3VFIA

Crystal structure of a metagenomic thioredoxin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
104
structure length
104
Chain Sequence
LRSLSDSDFQLEVRQHPDPIIIMFTGSWCQPCKKMKPTFEEMASQMEGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTMNKSDLRYWINNNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thioredoxin
publication title Structure of a Metagenomic Thioredoxin
rcsb
source organism Silicibacter phage dss3phi2
molecule tags Electron transport
total genus 30
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vfiA00
2GQKA 2C0GA 4JZQA 4IJ3A 2C4JA 2RLIA 3D6IA 2GZPA 4BPYA 3TJGA 3TKSA 3AY8A 1GL8A 4TR3A 5KN1A 2YV7A 3IAM2 4DSQA 3FR6A 2L5OA 2DSAA 2YZHA 3WYWA 3IXRA 1Q4JA 4TN8A 2FD3A 6GSUA 1GSDA 2H1GA 2OJLA 1Z7RA 3L9VA 3GNJA 2PERA 4BVXA 1MD3A 4OO5A 4GQFA 2WB9A 5AIXA 18GSA 3CRTA 4BA7A 1NW2A 3ME8A 2VCZA 5ECIB 3HCZA 4IQAA 5J5NA 4G10A 1QMVA 1J0FA 2IN3A 3TRQA 2I81A 2HYXA 1R7HA 3TKRA 4EE0A 2I3YA 2GSRA 1MD4A 22GSA 4FYUA 1GULA 5JWOB 1SKWB 5CRHA 3K8NA 2F51A 3APOA 4D73A 1SJIA 3KTLA 3TOTA 3GTUA 1HD2A 4L0WA 1S3CA 5L71A 3OR5A 1OE7A 2GGTA 1EGRA 3HVXA 3GKXA 5JCUA 4IVFA 2L5LA 3QAWA 2OA7A 4KCEA 4TOPA 2GSSA 3Q19A 3IBHA 4WBRD 2GQLA 3IPZA 3LGCA 1OKDA 1CQGA 3ZLPA 4K7NA 1PQNA 3ZL5A 1UA5A 2LJRA 2IMKA 1G7OA 1XFLA 5DQYA 3O6TA 1SL0B 1AIUA 5F05A 4MPFA 2K6VA 2YV9A 3UJ1A 4ZBAA 2D2ZA 3ZVJA 2GSQA 1BJXA 5INYA 1M2AA 2XPDA 3FW2A 3CMIA 3DKSA 1XWKA 1LU4A 4XTSA 5GZZB 4HI7A 1M2DA 4EL1A 2CX3A 1DE2A 4POMA 4K2DA 5IQYA 4DSRA 1EWXA 5D9WA 2V6KA 4ILFA 2VCWA 5EPFA 1R4WA 1T1VA 2DC5A 1XIYA 2C3QA 4ZIJA 4MF6A 3NOFA 4EDZA 1KNGA 3GURA 2C0FA 2F8FA 2DMLA 5F0GA 4EF0A 1O8XA 3GMFA 4H86A 3LXZA 3VURA 3TRPA 2B5XA 3QD9A 3S9FA 4HJMA 5D93A 2MMOA 2VM1A 2L4CA 1V57A 1OKTA 4FYCA 1VF1A 1M2BA 3F63A 2X99A 1M99A 3GUSA 3WD6A 4N10A 2MBSA 4K1FA 3MWHA 4J57E 1B9XC 2JSZA 3NIVA 3GX0A 4AJ6A 4GTUA 5HFGA 4AF2A 4K7OA 3KJYA 1HNCA 2IL3A 3U5RE 1MDIA 1HQOA 2GTUA 2YANA 1OC3A 4O92A 3IE3A 4LLRA 3A2XA 4WEYA 4PQIA 1KEBA 1Y6EA 2XHFA 3HJPA 1T4YA 1CQHA 5IOXA 2JACA 5ECPB 2O87A 4IS0A 2AYTA 1QGVA 1SKSB 1V9WA 5ECSA 2VL2C 4POLA 2WFCA 4MP4A 4HUAA 4NV5A 2LQOA 2B7JA 2FLSA 3TCOA 2R3XA 3I43A 5CRWA 1SENA 1PRXA 3LXTA 3MNGA 4BL7A 2ZUPA 1F3AA 2TRXA 2WJUA 1AW9A 4Z7XA 2H6YA 3P8WA 1EGOA 1ACVA 4RI7A 4WKWA 3TJFA 1JLVA 4NAXA 4JR6A 1ZYQB 2IIYA 1QFNA 1AC1A 4LMWA 1ZOFA 2ON7A 3FY7A 3EINA 4J2FA 1M0UA 1WOUA 1UVZA 1RK4A 4OWYA 3HKRA 5B7CA 1JFUA 4OFTA 5KN3A 1QK8A 1GH2A 5E59A 4HU7A 3LQ7A 1AQWA 3KP8A 6GSSA 5HR1A 1K3YA 3ERFA 3TKQA 1THOA 2H72A 16GSA 3L9SA 1G6WA 2FWHA 3IA1A 5ECQB 3VWXA 5KEJA 3EMPA 1ZL9A 2JL4A 4POKA 4JE1A 2TIRA 1GLPA 4V2NA 1TRWA 4LA1A 5IIZA 3WGDA 2A2RA 4MZBA 5HQPA 4ML1A 4KAEA 4TW5A 1DUGA 4L5OA 3QFAC 2GT6A 4IKHA 3APSA 3L78A 4ZL7A 2L6DA 3EMXA 1A2JA 3M0FA 3PINA 3KP9A 2JZRA 2HXKA 3QDNA 4MJAA 1TKDB 3F3RA 1GP1A 4CDOA 3FKFA 3C7MA 3TGZA 4O5RA 1AAZA 4FH8A 5AN1A 4MZWA 1SK0A 2PMTA 1B4PA 3CSHA 3FEUA 5ECRB 2WZ9A 3UBKA 4OCEA 4TRXA 2H8LA 2CAQA 3IK9A 4GSSA 2NDOA 1GSEA 4MZCA 4KNDA 4NHZA 1XW5A 1PX7A 4XS6A 3HYPA 1E6BA 2CQ9A 4MH3A 2VLVA 4GQCA 2YPMA 3GHAA 5C04A 1K0BA 3QMXA 1XOBA 4EUYA 1EOGA 2BTOT 2ZCTA 3BD2A 2IWTA 3A2WA 3KTBA 7GSSA 2KUCA 4WETA 2VUPA 3LYKA 2HSYA 1SD8A 5CRDA 5ID2B 3ZFLA 1PKZA 3DYRA 5DDLA 1K0CA 5HR3A 4ZILA 2BMXA 4XCSA 2OE0A 4N0ZA 1NHOA 1X5EA 4WR4A 4N30A 2H01A 2CV4A 5IMDA 3SWLA 3GL3A 1GTUA 1XW6A 4LMVA 1OVNA 1EEMA 4KSMA 3IRAA 2HSHA 3DVXA 4OCFA 2AB6A 2HRFA 5C00A 2GS3A 1I9DA 3A5WA 3QPMA 1KBNA 5CYYA 2CA8A 1YKAA 5FWGA 3BCIA 2CVBA 14GSA 3LSZA 4GRFA 4XRAA 2O8VB 3C1RA 4K8MA 3LJRA 1TOFA 4NHWA 2C0EA 3TJKA 4XS4B 4EVMA 1PL1A 3GSSA 2B5YA 2MZCA 4MK3A 5DQSA 4K7IA 4QL7A 4V2LA 4F03A 1WMJA 3F9UA 4KH7A 4LL4B 2H19A 2EIQA 5G30A 4F2IA 3BOAA 1F6MC 5DVBA 2L4QA 2OKAA 1SKRB 3ZTLA 1RW1A 5IMZA 4YQUA 5CRGA 5J9CA 4WXTA 4EXJA 4N0VA 5IPHA 2YOIA 1SYRA 4IQ1A 1EZKA 2QGVA 3IHQA 3Q74A 3WGEA 2HZEB 2WGRA 3D4MA 5F07A 3F8UA 2HE3A 1K3OA 4E8HA 1U3IA 3F6FA 1H75A 1SK1A 1BEDA 4WBJA 1N8JA 20GSA 2V41A 1I5GA 1K0DA 5JWQB 1O81A 2HI7A 5HFIA 1XZOA 4MCUA 4ZB8A 4YQVA 2H76A 1GRXA 1FB6A 3ERWA 4KX4A 2MMNA 1WJKA 1YDKA 2FGXA 1XVWA 1VF2A 3FZ4A 1S3AA 4FO5A 3HVVA 1R5PA 1V2AA 2KOKA 3KMOA 1BG5A 2LRNA 2H73A 2E2MA 4YH2A 2PU9C 4XS4A 2XBQA 1Q98A 4PGTA 2X8CA 2LRTA 3D0ZA 4AJ7A 2QC7A 4RQXA 2R5GA 3ZREA 1O85A 1EOHA 2H70A 3QFBC 2XBIA 2FNOA 2H30A 2YWIA 2Z9SA 4TR1B 1HNAA 4MLYA 2VCVA 1A0FA 2C80A 3E0UA 2GVPA 2M72A 1XPVA 2NTOA 2H66A 1EEJA 4IP1A 4OFMA 3QR6A 1FW1A 3WGXA 1PSQA 2I9HA 1FG4A 1GUHA 5HFKA 2H1BA 2VCTA 2LSTA 4ZBBA 3KGKA 1J9BA 1WRYA 5DJLA 1RQMA 5FHIA 3GYKA 3I69A 3IDVA 3GV1A 3PH9A 5EY6A 4J56E 2KHPA 1A0RP 4HS1A 1MDJA 4BWSA 1GWCA 1TRSA 3BJ5A 5J9BA 2TRCP 4LL1B 5J4UA 3O76A 5ABRA 2QSIA 1X9WB 4RI6A 3F6DA 5IMCA 1O8WA 4HEA2 2F8AA 1ML6A 17GSA 3ISOA 5ECLB 1XWBA 1SD9A 2PN8A 2L57A 5KN2A 3JCML 4GXZA 4ECCA 3F4SA 2CVDA 2C0DA 3HY2A 3BCKA 1OC9B 2I1UA 3FK8A 3TKSE 4ISDA 1PA3A 4OFNA 5AISA 2HLSA 4PUFC 1YEPA 19GSA 5ECOB 3C1SA 4ZL9A 1PMTA 2PPTA 2DIYA 2N5BA 1C72A 1BX9A 1B48A 2IJYA 4ML6A 2E7PA 2EIRA 2A4VA 1TK0B 3UARA 4MF5A 4I2UA 2H0GA 5LCZA 1YKCA 3C71A 1K0OA 2JADA 4GF0A 3WT1A 4TXOB 1LBKA 5IMVA 1TDIA 2IMEA 2FWGA 3TJJA 2LNTA 2XC2A 1FO5A 1BQ7A 3CTGA 5DBQA 1GNEA 4AJ8A 2AJQB 1K0AA 5JCWA 1TW9A 2YWNA 1X5CA 3HA9A 3GSTA 4KE3A 1XWGA 3FZ9A 4CW9A 2H0HA 5H5RA 3P2AA 1H4OA 5DJMA 3ERGA 3KMNA 1J08A 2ES7A 2NPBA 3N9JA 2E0QA 4IJIA 4DSSB 3QAGA 4JEDA 2P5QA 5G5EA 5D8IA 4KW6A 1QQ2A 2DJ2A 4ULXA 5CO3A 1NSWA 2DLXA 1GLQA 2GDRA 4XIHA 3R2QA 3G9BA 4KGIA 4XS1A 13GSA 2JSYA 4EKZA 2C1YA 2GT5A 3H1NA 1ZGNA 3A2VA 4XRDA 1S3DA 5CREA 3RDWA 3LEFA 2LJKA 4F0BA 1AXDA 4V2MA 4OD7A 4ECJA 1IYIA 2HFDA 4K9ZA 5G1KA 5EL8A 3DD3A 2V32A 2X64A 2KLXA 3D22A 5D9VA 4TR0A 5IM9A 1WIKA 4PQHA 2YN1A 4Q5QA 6GSXA 1X0RA 1PKWA 1FAAA 1G6YA 3W6GA 3O3TA 2HNLA 3KCMA 5AGYA 2H74A 5LNKe 4DEJA 2H6ZA 4IP6A 2VCQA 5B8BA 4PNGA 5H5SA 4X0XA 2M46A 1V98A 3LFLA 3F3QA 3VK9A 1ZZYA 4TVEA 5IO2A 5IMAA 1Z6NA 3KIJA 2G0FA 3H8QA 1GTAA 2FUG2 4EO3A 1WPIA 2VL2A 1O6JA 5AIVA 4YAVA 3FR9A 5HR0A 4Q5NA 4ZB9A 2I4AA 4BVYA 1V58A 2FA4A 4I8BA 1DSBA 1VGLA 2NVLA 1Z6MA 1BAYA 2YWOA 4PXOA 4IN0A 6GSTA 2RIIA 1R26A 1XXUA 3UBLA 1GNWA 5B6MA 2IPAA 3HZ4A 2VIMA 2VD1A 3F0IA 4L5LA 5H5QA 3GH6A 2GZYA 5JWRB 5G31A 4QL9A 5ENUA 1SU9A 4X1UA 3GX8A 1X5DA 2E2GA 2EC4A 4IGJA 4WR5A 2R6KA 2MYGA 5A4VA 4KDXA 1QXHA 1AQXA 1TI3A 4GSNA 1XOAA 3TKSC 2LNSA 3FHKA 2VL3A 1B4QA 3CYNA 2RM6A 3D21A 3P7XA 1U87A 2R4VA 1XW9A 2LKUA 3GN3A 1YZXA 2CAIA 3DGQA 3L9UA 4MDCA 2LS5A 4ECIA 2YJ7A 5J3RA 2K18A 2KP2A 3RHCA 5CP1A 4MJBA 3SBCA 3APQA 4F82A 1AUCA 3DXBA 5KN0A 2FY6A 2G2QA 1FVKA 4FIWA 1ERUA 3IR4A 4HQSA 11GSA 4MMMA 3TJBA 1LJRA 4D73B 2PBJA 2RM5A 3QAVA 1SYXA 1JHBA 5F06A 4WF4A 4KDUA 5HR2A 4TXVA 2VM2A 2H75A 4OO4A 1T4ZA 5ID2A 1Z5YE 4F0CA 1ON4A 2J9HA 2DJ0A 2H6XA 1ZYEA 5LD0A 3J7Yk 3CXGA 1TU7A 4HDEA 1ZMAA 2CVKA 1Z3EA 3KH9A 4G2EA 2FA8A 3QOUA 4ZXGA 4E8EA 1YF1A 5DCHA 2JZTA 5A4WA 1VF4A 4MPGA 5CAXA 2VCXA 4NMUA 1E2YA 3J7Yb 3LWAA 1WP0A 5ELAA 4G9HA 2LQQA 1FB0A 1GTIA 4I6XA 4WF5A 2F9SA 4PUAA 3UAPA 3EE2A 3VPTA 5D96A 3ME7A 1X9MB 1TRUA 1A24A 5ECKB 4GSTA 1F3BA 4JR4A 4KB3A 5D9XA 3ZYWA 4HJ2A 2OBIA 1GUKA 1MEKA 4IHUA 4NPBA 3UL3A 2N5FA 5D9TA 1FOVA 1TP9A 4CHSA 1HYUA 2DIZA 4MA9A 4K6XA 4O7HA 5DAKB 4KSOA 2HRNA 3L4NA 1SJ6A 1PL2A 8GSSA 2B1KA 4MJCA 1OC8A 1G0TA 2R37A 2VLTA 3Q6OA 1Z7PA 3UVTA 2DJJA 1A2MA 1MDKA 4ECBA 2WS2A 1URMA 3RPNA 3H4KA 3G7JA 3GL5A 3US3A 2GQMA 1B9YC 3ZRDA 3VWUA 4HQZA 3EWLA 3E9JB 1OAZA 2H0IA 5G1LA 1NHYA 1VF3A 1SJZA 5JCGA 1PN9A 2P0GA 4KA0A 1ST9A 2RUEA 3KM6A 3G7IA 2K8VA 3LYPA 2HZEA 2K9FA 2PGTA 2MMZA 2O7KA 2LEGA 3KEBA 3HVSA 4PQ1A 2AHEA 3CBUA 2DMMA 2XPEA 1ABAA 1M9AA 5A5KA 4MH2A 5B8AA 1T00A 1GSYA 1F37A 3ZITA 3W8JA 3HD5A 4MF7A 3RAZA 4PNFA 2YZUA 1A2LA 4JRRA 1TXXA 2LRCA 3UVHA 5IOWA 2LJAA 4GCIA 4JBBA 2YNXA 3M9JA 3V1WA 2DJ1A 2H1AA 1YJ6A 1JZWA 1MTCA 3ZIJA 2LV3A 3UEMA 2WCIA 1K0MA 1TI1A 2GSTA 2B3SA 5GAND 2ALBA 3PR8A 5DAKA 2YJHA 4GLTA 1B8XA 5GSSA 2O89A 2OE3A 3M1GA 4HU9A 3DEXA 4DVCA 1FVJA 1R5AA 3CSIA 3LG6A 3P90A 3LORA 4AGSA 2V6OA 1PX6A 3GA4A 3D5JA 3PGTA 4YAPA 4TR1A 3IV4A 5J41A 2B5EA 4KDYA 4OMVA 3ZZXA 1F2EA 2C3TA 4KCAA 5DALB 1U6TA 4ZL8A 3DMLA 3CRUA 3L0HA 2YWMA 3VWVA 4FYBA 3MDKA 2C8UA 3UIWA 3FZAA 2WULA 1OE8A 1EV9A 12GSA 4EDYA 1ZCPA 3M3MA 1WWJA 3KD0A 1XWCA 3GKNA 1ERTA 1BYEA 1PD21 2C3NA 2VAFA 5G2ZA 3C73A 3TB2A 1QUWA 4POBA 4I2TA 5IPGA 3EURA 3VWWA 5EVOA 3EC3A 2AAWA 4XHMA 4X43A 2VL9A 3UMAA 1FHEA 4NV2A 1OC9A 1USBA 3EU4A 1TJDA 1YF0A 2WDUA 2WRTA 1SL2B 2F3MA 3KH7A 2RUFA 2KP1A 2PUKC 2L59A 3ZIVA 3EYTA 1EP7A 2B6MA 2NBSA 1XBSA 1Z9HA 3HJOA 3I9V2 3VI5A 2DJKA 1K3LA 2VO4A 3KXOA 4HZ4A 1N2AA 1M9BA 3MAKA 1AQVA 1TK5B 2ZNMA 2X8GA 3DWVA 1WE0A 4TR4A 2REMA 3HHVA 3ZFBA 2ON5A 4G19A 2R2JA 4I97A 3FYGA 4NWYA 1PGTA 2JU5A 4TXOA 4F9ZA 5DALA 2V1MA 3QCPA 1K0NA 1VRSD 1UN2A 1TU8A 5E4WA 2FCHA 3BBYA 4K0GA 3TUEA 2IMIA 3MSZA 2MMAA 3RHBA 4IELA 2VOCA 4RQRA 1G7EA 4IBPA 3UOMA 4BWQA 5ECMB 2N5AA 1X9SB 2BJXA 2FWFA 5F8BA 1GSFA 2M80A 4TKYA 3WT2A 2PWJA 1Y25A 4QQ7A 3G7YA 3RBTA 3VLNA 4DSSA 1A8YA 2CT6A 3HJMA 1EP8A 6GSVA 2VD0A 3D4TA 2H1DA 1JZRA 1YEXA 2IFQB 9GSSA 3DRNA 4L0UA 2FHEA 1A23A 1GUMA 4KUNA 1GTBA 5ECHB 5FT3A 1W4VA 4Q5RA 2OADA 6GSWA 2YP6A 4JU5A 1M7TA 1W89A 4PURA 4PX1A 1XCCA 1OYJA 5IMFA 3ED3A 2DJ3A 4O32A 1O7UA 1TTZA 2OACA 4IW9A 1JZDA 4ID0A 5IO0A 1HNBA 1XVQA 1GSUA 2GZZA 1YQ1A 1SK2A 1DBYA 2JZSA 3VFIA 1V40A 4N11A 3TKPA 4ZBDA 6GSYA 10GSA 1O73A 2OBKA 4NXIA 4RUVA 5GSTA 5D73A 2YCDA 3CTFA 1YY7A 1GSQA 3GH9A 3DIEA 3GRXA 5B6NA 3RPPA 3HXSA 3IK7A 4L8EA 4K0NA 1U88A 5A4UA 1SL1B 2IMDA 1THXA 2IMFA 3DVWA 3A3TA 3C8EA 3Q18A 5COHA 2HT9A 4HOJA 1T3BA 1IYHA 1U3AA 3GKMA 3TDGA 2PVQA 1EV4A 4YQMA 4HZ2A 2HZFA 3IAS2 2DBCA 3VI7A 3GFKA 2B1LA 3VPQA 1GSSA 4I5QA 2CX4A 1F9MA 3FZ5A 2EIOA 5ELGA 3TOUA 3M9KA 1NM3A 2CZ3A 2AV4A 2A2SA 3IOSA 2LTKA 1A8LA 2IFQA 1ILOA 2X8HA 4EC0A 1T8EB 3F4RA 2K8SA 3N5OA 4MABA 4Q5FA 4ACSA 3TRXA 2GLRA 3FR3A 1DE1A 2L6CA 3EU3A 3ZVJD 5G5FA 2QKEA 3HDCA 3H93A 3KZQA 2P31A 3W8SA 1XWAA 2LUSA 3HZ8A 4ZB6A 3U6VA 3I6AA 1UC7A 2O85A 1KTEA 1ERWA 3GKKA 3GTUB 1TRVA 2B7KA 2J23A 2VLUA 1T7PB 2MBTA 1ERVA 3F4TA 1JZOA 2FWEA 5CNWA 4V1Ap 3FRCA 2CZ2A 2OE1A 3CSJA 3IC4A 4MJEA 1TK8B 2V2GA 5DCGA 3ZMKA 2H71A 4GWRA 3EVIA 2PVOC 3E3EA 4P3YB 3M8NA 3ZMLA 1JLWA 4V1Ag 2P5RA 3NZNA 3GIXA 2AUVA 5GAPD 5ECNB 3H79A
chains in the Genus database with same CATH superfamily
2GQKA 5BRTA 2C0GA 4JZQA 4IJ3A 2C4JA 2RLIA 3D6IA 2GZPA 4BPYA 3TJGA 3TKSA 3AY8A 1GL8A 4TR3A 5KN1A 2YV7A 3IAM2 4DSQA 3FR6A 2L5OA 2DSAA 2YZHA 3WYWA 3IXRA 1Q4JA 4TN8A 2FD3A 6GSUA 1GSDA 2H1GA 2OJLA 1Z7RA 3L9VA 3GNJA 2PERA 4BVXA 1MD3A 4OO5A 4GQFA 2WB9A 5AIXA 18GSA 3CRTA 4BA7A 1NW2A 3ME8A 2VCZA 5ECIB 3HCZA 4IQAA 5J5NA 4G10A 1QMVA 1J0FA 2IN3A 3TRQA 2X49A 2I81A 2HYXA 1R7HA 3TKRA 4EE0A 2I3YA 2GSRA 1MD4A 22GSA 4FYUA 1GULA 5JWOB 2A4HA 1SKWB 5CRHA 3K8NA 2F51A 3APOA 4D73A 1SJIA 3KTLA 3TOTA 3GTUA 1HD2A 4L0WA 1S3CA 5L71A 3OR5A 1OE7A 2GGTA 1EGRA 3HVXA 3GKXA 5JCUA 4IVFA 2L5LA 3QAWA 2OA7A 4KCEA 4TOPA 2GSSA 3Q19A 3IHGA 3IBHA 4WBRD 2GQLA 3IPZA 3LGCA 1OKDA 1CQGA 3ZLPA 4K7NA 4CY6A 1PQNA 3ZL5A 1UA5A 2LJRA 2IMKA 1G7OA 1XFLA 5DQYA 3O6TA 1SL0B 1AIUA 5F05A 4MPFA 2K6VA 2DKHA 2YV9A 3UJ1A 4ZBAA 2D2ZA 3ZVJA 4BL7B 2GSQA 1BJXA 5INYA 1M2AA 4Z2TA 2XPDA 3FW2A 3CMIA 3DKSA 1XWKA 1LU4A 4XTSA 5GZZB 2A2PA 4HI7A 1M2DA 4EL1A 4YKGA 2CX3A 1DE2A 4POMA 4K2DA 5IQYA 4DSRA 1EWXA 5D9WA 2V6KA 4ILFA 2VCWA 5EPFA 1R4WA 1T1VA 2DC5A 1XIYA 2C3QA 4ZIJA 4MF6A 3NOFA 4EDZA 1KNGA 3GURA 2C0FA 2F8FA 2DMLA 5F0GA 4EF0A 1O8XA 3GMFA 4H86A 3LXZA 3VURA 3TRPA 2B5XA 3QD9A 3S9FA 4HJMA 5D93A 2MMOA 2VM1A 2L4CA 1V57A 1OKTA 4FYCA 1VF1A 4G0IA 1M2BA 3F63A 2X99A 1M99A 3GUSA 3WD6A 4N10A 2MBSA 4K1FA 3MWHA 4J57E 1B9XC 2JSZA 3NIVA 3GX0A 4AJ6A 4GTUA 5HFGA 4AF2A 4K7OA 3KJYA 1HNCA 2IL3A 3U5RE 1MDIA 1HQOA 2GTUA 2YANA 1OC3A 4O92A 3IE3A 4LLRA 3MIXA 3A2XA 4WEYA 4PQIA 1KEBA 1Y6EA 2XHFA 3HJPA 1T4YA 1CQHA 5IOXA 2JACA 5ECPB 2O87A 4IS0A 2AYTA 1QGVA 1SKSB 1V9WA 5ECSA 2VL2C 4POLA 2WFCA 4MP4A 4HUAA 4NV5A 2LQOA 2B7JA 2FLSA 3TCOA 2R3XA 3I43A 5CRWA 1SENA 1PRXA 3LXTA 3MNGA 4BL7A 2ZUPA 3FMWA 1F3AA 2TRXA 2WJUA 1AW9A 4BVYB 4Z7XA 2H6YA 3P8WA 1EGOA 1ACVA 4RI7A 4WKWA 3TJFA 1JLVA 4NAXA 4JR6A 1ZYQB 2IIYA 1QFNA 1AC1A 4LMWA 1ZOFA 2ON7A 3FY7A 3EINA 4J2FA 1M0UA 1WOUA 1UVZA 1RK4A 4OWYA 3HKRA 5B7CA 1JFUA 4OFTA 5KN3A 1QK8A 1GH2A 5E59A 4HU7A 3LQ7A 1AQWA 3KP8A 6GSSA 5HR1A 1K3YA 3ERFA 3TKQA 1THOA 2H72A 16GSA 3L9SA 1G6WA 2FWHA 3IA1A 5ECQB 3R3EA 3VWXA 5KEJA 3EMPA 1ZL9A 4POKA 2JL4A 4JE1A 2TIRA 1GLPA 4V2NA 1TRWA 4LA1A 5IIZA 3WGDA 2A2RA 4MZBA 5HQPA 4ML1A 4KAEA 4TW5A 1DUGA 4L5OA 2HRKA 3QFAC 2GT6A 4IKHA 3APSA 3L78A 4ZL7A 2L6DA 3EMXA 1A2JA 3M0FA 3PINA 4O5QA 3KP9A 2JZRA 2HXKA 3QDNA 4MJAA 1TKDB 3F3RA 3PPUA 1GP1A 4CDOA 3FKFA 3C7MA 3TGZA 4PTSA 3CQFA 4O5RA 1AAZA 4FH8A 5AN1A 4MZWA 1SK0A 2PMTA 1PFOA 1B4PA 3CSHA 3FEUA 5ECRB 2WZ9A 3UBKA 4OCEA 4TRXA 2H8LA 2CAQA 3IK9A 4GSSA 2NDOA 1GSEA 4MZCA 4KNDA 4NHZA 1XW5A 1PX7A 4XS6A 3HYPA 1E6BA 2CQ9A 4MH3A 2VLVA 4GQCA 2YPMA 3GHAA 5C04A 1K0BA 3QMXA 1XOBA 4EUYA 1EOGA 2BTOT 2ZCTA 3BD2A 2IWTA 3A2WA 3KTBA 7GSSA 2KUCA 4WETA 2VUPA 3LYKA 2HSYA 1SD8A 5CRDA 5ID2B 3ZFLA 1PKZA 4Z2UA 3DYRA 5DDLA 1K0CA 5HR3A 4ZILA 2BMXA 4XCSA 2OE0A 3IC8A 4N0ZA 1NHOA 1X5EA 4WR4A 4N30A 2H01A 2CV4A 5IMDA 3SWLA 3GL3A 1GTUA 1XW6A 2R0GA 4LMVA 1OVNA 1EEMA 4KSMA 3IRAA 2HSHA 3DVXA 4OCFA 2AB6A 2HRFA 5C00A 2GS3A 1I9DA 3A5WA 3QPMA 1KBNA 5CYYA 2CA8A 1YKAA 5FWGA 3BCIA 2CVBA 4ICYA 14GSA 3LSZA 4GRFA 4XRAA 2O8VB 3C1RA 4K8MA 3LJRA 1TOFA 4NHWA 2C0EA 3TJKA 4XS4B 4EVMA 4USSA 1PL1A 3GSSA 2B5YA 2MZCA 4MK3A 5DQSA 4K7IA 4QL7A 4V2LA 4F03A 1WMJA 3F9UA 4KH7A 4LL4B 2H19A 2EIQA 5G30A 4F2IA 5BMUA 3BOAA 1F6MC 4MNNA 5DVBA 2L4QA 2OKAA 1SKRB 3ZTLA 1RW1A 5IMZA 4YQUA 5CRGA 5J9CA 4WXTA 4EXJA 4N0VA 5IPHA 2YOIA 1SYRA 4IQ1A 1EZKA 2QGVA 3IHQA 3Q74A 3WGEA 2HZEB 2WGRA 3D4MA 5F07A 3F8UA 2HE3A 1K3OA 4E8HA 1U3IA 3F6FA 1H75A 1SK1A 1BEDA 4WBJA 1N8JA 20GSA 2V41A 1I5GA 1K0DA 5JWQB 1O81A 2HI7A 5HFIA 1XZOA 4MCUA 4ZB8A 4YQVA 2H76A 1GRXA 1FB6A 3ERWA 4KX4A 2MMNA 1WJKA 1YDKA 2FGXA 1XVWA 1VF2A 3FZ4A 1S3AA 4FO5A 3HVVA 1R5PA 1V2AA 2KOKA 3KMOA 1BG5A 1ZYNA 2LRNA 2H73A 2E2MA 4YH2A 2PU9C 4XS4A 2XBQA 1Q98A 4PGTA 2X8CA 2LRTA 3D0ZA 4AJ7A 2QC7A 4RQXA 2R5GA 3ZREA 1O85A 1EOHA 2H70A 3QFBC 2XBIA 2FNOA 2H30A 2YWIA 2Z9SA 4TR1B 1HNAA 4MLYA 2VCVA 1A0FA 2C80A 3E0UA 2GVPA 2M72A 1XPVA 2NTOA 2H66A 1EEJA 4IP1A 4OFMA 3QR6A 1FW1A 3WGXA 1PSQA 2I9HA 1FG4A 1GUHA 5HFKA 2H1BA 2R0PA 2VCTA 2LSTA 4ZBBA 3KGKA 4CY8A 1J9BA 1WRYA 4G0KA 5DJLA 1RQMA 5FHIA 3GYKA 3I69A 3IDVA 3GV1A 3PH9A 5EY6A 4J56E 2KHPA 1A0RP 2X4AA 4HS1A 1MDJA 4BWSA 1GWCA 1TRSA 3BJ5A 5J9BA 2TRCP 4LL1B 4A5PA 5J4UA 3O76A 5ABRA 2QSIA 1X9WB 4RI6A 3F6DA 5IMCA 1O8WA 4HEA2 2F8AA 1ML6A 17GSA 3ISOA 5ECLB 1XWBA 1SD9A 2PN8A 2L57A 5KN2A 3JCML 4GXZA 4ECCA 3F4SA 2CVDA 2C0DA 3HY2A 3BCKA 1OC9B 2I1UA 3FK8A 3TKSE 4ISDA 3LW9A 1PA3A 4OFNA 5AISA 2HLSA 4PUFC 1YEPA 19GSA 5ECOB 3C1SA 4ZL9A 1PMTA 2PPTA 1M3IA 2DIYA 2N5BA 1C72A 1BX9A 1B48A 2IJYA 4ML6A 2E7PA 2EIRA 2A4VA 1TK0B 3UARA 4MF5A 4I2UA 2H0GA 5LCZA 1YKCA 3C71A 1K0OA 2JADA 4GF0A 3WT1A 4TXOB 1LBKA 5IMVA 1TDIA 2IMEA 2FWGA 3TJJA 2LNTA 2XC2A 4YKFA 1FO5A 1BQ7A 3CTGA 5DBQA 1GNEA 3HVNA 4AJ8A 2AJQB 1K0AA 5JCWA 1TW9A 2YWNA 1X5CA 3HA9A 3GSTA 4KE3A 1XWGA 3FZ9A 4CW9A 2H0HA 5H5RA 3P2AA 1H4OA 5DJMA 3ERGA 3KMNA 1J08A 2ES7A 2NPBA 3N9JA 2E0QA 4IJIA 4DSSB 3QAGA 4JEDA 2P5QA 5G5EA 5D8IA 4KW6A 1QQ2A 2DJ2A 4ULXA 5CO3A 4X4JA 1NSWA 2DLXA 1GLQA 4BIKA 2GDRA 4XIHA 3R2QA 3G9BA 4KGIA 4XS1A 13GSA 2JSYA 4EKZA 2C1YA 2GT5A 3H1NA 1ZGNA 4FQUA 3A2VA 4XRDA 1S3DA 5CREA 1FOHA 3RDWA 3LEFA 2LJKA 4F0BA 1AXDA 4V2MA 2QA2A 4OD7A 4ECJA 1IYIA 2HFDA 4K9ZA 5G1KA 5EL8A 3DD3A 2V32A 2X64A 2KLXA 3D22A 5D9VA 4TR0A 5IM9A 1WIKA 4PQHA 2YN1A 4Q5QA 6GSXA 1X0RA 1PKWA 1FAAA 1G6YA 3W6GA 3O3TA 2HNLA 3KCMA 5AGYA 2H74A 5LNKe 4DEJA 2H6ZA 4IP6A 2VCQA 5B8BA 3A5IA 4PNGA 5H5SA 4X0XA 2M46A 1V98A 3LFLA 3F3QA 3VK9A 1ZZYA 4TVEA 5IO2A 5IMAA 1Z6NA 3KIJA 2G0FA 3H8QA 1GTAA 2FUG2 4EO3A 1WPIA 2VL2A 1O6JA 5AIVA 4YAVA 3FR9A 5HR0A 2HSMA 4Q5NA 4ZB9A 2I4AA 4BVYA 1V58A 2FA4A 4I8BA 1DSBA 1VGLA 2NVLA 1Z6MA 1BAYA 5KOXA 2YWOA 4PXOA 4IN0A 6GSTA 2RIIA 1R26A 1XXUA 3UBLA 1GNWA 5B6MA 2IPAA 3HZ4A 2VIMA 2VD1A 3F0IA 4L5LA 5H5QA 3GH6A 2GZYA 5JWRB 5G31A 4QL9A 5ENUA 1SU9A 4X1UA 3GX8A 1X5DA 2E2GA 2EC4A 4IGJA 4WR5A 2R6KA 2MYGA 5A4VA 4KDXA 1QXHA 1AQXA 1TI3A 4GSNA 1XOAA 3EPTA 3TKSC 2LNSA 3FHKA 2VL3A 1B4QA 3CYNA 2R0CA 2RM6A 3D21A 3P7XA 1U87A 2R4VA 1XW9A 2DKIA 2LKUA 3GN3A 1YZXA 2CAIA 3DGQA 3L9UA 4MDCA 2LS5A 4ECIA 2YJ7A 5J3RA 4BVXB 2K18A 2KP2A 3RHCA 5CP1A 4MJBA 3SBCA 3APQA 4F82A 1AUCA 3DXBA 5KN0A 2FY6A 2G2QA 1FVKA 4FIWA 1ERUA 3IR4A 4HQSA 11GSA 4MMMA 3TJBA 1ZYPA 1LJRA 1XG8A 4D73B 2PBJA 2RM5A 3QAVA 1SYXA 1JHBA 5F06A 4K5SA 4WF4A 4KDUA 5HR2A 4TXVA 2VM2A 2H75A 4OO4A 1T4ZA 5ID2A 1Z5YE 4F0CA 1ON4A 2J9HA 2DJ0A 2H6XA 1ZYEA 5LD0A 3J7Yk 3CXGA 1TU7A 4HDEA 1ZMAA 2CVKA 1Z3EA 3KH9A 4G2EA 2FA8A 3QOUA 4ZXGA 4E8EA 1YF1A 5DCHA 2JZTA 5A4WA 1VF4A 4MPGA 5CAXA 2VCXA 4NMUA 1E2YA 3J7Yb 3LWAA 1WP0A 5ELAA 4G9HA 2LQQA 4G0LA 1FB0A 1GTIA 4I6XA 4WF5A 2F9SA 4PUAA 3UAPA 3EE2A 3VPTA 5D96A 3ME7A 1X9MB 1TRUA 1A24A 5ECKB 4GSTA 1F3BA 4JR4A 4KB3A 5D9XA 3ZYWA 4HJ2A 2OBIA 1GUKA 1MEKA 4IHUA 4NPBA 3UL3A 2N5FA 5D9TA 1FOVA 1TP9A 4CHSA 1HYUA 2DIZA 4MA9A 4K6XA 4O7HA 5DAKB 4KSOA 2HRNA 3L4NA 1SJ6A 1PL2A 8GSSA 2B1KA 4MJCA 1OC8A 1G0TA 2R37A 2VLTA 3Q6OA 1Z7PA 3UVTA 4Z2RA 2DJJA 1A2MA 1MDKA 4ECBA 2WS2A 1URMA 3RPNA 5KOWA 3H4KA 3G7JA 3GL5A 3US3A 2GQMA 1B9YC 3ZRDA 3VWUA 4HQZA 3EWLA 3E9JB 1OAZA 2H0IA 5G1LA 1NHYA 1VF3A 1SJZA 5JCGA 1PN9A 2P0GA 4KA0A 1ST9A 2RUEA 3KM6A 3G7IA 2K8VA 3LYPA 2HZEA 2K9FA 2PGTA 2MMZA 2O7KA 2LEGA 3KEBA 3HVSA 4PQ1A 2AHEA 3CBUA 2DMMA 2XPEA 1ABAA 1M9AA 5A5KA 4MH2A 5B8AA 4KF9A 1T00A 1GSYA 1F37A 3ZITA 3W8JA 3HD5A 1S3RA 4MF7A 3RAZA 4PNFA 4JRRA 1A2LA 2YZUA 1TXXA 2LRCA 3UVHA 5IOWA 2LJAA 4GCIA 4JBBA 2YNXA 3M9JA 3V1WA 4EIPA 2DJ1A 2H1AA 1YJ6A 1JZWA 1MTCA 3ZIJA 2LV3A 3UEMA 2WCIA 1K0MA 1TI1A 2GSTA 2B3SA 5GAND 2ALBA 3PR8A 5DAKA 2YJHA 4GLTA 1B8XA 5GSSA 2O89A 2OE3A 3M1GA 4HU9A 3DEXA 4DVCA 1FVJA 1R5AA 3CSIA 3LG6A 3P90A 3LORA 4AGSA 2V6OA 1PX6A 3GA4A 3D5JA 3PGTA 4YAPA 4TR1A 3IV4A 5J41A 2B5EA 4KDYA 4OMVA 3ZZXA 1F2EA 2C3TA 4KCAA 5DALB 1U6TA 4ZL8A 3DMLA 3CRUA 3L0HA 2YWMA 3VWVA 4FYBA 3MDKA 2C8UA 3UIWA 3FZAA 2WULA 1OE8A 1EV9A 12GSA 4EDYA 1ZCPA 3M3MA 1WWJA 3KD0A 1XWCA 3GKNA 1ERTA 1BYEA 1PD21 2C3NA 2VAFA 5G2ZA 3C73A 3TB2A 1QUWA 4POBA 4I2TA 5IPGA 3EURA 3VWWA 5EVOA 3EC3A 2AAWA 4XHMA 4X43A 4HSCX 2VL9A 3UMAA 1FHEA 4NV2A 1OC9A 1USBA 3EU4A 1TJDA 1YF0A 2WDUA 2WRTA 1SL2B 2F3MA 3KH7A 2RUFA 2KP1A 2PUKC 2L59A 3ZIVA 3EYTA 1EP7A 2B6MA 2NBSA 1XBSA 1Z9HA 3HJOA 3I9V2 3VI5A 2DJKA 1K3LA 2VO4A 3KXOA 4HZ4A 1N2AA 1M9BA 3MAKA 1AQVA 1TK5B 2ZNMA 2X8GA 3DWVA 1WE0A 4TR4A 2REMA 3HHVA 3ZFBA 2ON5A 4G19A 2R2JA 4I97A 3FYGA 4NWYA 1PGTA 2JU5A 4TXOA 4F9ZA 5DALA 2V1MA 3QCPA 1K0NA 1VRSD 1UN2A 1TU8A 5E4WA 2FCHA 3BBYA 4K0GA 3TUEA 2IMIA 3MSZA 2MMAA 3RHBA 4IELA 2VOCA 4RQRA 1G7EA 4IBPA 3UOMA 4BWQA 5ECMB 2N5AA 1X9SB 2BJXA 2FWFA 5F8BA 1GSFA 3MYDA 2M80A 4TKYA 3WT2A 2PWJA 1Y25A 4QQ7A 3G7YA 3RBTA 3VLNA 4DSSA 1A8YA 2CT6A 3HJMA 1EP8A 6GSVA 2VD0A 3D4TA 2H1DA 1JZRA 1YEXA 2IFQB 9GSSA 3DRNA 4L0UA 2FHEA 1A23A 1GUMA 4KUNA 1GTBA 5ECHB 5FT3A 1W4VA 4Q5RA 2OADA 6GSWA 2YP6A 4JU5A 1M7TA 1W89A 4PURA 4PX1A 4K2XA 1XCCA 1OYJA 5IMFA 3ED3A 2DJ3A 4K5RA 4O32A 1O7UA 1TTZA 2OACA 4IW9A 1JZDA 4ID0A 5IO0A 1HNBA 1XVQA 1GSUA 2GZZA 1YQ1A 4EIQA 1SK2A 1DBYA 2JZSA 3VFIA 1V40A 4N11A 3TKPA 4ZBDA 6GSYA 10GSA 1O73A 2QA1A 2OBKA 4NXIA 4RUVA 5GSTA 5D73A 2YCDA 3CTFA 1YY7A 1GSQA 3GH9A 3DIEA 3GRXA 5B6NA 3RPPA 3HXSA 3IK7A 4L8EA 4K0NA 1U88A 5A4UA 1SL1B 2IMDA 1THXA 2IMFA 3DVWA 3A3TA 3C8EA 3Q18A 5COHA 2HT9A 4HOJA 1T3BA 1IYHA 1U3AA 3GKMA 2HRAA 3TDGA 2PVQA 1EV4A 4YQMA 4HZ2A 2HZFA 3IAS2 2DBCA 3VI7A 3GFKA 2B1LA 3VPQA 1GSSA 4I5QA 2CX4A 1F9MA 3FZ5A 2EIOA 5ELGA 3TOUA 3M9KA 1NM3A 2CZ3A 2AV4A 2A2SA 3IOSA 2LTKA 1A8LA 2IFQA 1ILOA 2X8HA 4EC0A 1T8EB 3F4RA 2K8SA 3N5OA 4MABA 4Q5FA 4ACSA 3TRXA 2GLRA 3FR3A 1DE1A 4O5UA 1PN0A 2L6CA 3EU3A 3ZVJD 5G5FA 2QKEA 3HDCA 3H93A 3KZQA 2P31A 3W8SA 1XWAA 2LUSA 3HZ8A 4ZB6A 3U6VA 3I6AA 1UC7A 2O85A 1KTEA 1ERWA 3GKKA 3GTUB 1TRVA 2B7KA 2J23A 2VLUA 1T7PB 2MBTA 1ERVA 3F4TA 1JZOA 2FWEA 5CNWA 4V1Ap 3FRCA 2CZ2A 2OE1A 3CSJA 3IC4A 4MJEA 1TK8B 2V2GA 5DCGA 3ZMKA 2H71A 1M3JA 4GWRA 3EVIA 2PVOC 3E3EA 4P3YB 3M8NA 3ZMLA 1JLWA 4V1Ag 2UZ8A 2P5RA 3NZNA 3GIXA 2AUVA 5GAPD 5ECNB 3H79A
chains in the Genus database with same CATH topology
2GQKA 5BRTA 2C0GA 4JZQA 4IJ3A 2C4JA 2RLIA 3D6IA 2GZPA 4BPYA 3TJGA 3TKSA 3AY8A 1GL8A 4TR3A 5KN1A 2YV7A 3IAM2 4DSQA 3FR6A 2L5OA 2DSAA 2YZHA 3WYWA 3IXRA 1Q4JA 4TN8A 2FD3A 6GSUA 1GSDA 2H1GA 2OJLA 1Z7RA 3L9VA 3GNJA 2PERA 4BVXA 1MD3A 4OO5A 4GQFA 2WB9A 5AIXA 18GSA 3CRTA 4BA7A 1NW2A 3ME8A 2VCZA 5ECIB 3HCZA 4IQAA 5J5NA 4G10A 1QMVA 1J0FA 2IN3A 3TRQA 2X49A 2I81A 2HYXA 1R7HA 3TKRA 4EE0A 2I3YA 2GSRA 1MD4A 22GSA 4FYUA 1GULA 5JWOB 2A4HA 1SKWB 5CRHA 3K8NA 2F51A 3APOA 4D73A 1SJIA 3KTLA 3TOTA 3GTUA 1HD2A 4L0WA 1S3CA 5L71A 3OR5A 1OE7A 2GGTA 1EGRA 3HVXA 3GKXA 5JCUA 4IVFA 2L5LA 3QAWA 2OA7A 4KCEA 4TOPA 2GSSA 3Q19A 3IHGA 3IBHA 4WBRD 2GQLA 3IPZA 3LGCA 1OKDA 1CQGA 3ZLPA 4K7NA 4CY6A 1PQNA 3ZL5A 1UA5A 2LJRA 2IMKA 1G7OA 1XFLA 5DQYA 3O6TA 1SL0B 1AIUA 5F05A 4MPFA 2K6VA 2DKHA 2YV9A 3UJ1A 4ZBAA 2D2ZA 3ZVJA 4BL7B 2GSQA 1BJXA 5INYA 1M2AA 4Z2TA 2XPDA 3FW2A 3CMIA 3DKSA 1XWKA 1LU4A 4XTSA 5GZZB 2A2PA 4HI7A 1M2DA 4EL1A 4YKGA 2CX3A 1DE2A 4POMA 4K2DA 5IQYA 4DSRA 1EWXA 5D9WA 2V6KA 4ILFA 2VCWA 5EPFA 1R4WA 1T1VA 2DC5A 1XIYA 2C3QA 4ZIJA 4MF6A 3NOFA 4EDZA 1KNGA 3GURA 2C0FA 2F8FA 2DMLA 5F0GA 4EF0A 1O8XA 3GMFA 4H86A 3LXZA 3VURA 3TRPA 2B5XA 3QD9A 3S9FA 4HJMA 5D93A 2MMOA 2VM1A 2L4CA 1V57A 1OKTA 4FYCA 1VF1A 4G0IA 1M2BA 3F63A 2X99A 1M99A 3GUSA 3WD6A 4N10A 2MBSA 4K1FA 3MWHA 4J57E 1B9XC 2JSZA 3NIVA 3GX0A 4AJ6A 4GTUA 5HFGA 4AF2A 4K7OA 3KJYA 1HNCA 2IL3A 3U5RE 1MDIA 1HQOA 2GTUA 2YANA 1OC3A 4O92A 3IE3A 4LLRA 3MIXA 3A2XA 4WEYA 4PQIA 1KEBA 1Y6EA 2XHFA 3HJPA 1T4YA 1CQHA 5IOXA 2JACA 5ECPB 2O87A 4IS0A 2AYTA 1QGVA 1SKSB 1V9WA 5ECSA 2VL2C 4POLA 2WFCA 4MP4A 4HUAA 4NV5A 2LQOA 2B7JA 2FLSA 3TCOA 2R3XA 3I43A 5CRWA 1SENA 1PRXA 3LXTA 3MNGA 4BL7A 2ZUPA 3FMWA 1F3AA 2TRXA 2WJUA 1AW9A 4BVYB 4Z7XA 2H6YA 3P8WA 1EGOA 1ACVA 4RI7A 4WKWA 3TJFA 1JLVA 4NAXA 4JR6A 1ZYQB 2IIYA 1QFNA 1AC1A 4LMWA 1ZOFA 2ON7A 3FY7A 3EINA 4J2FA 1M0UA 1WOUA 1UVZA 1RK4A 4OWYA 3HKRA 5B7CA 1JFUA 4OFTA 5KN3A 1QK8A 1GH2A 5E59A 4HU7A 3LQ7A 1AQWA 3KP8A 6GSSA 5HR1A 1K3YA 3ERFA 3TKQA 1THOA 2H72A 16GSA 3L9SA 1G6WA 2FWHA 3IA1A 5ECQB 3R3EA 3VWXA 5KEJA 3EMPA 1ZL9A 4POKA 2JL4A 4JE1A 2TIRA 1GLPA 4V2NA 1TRWA 4LA1A 5IIZA 3WGDA 2A2RA 4MZBA 5HQPA 4ML1A 4KAEA 4TW5A 1DUGA 4L5OA 2HRKA 3QFAC 2GT6A 4IKHA 3APSA 3L78A 4ZL7A 2L6DA 3EMXA 1A2JA 3M0FA 3PINA 4O5QA 3KP9A 2JZRA 2HXKA 3QDNA 4MJAA 1TKDB 3F3RA 3PPUA 1GP1A 4CDOA 3FKFA 3C7MA 3TGZA 4PTSA 4O5RA 1AAZA 4FH8A 5AN1A 4MZWA 1SK0A 2PMTA 1B4PA 3CSHA 3FEUA 5ECRB 2WZ9A 3UBKA 4OCEA 4TRXA 2H8LA 2CAQA 3IK9A 4GSSA 2NDOA 1GSEA 4MZCA 4KNDA 4NHZA 1XW5A 1PX7A 4XS6A 3HYPA 1E6BA 2CQ9A 4MH3A 2VLVA 4GQCA 2YPMA 3GHAA 5C04A 1K0BA 3QMXA 1XOBA 4EUYA 1EOGA 2BTOT 2ZCTA 3BD2A 2IWTA 3A2WA 3KTBA 7GSSA 2KUCA 4WETA 2VUPA 3LYKA 2HSYA 1SD8A 5CRDA 5ID2B 3ZFLA 1PKZA 4Z2UA 3DYRA 5DDLA 1K0CA 5HR3A 4ZILA 2BMXA 4XCSA 2OE0A 3IC8A 4N0ZA 1NHOA 1X5EA 4WR4A 4N30A 2H01A 2CV4A 5IMDA 3SWLA 3GL3A 1GTUA 1XW6A 2R0GA 4LMVA 1OVNA 1EEMA 4KSMA 3IRAA 2HSHA 3DVXA 4OCFA 2AB6A 2HRFA 5C00A 2GS3A 1I9DA 3A5WA 3QPMA 1KBNA 5CYYA 2CA8A 1YKAA 5FWGA 3BCIA 2CVBA 4ICYA 14GSA 3LSZA 4GRFA 4XRAA 2O8VB 3C1RA 4K8MA 3LJRA 1TOFA 4NHWA 2C0EA 3TJKA 4XS4B 4EVMA 4USSA 1PL1A 3GSSA 2B5YA 2MZCA 4MK3A 5DQSA 4K7IA 4QL7A 4V2LA 4F03A 1WMJA 3F9UA 4KH7A 4LL4B 2H19A 2EIQA 5G30A 4F2IA 5BMUA 3BOAA 1F6MC 4MNNA 5DVBA 2L4QA 2OKAA 1SKRB 3ZTLA 1RW1A 5IMZA 4YQUA 5CRGA 5J9CA 4WXTA 4EXJA 4N0VA 5IPHA 2YOIA 1SYRA 4IQ1A 1EZKA 2QGVA 3IHQA 3Q74A 3WGEA 2HZEB 2WGRA 3D4MA 5F07A 3F8UA 2HE3A 1K3OA 4E8HA 1U3IA 3F6FA 1H75A 1SK1A 1BEDA 4WBJA 1N8JA 20GSA 2V41A 1I5GA 1K0DA 5JWQB 1O81A 2HI7A 5HFIA 1XZOA 4MCUA 4ZB8A 4YQVA 2H76A 1GRXA 1FB6A 3ERWA 4KX4A 2MMNA 1WJKA 1YDKA 2FGXA 1XVWA 1VF2A 3FZ4A 1S3AA 4FO5A 3HVVA 1R5PA 1V2AA 2KOKA 3KMOA 1BG5A 1ZYNA 2LRNA 2H73A 2E2MA 4YH2A 2PU9C 4XS4A 2XBQA 1Q98A 4PGTA 2X8CA 2LRTA 3D0ZA 4AJ7A 2QC7A 4RQXA 2R5GA 3ZREA 1O85A 1EOHA 2H70A 3QFBC 2XBIA 2FNOA 2H30A 2YWIA 2Z9SA 4TR1B 1HNAA 4MLYA 2VCVA 1A0FA 2C80A 3E0UA 2GVPA 2M72A 1XPVA 2NTOA 2H66A 1EEJA 4IP1A 4OFMA 3QR6A 1FW1A 3WGXA 1PSQA 2I9HA 1FG4A 1GUHA 5HFKA 2H1BA 2R0PA 2VCTA 2LSTA 4ZBBA 3KGKA 4CY8A 1J9BA 1WRYA 4G0KA 5DJLA 1RQMA 5FHIA 3GYKA 3I69A 3IDVA 3GV1A 3PH9A 5EY6A 4J56E 2KHPA 1A0RP 2X4AA 4HS1A 1MDJA 4BWSA 1GWCA 1TRSA 3BJ5A 5J9BA 2TRCP 4LL1B 4A5PA 5J4UA 3O76A 5ABRA 2QSIA 1X9WB 4RI6A 3F6DA 5IMCA 1O8WA 4HEA2 2F8AA 1ML6A 17GSA 3ISOA 5ECLB 1XWBA 1SD9A 2PN8A 2L57A 5KN2A 3JCML 4GXZA 4ECCA 3F4SA 2CVDA 2C0DA 3HY2A 3BCKA 1OC9B 2I1UA 3FK8A 3TKSE 4ISDA 3LW9A 1PA3A 4OFNA 5AISA 2HLSA 4PUFC 1YEPA 19GSA 5ECOB 3C1SA 4ZL9A 1PMTA 2PPTA 2DIYA 2N5BA 1C72A 1BX9A 1B48A 2IJYA 4ML6A 2E7PA 2EIRA 2A4VA 1TK0B 3UARA 4MF5A 4I2UA 2H0GA 5LCZA 1YKCA 3C71A 1K0OA 2JADA 4GF0A 3WT1A 4TXOB 1LBKA 5IMVA 1TDIA 2IMEA 2FWGA 3TJJA 2LNTA 2XC2A 4YKFA 1FO5A 1BQ7A 3CTGA 5DBQA 1GNEA 4AJ8A 2AJQB 1K0AA 5JCWA 1TW9A 2YWNA 1X5CA 3HA9A 3GSTA 4KE3A 1XWGA 3FZ9A 4CW9A 2H0HA 5H5RA 3P2AA 1H4OA 5DJMA 3ERGA 3KMNA 1J08A 2ES7A 2NPBA 3N9JA 2E0QA 4IJIA 4DSSB 3QAGA 4JEDA 2P5QA 5G5EA 5D8IA 4KW6A 1QQ2A 2DJ2A 4ULXA 5CO3A 4X4JA 1NSWA 2DLXA 1GLQA 2GDRA 4XIHA 3R2QA 3G9BA 4KGIA 4XS1A 13GSA 2JSYA 4EKZA 2C1YA 2GT5A 3H1NA 1ZGNA 4FQUA 3A2VA 4XRDA 1S3DA 5CREA 1FOHA 3RDWA 3LEFA 2LJKA 4F0BA 1AXDA 4V2MA 2QA2A 4OD7A 4ECJA 1IYIA 2HFDA 4K9ZA 5G1KA 5EL8A 3DD3A 2V32A 2X64A 2KLXA 3D22A 5D9VA 4TR0A 5IM9A 1WIKA 4PQHA 2YN1A 4Q5QA 6GSXA 1X0RA 1PKWA 1FAAA 1G6YA 3W6GA 3O3TA 2HNLA 3KCMA 5AGYA 2H74A 5LNKe 4DEJA 2H6ZA 4IP6A 2VCQA 5B8BA 3A5IA 4PNGA 5H5SA 4X0XA 2M46A 1V98A 3LFLA 3F3QA 3VK9A 1ZZYA 4TVEA 5IO2A 5IMAA 1Z6NA 3KIJA 2G0FA 3H8QA 1GTAA 2FUG2 4EO3A 1WPIA 2VL2A 1O6JA 5AIVA 4YAVA 3FR9A 5HR0A 2HSMA 4Q5NA 4ZB9A 2I4AA 4BVYA 1V58A 2FA4A 4I8BA 1DSBA 1VGLA 2NVLA 1Z6MA 1BAYA 5KOXA 2YWOA 4PXOA 4IN0A 6GSTA 2RIIA 1R26A 1XXUA 3UBLA 1GNWA 5B6MA 2IPAA 3HZ4A 2VIMA 2VD1A 3F0IA 4L5LA 5H5QA 3GH6A 2GZYA 5JWRB 5G31A 4QL9A 5ENUA 1SU9A 4X1UA 3GX8A 1X5DA 2E2GA 2EC4A 4IGJA 4WR5A 2R6KA 2MYGA 5A4VA 4KDXA 1QXHA 1AQXA 1TI3A 4GSNA 1XOAA 3EPTA 3TKSC 2LNSA 3FHKA 2VL3A 1B4QA 3CYNA 2R0CA 2RM6A 3D21A 3P7XA 1U87A 2R4VA 1XW9A 2DKIA 2LKUA 3GN3A 1YZXA 2CAIA 3DGQA 3L9UA 4MDCA 2LS5A 4ECIA 2YJ7A 5J3RA 4BVXB 2K18A 2KP2A 3RHCA 5CP1A 4MJBA 3SBCA 3APQA 4F82A 1AUCA 3DXBA 5KN0A 2FY6A 2G2QA 1FVKA 4FIWA 1ERUA 3IR4A 4HQSA 11GSA 4MMMA 3TJBA 1ZYPA 1LJRA 4D73B 2PBJA 2RM5A 3QAVA 1SYXA 1JHBA 5F06A 4K5SA 4WF4A 4KDUA 5HR2A 4TXVA 2VM2A 2H75A 4OO4A 1T4ZA 5ID2A 1Z5YE 4F0CA 1ON4A 2J9HA 2DJ0A 2H6XA 1ZYEA 5LD0A 3J7Yk 3CXGA 1TU7A 4HDEA 1ZMAA 2CVKA 1Z3EA 3KH9A 4G2EA 2FA8A 3QOUA 4ZXGA 4E8EA 1YF1A 5DCHA 2JZTA 5A4WA 1VF4A 4MPGA 5CAXA 2VCXA 4NMUA 1E2YA 3J7Yb 3LWAA 1WP0A 5ELAA 4G9HA 2LQQA 4G0LA 1FB0A 1GTIA 4I6XA 4WF5A 2F9SA 4PUAA 3UAPA 3EE2A 3VPTA 5D96A 3ME7A 1X9MB 1TRUA 1A24A 5ECKB 4GSTA 1F3BA 4JR4A 4KB3A 5D9XA 3ZYWA 4HJ2A 2OBIA 1GUKA 1MEKA 4IHUA 4NPBA 3UL3A 2N5FA 5D9TA 1FOVA 1TP9A 4CHSA 1HYUA 2DIZA 4MA9A 4K6XA 4O7HA 5DAKB 4KSOA 2HRNA 3L4NA 1SJ6A 1PL2A 8GSSA 2B1KA 4MJCA 1OC8A 1G0TA 2R37A 2VLTA 3Q6OA 1Z7PA 3UVTA 4Z2RA 2DJJA 1A2MA 1MDKA 4ECBA 2WS2A 1URMA 3RPNA 5KOWA 3H4KA 3G7JA 3GL5A 3US3A 2GQMA 1B9YC 3ZRDA 3VWUA 4HQZA 3EWLA 3E9JB 1OAZA 2H0IA 5G1LA 1NHYA 1VF3A 1SJZA 5JCGA 1PN9A 2P0GA 4KA0A 1ST9A 2RUEA 3KM6A 3G7IA 2K8VA 3LYPA 2HZEA 2K9FA 2PGTA 2MMZA 2O7KA 2LEGA 3KEBA 3HVSA 4PQ1A 2AHEA 3CBUA 2DMMA 2XPEA 1ABAA 1M9AA 5A5KA 4MH2A 5B8AA 4KF9A 1T00A 1GSYA 1F37A 3ZITA 3W8JA 3HD5A 4MF7A 3RAZA 4PNFA 4JRRA 1A2LA 2YZUA 1TXXA 2LRCA 3UVHA 5IOWA 2LJAA 4GCIA 4JBBA 2YNXA 3M9JA 3V1WA 4EIPA 2DJ1A 2H1AA 1YJ6A 1JZWA 1MTCA 3ZIJA 2LV3A 3UEMA 2WCIA 1K0MA 1TI1A 2GSTA 2B3SA 5GAND 2ALBA 3PR8A 5DAKA 2YJHA 4GLTA 1B8XA 5GSSA 2O89A 2OE3A 3M1GA 4HU9A 3DEXA 4DVCA 1FVJA 1R5AA 3CSIA 3LG6A 3P90A 3LORA 4AGSA 2V6OA 1PX6A 3GA4A 3D5JA 3PGTA 4YAPA 4TR1A 3IV4A 5J41A 2B5EA 4KDYA 4OMVA 3ZZXA 1F2EA 2C3TA 4KCAA 5DALB 1U6TA 4ZL8A 3DMLA 3CRUA 3L0HA 2YWMA 3VWVA 4FYBA 3MDKA 2C8UA 3UIWA 3FZAA 2WULA 1OE8A 1EV9A 12GSA 4EDYA 1ZCPA 3M3MA 1WWJA 3KD0A 1XWCA 3GKNA 1ERTA 1BYEA 1PD21 2C3NA 2VAFA 5G2ZA 3C73A 3TB2A 1QUWA 4POBA 4I2TA 5IPGA 3EURA 3VWWA 5EVOA 3EC3A 2AAWA 4XHMA 4X43A 2VL9A 3UMAA 1FHEA 4NV2A 1OC9A 1USBA 3EU4A 1TJDA 1YF0A 2WDUA 2WRTA 1SL2B 2F3MA 3KH7A 2RUFA 2KP1A 2PUKC 2L59A 3ZIVA 3EYTA 1EP7A 2B6MA 2NBSA 1XBSA 1Z9HA 3HJOA 3I9V2 3VI5A 2DJKA 1K3LA 2VO4A 3KXOA 4HZ4A 1N2AA 1M9BA 3MAKA 1AQVA 1TK5B 2ZNMA 2X8GA 3DWVA 1WE0A 4TR4A 2REMA 3HHVA 3ZFBA 2ON5A 4G19A 2R2JA 4I97A 3FYGA 4NWYA 1PGTA 2JU5A 4TXOA 4F9ZA 5DALA 2V1MA 3QCPA 1K0NA 1VRSD 1UN2A 1TU8A 5E4WA 2FCHA 3BBYA 4K0GA 3TUEA 2IMIA 3MSZA 2MMAA 3RHBA 4IELA 2VOCA 4RQRA 1G7EA 4IBPA 3UOMA 4BWQA 5ECMB 2N5AA 1X9SB 2BJXA 2FWFA 5F8BA 1GSFA 3MYDA 2M80A 4TKYA 3WT2A 2PWJA 1Y25A 4QQ7A 3G7YA 3RBTA 3VLNA 4DSSA 1A8YA 2CT6A 3HJMA 1EP8A 6GSVA 2VD0A 3D4TA 2H1DA 1JZRA 1YEXA 2IFQB 9GSSA 3DRNA 4L0UA 2FHEA 1A23A 1GUMA 4KUNA 1GTBA 5ECHB 5FT3A 1W4VA 4Q5RA 2OADA 6GSWA 2YP6A 4JU5A 1M7TA 1W89A 4PURA 4PX1A 4K2XA 1XCCA 1OYJA 5IMFA 3ED3A 2DJ3A 4K5RA 4O32A 1O7UA 1TTZA 2OACA 4IW9A 1JZDA 4ID0A 5IO0A 1HNBA 1XVQA 1GSUA 2GZZA 1YQ1A 4EIQA 1SK2A 1DBYA 2JZSA 3VFIA 1V40A 4N11A 3TKPA 4ZBDA 6GSYA 10GSA 1O73A 2QA1A 2OBKA 4NXIA 4RUVA 5GSTA 5D73A 2YCDA 3CTFA 1YY7A 1GSQA 3GH9A 3DIEA 3GRXA 5B6NA 3RPPA 3HXSA 3IK7A 4L8EA 4K0NA 1U88A 5A4UA 1SL1B 2IMDA 1THXA 2IMFA 3DVWA 3A3TA 3C8EA 3Q18A 5COHA 2HT9A 4HOJA 1T3BA 1IYHA 1U3AA 3GKMA 2HRAA 3TDGA 2PVQA 1EV4A 4YQMA 4HZ2A 2HZFA 3IAS2 2DBCA 3VI7A 3GFKA 2B1LA 3VPQA 1GSSA 4I5QA 2CX4A 1F9MA 3FZ5A 2EIOA 5ELGA 3TOUA 3M9KA 1NM3A 2CZ3A 2AV4A 2A2SA 3IOSA 2LTKA 1A8LA 2IFQA 1ILOA 2X8HA 4EC0A 1T8EB 3F4RA 2K8SA 3N5OA 4MABA 4Q5FA 4ACSA 3TRXA 2GLRA 3FR3A 1DE1A 4O5UA 1PN0A 2L6CA 3EU3A 3ZVJD 5G5FA 2QKEA 3HDCA 3H93A 3KZQA 2P31A 3W8SA 1XWAA 2LUSA 3HZ8A 4ZB6A 3U6VA 3I6AA 1UC7A 2O85A 1KTEA 1ERWA 3GKKA 3GTUB 1TRVA 2B7KA 2J23A 2VLUA 1T7PB 2MBTA 1ERVA 3F4TA 1JZOA 2FWEA 5CNWA 4V1Ap 3FRCA 2CZ2A 2OE1A 3CSJA 3IC4A 4MJEA 1TK8B 2V2GA 5DCGA 3ZMKA 2H71A 4GWRA 3EVIA 2PVOC 3E3EA 4P3YB 3M8NA 3ZMLA 1JLWA 4V1Ag 2UZ8A 2P5RA 3NZNA 3GIXA 2AUVA 5GAPD 5ECNB 3H79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQK A;  2C0G A;  4JZQ A;  4IJ3 A;  2C4J A;  2RLI A;  3D6I A;  2GZP A;  4BPY A;  3TJG A;  3TKS A;  3AY8 A;  1GL8 A;  4TR3 A;  5KN1 A;  2YV7 A;  3IAM 2;  4DSQ A;  3FR6 A;  2L5O A;  2DSA A;  2YZH A;  3WYW A;  3IXR A;  1Q4J A;  4TN8 A;  2FD3 A;  6GSU A;  1GSD A;  2H1G A;  2OJL A;  1Z7R A;  3L9V A;  3GNJ A;  2PER A;  4BVX A;  1MD3 A;  4OO5 A;  4GQF A;  2WB9 A;  5AIX A;  18GS A;  3CRT A;  4BA7 A;  1NW2 A;  3ME8 A;  2VCZ A;  5ECI B;  3HCZ A;  4IQA A;  5J5N A;  4G10 A;  1QMV A;  1J0F A;  2IN3 A;  3TRQ A;  2I81 A;  2HYX A;  1R7H A;  3TKR A;  4EE0 A;  2I3Y A;  2GSR A;  1MD4 A;  22GS A;  4FYU A;  1GUL A;  5JWO B;  1SKW B;  5CRH A;  3K8N A;  2F51 A;  3APO A;  4D73 A;  1SJI A;  3KTL A;  3TOT A;  3GTU A;  1HD2 A;  4L0W A;  1S3C A;  5L71 A;  3OR5 A;  1OE7 A;  2GGT A;  1EGR A;  3HVX A;  3GKX A;  5JCU A;  4IVF A;  2L5L A;  3QAW A;  2OA7 A;  4KCE A;  4TOP A;  2GSS A;  3Q19 A;  3IBH A;  4WBR D;  2GQL A;  3IPZ A;  3LGC A;  1OKD A;  1CQG A;  3ZLP A;  4K7N A;  1PQN A;  3ZL5 A;  1UA5 A;  2LJR A;  2IMK A;  1G7O A;  1XFL A;  5DQY A;  3O6T A;  1SL0 B;  1AIU A;  5F05 A;  4MPF A;  2K6V A;  2YV9 A;  3UJ1 A;  4ZBA A;  2D2Z A;  3ZVJ A;  2GSQ A;  1BJX A;  5INY A;  1M2A A;  2XPD A;  3FW2 A;  3CMI A;  3DKS A;  1XWK A;  1LU4 A;  4XTS A;  5GZZ B;  4HI7 A;  1M2D A;  4EL1 A;  2CX3 A;  1DE2 A;  4POM A;  4K2D A;  5IQY A;  4DSR A;  1EWX A;  5D9W A;  2V6K A;  4ILF A;  2VCW A;  5EPF A;  1R4W A;  1T1V A;  2DC5 A;  1XIY A;  2C3Q A;  4ZIJ A;  4MF6 A;  3NOF A;  4EDZ A;  1KNG A;  3GUR A;  2C0F A;  2F8F A;  2DML A;  5F0G A;  4EF0 A;  1O8X A;  3GMF A;  4H86 A;  3LXZ A;  3VUR A;  3TRP A;  2B5X A;  3QD9 A;  3S9F A;  4HJM A;  5D93 A;  2MMO A;  2VM1 A;  2L4C A;  1V57 A;  1OKT A;  4FYC A;  1VF1 A;  1M2B A;  3F63 A;  2X99 A;  1M99 A;  3GUS A;  3WD6 A;  4N10 A;  2MBS A;  4K1F A;  3MWH A;  4J57 E;  1B9X C;  2JSZ A;  3NIV A;  3GX0 A;  4AJ6 A;  4GTU A;  5HFG A;  4AF2 A;  4K7O A;  3KJY A;  1HNC A;  2IL3 A;  3U5R E;  1MDI A;  1HQO A;  2GTU A;  2YAN A;  1OC3 A;  4O92 A;  3IE3 A;  4LLR A;  3A2X A;  4WEY A;  4PQI A;  1KEB A;  1Y6E A;  2XHF A;  3HJP A;  1T4Y A;  1CQH A;  5IOX A;  2JAC A;  5ECP B;  2O87 A;  4IS0 A;  2AYT A;  1QGV A;  1SKS B;  1V9W A;  5ECS A;  2VL2 C;  4POL A;  2WFC A;  4MP4 A;  4HUA A;  4NV5 A;  2LQO A;  2B7J A;  2FLS A;  3TCO A;  2R3X A;  3I43 A;  5CRW A;  1SEN A;  1PRX A;  3LXT A;  3MNG A;  4BL7 A;  2ZUP A;  1F3A A;  2TRX A;  2WJU A;  1AW9 A;  4Z7X A;  2H6Y A;  3P8W A;  1EGO A;  1ACV A;  4RI7 A;  4WKW A;  3TJF A;  1JLV A;  4NAX A;  4JR6 A;  1ZYQ B;  2IIY A;  1QFN A;  1AC1 A;  4LMW A;  1ZOF A;  2ON7 A;  3FY7 A;  3EIN A;  4J2F A;  1M0U A;  1WOU A;  1UVZ A;  1RK4 A;  4OWY A;  3HKR A;  5B7C A;  1JFU A;  4OFT A;  5KN3 A;  1QK8 A;  1GH2 A;  5E59 A;  4HU7 A;  3LQ7 A;  1AQW A;  3KP8 A;  6GSS A;  5HR1 A;  1K3Y A;  3ERF A;  3TKQ A;  1THO A;  2H72 A;  16GS A;  3L9S A;  1G6W A;  2FWH A;  3IA1 A;  5ECQ B;  3VWX A;  5KEJ A;  3EMP A;  1ZL9 A;  2JL4 A;  4POK A;  4JE1 A;  2TIR A;  1GLP A;  4V2N A;  1TRW A;  4LA1 A;  5IIZ A;  3WGD A;  2A2R A;  4MZB A;  5HQP A;  4ML1 A;  4KAE A;  4TW5 A;  1DUG A;  4L5O A;  3QFA C;  2GT6 A;  4IKH A;  3APS A;  3L78 A;  4ZL7 A;  2L6D A;  3EMX A;  1A2J A;  3M0F A;  3PIN A;  3KP9 A;  2JZR A;  2HXK A;  3QDN A;  4MJA A;  1TKD B;  3F3R A;  1GP1 A;  4CDO A;  3FKF A;  3C7M A;  3TGZ A;  4O5R A;  1AAZ A;  4FH8 A;  5AN1 A;  4MZW A;  1SK0 A;  2PMT A;  1B4P A;  3CSH A;  3FEU A;  5ECR B;  2WZ9 A;  3UBK A;  4OCE A;  4TRX A;  2H8L A;  2CAQ A;  3IK9 A;  4GSS A;  2NDO A;  1GSE A;  4MZC A;  4KND A;  4NHZ A;  1XW5 A;  1PX7 A;  4XS6 A;  3HYP A;  1E6B A;  2CQ9 A;  4MH3 A;  2VLV A;  4GQC A;  2YPM A;  3GHA A;  5C04 A;  1K0B A;  3QMX A;  1XOB A;  4EUY A;  1EOG A;  2BTO T;  2ZCT A;  3BD2 A;  2IWT A;  3A2W A;  3KTB A;  7GSS A;  2KUC A;  4WET A;  2VUP A;  3LYK A;  2HSY A;  1SD8 A;  5CRD A;  5ID2 B;  3ZFL A;  1PKZ A;  3DYR A;  5DDL A;  1K0C A;  5HR3 A;  4ZIL A;  2BMX A;  4XCS A;  2OE0 A;  4N0Z A;  1NHO A;  1X5E A;  4WR4 A;  4N30 A;  2H01 A;  2CV4 A;  5IMD A;  3SWL A;  3GL3 A;  1GTU A;  1XW6 A;  4LMV A;  1OVN A;  1EEM A;  4KSM A;  3IRA A;  2HSH A;  3DVX A;  4OCF A;  2AB6 A;  2HRF A;  5C00 A;  2GS3 A;  1I9D A;  3A5W A;  3QPM A;  1KBN A;  5CYY A;  2CA8 A;  1YKA A;  5FWG A;  3BCI A;  2CVB A;  14GS A;  3LSZ A;  4GRF A;  4XRA A;  2O8V B;  3C1R A;  4K8M A;  3LJR A;  1TOF A;  4NHW A;  2C0E A;  3TJK A;  4XS4 B;  4EVM A;  1PL1 A;  3GSS A;  2B5Y A;  2MZC A;  4MK3 A;  5DQS A;  4K7I A;  4QL7 A;  4V2L A;  4F03 A;  1WMJ A;  3F9U A;  4KH7 A;  4LL4 B;  2H19 A;  2EIQ A;  5G30 A;  4F2I A;  3BOA A;  1F6M C;  5DVB A;  2L4Q A;  2OKA A;  1SKR B;  3ZTL A;  1RW1 A;  5IMZ A;  4YQU A;  5CRG A;  5J9C A;  4WXT A;  4EXJ A;  4N0V A;  5IPH A;  2YOI A;  1SYR A;  4IQ1 A;  1EZK A;  2QGV A;  3IHQ A;  3Q74 A;  3WGE A;  2HZE B;  2WGR A;  3D4M A;  5F07 A;  3F8U A;  2HE3 A;  1K3O A;  4E8H A;  1U3I A;  3F6F A;  1H75 A;  1SK1 A;  1BED A;  4WBJ A;  1N8J A;  20GS A;  2V41 A;  1I5G A;  1K0D A;  5JWQ B;  1O81 A;  2HI7 A;  5HFI A;  1XZO A;  4MCU A;  4ZB8 A;  4YQV A;  2H76 A;  1GRX A;  1FB6 A;  3ERW A;  4KX4 A;  2MMN A;  1WJK A;  1YDK A;  2FGX A;  1XVW A;  1VF2 A;  3FZ4 A;  1S3A A;  4FO5 A;  3HVV A;  1R5P A;  1V2A A;  2KOK A;  3KMO A;  1BG5 A;  2LRN A;  2H73 A;  2E2M A;  4YH2 A;  2PU9 C;  4XS4 A;  2XBQ A;  1Q98 A;  4PGT A;  2X8C A;  2LRT A;  3D0Z A;  4AJ7 A;  2QC7 A;  4RQX A;  2R5G A;  3ZRE A;  1O85 A;  1EOH A;  2H70 A;  3QFB C;  2XBI A;  2FNO A;  2H30 A;  2YWI A;  2Z9S A;  4TR1 B;  1HNA A;  4MLY A;  2VCV A;  1A0F A;  2C80 A;  3E0U A;  2GVP A;  2M72 A;  1XPV A;  2NTO A;  2H66 A;  1EEJ A;  4IP1 A;  4OFM A;  3QR6 A;  1FW1 A;  3WGX A;  1PSQ A;  2I9H A;  1FG4 A;  1GUH A;  5HFK A;  2H1B A;  2VCT A;  2LST A;  4ZBB A;  3KGK A;  1J9B A;  1WRY A;  5DJL A;  1RQM A;  5FHI A;  3GYK A;  3I69 A;  3IDV A;  3GV1 A;  3PH9 A;  5EY6 A;  4J56 E;  2KHP A;  1A0R P;  4HS1 A;  1MDJ A;  4BWS A;  1GWC A;  1TRS A;  3BJ5 A;  5J9B A;  2TRC P;  4LL1 B;  5J4U A;  3O76 A;  5ABR A;  2QSI A;  1X9W B;  4RI6 A;  3F6D A;  5IMC A;  1O8W A;  4HEA 2;  2F8A A;  1ML6 A;  17GS A;  3ISO A;  5ECL B;  1XWB A;  1SD9 A;  2PN8 A;  2L57 A;  5KN2 A;  3JCM L;  4GXZ A;  4ECC A;  3F4S A;  2CVD A;  2C0D A;  3HY2 A;  3BCK A;  1OC9 B;  2I1U A;  3FK8 A;  3TKS E;  4ISD A;  1PA3 A;  4OFN A;  5AIS A;  2HLS A;  4PUF C;  1YEP A;  19GS A;  5ECO B;  3C1S A;  4ZL9 A;  1PMT A;  2PPT A;  2DIY A;  2N5B A;  1C72 A;  1BX9 A;  1B48 A;  2IJY A;  4ML6 A;  2E7P A;  2EIR A;  2A4V A;  1TK0 B;  3UAR A;  4MF5 A;  4I2U A;  2H0G A;  5LCZ A;  1YKC A;  3C71 A;  1K0O A;  2JAD A;  4GF0 A;  3WT1 A;  4TXO B;  1LBK A;  5IMV A;  1TDI A;  2IME A;  2FWG A;  3TJJ A;  2LNT A;  2XC2 A;  1FO5 A;  1BQ7 A;  3CTG A;  5DBQ A;  1GNE A;  4AJ8 A;  2AJQ B;  1K0A A;  5JCW A;  1TW9 A;  2YWN A;  1X5C A;  3HA9 A;  3GST A;  4KE3 A;  1XWG A;  3FZ9 A;  4CW9 A;  2H0H A;  5H5R A;  3P2A A;  1H4O A;  5DJM A;  3ERG A;  3KMN A;  1J08 A;  2ES7 A;  2NPB A;  3N9J A;  2E0Q A;  4IJI A;  4DSS B;  3QAG A;  4JED A;  2P5Q A;  5G5E A;  5D8I A;  4KW6 A;  1QQ2 A;  2DJ2 A;  4ULX A;  5CO3 A;  1NSW A;  2DLX A;  1GLQ A;  2GDR A;  4XIH A;  3R2Q A;  3G9B A;  4KGI A;  4XS1 A;  13GS A;  2JSY A;  4EKZ A;  2C1Y A;  2GT5 A;  3H1N A;  1ZGN A;  3A2V A;  4XRD A;  1S3D A;  5CRE A;  3RDW A;  3LEF A;  2LJK A;  4F0B A;  1AXD A;  4V2M A;  4OD7 A;  4ECJ A;  1IYI A;  2HFD A;  4K9Z A;  5G1K A;  5EL8 A;  3DD3 A;  2V32 A;  2X64 A;  2KLX A;  3D22 A;  5D9V A;  4TR0 A;  5IM9 A;  1WIK A;  4PQH A;  2YN1 A;  4Q5Q A;  6GSX A;  1X0R A;  1PKW A;  1FAA A;  1G6Y A;  3W6G A;  3O3T A;  2HNL A;  3KCM A;  5AGY A;  2H74 A;  5LNK e;  4DEJ A;  2H6Z A;  4IP6 A;  2VCQ A;  5B8B A;  4PNG A;  5H5S A;  4X0X A;  2M46 A;  1V98 A;  3LFL A;  3F3Q A;  3VK9 A;  1ZZY A;  4TVE A;  5IO2 A;  5IMA A;  1Z6N A;  3KIJ A;  2G0F A;  3H8Q A;  1GTA A;  2FUG 2;  4EO3 A;  1WPI A;  2VL2 A;  1O6J A;  5AIV A;  4YAV A;  3FR9 A;  5HR0 A;  4Q5N A;  4ZB9 A;  2I4A A;  4BVY A;  1V58 A;  2FA4 A;  4I8B A;  1DSB A;  1VGL A;  2NVL A;  1Z6M A;  1BAY A;  2YWO A;  4PXO A;  4IN0 A;  6GST A;  2RII A;  1R26 A;  1XXU A;  3UBL A;  1GNW A;  5B6M A;  2IPA A;  3HZ4 A;  2VIM A;  2VD1 A;  3F0I A;  4L5L A;  5H5Q A;  3GH6 A;  2GZY A;  5JWR B;  5G31 A;  4QL9 A;  5ENU A;  1SU9 A;  4X1U A;  3GX8 A;  1X5D A;  2E2G A;  2EC4 A;  4IGJ A;  4WR5 A;  2R6K A;  2MYG A;  5A4V A;  4KDX A;  1QXH A;  1AQX A;  1TI3 A;  4GSN A;  1XOA A;  3TKS C;  2LNS A;  3FHK A;  2VL3 A;  1B4Q A;  3CYN A;  2RM6 A;  3D21 A;  3P7X A;  1U87 A;  2R4V A;  1XW9 A;  2LKU A;  3GN3 A;  1YZX A;  2CAI A;  3DGQ A;  3L9U A;  4MDC A;  2LS5 A;  4ECI A;  2YJ7 A;  5J3R A;  2K18 A;  2KP2 A;  3RHC A;  5CP1 A;  4MJB A;  3SBC A;  3APQ A;  4F82 A;  1AUC A;  3DXB A;  5KN0 A;  2FY6 A;  2G2Q A;  1FVK A;  4FIW A;  1ERU A;  3IR4 A;  4HQS A;  11GS A;  4MMM A;  3TJB A;  1LJR A;  4D73 B;  2PBJ A;  2RM5 A;  3QAV A;  1SYX A;  1JHB A;  5F06 A;  4WF4 A;  4KDU A;  5HR2 A;  4TXV A;  2VM2 A;  2H75 A;  4OO4 A;  1T4Z A;  5ID2 A;  1Z5Y E;  4F0C A;  1ON4 A;  2J9H A;  2DJ0 A;  2H6X A;  1ZYE A;  5LD0 A;  3J7Y k;  3CXG A;  1TU7 A;  4HDE A;  1ZMA A;  2CVK A;  1Z3E A;  3KH9 A;  4G2E A;  2FA8 A;  3QOU A;  4ZXG A;  4E8E A;  1YF1 A;  5DCH A;  2JZT A;  5A4W A;  1VF4 A;  4MPG A;  5CAX A;  2VCX A;  4NMU A;  1E2Y A;  3J7Y b;  3LWA A;  1WP0 A;  5ELA A;  4G9H A;  2LQQ A;  1FB0 A;  1GTI A;  4I6X A;  4WF5 A;  2F9S A;  4PUA A;  3UAP A;  3EE2 A;  3VPT A;  5D96 A;  3ME7 A;  1X9M B;  1TRU A;  1A24 A;  5ECK B;  4GST A;  1F3B A;  4JR4 A;  4KB3 A;  5D9X A;  3ZYW A;  4HJ2 A;  2OBI A;  1GUK A;  1MEK A;  4IHU A;  4NPB A;  3UL3 A;  2N5F A;  5D9T A;  1FOV A;  1TP9 A;  4CHS A;  1HYU A;  2DIZ A;  4MA9 A;  4K6X A;  4O7H A;  5DAK B;  4KSO A;  2HRN A;  3L4N A;  1SJ6 A;  1PL2 A;  8GSS A;  2B1K A;  4MJC A;  1OC8 A;  1G0T A;  2R37 A;  2VLT A;  3Q6O A;  1Z7P A;  3UVT A;  2DJJ A;  1A2M A;  1MDK A;  4ECB A;  2WS2 A;  1URM A;  3RPN A;  3H4K A;  3G7J A;  3GL5 A;  3US3 A;  2GQM A;  1B9Y C;  3ZRD A;  3VWU A;  4HQZ A;  3EWL A;  3E9J B;  1OAZ A;  2H0I A;  5G1L A;  1NHY A;  1VF3 A;  1SJZ A;  5JCG A;  1PN9 A;  2P0G A;  4KA0 A;  1ST9 A;  2RUE A;  3KM6 A;  3G7I A;  2K8V A;  3LYP A;  2HZE A;  2K9F A;  2PGT A;  2MMZ A;  2O7K A;  2LEG A;  3KEB A;  3HVS A;  4PQ1 A;  2AHE A;  3CBU A;  2DMM A;  2XPE A;  1ABA A;  1M9A A;  5A5K A;  4MH2 A;  5B8A A;  1T00 A;  1GSY A;  1F37 A;  3ZIT A;  3W8J A;  3HD5 A;  4MF7 A;  3RAZ A;  4PNF A;  2YZU A;  1A2L A;  4JRR A;  1TXX A;  2LRC A;  3UVH A;  5IOW A;  2LJA A;  4GCI A;  4JBB A;  2YNX A;  3M9J A;  3V1W A;  2DJ1 A;  2H1A A;  1YJ6 A;  1JZW A;  1MTC A;  3ZIJ A;  2LV3 A;  3UEM A;  2WCI A;  1K0M A;  1TI1 A;  2GST A;  2B3S A;  5GAN D;  2ALB A;  3PR8 A;  5DAK A;  2YJH A;  4GLT A;  1B8X A;  5GSS A;  2O89 A;  2OE3 A;  3M1G A;  4HU9 A;  3DEX A;  4DVC A;  1FVJ A;  1R5A A;  3CSI A;  3LG6 A;  3P90 A;  3LOR A;  4AGS A;  2V6O A;  1PX6 A;  3GA4 A;  3D5J A;  3PGT A;  4YAP A;  4TR1 A;  3IV4 A;  5J41 A;  2B5E A;  4KDY A;  4OMV A;  3ZZX A;  1F2E A;  2C3T A;  4KCA A;  5DAL B;  1U6T A;  4ZL8 A;  3DML A;  3CRU A;  3L0H A;  2YWM A;  3VWV A;  4FYB A;  3MDK A;  2C8U A;  3UIW A;  3FZA A;  2WUL A;  1OE8 A;  1EV9 A;  12GS A;  4EDY A;  1ZCP A;  3M3M A;  1WWJ A;  3KD0 A;  1XWC A;  3GKN A;  1ERT A;  1BYE A;  1PD2 1;  2C3N A;  2VAF A;  5G2Z A;  3C73 A;  3TB2 A;  1QUW A;  4POB A;  4I2T A;  5IPG A;  3EUR A;  3VWW A;  5EVO A;  3EC3 A;  2AAW A;  4XHM A;  4X43 A;  2VL9 A;  3UMA A;  1FHE A;  4NV2 A;  1OC9 A;  1USB A;  3EU4 A;  1TJD A;  1YF0 A;  2WDU A;  2WRT A;  1SL2 B;  2F3M A;  3KH7 A;  2RUF A;  2KP1 A;  2PUK C;  2L59 A;  3ZIV A;  3EYT A;  1EP7 A;  2B6M A;  2NBS A;  1XBS A;  1Z9H A;  3HJO A;  3I9V 2;  3VI5 A;  2DJK A;  1K3L A;  2VO4 A;  3KXO A;  4HZ4 A;  1N2A A;  1M9B A;  3MAK A;  1AQV A;  1TK5 B;  2ZNM A;  2X8G A;  3DWV A;  1WE0 A;  4TR4 A;  2REM A;  3HHV A;  3ZFB A;  2ON5 A;  4G19 A;  2R2J A;  4I97 A;  3FYG A;  4NWY A;  1PGT A;  2JU5 A;  4TXO A;  4F9Z A;  5DAL A;  2V1M A;  3QCP A;  1K0N A;  1VRS D;  1UN2 A;  1TU8 A;  5E4W A;  2FCH A;  3BBY A;  4K0G A;  3TUE A;  2IMI A;  3MSZ A;  2MMA A;  3RHB A;  4IEL A;  2VOC A;  4RQR A;  1G7E A;  4IBP A;  3UOM A;  4BWQ A;  5ECM B;  2N5A A;  1X9S B;  2BJX A;  2FWF A;  5F8B A;  1GSF A;  2M80 A;  4TKY A;  3WT2 A;  2PWJ A;  1Y25 A;  4QQ7 A;  3G7Y A;  3RBT A;  3VLN A;  4DSS A;  1A8Y A;  2CT6 A;  3HJM A;  1EP8 A;  6GSV A;  2VD0 A;  3D4T A;  2H1D A;  1JZR A;  1YEX A;  2IFQ B;  9GSS A;  3DRN A;  4L0U A;  2FHE A;  1A23 A;  1GUM A;  4KUN A;  1GTB A;  5ECH B;  5FT3 A;  1W4V A;  4Q5R A;  2OAD A;  6GSW A;  2YP6 A;  4JU5 A;  1M7T A;  1W89 A;  4PUR A;  4PX1 A;  1XCC A;  1OYJ A;  5IMF A;  3ED3 A;  2DJ3 A;  4O32 A;  1O7U A;  1TTZ A;  2OAC A;  4IW9 A;  1JZD A;  4ID0 A;  5IO0 A;  1HNB A;  1XVQ A;  1GSU A;  2GZZ A;  1YQ1 A;  1SK2 A;  1DBY A;  2JZS A;  3VFI A;  1V40 A;  4N11 A;  3TKP A;  4ZBD A;  6GSY A;  10GS A;  1O73 A;  2OBK A;  4NXI A;  4RUV A;  5GST A;  5D73 A;  2YCD A;  3CTF A;  1YY7 A;  1GSQ A;  3GH9 A;  3DIE A;  3GRX A;  5B6N A;  3RPP A;  3HXS A;  3IK7 A;  4L8E A;  4K0N A;  1U88 A;  5A4U A;  1SL1 B;  2IMD A;  1THX A;  2IMF A;  3DVW A;  3A3T A;  3C8E A;  3Q18 A;  5COH A;  2HT9 A;  4HOJ A;  1T3B A;  1IYH A;  1U3A A;  3GKM A;  3TDG A;  2PVQ A;  1EV4 A;  4YQM A;  4HZ2 A;  2HZF A;  3IAS 2;  2DBC A;  3VI7 A;  3GFK A;  2B1L A;  3VPQ A;  1GSS A;  4I5Q A;  2CX4 A;  1F9M A;  3FZ5 A;  2EIO A;  5ELG A;  3TOU A;  3M9K A;  1NM3 A;  2CZ3 A;  2AV4 A;  2A2S A;  3IOS A;  2LTK A;  1A8L A;  2IFQ A;  1ILO A;  2X8H A;  4EC0 A;  1T8E B;  3F4R A;  2K8S A;  3N5O A;  4MAB A;  4Q5F A;  4ACS A;  3TRX A;  2GLR A;  3FR3 A;  1DE1 A;  2L6C A;  3EU3 A;  3ZVJ D;  5G5F A;  2QKE A;  3HDC A;  3H93 A;  3KZQ A;  2P31 A;  3W8S A;  1XWA A;  2LUS A;  3HZ8 A;  4ZB6 A;  3U6V A;  3I6A A;  1UC7 A;  2O85 A;  1KTE A;  1ERW A;  3GKK A;  3GTU B;  1TRV A;  2B7K A;  2J23 A;  2VLU A;  1T7P B;  2MBT A;  1ERV A;  3F4T A;  1JZO A;  2FWE A;  5CNW A;  4V1A p;  3FRC A;  2CZ2 A;  2OE1 A;  3CSJ A;  3IC4 A;  4MJE A;  1TK8 B;  2V2G A;  5DCG A;  3ZMK A;  2H71 A;  4GWR A;  3EVI A;  2PVO C;  3E3E A;  4P3Y B;  3M8N A;  3ZML A;  1JLW A;  4V1A g;  2P5R A;  3NZN A;  3GIX A;  2AUV A;  5GAP D;  5ECN B;  3H79 A; 
#chains in the Genus database with same CATH topology
 2GQK A;  5BRT A;  2C0G A;  4JZQ A;  4IJ3 A;  2C4J A;  2RLI A;  3D6I A;  2GZP A;  4BPY A;  3TJG A;  3TKS A;  3AY8 A;  1GL8 A;  4TR3 A;  5KN1 A;  2YV7 A;  3IAM 2;  4DSQ A;  3FR6 A;  2L5O A;  2DSA A;  2YZH A;  3WYW A;  3IXR A;  1Q4J A;  4TN8 A;  2FD3 A;  6GSU A;  1GSD A;  2H1G A;  2OJL A;  1Z7R A;  3L9V A;  3GNJ A;  2PER A;  4BVX A;  1MD3 A;  4OO5 A;  4GQF A;  2WB9 A;  5AIX A;  18GS A;  3CRT A;  4BA7 A;  1NW2 A;  3ME8 A;  2VCZ A;  5ECI B;  3HCZ A;  4IQA A;  5J5N A;  4G10 A;  1QMV A;  1J0F A;  2IN3 A;  3TRQ A;  2X49 A;  2I81 A;  2HYX A;  1R7H A;  3TKR A;  4EE0 A;  2I3Y A;  2GSR A;  1MD4 A;  22GS A;  4FYU A;  1GUL A;  5JWO B;  2A4H A;  1SKW B;  5CRH A;  3K8N A;  2F51 A;  3APO A;  4D73 A;  1SJI A;  3KTL A;  3TOT A;  3GTU A;  1HD2 A;  4L0W A;  1S3C A;  5L71 A;  3OR5 A;  1OE7 A;  2GGT A;  1EGR A;  3HVX A;  3GKX A;  5JCU A;  4IVF A;  2L5L A;  3QAW A;  2OA7 A;  4KCE A;  4TOP A;  2GSS A;  3Q19 A;  3IHG A;  3IBH A;  4WBR D;  2GQL A;  3IPZ A;  3LGC A;  1OKD A;  1CQG A;  3ZLP A;  4K7N A;  4CY6 A;  1PQN A;  3ZL5 A;  1UA5 A;  2LJR A;  2IMK A;  1G7O A;  1XFL A;  5DQY A;  3O6T A;  1SL0 B;  1AIU A;  5F05 A;  4MPF A;  2K6V A;  2DKH A;  2YV9 A;  3UJ1 A;  4ZBA A;  2D2Z A;  3ZVJ A;  4BL7 B;  2GSQ A;  1BJX A;  5INY A;  1M2A A;  4Z2T A;  2XPD A;  3FW2 A;  3CMI A;  3DKS A;  1XWK A;  1LU4 A;  4XTS A;  5GZZ B;  2A2P A;  4HI7 A;  1M2D A;  4EL1 A;  4YKG A;  2CX3 A;  1DE2 A;  4POM A;  4K2D A;  5IQY A;  4DSR A;  1EWX A;  5D9W A;  2V6K A;  4ILF A;  2VCW A;  5EPF A;  1R4W A;  1T1V A;  2DC5 A;  1XIY A;  2C3Q A;  4ZIJ A;  4MF6 A;  3NOF A;  4EDZ A;  1KNG A;  3GUR A;  2C0F A;  2F8F A;  2DML A;  5F0G A;  4EF0 A;  1O8X A;  3GMF A;  4H86 A;  3LXZ A;  3VUR A;  3TRP A;  2B5X A;  3QD9 A;  3S9F A;  4HJM A;  5D93 A;  2MMO A;  2VM1 A;  2L4C A;  1V57 A;  1OKT A;  4FYC A;  1VF1 A;  4G0I A;  1M2B A;  3F63 A;  2X99 A;  1M99 A;  3GUS A;  3WD6 A;  4N10 A;  2MBS A;  4K1F A;  3MWH A;  4J57 E;  1B9X C;  2JSZ A;  3NIV A;  3GX0 A;  4AJ6 A;  4GTU A;  5HFG A;  4AF2 A;  4K7O A;  3KJY A;  1HNC A;  2IL3 A;  3U5R E;  1MDI A;  1HQO A;  2GTU A;  2YAN A;  1OC3 A;  4O92 A;  3IE3 A;  4LLR A;  3MIX A;  3A2X A;  4WEY A;  4PQI A;  1KEB A;  1Y6E A;  2XHF A;  3HJP A;  1T4Y A;  1CQH A;  5IOX A;  2JAC A;  5ECP B;  2O87 A;  4IS0 A;  2AYT A;  1QGV A;  1SKS B;  1V9W A;  5ECS A;  2VL2 C;  4POL A;  2WFC A;  4MP4 A;  4HUA A;  4NV5 A;  2LQO A;  2B7J A;  2FLS A;  3TCO A;  2R3X A;  3I43 A;  5CRW A;  1SEN A;  1PRX A;  3LXT A;  3MNG A;  4BL7 A;  2ZUP A;  3FMW A;  1F3A A;  2TRX A;  2WJU A;  1AW9 A;  4BVY B;  4Z7X A;  2H6Y A;  3P8W A;  1EGO A;  1ACV A;  4RI7 A;  4WKW A;  3TJF A;  1JLV A;  4NAX A;  4JR6 A;  1ZYQ B;  2IIY A;  1QFN A;  1AC1 A;  4LMW A;  1ZOF A;  2ON7 A;  3FY7 A;  3EIN A;  4J2F A;  1M0U A;  1WOU A;  1UVZ A;  1RK4 A;  4OWY A;  3HKR A;  5B7C A;  1JFU A;  4OFT A;  5KN3 A;  1QK8 A;  1GH2 A;  5E59 A;  4HU7 A;  3LQ7 A;  1AQW A;  3KP8 A;  6GSS A;  5HR1 A;  1K3Y A;  3ERF A;  3TKQ A;  1THO A;  2H72 A;  16GS A;  3L9S A;  1G6W A;  2FWH A;  3IA1 A;  5ECQ B;  3R3E A;  3VWX A;  5KEJ A;  3EMP A;  1ZL9 A;  4POK A;  2JL4 A;  4JE1 A;  2TIR A;  1GLP A;  4V2N A;  1TRW A;  4LA1 A;  5IIZ A;  3WGD A;  2A2R A;  4MZB A;  5HQP A;  4ML1 A;  4KAE A;  4TW5 A;  1DUG A;  4L5O A;  2HRK A;  3QFA C;  2GT6 A;  4IKH A;  3APS A;  3L78 A;  4ZL7 A;  2L6D A;  3EMX A;  1A2J A;  3M0F A;  3PIN A;  4O5Q A;  3KP9 A;  2JZR A;  2HXK A;  3QDN A;  4MJA A;  1TKD B;  3F3R A;  3PPU A;  1GP1 A;  4CDO A;  3FKF A;  3C7M A;  3TGZ A;  4PTS A;  3CQF A;  4O5R A;  1AAZ A;  4FH8 A;  5AN1 A;  4MZW A;  1SK0 A;  2PMT A;  1PFO A;  1B4P A;  3CSH A;  3FEU A;  5ECR B;  2WZ9 A;  3UBK A;  4OCE A;  4TRX A;  2H8L A;  2CAQ A;  3IK9 A;  4GSS A;  2NDO A;  1GSE A;  4MZC A;  4KND A;  4NHZ A;  1XW5 A;  1PX7 A;  4XS6 A;  3HYP A;  1E6B A;  2CQ9 A;  4MH3 A;  2VLV A;  4GQC A;  2YPM A;  3GHA A;  5C04 A;  1K0B A;  3QMX A;  1XOB A;  4EUY A;  1EOG A;  2BTO T;  2ZCT A;  3BD2 A;  2IWT A;  3A2W A;  3KTB A;  7GSS A;  2KUC A;  4WET A;  2VUP A;  3LYK A;  2HSY A;  1SD8 A;  5CRD A;  5ID2 B;  3ZFL A;  1PKZ A;  4Z2U A;  3DYR A;  5DDL A;  1K0C A;  5HR3 A;  4ZIL A;  2BMX A;  4XCS A;  2OE0 A;  3IC8 A;  4N0Z A;  1NHO A;  1X5E A;  4WR4 A;  4N30 A;  2H01 A;  2CV4 A;  5IMD A;  3SWL A;  3GL3 A;  1GTU A;  1XW6 A;  2R0G A;  4LMV A;  1OVN A;  1EEM A;  4KSM A;  3IRA A;  2HSH A;  3DVX A;  4OCF A;  2AB6 A;  2HRF A;  5C00 A;  2GS3 A;  1I9D A;  3A5W A;  3QPM A;  1KBN A;  5CYY A;  2CA8 A;  1YKA A;  5FWG A;  3BCI A;  2CVB A;  4ICY A;  14GS A;  3LSZ A;  4GRF A;  4XRA A;  2O8V B;  3C1R A;  4K8M A;  3LJR A;  1TOF A;  4NHW A;  2C0E A;  3TJK A;  4XS4 B;  4EVM A;  4USS A;  1PL1 A;  3GSS A;  2B5Y A;  2MZC A;  4MK3 A;  5DQS A;  4K7I A;  4QL7 A;  4V2L A;  4F03 A;  1WMJ A;  3F9U A;  4KH7 A;  4LL4 B;  2H19 A;  2EIQ A;  5G30 A;  4F2I A;  5BMU A;  3BOA A;  1F6M C;  4MNN A;  5DVB A;  2L4Q A;  2OKA A;  1SKR B;  3ZTL A;  1RW1 A;  5IMZ A;  4YQU A;  5CRG A;  5J9C A;  4WXT A;  4EXJ A;  4N0V A;  5IPH A;  2YOI A;  1SYR A;  4IQ1 A;  1EZK A;  2QGV A;  3IHQ A;  3Q74 A;  3WGE A;  2HZE B;  2WGR A;  3D4M A;  5F07 A;  3F8U A;  2HE3 A;  1K3O A;  4E8H A;  1U3I A;  3F6F A;  1H75 A;  1SK1 A;  1BED A;  4WBJ A;  1N8J A;  20GS A;  2V41 A;  1I5G A;  1K0D A;  5JWQ B;  1O81 A;  2HI7 A;  5HFI A;  1XZO A;  4MCU A;  4ZB8 A;  4YQV A;  2H76 A;  1GRX A;  1FB6 A;  3ERW A;  4KX4 A;  2MMN A;  1WJK A;  1YDK A;  2FGX A;  1XVW A;  1VF2 A;  3FZ4 A;  1S3A A;  4FO5 A;  3HVV A;  1R5P A;  1V2A A;  2KOK A;  3KMO A;  1BG5 A;  1ZYN A;  2LRN A;  2H73 A;  2E2M A;  4YH2 A;  2PU9 C;  4XS4 A;  2XBQ A;  1Q98 A;  4PGT A;  2X8C A;  2LRT A;  3D0Z A;  4AJ7 A;  2QC7 A;  4RQX A;  2R5G A;  3ZRE A;  1O85 A;  1EOH A;  2H70 A;  3QFB C;  2XBI A;  2FNO A;  2H30 A;  2YWI A;  2Z9S A;  4TR1 B;  1HNA A;  4MLY A;  2VCV A;  1A0F A;  2C80 A;  3E0U A;  2GVP A;  2M72 A;  1XPV A;  2NTO A;  2H66 A;  1EEJ A;  4IP1 A;  4OFM A;  3QR6 A;  1FW1 A;  3WGX A;  1PSQ A;  2I9H A;  1FG4 A;  1GUH A;  5HFK A;  2H1B A;  2R0P A;  2VCT A;  2LST A;  4ZBB A;  3KGK A;  4CY8 A;  1J9B A;  1WRY A;  4G0K A;  5DJL A;  1RQM A;  5FHI A;  3GYK A;  3I69 A;  3IDV A;  3GV1 A;  3PH9 A;  5EY6 A;  4J56 E;  2KHP A;  1A0R P;  2X4A A;  4HS1 A;  1MDJ A;  4BWS A;  1GWC A;  1TRS A;  3BJ5 A;  5J9B A;  2TRC P;  4LL1 B;  4A5P A;  5J4U A;  3O76 A;  5ABR A;  2QSI A;  1X9W B;  4RI6 A;  3F6D A;  5IMC A;  1O8W A;  4HEA 2;  2F8A A;  1ML6 A;  17GS A;  3ISO A;  5ECL B;  1XWB A;  1SD9 A;  2PN8 A;  2L57 A;  5KN2 A;  3JCM L;  4GXZ A;  4ECC A;  3F4S A;  2CVD A;  2C0D A;  3HY2 A;  3BCK A;  1OC9 B;  2I1U A;  3FK8 A;  3TKS E;  4ISD A;  3LW9 A;  1PA3 A;  4OFN A;  5AIS A;  2HLS A;  4PUF C;  1YEP A;  19GS A;  5ECO B;  3C1S A;  4ZL9 A;  1PMT A;  2PPT A;  1M3I A;  2DIY A;  2N5B A;  1C72 A;  1BX9 A;  1B48 A;  2IJY A;  4ML6 A;  2E7P A;  2EIR A;  2A4V A;  1TK0 B;  3UAR A;  4MF5 A;  4I2U A;  2H0G A;  5LCZ A;  1YKC A;  3C71 A;  1K0O A;  2JAD A;  4GF0 A;  3WT1 A;  4TXO B;  1LBK A;  5IMV A;  1TDI A;  2IME A;  2FWG A;  3TJJ A;  2LNT A;  2XC2 A;  4YKF A;  1FO5 A;  1BQ7 A;  3CTG A;  5DBQ A;  1GNE A;  3HVN A;  4AJ8 A;  2AJQ B;  1K0A A;  5JCW A;  1TW9 A;  2YWN A;  1X5C A;  3HA9 A;  3GST A;  4KE3 A;  1XWG A;  3FZ9 A;  4CW9 A;  2H0H A;  5H5R A;  3P2A A;  1H4O A;  5DJM A;  3ERG A;  3KMN A;  1J08 A;  2ES7 A;  2NPB A;  3N9J A;  2E0Q A;  4IJI A;  4DSS B;  3QAG A;  4JED A;  2P5Q A;  5G5E A;  5D8I A;  4KW6 A;  1QQ2 A;  2DJ2 A;  4ULX A;  5CO3 A;  4X4J A;  1NSW A;  2DLX A;  1GLQ A;  4BIK A;  2GDR A;  4XIH A;  3R2Q A;  3G9B A;  4KGI A;  4XS1 A;  13GS A;  2JSY A;  4EKZ A;  2C1Y A;  2GT5 A;  3H1N A;  1ZGN A;  4FQU A;  3A2V A;  4XRD A;  1S3D A;  5CRE A;  1FOH A;  3RDW A;  3LEF A;  2LJK A;  4F0B A;  1AXD A;  4V2M A;  2QA2 A;  4OD7 A;  4ECJ A;  1IYI A;  2HFD A;  4K9Z A;  5G1K A;  5EL8 A;  3DD3 A;  2V32 A;  2X64 A;  2KLX A;  3D22 A;  5D9V A;  4TR0 A;  5IM9 A;  1WIK A;  4PQH A;  2YN1 A;  4Q5Q A;  6GSX A;  1X0R A;  1PKW A;  1FAA A;  1G6Y A;  3W6G A;  3O3T A;  2HNL A;  3KCM A;  5AGY A;  2H74 A;  5LNK e;  4DEJ A;  2H6Z A;  4IP6 A;  2VCQ A;  5B8B A;  3A5I A;  4PNG A;  5H5S A;  4X0X A;  2M46 A;  1V98 A;  3LFL A;  3F3Q A;  3VK9 A;  1ZZY A;  4TVE A;  5IO2 A;  5IMA A;  1Z6N A;  3KIJ A;  2G0F A;  3H8Q A;  1GTA A;  2FUG 2;  4EO3 A;  1WPI A;  2VL2 A;  1O6J A;  5AIV A;  4YAV A;  3FR9 A;  5HR0 A;  2HSM A;  4Q5N A;  4ZB9 A;  2I4A A;  4BVY A;  1V58 A;  2FA4 A;  4I8B A;  1DSB A;  1VGL A;  2NVL A;  1Z6M A;  1BAY A;  5KOX A;  2YWO A;  4PXO A;  4IN0 A;  6GST A;  2RII A;  1R26 A;  1XXU A;  3UBL A;  1GNW A;  5B6M A;  2IPA A;  3HZ4 A;  2VIM A;  2VD1 A;  3F0I A;  4L5L A;  5H5Q A;  3GH6 A;  2GZY A;  5JWR B;  5G31 A;  4QL9 A;  5ENU A;  1SU9 A;  4X1U A;  3GX8 A;  1X5D A;  2E2G A;  2EC4 A;  4IGJ A;  4WR5 A;  2R6K A;  2MYG A;  5A4V A;  4KDX A;  1QXH A;  1AQX A;  1TI3 A;  4GSN A;  1XOA A;  3EPT A;  3TKS C;  2LNS A;  3FHK A;  2VL3 A;  1B4Q A;  3CYN A;  2R0C A;  2RM6 A;  3D21 A;  3P7X A;  1U87 A;  2R4V A;  1XW9 A;  2DKI A;  2LKU A;  3GN3 A;  1YZX A;  2CAI A;  3DGQ A;  3L9U A;  4MDC A;  2LS5 A;  4ECI A;  2YJ7 A;  5J3R A;  4BVX B;  2K18 A;  2KP2 A;  3RHC A;  5CP1 A;  4MJB A;  3SBC A;  3APQ A;  4F82 A;  1AUC A;  3DXB A;  5KN0 A;  2FY6 A;  2G2Q A;  1FVK A;  4FIW A;  1ERU A;  3IR4 A;  4HQS A;  11GS A;  4MMM A;  3TJB A;  1ZYP A;  1LJR A;  1XG8 A;  4D73 B;  2PBJ A;  2RM5 A;  3QAV A;  1SYX A;  1JHB A;  5F06 A;  4K5S A;  4WF4 A;  4KDU A;  5HR2 A;  4TXV A;  2VM2 A;  2H75 A;  4OO4 A;  1T4Z A;  5ID2 A;  1Z5Y E;  4F0C A;  1ON4 A;  2J9H A;  2DJ0 A;  2H6X A;  1ZYE A;  5LD0 A;  3J7Y k;  3CXG A;  1TU7 A;  4HDE A;  1ZMA A;  2CVK A;  1Z3E A;  3KH9 A;  4G2E A;  2FA8 A;  3QOU A;  4ZXG A;  4E8E A;  1YF1 A;  5DCH A;  2JZT A;  5A4W A;  1VF4 A;  4MPG A;  5CAX A;  2VCX A;  4NMU A;  1E2Y A;  3J7Y b;  3LWA A;  1WP0 A;  5ELA A;  4G9H A;  2LQQ A;  4G0L A;  1FB0 A;  1GTI A;  4I6X A;  4WF5 A;  2F9S A;  4PUA A;  3UAP A;  3EE2 A;  3VPT A;  5D96 A;  3ME7 A;  1X9M B;  1TRU A;  1A24 A;  5ECK B;  4GST A;  1F3B A;  4JR4 A;  4KB3 A;  5D9X A;  3ZYW A;  4HJ2 A;  2OBI A;  1GUK A;  1MEK A;  4IHU A;  4NPB A;  3UL3 A;  2N5F A;  5D9T A;  1FOV A;  1TP9 A;  4CHS A;  1HYU A;  2DIZ A;  4MA9 A;  4K6X A;  4O7H A;  5DAK B;  4KSO A;  2HRN A;  3L4N A;  1SJ6 A;  1PL2 A;  8GSS A;  2B1K A;  4MJC A;  1OC8 A;  1G0T A;  2R37 A;  2VLT A;  3Q6O A;  1Z7P A;  3UVT A;  4Z2R A;  2DJJ A;  1A2M A;  1MDK A;  4ECB A;  2WS2 A;  1URM A;  3RPN A;  5KOW A;  3H4K A;  3G7J A;  3GL5 A;  3US3 A;  2GQM A;  1B9Y C;  3ZRD A;  3VWU A;  4HQZ A;  3EWL A;  3E9J B;  1OAZ A;  2H0I A;  5G1L A;  1NHY A;  1VF3 A;  1SJZ A;  5JCG A;  1PN9 A;  2P0G A;  4KA0 A;  1ST9 A;  2RUE A;  3KM6 A;  3G7I A;  2K8V A;  3LYP A;  2HZE A;  2K9F A;  2PGT A;  2MMZ A;  2O7K A;  2LEG A;  3KEB A;  3HVS A;  4PQ1 A;  2AHE A;  3CBU A;  2DMM A;  2XPE A;  1ABA A;  1M9A A;  5A5K A;  4MH2 A;  5B8A A;  4KF9 A;  1T00 A;  1GSY A;  1F37 A;  3ZIT A;  3W8J A;  3HD5 A;  1S3R A;  4MF7 A;  3RAZ A;  4PNF A;  4JRR A;  1A2L A;  2YZU A;  1TXX A;  2LRC A;  3UVH A;  5IOW A;  2LJA A;  4GCI A;  4JBB A;  2YNX A;  3M9J A;  3V1W A;  4EIP A;  2DJ1 A;  2H1A A;  1YJ6 A;  1JZW A;  1MTC A;  3ZIJ A;  2LV3 A;  3UEM A;  2WCI A;  1K0M A;  1TI1 A;  2GST A;  2B3S A;  5GAN D;  2ALB A;  3PR8 A;  5DAK A;  2YJH A;  4GLT A;  1B8X A;  5GSS A;  2O89 A;  2OE3 A;  3M1G A;  4HU9 A;  3DEX A;  4DVC A;  1FVJ A;  1R5A A;  3CSI A;  3LG6 A;  3P90 A;  3LOR A;  4AGS A;  2V6O A;  1PX6 A;  3GA4 A;  3D5J A;  3PGT A;  4YAP A;  4TR1 A;  3IV4 A;  5J41 A;  2B5E A;  4KDY A;  4OMV A;  3ZZX A;  1F2E A;  2C3T A;  4KCA A;  5DAL B;  1U6T A;  4ZL8 A;  3DML A;  3CRU A;  3L0H A;  2YWM A;  3VWV A;  4FYB A;  3MDK A;  2C8U A;  3UIW A;  3FZA A;  2WUL A;  1OE8 A;  1EV9 A;  12GS A;  4EDY A;  1ZCP A;  3M3M A;  1WWJ A;  3KD0 A;  1XWC A;  3GKN A;  1ERT A;  1BYE A;  1PD2 1;  2C3N A;  2VAF A;  5G2Z A;  3C73 A;  3TB2 A;  1QUW A;  4POB A;  4I2T A;  5IPG A;  3EUR A;  3VWW A;  5EVO A;  3EC3 A;  2AAW A;  4XHM A;  4X43 A;  4HSC X;  2VL9 A;  3UMA A;  1FHE A;  4NV2 A;  1OC9 A;  1USB A;  3EU4 A;  1TJD A;  1YF0 A;  2WDU A;  2WRT A;  1SL2 B;  2F3M A;  3KH7 A;  2RUF A;  2KP1 A;  2PUK C;  2L59 A;  3ZIV A;  3EYT A;  1EP7 A;  2B6M A;  2NBS A;  1XBS A;  1Z9H A;  3HJO A;  3I9V 2;  3VI5 A;  2DJK A;  1K3L A;  2VO4 A;  3KXO A;  4HZ4 A;  1N2A A;  1M9B A;  3MAK A;  1AQV A;  1TK5 B;  2ZNM A;  2X8G A;  3DWV A;  1WE0 A;  4TR4 A;  2REM A;  3HHV A;  3ZFB A;  2ON5 A;  4G19 A;  2R2J A;  4I97 A;  3FYG A;  4NWY A;  1PGT A;  2JU5 A;  4TXO A;  4F9Z A;  5DAL A;  2V1M A;  3QCP A;  1K0N A;  1VRS D;  1UN2 A;  1TU8 A;  5E4W A;  2FCH A;  3BBY A;  4K0G A;  3TUE A;  2IMI A;  3MSZ A;  2MMA A;  3RHB A;  4IEL A;  2VOC A;  4RQR A;  1G7E A;  4IBP A;  3UOM A;  4BWQ A;  5ECM B;  2N5A A;  1X9S B;  2BJX A;  2FWF A;  5F8B A;  1GSF A;  3MYD A;  2M80 A;  4TKY A;  3WT2 A;  2PWJ A;  1Y25 A;  4QQ7 A;  3G7Y A;  3RBT A;  3VLN A;  4DSS A;  1A8Y A;  2CT6 A;  3HJM A;  1EP8 A;  6GSV A;  2VD0 A;  3D4T A;  2H1D A;  1JZR A;  1YEX A;  2IFQ B;  9GSS A;  3DRN A;  4L0U A;  2FHE A;  1A23 A;  1GUM A;  4KUN A;  1GTB A;  5ECH B;  5FT3 A;  1W4V A;  4Q5R A;  2OAD A;  6GSW A;  2YP6 A;  4JU5 A;  1M7T A;  1W89 A;  4PUR A;  4PX1 A;  4K2X A;  1XCC A;  1OYJ A;  5IMF A;  3ED3 A;  2DJ3 A;  4K5R A;  4O32 A;  1O7U A;  1TTZ A;  2OAC A;  4IW9 A;  1JZD A;  4ID0 A;  5IO0 A;  1HNB A;  1XVQ A;  1GSU A;  2GZZ A;  1YQ1 A;  4EIQ A;  1SK2 A;  1DBY A;  2JZS A;  3VFI A;  1V40 A;  4N11 A;  3TKP A;  4ZBD A;  6GSY A;  10GS A;  1O73 A;  2QA1 A;  2OBK A;  4NXI A;  4RUV A;  5GST A;  5D73 A;  2YCD A;  3CTF A;  1YY7 A;  1GSQ A;  3GH9 A;  3DIE A;  3GRX A;  5B6N A;  3RPP A;  3HXS A;  3IK7 A;  4L8E A;  4K0N A;  1U88 A;  5A4U A;  1SL1 B;  2IMD A;  1THX A;  2IMF A;  3DVW A;  3A3T A;  3C8E A;  3Q18 A;  5COH A;  2HT9 A;  4HOJ A;  1T3B A;  1IYH A;  1U3A A;  3GKM A;  2HRA A;  3TDG A;  2PVQ A;  1EV4 A;  4YQM A;  4HZ2 A;  2HZF A;  3IAS 2;  2DBC A;  3VI7 A;  3GFK A;  2B1L A;  3VPQ A;  1GSS A;  4I5Q A;  2CX4 A;  1F9M A;  3FZ5 A;  2EIO A;  5ELG A;  3TOU A;  3M9K A;  1NM3 A;  2CZ3 A;  2AV4 A;  2A2S A;  3IOS A;  2LTK A;  1A8L A;  2IFQ A;  1ILO A;  2X8H A;  4EC0 A;  1T8E B;  3F4R A;  2K8S A;  3N5O A;  4MAB A;  4Q5F A;  4ACS A;  3TRX A;  2GLR A;  3FR3 A;  1DE1 A;  4O5U A;  1PN0 A;  2L6C A;  3EU3 A;  3ZVJ D;  5G5F A;  2QKE A;  3HDC A;  3H93 A;  3KZQ A;  2P31 A;  3W8S A;  1XWA A;  2LUS A;  3HZ8 A;  4ZB6 A;  3U6V A;  3I6A A;  1UC7 A;  2O85 A;  1KTE A;  1ERW A;  3GKK A;  3GTU B;  1TRV A;  2B7K A;  2J23 A;  2VLU A;  1T7P B;  2MBT A;  1ERV A;  3F4T A;  1JZO A;  2FWE A;  5CNW A;  4V1A p;  3FRC A;  2CZ2 A;  2OE1 A;  3CSJ A;  3IC4 A;  4MJE A;  1TK8 B;  2V2G A;  5DCG A;  3ZMK A;  2H71 A;  1M3J A;  4GWR A;  3EVI A;  2PVO C;  3E3E A;  4P3Y B;  3M8N A;  3ZML A;  1JLW A;  4V1A g;  2UZ8 A;  2P5R A;  3NZN A;  3GIX A;  2AUV A;  5GAP D;  5ECN B;  3H79 A; 
#chains in the Genus database with same CATH homology
 2GQK A;  5BRT A;  2C0G A;  4JZQ A;  4IJ3 A;  2C4J A;  2RLI A;  3D6I A;  2GZP A;  4BPY A;  3TJG A;  3TKS A;  3AY8 A;  1GL8 A;  4TR3 A;  5KN1 A;  2YV7 A;  3IAM 2;  4DSQ A;  3FR6 A;  2L5O A;  2DSA A;  2YZH A;  3WYW A;  3IXR A;  1Q4J A;  4TN8 A;  2FD3 A;  6GSU A;  1GSD A;  2H1G A;  2OJL A;  1Z7R A;  3L9V A;  3GNJ A;  2PER A;  4BVX A;  1MD3 A;  4OO5 A;  4GQF A;  2WB9 A;  5AIX A;  18GS A;  3CRT A;  4BA7 A;  1NW2 A;  3ME8 A;  2VCZ A;  5ECI B;  3HCZ A;  4IQA A;  5J5N A;  4G10 A;  1QMV A;  1J0F A;  2IN3 A;  3TRQ A;  2X49 A;  2I81 A;  2HYX A;  1R7H A;  3TKR A;  4EE0 A;  2I3Y A;  2GSR A;  1MD4 A;  22GS A;  4FYU A;  1GUL A;  5JWO B;  2A4H A;  1SKW B;  5CRH A;  3K8N A;  2F51 A;  3APO A;  4D73 A;  1SJI A;  3KTL A;  3TOT A;  3GTU A;  1HD2 A;  4L0W A;  1S3C A;  5L71 A;  3OR5 A;  1OE7 A;  2GGT A;  1EGR A;  3HVX A;  3GKX A;  5JCU A;  4IVF A;  2L5L A;  3QAW A;  2OA7 A;  4KCE A;  4TOP A;  2GSS A;  3Q19 A;  3IHG A;  3IBH A;  4WBR D;  2GQL A;  3IPZ A;  3LGC A;  1OKD A;  1CQG A;  3ZLP A;  4K7N A;  4CY6 A;  1PQN A;  3ZL5 A;  1UA5 A;  2LJR A;  2IMK A;  1G7O A;  1XFL A;  5DQY A;  3O6T A;  1SL0 B;  1AIU A;  5F05 A;  4MPF A;  2K6V A;  2DKH A;  2YV9 A;  3UJ1 A;  4ZBA A;  2D2Z A;  3ZVJ A;  4BL7 B;  2GSQ A;  1BJX A;  5INY A;  1M2A A;  4Z2T A;  2XPD A;  3FW2 A;  3CMI A;  3DKS A;  1XWK A;  1LU4 A;  4XTS A;  5GZZ B;  2A2P A;  4HI7 A;  1M2D A;  4EL1 A;  4YKG A;  2CX3 A;  1DE2 A;  4POM A;  4K2D A;  5IQY A;  4DSR A;  1EWX A;  5D9W A;  2V6K A;  4ILF A;  2VCW A;  5EPF A;  1R4W A;  1T1V A;  2DC5 A;  1XIY A;  2C3Q A;  4ZIJ A;  4MF6 A;  3NOF A;  4EDZ A;  1KNG A;  3GUR A;  2C0F A;  2F8F A;  2DML A;  5F0G A;  4EF0 A;  1O8X A;  3GMF A;  4H86 A;  3LXZ A;  3VUR A;  3TRP A;  2B5X A;  3QD9 A;  3S9F A;  4HJM A;  5D93 A;  2MMO A;  2VM1 A;  2L4C A;  1V57 A;  1OKT A;  4FYC A;  1VF1 A;  4G0I A;  1M2B A;  3F63 A;  2X99 A;  1M99 A;  3GUS A;  3WD6 A;  4N10 A;  2MBS A;  4K1F A;  3MWH A;  4J57 E;  1B9X C;  2JSZ A;  3NIV A;  3GX0 A;  4AJ6 A;  4GTU A;  5HFG A;  4AF2 A;  4K7O A;  3KJY A;  1HNC A;  2IL3 A;  3U5R E;  1MDI A;  1HQO A;  2GTU A;  2YAN A;  1OC3 A;  4O92 A;  3IE3 A;  4LLR A;  3MIX A;  3A2X A;  4WEY A;  4PQI A;  1KEB A;  1Y6E A;  2XHF A;  3HJP A;  1T4Y A;  1CQH A;  5IOX A;  2JAC A;  5ECP B;  2O87 A;  4IS0 A;  2AYT A;  1QGV A;  1SKS B;  1V9W A;  5ECS A;  2VL2 C;  4POL A;  2WFC A;  4MP4 A;  4HUA A;  4NV5 A;  2LQO A;  2B7J A;  2FLS A;  3TCO A;  2R3X A;  3I43 A;  5CRW A;  1SEN A;  1PRX A;  3LXT A;  3MNG A;  4BL7 A;  2ZUP A;  3FMW A;  1F3A A;  2TRX A;  2WJU A;  1AW9 A;  4BVY B;  4Z7X A;  2H6Y A;  3P8W A;  1EGO A;  1ACV A;  4RI7 A;  4WKW A;  3TJF A;  1JLV A;  4NAX A;  4JR6 A;  1ZYQ B;  2IIY A;  1QFN A;  1AC1 A;  4LMW A;  1ZOF A;  2ON7 A;  3FY7 A;  3EIN A;  4J2F A;  1M0U A;  1WOU A;  1UVZ A;  1RK4 A;  4OWY A;  3HKR A;  5B7C A;  1JFU A;  4OFT A;  5KN3 A;  1QK8 A;  1GH2 A;  5E59 A;  4HU7 A;  3LQ7 A;  1AQW A;  3KP8 A;  6GSS A;  5HR1 A;  1K3Y A;  3ERF A;  3TKQ A;  1THO A;  2H72 A;  16GS A;  3L9S A;  1G6W A;  2FWH A;  3IA1 A;  5ECQ B;  3R3E A;  3VWX A;  5KEJ A;  3EMP A;  1ZL9 A;  4POK A;  2JL4 A;  4JE1 A;  2TIR A;  1GLP A;  4V2N A;  1TRW A;  4LA1 A;  5IIZ A;  3WGD A;  2A2R A;  4MZB A;  5HQP A;  4ML1 A;  4KAE A;  4TW5 A;  1DUG A;  4L5O A;  2HRK A;  3QFA C;  2GT6 A;  4IKH A;  3APS A;  3L78 A;  4ZL7 A;  2L6D A;  3EMX A;  1A2J A;  3M0F A;  3PIN A;  4O5Q A;  3KP9 A;  2JZR A;  2HXK A;  3QDN A;  4MJA A;  1TKD B;  3F3R A;  3PPU A;  1GP1 A;  4CDO A;  3FKF A;  3C7M A;  3TGZ A;  4PTS A;  4O5R A;  1AAZ A;  4FH8 A;  5AN1 A;  4MZW A;  1SK0 A;  2PMT A;  1B4P A;  3CSH A;  3FEU A;  5ECR B;  2WZ9 A;  3UBK A;  4OCE A;  4TRX A;  2H8L A;  2CAQ A;  3IK9 A;  4GSS A;  2NDO A;  1GSE A;  4MZC A;  4KND A;  4NHZ A;  1XW5 A;  1PX7 A;  4XS6 A;  3HYP A;  1E6B A;  2CQ9 A;  4MH3 A;  2VLV A;  4GQC A;  2YPM A;  3GHA A;  5C04 A;  1K0B A;  3QMX A;  1XOB A;  4EUY A;  1EOG A;  2BTO T;  2ZCT A;  3BD2 A;  2IWT A;  3A2W A;  3KTB A;  7GSS A;  2KUC A;  4WET A;  2VUP A;  3LYK A;  2HSY A;  1SD8 A;  5CRD A;  5ID2 B;  3ZFL A;  1PKZ A;  4Z2U A;  3DYR A;  5DDL A;  1K0C A;  5HR3 A;  4ZIL A;  2BMX A;  4XCS A;  2OE0 A;  3IC8 A;  4N0Z A;  1NHO A;  1X5E A;  4WR4 A;  4N30 A;  2H01 A;  2CV4 A;  5IMD A;  3SWL A;  3GL3 A;  1GTU A;  1XW6 A;  2R0G A;  4LMV A;  1OVN A;  1EEM A;  4KSM A;  3IRA A;  2HSH A;  3DVX A;  4OCF A;  2AB6 A;  2HRF A;  5C00 A;  2GS3 A;  1I9D A;  3A5W A;  3QPM A;  1KBN A;  5CYY A;  2CA8 A;  1YKA A;  5FWG A;  3BCI A;  2CVB A;  4ICY A;  14GS A;  3LSZ A;  4GRF A;  4XRA A;  2O8V B;  3C1R A;  4K8M A;  3LJR A;  1TOF A;  4NHW A;  2C0E A;  3TJK A;  4XS4 B;  4EVM A;  4USS A;  1PL1 A;  3GSS A;  2B5Y A;  2MZC A;  4MK3 A;  5DQS A;  4K7I A;  4QL7 A;  4V2L A;  4F03 A;  1WMJ A;  3F9U A;  4KH7 A;  4LL4 B;  2H19 A;  2EIQ A;  5G30 A;  4F2I A;  5BMU A;  3BOA A;  1F6M C;  4MNN A;  5DVB A;  2L4Q A;  2OKA A;  1SKR B;  3ZTL A;  1RW1 A;  5IMZ A;  4YQU A;  5CRG A;  5J9C A;  4WXT A;  4EXJ A;  4N0V A;  5IPH A;  2YOI A;  1SYR A;  4IQ1 A;  1EZK A;  2QGV A;  3IHQ A;  3Q74 A;  3WGE A;  2HZE B;  2WGR A;  3D4M A;  5F07 A;  3F8U A;  2HE3 A;  1K3O A;  4E8H A;  1U3I A;  3F6F A;  1H75 A;  1SK1 A;  1BED A;  4WBJ A;  1N8J A;  20GS A;  2V41 A;  1I5G A;  1K0D A;  5JWQ B;  1O81 A;  2HI7 A;  5HFI A;  1XZO A;  4MCU A;  4ZB8 A;  4YQV A;  2H76 A;  1GRX A;  1FB6 A;  3ERW A;  4KX4 A;  2MMN A;  1WJK A;  1YDK A;  2FGX A;  1XVW A;  1VF2 A;  3FZ4 A;  1S3A A;  4FO5 A;  3HVV A;  1R5P A;  1V2A A;  2KOK A;  3KMO A;  1BG5 A;  1ZYN A;  2LRN A;  2H73 A;  2E2M A;  4YH2 A;  2PU9 C;  4XS4 A;  2XBQ A;  1Q98 A;  4PGT A;  2X8C A;  2LRT A;  3D0Z A;  4AJ7 A;  2QC7 A;  4RQX A;  2R5G A;  3ZRE A;  1O85 A;  1EOH A;  2H70 A;  3QFB C;  2XBI A;  2FNO A;  2H30 A;  2YWI A;  2Z9S A;  4TR1 B;  1HNA A;  4MLY A;  2VCV A;  1A0F A;  2C80 A;  3E0U A;  2GVP A;  2M72 A;  1XPV A;  2NTO A;  2H66 A;  1EEJ A;  4IP1 A;  4OFM A;  3QR6 A;  1FW1 A;  3WGX A;  1PSQ A;  2I9H A;  1FG4 A;  1GUH A;  5HFK A;  2H1B A;  2R0P A;  2VCT A;  2LST A;  4ZBB A;  3KGK A;  4CY8 A;  1J9B A;  1WRY A;  4G0K A;  5DJL A;  1RQM A;  5FHI A;  3GYK A;  3I69 A;  3IDV A;  3GV1 A;  3PH9 A;  5EY6 A;  4J56 E;  2KHP A;  1A0R P;  2X4A A;  4HS1 A;  1MDJ A;  4BWS A;  1GWC A;  1TRS A;  3BJ5 A;  5J9B A;  2TRC P;  4LL1 B;  4A5P A;  5J4U A;  3O76 A;  5ABR A;  2QSI A;  1X9W B;  4RI6 A;  3F6D A;  5IMC A;  1O8W A;  4HEA 2;  2F8A A;  1ML6 A;  17GS A;  3ISO A;  5ECL B;  1XWB A;  1SD9 A;  2PN8 A;  2L57 A;  5KN2 A;  3JCM L;  4GXZ A;  4ECC A;  3F4S A;  2CVD A;  2C0D A;  3HY2 A;  3BCK A;  1OC9 B;  2I1U A;  3FK8 A;  3TKS E;  4ISD A;  3LW9 A;  1PA3 A;  4OFN A;  5AIS A;  2HLS A;  4PUF C;  1YEP A;  19GS A;  5ECO B;  3C1S A;  4ZL9 A;  1PMT A;  2PPT A;  2DIY A;  2N5B A;  1C72 A;  1BX9 A;  1B48 A;  2IJY A;  4ML6 A;  2E7P A;  2EIR A;  2A4V A;  1TK0 B;  3UAR A;  4MF5 A;  4I2U A;  2H0G A;  5LCZ A;  1YKC A;  3C71 A;  1K0O A;  2JAD A;  4GF0 A;  3WT1 A;  4TXO B;  1LBK A;  5IMV A;  1TDI A;  2IME A;  2FWG A;  3TJJ A;  2LNT A;  2XC2 A;  4YKF A;  1FO5 A;  1BQ7 A;  3CTG A;  5DBQ A;  1GNE A;  4AJ8 A;  2AJQ B;  1K0A A;  5JCW A;  1TW9 A;  2YWN A;  1X5C A;  3HA9 A;  3GST A;  4KE3 A;  1XWG A;  3FZ9 A;  4CW9 A;  2H0H A;  5H5R A;  3P2A A;  1H4O A;  5DJM A;  3ERG A;  3KMN A;  1J08 A;  2ES7 A;  2NPB A;  3N9J A;  2E0Q A;  4IJI A;  4DSS B;  3QAG A;  4JED A;  2P5Q A;  5G5E A;  5D8I A;  4KW6 A;  1QQ2 A;  2DJ2 A;  4ULX A;  5CO3 A;  4X4J A;  1NSW A;  2DLX A;  1GLQ A;  2GDR A;  4XIH A;  3R2Q A;  3G9B A;  4KGI A;  4XS1 A;  13GS A;  2JSY A;  4EKZ A;  2C1Y A;  2GT5 A;  3H1N A;  1ZGN A;  4FQU A;  3A2V A;  4XRD A;  1S3D A;  5CRE A;  1FOH A;  3RDW A;  3LEF A;  2LJK A;  4F0B A;  1AXD A;  4V2M A;  2QA2 A;  4OD7 A;  4ECJ A;  1IYI A;  2HFD A;  4K9Z A;  5G1K A;  5EL8 A;  3DD3 A;  2V32 A;  2X64 A;  2KLX A;  3D22 A;  5D9V A;  4TR0 A;  5IM9 A;  1WIK A;  4PQH A;  2YN1 A;  4Q5Q A;  6GSX A;  1X0R A;  1PKW A;  1FAA A;  1G6Y A;  3W6G A;  3O3T A;  2HNL A;  3KCM A;  5AGY A;  2H74 A;  5LNK e;  4DEJ A;  2H6Z A;  4IP6 A;  2VCQ A;  5B8B A;  3A5I A;  4PNG A;  5H5S A;  4X0X A;  2M46 A;  1V98 A;  3LFL A;  3F3Q A;  3VK9 A;  1ZZY A;  4TVE A;  5IO2 A;  5IMA A;  1Z6N A;  3KIJ A;  2G0F A;  3H8Q A;  1GTA A;  2FUG 2;  4EO3 A;  1WPI A;  2VL2 A;  1O6J A;  5AIV A;  4YAV A;  3FR9 A;  5HR0 A;  2HSM A;  4Q5N A;  4ZB9 A;  2I4A A;  4BVY A;  1V58 A;  2FA4 A;  4I8B A;  1DSB A;  1VGL A;  2NVL A;  1Z6M A;  1BAY A;  5KOX A;  2YWO A;  4PXO A;  4IN0 A;  6GST A;  2RII A;  1R26 A;  1XXU A;  3UBL A;  1GNW A;  5B6M A;  2IPA A;  3HZ4 A;  2VIM A;  2VD1 A;  3F0I A;  4L5L A;  5H5Q A;  3GH6 A;  2GZY A;  5JWR B;  5G31 A;  4QL9 A;  5ENU A;  1SU9 A;  4X1U A;  3GX8 A;  1X5D A;  2E2G A;  2EC4 A;  4IGJ A;  4WR5 A;  2R6K A;  2MYG A;  5A4V A;  4KDX A;  1QXH A;  1AQX A;  1TI3 A;  4GSN A;  1XOA A;  3EPT A;  3TKS C;  2LNS A;  3FHK A;  2VL3 A;  1B4Q A;  3CYN A;  2R0C A;  2RM6 A;  3D21 A;  3P7X A;  1U87 A;  2R4V A;  1XW9 A;  2DKI A;  2LKU A;  3GN3 A;  1YZX A;  2CAI A;  3DGQ A;  3L9U A;  4MDC A;  2LS5 A;  4ECI A;  2YJ7 A;  5J3R A;  4BVX B;  2K18 A;  2KP2 A;  3RHC A;  5CP1 A;  4MJB A;  3SBC A;  3APQ A;  4F82 A;  1AUC A;  3DXB A;  5KN0 A;  2FY6 A;  2G2Q A;  1FVK A;  4FIW A;  1ERU A;  3IR4 A;  4HQS A;  11GS A;  4MMM A;  3TJB A;  1ZYP A;  1LJR A;  4D73 B;  2PBJ A;  2RM5 A;  3QAV A;  1SYX A;  1JHB A;  5F06 A;  4K5S A;  4WF4 A;  4KDU A;  5HR2 A;  4TXV A;  2VM2 A;  2H75 A;  4OO4 A;  1T4Z A;  5ID2 A;  1Z5Y E;  4F0C A;  1ON4 A;  2J9H A;  2DJ0 A;  2H6X A;  1ZYE A;  5LD0 A;  3J7Y k;  3CXG A;  1TU7 A;  4HDE A;  1ZMA A;  2CVK A;  1Z3E A;  3KH9 A;  4G2E A;  2FA8 A;  3QOU A;  4ZXG A;  4E8E A;  1YF1 A;  5DCH A;  2JZT A;  5A4W A;  1VF4 A;  4MPG A;  5CAX A;  2VCX A;  4NMU A;  1E2Y A;  3J7Y b;  3LWA A;  1WP0 A;  5ELA A;  4G9H A;  2LQQ A;  4G0L A;  1FB0 A;  1GTI A;  4I6X A;  4WF5 A;  2F9S A;  4PUA A;  3UAP A;  3EE2 A;  3VPT A;  5D96 A;  3ME7 A;  1X9M B;  1TRU A;  1A24 A;  5ECK B;  4GST A;  1F3B A;  4JR4 A;  4KB3 A;  5D9X A;  3ZYW A;  4HJ2 A;  2OBI A;  1GUK A;  1MEK A;  4IHU A;  4NPB A;  3UL3 A;  2N5F A;  5D9T A;  1FOV A;  1TP9 A;  4CHS A;  1HYU A;  2DIZ A;  4MA9 A;  4K6X A;  4O7H A;  5DAK B;  4KSO A;  2HRN A;  3L4N A;  1SJ6 A;  1PL2 A;  8GSS A;  2B1K A;  4MJC A;  1OC8 A;  1G0T A;  2R37 A;  2VLT A;  3Q6O A;  1Z7P A;  3UVT A;  4Z2R A;  2DJJ A;  1A2M A;  1MDK A;  4ECB A;  2WS2 A;  1URM A;  3RPN A;  5KOW A;  3H4K A;  3G7J A;  3GL5 A;  3US3 A;  2GQM A;  1B9Y C;  3ZRD A;  3VWU A;  4HQZ A;  3EWL A;  3E9J B;  1OAZ A;  2H0I A;  5G1L A;  1NHY A;  1VF3 A;  1SJZ A;  5JCG A;  1PN9 A;  2P0G A;  4KA0 A;  1ST9 A;  2RUE A;  3KM6 A;  3G7I A;  2K8V A;  3LYP A;  2HZE A;  2K9F A;  2PGT A;  2MMZ A;  2O7K A;  2LEG A;  3KEB A;  3HVS A;  4PQ1 A;  2AHE A;  3CBU A;  2DMM A;  2XPE A;  1ABA A;  1M9A A;  5A5K A;  4MH2 A;  5B8A A;  4KF9 A;  1T00 A;  1GSY A;  1F37 A;  3ZIT A;  3W8J A;  3HD5 A;  4MF7 A;  3RAZ A;  4PNF A;  4JRR A;  1A2L A;  2YZU A;  1TXX A;  2LRC A;  3UVH A;  5IOW A;  2LJA A;  4GCI A;  4JBB A;  2YNX A;  3M9J A;  3V1W A;  4EIP A;  2DJ1 A;  2H1A A;  1YJ6 A;  1JZW A;  1MTC A;  3ZIJ A;  2LV3 A;  3UEM A;  2WCI A;  1K0M A;  1TI1 A;  2GST A;  2B3S A;  5GAN D;  2ALB A;  3PR8 A;  5DAK A;  2YJH A;  4GLT A;  1B8X A;  5GSS A;  2O89 A;  2OE3 A;  3M1G A;  4HU9 A;  3DEX A;  4DVC A;  1FVJ A;  1R5A A;  3CSI A;  3LG6 A;  3P90 A;  3LOR A;  4AGS A;  2V6O A;  1PX6 A;  3GA4 A;  3D5J A;  3PGT A;  4YAP A;  4TR1 A;  3IV4 A;  5J41 A;  2B5E A;  4KDY A;  4OMV A;  3ZZX A;  1F2E A;  2C3T A;  4KCA A;  5DAL B;  1U6T A;  4ZL8 A;  3DML A;  3CRU A;  3L0H A;  2YWM A;  3VWV A;  4FYB A;  3MDK A;  2C8U A;  3UIW A;  3FZA A;  2WUL A;  1OE8 A;  1EV9 A;  12GS A;  4EDY A;  1ZCP A;  3M3M A;  1WWJ A;  3KD0 A;  1XWC A;  3GKN A;  1ERT A;  1BYE A;  1PD2 1;  2C3N A;  2VAF A;  5G2Z A;  3C73 A;  3TB2 A;  1QUW A;  4POB A;  4I2T A;  5IPG A;  3EUR A;  3VWW A;  5EVO A;  3EC3 A;  2AAW A;  4XHM A;  4X43 A;  2VL9 A;  3UMA A;  1FHE A;  4NV2 A;  1OC9 A;  1USB A;  3EU4 A;  1TJD A;  1YF0 A;  2WDU A;  2WRT A;  1SL2 B;  2F3M A;  3KH7 A;  2RUF A;  2KP1 A;  2PUK C;  2L59 A;  3ZIV A;  3EYT A;  1EP7 A;  2B6M A;  2NBS A;  1XBS A;  1Z9H A;  3HJO A;  3I9V 2;  3VI5 A;  2DJK A;  1K3L A;  2VO4 A;  3KXO A;  4HZ4 A;  1N2A A;  1M9B A;  3MAK A;  1AQV A;  1TK5 B;  2ZNM A;  2X8G A;  3DWV A;  1WE0 A;  4TR4 A;  2REM A;  3HHV A;  3ZFB A;  2ON5 A;  4G19 A;  2R2J A;  4I97 A;  3FYG A;  4NWY A;  1PGT A;  2JU5 A;  4TXO A;  4F9Z A;  5DAL A;  2V1M A;  3QCP A;  1K0N A;  1VRS D;  1UN2 A;  1TU8 A;  5E4W A;  2FCH A;  3BBY A;  4K0G A;  3TUE A;  2IMI A;  3MSZ A;  2MMA A;  3RHB A;  4IEL A;  2VOC A;  4RQR A;  1G7E A;  4IBP A;  3UOM A;  4BWQ A;  5ECM B;  2N5A A;  1X9S B;  2BJX A;  2FWF A;  5F8B A;  1GSF A;  3MYD A;  2M80 A;  4TKY A;  3WT2 A;  2PWJ A;  1Y25 A;  4QQ7 A;  3G7Y A;  3RBT A;  3VLN A;  4DSS A;  1A8Y A;  2CT6 A;  3HJM A;  1EP8 A;  6GSV A;  2VD0 A;  3D4T A;  2H1D A;  1JZR A;  1YEX A;  2IFQ B;  9GSS A;  3DRN A;  4L0U A;  2FHE A;  1A23 A;  1GUM A;  4KUN A;  1GTB A;  5ECH B;  5FT3 A;  1W4V A;  4Q5R A;  2OAD A;  6GSW A;  2YP6 A;  4JU5 A;  1M7T A;  1W89 A;  4PUR A;  4PX1 A;  4K2X A;  1XCC A;  1OYJ A;  5IMF A;  3ED3 A;  2DJ3 A;  4K5R A;  4O32 A;  1O7U A;  1TTZ A;  2OAC A;  4IW9 A;  1JZD A;  4ID0 A;  5IO0 A;  1HNB A;  1XVQ A;  1GSU A;  2GZZ A;  1YQ1 A;  4EIQ A;  1SK2 A;  1DBY A;  2JZS A;  3VFI A;  1V40 A;  4N11 A;  3TKP A;  4ZBD A;  6GSY A;  10GS A;  1O73 A;  2QA1 A;  2OBK A;  4NXI A;  4RUV A;  5GST A;  5D73 A;  2YCD A;  3CTF A;  1YY7 A;  1GSQ A;  3GH9 A;  3DIE A;  3GRX A;  5B6N A;  3RPP A;  3HXS A;  3IK7 A;  4L8E A;  4K0N A;  1U88 A;  5A4U A;  1SL1 B;  2IMD A;  1THX A;  2IMF A;  3DVW A;  3A3T A;  3C8E A;  3Q18 A;  5COH A;  2HT9 A;  4HOJ A;  1T3B A;  1IYH A;  1U3A A;  3GKM A;  2HRA A;  3TDG A;  2PVQ A;  1EV4 A;  4YQM A;  4HZ2 A;  2HZF A;  3IAS 2;  2DBC A;  3VI7 A;  3GFK A;  2B1L A;  3VPQ A;  1GSS A;  4I5Q A;  2CX4 A;  1F9M A;  3FZ5 A;  2EIO A;  5ELG A;  3TOU A;  3M9K A;  1NM3 A;  2CZ3 A;  2AV4 A;  2A2S A;  3IOS A;  2LTK A;  1A8L A;  2IFQ A;  1ILO A;  2X8H A;  4EC0 A;  1T8E B;  3F4R A;  2K8S A;  3N5O A;  4MAB A;  4Q5F A;  4ACS A;  3TRX A;  2GLR A;  3FR3 A;  1DE1 A;  4O5U A;  1PN0 A;  2L6C A;  3EU3 A;  3ZVJ D;  5G5F A;  2QKE A;  3HDC A;  3H93 A;  3KZQ A;  2P31 A;  3W8S A;  1XWA A;  2LUS A;  3HZ8 A;  4ZB6 A;  3U6V A;  3I6A A;  1UC7 A;  2O85 A;  1KTE A;  1ERW A;  3GKK A;  3GTU B;  1TRV A;  2B7K A;  2J23 A;  2VLU A;  1T7P B;  2MBT A;  1ERV A;  3F4T A;  1JZO A;  2FWE A;  5CNW A;  4V1A p;  3FRC A;  2CZ2 A;  2OE1 A;  3CSJ A;  3IC4 A;  4MJE A;  1TK8 B;  2V2G A;  5DCG A;  3ZMK A;  2H71 A;  4GWR A;  3EVI A;  2PVO C;  3E3E A;  4P3Y B;  3M8N A;  3ZML A;  1JLW A;  4V1A g;  2UZ8 A;  2P5R A;  3NZN A;  3GIX A;  2AUV A;  5GAP D;  5ECN B;  3H79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...