3CSIA 3K8NA 3KIJA 3NZNA 4D73B 1GTIA 3FRCA 3I9V2 1KTEA 1AW9A 3FHKA 2C3TA 1GSEA 1B9YC 3TKRA 2PERA 4PQHA 2K6VA 1XWGA 1URMA 2IN3A 19GSA 1PKZA 2HZEB 4ZB8A 2RM6A 4XRAA 5LCZA 4V1Ag 4ECCA 3MIXA 4IBPA 1O8WA 2YZUA 5J41A 4Q5QA 2CZ3A 1G0TA 2C1YA 2H19A 3HD5A 2P0GA 1UN2A 2WRTA 4JRRA 3TCOA 1M2BA 4EL1A 1XOAA 1UC7A 4GLTA 1SU9A 4F03A 1ILOA 1T00A 1K0AA 1PA3A 1K0OA 4MMMA 3J7Yk 4ECBA 3ERGA 4E8HA 5C00A 5AISA 1YF1A 1MDKA 2R4VA 1ERVA 1GTUA 4TW5A 3LW9A 3GKMA 4J57E 3IPZA 1VF2A 3EMPA 4GSSA 4HS1A 3FR9A 3UOMA 2LNSA 1ZCPA 2YWNA 5DJMA 1DSBA 3UVHA 3H4KA 1TU7A 5CREA 3BOAA 3CMIA 3ZTLA 2GVPA 4JZQA 4DSRA 4WKWA 1BG5A 4XTSA 2YWIA 3M3MA 3C73A 4K7OA 4V2MA 3FKFA 2K8SA 2B7KA 1TI1A 5IOXA 3UVTA 4IVFA 2H76A 4IN0A 1TK5B 4K2DA 3LXZA 3VFIA 4O5QA 2EIRA 3JCML 2JZRA 1YJ6A 5HFGA 3U6VA 3HVSA 3HY2A 2HRKA 2VL9A 1V2AA 4K7NA 5J9CA 1SKSB 4XCSA 4IJIA 3DIEA 2B3SA 3UMAA 4KH7A 3AY8A 3F3RA 5CRGA 5F05A 1U88A 4MK3A 1JLVA 2QSIA 1Y6EA 1XWBA 2AHEA 3UJ1A 3KTLA 2MBSA 1F37A 1PL2A 3HJMA 1HNAA 4PUAA 1TW9A 1A24A 1AUCA 5IO2A 3OR5A 4L8EA 2BTOT 1ACVA 1W89A 4G0IA 1EEMA 2A2PA 3WGDA 1ZYQB 3I6AA 2I81A 3J7Yb 4L5LA 4ZL9A 4A5PA 2CVBA 3GURA 5DQYA 3DD3A 1M9AA 2LJRA 4ACSA 3A2VA 2DJJA 5F06A 3HA9A 4JU5A 2VCVA 3D22A 1U87A 2WFCA 2NTOA 2MMZA 3IOSA 2I4AA 4XS6A 1BQ7A 2IIYA 5ECLB 8GSSA 1YQ1A 1PFOA 1VRSD 2GQMA 2O89A 4XRDA 1GTAA 3E9JB 3EU3A 3EMXA 3IA1A 4G0LA 1R5AA 5H5SA 4KW6A 1NSWA 2HNLA 3CSJA 2R6KA 3IRAA 4KCAA 1EV9A 2H1DA 2H72A 14GSA 4MCUA 2NPBA 3BCKA 1E6BA 2AUVA 2H6YA 4K0NA 2GZPA 2DBCA 1PD21 4OO4A 1GULA 4J56E 4IS0A 3WGEA 1V57A 2F8FA 5FWGA 2DIYA 1RQMA 1WRYA 2H6XA 3FEUA 3F4SA 1ZYNA 4KUNA 3CTFA 4ZB9A 3ZIVA 3ZL5A 4FYBA 3A3TA 2KLXA 2OE0A 4I5QA 1K0DA 2FA8A 1R5PA 2HE3A 3DEXA 1MD3A 4BVXA 4MH3A 2V2GA 3MDKA 2NBSA 2B7JA 5G31A 2R2JA 2VCXA 1FHEA 2F8AA 3G7YA 1WWJA 5F8BA 4Q5NA 1BJXA 5IPHA 4E8EA 2EIQA 5COHA 4NAXA 3FZ5A 4POKA 1WMJA 3ZFLA 3UL3A 2LRNA 4MNNA 2YWOA 1K3LA 3DXBA 3QMXA 5D9WA 1FVKA 2PGTA 1SKRB 5J4UA 2H1AA 3KP9A 1TRUA 2C80A 3KP8A 2ZCTA 2A2SA 2PWJA 4MLYA 2HSHA 3D4TA 1GSDA 3GFKA 3KTBA 2O87A 3NIVA 4OFTA 4GTUA 1QK8A 10GSA 3CBUA 2YWMA 5KOWA 2GQKA 2DJ3A 1V98A 3F0IA
chains in the Genus database with same CATH topology
4AJ7A 5BMUA 2GT5A 3E0UA 1R26A 3P90A 5GAPD 3FMWA 4LLRA 3C8EA 5KN3A 4X43A 1QUWA 3TRXA 5ENUA 3VK9A 3TKQA 4BVXB 2ZNMA 4V2LA 1TP9A 5IMZA 2H30A 1JLWA 4TXOA 5E59A 5GSTA 2ON7A 3TKPA 4BPYA 3ED3A 4USSA 1XWCA 4I2UA 2H71A 2YZHA 3CXGA 5DAKA 4AGSA 3EURA 3GV1A 2GZYA 3DVXA 1PMTA 4RQXA 1KBNA 2L6DA 4ILFA 1UA5A 1Z6MA 3QDNA 1G6YA 3IXRA 1BEDA 5D9TA 4N11A 1G7OA 3SWLA 3DKSA 2TRXA 3H1NA 3KMNA 1O73A 5AIXA 3BCIA 2DJ1A 1QGVA 1ERWA 3MYDA 2KOKA 1C72A 4YQVA 3QAWA 1XW6A 1ST9A 13GSA 3HHVA 1M0UA 1YEXA 2IPAA 1ZOFA 4KDUA 2AJQB 1TOFA 2L59A 2MYGA 1R7HA 2C0GA 3KD0A 1A2JA 2HRAA 4XS4A 2YV7A 3A2WA 1GUHA 4TVEA 3HJPA 4BL7A 1LBKA 3HYPA 5L71A 1ZMAA 1M2DA 2WZ9A 5EL8A 3M1GA 3G9BA 1FG4A 1YKCA 4TXOB 4K1FA 6GSWA 2H01A 3PH9A 5HR2A 1IYHA 4HQSA 3F4TA 4POMA 5DAKB 3M9KA 2DKIA 2DMLA 4WETA 5D96A 4OCFA 2LUSA 2LQQA 1QQ2A 1O85A 1B48A 2VD1A 3A2XA 2WGRA 3BBYA 2CQ9A 3LQ7A 3LGCA 2H1BA 3GKKA 4MJAA 5E4WA 2F3MA 1GP1A 2E2GA 16GSA 1JZDA 2IFQB 4MP4A 4EUYA 2VO4A 3DGQA 1FVJA 4HJ2A 1JHBA 1OE7A 3ZMLA 3ZYWA 4V1Ap 4K5RA 3QFAC 4WF4A 4IW9A 4P3YB 3EU4A 3CSHA 1ML6A 4XS4B 1YKAA 2JU5A 5B8BA 2DJ2A 4KCEA 4HDEA 3R3EA 1G6WA 4O32A 4BL7B 1AXDA 5J5NA 2LKUA 5HFIA 1ON4A 5DVBA 4L0UA 2FD3A 3MNGA 1SYXA 1XVWA 4ID0A 1GSFA 3VLNA 3HVXA 1TU8A 4WXTA 3QD9A 4N30A 4XS1A 4GCIA 4AJ6A 1XBSA 2LEGA 1AQWA 2LJKA 2HI7A 5J9BA 3IK9A 6GSUA 3UBKA 1PGTA 1OC3A 2ES7A 4NHWA 2FY6A 4HUAA 2OJLA 2X8GA 2KUCA 2FWGA 4MJCA 4EO3A 4K0GA 2LNTA 3A5IA 4MH2A 3FYGA 2DSAA 5A4VA 1VF1A 2KHPA 5J3RA 2JSYA 2H0GA 1N8JA 3PGTA 2QA2A 4O92A 3VURA 1GUKA 3F6DA 2A2RA 2LQOA 2LV3A 3FY7A 2LS5A 1ZGNA 2B1KA 4FYUA 4WR5A 4HI7A 1BYEA 1K0CA 2GGTA 3HXSA 2C0FA 1MEKA 4IELA 2H70A 2CV4A 2LTKA 2L5LA 3GUSA 3WT2A 4IP1A 3RPNA 2L4QA 4KSOA 3C7MA 5ECHB 5A5KA 1BAYA 4K9ZA 3QAGA 4ZIJA 3W8JA 1YF0A 3GRXA 3IHQA 2NDOA 3I43A 3VI7A 5ECKB 1XPVA 1E2YA 4PXOA 3VWUA 1G7EA 20GSA 4GWRA 4PQ1A 3KCMA 5JCUA 1MD4A 3R2QA 3GH6A 4Q5FA 3HKRA 4L5OA 2O7KA 1Z9HA 2GDRA 3GHAA 1A2LA 4J2FA 1TKDB 3KJYA 12GSA 3IBHA 2OACA 3GA4A 2CZ2A 3Q18A 1GLPA 2HZFA 1AQVA 3TRQA 2DJ0A 4ZL7A 1J9BA 3TDGA 4JEDA 4NPBA 2L4CA 2QC7A 5G5EA 1A2MA 4KA0A 2B5XA 3IAM2 3L9SA 1A0RP 3FR6A 5GZZB 1QMVA 2H0IA 4PX1A 4GSTA 3LXTA 3IV4A 3RHCA 2I3YA 2E2MA 3VWXA 3LEFA 2Z9SA 1U6TA 5ID2A 2HSYA 2VLUA 3UARA 5IPGA 3TKSC 3ZVJD 5H5RA 4QQ7A 1Q98A 4MDCA 5ABRA 1DBYA 4HEA2 1F6MC 2XBQA 1J0FA 2HLSA 1TXXA 4EXJA 2FGXA 2JSZA 1T8EB 1O81A 5D8IA 1AQXA 4BWSA 4TN8A 5G1LA 4GXZA 2H8LA 1TK8B 2C4JA 2H73A 1DE2A 2P31A 5IMAA 3LJRA 4ISDA 4JR4A 3WYWA 2X64A 3GN3A 1NHOA 4G0KA 4TR0A 4JE1A 3C1SA 2XC2A 3PR8A 4WR4A 4BWQA 4O7HA 1V58A 1SJIA 3PINA 2G0FA 2PBJA 2GZZA 2HRFA 2HT9A 1PKWA 3TB2A 3TRPA 3GH9A 2XBIA 2X99A 3APOA 3ZRDA 1JZOA 4LL1B 2R5GA 1V40A 2OKAA 5ID2B 3ISOA 5ECRB 1YY7A 1Z7RA 3W6GA 1O6JA 1HD2A 6GSXA 3LWAA 3GKXA 1XWAA 3F63A 4ZILA 1HNCA 9GSSA 4KSMA 4GQCA 1FO5A 2IL3A 5D93A 3ZZXA 4N0VA 2X4AA 1SK0A 1GSSA 2DIZA 3GSTA 2C3NA 3APSA 3UIWA 3DVWA 5IMFA 3DMLA 3RBTA 5DDLA 3FZ4A 5GAND 2V41A 1TI3A 1LJRA 2FHEA 3L9VA 3L78A 1KEBA 1F3AA 4MF5A 1NHYA 1OE8A 1S3DA 1TK0B 3G7IA 2AV4A 1T4YA 2G2QA 1SD8A 5G5FA 2A4VA 2C0EA 5ECOB 5HQPA 5INYA 1OC9A 3TGZA 1B4QA 1HQOA 1O8XA 2PMTA 2OADA 4Z2RA 3ZREA 3F8UA 4PNFA 1BX9A 5ECPB 4G10A 1DE1A 1YDKA 3RHBA 3TJJA 4YH2A 2NVLA 4X4JA 1AIUA 4NWYA 1FAAA 1M7TA 2KP2A 2OA7A 4Z2UA 4XHMA 4ML6A 1DUGA 4N10A 5B6MA 1GH2A 3EVIA 1WIKA 2EC4A 3QPMA 2CA8A 1M9BA 3GTUB 4ML1A 2VL3A 5G2ZA 4ZBDA 2WCIA 3W8SA 2EIOA 5KN0A 2YNXA 1J08A 2OBKA 3KGKA 1EGOA 3RPPA 4HU7A 2CVDA 3A5WA 3N5OA 4F2IA 2P5QA 5CO3A 2L6CA 3HJOA 1GNWA 1GSUA 1MDIA 2RUFA 4NMUA 4NV5A 3ZIJA 1Z5YE 2MMOA 5IOWA 3GL3A 4KDYA 1X9MB 1AC1A 3D5JA 5F07A 3TJGA 1FOHA 2R37A 4MZWA 1OC9B 2GSSA 1TRWA 1USBA 1SJ6A 3GYKA 3LYPA 2C8UA 4LMWA 3QCPA 3QFBC 4POBA 5JCGA 2DMMA 2QGVA 1X9WB 1ZYEA 4CDOA 1QXHA 4IJ3A 3GKNA 1T7PB 2IFQA 4RI6A 1T4ZA 4HU9A 5CAXA 2PN8A 4MZBA 1K0BA 1X5EA 1ZL9A 5HR0A 2DLXA 2JZTA 3U5RE 4O5RA 4MZCA 3P2AA 4ULXA 3DYRA 5IO0A 3KMOA 3TKSA 4Z7XA 1X9SB 2M46A 2VL2C 3IK7A 4GRFA 5AN1A 11GSA 4PQIA 4MABA 1EV4A 1ERUA 2IWTA 1SD9A 3UEMA 2FWEA 1GSQA 3HZ4A 4KX4A 4TRXA 1GNEA 4KDXA 2HXKA 2CX3A 4TR1A 3GX8A 3TUEA 5JWOB 5G30A 4KGIA 2O8VB 2WS2A 2E0QA 1H75A 2JZSA 3WT1A 5B8AA 1X5CA 1TDIA 7GSSA 4CW9A 4CY6A 5C04A 4PURA 2YJ7A 2P5RA 1PX7A 3TJFA 5HR3A 4IP6A 3FZAA 1EZKA 4NXIA 4LMVA 4KB3A 2RM5A 2GSQA 3CYNA 4LL4B 2HRNA 3C1RA 3WGXA 3P8WA 3H93A 1X0RA 4K5SA 3G7JA 5AIVA 2MZCA 2YPMA 3MSZA 4BVYB 1THOA 2F9SA 2IMFA 3L9UA 2ON5A 3GX0A 5DCGA 5HR1A 1Q4JA 4OCEA 1TRVA 3GL5A 4AJ8A 1OAZA 4GSNA 6GSYA 1R4WA 1SYRA 4JR6A 3EE2A 4ECJA 3FZ9A 2ZUPA 1T3BA 2GLRA 3TKSE 1VGLA 4MJBA 4EVMA 4I8BA 4MF7A 1PX6A 4CHSA 2VIMA 5DQSA 2VLTA 4TR1B 3VPTA 1SL1B 2VD0A 2B5EA 1M2AA 1WOUA 5G1KA 1GTBA 3E3EA 5JWRB 4IHUA 2CAIA 2RLIA 3M9JA 3N9JA 5FT3A 2WULA 4POLA 4KF9A 4YKGA 3DRNA 2HYXA 5DCHA 1SK1A 2VCWA 1RW1A 2LRCA 4QL9A 2K9FA 1ABAA 2WB9A 3RDWA 4FIWA 1HNBA 1XW9A 1O7UA 1RK4A 1F9MA 1CQHA 3GSSA 1EEJA 1EOHA 3MAKA 4YQMA 2JACA 2L5OA 4DSSA 2UZ8A 1UVZA 4QL7A 1EP7A 5CNWA 22GSA 1GSYA 3L0HA 2HSMA 1TTZA 1EP8A 1WPIA 1MTCA 4NHZA 1A8LA 4EIPA 2LSTA 5IIZA 1GRXA 2CVKA 2H6ZA 4HQZA 1SJZA 5IQYA 2YP6A 4YAVA 5ELAA 3KXOA 1XXUA 3V1WA 1WP0A 2I1UA 5IMCA 1IYIA 3GMFA 3HZ8A 4ZXGA 1XWKA 2CX4A 5B6NA 2N5AA 3F6FA 3ERWA 2C0DA 2X49A 4ZL8A 3I69A 2WDUA 4WBJA 3FR3A 1JFUA 2MBTA 4OMVA 3MWHA 3FK8A 1THXA 4EDZA 2XHFA 1K3YA 2I9HA 2VCZA 2XPDA 1YEPA 4NV2A 4FQUA 3M8NA 1X5DA 2GS3A 5CYYA 2M72A 4HZ2A 4DVCA 1GL8A 1GUMA 1MDJA 1XIYA 2L57A 2FLSA 2REMA 1AAZA 4DSSB 3D21A 1B4PA 4G9HA 4MF6A 3WD6A 2F51A 2X8CA 1B9XC 2LJAA 3EINA 5ELGA 1ERTA 1Z3EA 1QFNA 4F0BA 3EC3A 2KP1A 2YV9A 2VL2A 1H4OA 1S3AA 2MMAA 1SL0B 5GSSA 4PNGA 2VOCA 1KNGA 5KN1A 4F82A 2H74A 1N2AA 4PUFC 1WE0A 1CQGA 2M80A 6GSTA 4EIQA 4EDYA 2YANA 1ZYPA 4OFNA 3IAS2 1EOGA 5LD0A 2RIIA 3IC8A 3Q19A 1TRSA 2N5BA 2PUKC 2DJKA 5DJLA 5FHIA 2FWFA 4GF0A 5BRTA 4ZB6A 4FH8A 3CTGA 1I5GA 2OE1A 2CT6A 3IHGA 4EC0A 18GSA 2D2ZA 1EGRA 1Z6NA 3D0ZA 2IMIA 2V32A 3VI5A 2VLVA 1XCCA 1PRXA 5ECQB 2IMKA 2B6MA 1FOVA 4JBBA 4EF0A 2OE3A 4L0WA 1M99A 3KH7A 3NOFA 2MMNA 2AYTA 1XOBA 3H79A 2R0PA 4EE0A 2B5YA 4IQ1A 1PSQA 4I6XA 5B7CA 2BJXA 5CRHA 4MJEA 1S3CA 3UAPA 4X1UA 5IMVA 2GSRA 2X8HA 1XZOA 4TXVA 1XVQA 4IKHA 3S9FA 5ECSA 4PGTA 2R0CA 4IQAA 5CRDA 1I9DA 1A0FA 2O85A 3QR6A 4MA9A 3LG6A 1HYUA 2PU9C 1A8YA 3EPTA 1NM3A 2V6OA 5KOXA 3GTUA 1EWXA 3FW2A 3O76A 1K0MA 1GWCA 1PN9A 2JADA 4YQUA 2A4HA 2YJHA 3H8QA 3VWWA 2QKEA 3O6TA 2QA1A 1A23A 2IMDA 1FB6A 2GT6A 4FYCA 4K6XA 4DSQA 4RI7A 5D9XA 3IC4A 3EWLA 5A4UA 6GSSA 2DC5A 4IGJA 2J9HA 1FW1A 1W4VA 3CRUA 1YZXA 4KNDA 3KZQA 4TR3A 5ECMB 3TJKA 3LORA 2GQLA 3APQA 5HFKA 3ZVJA 3TOUA 5KEJA 4WEYA 4DEJA 1K3OA 3L4NA 1XW5A 4EKZA 3ZLPA 4N0ZA 2FWHA 1JZRA 3Q6OA 2E7PA 2VUPA 3M0FA 5IMDA 2GSTA 1F2EA 3RAZA 2FNOA 2OBIA 4GQFA 2VAFA 1LU4A 1OC8A 2FCHA 4TR4A 4RUVA 5EPFA 2FA4A 2K8VA 3D4MA 2V1MA 2H66A 1V9WA 3CRTA 4V2NA 2ALBA 3LSZA 3GIXA 2IMEA 5ECNB 4ECIA 4ZBBA 3D6IA 2BMXA 3F3QA 4YKFA 3DWVA 1U3IA 3HVVA 4CY8A 4G19A 3Q74A 2PPTA 5DALA 3GNJA 4KAEA 2HFDA 5EVOA 1WJKA 1VF4A 4I97A 2H0HA 5CP1A 2YCDA 2LRTA 4K7IA 5JCWA 1SKWB 4G2EA 2VM1A 4X0XA 4OD7A 3F9UA 4F0CA 2R0GA 5D9VA 4O5UA 3KH9A 3US3A 5KN2A 1OVNA 2YN1A 3ME8A 1JZWA 4XIHA 3QAVA 3ME7A 1OKTA 3F4RA 2GTUA 1FB0A 4Z2TA 2B1LA 5LNKe 4RQRA 4K8MA 1SENA 2VCTA 2IJYA 4OFMA 2PVOC 2TIRA 3LYKA 2R3XA 1OKDA 1PQNA 2K18A 4OO5A 1GLQA 2N5FA 4BVYA 2AB6A 3VPQA 2J23A 4OWYA 4K2XA 3KM6A 4LA1A 3IE3A 2FUG2 2H1GA 5H5QA 4D73A 1U3AA 5DBQA 3LFLA 3O3TA 3ZFBA 2H75A 4PTSA 1PN0A 4YAPA 4HZ4A 5DALB 3HCZA 1B8XA 3UBLA 2AAWA 5F0GA 4WBRD 3VWVA 3TJBA 2CAQA 4WF5A 4MPGA 5D73A 2RUEA 2HZEA 1SL2B 2XPEA 5IM9A 2DKHA 4HOJA 3ZITA 2PVQA 17GSA 4MPFA 4TOPA 3ZMKA 6GSVA 3EYTA 3PPUA 4I2TA 1PL1A 1XFLA 5ECIB 4KE3A 4ICYA 5EY6A 3HDCA 1VF3A 5CRWA 3KEBA 4FO5A 4AF2A 2VCQA 4BA7A 4ZBAA 1SK2A 2V6KA 2JL4A 1Z7PA 2YOIA 3IR4A 1Y25A 3TOTA 5A4WA 4HJMA 1NW2A 3P7XA 5JWQB 3SBCA 4F9ZA 2WJUA 4Q5RA 1K0NA 5AGYA 2VM2A 3C71A 2TRCP 3IDVA 4TKYA 3QOUA 2C3QA 3ERFA 1F3BA 3BJ5A 1T1VA 4H86A 1OYJA 1TJDA 1ZZYA 3BD2A 3CSIA 3K8NA 3KIJA 3NZNA 4D73B 1GTIA 3FRCA 3I9V2 1KTEA 1AW9A 3FHKA 2C3TA 1GSEA 1B9YC 3TKRA 2PERA 4PQHA 2K6VA 1XWGA 1URMA 2IN3A 19GSA 1PKZA 2HZEB 4ZB8A 2RM6A 4XRAA 5LCZA 4V1Ag 4ECCA 3MIXA 4IBPA 1O8WA 2YZUA 5J41A 4Q5QA 2CZ3A 1G0TA 2C1YA 2H19A 3HD5A 2P0GA 1UN2A 2WRTA 4JRRA 3TCOA 1M2BA 4EL1A 1XOAA 1UC7A 4GLTA 1SU9A 4F03A 1ILOA 1T00A 1K0AA 1PA3A 1K0OA 4MMMA 3J7Yk 4ECBA 3ERGA 4E8HA 5C00A 5AISA 1YF1A 1MDKA 2R4VA 1ERVA 1GTUA 4TW5A 3LW9A 3GKMA 4J57E 3IPZA 1VF2A 3EMPA 4GSSA 4HS1A 3FR9A 3UOMA 2LNSA 1ZCPA 2YWNA 5DJMA 1DSBA 3UVHA 3H4KA 1TU7A 5CREA 3BOAA 3CMIA 3ZTLA 2GVPA 4JZQA 4DSRA 4WKWA 1BG5A 4XTSA 2YWIA 3M3MA 3C73A 4K7OA 4V2MA 3FKFA 2K8SA 2B7KA 1TI1A 5IOXA 3UVTA 4IVFA 2H76A 4IN0A 1TK5B 4K2DA 3LXZA 3VFIA 4O5QA 2EIRA 3JCML 2JZRA 1YJ6A 5HFGA 3U6VA 3HVSA 3HY2A 2HRKA 2VL9A 1V2AA 4K7NA 5J9CA 1SKSB 4XCSA 4IJIA 3DIEA 2B3SA 3UMAA 4KH7A 3AY8A 3F3RA 5CRGA 5F05A 1U88A 4MK3A 1JLVA 2QSIA 1Y6EA 1XWBA 2AHEA 3UJ1A 3KTLA 2MBSA 1F37A 1PL2A 3HJMA 1HNAA 4PUAA 1TW9A 1A24A 1AUCA 5IO2A 3OR5A 4L8EA 2BTOT 1ACVA 1W89A 4G0IA 1EEMA 2A2PA 3WGDA 1ZYQB 3I6AA 2I81A 3J7Yb 4L5LA 4ZL9A 4A5PA 2CVBA 3GURA 5DQYA 3DD3A 1M9AA 2LJRA 4ACSA 3A2VA 2DJJA 5F06A 3HA9A 4JU5A 2VCVA 3D22A 1U87A 2WFCA 2NTOA 2MMZA 3IOSA 2I4AA 4XS6A 1BQ7A 2IIYA 5ECLB 8GSSA 1YQ1A 1VRSD 2GQMA 2O89A 4XRDA 1GTAA 3E9JB 3EU3A 3EMXA 3IA1A 4G0LA 1R5AA 5H5SA 4KW6A 1NSWA 2HNLA 3CSJA 2R6KA 3IRAA 4KCAA 1EV9A 2H1DA 2H72A 14GSA 4MCUA 2NPBA 3BCKA 1E6BA 2AUVA 2H6YA 4K0NA 2GZPA 2DBCA 1PD21 4OO4A 1GULA 4J56E 4IS0A 3WGEA 1V57A 2F8FA 5FWGA 2DIYA 1RQMA 1WRYA 2H6XA 3FEUA 3F4SA 1ZYNA 4KUNA 3CTFA 4ZB9A 3ZIVA 3ZL5A 4FYBA 3A3TA 2KLXA 2OE0A 4I5QA 1K0DA 2FA8A 1R5PA 2HE3A 3DEXA 1MD3A 4BVXA 4MH3A 2V2GA 3MDKA 2NBSA 2B7JA 5G31A 2R2JA 2VCXA 1FHEA 2F8AA 3G7YA 1WWJA 5F8BA 4Q5NA 1BJXA 5IPHA 4E8EA 2EIQA 5COHA 4NAXA 3FZ5A 4POKA 1WMJA 3ZFLA 3UL3A 2LRNA 4MNNA 2YWOA 1K3LA 3DXBA 3QMXA 5D9WA 1FVKA 2PGTA 1SKRB 5J4UA 2H1AA 3KP9A 1TRUA 2C80A 3KP8A 2ZCTA 2A2SA 2PWJA 4MLYA 2HSHA 3D4TA 1GSDA 3GFKA 3KTBA 2O87A 3NIVA 4OFTA 4GTUA 1QK8A 10GSA 3CBUA 2YWMA 5KOWA 2GQKA 2DJ3A 1V98A 3F0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AJ7 A;  2GT5 A;  3E0U A;  1R26 A;  3P90 A;  5GAP D;  4LLR A;  3C8E A;  5KN3 A;  4X43 A;  1QUW A;  3TRX A;  5ENU A;  3VK9 A;  3TKQ A;  2ZNM A;  4V2L A;  1TP9 A;  5IMZ A;  2H30 A;  1JLW A;  4TXO A;  5E59 A;  5GST A;  2ON7 A;  3TKP A;  4BPY A;  3ED3 A;  1XWC A;  4I2U A;  2H71 A;  2YZH A;  3CXG A;  5DAK A;  4AGS A;  3EUR A;  3GV1 A;  2GZY A;  3DVX A;  1PMT A;  4RQX A;  1KBN A;  2L6D A;  4ILF A;  1UA5 A;  1Z6M A;  3QDN A;  1G6Y A;  3IXR A;  1BED A;  5D9T A;  4N11 A;  1G7O A;  3SWL A;  3DKS A;  2TRX A;  3H1N A;  3KMN A;  1O73 A;  5AIX A;  3BCI A;  2DJ1 A;  1QGV A;  1ERW A;  2KOK A;  1C72 A;  4YQV A;  3QAW A;  1XW6 A;  1ST9 A;  13GS A;  3HHV A;  1M0U A;  1YEX A;  2IPA A;  1ZOF A;  4KDU A;  2AJQ B;  1TOF A;  2L59 A;  2MYG A;  1R7H A;  2C0G A;  3KD0 A;  1A2J A;  4XS4 A;  2YV7 A;  3A2W A;  1GUH A;  4TVE A;  3HJP A;  4BL7 A;  1LBK A;  3HYP A;  5L71 A;  1ZMA A;  1M2D A;  2WZ9 A;  5EL8 A;  3M1G A;  3G9B A;  1FG4 A;  1YKC A;  4TXO B;  4K1F A;  6GSW A;  2H01 A;  3PH9 A;  5HR2 A;  1IYH A;  4HQS A;  3F4T A;  4POM A;  5DAK B;  3M9K A;  2DML A;  4WET A;  5D96 A;  4OCF A;  2LUS A;  2LQQ A;  1QQ2 A;  1O85 A;  1B48 A;  2VD1 A;  3A2X A;  2WGR A;  3BBY A;  2CQ9 A;  3LQ7 A;  3LGC A;  2H1B A;  3GKK A;  4MJA A;  5E4W A;  2F3M A;  1GP1 A;  2E2G A;  16GS A;  1JZD A;  2IFQ B;  4MP4 A;  4EUY A;  2VO4 A;  3DGQ A;  1FVJ A;  4HJ2 A;  1JHB A;  1OE7 A;  3ZML A;  3ZYW A;  4V1A p;  3QFA C;  4WF4 A;  4IW9 A;  4P3Y B;  3EU4 A;  3CSH A;  1ML6 A;  4XS4 B;  1YKA A;  2JU5 A;  5B8B A;  2DJ2 A;  4KCE A;  4HDE A;  1G6W A;  4O32 A;  1AXD A;  5J5N A;  2LKU A;  5HFI A;  1ON4 A;  5DVB A;  4L0U A;  2FD3 A;  3MNG A;  1SYX A;  1XVW A;  4ID0 A;  1GSF A;  3VLN A;  3HVX A;  1TU8 A;  4WXT A;  3QD9 A;  4N30 A;  4XS1 A;  4GCI A;  4AJ6 A;  1XBS A;  2LEG A;  1AQW A;  2LJK A;  2HI7 A;  5J9B A;  3IK9 A;  6GSU A;  3UBK A;  1PGT A;  1OC3 A;  2ES7 A;  4NHW A;  2FY6 A;  4HUA A;  2OJL A;  2X8G A;  2KUC A;  2FWG A;  4MJC A;  4EO3 A;  4K0G A;  2LNT A;  4MH2 A;  3FYG A;  2DSA A;  5A4V A;  1VF1 A;  2KHP A;  5J3R A;  2JSY A;  2H0G A;  1N8J A;  3PGT A;  4O92 A;  3VUR A;  1GUK A;  3F6D A;  2A2R A;  2LQO A;  2LV3 A;  3FY7 A;  2LS5 A;  1ZGN A;  2B1K A;  4FYU A;  4WR5 A;  4HI7 A;  1BYE A;  1K0C A;  2GGT A;  3HXS A;  2C0F A;  1MEK A;  4IEL A;  2H70 A;  2CV4 A;  2LTK A;  2L5L A;  3GUS A;  3WT2 A;  4IP1 A;  3RPN A;  2L4Q A;  4KSO A;  3C7M A;  5ECH B;  5A5K A;  1BAY A;  4K9Z A;  3QAG A;  4ZIJ A;  3W8J A;  1YF0 A;  3GRX A;  3IHQ A;  2NDO A;  3I43 A;  3VI7 A;  5ECK B;  1XPV A;  1E2Y A;  4PXO A;  3VWU A;  1G7E A;  20GS A;  4GWR A;  4PQ1 A;  3KCM A;  5JCU A;  1MD4 A;  3R2Q A;  3GH6 A;  4Q5F A;  3HKR A;  4L5O A;  2O7K A;  1Z9H A;  2GDR A;  3GHA A;  1A2L A;  4J2F A;  1TKD B;  3KJY A;  12GS A;  3IBH A;  2OAC A;  3GA4 A;  2CZ2 A;  3Q18 A;  1GLP A;  2HZF A;  1AQV A;  3TRQ A;  2DJ0 A;  4ZL7 A;  1J9B A;  3TDG A;  4JED A;  4NPB A;  2L4C A;  2QC7 A;  5G5E A;  1A2M A;  4KA0 A;  2B5X A;  3IAM 2;  3L9S A;  1A0R P;  3FR6 A;  5GZZ B;  1QMV A;  2H0I A;  4PX1 A;  4GST A;  3LXT A;  3IV4 A;  3RHC A;  2I3Y A;  2E2M A;  3VWX A;  3LEF A;  2Z9S A;  1U6T A;  5ID2 A;  2HSY A;  2VLU A;  3UAR A;  5IPG A;  3TKS C;  3ZVJ D;  5H5R A;  4QQ7 A;  1Q98 A;  4MDC A;  5ABR A;  1DBY A;  4HEA 2;  1F6M C;  2XBQ A;  1J0F A;  2HLS A;  1TXX A;  4EXJ A;  2FGX A;  2JSZ A;  1T8E B;  1O81 A;  5D8I A;  1AQX A;  4BWS A;  4TN8 A;  5G1L A;  4GXZ A;  2H8L A;  1TK8 B;  2C4J A;  2H73 A;  1DE2 A;  2P31 A;  5IMA A;  3LJR A;  4ISD A;  4JR4 A;  3WYW A;  2X64 A;  3GN3 A;  1NHO A;  4TR0 A;  4JE1 A;  3C1S A;  2XC2 A;  3PR8 A;  4WR4 A;  4BWQ A;  4O7H A;  1V58 A;  1SJI A;  3PIN A;  2G0F A;  2PBJ A;  2GZZ A;  2HRF A;  2HT9 A;  1PKW A;  3TB2 A;  3TRP A;  3GH9 A;  2XBI A;  2X99 A;  3APO A;  3ZRD A;  1JZO A;  4LL1 B;  2R5G A;  1V40 A;  2OKA A;  5ID2 B;  3ISO A;  5ECR B;  1YY7 A;  1Z7R A;  3W6G A;  1O6J A;  1HD2 A;  6GSX A;  3LWA A;  3GKX A;  1XWA A;  3F63 A;  4ZIL A;  1HNC A;  9GSS A;  4KSM A;  4GQC A;  1FO5 A;  2IL3 A;  5D93 A;  3ZZX A;  4N0V A;  1SK0 A;  1GSS A;  2DIZ A;  3GST A;  2C3N A;  3APS A;  3UIW A;  3DVW A;  5IMF A;  3DML A;  3RBT A;  5DDL A;  3FZ4 A;  5GAN D;  2V41 A;  1TI3 A;  1LJR A;  2FHE A;  3L9V A;  3L78 A;  1KEB A;  1F3A A;  4MF5 A;  1NHY A;  1OE8 A;  1S3D A;  1TK0 B;  3G7I A;  2AV4 A;  1T4Y A;  2G2Q A;  1SD8 A;  5G5F A;  2A4V A;  2C0E A;  5ECO B;  5HQP A;  5INY A;  1OC9 A;  3TGZ A;  1B4Q A;  1HQO A;  1O8X A;  2PMT A;  2OAD A;  3ZRE A;  3F8U A;  4PNF A;  1BX9 A;  5ECP B;  4G10 A;  1DE1 A;  1YDK A;  3RHB A;  3TJJ A;  4YH2 A;  2NVL A;  1AIU A;  4NWY A;  1FAA A;  1M7T A;  2KP2 A;  2OA7 A;  4XHM A;  4ML6 A;  1DUG A;  4N10 A;  5B6M A;  1GH2 A;  3EVI A;  1WIK A;  2EC4 A;  3QPM A;  2CA8 A;  1M9B A;  3GTU B;  4ML1 A;  2VL3 A;  5G2Z A;  4ZBD A;  2WCI A;  3W8S A;  2EIO A;  5KN0 A;  2YNX A;  1J08 A;  2OBK A;  3KGK A;  1EGO A;  3RPP A;  4HU7 A;  2CVD A;  3A5W A;  3N5O A;  4F2I A;  2P5Q A;  5CO3 A;  2L6C A;  3HJO A;  1GNW A;  1GSU A;  1MDI A;  2RUF A;  4NMU A;  4NV5 A;  3ZIJ A;  1Z5Y E;  2MMO A;  5IOW A;  3GL3 A;  4KDY A;  1X9M B;  1AC1 A;  3D5J A;  5F07 A;  3TJG A;  2R37 A;  4MZW A;  1OC9 B;  2GSS A;  1TRW A;  1USB A;  1SJ6 A;  3GYK A;  3LYP A;  2C8U A;  4LMW A;  3QCP A;  3QFB C;  4POB A;  5JCG A;  2DMM A;  2QGV A;  1X9W B;  1ZYE A;  4CDO A;  1QXH A;  4IJ3 A;  3GKN A;  1T7P B;  2IFQ A;  4RI6 A;  1T4Z A;  4HU9 A;  5CAX A;  2PN8 A;  4MZB A;  1K0B A;  1X5E A;  1ZL9 A;  5HR0 A;  2DLX A;  2JZT A;  3U5R E;  4O5R A;  4MZC A;  3P2A A;  4ULX A;  3DYR A;  5IO0 A;  3KMO A;  3TKS A;  4Z7X A;  1X9S B;  2M46 A;  2VL2 C;  3IK7 A;  4GRF A;  5AN1 A;  11GS A;  4PQI A;  4MAB A;  1EV4 A;  1ERU A;  2IWT A;  1SD9 A;  3UEM A;  2FWE A;  1GSQ A;  3HZ4 A;  4KX4 A;  4TRX A;  1GNE A;  4KDX A;  2HXK A;  2CX3 A;  4TR1 A;  3GX8 A;  3TUE A;  5JWO B;  5G30 A;  4KGI A;  2O8V B;  2WS2 A;  2E0Q A;  1H75 A;  2JZS A;  3WT1 A;  5B8A A;  1X5C A;  1TDI A;  7GSS A;  4CW9 A;  5C04 A;  4PUR A;  2YJ7 A;  2P5R A;  1PX7 A;  3TJF A;  5HR3 A;  4IP6 A;  3FZA A;  1EZK A;  4NXI A;  4LMV A;  4KB3 A;  2RM5 A;  2GSQ A;  3CYN A;  4LL4 B;  2HRN A;  3C1R A;  3WGX A;  3P8W A;  3H93 A;  1X0R A;  3G7J A;  5AIV A;  2MZC A;  2YPM A;  3MSZ A;  1THO A;  2F9S A;  2IMF A;  3L9U A;  2ON5 A;  3GX0 A;  5DCG A;  5HR1 A;  1Q4J A;  4OCE A;  1TRV A;  3GL5 A;  4AJ8 A;  1OAZ A;  4GSN A;  6GSY A;  1R4W A;  1SYR A;  4JR6 A;  3EE2 A;  4ECJ A;  3FZ9 A;  2ZUP A;  1T3B A;  2GLR A;  3TKS E;  1VGL A;  4MJB A;  4EVM A;  4I8B A;  4MF7 A;  1PX6 A;  4CHS A;  2VIM A;  5DQS A;  2VLT A;  4TR1 B;  3VPT A;  1SL1 B;  2VD0 A;  2B5E A;  1M2A A;  1WOU A;  5G1K A;  1GTB A;  3E3E A;  5JWR B;  4IHU A;  2CAI A;  2RLI A;  3M9J A;  3N9J A;  5FT3 A;  2WUL A;  4POL A;  3DRN A;  2HYX A;  5DCH A;  1SK1 A;  2VCW A;  1RW1 A;  2LRC A;  4QL9 A;  2K9F A;  1ABA A;  2WB9 A;  3RDW A;  4FIW A;  1HNB A;  1XW9 A;  1O7U A;  1RK4 A;  1F9M A;  1CQH A;  3GSS A;  1EEJ A;  1EOH A;  3MAK A;  4YQM A;  2JAC A;  2L5O A;  4DSS A;  1UVZ A;  4QL7 A;  1EP7 A;  5CNW A;  22GS A;  1GSY A;  3L0H A;  1TTZ A;  1EP8 A;  1WPI A;  1MTC A;  4NHZ A;  1A8L A;  1GRX A;  2LST A;  5IIZ A;  2CVK A;  2H6Z A;  4HQZ A;  1SJZ A;  5IQY A;  2YP6 A;  4YAV A;  5ELA A;  3KXO A;  1XXU A;  3V1W A;  1WP0 A;  2I1U A;  5IMC A;  1IYI A;  3GMF A;  3HZ8 A;  4ZXG A;  1XWK A;  2CX4 A;  5B6N A;  2N5A A;  3F6F A;  3ERW A;  2C0D A;  4ZL8 A;  3I69 A;  2WDU A;  4WBJ A;  3FR3 A;  1JFU A;  2MBT A;  4OMV A;  3MWH A;  3FK8 A;  1THX A;  4EDZ A;  2XHF A;  1K3Y A;  2I9H A;  2VCZ A;  2XPD A;  1YEP A;  4NV2 A;  3M8N A;  5CYY A;  1X5D A;  2GS3 A;  2M72 A;  4HZ2 A;  4DVC A;  1GL8 A;  1GUM A;  1MDJ A;  1XIY A;  2L57 A;  2FLS A;  2REM A;  1AAZ A;  4DSS B;  3D21 A;  1B4P A;  4G9H A;  4MF6 A;  3WD6 A;  2F51 A;  2X8C A;  1B9X C;  2LJA A;  3EIN A;  5ELG A;  1ERT A;  1Z3E A;  1QFN A;  4F0B A;  3EC3 A;  2KP1 A;  2YV9 A;  2VL2 A;  1H4O A;  1S3A A;  2MMA A;  1SL0 B;  5GSS A;  4PNG A;  2VOC A;  1KNG A;  5KN1 A;  4F82 A;  2H74 A;  1N2A A;  4PUF C;  1WE0 A;  1CQG A;  2M80 A;  6GST A;  4EDY A;  2YAN A;  4OFN A;  3IAS 2;  1EOG A;  5LD0 A;  2RII A;  3Q19 A;  1TRS A;  2N5B A;  2PUK C;  2DJK A;  5DJL A;  5FHI A;  2FWF A;  4GF0 A;  4ZB6 A;  4FH8 A;  3CTG A;  1I5G A;  2OE1 A;  2CT6 A;  4EC0 A;  18GS A;  2D2Z A;  1EGR A;  1Z6N A;  3D0Z A;  2IMI A;  2V32 A;  3VI5 A;  2VLV A;  1XCC A;  1PRX A;  5ECQ B;  2IMK A;  2B6M A;  1FOV A;  4JBB A;  4EF0 A;  2OE3 A;  4L0W A;  1M99 A;  3KH7 A;  3NOF A;  2MMN A;  2AYT A;  1XOB A;  3H79 A;  4EE0 A;  2B5Y A;  4IQ1 A;  1PSQ A;  4I6X A;  5B7C A;  2BJX A;  5CRH A;  4MJE A;  1S3C A;  3UAP A;  4X1U A;  5IMV A;  2GSR A;  2X8H A;  1XZO A;  4TXV A;  1XVQ A;  4IKH A;  3S9F A;  5ECS A;  4PGT A;  4IQA A;  5CRD A;  1I9D A;  1A0F A;  2O85 A;  3QR6 A;  4MA9 A;  3LG6 A;  1HYU A;  2PU9 C;  1A8Y A;  1NM3 A;  2V6O A;  3GTU A;  1EWX A;  3FW2 A;  3O76 A;  1K0M A;  1GWC A;  1PN9 A;  2JAD A;  4YQU A;  2YJH A;  3H8Q A;  3VWW A;  2QKE A;  3O6T A;  1A23 A;  2IMD A;  1FB6 A;  2GT6 A;  4FYC A;  4K6X A;  4DSQ A;  4RI7 A;  5D9X A;  3IC4 A;  3EWL A;  5A4U A;  6GSS A;  2DC5 A;  4IGJ A;  2J9H A;  1FW1 A;  1W4V A;  3CRU A;  1YZX A;  4KND A;  3KZQ A;  4TR3 A;  5ECM B;  3TJK A;  3LOR A;  2GQL A;  3APQ A;  5HFK A;  3ZVJ A;  3TOU A;  5KEJ A;  4WEY A;  4DEJ A;  1K3O A;  3L4N A;  1XW5 A;  4EKZ A;  3ZLP A;  4N0Z A;  2FWH A;  1JZR A;  3Q6O A;  2E7P A;  2VUP A;  3M0F A;  5IMD A;  2GST A;  1F2E A;  3RAZ A;  2FNO A;  2OBI A;  4GQF A;  2VAF A;  1LU4 A;  1OC8 A;  2FCH A;  4TR4 A;  4RUV A;  5EPF A;  2FA4 A;  2K8V A;  3D4M A;  2V1M A;  2H66 A;  1V9W A;  3CRT A;  4V2N A;  2ALB A;  3LSZ A;  3GIX A;  2IME A;  5ECN B;  4ECI A;  4ZBB A;  3D6I A;  2BMX A;  3F3Q A;  3DWV A;  1U3I A;  3HVV A;  4G19 A;  3Q74 A;  2PPT A;  5DAL A;  3GNJ A;  4KAE A;  2HFD A;  5EVO A;  1WJK A;  1VF4 A;  4I97 A;  2H0H A;  5CP1 A;  2YCD A;  2LRT A;  4K7I A;  5JCW A;  1SKW B;  4G2E A;  2VM1 A;  4X0X A;  4OD7 A;  3F9U A;  4F0C A;  5D9V A;  3KH9 A;  3US3 A;  5KN2 A;  1OVN A;  2YN1 A;  3ME8 A;  1JZW A;  4XIH A;  3QAV A;  3ME7 A;  1OKT A;  3F4R A;  2GTU A;  1FB0 A;  2B1L A;  5LNK e;  4RQR A;  4K8M A;  1SEN A;  2VCT A;  2IJY A;  4OFM A;  2PVO C;  2TIR A;  3LYK A;  2R3X A;  1OKD A;  1PQN A;  2K18 A;  4OO5 A;  1GLQ A;  2N5F A;  4BVY A;  2AB6 A;  3VPQ A;  2J23 A;  4OWY A;  3KM6 A;  4LA1 A;  3IE3 A;  2FUG 2;  2H1G A;  5H5Q A;  4D73 A;  1U3A A;  5DBQ A;  3LFL A;  3O3T A;  3ZFB A;  2H75 A;  4YAP A;  4HZ4 A;  5DAL B;  3HCZ A;  1B8X A;  3UBL A;  2AAW A;  5F0G A;  4WBR D;  3VWV A;  3TJB A;  2CAQ A;  4WF5 A;  4MPG A;  5D73 A;  2RUE A;  2HZE A;  1SL2 B;  2XPE A;  5IM9 A;  4HOJ A;  3ZIT A;  2PVQ A;  17GS A;  4MPF A;  4TOP A;  3ZMK A;  6GSV A;  3EYT A;  4I2T A;  1PL1 A;  1XFL A;  5ECI B;  4KE3 A;  5EY6 A;  3HDC A;  1VF3 A;  5CRW A;  3KEB A;  4FO5 A;  4AF2 A;  2VCQ A;  4BA7 A;  4ZBA A;  1SK2 A;  2V6K A;  2JL4 A;  1Z7P A;  2YOI A;  3IR4 A;  1Y25 A;  3TOT A;  5A4W A;  4HJM A;  1NW2 A;  3P7X A;  5JWQ B;  3SBC A;  4F9Z A;  2WJU A;  4Q5R A;  1K0N A;  5AGY A;  2VM2 A;  3C71 A;  2TRC P;  3IDV A;  4TKY A;  3QOU A;  2C3Q A;  3ERF A;  1F3B A;  3BJ5 A;  1T1V A;  4H86 A;  1OYJ A;  1TJD A;  1ZZY A;  3BD2 A;  3CSI A;  3K8N A;  3KIJ A;  3NZN A;  4D73 B;  1GTI A;  3FRC A;  3I9V 2;  1KTE A;  1AW9 A;  3FHK A;  2C3T A;  1GSE A;  1B9Y C;  3TKR A;  2PER A;  4PQH A;  2K6V A;  1XWG A;  1URM A;  2IN3 A;  19GS A;  1PKZ A;  2HZE B;  4ZB8 A;  2RM6 A;  4XRA A;  5LCZ A;  4V1A g;  4ECC A;  4IBP A;  1O8W A;  2YZU A;  5J41 A;  4Q5Q A;  2CZ3 A;  1G0T A;  2C1Y A;  2H19 A;  3HD5 A;  2P0G A;  1UN2 A;  2WRT A;  4JRR A;  3TCO A;  1M2B A;  4EL1 A;  1XOA A;  1UC7 A;  4GLT A;  1SU9 A;  4F03 A;  1ILO A;  1T00 A;  1K0A A;  1PA3 A;  1K0O A;  4MMM A;  3J7Y k;  4ECB A;  3ERG A;  4E8H A;  5C00 A;  5AIS A;  1YF1 A;  1MDK A;  2R4V A;  1ERV A;  1GTU A;  4TW5 A;  3GKM A;  4J57 E;  3IPZ A;  1VF2 A;  3EMP A;  4GSS A;  4HS1 A;  3FR9 A;  3UOM A;  2LNS A;  1ZCP A;  2YWN A;  5DJM A;  1DSB A;  3UVH A;  3H4K A;  1TU7 A;  5CRE A;  3BOA A;  3CMI A;  3ZTL A;  2GVP A;  4JZQ A;  4DSR A;  4WKW A;  1BG5 A;  4XTS A;  2YWI A;  3M3M A;  3C73 A;  4K7O A;  4V2M A;  3FKF A;  2K8S A;  2B7K A;  1TI1 A;  5IOX A;  3UVT A;  4IVF A;  2H76 A;  4IN0 A;  1TK5 B;  4K2D A;  3LXZ A;  3VFI A;  2EIR A;  3JCM L;  2JZR A;  1YJ6 A;  5HFG A;  3U6V A;  3HVS A;  3HY2 A;  2VL9 A;  1V2A A;  4K7N A;  5J9C A;  1SKS B;  4XCS A;  4IJI A;  3DIE A;  2B3S A;  3UMA A;  4KH7 A;  3AY8 A;  3F3R A;  5F05 A;  5CRG A;  1U88 A;  4MK3 A;  1JLV A;  2QSI A;  1Y6E A;  1XWB A;  2AHE A;  3UJ1 A;  3KTL A;  2MBS A;  1F37 A;  1PL2 A;  3HJM A;  1HNA A;  4PUA A;  1TW9 A;  1A24 A;  1AUC A;  5IO2 A;  3OR5 A;  4L8E A;  2BTO T;  1ACV A;  1W89 A;  1EEM A;  3WGD A;  1ZYQ B;  3I6A A;  2I81 A;  3J7Y b;  4L5L A;  4ZL9 A;  2CVB A;  3GUR A;  5DQY A;  3DD3 A;  1M9A A;  2LJR A;  4ACS A;  3A2V A;  2DJJ A;  5F06 A;  3HA9 A;  4JU5 A;  2VCV A;  3D22 A;  1U87 A;  2WFC A;  2NTO A;  2MMZ A;  3IOS A;  2I4A A;  4XS6 A;  1BQ7 A;  2IIY A;  5ECL B;  8GSS A;  1YQ1 A;  1VRS D;  2GQM A;  2O89 A;  4XRD A;  1GTA A;  3E9J B;  3EU3 A;  3EMX A;  3IA1 A;  1R5A A;  5H5S A;  4KW6 A;  1NSW A;  2HNL A;  3CSJ A;  2R6K A;  3IRA A;  4KCA A;  1EV9 A;  2H1D A;  2H72 A;  14GS A;  4MCU A;  2NPB A;  3BCK A;  1E6B A;  2AUV A;  2H6Y A;  4K0N A;  2GZP A;  2DBC A;  1PD2 1;  4OO4 A;  1GUL A;  4J56 E;  4IS0 A;  3WGE A;  1V57 A;  2F8F A;  5FWG A;  2DIY A;  1RQM A;  1WRY A;  2H6X A;  3FEU A;  3F4S A;  4KUN A;  3CTF A;  4ZB9 A;  3ZIV A;  3ZL5 A;  4FYB A;  3A3T A;  2KLX A;  2OE0 A;  4I5Q A;  1K0D A;  2FA8 A;  1R5P A;  2HE3 A;  3DEX A;  1MD3 A;  4BVX A;  4MH3 A;  2V2G A;  3MDK A;  2NBS A;  2B7J A;  5G31 A;  2R2J A;  2VCX A;  1FHE A;  2F8A A;  3G7Y A;  1WWJ A;  5F8B A;  4Q5N A;  1BJX A;  5IPH A;  4E8E A;  2EIQ A;  5COH A;  4NAX A;  3FZ5 A;  4POK A;  1WMJ A;  3ZFL A;  3UL3 A;  2LRN A;  2YWO A;  1K3L A;  3DXB A;  3QMX A;  5D9W A;  1FVK A;  2PGT A;  1SKR B;  5J4U A;  2H1A A;  3KP9 A;  1TRU A;  2C80 A;  3KP8 A;  2ZCT A;  2A2S A;  2PWJ A;  4MLY A;  2HSH A;  3D4T A;  1GSD A;  3GFK A;  3KTB A;  2O87 A;  3NIV A;  4OFT A;  4GTU A;  1QK8 A;  10GS A;  3CBU A;  2YWM A;  2GQK A;  2DJ3 A;  1V98 A;  3F0I A; 
#chains in the Genus database with same CATH topology
 4AJ7 A;  5BMU A;  2GT5 A;  3E0U A;  1R26 A;  3P90 A;  5GAP D;  3FMW A;  4LLR A;  3C8E A;  5KN3 A;  4X43 A;  1QUW A;  3TRX A;  5ENU A;  3VK9 A;  3TKQ A;  4BVX B;  2ZNM A;  4V2L A;  1TP9 A;  5IMZ A;  2H30 A;  1JLW A;  4TXO A;  5E59 A;  5GST A;  2ON7 A;  3TKP A;  4BPY A;  3ED3 A;  4USS A;  1XWC A;  4I2U A;  2H71 A;  2YZH A;  3CXG A;  5DAK A;  4AGS A;  3EUR A;  3GV1 A;  2GZY A;  3DVX A;  1PMT A;  4RQX A;  1KBN A;  2L6D A;  4ILF A;  1UA5 A;  1Z6M A;  3QDN A;  1G6Y A;  3IXR A;  1BED A;  5D9T A;  4N11 A;  1G7O A;  3SWL A;  3DKS A;  2TRX A;  3H1N A;  3KMN A;  1O73 A;  5AIX A;  3BCI A;  2DJ1 A;  1QGV A;  1ERW A;  3MYD A;  2KOK A;  1C72 A;  4YQV A;  3QAW A;  1XW6 A;  1ST9 A;  13GS A;  3HHV A;  1M0U A;  1YEX A;  2IPA A;  1ZOF A;  4KDU A;  2AJQ B;  1TOF A;  2L59 A;  2MYG A;  1R7H A;  2C0G A;  3KD0 A;  1A2J A;  2HRA A;  4XS4 A;  2YV7 A;  3A2W A;  1GUH A;  4TVE A;  3HJP A;  4BL7 A;  1LBK A;  3HYP A;  5L71 A;  1ZMA A;  1M2D A;  2WZ9 A;  5EL8 A;  3M1G A;  3G9B A;  1FG4 A;  1YKC A;  4TXO B;  4K1F A;  6GSW A;  2H01 A;  3PH9 A;  5HR2 A;  1IYH A;  4HQS A;  3F4T A;  4POM A;  5DAK B;  3M9K A;  2DKI A;  2DML A;  4WET A;  5D96 A;  4OCF A;  2LUS A;  2LQQ A;  1QQ2 A;  3HVN A;  1O85 A;  1B48 A;  2VD1 A;  3A2X A;  2WGR A;  3BBY A;  2CQ9 A;  3LQ7 A;  3LGC A;  2H1B A;  3GKK A;  4MJA A;  5E4W A;  2F3M A;  1GP1 A;  2E2G A;  16GS A;  1JZD A;  2IFQ B;  4MP4 A;  4EUY A;  2VO4 A;  3DGQ A;  1S3R A;  1FVJ A;  4HJ2 A;  1JHB A;  1OE7 A;  3ZML A;  3ZYW A;  4V1A p;  4K5R A;  3QFA C;  4WF4 A;  4IW9 A;  4P3Y B;  3EU4 A;  3CSH A;  1ML6 A;  4XS4 B;  1YKA A;  2JU5 A;  5B8B A;  2DJ2 A;  4KCE A;  4HDE A;  3R3E A;  1G6W A;  4O32 A;  4BL7 B;  1AXD A;  5J5N A;  2LKU A;  5HFI A;  4BIK A;  1ON4 A;  5DVB A;  4L0U A;  2FD3 A;  3MNG A;  1SYX A;  1XVW A;  4ID0 A;  1GSF A;  3VLN A;  3HVX A;  1TU8 A;  4WXT A;  3QD9 A;  4N30 A;  4XS1 A;  4GCI A;  4AJ6 A;  1XBS A;  2LEG A;  1AQW A;  2LJK A;  2HI7 A;  5J9B A;  3IK9 A;  6GSU A;  3UBK A;  1PGT A;  1OC3 A;  2ES7 A;  4NHW A;  2FY6 A;  4HUA A;  2OJL A;  2X8G A;  2KUC A;  2FWG A;  4MJC A;  4EO3 A;  4K0G A;  2LNT A;  3A5I A;  4MH2 A;  3FYG A;  2DSA A;  5A4V A;  1VF1 A;  2KHP A;  5J3R A;  2JSY A;  2H0G A;  1N8J A;  3PGT A;  2QA2 A;  4O92 A;  3VUR A;  1GUK A;  3F6D A;  2A2R A;  2LQO A;  2LV3 A;  3FY7 A;  2LS5 A;  1ZGN A;  2B1K A;  4FYU A;  4WR5 A;  4HI7 A;  1BYE A;  1K0C A;  2GGT A;  3HXS A;  2C0F A;  1MEK A;  4IEL A;  2H70 A;  2CV4 A;  2LTK A;  2L5L A;  3GUS A;  3WT2 A;  4IP1 A;  3RPN A;  2L4Q A;  4KSO A;  3C7M A;  5ECH B;  5A5K A;  1BAY A;  4K9Z A;  3QAG A;  4ZIJ A;  3W8J A;  1YF0 A;  3GRX A;  3IHQ A;  2NDO A;  3I43 A;  3VI7 A;  5ECK B;  1XPV A;  1E2Y A;  4PXO A;  3VWU A;  1G7E A;  20GS A;  4GWR A;  4PQ1 A;  3KCM A;  5JCU A;  1MD4 A;  3R2Q A;  3GH6 A;  4Q5F A;  3HKR A;  4L5O A;  2O7K A;  1Z9H A;  2GDR A;  3GHA A;  1A2L A;  4J2F A;  1TKD B;  3KJY A;  12GS A;  3IBH A;  2OAC A;  3GA4 A;  2CZ2 A;  3Q18 A;  1GLP A;  2HZF A;  1AQV A;  3TRQ A;  2DJ0 A;  4ZL7 A;  1J9B A;  3TDG A;  4JED A;  4NPB A;  2L4C A;  2QC7 A;  5G5E A;  1A2M A;  4KA0 A;  2B5X A;  3IAM 2;  3L9S A;  1A0R P;  3FR6 A;  4HSC X;  5GZZ B;  1QMV A;  2H0I A;  4PX1 A;  4GST A;  3LXT A;  3IV4 A;  3RHC A;  2I3Y A;  2E2M A;  3VWX A;  3LEF A;  2Z9S A;  1U6T A;  5ID2 A;  2HSY A;  2VLU A;  3UAR A;  5IPG A;  3TKS C;  3ZVJ D;  5H5R A;  4QQ7 A;  1Q98 A;  4MDC A;  5ABR A;  1DBY A;  4HEA 2;  1F6M C;  2XBQ A;  1J0F A;  2HLS A;  1TXX A;  4EXJ A;  2FGX A;  2JSZ A;  1T8E B;  1O81 A;  5D8I A;  1AQX A;  4BWS A;  4TN8 A;  5G1L A;  4GXZ A;  2H8L A;  1TK8 B;  2C4J A;  2H73 A;  1DE2 A;  2P31 A;  5IMA A;  3LJR A;  4ISD A;  4JR4 A;  3WYW A;  2X64 A;  3GN3 A;  1NHO A;  4G0K A;  4TR0 A;  4JE1 A;  3C1S A;  2XC2 A;  3PR8 A;  4WR4 A;  4BWQ A;  4O7H A;  1V58 A;  1SJI A;  3PIN A;  2G0F A;  2PBJ A;  2GZZ A;  2HRF A;  2HT9 A;  1PKW A;  3TB2 A;  3TRP A;  3GH9 A;  2XBI A;  2X99 A;  3APO A;  3ZRD A;  1JZO A;  4LL1 B;  2R5G A;  1V40 A;  2OKA A;  5ID2 B;  3ISO A;  5ECR B;  1YY7 A;  1Z7R A;  3W6G A;  1O6J A;  1HD2 A;  6GSX A;  3LWA A;  3GKX A;  1XWA A;  3F63 A;  4ZIL A;  1XG8 A;  1HNC A;  9GSS A;  4KSM A;  4GQC A;  1FO5 A;  2IL3 A;  5D93 A;  3ZZX A;  4N0V A;  2X4A A;  1SK0 A;  1GSS A;  2DIZ A;  3GST A;  2C3N A;  3APS A;  3UIW A;  3DVW A;  5IMF A;  3DML A;  3RBT A;  5DDL A;  3FZ4 A;  5GAN D;  2V41 A;  1TI3 A;  1LJR A;  2FHE A;  3L9V A;  3L78 A;  1KEB A;  1F3A A;  4MF5 A;  1NHY A;  1OE8 A;  1S3D A;  1TK0 B;  3G7I A;  2AV4 A;  1T4Y A;  2G2Q A;  1SD8 A;  5G5F A;  2A4V A;  2C0E A;  5ECO B;  5HQP A;  5INY A;  1OC9 A;  3TGZ A;  1B4Q A;  1HQO A;  1O8X A;  2PMT A;  2OAD A;  4Z2R A;  3ZRE A;  3F8U A;  4PNF A;  1BX9 A;  5ECP B;  4G10 A;  1DE1 A;  1YDK A;  3RHB A;  3TJJ A;  4YH2 A;  2NVL A;  4X4J A;  1AIU A;  4NWY A;  1FAA A;  1M7T A;  2KP2 A;  2OA7 A;  4Z2U A;  4XHM A;  4ML6 A;  1DUG A;  4N10 A;  5B6M A;  1GH2 A;  3EVI A;  1WIK A;  2EC4 A;  3QPM A;  2CA8 A;  1M9B A;  3GTU B;  4ML1 A;  2VL3 A;  5G2Z A;  4ZBD A;  2WCI A;  3W8S A;  2EIO A;  5KN0 A;  2YNX A;  1J08 A;  2OBK A;  3KGK A;  1EGO A;  3RPP A;  4HU7 A;  2CVD A;  3A5W A;  3N5O A;  4F2I A;  2P5Q A;  5CO3 A;  2L6C A;  3HJO A;  1GNW A;  1GSU A;  1MDI A;  2RUF A;  4NMU A;  4NV5 A;  3ZIJ A;  1Z5Y E;  2MMO A;  5IOW A;  3GL3 A;  4KDY A;  1X9M B;  1AC1 A;  3D5J A;  5F07 A;  3TJG A;  1FOH A;  2R37 A;  4MZW A;  1OC9 B;  2GSS A;  1TRW A;  1USB A;  1SJ6 A;  3GYK A;  3LYP A;  2C8U A;  4LMW A;  3QCP A;  3QFB C;  4POB A;  5JCG A;  2DMM A;  2QGV A;  1X9W B;  1ZYE A;  4CDO A;  1QXH A;  4IJ3 A;  3GKN A;  1T7P B;  2IFQ A;  4RI6 A;  1T4Z A;  4HU9 A;  5CAX A;  2PN8 A;  4MZB A;  1K0B A;  1X5E A;  1ZL9 A;  5HR0 A;  2DLX A;  2JZT A;  3U5R E;  4O5R A;  4MZC A;  3P2A A;  4ULX A;  3DYR A;  5IO0 A;  3KMO A;  3TKS A;  4Z7X A;  1X9S B;  2M46 A;  2VL2 C;  3IK7 A;  4GRF A;  5AN1 A;  11GS A;  4PQI A;  4MAB A;  1EV4 A;  1ERU A;  2IWT A;  1SD9 A;  3UEM A;  2FWE A;  1GSQ A;  3HZ4 A;  4KX4 A;  4TRX A;  1GNE A;  4KDX A;  2HXK A;  2CX3 A;  4TR1 A;  3GX8 A;  3TUE A;  5JWO B;  5G30 A;  4KGI A;  2O8V B;  2WS2 A;  2E0Q A;  1H75 A;  2JZS A;  3WT1 A;  5B8A A;  1X5C A;  1TDI A;  7GSS A;  4CW9 A;  4CY6 A;  5C04 A;  4PUR A;  2YJ7 A;  2P5R A;  1PX7 A;  3TJF A;  5HR3 A;  4IP6 A;  3FZA A;  1EZK A;  4NXI A;  4LMV A;  4KB3 A;  2RM5 A;  2GSQ A;  3CYN A;  4LL4 B;  2HRN A;  3C1R A;  3WGX A;  3P8W A;  3H93 A;  1X0R A;  4K5S A;  3G7J A;  5AIV A;  2MZC A;  2YPM A;  3MSZ A;  4BVY B;  1THO A;  2F9S A;  2IMF A;  3L9U A;  2ON5 A;  3GX0 A;  5DCG A;  5HR1 A;  1Q4J A;  4OCE A;  1TRV A;  3GL5 A;  4AJ8 A;  1OAZ A;  4GSN A;  6GSY A;  1R4W A;  1SYR A;  4JR6 A;  3EE2 A;  4ECJ A;  3FZ9 A;  2ZUP A;  1T3B A;  2GLR A;  3TKS E;  1VGL A;  4MJB A;  4EVM A;  4I8B A;  4MF7 A;  1PX6 A;  4CHS A;  2VIM A;  5DQS A;  2VLT A;  4TR1 B;  3VPT A;  1SL1 B;  2VD0 A;  2B5E A;  1M2A A;  1WOU A;  5G1K A;  1GTB A;  3E3E A;  5JWR B;  4IHU A;  2CAI A;  2RLI A;  3M9J A;  3N9J A;  5FT3 A;  2WUL A;  4POL A;  4KF9 A;  4YKG A;  3DRN A;  2HYX A;  5DCH A;  1SK1 A;  2VCW A;  1RW1 A;  2LRC A;  4QL9 A;  2K9F A;  1ABA A;  2WB9 A;  3RDW A;  4FIW A;  1HNB A;  1XW9 A;  1O7U A;  1RK4 A;  1F9M A;  1CQH A;  3GSS A;  1EEJ A;  1EOH A;  3MAK A;  4YQM A;  2JAC A;  2L5O A;  4DSS A;  2UZ8 A;  1UVZ A;  4QL7 A;  1EP7 A;  5CNW A;  22GS A;  1GSY A;  3L0H A;  2HSM A;  1TTZ A;  1EP8 A;  1WPI A;  1MTC A;  4NHZ A;  1A8L A;  4EIP A;  2LST A;  5IIZ A;  1GRX A;  2CVK A;  2H6Z A;  4HQZ A;  1SJZ A;  5IQY A;  2YP6 A;  4YAV A;  5ELA A;  3KXO A;  1XXU A;  3V1W A;  1WP0 A;  2I1U A;  5IMC A;  1IYI A;  3GMF A;  3HZ8 A;  4ZXG A;  1XWK A;  2CX4 A;  5B6N A;  2N5A A;  3F6F A;  3ERW A;  2C0D A;  2X49 A;  4ZL8 A;  3I69 A;  2WDU A;  4WBJ A;  3FR3 A;  1JFU A;  2MBT A;  4OMV A;  3MWH A;  3FK8 A;  1THX A;  3CQF A;  2XHF A;  4EDZ A;  1K3Y A;  2I9H A;  2VCZ A;  2XPD A;  1YEP A;  4NV2 A;  4FQU A;  3M8N A;  1X5D A;  2GS3 A;  5CYY A;  2M72 A;  4HZ2 A;  4DVC A;  1GL8 A;  1GUM A;  1MDJ A;  1XIY A;  2L57 A;  2FLS A;  2REM A;  1AAZ A;  4DSS B;  3D21 A;  1B4P A;  4G9H A;  4MF6 A;  3WD6 A;  2F51 A;  2X8C A;  1B9X C;  2LJA A;  3EIN A;  5ELG A;  1ERT A;  1Z3E A;  1QFN A;  4F0B A;  3EC3 A;  2KP1 A;  2YV9 A;  2VL2 A;  1H4O A;  1S3A A;  2MMA A;  1SL0 B;  5GSS A;  4PNG A;  2VOC A;  1KNG A;  5KN1 A;  4F82 A;  2H74 A;  1N2A A;  4PUF C;  1WE0 A;  1CQG A;  2M80 A;  6GST A;  4EIQ A;  4EDY A;  2YAN A;  1ZYP A;  4OFN A;  3IAS 2;  1EOG A;  5LD0 A;  2RII A;  3IC8 A;  3Q19 A;  1TRS A;  2N5B A;  2PUK C;  2DJK A;  5DJL A;  5FHI A;  2FWF A;  4GF0 A;  5BRT A;  4ZB6 A;  4FH8 A;  3CTG A;  1I5G A;  2OE1 A;  2CT6 A;  3IHG A;  4EC0 A;  18GS A;  2D2Z A;  1EGR A;  1Z6N A;  3D0Z A;  2IMI A;  2V32 A;  3VI5 A;  2VLV A;  1XCC A;  1PRX A;  5ECQ B;  2IMK A;  2B6M A;  1FOV A;  4JBB A;  4EF0 A;  2OE3 A;  4L0W A;  1M99 A;  3KH7 A;  3NOF A;  2MMN A;  2AYT A;  1XOB A;  3H79 A;  2R0P A;  4EE0 A;  2B5Y A;  4IQ1 A;  1PSQ A;  4I6X A;  5B7C A;  2BJX A;  5CRH A;  4MJE A;  1S3C A;  3UAP A;  4X1U A;  5IMV A;  2GSR A;  2X8H A;  1XZO A;  4TXV A;  1XVQ A;  4IKH A;  3S9F A;  5ECS A;  4PGT A;  2R0C A;  4IQA A;  5CRD A;  1I9D A;  1A0F A;  2O85 A;  3QR6 A;  4MA9 A;  3LG6 A;  1HYU A;  2PU9 C;  1A8Y A;  3EPT A;  1NM3 A;  2V6O A;  5KOX A;  3GTU A;  1EWX A;  3FW2 A;  3O76 A;  1K0M A;  1GWC A;  1PN9 A;  2JAD A;  4YQU A;  2A4H A;  2YJH A;  3H8Q A;  1M3I A;  3VWW A;  2QKE A;  3O6T A;  2QA1 A;  1A23 A;  2IMD A;  1FB6 A;  2GT6 A;  4FYC A;  4K6X A;  4DSQ A;  4RI7 A;  5D9X A;  3IC4 A;  3EWL A;  5A4U A;  6GSS A;  2DC5 A;  4IGJ A;  2J9H A;  1FW1 A;  1W4V A;  3CRU A;  1YZX A;  4KND A;  3KZQ A;  4TR3 A;  5ECM B;  3TJK A;  3LOR A;  2GQL A;  3APQ A;  5HFK A;  3ZVJ A;  3TOU A;  5KEJ A;  4WEY A;  4DEJ A;  1K3O A;  3L4N A;  1XW5 A;  4EKZ A;  3ZLP A;  4N0Z A;  2FWH A;  1JZR A;  3Q6O A;  2E7P A;  2VUP A;  3M0F A;  5IMD A;  2GST A;  1F2E A;  3RAZ A;  2FNO A;  2OBI A;  4GQF A;  2VAF A;  1LU4 A;  1OC8 A;  2FCH A;  4TR4 A;  4RUV A;  5EPF A;  2FA4 A;  2K8V A;  3D4M A;  2V1M A;  2H66 A;  1V9W A;  3CRT A;  4V2N A;  2ALB A;  3LSZ A;  3GIX A;  2IME A;  5ECN B;  4ECI A;  4ZBB A;  3D6I A;  2BMX A;  3F3Q A;  4YKF A;  3DWV A;  1U3I A;  3HVV A;  4CY8 A;  4G19 A;  3Q74 A;  2PPT A;  5DAL A;  3GNJ A;  4KAE A;  2HFD A;  5EVO A;  1WJK A;  1VF4 A;  4I97 A;  2H0H A;  5CP1 A;  2YCD A;  2LRT A;  4K7I A;  5JCW A;  1SKW B;  4G2E A;  2VM1 A;  4X0X A;  4OD7 A;  3F9U A;  4F0C A;  2R0G A;  5D9V A;  4O5U A;  3KH9 A;  3US3 A;  5KN2 A;  1OVN A;  2YN1 A;  3ME8 A;  1JZW A;  4XIH A;  3QAV A;  3ME7 A;  1OKT A;  3F4R A;  2GTU A;  1FB0 A;  4Z2T A;  2B1L A;  5LNK e;  4RQR A;  4K8M A;  1SEN A;  2VCT A;  2IJY A;  4OFM A;  2PVO C;  2TIR A;  3LYK A;  2R3X A;  1OKD A;  1PQN A;  2K18 A;  4OO5 A;  1GLQ A;  2N5F A;  4BVY A;  2AB6 A;  3VPQ A;  2J23 A;  4OWY A;  4K2X A;  3KM6 A;  4LA1 A;  1M3J A;  3IE3 A;  2FUG 2;  2H1G A;  5H5Q A;  4D73 A;  1U3A A;  5DBQ A;  3LFL A;  3O3T A;  3ZFB A;  2H75 A;  4PTS A;  1PN0 A;  4YAP A;  4HZ4 A;  5DAL B;  3HCZ A;  1B8X A;  3UBL A;  2AAW A;  5F0G A;  4WBR D;  3VWV A;  3TJB A;  2CAQ A;  4WF5 A;  4MPG A;  5D73 A;  2RUE A;  2HZE A;  1SL2 B;  2XPE A;  5IM9 A;  2DKH A;  4HOJ A;  3ZIT A;  2PVQ A;  17GS A;  4MPF A;  4TOP A;  3ZMK A;  6GSV A;  3EYT A;  3PPU A;  4I2T A;  1PL1 A;  1XFL A;  5ECI B;  4KE3 A;  4ICY A;  5EY6 A;  3HDC A;  1VF3 A;  5CRW A;  3KEB A;  4FO5 A;  4AF2 A;  2VCQ A;  4BA7 A;  4ZBA A;  1SK2 A;  2V6K A;  2JL4 A;  1Z7P A;  2YOI A;  3IR4 A;  1Y25 A;  3TOT A;  5A4W A;  4HJM A;  1NW2 A;  3P7X A;  5JWQ B;  3SBC A;  4F9Z A;  2WJU A;  4Q5R A;  1K0N A;  5AGY A;  2VM2 A;  3C71 A;  2TRC P;  3IDV A;  4TKY A;  3QOU A;  2C3Q A;  3ERF A;  1F3B A;  3BJ5 A;  1T1V A;  4H86 A;  1OYJ A;  1TJD A;  1ZZY A;  3BD2 A;  3CSI A;  3K8N A;  3KIJ A;  3NZN A;  4D73 B;  1GTI A;  3FRC A;  3I9V 2;  1KTE A;  1AW9 A;  3FHK A;  2C3T A;  1GSE A;  1B9Y C;  3TKR A;  2PER A;  4PQH A;  2K6V A;  1XWG A;  1URM A;  2IN3 A;  19GS A;  1PKZ A;  2HZE B;  4ZB8 A;  2RM6 A;  4XRA A;  5LCZ A;  4V1A g;  4ECC A;  3MIX A;  4IBP A;  1O8W A;  2YZU A;  5J41 A;  4Q5Q A;  2CZ3 A;  1G0T A;  2C1Y A;  2H19 A;  3HD5 A;  2P0G A;  1UN2 A;  2WRT A;  4JRR A;  3TCO A;  1M2B A;  4EL1 A;  1XOA A;  1UC7 A;  4GLT A;  1SU9 A;  4F03 A;  1ILO A;  1T00 A;  1K0A A;  1PA3 A;  1K0O A;  4MMM A;  3J7Y k;  4ECB A;  3ERG A;  4E8H A;  5C00 A;  5AIS A;  1YF1 A;  1MDK A;  2R4V A;  1ERV A;  1GTU A;  4TW5 A;  3LW9 A;  3GKM A;  4J57 E;  3IPZ A;  1VF2 A;  3EMP A;  4GSS A;  4HS1 A;  3FR9 A;  3UOM A;  2LNS A;  1ZCP A;  2YWN A;  5DJM A;  1DSB A;  3UVH A;  3H4K A;  1TU7 A;  5CRE A;  3BOA A;  3CMI A;  3ZTL A;  2GVP A;  4JZQ A;  4DSR A;  4WKW A;  1BG5 A;  4XTS A;  2YWI A;  3M3M A;  3C73 A;  4K7O A;  4V2M A;  3FKF A;  2K8S A;  2B7K A;  1TI1 A;  5IOX A;  3UVT A;  4IVF A;  2H76 A;  4IN0 A;  1TK5 B;  4K2D A;  3LXZ A;  3VFI A;  4O5Q A;  2EIR A;  3JCM L;  2JZR A;  1YJ6 A;  5HFG A;  3U6V A;  3HVS A;  3HY2 A;  2HRK A;  2VL9 A;  1V2A A;  4K7N A;  5J9C A;  1SKS B;  4XCS A;  4IJI A;  3DIE A;  2B3S A;  3UMA A;  4KH7 A;  3AY8 A;  3F3R A;  5CRG A;  5F05 A;  1U88 A;  4MK3 A;  1JLV A;  2QSI A;  1Y6E A;  1XWB A;  2AHE A;  3UJ1 A;  3KTL A;  2MBS A;  1F37 A;  1PL2 A;  3HJM A;  1HNA A;  4PUA A;  1TW9 A;  1A24 A;  1AUC A;  5IO2 A;  3OR5 A;  4L8E A;  2BTO T;  1ACV A;  1W89 A;  4G0I A;  1EEM A;  2A2P A;  3WGD A;  1ZYQ B;  3I6A A;  2I81 A;  3J7Y b;  4L5L A;  4ZL9 A;  4A5P A;  2CVB A;  3GUR A;  5DQY A;  3DD3 A;  1M9A A;  2LJR A;  4ACS A;  3A2V A;  2DJJ A;  5F06 A;  3HA9 A;  4JU5 A;  2VCV A;  3D22 A;  1U87 A;  2WFC A;  2NTO A;  2MMZ A;  3IOS A;  2I4A A;  4XS6 A;  1BQ7 A;  2IIY A;  5ECL B;  8GSS A;  1YQ1 A;  1PFO A;  1VRS D;  2GQM A;  2O89 A;  4XRD A;  1GTA A;  3E9J B;  3EU3 A;  3EMX A;  3IA1 A;  4G0L A;  1R5A A;  5H5S A;  4KW6 A;  1NSW A;  2HNL A;  3CSJ A;  2R6K A;  3IRA A;  4KCA A;  1EV9 A;  2H1D A;  2H72 A;  14GS A;  4MCU A;  2NPB A;  3BCK A;  1E6B A;  2AUV A;  2H6Y A;  4K0N A;  2GZP A;  2DBC A;  1PD2 1;  4OO4 A;  1GUL A;  4J56 E;  4IS0 A;  3WGE A;  1V57 A;  2F8F A;  5FWG A;  2DIY A;  1RQM A;  1WRY A;  2H6X A;  3FEU A;  3F4S A;  1ZYN A;  4KUN A;  3CTF A;  4ZB9 A;  3ZIV A;  3ZL5 A;  4FYB A;  3A3T A;  2KLX A;  2OE0 A;  4I5Q A;  1K0D A;  2FA8 A;  1R5P A;  2HE3 A;  3DEX A;  1MD3 A;  4BVX A;  4MH3 A;  2V2G A;  3MDK A;  2NBS A;  2B7J A;  5G31 A;  2R2J A;  2VCX A;  1FHE A;  2F8A A;  3G7Y A;  1WWJ A;  5F8B A;  4Q5N A;  1BJX A;  5IPH A;  4E8E A;  2EIQ A;  5COH A;  4NAX A;  3FZ5 A;  4POK A;  1WMJ A;  3ZFL A;  3UL3 A;  2LRN A;  4MNN A;  2YWO A;  1K3L A;  3DXB A;  3QMX A;  5D9W A;  1FVK A;  2PGT A;  1SKR B;  5J4U A;  2H1A A;  3KP9 A;  1TRU A;  2C80 A;  3KP8 A;  2ZCT A;  2A2S A;  2PWJ A;  4MLY A;  2HSH A;  3D4T A;  1GSD A;  3GFK A;  3KTB A;  2O87 A;  3NIV A;  4OFT A;  4GTU A;  1QK8 A;  10GS A;  3CBU A;  2YWM A;  5KOW A;  2GQK A;  2DJ3 A;  1V98 A;  3F0I A; 
#chains in the Genus database with same CATH homology
 4AJ7 A;  5BMU A;  2GT5 A;  3E0U A;  1R26 A;  3P90 A;  5GAP D;  3FMW A;  4LLR A;  3C8E A;  5KN3 A;  4X43 A;  1QUW A;  3TRX A;  5ENU A;  3VK9 A;  3TKQ A;  4BVX B;  2ZNM A;  4V2L A;  1TP9 A;  5IMZ A;  2H30 A;  1JLW A;  4TXO A;  5E59 A;  5GST A;  2ON7 A;  3TKP A;  4BPY A;  3ED3 A;  4USS A;  1XWC A;  4I2U A;  2H71 A;  2YZH A;  3CXG A;  5DAK A;  4AGS A;  3EUR A;  3GV1 A;  2GZY A;  3DVX A;  1PMT A;  4RQX A;  1KBN A;  2L6D A;  4ILF A;  1UA5 A;  1Z6M A;  3QDN A;  1G6Y A;  3IXR A;  1BED A;  5D9T A;  4N11 A;  1G7O A;  3SWL A;  3DKS A;  2TRX A;  3H1N A;  3KMN A;  1O73 A;  5AIX A;  3BCI A;  2DJ1 A;  1QGV A;  1ERW A;  3MYD A;  2KOK A;  1C72 A;  4YQV A;  3QAW A;  1XW6 A;  1ST9 A;  13GS A;  3HHV A;  1M0U A;  1YEX A;  2IPA A;  1ZOF A;  4KDU A;  2AJQ B;  1TOF A;  2L59 A;  2MYG A;  1R7H A;  2C0G A;  3KD0 A;  1A2J A;  2HRA A;  4XS4 A;  2YV7 A;  3A2W A;  1GUH A;  4TVE A;  3HJP A;  4BL7 A;  1LBK A;  3HYP A;  5L71 A;  1ZMA A;  1M2D A;  2WZ9 A;  5EL8 A;  3M1G A;  3G9B A;  1FG4 A;  1YKC A;  4TXO B;  4K1F A;  6GSW A;  2H01 A;  3PH9 A;  5HR2 A;  1IYH A;  4HQS A;  3F4T A;  4POM A;  5DAK B;  3M9K A;  2DKI A;  2DML A;  4WET A;  5D96 A;  4OCF A;  2LUS A;  2LQQ A;  1QQ2 A;  1O85 A;  1B48 A;  2VD1 A;  3A2X A;  2WGR A;  3BBY A;  2CQ9 A;  3LQ7 A;  3LGC A;  2H1B A;  3GKK A;  4MJA A;  5E4W A;  2F3M A;  1GP1 A;  2E2G A;  16GS A;  1JZD A;  2IFQ B;  4MP4 A;  4EUY A;  2VO4 A;  3DGQ A;  1FVJ A;  4HJ2 A;  1JHB A;  1OE7 A;  3ZML A;  3ZYW A;  4V1A p;  4K5R A;  3QFA C;  4WF4 A;  4IW9 A;  4P3Y B;  3EU4 A;  3CSH A;  1ML6 A;  4XS4 B;  1YKA A;  2JU5 A;  5B8B A;  2DJ2 A;  4KCE A;  4HDE A;  3R3E A;  1G6W A;  4O32 A;  4BL7 B;  1AXD A;  5J5N A;  2LKU A;  5HFI A;  1ON4 A;  5DVB A;  4L0U A;  2FD3 A;  3MNG A;  1SYX A;  1XVW A;  4ID0 A;  1GSF A;  3VLN A;  3HVX A;  1TU8 A;  4WXT A;  3QD9 A;  4N30 A;  4XS1 A;  4GCI A;  4AJ6 A;  1XBS A;  2LEG A;  1AQW A;  2LJK A;  2HI7 A;  5J9B A;  3IK9 A;  6GSU A;  3UBK A;  1PGT A;  1OC3 A;  2ES7 A;  4NHW A;  2FY6 A;  4HUA A;  2OJL A;  2X8G A;  2KUC A;  2FWG A;  4MJC A;  4EO3 A;  4K0G A;  2LNT A;  3A5I A;  4MH2 A;  3FYG A;  2DSA A;  5A4V A;  1VF1 A;  2KHP A;  5J3R A;  2JSY A;  2H0G A;  1N8J A;  3PGT A;  2QA2 A;  4O92 A;  3VUR A;  1GUK A;  3F6D A;  2A2R A;  2LQO A;  2LV3 A;  3FY7 A;  2LS5 A;  1ZGN A;  2B1K A;  4FYU A;  4WR5 A;  4HI7 A;  1BYE A;  1K0C A;  2GGT A;  3HXS A;  2C0F A;  1MEK A;  4IEL A;  2H70 A;  2CV4 A;  2LTK A;  2L5L A;  3GUS A;  3WT2 A;  4IP1 A;  3RPN A;  2L4Q A;  4KSO A;  3C7M A;  5ECH B;  5A5K A;  1BAY A;  4K9Z A;  3QAG A;  4ZIJ A;  3W8J A;  1YF0 A;  3GRX A;  3IHQ A;  2NDO A;  3I43 A;  3VI7 A;  5ECK B;  1XPV A;  1E2Y A;  4PXO A;  3VWU A;  1G7E A;  20GS A;  4GWR A;  4PQ1 A;  3KCM A;  5JCU A;  1MD4 A;  3R2Q A;  3GH6 A;  4Q5F A;  3HKR A;  4L5O A;  2O7K A;  1Z9H A;  2GDR A;  3GHA A;  1A2L A;  4J2F A;  1TKD B;  3KJY A;  12GS A;  3IBH A;  2OAC A;  3GA4 A;  2CZ2 A;  3Q18 A;  1GLP A;  2HZF A;  1AQV A;  3TRQ A;  2DJ0 A;  4ZL7 A;  1J9B A;  3TDG A;  4JED A;  4NPB A;  2L4C A;  2QC7 A;  5G5E A;  1A2M A;  4KA0 A;  2B5X A;  3IAM 2;  3L9S A;  1A0R P;  3FR6 A;  5GZZ B;  1QMV A;  2H0I A;  4PX1 A;  4GST A;  3LXT A;  3IV4 A;  3RHC A;  2I3Y A;  2E2M A;  3VWX A;  3LEF A;  2Z9S A;  1U6T A;  5ID2 A;  2HSY A;  2VLU A;  3UAR A;  5IPG A;  3TKS C;  3ZVJ D;  5H5R A;  4QQ7 A;  1Q98 A;  4MDC A;  5ABR A;  1DBY A;  4HEA 2;  1F6M C;  2XBQ A;  1J0F A;  2HLS A;  1TXX A;  4EXJ A;  2FGX A;  2JSZ A;  1T8E B;  1O81 A;  5D8I A;  1AQX A;  4BWS A;  4TN8 A;  5G1L A;  4GXZ A;  2H8L A;  1TK8 B;  2C4J A;  2H73 A;  1DE2 A;  2P31 A;  5IMA A;  3LJR A;  4ISD A;  4JR4 A;  3WYW A;  2X64 A;  3GN3 A;  1NHO A;  4G0K A;  4TR0 A;  4JE1 A;  3C1S A;  2XC2 A;  3PR8 A;  4WR4 A;  4BWQ A;  4O7H A;  1V58 A;  1SJI A;  3PIN A;  2G0F A;  2PBJ A;  2GZZ A;  2HRF A;  2HT9 A;  1PKW A;  3TB2 A;  3TRP A;  3GH9 A;  2XBI A;  2X99 A;  3APO A;  3ZRD A;  1JZO A;  4LL1 B;  2R5G A;  1V40 A;  2OKA A;  5ID2 B;  3ISO A;  5ECR B;  1YY7 A;  1Z7R A;  3W6G A;  1O6J A;  1HD2 A;  6GSX A;  3LWA A;  3GKX A;  1XWA A;  3F63 A;  4ZIL A;  1HNC A;  9GSS A;  4KSM A;  4GQC A;  1FO5 A;  2IL3 A;  5D93 A;  3ZZX A;  4N0V A;  2X4A A;  1SK0 A;  1GSS A;  2DIZ A;  3GST A;  2C3N A;  3APS A;  3UIW A;  3DVW A;  5IMF A;  3DML A;  3RBT A;  5DDL A;  3FZ4 A;  5GAN D;  2V41 A;  1TI3 A;  1LJR A;  2FHE A;  3L9V A;  3L78 A;  1KEB A;  1F3A A;  4MF5 A;  1NHY A;  1OE8 A;  1S3D A;  1TK0 B;  3G7I A;  2AV4 A;  1T4Y A;  2G2Q A;  1SD8 A;  5G5F A;  2A4V A;  2C0E A;  5ECO B;  5HQP A;  5INY A;  1OC9 A;  3TGZ A;  1B4Q A;  1HQO A;  1O8X A;  2PMT A;  2OAD A;  4Z2R A;  3ZRE A;  3F8U A;  4PNF A;  1BX9 A;  5ECP B;  4G10 A;  1DE1 A;  1YDK A;  3RHB A;  3TJJ A;  4YH2 A;  2NVL A;  4X4J A;  1AIU A;  4NWY A;  1FAA A;  1M7T A;  2KP2 A;  2OA7 A;  4Z2U A;  4XHM A;  4ML6 A;  1DUG A;  4N10 A;  5B6M A;  1GH2 A;  3EVI A;  1WIK A;  2EC4 A;  3QPM A;  2CA8 A;  1M9B A;  3GTU B;  4ML1 A;  2VL3 A;  5G2Z A;  4ZBD A;  2WCI A;  3W8S A;  2EIO A;  5KN0 A;  2YNX A;  1J08 A;  2OBK A;  3KGK A;  1EGO A;  3RPP A;  4HU7 A;  2CVD A;  3A5W A;  3N5O A;  4F2I A;  2P5Q A;  5CO3 A;  2L6C A;  3HJO A;  1GNW A;  1GSU A;  1MDI A;  2RUF A;  4NMU A;  4NV5 A;  3ZIJ A;  1Z5Y E;  2MMO A;  5IOW A;  3GL3 A;  4KDY A;  1X9M B;  1AC1 A;  3D5J A;  5F07 A;  3TJG A;  1FOH A;  2R37 A;  4MZW A;  1OC9 B;  2GSS A;  1TRW A;  1USB A;  1SJ6 A;  3GYK A;  3LYP A;  2C8U A;  4LMW A;  3QCP A;  3QFB C;  4POB A;  5JCG A;  2DMM A;  2QGV A;  1X9W B;  1ZYE A;  4CDO A;  1QXH A;  4IJ3 A;  3GKN A;  1T7P B;  2IFQ A;  4RI6 A;  1T4Z A;  4HU9 A;  5CAX A;  2PN8 A;  4MZB A;  1K0B A;  1X5E A;  1ZL9 A;  5HR0 A;  2DLX A;  2JZT A;  3U5R E;  4O5R A;  4MZC A;  3P2A A;  4ULX A;  3DYR A;  5IO0 A;  3KMO A;  3TKS A;  4Z7X A;  1X9S B;  2M46 A;  2VL2 C;  3IK7 A;  4GRF A;  5AN1 A;  11GS A;  4PQI A;  4MAB A;  1EV4 A;  1ERU A;  2IWT A;  1SD9 A;  3UEM A;  2FWE A;  1GSQ A;  3HZ4 A;  4KX4 A;  4TRX A;  1GNE A;  4KDX A;  2HXK A;  2CX3 A;  4TR1 A;  3GX8 A;  3TUE A;  5JWO B;  5G30 A;  4KGI A;  2O8V B;  2WS2 A;  2E0Q A;  1H75 A;  2JZS A;  3WT1 A;  5B8A A;  1X5C A;  1TDI A;  7GSS A;  4CW9 A;  4CY6 A;  5C04 A;  4PUR A;  2YJ7 A;  2P5R A;  1PX7 A;  3TJF A;  5HR3 A;  4IP6 A;  3FZA A;  1EZK A;  4NXI A;  4LMV A;  4KB3 A;  2RM5 A;  2GSQ A;  3CYN A;  4LL4 B;  2HRN A;  3C1R A;  3WGX A;  3P8W A;  3H93 A;  1X0R A;  4K5S A;  3G7J A;  5AIV A;  2MZC A;  2YPM A;  3MSZ A;  4BVY B;  1THO A;  2F9S A;  2IMF A;  3L9U A;  2ON5 A;  3GX0 A;  5DCG A;  5HR1 A;  1Q4J A;  4OCE A;  1TRV A;  3GL5 A;  4AJ8 A;  1OAZ A;  4GSN A;  6GSY A;  1R4W A;  1SYR A;  4JR6 A;  3EE2 A;  4ECJ A;  3FZ9 A;  2ZUP A;  1T3B A;  2GLR A;  3TKS E;  1VGL A;  4MJB A;  4EVM A;  4I8B A;  4MF7 A;  1PX6 A;  4CHS A;  2VIM A;  5DQS A;  2VLT A;  4TR1 B;  3VPT A;  1SL1 B;  2VD0 A;  2B5E A;  1M2A A;  1WOU A;  5G1K A;  1GTB A;  3E3E A;  5JWR B;  4IHU A;  2CAI A;  2RLI A;  3M9J A;  3N9J A;  5FT3 A;  2WUL A;  4POL A;  4KF9 A;  4YKG A;  3DRN A;  2HYX A;  5DCH A;  1SK1 A;  2VCW A;  1RW1 A;  2LRC A;  4QL9 A;  2K9F A;  1ABA A;  2WB9 A;  3RDW A;  4FIW A;  1HNB A;  1XW9 A;  1O7U A;  1RK4 A;  1F9M A;  1CQH A;  3GSS A;  1EEJ A;  1EOH A;  3MAK A;  4YQM A;  2JAC A;  2L5O A;  4DSS A;  2UZ8 A;  1UVZ A;  4QL7 A;  1EP7 A;  5CNW A;  22GS A;  1GSY A;  3L0H A;  2HSM A;  1TTZ A;  1EP8 A;  1WPI A;  1MTC A;  4NHZ A;  1A8L A;  4EIP A;  2LST A;  5IIZ A;  1GRX A;  2CVK A;  2H6Z A;  4HQZ A;  1SJZ A;  5IQY A;  2YP6 A;  4YAV A;  5ELA A;  3KXO A;  1XXU A;  3V1W A;  1WP0 A;  2I1U A;  5IMC A;  1IYI A;  3GMF A;  3HZ8 A;  4ZXG A;  1XWK A;  2CX4 A;  5B6N A;  2N5A A;  3F6F A;  3ERW A;  2C0D A;  2X49 A;  4ZL8 A;  3I69 A;  2WDU A;  4WBJ A;  3FR3 A;  1JFU A;  2MBT A;  4OMV A;  3MWH A;  3FK8 A;  1THX A;  4EDZ A;  2XHF A;  1K3Y A;  2I9H A;  2VCZ A;  2XPD A;  1YEP A;  4NV2 A;  4FQU A;  3M8N A;  1X5D A;  2GS3 A;  5CYY A;  2M72 A;  4HZ2 A;  4DVC A;  1GL8 A;  1GUM A;  1MDJ A;  1XIY A;  2L57 A;  2FLS A;  2REM A;  1AAZ A;  4DSS B;  3D21 A;  1B4P A;  4G9H A;  4MF6 A;  3WD6 A;  2F51 A;  2X8C A;  1B9X C;  2LJA A;  3EIN A;  5ELG A;  1ERT A;  1Z3E A;  1QFN A;  4F0B A;  3EC3 A;  2KP1 A;  2YV9 A;  2VL2 A;  1H4O A;  1S3A A;  2MMA A;  1SL0 B;  5GSS A;  4PNG A;  2VOC A;  1KNG A;  5KN1 A;  4F82 A;  2H74 A;  1N2A A;  4PUF C;  1WE0 A;  1CQG A;  2M80 A;  6GST A;  4EIQ A;  4EDY A;  2YAN A;  1ZYP A;  4OFN A;  3IAS 2;  1EOG A;  5LD0 A;  2RII A;  3IC8 A;  3Q19 A;  1TRS A;  2N5B A;  2PUK C;  2DJK A;  5DJL A;  5FHI A;  2FWF A;  4GF0 A;  5BRT A;  4ZB6 A;  4FH8 A;  3CTG A;  1I5G A;  2OE1 A;  2CT6 A;  3IHG A;  4EC0 A;  18GS A;  2D2Z A;  1EGR A;  1Z6N A;  3D0Z A;  2IMI A;  2V32 A;  3VI5 A;  2VLV A;  1XCC A;  1PRX A;  5ECQ B;  2IMK A;  2B6M A;  1FOV A;  4JBB A;  4EF0 A;  2OE3 A;  4L0W A;  1M99 A;  3KH7 A;  3NOF A;  2MMN A;  2AYT A;  1XOB A;  3H79 A;  2R0P A;  4EE0 A;  2B5Y A;  4IQ1 A;  1PSQ A;  4I6X A;  5B7C A;  2BJX A;  5CRH A;  4MJE A;  1S3C A;  3UAP A;  4X1U A;  5IMV A;  2GSR A;  2X8H A;  1XZO A;  4TXV A;  1XVQ A;  4IKH A;  3S9F A;  5ECS A;  4PGT A;  2R0C A;  4IQA A;  5CRD A;  1I9D A;  1A0F A;  2O85 A;  3QR6 A;  4MA9 A;  3LG6 A;  1HYU A;  2PU9 C;  1A8Y A;  3EPT A;  1NM3 A;  2V6O A;  5KOX A;  3GTU A;  1EWX A;  3FW2 A;  3O76 A;  1K0M A;  1GWC A;  1PN9 A;  2JAD A;  4YQU A;  2A4H A;  2YJH A;  3H8Q A;  3VWW A;  2QKE A;  3O6T A;  2QA1 A;  1A23 A;  2IMD A;  1FB6 A;  2GT6 A;  4FYC A;  4K6X A;  4DSQ A;  4RI7 A;  5D9X A;  3IC4 A;  3EWL A;  5A4U A;  6GSS A;  2DC5 A;  4IGJ A;  2J9H A;  1FW1 A;  1W4V A;  3CRU A;  1YZX A;  4KND A;  3KZQ A;  4TR3 A;  5ECM B;  3TJK A;  3LOR A;  2GQL A;  3APQ A;  5HFK A;  3ZVJ A;  3TOU A;  5KEJ A;  4WEY A;  4DEJ A;  1K3O A;  3L4N A;  1XW5 A;  4EKZ A;  3ZLP A;  4N0Z A;  2FWH A;  1JZR A;  3Q6O A;  2E7P A;  2VUP A;  3M0F A;  5IMD A;  2GST A;  1F2E A;  3RAZ A;  2FNO A;  2OBI A;  4GQF A;  2VAF A;  1LU4 A;  1OC8 A;  2FCH A;  4TR4 A;  4RUV A;  5EPF A;  2FA4 A;  2K8V A;  3D4M A;  2V1M A;  2H66 A;  1V9W A;  3CRT A;  4V2N A;  2ALB A;  3LSZ A;  3GIX A;  2IME A;  5ECN B;  4ECI A;  4ZBB A;  3D6I A;  2BMX A;  3F3Q A;  4YKF A;  3DWV A;  1U3I A;  3HVV A;  4CY8 A;  4G19 A;  3Q74 A;  2PPT A;  5DAL A;  3GNJ A;  4KAE A;  2HFD A;  5EVO A;  1WJK A;  1VF4 A;  4I97 A;  2H0H A;  5CP1 A;  2YCD A;  2LRT A;  4K7I A;  5JCW A;  1SKW B;  4G2E A;  2VM1 A;  4X0X A;  4OD7 A;  3F9U A;  4F0C A;  2R0G A;  5D9V A;  4O5U A;  3KH9 A;  3US3 A;  5KN2 A;  1OVN A;  2YN1 A;  3ME8 A;  1JZW A;  4XIH A;  3QAV A;  3ME7 A;  1OKT A;  3F4R A;  2GTU A;  1FB0 A;  4Z2T A;  2B1L A;  5LNK e;  4RQR A;  4K8M A;  1SEN A;  2VCT A;  2IJY A;  4OFM A;  2PVO C;  2TIR A;  3LYK A;  2R3X A;  1OKD A;  1PQN A;  2K18 A;  4OO5 A;  1GLQ A;  2N5F A;  4BVY A;  2AB6 A;  3VPQ A;  2J23 A;  4OWY A;  4K2X A;  3KM6 A;  4LA1 A;  3IE3 A;  2FUG 2;  2H1G A;  5H5Q A;  4D73 A;  1U3A A;  5DBQ A;  3LFL A;  3O3T A;  3ZFB A;  2H75 A;  4PTS A;  1PN0 A;  4YAP A;  4HZ4 A;  5DAL B;  3HCZ A;  1B8X A;  3UBL A;  2AAW A;  5F0G A;  4WBR D;  3VWV A;  3TJB A;  2CAQ A;  4WF5 A;  4MPG A;  5D73 A;  2RUE A;  2HZE A;  1SL2 B;  2XPE A;  5IM9 A;  2DKH A;  4HOJ A;  3ZIT A;  2PVQ A;  17GS A;  4MPF A;  4TOP A;  3ZMK A;  6GSV A;  3EYT A;  3PPU A;  4I2T A;  1PL1 A;  1XFL A;  5ECI B;  4KE3 A;  4ICY A;  5EY6 A;  3HDC A;  1VF3 A;  5CRW A;  3KEB A;  4FO5 A;  4AF2 A;  2VCQ A;  4BA7 A;  4ZBA A;  1SK2 A;  2V6K A;  2JL4 A;  1Z7P A;  2YOI A;  3IR4 A;  1Y25 A;  3TOT A;  5A4W A;  4HJM A;  1NW2 A;  3P7X A;  5JWQ B;  3SBC A;  4F9Z A;  2WJU A;  4Q5R A;  1K0N A;  5AGY A;  2VM2 A;  3C71 A;  2TRC P;  3IDV A;  4TKY A;  3QOU A;  2C3Q A;  3ERF A;  1F3B A;  3BJ5 A;  1T1V A;  4H86 A;  1OYJ A;  1TJD A;  1ZZY A;  3BD2 A;  3CSI A;  3K8N A;  3KIJ A;  3NZN A;  4D73 B;  1GTI A;  3FRC A;  3I9V 2;  1KTE A;  1AW9 A;  3FHK A;  2C3T A;  1GSE A;  1B9Y C;  3TKR A;  2PER A;  4PQH A;  2K6V A;  1XWG A;  1URM A;  2IN3 A;  19GS A;  1PKZ A;  2HZE B;  4ZB8 A;  2RM6 A;  4XRA A;  5LCZ A;  4V1A g;  4ECC A;  3MIX A;  4IBP A;  1O8W A;  2YZU A;  5J41 A;  4Q5Q A;  2CZ3 A;  1G0T A;  2C1Y A;  2H19 A;  3HD5 A;  2P0G A;  1UN2 A;  2WRT A;  4JRR A;  3TCO A;  1M2B A;  4EL1 A;  1XOA A;  1UC7 A;  4GLT A;  1SU9 A;  4F03 A;  1ILO A;  1T00 A;  1K0A A;  1PA3 A;  1K0O A;  4MMM A;  3J7Y k;  4ECB A;  3ERG A;  4E8H A;  5C00 A;  5AIS A;  1YF1 A;  1MDK A;  2R4V A;  1ERV A;  1GTU A;  4TW5 A;  3LW9 A;  3GKM A;  4J57 E;  3IPZ A;  1VF2 A;  3EMP A;  4GSS A;  4HS1 A;  3FR9 A;  3UOM A;  2LNS A;  1ZCP A;  2YWN A;  5DJM A;  1DSB A;  3UVH A;  3H4K A;  1TU7 A;  5CRE A;  3BOA A;  3CMI A;  3ZTL A;  2GVP A;  4JZQ A;  4DSR A;  4WKW A;  1BG5 A;  4XTS A;  2YWI A;  3M3M A;  3C73 A;  4K7O A;  4V2M A;  3FKF A;  2K8S A;  2B7K A;  1TI1 A;  5IOX A;  3UVT A;  4IVF A;  2H76 A;  4IN0 A;  1TK5 B;  4K2D A;  3LXZ A;  3VFI A;  4O5Q A;  2EIR A;  3JCM L;  2JZR A;  1YJ6 A;  5HFG A;  3U6V A;  3HVS A;  3HY2 A;  2HRK A;  2VL9 A;  1V2A A;  4K7N A;  5J9C A;  1SKS B;  4XCS A;  4IJI A;  3DIE A;  2B3S A;  3UMA A;  4KH7 A;  3AY8 A;  3F3R A;  5CRG A;  5F05 A;  1U88 A;  4MK3 A;  1JLV A;  2QSI A;  1Y6E A;  1XWB A;  2AHE A;  3UJ1 A;  3KTL A;  2MBS A;  1F37 A;  1PL2 A;  3HJM A;  1HNA A;  4PUA A;  1TW9 A;  1A24 A;  1AUC A;  5IO2 A;  3OR5 A;  4L8E A;  2BTO T;  1ACV A;  1W89 A;  4G0I A;  1EEM A;  2A2P A;  3WGD A;  1ZYQ B;  3I6A A;  2I81 A;  3J7Y b;  4L5L A;  4ZL9 A;  4A5P A;  2CVB A;  3GUR A;  5DQY A;  3DD3 A;  1M9A A;  2LJR A;  4ACS A;  3A2V A;  2DJJ A;  5F06 A;  3HA9 A;  4JU5 A;  2VCV A;  3D22 A;  1U87 A;  2WFC A;  2NTO A;  2MMZ A;  3IOS A;  2I4A A;  4XS6 A;  1BQ7 A;  2IIY A;  5ECL B;  8GSS A;  1YQ1 A;  1VRS D;  2GQM A;  2O89 A;  4XRD A;  1GTA A;  3E9J B;  3EU3 A;  3EMX A;  3IA1 A;  4G0L A;  1R5A A;  5H5S A;  4KW6 A;  1NSW A;  2HNL A;  3CSJ A;  2R6K A;  3IRA A;  4KCA A;  1EV9 A;  2H1D A;  2H72 A;  14GS A;  4MCU A;  2NPB A;  3BCK A;  1E6B A;  2AUV A;  2H6Y A;  4K0N A;  2GZP A;  2DBC A;  1PD2 1;  4OO4 A;  1GUL A;  4J56 E;  4IS0 A;  3WGE A;  1V57 A;  2F8F A;  5FWG A;  2DIY A;  1RQM A;  1WRY A;  2H6X A;  3FEU A;  3F4S A;  1ZYN A;  4KUN A;  3CTF A;  4ZB9 A;  3ZIV A;  3ZL5 A;  4FYB A;  3A3T A;  2KLX A;  2OE0 A;  4I5Q A;  1K0D A;  2FA8 A;  1R5P A;  2HE3 A;  3DEX A;  1MD3 A;  4BVX A;  4MH3 A;  2V2G A;  3MDK A;  2NBS A;  2B7J A;  5G31 A;  2R2J A;  2VCX A;  1FHE A;  2F8A A;  3G7Y A;  1WWJ A;  5F8B A;  4Q5N A;  1BJX A;  5IPH A;  4E8E A;  2EIQ A;  5COH A;  4NAX A;  3FZ5 A;  4POK A;  1WMJ A;  3ZFL A;  3UL3 A;  2LRN A;  4MNN A;  2YWO A;  1K3L A;  3DXB A;  3QMX A;  5D9W A;  1FVK A;  2PGT A;  1SKR B;  5J4U A;  2H1A A;  3KP9 A;  1TRU A;  2C80 A;  3KP8 A;  2ZCT A;  2A2S A;  2PWJ A;  4MLY A;  2HSH A;  3D4T A;  1GSD A;  3GFK A;  3KTB A;  2O87 A;  3NIV A;  4OFT A;  4GTU A;  1QK8 A;  10GS A;  3CBU A;  2YWM A;  5KOW A;  2GQK A;  2DJ3 A;  1V98 A;  3F0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...