2LNTA

Solution structure of e60a mutant agr2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
140
structure length
140
Chain Sequence
IDPFTPQTLSRGWGDQLIWTQTYEAALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Anterior gradient protein 2 homolog
publication title Metastasis-promoting anterior gradient 2 protein has a dimeric thioredoxin fold structure and a role in cell adhesion.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2012-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13899 Thioredoxin_7 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2lntA00
3F6FA 2VCXA 3EYTA 3OR5A 3Q6OA 2FD3A 1N8JA 3W6GA 1TXXA 1QK8A 3TDGA 3N9JA 1XCCA 3FHKA 1X5DA 3EC3A 4HI7A 2L5LA 2L57A 5C00A 2IN3A 4IQAA 1I5GA 1M9BA 2B7JA 2XHFA 1YEXA 3LORA 3EMXA 2DIYA 1O8XA 2MBTA 1Z6MA 5IMZA 4GCIA 2F51A 2BTOT 3EMPA 3MAKA 3KH9A 5G1LA 4FYUA 4I5QA 1PSQA 3TOUA 1K0BA 3RPNA 1SKRB 2GTUA 4FYCA 3JCML 2N5AA 5HR1A 1V40A 3UEMA 11GSA 1DUGA 1PGTA 2OKAA 8GSSA 4TXOA 2C3NA 4EO3A 4PQIA 1UA5A 3C7MA 4NMUA 3F9UA 3HHVA 1HNAA 2LS5A 1M2AA 2NPBA 5B7CA 2FGXA 3HVVA 2E2MA 2YWMA 1WOUA 1AXDA 2VOCA 3PH9A 3I69A 2CZ3A 3U5RE 2VL9A 1TK8B 1PL2A 1A8LA 4V1Ap 2N5BA 4KX4A 3HJOA 4F0BA 1TW9A 1PX7A 4EC0A 1SKSB 2XC2A 5C04A 3L0HA 2PPTA 1GLPA 1U6TA 1WJKA 3M9KA 1NW2A 4X0XA 4WBRD 1PKZA 1SJZA 1UC7A 1JLVA 1THOA 5D73A 2P5RA 5COHA 2B5YA 1USBA 2ES7A 2L4QA 3ERFA 4MK3A 2RLIA 1R5AA 5D96A 2M46A 2C3QA 2WS2A 1GTAA 4QL7A 5JCGA 1AW9A 3KXOA 1WIKA 2HLSA 2YWOA 4RI6A 3DEXA 3GV1A 1G0TA 3HXSA 3G7JA 2OA7A 2RM6A 4XIHA 4MABA 3O6TA 3J7Yk 1TI1A 4MH3A 1EV4A 4JR6A 4OCFA 6GSVA 5G31A 1WE0A 3EVIA 5HR3A 3I43A 1QMVA 2LSTA 3QOUA 2VM2A 1F37A 3HVXA 4TVEA 4POBA 3D4TA 3WD6A 2FWHA 5ECNB 1KTEA 2REMA 2FA8A 1WMJA 4EKZA 5JWOB 1A8YA 3IDVA 5B8BA 2DIZA 3LFLA 2EC4A 1SD8A 5ENUA 1X9WB 1AUCA 2HE3A 1JZDA 4IP6A 2K18A 5F0GA 1MDIA 4MJEA 4WBJA 2ON7A 4IKHA 3CSIA 4EXJA 3RHBA 5KN1A 3J7Yb 1GSUA 3GSTA 3WGXA 3M9JA 4GTUA 3APQA 4ILFA 4P3YB 2YWIA 1U3AA 4XCSA 3PGTA 4Q5FA 4Z7XA 4ZB9A 2YWNA 2NDOA 4MLYA 3TKSA 2R4VA 1KEBA 3BCKA 3KTLA 3SWLA 3GTUB 5E4WA 3HKRA 1AQXA 1S3DA 1TI3A 3P8WA 4IJIA 4ZXGA 3IPZA 3TRQA 3GL5A 4MH2A 5CRDA 2V41A 2XPDA 1EGRA 5IMFA 2QSIA 6GSXA 4POLA 1GNEA 2I1UA 3UAPA 6GSUA 1ERVA 1MD4A 1FB6A 1V2AA 4KSMA 1Z6NA 2CX4A 4MJCA 5ECHB 3TOTA 4F03A 4ZB8A 4LMWA 2E0QA 4K7NA 1B4PA 14GSA 3P90A 1FG4A 3R2QA 1QUWA 1A0RP 2CZ2A 4LLRA 2ALBA 3D6IA 2R3XA 2BJXA 3GN3A 2CVBA 1GUHA 3KZQA 2JZSA 4ID0A 2I9HA 1SU9A 2HSHA 4PXOA 2DJJA 1SK0A 2H1GA 1XIYA 4OFTA 3HJPA 3K8NA 4IHUA 2FA4A 3KMOA 5D9VA 1A23A 1J9BA 4DSQA 5JCWA 1IYIA 1NSWA 3LGCA 2WGRA 4EL1A 1YKCA 2J23A 4J56E 2GLRA 4L0UA 1Z7PA 3ZZXA 1O85A 5CRWA 3GIXA 2WFCA 19GSA 2GZYA 3GURA 3TJBA 5D9XA 1SL1B 1M99A 2H70A 1VRSD 5G5FA 1K0CA 1M0UA 3TJKA 4L5OA 3W8SA 1XOAA 2RUFA 1HYUA 4GF0A 4L8EA 2A4VA 4WR4A 1XWCA 3HY2A 4O5RA 5ECPB 2OJLA 2L6CA 5A4UA 5CAXA 5ID2A 1OC9A 1A2LA 1GUMA 3ZMKA 1FB0A 3LWAA 2IWTA 5KEJA 5ECMB 1OVNA 1K3YA 4TXOB 5FWGA 4O32A 1ABAA 3DD3A 2H6ZA 4NWYA 1F9MA 4NAXA 2QC7A 3HJMA 3PR8A 5B6MA 3D21A 3ISOA 3UVHA 4WETA 2O89A 2LUSA 4DSSA 4MDCA 1XFLA 4BVXA 1ML6A 2A2SA 4KCEA 2B7KA 3G7IA 2B3SA 4KNDA 2GDRA 3DWVA 2DLXA 5CRGA 2VL2C 3RHCA 4K0NA 1ZL9A 4PNFA 2YOIA 3GX0A 1MDKA 5DCHA 1ON4A 5FT3A 4N0VA 3GUSA 4KE3A 1W89A 1WPIA 1PA3A 4IELA 1PMTA 3DXBA 2JU5A 5F05A 3UJ1A 5EPFA 1GSQA 1GL8A 4TRXA 4PNGA 2CX3A 5ELGA 2HFDA 1GP1A 3NZNA 4GRFA 3LQ7A 1TRWA 2FNOA 3QAWA 1H75A 3TRPA 1CQGA 2P31A 3DIEA 4IGJA 2O87A 3GNJA 4PUFC 4BA7A 4PUAA 3ZIJA 5L71A 4ECCA 5J9BA 3QPMA 4KW6A 2VAFA 5H5RA 4ZILA 2I3YA 1R5PA 4V2MA 4G10A 1X5CA 4KA0A 4BWSA 4HZ2A 1F3BA 4CW9A 5DCGA 1T8EB 1Z7RA 3GL3A 3W8JA 1XW5A 2LEGA 4IN0A 4HU9A 2H19A 2K8VA 5HQPA 2HSYA 3TKQA 2CAQA 5G2ZA 3L4NA 2IL3A 4KUNA 2H74A 4NHZA 1ERUA 2C8UA 7GSSA 1TTZA 3KIJA 4Q5NA 3CSJA 4RI7A 2YPMA 2B1KA 1J0FA 3QDNA 1QXHA 2EIRA 2L6DA 3ZITA 3P2AA 4MZBA 4MF5A 4FO5A 3BJ5A 3IAM2 5H5QA 2RM5A 1YJ6A 4OO4A 5G30A 1MD3A 1A24A 4TOPA 1YKAA 2OACA 1MDJA 5CO3A 3HZ4A 1DBYA 4XRAA 3TUEA 5GSTA 3TRXA 2MMOA 4G19A 1BAYA 2PWJA 4PX1A 2HI7A 2XBQA 3IBHA 1NHYA 3CMIA 2DMMA 1KBNA 18GSA 3Q74A 1WP0A 1JFUA 5J4UA 5IO0A 3L9SA 2LRNA 2DJKA 5F07A 2HRFA 1LU4A 3BD2A 3M0FA 3LXZA 2H66A 1B4QA 2I4AA 3VWWA 2HT9A 2VLVA 3CYNA 2LJAA 1U3IA 2X8HA 5DAKA 4ECBA 4QQ7A 1GSYA 4HQZA 1OYJA 4KDXA 1VF1A 3LEFA 5DBQA 4FIWA 4ECJA 4F82A 1GTIA 1AC1A 1YY7A 1TOFA 1YZXA 3EURA 3FZ4A 1TRVA 2MMAA 1LBKA 2B5XA 2C0FA 5ECSA 4LL1B 3GKKA 2YN1A 3EE2A 3F0IA 3WYWA 5F06A 1QGVA 2YCDA 4TR4A 3GH9A 2ON5A 2DMLA 3GH6A 1G6YA 2C0DA 2WZ9A 1O6JA 2DJ2A 5AN1A 1XOBA 1XWKA 3UIWA 3NOFA 5D93A 2KUCA 4JRRA 1A0FA 3MSZA 4LL4B 2WDUA 1T4ZA 4JU5A 2GT5A 2IMFA 2R5GA 3FZ9A 3F63A 4WR5A 1TRUA 4RUVA 16GSA 3FK8A 1ZYEA 2FY6A 1XXUA 2H6XA 3IHQA 2KHPA 2HXKA 5A5KA 1CQHA 5ID2B 2G2QA 1OC9B 5ECQB 2G0FA 3VFIA 2H0HA 3I6AA 2YNXA 2IIYA 3GMFA 4JBBA 1B9XC 3E9JB 5IM9A 3D4MA 5AGYA 1MTCA 5G1KA 1EOGA 3VWXA 4AF2A 1O7UA 2HRNA 4CDOA 2TRXA 5DJLA 3AY8A 3KGKA 1E6BA 1GTUA 1XWAA 2IMDA 2E7PA 1PN9A 3TJGA 2MMNA 3FRCA 1ZYQB 2H73A 13GSA 5CRHA 4DSSB 2R6KA 1K0NA 3DGQA 1Y6EA 3ZFBA 3TJJA 2V2GA 2AHEA 3P7XA 1NHOA 1A2MA 2CAIA 1XWGA 4N0ZA 5JCUA 3QCPA 3L9UA 1M7TA 4GLTA 4I2TA 1OC3A 3EWLA 3HCZA 3LYPA 1EOHA 2WB9A 2NTOA 1N2AA 4V1Ag 6GSSA 4PQHA 2VLUA 3GRXA 4K8MA 1EWXA 1HQOA 3ERWA 1TK5B 1FVJA 4EF0A 5GAND 2VCTA 1JLWA 4KSOA 4F2IA 4XS6A 2GSRA 4HU7A 5AIVA 2K6VA 2IFQA 1TJDA 1V57A 1URMA 2HYXA 4O7HA 4LA1A 5AIXA 3MDKA 5KN2A 2R2JA 2H1DA 2VL2A 4WKWA 5CREA 2F3MA 2FWFA 2VCWA 4MF6A 4YQMA 1TP9A 5IMCA 5CP1A 4ZBDA 1V9WA 3VI5A 5KN0A 5IO2A 5JWRB 3GKNA 2H76A 2FWGA 5G5EA 2PGTA 2QKEA 1G7EA 1SJ6A 5IPHA 2YP6A 1YEPA 1XW6A 3QMXA 4MCUA 4OO5A 4EDZA 3CBUA 1UN2A 1GTBA 4ML1A 3IR4A 4ULXA 1YQ1A 4WXTA 1K3OA 5IMVA 3WT1A 1G6WA 1Z3EA 2GGTA 1DE2A 1FAAA 2F8FA 3KP9A 4YQUA 2R37A 1WRYA 5DDLA 3UVTA 3TB2A 3ZL5A 4TXVA 5D9TA 3E3EA 2H1BA 4ML6A 1BEDA 2MBSA 3IOSA 3KEBA 4XTSA 4K6XA 5DVBA 1GSDA 3A2XA 4AJ6A 5JWQB 2HZFA 1XVWA 4K9ZA 2V1MA 4XHMA 2KP2A 5DQYA 5A4VA 3KMNA 4MPFA 2IMKA 2VM1A 3HYPA 3L9VA 5E59A 1EEMA 2MZCA 3ZRDA 4ZBAA 3ZTLA 3UOMA 3C1SA 3QR6A 2V32A 3IE3A 5HFGA 3TCOA 2X8GA 5GSSA 5HFIA 3ZREA 5ECOB 3KM6A 3TKSC 1X9MB 1OC8A 5DAKB 2PN8A 3FKFA 2GSSA 5GAPD 1ZCPA 4MJBA 3UMAA 1ERWA 5ECIB 3U6VA 4I8BA 4CHSA 2VLTA 2H71A 3WT2A 5EY6A 2YV9A 2NVLA 3CRTA 1R26A 3ED3A 4DVCA 4L0WA 4OMVA 4EE0A 2H30A 2D2ZA 2DSAA 2AUVA 3A2VA 3ZFLA 5IMAA 5ABRA 2C0EA 1BQ7A 4PGTA 3HVSA 4TR1A 2FWEA 4MA9A 3VPQA 3O3TA 5DJMA 2O7KA 3GYKA 3F6DA 5IOXA 4OFNA 2CV4A 4K7IA 1PQNA 3FYGA 2XBIA 3CTFA 2VO4A 1BYEA 4ZL8A 2H0GA 2K8SA 3QFAC 4WEYA 2PBJA 5EVOA 4RQRA 3Q19A 1T3BA 4XS4A 2LV3A 4YQVA 4HZ4A 4MPGA 3KJYA 5A4WA 2PVQA 5IPGA 1FHEA 3TGZA 1NM3A 4FH8A 2C0GA 4Q5QA 1G7OA 3C73A 4TW5A 3APSA 1Q4JA 1XPVA 4TR3A 4ZB6A 2IJYA 4NXIA 2MMZA 2M80A 1W4VA 4V2LA 1GULA 1SK2A 10GSA 2CT6A 3VWUA 4HJMA 3F4SA 1J08A 4GSTA 1JZRA 2JL4A 4JEDA 2VD0A 3RPPA 1THXA 3A5WA 5J5NA 1XBSA 1O73A 2CVKA 1PKWA 2RIIA 2H72A 3VURA 4DEJA 2O8VB 4QL9A 2JSZA 1HD2A 2RUEA 5KN3A 1I9DA 4K2DA 3FR3A 2C4JA 1GUKA 2H75A 3V1WA 2B6MA 2TIRA 1DE1A 3IAS2 5IOWA 4GSSA 1H4OA 2LJKA 2X8CA 3DVWA 3KH7A 2LRTA 3LYKA 2VL3A 4BL7A 2LKUA 4OCEA 2TRCP 1SL2B 4POKA 17GSA 5J41A 3IV4A 2K9FA 1FW1A 3BCIA 1ZMAA 3BOAA 1F3AA 4ISDA 4XRDA 3IC4A 3IXRA 4O92A 2IFQB 2GSQA 2CA8A 2MYGA 2HNLA 5INYA 1AAZA 1IYHA 4NV2A 4PQ1A 5CNWA 1TRSA 4E8EA 3VLNA 2KOKA 4HUAA 3N5OA 3FZAA 3C8EA 3ZMLA 3FR6A 1VF4A 4K7OA 2FLSA 2VUPA 1TDIA 1XVQA 1ZOFA 3H8QA 4D73A 4H86A 4OWYA 3GA4A 4AJ7A 5AISA 1MEKA 1F2EA 3S9FA 1O8WA 1WWJA 2WULA 1X0RA 3TJFA 4L5LA 1TU7A 3MWHA 4GXZA 2ZUPA 3RBTA 4OD7A 1HNCA 3WGEA 3F4RA 4F0CA 6GSTA 3F3RA 2PU9C 4NHWA 2YZUA 1Z9HA 2P0GA 3H1NA 1JHBA 4GWRA 4N11A 1SYRA 2YJ7A 3UARA 1SJIA 2C1YA 1ZZYA 4Q5RA 4NPBA 1T7PB 1Q98A 4HEA2 5HR2A 1K3LA 2LQOA 4AJ8A 3D22A 2HZEA 4FYBA 1ILOA 1AIUA 1S3AA 3ZYWA 2KLXA 4V2NA 1PL1A 2JZRA 3GFKA 4ZBBA 2IMEA 1SYXA 1S3CA 2B1LA 2OE3A 3GKMA 3LXTA 3GX8A 2LQQA 4DSRA 3RAZA 2PVOC 1EGOA 4E8HA 1M2DA 3TKRA 4WF5A 4GSNA 4HQSA 4N30A 1SKWB 3IRAA 1E2YA 4LMVA 2WJUA 2YZHA 2OBKA 3D0ZA 3DMLA 4JZQA 5J9CA 2DBCA 4TKYA 1RK4A 5HR0A 2YV7A 4ZL7A 3EINA 1GNWA 2GZPA 4ZL9A 4RQXA 4YAPA 4I6XA 2LNSA 1JZWA 2O85A 4KH7A 1VF2A 4KAEA 4PURA 3Q18A 1OE7A 2H6YA 3VI7A 3HDCA 2JADA 1OKDA 5DQSA 5D8IA 3IK7A 3LG6A 2GZZA 2PERA 3HZ8A 1TU8A 3CTGA 4X1UA 1YF0A 3IA1A 2WRTA 1V58A 2GQKA 3A2WA 4TR1B 3VWVA 1T4YA 2H01A 3QAGA 5D9WA 3H79A 1BJXA 3KD0A 3ZVJA 4ACSA 1FVKA 1RW1A 1SENA 4G9HA 1XZOA 2JACA 3UBKA 2X99A 1Y25A 2ZNMA 4BWQA 2GQMA 2YJHA 2OBIA 1F6MC 4JR4A 5ECLB 2P5QA 1EEJA 4XS4B 4MP4A 2L4CA 3MNGA 2FCHA 3DYRA 1ZGNA 3CSHA 4IW9A 4JE1A 4EVMA 3BBYA 1SL0B 1X9SB 2JZTA 2VD1A 2LJRA 4MMMA 1EP7A 4YH2A 1RQMA 1Z5YE 5IIZA 2BMXA 5ELAA 1U88A 2LRCA 1FOVA 2LTKA 3CXGA 4HOJA 4TR0A 1B9YC 1R7HA 3GHAA 1M9AA 5DALB 4I2UA 3A3TA 1GSFA 2AV4A 3VK9A 2E2GA 12GSA 2GSTA 1GWCA 3EU3A 2IMIA 1ACVA 2M72A 4IBPA 2PMTA 3ERGA 4HS1A 2EIOA 3DRNA 2GT6A 4MZWA 5EL8A 1DSBA 1K0MA 3FY7A 4J57E 1UVZA 1LJRA 4TN8A 5F8BA 2B5EA 2AJQB 4KDUA 1EV9A 1XW9A 3G9BA 3QFBC 1QFNA 3KCMA 4AGSA 4YAVA 1T00A 2QGVA 1XWBA 1AQVA 3QD9A 2FUG2 2VCVA 1PD21 1B48A 3FR9A 22GSA 3GSSA 4K0GA 3F3QA 2LNTA 3IK9A 2C80A 1VF3A 3EU4A 1GRXA 1C72A 2GQLA 3QAVA 3FW2A 3GKXA 3L78A 20GSA 3ME8A 3H4KA 4HJ2A 4GQCA 4F9ZA 4KDYA 2L5OA 4POMA 4MJAA 4ZIJA 5LD0A 1PX6A 2DC5A 5IQYA 2AYTA 4KB3A 1TK0B 2CQ9A 2JSYA 4X43A 1V98A 4IQ1A 3LSZA 3C71A 4GQFA 1K0DA 5FHIA 5CYYA 2V6OA 1O81A 1PRXA 2Z9SA 1M2BA 3HA9A 1BX9A 2IPAA 1B8XA 3FZ5A 1U87A 2PUKC 4D73B 1GSEA 4K1FA 3ME7A 3DKSA 3UL3A 4IJ3A 3LJRA 4HDEA 5H5SA 4XS1A 3D5JA 5ECKB 5HFKA 2DJ3A 5ECRB 1ERTA 2VIMA 1FO5A 1YDKA 4KGIA 4WF4A 1OKTA 2OADA 5B6NA 1EP8A 3WGDA 3ZVJD 2GVPA 3APOA 1TKDB 1X5EA 1OE8A 3O76A 3HD5A 5B8AA 4J2FA 2EIQA 4OFMA 6GSYA 3CRUA 1KNGA 2V6KA 2OE1A 2ZCTA 3TKPA 3NIVA 3SBCA 1OAZA 1VGLA 2AAWA 5LCZA 1YF1A 2HZEB 3GTUA 2DJ0A 5GZZB 3F4TA 2XPEA 4N10A 4EDYA 2VCZA 3TKSE 2A2RA 2H1AA 2KP1A 3KP8A 5LNKe 4I97A 1EZKA 2F8AA 1SD9A 2J9HA 3ZIVA 4G2EA 1HNBA 5IMDA 3VPTA 4KCAA 1R4WA 3M8NA 3RDWA 4NV5A 2N5FA 4MZCA 1SK1A 4IS0A 2L59A 5DALA 2GS3A 1QQ2A 3C1RA 1JZOA 2X64A 2H0IA 4ECIA 3DVXA 3I9V2 5J3RA 2AB6A 2H8LA 3H93A 3G7YA 2C3TA 3M1GA 1K0AA 3FEUA 3UBLA 4IVFA 2OE0A 1ST9A 3M3MA 1GH2A 2WCIA 1K0OA 2I81A 2NBSA 1A2JA 4IP1A 2VCQA 1GSSA 3KTBA 1BG5A 3E0UA 4EUYA 1AQWA 1GLQA 4MF7A 2CVDA 2FHEA 2YANA 4BPYA 2F9SA 2DJ1A 6GSWA 3F8UA 3ZLPA 3PINA 3US3A 1T1VA 9GSSA 4BVYA
chains in the Genus database with same CATH superfamily
3F6FA 2VCXA 3EYTA 3OR5A 3Q6OA 2FD3A 1N8JA 3W6GA 1TXXA 1QK8A 3TDGA 3N9JA 1XCCA 3FHKA 1X5DA 3EC3A 4HI7A 2L5LA 2L57A 5C00A 2IN3A 4IQAA 1I5GA 1M9BA 2B7JA 2XHFA 1YEXA 3LORA 3EMXA 2DIYA 1O8XA 2MBTA 1Z6MA 5IMZA 4GCIA 2F51A 2BTOT 3EMPA 3MAKA 3KH9A 5G1LA 4FYUA 4I5QA 1PSQA 3TOUA 1K0BA 3RPNA 1SKRB 2GTUA 4FYCA 3JCML 2N5AA 5HR1A 1V40A 3UEMA 11GSA 1DUGA 1PGTA 2OKAA 8GSSA 4K2XA 4TXOA 2C3NA 4EO3A 4PQIA 1UA5A 3C7MA 4CY8A 4NMUA 3F9UA 3HHVA 1HNAA 2LS5A 1M2AA 2NPBA 5B7CA 2FGXA 5BRTA 3HVVA 2E2MA 2YWMA 1WOUA 1AXDA 2VOCA 3PH9A 3I69A 2CZ3A 3U5RE 2VL9A 1TK8B 1PL2A 1A8LA 4V1Ap 2N5BA 4KX4A 3HJOA 4F0BA 1TW9A 1PX7A 4EC0A 1SKSB 2XC2A 5C04A 3L0HA 2PPTA 1GLPA 1U6TA 1WJKA 3M9KA 1NW2A 4X0XA 4G0IA 2HRKA 4WBRD 1PKZA 1SJZA 1UC7A 1JLVA 1THOA 5D73A 2P5RA 5COHA 2B5YA 1USBA 2ES7A 2L4QA 3ERFA 4MK3A 2RLIA 1R5AA 5D96A 2M46A 2C3QA 2WS2A 1GTAA 4QL7A 5JCGA 1AW9A 3KXOA 1WIKA 2HLSA 2YWOA 4RI6A 3DEXA 3GV1A 1G0TA 1XG8A 3G7JA 3HXSA 2OA7A 2RM6A 4XIHA 4MABA 3O6TA 3J7Yk 1TI1A 4MH3A 1EV4A 4JR6A 4OCFA 6GSVA 5G31A 2R0GA 1WE0A 3EVIA 5HR3A 3I43A 1QMVA 2LSTA 3QOUA 2VM2A 1F37A 3HVXA 4TVEA 4POBA 3D4TA 3WD6A 2FWHA 5ECNB 1KTEA 2REMA 4G0KA 2FA8A 1WMJA 1FOHA 4EKZA 5JWOB 1A8YA 3IDVA 5B8BA 2DIZA 3LFLA 2EC4A 1SD8A 5ENUA 1X9WB 1AUCA 2HE3A 1JZDA 4IP6A 2K18A 5F0GA 1MDIA 4MJEA 4WBJA 2ON7A 4IKHA 3PPUA 3CSIA 4EXJA 3RHBA 5KN1A 3J7Yb 1GSUA 3GSTA 3WGXA 3M9JA 4GTUA 3APQA 4ILFA 4P3YB 2YWIA 1U3AA 4XCSA 3PGTA 4Q5FA 4Z7XA 4ZB9A 2YWNA 2NDOA 4MLYA 3TKSA 2R4VA 1KEBA 3BCKA 3KTLA 3SWLA 3GTUB 5E4WA 3HKRA 1AQXA 1S3DA 1TI3A 3P8WA 4IJIA 4ZXGA 3IPZA 3TRQA 3GL5A 4MH2A 5CRDA 2V41A 2XPDA 1EGRA 5IMFA 2QSIA 6GSXA 4POLA 1GNEA 2I1UA 3UAPA 2UZ8A 6GSUA 2DKIA 1ERVA 1MD4A 1FB6A 1V2AA 4KSMA 1Z6NA 2CX4A 4MJCA 5ECHB 3TOTA 4F03A 4ZB8A 4LMWA 2E0QA 4K7NA 1B4PA 14GSA 3P90A 1FG4A 3R2QA 1QUWA 1A0RP 2CZ2A 4LLRA 3IC8A 2ALBA 3D6IA 2R3XA 2BJXA 3GN3A 2CVBA 1GUHA 3KZQA 2JZSA 4ID0A 2I9HA 1SU9A 2X4AA 2HSHA 4PXOA 2DJJA 1SK0A 2H1GA 1XIYA 4OFTA 3HJPA 3K8NA 4IHUA 2FA4A 3KMOA 5D9VA 1A23A 1J9BA 4DSQA 5JCWA 1IYIA 1NSWA 3LGCA 2WGRA 4EL1A 1YKCA 4BVYB 2J23A 4J56E 2GLRA 4L0UA 1Z7PA 3ZZXA 1O85A 5CRWA 3GIXA 2WFCA 19GSA 4K5RA 2GZYA 3GURA 3TJBA 5D9XA 1SL1B 1M99A 2H70A 1VRSD 5G5FA 1K0CA 1M0UA 3TJKA 4L5OA 3W8SA 1XOAA 2RUFA 1HYUA 4GF0A 4L8EA 2A4VA 4WR4A 1XWCA 3HY2A 4O5RA 5ECPB 2OJLA 2L6CA 5A4UA 5CAXA 5ID2A 1OC9A 1A2LA 4O5UA 1GUMA 3ZMKA 1FB0A 3LWAA 2IWTA 5KEJA 5ECMB 1OVNA 1K3YA 4TXOB 5FWGA 4O32A 1ABAA 3DD3A 2R0PA 2H6ZA 4NWYA 1F9MA 4NAXA 2QC7A 3HJMA 3PR8A 5B6MA 2HRAA 3D21A 3ISOA 3UVHA 4WETA 2O89A 2LUSA 4DSSA 4MDCA 1XFLA 4BVXA 1ML6A 4YKGA 2A2SA 4KCEA 2B7KA 3G7IA 2B3SA 4KNDA 2GDRA 3DWVA 2DLXA 5CRGA 2VL2C 3RHCA 4K0NA 1ZL9A 4PNFA 2YOIA 3GX0A 1MDKA 5DCHA 1ON4A 5FT3A 4N0VA 3GUSA 4KE3A 1W89A 1WPIA 1PA3A 4IELA 1PMTA 3DXBA 2JU5A 5F05A 3UJ1A 5EPFA 1GSQA 1GL8A 4TRXA 4PNGA 2CX3A 5ELGA 2HFDA 1GP1A 3NZNA 4GRFA 3LQ7A 1TRWA 2FNOA 3QAWA 1H75A 3TRPA 1CQGA 2P31A 3DIEA 4IGJA 2O87A 3GNJA 4PUFC 4BA7A 4PUAA 3ZIJA 5L71A 4ECCA 5J9BA 3QPMA 4KW6A 2VAFA 5H5RA 4ZILA 2I3YA 1R5PA 4V2MA 4G10A 1X5CA 4KA0A 4BWSA 4HZ2A 1F3BA 3EPTA 4CW9A 5DCGA 1T8EB 1Z7RA 3GL3A 3W8JA 4FQUA 1XW5A 2LEGA 4IN0A 4HU9A 2H19A 2K8VA 5HQPA 2HSYA 3TKQA 2CAQA 5G2ZA 3L4NA 2IL3A 4KUNA 2H74A 4NHZA 1ERUA 2C8UA 7GSSA 1TTZA 3KIJA 4Q5NA 3CSJA 3CQFA 4RI7A 2YPMA 2B1KA 1J0FA 3QDNA 1QXHA 2EIRA 2L6DA 3ZITA 3P2AA 4MZBA 4MF5A 4FO5A 3BJ5A 3IAM2 5H5QA 2RM5A 1YJ6A 4OO4A 5G30A 1MD3A 1A24A 4TOPA 1YKAA 2OACA 1MDJA 5CO3A 3HZ4A 1DBYA 4XRAA 3TUEA 5GSTA 3TRXA 2MMOA 4G19A 1BAYA 2PWJA 4PX1A 2HI7A 2XBQA 3IBHA 1NHYA 3CMIA 2DMMA 1KBNA 18GSA 3Q74A 1WP0A 1JFUA 5J4UA 5IO0A 3L9SA 2LRNA 2DJKA 5F07A 2HRFA 1LU4A 3BD2A 3M0FA 3LXZA 2H66A 1B4QA 2I4AA 3VWWA 2HT9A 2VLVA 3CYNA 2LJAA 1U3IA 2X49A 2X8HA 5DAKA 4ECBA 4QQ7A 1GSYA 4HQZA 1OYJA 4KDXA 1VF1A 3LEFA 4FIWA 5DBQA 4ECJA 4F82A 1GTIA 1AC1A 5KOWA 1YY7A 1TOFA 3FMWA 1YZXA 3EURA 3FZ4A 1TRVA 2MMAA 1LBKA 2B5XA 2C0FA 5ECSA 4LL1B 3GKKA 2YN1A 3EE2A 3F0IA 3WYWA 5F06A 1QGVA 2YCDA 4TR4A 3GH9A 1ZYNA 2ON5A 2QA2A 2DMLA 3GH6A 1G6YA 2C0DA 3IHGA 2WZ9A 1O6JA 2DJ2A 5AN1A 1XOBA 1XWKA 3UIWA 3NOFA 5D93A 2KUCA 4JRRA 1A0FA 3MSZA 4LL4B 2WDUA 1T4ZA 4JU5A 2GT5A 2IMFA 2R5GA 3FZ9A 3F63A 4WR5A 1TRUA 4RUVA 16GSA 3FK8A 1ZYEA 2FY6A 1XXUA 2H6XA 3IHQA 2KHPA 2HXKA 5A5KA 1CQHA 2QA1A 2G2QA 5ID2B 1OC9B 5ECQB 2G0FA 3VFIA 2H0HA 3I6AA 1S3RA 2YNXA 2IIYA 3GMFA 4USSA 4JBBA 1B9XC 3E9JB 5IM9A 3D4MA 5AGYA 1MTCA 5G1KA 1EOGA 3VWXA 4AF2A 1O7UA 2HRNA 4CDOA 2TRXA 5DJLA 3AY8A 3KGKA 1E6BA 1GTUA 1XWAA 2IMDA 2E7PA 1PN9A 3TJGA 2MMNA 3FRCA 1ZYQB 2H73A 13GSA 5CRHA 4DSSB 2R6KA 1K0NA 4BVXB 3DGQA 1Y6EA 3ZFBA 3TJJA 2V2GA 2AHEA 3P7XA 1NHOA 1A2MA 2CAIA 1XWGA 4N0ZA 5JCUA 3QCPA 3L9UA 1M7TA 4GLTA 4I2TA 1OC3A 3EWLA 3HCZA 3LYPA 1EOHA 2WB9A 2NTOA 1N2AA 4V1Ag 6GSSA 4PQHA 2VLUA 3GRXA 4K8MA 1EWXA 1HQOA 3ERWA 1TK5B 1FVJA 4EF0A 5GAND 2VCTA 1JLWA 4KSOA 4F2IA 4XS6A 2GSRA 4HU7A 5AIVA 2K6VA 2IFQA 1TJDA 4EIPA 1V57A 1URMA 2HYXA 4O7HA 4LA1A 5AIXA 3MDKA 4A5PA 5KN2A 2R2JA 2H1DA 2VL2A 4WKWA 5CREA 2F3MA 2FWFA 2VCWA 4MF6A 4YQMA 1TP9A 5IMCA 5CP1A 4ZBDA 1V9WA 3VI5A 5KN0A 5IO2A 5JWRB 3GKNA 2H76A 2FWGA 5G5EA 2PGTA 2QKEA 1G7EA 1SJ6A 5IPHA 2YP6A 1YEPA 1XW6A 3QMXA 4MCUA 4OO5A 4EDZA 3CBUA 1UN2A 1GTBA 4ML1A 3IR4A 4ULXA 1YQ1A 4WXTA 1K3OA 5IMVA 3WT1A 1G6WA 1Z3EA 2GGTA 1DE2A 1FAAA 2F8FA 3KP9A 4YQUA 2R37A 1WRYA 5DDLA 3UVTA 3TB2A 3ZL5A 4TXVA 5D9TA 3E3EA 2H1BA 4ML6A 4X4JA 1BEDA 2MBSA 3IOSA 3KEBA 4XTSA 4K6XA 5DVBA 1GSDA 3A2XA 4AJ6A 5JWQB 2HZFA 1XVWA 4K9ZA 2V1MA 4XHMA 2KP2A 5DQYA 5A4VA 3KMNA 4MPFA 2IMKA 2VM1A 3HYPA 3L9VA 5E59A 1EEMA 2MZCA 3ZRDA 4ZBAA 3ZTLA 3UOMA 3C1SA 3QR6A 2V32A 3IE3A 5HFGA 3TCOA 2X8GA 5GSSA 5HFIA 3ZREA 5ECOB 3KM6A 3TKSC 1X9MB 1OC8A 5DAKB 2PN8A 3FKFA 2GSSA 5GAPD 1M3IA 1ZCPA 4MJBA 3UMAA 1ERWA 5ECIB 3U6VA 4I8BA 4CHSA 2VLTA 2H71A 3WT2A 5EY6A 2YV9A 2NVLA 3CRTA 1R26A 3ED3A 4DVCA 3R3EA 4L0WA 4OMVA 2DKHA 4EE0A 2H30A 2D2ZA 2DSAA 2AUVA 3A2VA 3ZFLA 5IMAA 5ABRA 1PFOA 2C0EA 1BQ7A 4PGTA 3HVSA 4TR1A 2FWEA 4MA9A 3VPQA 3O3TA 5DJMA 2O7KA 3GYKA 3F6DA 5IOXA 4OFNA 2CV4A 4K7IA 1PQNA 3FYGA 2XBIA 3CTFA 2VO4A 1BYEA 5KOXA 4ZL8A 2H0GA 2K8SA 3QFAC 4WEYA 2PBJA 5EVOA 4RQRA 3Q19A 1T3BA 4XS4A 2LV3A 4YQVA 4HZ4A 4MPGA 3KJYA 5A4WA 2PVQA 5IPGA 1FHEA 3TGZA 1NM3A 4FH8A 2C0GA 4Q5QA 1G7OA 3C73A 4TW5A 3APSA 4Z2RA 1Q4JA 1XPVA 4TR3A 4ZB6A 2IJYA 4NXIA 2MMZA 2M80A 1W4VA 4V2LA 1GULA 1SK2A 10GSA 2CT6A 3VWUA 4HJMA 3F4SA 1J08A 4GSTA 1JZRA 2JL4A 4JEDA 2VD0A 3RPPA 1THXA 3A5WA 5J5NA 1XBSA 1O73A 2CVKA 1PKWA 2RIIA 2H72A 3VURA 4DEJA 2O8VB 4QL9A 2JSZA 1HD2A 2RUEA 5KN3A 1I9DA 4K2DA 3FR3A 2C4JA 3HVNA 1GUKA 2H75A 3V1WA 2B6MA 2TIRA 1DE1A 3IAS2 5IOWA 4GSSA 1H4OA 2LJKA 2X8CA 3DVWA 3KH7A 2LRTA 3LYKA 2VL3A 4BL7A 2LKUA 4BIKA 4OCEA 2TRCP 1SL2B 4POKA 17GSA 5J41A 3IV4A 2K9FA 1FW1A 3BCIA 1ZMAA 3BOAA 1F3AA 4ISDA 4XRDA 3IC4A 3IXRA 4O92A 2IFQB 2GSQA 2CA8A 2MYGA 2HNLA 5INYA 1AAZA 1IYHA 4NV2A 4PQ1A 5CNWA 1TRSA 4E8EA 3VLNA 2KOKA 4HUAA 3N5OA 3LW9A 3FZAA 3C8EA 3ZMLA 3FR6A 1VF4A 4K7OA 2FLSA 2VUPA 1TDIA 1XVQA 1ZOFA 3H8QA 4D73A 4H86A 4OWYA 3GA4A 4AJ7A 5AISA 1MEKA 1F2EA 3S9FA 1O8WA 1WWJA 2WULA 1X0RA 3TJFA 4L5LA 1TU7A 5BMUA 3MWHA 4GXZA 2ZUPA 3RBTA 4OD7A 1HNCA 3WGEA 3F4RA 4F0CA 6GSTA 3F3RA 2PU9C 4NHWA 2YZUA 1Z9HA 2P0GA 3H1NA 1JHBA 4GWRA 4N11A 1SYRA 2YJ7A 3UARA 1SJIA 2C1YA 1ZZYA 4Q5RA 4NPBA 1T7PB 1Q98A 4HEA2 5HR2A 1K3LA 2LQOA 4AJ8A 3D22A 2HZEA 1ZYPA 4FYBA 1ILOA 1AIUA 1S3AA 3ZYWA 2HSMA 4V2NA 2KLXA 1PL1A 2JZRA 3GFKA 4ZBBA 2IMEA 1SYXA 1S3CA 2B1LA 2OE3A 3GKMA 3LXTA 3GX8A 2LQQA 4DSRA 3RAZA 2PVOC 1EGOA 4E8HA 1M2DA 3TKRA 4WF5A 4GSNA 4HQSA 4N30A 1SKWB 3IRAA 1E2YA 4LMVA 2WJUA 2YZHA 2OBKA 3D0ZA 3DMLA 4JZQA 5J9CA 2DBCA 4TKYA 1RK4A 5HR0A 2YV7A 4ZL7A 3EINA 1GNWA 2GZPA 4ZL9A 4RQXA 4YAPA 4I6XA 2LNSA 1JZWA 2O85A 4KH7A 1VF2A 4KAEA 4PURA 3Q18A 1OE7A 2H6YA 3VI7A 3HDCA 2JADA 1OKDA 5DQSA 5D8IA 3IK7A 3LG6A 2GZZA 2PERA 3HZ8A 1TU8A 3CTGA 4X1UA 1YF0A 3IA1A 2WRTA 1V58A 2GQKA 3A2WA 4TR1B 3VWVA 1T4YA 2H01A 3QAGA 5D9WA 3H79A 1BJXA 3KD0A 3ZVJA 4ACSA 1FVKA 1RW1A 1SENA 4G9HA 1XZOA 2JACA 3UBKA 2X99A 1Y25A 2ZNMA 4BWQA 2GQMA 2YJHA 1M3JA 2OBIA 1F6MC 4K5SA 4JR4A 5ECLB 2P5QA 1EEJA 4XS4B 4MP4A 2L4CA 3MNGA 2FCHA 3DYRA 1ZGNA 3CSHA 4IW9A 4JE1A 4EVMA 3BBYA 1SL0B 1X9SB 2JZTA 2VD1A 2LJRA 4MMMA 1EP7A 4YH2A 1RQMA 1Z5YE 5IIZA 2BMXA 5ELAA 1U88A 2LRCA 1FOVA 4KF9A 2LTKA 3CXGA 4HOJA 4TR0A 1B9YC 1R7HA 3GHAA 1M9AA 5DALB 4I2UA 4O5QA 3A3TA 1GSFA 4YKFA 2AV4A 3VK9A 2E2GA 12GSA 2GSTA 1GWCA 3EU3A 2IMIA 1ACVA 2M72A 4IBPA 2PMTA 3ERGA 4HS1A 2EIOA 3DRNA 2GT6A 4MZWA 5EL8A 1DSBA 1K0MA 3FY7A 4J57E 1UVZA 4Z2TA 1LJRA 4TN8A 5F8BA 2B5EA 2AJQB 4KDUA 1EV9A 1XW9A 3G9BA 3QFBC 1QFNA 3KCMA 4AGSA 4YAVA 1T00A 2QGVA 1XWBA 1AQVA 3QD9A 2FUG2 2VCVA 1PD21 1B48A 3FR9A 4BL7B 22GSA 3GSSA 4K0GA 3F3QA 2LNTA 3IK9A 2C80A 1VF3A 4ICYA 3EU4A 3MIXA 1GRXA 1C72A 2GQLA 3QAVA 3FW2A 3GKXA 3L78A 20GSA 3ME8A 3H4KA 4HJ2A 4GQCA 4F9ZA 4KDYA 2L5OA 4POMA 4MJAA 4ZIJA 5LD0A 4Z2UA 4MNNA 1PX6A 2DC5A 5IQYA 2AYTA 4KB3A 1TK0B 2CQ9A 2JSYA 4X43A 1V98A 4IQ1A 3LSZA 3C71A 4GQFA 1K0DA 5FHIA 4PTSA 5CYYA 2V6OA 3MYDA 1O81A 1PRXA 2Z9SA 1M2BA 3HA9A 1BX9A 2IPAA 1B8XA 3FZ5A 1U87A 2PUKC 4D73B 2R0CA 1GSEA 4K1FA 4HSCX 3ME7A 3DKSA 3UL3A 4IJ3A 3LJRA 4HDEA 5H5SA 4XS1A 3D5JA 5ECKB 5HFKA 2DJ3A 5ECRB 1ERTA 2VIMA 1FO5A 1YDKA 4KGIA 4WF4A 1OKTA 2OADA 5B6NA 1EP8A 3WGDA 3ZVJD 2GVPA 3APOA 1TKDB 1X5EA 1OE8A 3O76A 3HD5A 5B8AA 4J2FA 2EIQA 4OFMA 6GSYA 3CRUA 1KNGA 2V6KA 2OE1A 2ZCTA 3TKPA 3NIVA 3SBCA 1OAZA 1VGLA 2AAWA 5LCZA 1YF1A 2HZEB 3GTUA 2DJ0A 5GZZB 3F4TA 2XPEA 4N10A 4EDYA 2VCZA 3TKSE 2A2RA 2H1AA 2KP1A 3KP8A 5LNKe 4I97A 1EZKA 2F8AA 1SD9A 2J9HA 3ZIVA 4G2EA 1HNBA 5IMDA 3VPTA 4KCAA 1R4WA 3M8NA 3RDWA 4NV5A 2N5FA 4MZCA 1SK1A 4IS0A 4EIQA 2L59A 5DALA 2GS3A 1QQ2A 3C1RA 1JZOA 2X64A 2H0IA 4ECIA 3DVXA 3I9V2 5J3RA 2AB6A 2H8LA 2A4HA 3H93A 3G7YA 2C3TA 3M1GA 1K0AA 3FEUA 3UBLA 2A2PA 4IVFA 2OE0A 1ST9A 3M3MA 1GH2A 2WCIA 1K0OA 4CY6A 2I81A 2NBSA 1A2JA 4IP1A 2VCQA 1GSSA 3KTBA 1BG5A 3E0UA 4EUYA 1AQWA 1GLQA 4MF7A 4G0LA 2CVDA 2FHEA 2YANA 4BPYA 1PN0A 2F9SA 2DJ1A 3A5IA 6GSWA 3F8UA 3ZLPA 3PINA 3US3A 1T1VA 9GSSA 4BVYA
chains in the Genus database with same CATH topology
3F6FA 2VCXA 3EYTA 3OR5A 3Q6OA 2FD3A 1N8JA 3W6GA 1TXXA 1QK8A 3TDGA 3N9JA 1XCCA 3FHKA 1X5DA 3EC3A 4HI7A 2L5LA 2L57A 5C00A 2IN3A 4IQAA 1I5GA 1M9BA 2B7JA 2XHFA 1YEXA 3LORA 3EMXA 2DIYA 1O8XA 2MBTA 1Z6MA 5IMZA 4GCIA 2F51A 2BTOT 3EMPA 3MAKA 3KH9A 5G1LA 4FYUA 4I5QA 1PSQA 3TOUA 1K0BA 3RPNA 1SKRB 2GTUA 4FYCA 3JCML 2N5AA 5HR1A 1V40A 3UEMA 11GSA 1DUGA 1PGTA 2OKAA 8GSSA 4K2XA 4TXOA 2C3NA 4EO3A 4PQIA 1UA5A 3C7MA 4CY8A 4NMUA 3F9UA 3HHVA 1HNAA 2LS5A 1M2AA 2NPBA 5B7CA 2FGXA 5BRTA 3HVVA 2E2MA 2YWMA 1WOUA 1AXDA 2VOCA 3PH9A 3I69A 2CZ3A 3U5RE 2VL9A 1TK8B 1PL2A 1A8LA 4V1Ap 2N5BA 4KX4A 3HJOA 4F0BA 1TW9A 1PX7A 4EC0A 1SKSB 2XC2A 5C04A 3L0HA 2PPTA 1GLPA 1U6TA 1WJKA 3M9KA 1NW2A 4X0XA 4G0IA 2HRKA 4WBRD 1PKZA 1SJZA 1UC7A 1JLVA 1THOA 5D73A 2P5RA 5COHA 2B5YA 1USBA 2ES7A 2L4QA 3ERFA 4MK3A 2RLIA 1R5AA 5D96A 2M46A 2C3QA 2WS2A 1GTAA 4QL7A 5JCGA 1AW9A 3KXOA 1WIKA 2HLSA 2YWOA 4RI6A 3DEXA 3GV1A 1G0TA 3HXSA 3G7JA 2OA7A 2RM6A 4XIHA 4MABA 3O6TA 3J7Yk 1TI1A 4MH3A 1EV4A 4JR6A 4OCFA 6GSVA 5G31A 2R0GA 1WE0A 3EVIA 5HR3A 3I43A 1QMVA 2LSTA 3QOUA 2VM2A 1F37A 3HVXA 4TVEA 4POBA 3D4TA 3WD6A 2FWHA 5ECNB 1KTEA 2REMA 4G0KA 2FA8A 1WMJA 1FOHA 4EKZA 5JWOB 1A8YA 3IDVA 5B8BA 2DIZA 3LFLA 2EC4A 1SD8A 5ENUA 1X9WB 1AUCA 2HE3A 1JZDA 4IP6A 2K18A 5F0GA 1MDIA 4MJEA 4WBJA 2ON7A 4IKHA 3PPUA 3CSIA 4EXJA 3RHBA 5KN1A 3J7Yb 1GSUA 3GSTA 3WGXA 3M9JA 4GTUA 3APQA 4ILFA 4P3YB 2YWIA 1U3AA 4XCSA 3PGTA 4Q5FA 4Z7XA 4ZB9A 2YWNA 2NDOA 4MLYA 3TKSA 2R4VA 1KEBA 3BCKA 3KTLA 3SWLA 3GTUB 5E4WA 3HKRA 1AQXA 1S3DA 1TI3A 3P8WA 4IJIA 4ZXGA 3IPZA 3TRQA 3GL5A 4MH2A 5CRDA 2V41A 2XPDA 1EGRA 5IMFA 2QSIA 6GSXA 4POLA 1GNEA 2I1UA 3UAPA 2UZ8A 6GSUA 2DKIA 1ERVA 1MD4A 1FB6A 1V2AA 4KSMA 1Z6NA 2CX4A 4MJCA 5ECHB 3TOTA 4F03A 4ZB8A 4LMWA 2E0QA 4K7NA 1B4PA 14GSA 3P90A 1FG4A 3R2QA 1QUWA 1A0RP 2CZ2A 4LLRA 3IC8A 2ALBA 3D6IA 2R3XA 2BJXA 3GN3A 2CVBA 1GUHA 3KZQA 2JZSA 4ID0A 2I9HA 1SU9A 2X4AA 2HSHA 4PXOA 2DJJA 1SK0A 2H1GA 1XIYA 4OFTA 3HJPA 3K8NA 4IHUA 2FA4A 3KMOA 5D9VA 1A23A 1J9BA 4DSQA 5JCWA 1IYIA 1NSWA 3LGCA 2WGRA 4EL1A 1YKCA 4BVYB 2J23A 4J56E 2GLRA 4L0UA 1Z7PA 3ZZXA 1O85A 5CRWA 3GIXA 2WFCA 19GSA 4K5RA 2GZYA 3GURA 3TJBA 5D9XA 1SL1B 1M99A 2H70A 1VRSD 5G5FA 1K0CA 1M0UA 3TJKA 4L5OA 3W8SA 1XOAA 2RUFA 1HYUA 4GF0A 4L8EA 2A4VA 4WR4A 1XWCA 3HY2A 4O5RA 5ECPB 2OJLA 2L6CA 5A4UA 5CAXA 5ID2A 1OC9A 1A2LA 4O5UA 1GUMA 3ZMKA 1FB0A 3LWAA 2IWTA 5KEJA 5ECMB 1OVNA 1K3YA 4TXOB 5FWGA 4O32A 1ABAA 3DD3A 2R0PA 2H6ZA 4NWYA 1F9MA 4NAXA 2QC7A 3HJMA 3PR8A 5B6MA 2HRAA 3D21A 3ISOA 3UVHA 4WETA 2O89A 2LUSA 4DSSA 4MDCA 1XFLA 4BVXA 1ML6A 4YKGA 2A2SA 4KCEA 2B7KA 3G7IA 2B3SA 4KNDA 2GDRA 3DWVA 2DLXA 5CRGA 2VL2C 3RHCA 4K0NA 1ZL9A 4PNFA 2YOIA 3GX0A 1MDKA 5DCHA 1ON4A 5FT3A 4N0VA 3GUSA 4KE3A 1W89A 1WPIA 1PA3A 4IELA 1PMTA 3DXBA 2JU5A 5F05A 3UJ1A 5EPFA 1GSQA 1GL8A 4TRXA 4PNGA 2CX3A 5ELGA 2HFDA 1GP1A 3NZNA 4GRFA 3LQ7A 1TRWA 2FNOA 3QAWA 1H75A 3TRPA 1CQGA 2P31A 3DIEA 4IGJA 2O87A 3GNJA 4PUFC 4BA7A 4PUAA 3ZIJA 5L71A 4ECCA 5J9BA 3QPMA 4KW6A 2VAFA 5H5RA 4ZILA 2I3YA 1R5PA 4V2MA 4G10A 1X5CA 4KA0A 4BWSA 4HZ2A 1F3BA 3EPTA 4CW9A 5DCGA 1T8EB 1Z7RA 3GL3A 3W8JA 4FQUA 1XW5A 2LEGA 4IN0A 4HU9A 2H19A 2K8VA 5HQPA 2HSYA 3TKQA 2CAQA 5G2ZA 3L4NA 2IL3A 4KUNA 2H74A 4NHZA 1ERUA 2C8UA 7GSSA 1TTZA 3KIJA 4Q5NA 3CSJA 4RI7A 2YPMA 2B1KA 1J0FA 3QDNA 1QXHA 2EIRA 2L6DA 3ZITA 3P2AA 4MZBA 4MF5A 4FO5A 3BJ5A 3IAM2 5H5QA 2RM5A 1YJ6A 4OO4A 5G30A 1MD3A 1A24A 4TOPA 1YKAA 2OACA 1MDJA 5CO3A 3HZ4A 1DBYA 4XRAA 3TUEA 5GSTA 3TRXA 2MMOA 4G19A 1BAYA 2PWJA 4PX1A 2HI7A 2XBQA 3IBHA 1NHYA 3CMIA 2DMMA 1KBNA 18GSA 3Q74A 1WP0A 1JFUA 5J4UA 5IO0A 3L9SA 2LRNA 2DJKA 5F07A 2HRFA 1LU4A 3BD2A 3M0FA 3LXZA 2H66A 1B4QA 2I4AA 3VWWA 2HT9A 2VLVA 3CYNA 2LJAA 1U3IA 2X49A 2X8HA 5DAKA 4ECBA 4QQ7A 1GSYA 4HQZA 1OYJA 4KDXA 1VF1A 3LEFA 4FIWA 5DBQA 4ECJA 4F82A 1GTIA 1AC1A 5KOWA 1YY7A 1TOFA 3FMWA 1YZXA 3EURA 3FZ4A 1TRVA 2MMAA 1LBKA 2B5XA 2C0FA 5ECSA 4LL1B 3GKKA 2YN1A 3EE2A 3F0IA 3WYWA 5F06A 1QGVA 2YCDA 4TR4A 3GH9A 1ZYNA 2ON5A 2QA2A 2DMLA 3GH6A 1G6YA 2C0DA 3IHGA 2WZ9A 1O6JA 2DJ2A 5AN1A 1XOBA 1XWKA 3UIWA 3NOFA 5D93A 2KUCA 4JRRA 1A0FA 3MSZA 4LL4B 2WDUA 1T4ZA 4JU5A 2GT5A 2IMFA 2R5GA 3FZ9A 3F63A 4WR5A 1TRUA 4RUVA 16GSA 3FK8A 1ZYEA 2FY6A 1XXUA 2H6XA 3IHQA 2KHPA 2HXKA 5A5KA 1CQHA 2QA1A 2G2QA 5ID2B 1OC9B 5ECQB 2G0FA 3VFIA 2H0HA 3I6AA 2YNXA 2IIYA 3GMFA 4USSA 4JBBA 1B9XC 3E9JB 5IM9A 3D4MA 5AGYA 1MTCA 5G1KA 1EOGA 3VWXA 4AF2A 1O7UA 2HRNA 4CDOA 2TRXA 5DJLA 3AY8A 3KGKA 1E6BA 1GTUA 1XWAA 2IMDA 2E7PA 1PN9A 3TJGA 2MMNA 3FRCA 1ZYQB 2H73A 13GSA 5CRHA 4DSSB 2R6KA 1K0NA 4BVXB 3DGQA 1Y6EA 3ZFBA 3TJJA 2V2GA 2AHEA 3P7XA 1NHOA 1A2MA 2CAIA 1XWGA 4N0ZA 5JCUA 3QCPA 3L9UA 1M7TA 4GLTA 4I2TA 1OC3A 3EWLA 3HCZA 3LYPA 1EOHA 2WB9A 2NTOA 1N2AA 4V1Ag 6GSSA 4PQHA 2VLUA 3GRXA 4K8MA 1EWXA 1HQOA 3ERWA 1TK5B 1FVJA 4EF0A 5GAND 2VCTA 1JLWA 4KSOA 4F2IA 4XS6A 2GSRA 4HU7A 5AIVA 2K6VA 2IFQA 1TJDA 4EIPA 1V57A 1URMA 2HYXA 4O7HA 4LA1A 5AIXA 3MDKA 4A5PA 5KN2A 2R2JA 2H1DA 2VL2A 4WKWA 5CREA 2F3MA 2FWFA 2VCWA 4MF6A 4YQMA 1TP9A 5IMCA 5CP1A 4ZBDA 1V9WA 3VI5A 5KN0A 5IO2A 5JWRB 3GKNA 2H76A 2FWGA 5G5EA 2PGTA 2QKEA 1G7EA 1SJ6A 5IPHA 2YP6A 1YEPA 1XW6A 3QMXA 4MCUA 4OO5A 4EDZA 3CBUA 1UN2A 1GTBA 4ML1A 3IR4A 4ULXA 1YQ1A 4WXTA 1K3OA 5IMVA 3WT1A 1G6WA 1Z3EA 2GGTA 1DE2A 1FAAA 2F8FA 3KP9A 4YQUA 2R37A 1WRYA 5DDLA 3UVTA 3TB2A 3ZL5A 4TXVA 5D9TA 3E3EA 2H1BA 4ML6A 4X4JA 1BEDA 2MBSA 3IOSA 3KEBA 4XTSA 4K6XA 5DVBA 1GSDA 3A2XA 4AJ6A 5JWQB 2HZFA 1XVWA 4K9ZA 2V1MA 4XHMA 2KP2A 5DQYA 5A4VA 3KMNA 4MPFA 2IMKA 2VM1A 3HYPA 3L9VA 5E59A 1EEMA 2MZCA 3ZRDA 4ZBAA 3ZTLA 3UOMA 3C1SA 3QR6A 2V32A 3IE3A 5HFGA 3TCOA 2X8GA 5GSSA 5HFIA 3ZREA 5ECOB 3KM6A 3TKSC 1X9MB 1OC8A 5DAKB 2PN8A 3FKFA 2GSSA 5GAPD 1ZCPA 4MJBA 3UMAA 1ERWA 5ECIB 3U6VA 4I8BA 4CHSA 2VLTA 2H71A 3WT2A 5EY6A 2YV9A 2NVLA 3CRTA 1R26A 3ED3A 4DVCA 3R3EA 4L0WA 4OMVA 2DKHA 4EE0A 2H30A 2D2ZA 2DSAA 2AUVA 3A2VA 3ZFLA 5IMAA 5ABRA 2C0EA 1BQ7A 4PGTA 3HVSA 4TR1A 2FWEA 4MA9A 3VPQA 3O3TA 5DJMA 2O7KA 3GYKA 3F6DA 5IOXA 4OFNA 2CV4A 4K7IA 1PQNA 3FYGA 2XBIA 3CTFA 2VO4A 1BYEA 5KOXA 4ZL8A 2H0GA 2K8SA 3QFAC 4WEYA 2PBJA 5EVOA 4RQRA 3Q19A 1T3BA 4XS4A 2LV3A 4YQVA 4HZ4A 4MPGA 3KJYA 5A4WA 2PVQA 5IPGA 1FHEA 3TGZA 1NM3A 4FH8A 2C0GA 4Q5QA 1G7OA 3C73A 4TW5A 3APSA 4Z2RA 1Q4JA 1XPVA 4TR3A 4ZB6A 2IJYA 4NXIA 2MMZA 2M80A 1W4VA 4V2LA 1GULA 1SK2A 10GSA 2CT6A 3VWUA 4HJMA 3F4SA 1J08A 4GSTA 1JZRA 2JL4A 4JEDA 2VD0A 3RPPA 1THXA 3A5WA 5J5NA 1XBSA 1O73A 2CVKA 1PKWA 2RIIA 2H72A 3VURA 4DEJA 2O8VB 4QL9A 2JSZA 1HD2A 2RUEA 5KN3A 1I9DA 4K2DA 3FR3A 2C4JA 1GUKA 2H75A 3V1WA 2B6MA 2TIRA 1DE1A 3IAS2 5IOWA 4GSSA 1H4OA 2LJKA 2X8CA 3DVWA 3KH7A 2LRTA 3LYKA 2VL3A 4BL7A 2LKUA 4OCEA 2TRCP 1SL2B 4POKA 17GSA 5J41A 3IV4A 2K9FA 1FW1A 3BCIA 1ZMAA 3BOAA 1F3AA 4ISDA 4XRDA 3IC4A 3IXRA 4O92A 2IFQB 2GSQA 2CA8A 2MYGA 2HNLA 5INYA 1AAZA 1IYHA 4NV2A 4PQ1A 5CNWA 1TRSA 4E8EA 3VLNA 2KOKA 4HUAA 3N5OA 3LW9A 3FZAA 3C8EA 3ZMLA 3FR6A 1VF4A 4K7OA 2FLSA 2VUPA 1TDIA 1XVQA 1ZOFA 3H8QA 4D73A 4H86A 4OWYA 3GA4A 4AJ7A 5AISA 1MEKA 1F2EA 3S9FA 1O8WA 1WWJA 2WULA 1X0RA 3TJFA 4L5LA 1TU7A 5BMUA 3MWHA 4GXZA 2ZUPA 3RBTA 4OD7A 1HNCA 3WGEA 3F4RA 4F0CA 6GSTA 3F3RA 2PU9C 4NHWA 2YZUA 1Z9HA 2P0GA 3H1NA 1JHBA 4GWRA 4N11A 1SYRA 2YJ7A 3UARA 1SJIA 2C1YA 1ZZYA 4Q5RA 4NPBA 1T7PB 1Q98A 4HEA2 5HR2A 1K3LA 2LQOA 4AJ8A 3D22A 2HZEA 1ZYPA 4FYBA 1ILOA 1AIUA 1S3AA 3ZYWA 2HSMA 4V2NA 2KLXA 1PL1A 2JZRA 3GFKA 4ZBBA 2IMEA 1SYXA 1S3CA 2B1LA 2OE3A 3GKMA 3LXTA 3GX8A 2LQQA 4DSRA 3RAZA 2PVOC 1EGOA 4E8HA 1M2DA 3TKRA 4WF5A 4GSNA 4HQSA 4N30A 1SKWB 3IRAA 1E2YA 4LMVA 2WJUA 2YZHA 2OBKA 3D0ZA 3DMLA 4JZQA 5J9CA 2DBCA 4TKYA 1RK4A 5HR0A 2YV7A 4ZL7A 3EINA 1GNWA 2GZPA 4ZL9A 4RQXA 4YAPA 4I6XA 2LNSA 1JZWA 2O85A 4KH7A 1VF2A 4KAEA 4PURA 3Q18A 1OE7A 2H6YA 3VI7A 3HDCA 2JADA 1OKDA 5DQSA 5D8IA 3IK7A 3LG6A 2GZZA 2PERA 3HZ8A 1TU8A 3CTGA 4X1UA 1YF0A 3IA1A 2WRTA 1V58A 2GQKA 3A2WA 4TR1B 3VWVA 1T4YA 2H01A 3QAGA 5D9WA 3H79A 1BJXA 3KD0A 3ZVJA 4ACSA 1FVKA 1RW1A 1SENA 4G9HA 1XZOA 2JACA 3UBKA 2X99A 1Y25A 2ZNMA 4BWQA 2GQMA 2YJHA 2OBIA 1F6MC 4K5SA 4JR4A 5ECLB 2P5QA 1EEJA 4XS4B 4MP4A 2L4CA 3MNGA 2FCHA 3DYRA 1ZGNA 3CSHA 4IW9A 4JE1A 4EVMA 3BBYA 1SL0B 1X9SB 2JZTA 2VD1A 2LJRA 4MMMA 1EP7A 4YH2A 1RQMA 1Z5YE 5IIZA 2BMXA 5ELAA 1U88A 2LRCA 1FOVA 4KF9A 2LTKA 3CXGA 4HOJA 4TR0A 1B9YC 1R7HA 3GHAA 1M9AA 5DALB 4I2UA 4O5QA 3A3TA 1GSFA 4YKFA 2AV4A 3VK9A 2E2GA 12GSA 2GSTA 1GWCA 3EU3A 2IMIA 1ACVA 2M72A 4IBPA 2PMTA 3ERGA 4HS1A 2EIOA 3DRNA 2GT6A 4MZWA 5EL8A 1DSBA 1K0MA 3FY7A 4J57E 1UVZA 4Z2TA 1LJRA 4TN8A 5F8BA 2B5EA 2AJQB 4KDUA 1EV9A 1XW9A 3G9BA 3QFBC 1QFNA 3KCMA 4AGSA 4YAVA 1T00A 2QGVA 1XWBA 1AQVA 3QD9A 2FUG2 2VCVA 1PD21 1B48A 3FR9A 4BL7B 22GSA 3GSSA 4K0GA 3F3QA 2LNTA 3IK9A 2C80A 1VF3A 4ICYA 3EU4A 3MIXA 1GRXA 1C72A 2GQLA 3QAVA 3FW2A 3GKXA 3L78A 20GSA 3ME8A 3H4KA 4HJ2A 4GQCA 4F9ZA 4KDYA 2L5OA 4POMA 4MJAA 4ZIJA 5LD0A 4Z2UA 4MNNA 1PX6A 2DC5A 5IQYA 2AYTA 4KB3A 1TK0B 2CQ9A 2JSYA 4X43A 1V98A 4IQ1A 3LSZA 3C71A 4GQFA 1K0DA 5FHIA 4PTSA 5CYYA 2V6OA 3MYDA 1O81A 1PRXA 2Z9SA 1M2BA 3HA9A 1BX9A 2IPAA 1B8XA 3FZ5A 1U87A 2PUKC 4D73B 2R0CA 1GSEA 4K1FA 3ME7A 3DKSA 3UL3A 4IJ3A 3LJRA 4HDEA 5H5SA 4XS1A 3D5JA 5ECKB 5HFKA 2DJ3A 5ECRB 1ERTA 2VIMA 1FO5A 1YDKA 4KGIA 4WF4A 1OKTA 2OADA 5B6NA 1EP8A 3WGDA 3ZVJD 2GVPA 3APOA 1TKDB 1X5EA 1OE8A 3O76A 3HD5A 5B8AA 4J2FA 2EIQA 4OFMA 6GSYA 3CRUA 1KNGA 2V6KA 2OE1A 2ZCTA 3TKPA 3NIVA 3SBCA 1OAZA 1VGLA 2AAWA 5LCZA 1YF1A 2HZEB 3GTUA 2DJ0A 5GZZB 3F4TA 2XPEA 4N10A 4EDYA 2VCZA 3TKSE 2A2RA 2H1AA 2KP1A 3KP8A 5LNKe 4I97A 1EZKA 2F8AA 1SD9A 2J9HA 3ZIVA 4G2EA 1HNBA 5IMDA 3VPTA 4KCAA 1R4WA 3M8NA 3RDWA 4NV5A 2N5FA 4MZCA 1SK1A 4IS0A 4EIQA 2L59A 5DALA 2GS3A 1QQ2A 3C1RA 1JZOA 2X64A 2H0IA 4ECIA 3DVXA 3I9V2 5J3RA 2AB6A 2H8LA 2A4HA 3H93A 3G7YA 2C3TA 3M1GA 1K0AA 3FEUA 3UBLA 2A2PA 4IVFA 2OE0A 1ST9A 3M3MA 1GH2A 2WCIA 1K0OA 4CY6A 2I81A 2NBSA 1A2JA 4IP1A 2VCQA 1GSSA 3KTBA 1BG5A 3E0UA 4EUYA 1AQWA 1GLQA 4MF7A 4G0LA 2CVDA 2FHEA 2YANA 4BPYA 1PN0A 2F9SA 2DJ1A 3A5IA 6GSWA 3F8UA 3ZLPA 3PINA 3US3A 1T1VA 9GSSA 4BVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F6F A;  2VCX A;  3EYT A;  3OR5 A;  3Q6O A;  2FD3 A;  1N8J A;  3W6G A;  1TXX A;  1QK8 A;  3TDG A;  3N9J A;  1XCC A;  3FHK A;  1X5D A;  3EC3 A;  4HI7 A;  2L5L A;  2L57 A;  5C00 A;  2IN3 A;  4IQA A;  1I5G A;  1M9B A;  2B7J A;  2XHF A;  1YEX A;  3LOR A;  3EMX A;  2DIY A;  1O8X A;  2MBT A;  1Z6M A;  5IMZ A;  4GCI A;  2F51 A;  2BTO T;  3EMP A;  3MAK A;  3KH9 A;  5G1L A;  4FYU A;  4I5Q A;  1PSQ A;  3TOU A;  1K0B A;  3RPN A;  1SKR B;  2GTU A;  4FYC A;  3JCM L;  2N5A A;  5HR1 A;  1V40 A;  3UEM A;  11GS A;  1DUG A;  1PGT A;  2OKA A;  8GSS A;  4TXO A;  2C3N A;  4EO3 A;  4PQI A;  1UA5 A;  3C7M A;  4NMU A;  3F9U A;  3HHV A;  1HNA A;  2LS5 A;  1M2A A;  2NPB A;  5B7C A;  2FGX A;  3HVV A;  2E2M A;  2YWM A;  1WOU A;  1AXD A;  2VOC A;  3PH9 A;  3I69 A;  2CZ3 A;  3U5R E;  2VL9 A;  1TK8 B;  1PL2 A;  1A8L A;  4V1A p;  2N5B A;  4KX4 A;  3HJO A;  4F0B A;  1TW9 A;  1PX7 A;  4EC0 A;  1SKS B;  2XC2 A;  5C04 A;  3L0H A;  2PPT A;  1GLP A;  1U6T A;  1WJK A;  3M9K A;  1NW2 A;  4X0X A;  4WBR D;  1PKZ A;  1SJZ A;  1UC7 A;  1JLV A;  1THO A;  5D73 A;  2P5R A;  5COH A;  2B5Y A;  1USB A;  2ES7 A;  2L4Q A;  3ERF A;  4MK3 A;  2RLI A;  1R5A A;  5D96 A;  2M46 A;  2C3Q A;  2WS2 A;  1GTA A;  4QL7 A;  5JCG A;  1AW9 A;  3KXO A;  1WIK A;  2HLS A;  2YWO A;  4RI6 A;  3DEX A;  3GV1 A;  1G0T A;  3HXS A;  3G7J A;  2OA7 A;  2RM6 A;  4XIH A;  4MAB A;  3O6T A;  3J7Y k;  1TI1 A;  4MH3 A;  1EV4 A;  4JR6 A;  4OCF A;  6GSV A;  5G31 A;  1WE0 A;  3EVI A;  5HR3 A;  3I43 A;  1QMV A;  2LST A;  3QOU A;  2VM2 A;  1F37 A;  3HVX A;  4TVE A;  4POB A;  3D4T A;  3WD6 A;  2FWH A;  5ECN B;  1KTE A;  2REM A;  2FA8 A;  1WMJ A;  4EKZ A;  5JWO B;  1A8Y A;  3IDV A;  5B8B A;  2DIZ A;  3LFL A;  2EC4 A;  1SD8 A;  5ENU A;  1X9W B;  1AUC A;  2HE3 A;  1JZD A;  4IP6 A;  2K18 A;  5F0G A;  1MDI A;  4MJE A;  4WBJ A;  2ON7 A;  4IKH A;  3CSI A;  4EXJ A;  3RHB A;  5KN1 A;  3J7Y b;  1GSU A;  3GST A;  3WGX A;  3M9J A;  4GTU A;  3APQ A;  4ILF A;  4P3Y B;  2YWI A;  1U3A A;  4XCS A;  3PGT A;  4Q5F A;  4Z7X A;  4ZB9 A;  2YWN A;  2NDO A;  4MLY A;  3TKS A;  2R4V A;  1KEB A;  3BCK A;  3KTL A;  3SWL A;  3GTU B;  5E4W A;  3HKR A;  1AQX A;  1S3D A;  1TI3 A;  3P8W A;  4IJI A;  4ZXG A;  3IPZ A;  3TRQ A;  3GL5 A;  4MH2 A;  5CRD A;  2V41 A;  2XPD A;  1EGR A;  5IMF A;  2QSI A;  6GSX A;  4POL A;  1GNE A;  2I1U A;  3UAP A;  6GSU A;  1ERV A;  1MD4 A;  1FB6 A;  1V2A A;  4KSM A;  1Z6N A;  2CX4 A;  4MJC A;  5ECH B;  3TOT A;  4F03 A;  4ZB8 A;  4LMW A;  2E0Q A;  4K7N A;  1B4P A;  14GS A;  3P90 A;  1FG4 A;  3R2Q A;  1QUW A;  1A0R P;  2CZ2 A;  4LLR A;  2ALB A;  3D6I A;  2R3X A;  2BJX A;  3GN3 A;  2CVB A;  1GUH A;  3KZQ A;  2JZS A;  4ID0 A;  2I9H A;  1SU9 A;  2HSH A;  4PXO A;  2DJJ A;  1SK0 A;  2H1G A;  1XIY A;  4OFT A;  3HJP A;  3K8N A;  4IHU A;  2FA4 A;  3KMO A;  5D9V A;  1A23 A;  1J9B A;  4DSQ A;  5JCW A;  1IYI A;  1NSW A;  3LGC A;  2WGR A;  4EL1 A;  1YKC A;  2J23 A;  4J56 E;  2GLR A;  4L0U A;  1Z7P A;  3ZZX A;  1O85 A;  5CRW A;  3GIX A;  2WFC A;  19GS A;  2GZY A;  3GUR A;  3TJB A;  5D9X A;  1SL1 B;  1M99 A;  2H70 A;  1VRS D;  5G5F A;  1K0C A;  1M0U A;  3TJK A;  4L5O A;  3W8S A;  1XOA A;  2RUF A;  1HYU A;  4GF0 A;  4L8E A;  2A4V A;  4WR4 A;  1XWC A;  3HY2 A;  4O5R A;  5ECP B;  2OJL A;  2L6C A;  5A4U A;  5CAX A;  5ID2 A;  1OC9 A;  1A2L A;  1GUM A;  3ZMK A;  1FB0 A;  3LWA A;  2IWT A;  5KEJ A;  5ECM B;  1OVN A;  1K3Y A;  4TXO B;  5FWG A;  4O32 A;  1ABA A;  3DD3 A;  2H6Z A;  4NWY A;  1F9M A;  4NAX A;  2QC7 A;  3HJM A;  3PR8 A;  5B6M A;  3D21 A;  3ISO A;  3UVH A;  4WET A;  2O89 A;  2LUS A;  4DSS A;  4MDC A;  1XFL A;  4BVX A;  1ML6 A;  2A2S A;  4KCE A;  2B7K A;  3G7I A;  2B3S A;  4KND A;  2GDR A;  3DWV A;  2DLX A;  5CRG A;  2VL2 C;  3RHC A;  4K0N A;  1ZL9 A;  4PNF A;  2YOI A;  3GX0 A;  1MDK A;  5DCH A;  1ON4 A;  5FT3 A;  4N0V A;  3GUS A;  4KE3 A;  1W89 A;  1WPI A;  1PA3 A;  4IEL A;  1PMT A;  3DXB A;  2JU5 A;  5F05 A;  3UJ1 A;  5EPF A;  1GSQ A;  1GL8 A;  4TRX A;  4PNG A;  2CX3 A;  5ELG A;  2HFD A;  1GP1 A;  3NZN A;  4GRF A;  3LQ7 A;  1TRW A;  2FNO A;  3QAW A;  1H75 A;  3TRP A;  1CQG A;  2P31 A;  3DIE A;  4IGJ A;  2O87 A;  3GNJ A;  4PUF C;  4BA7 A;  4PUA A;  3ZIJ A;  5L71 A;  4ECC A;  5J9B A;  3QPM A;  4KW6 A;  2VAF A;  5H5R A;  4ZIL A;  2I3Y A;  1R5P A;  4V2M A;  4G10 A;  1X5C A;  4KA0 A;  4BWS A;  4HZ2 A;  1F3B A;  4CW9 A;  5DCG A;  1T8E B;  1Z7R A;  3GL3 A;  3W8J A;  1XW5 A;  2LEG A;  4IN0 A;  4HU9 A;  2H19 A;  2K8V A;  5HQP A;  2HSY A;  3TKQ A;  2CAQ A;  5G2Z A;  3L4N A;  2IL3 A;  4KUN A;  2H74 A;  4NHZ A;  1ERU A;  2C8U A;  7GSS A;  1TTZ A;  3KIJ A;  4Q5N A;  3CSJ A;  4RI7 A;  2YPM A;  2B1K A;  1J0F A;  3QDN A;  1QXH A;  2EIR A;  2L6D A;  3ZIT A;  3P2A A;  4MZB A;  4MF5 A;  4FO5 A;  3BJ5 A;  3IAM 2;  5H5Q A;  2RM5 A;  1YJ6 A;  4OO4 A;  5G30 A;  1MD3 A;  1A24 A;  4TOP A;  1YKA A;  2OAC A;  1MDJ A;  5CO3 A;  3HZ4 A;  1DBY A;  4XRA A;  3TUE A;  5GST A;  3TRX A;  2MMO A;  4G19 A;  1BAY A;  2PWJ A;  4PX1 A;  2HI7 A;  2XBQ A;  3IBH A;  1NHY A;  3CMI A;  2DMM A;  1KBN A;  18GS A;  3Q74 A;  1WP0 A;  1JFU A;  5J4U A;  5IO0 A;  3L9S A;  2LRN A;  2DJK A;  5F07 A;  2HRF A;  1LU4 A;  3BD2 A;  3M0F A;  3LXZ A;  2H66 A;  1B4Q A;  2I4A A;  3VWW A;  2HT9 A;  2VLV A;  3CYN A;  2LJA A;  1U3I A;  2X8H A;  5DAK A;  4ECB A;  4QQ7 A;  1GSY A;  4HQZ A;  1OYJ A;  4KDX A;  1VF1 A;  3LEF A;  5DBQ A;  4FIW A;  4ECJ A;  4F82 A;  1GTI A;  1AC1 A;  1YY7 A;  1TOF A;  1YZX A;  3EUR A;  3FZ4 A;  1TRV A;  2MMA A;  1LBK A;  2B5X A;  2C0F A;  5ECS A;  4LL1 B;  3GKK A;  2YN1 A;  3EE2 A;  3F0I A;  3WYW A;  5F06 A;  1QGV A;  2YCD A;  4TR4 A;  3GH9 A;  2ON5 A;  2DML A;  3GH6 A;  1G6Y A;  2C0D A;  2WZ9 A;  1O6J A;  2DJ2 A;  5AN1 A;  1XOB A;  1XWK A;  3UIW A;  3NOF A;  5D93 A;  2KUC A;  4JRR A;  1A0F A;  3MSZ A;  4LL4 B;  2WDU A;  1T4Z A;  4JU5 A;  2GT5 A;  2IMF A;  2R5G A;  3FZ9 A;  3F63 A;  4WR5 A;  1TRU A;  4RUV A;  16GS A;  3FK8 A;  1ZYE A;  2FY6 A;  1XXU A;  2H6X A;  3IHQ A;  2KHP A;  2HXK A;  5A5K A;  1CQH A;  5ID2 B;  2G2Q A;  1OC9 B;  5ECQ B;  2G0F A;  3VFI A;  2H0H A;  3I6A A;  2YNX A;  2IIY A;  3GMF A;  4JBB A;  1B9X C;  3E9J B;  5IM9 A;  3D4M A;  5AGY A;  1MTC A;  5G1K A;  1EOG A;  3VWX A;  4AF2 A;  1O7U A;  2HRN A;  4CDO A;  2TRX A;  5DJL A;  3AY8 A;  3KGK A;  1E6B A;  1GTU A;  1XWA A;  2IMD A;  2E7P A;  1PN9 A;  3TJG A;  2MMN A;  3FRC A;  1ZYQ B;  2H73 A;  13GS A;  5CRH A;  4DSS B;  2R6K A;  1K0N A;  3DGQ A;  1Y6E A;  3ZFB A;  3TJJ A;  2V2G A;  2AHE A;  3P7X A;  1NHO A;  1A2M A;  2CAI A;  1XWG A;  4N0Z A;  5JCU A;  3QCP A;  3L9U A;  1M7T A;  4GLT A;  4I2T A;  1OC3 A;  3EWL A;  3HCZ A;  3LYP A;  1EOH A;  2WB9 A;  2NTO A;  1N2A A;  4V1A g;  6GSS A;  4PQH A;  2VLU A;  3GRX A;  4K8M A;  1EWX A;  1HQO A;  3ERW A;  1TK5 B;  1FVJ A;  4EF0 A;  5GAN D;  2VCT A;  1JLW A;  4KSO A;  4F2I A;  4XS6 A;  2GSR A;  4HU7 A;  5AIV A;  2K6V A;  2IFQ A;  1TJD A;  1V57 A;  1URM A;  2HYX A;  4O7H A;  4LA1 A;  5AIX A;  3MDK A;  5KN2 A;  2R2J A;  2H1D A;  2VL2 A;  4WKW A;  5CRE A;  2F3M A;  2FWF A;  2VCW A;  4MF6 A;  4YQM A;  1TP9 A;  5IMC A;  5CP1 A;  4ZBD A;  1V9W A;  3VI5 A;  5KN0 A;  5IO2 A;  5JWR B;  3GKN A;  2H76 A;  2FWG A;  5G5E A;  2PGT A;  2QKE A;  1G7E A;  1SJ6 A;  5IPH A;  2YP6 A;  1YEP A;  1XW6 A;  3QMX A;  4MCU A;  4OO5 A;  4EDZ A;  3CBU A;  1UN2 A;  1GTB A;  4ML1 A;  3IR4 A;  4ULX A;  1YQ1 A;  4WXT A;  1K3O A;  5IMV A;  3WT1 A;  1G6W A;  1Z3E A;  2GGT A;  1DE2 A;  1FAA A;  2F8F A;  3KP9 A;  4YQU A;  2R37 A;  1WRY A;  5DDL A;  3UVT A;  3TB2 A;  3ZL5 A;  4TXV A;  5D9T A;  3E3E A;  2H1B A;  4ML6 A;  1BED A;  2MBS A;  3IOS A;  3KEB A;  4XTS A;  4K6X A;  5DVB A;  1GSD A;  3A2X A;  4AJ6 A;  5JWQ B;  2HZF A;  1XVW A;  4K9Z A;  2V1M A;  4XHM A;  2KP2 A;  5DQY A;  5A4V A;  3KMN A;  4MPF A;  2IMK A;  2VM1 A;  3HYP A;  3L9V A;  5E59 A;  1EEM A;  2MZC A;  3ZRD A;  4ZBA A;  3ZTL A;  3UOM A;  3C1S A;  3QR6 A;  2V32 A;  3IE3 A;  5HFG A;  3TCO A;  2X8G A;  5GSS A;  5HFI A;  3ZRE A;  5ECO B;  3KM6 A;  3TKS C;  1X9M B;  1OC8 A;  5DAK B;  2PN8 A;  3FKF A;  2GSS A;  5GAP D;  1ZCP A;  4MJB A;  3UMA A;  1ERW A;  5ECI B;  3U6V A;  4I8B A;  4CHS A;  2VLT A;  2H71 A;  3WT2 A;  5EY6 A;  2YV9 A;  2NVL A;  3CRT A;  1R26 A;  3ED3 A;  4DVC A;  4L0W A;  4OMV A;  4EE0 A;  2H30 A;  2D2Z A;  2DSA A;  2AUV A;  3A2V A;  3ZFL A;  5IMA A;  5ABR A;  2C0E A;  1BQ7 A;  4PGT A;  3HVS A;  4TR1 A;  2FWE A;  4MA9 A;  3VPQ A;  3O3T A;  5DJM A;  2O7K A;  3GYK A;  3F6D A;  5IOX A;  4OFN A;  2CV4 A;  4K7I A;  1PQN A;  3FYG A;  2XBI A;  3CTF A;  2VO4 A;  1BYE A;  4ZL8 A;  2H0G A;  2K8S A;  3QFA C;  4WEY A;  2PBJ A;  5EVO A;  4RQR A;  3Q19 A;  1T3B A;  4XS4 A;  2LV3 A;  4YQV A;  4HZ4 A;  4MPG A;  3KJY A;  5A4W A;  2PVQ A;  5IPG A;  1FHE A;  3TGZ A;  1NM3 A;  4FH8 A;  2C0G A;  4Q5Q A;  1G7O A;  3C73 A;  4TW5 A;  3APS A;  1Q4J A;  1XPV A;  4TR3 A;  4ZB6 A;  2IJY A;  4NXI A;  2MMZ A;  2M80 A;  1W4V A;  4V2L A;  1GUL A;  1SK2 A;  10GS A;  2CT6 A;  3VWU A;  4HJM A;  3F4S A;  1J08 A;  4GST A;  1JZR A;  2JL4 A;  4JED A;  2VD0 A;  3RPP A;  1THX A;  3A5W A;  5J5N A;  1XBS A;  1O73 A;  2CVK A;  1PKW A;  2RII A;  2H72 A;  3VUR A;  4DEJ A;  2O8V B;  4QL9 A;  2JSZ A;  1HD2 A;  2RUE A;  5KN3 A;  1I9D A;  4K2D A;  3FR3 A;  2C4J A;  1GUK A;  2H75 A;  3V1W A;  2B6M A;  2TIR A;  1DE1 A;  3IAS 2;  5IOW A;  4GSS A;  1H4O A;  2LJK A;  2X8C A;  3DVW A;  3KH7 A;  2LRT A;  3LYK A;  2VL3 A;  4BL7 A;  2LKU A;  4OCE A;  2TRC P;  1SL2 B;  4POK A;  17GS A;  5J41 A;  3IV4 A;  2K9F A;  1FW1 A;  3BCI A;  1ZMA A;  3BOA A;  1F3A A;  4ISD A;  4XRD A;  3IC4 A;  3IXR A;  4O92 A;  2IFQ B;  2GSQ A;  2CA8 A;  2MYG A;  2HNL A;  5INY A;  1AAZ A;  1IYH A;  4NV2 A;  4PQ1 A;  5CNW A;  1TRS A;  4E8E A;  3VLN A;  2KOK A;  4HUA A;  3N5O A;  3FZA A;  3C8E A;  3ZML A;  3FR6 A;  1VF4 A;  4K7O A;  2FLS A;  2VUP A;  1TDI A;  1XVQ A;  1ZOF A;  3H8Q A;  4D73 A;  4H86 A;  4OWY A;  3GA4 A;  4AJ7 A;  5AIS A;  1MEK A;  1F2E A;  3S9F A;  1O8W A;  1WWJ A;  2WUL A;  1X0R A;  3TJF A;  4L5L A;  1TU7 A;  3MWH A;  4GXZ A;  2ZUP A;  3RBT A;  4OD7 A;  1HNC A;  3WGE A;  3F4R A;  4F0C A;  6GST A;  3F3R A;  2PU9 C;  4NHW A;  2YZU A;  1Z9H A;  2P0G A;  3H1N A;  1JHB A;  4GWR A;  4N11 A;  1SYR A;  2YJ7 A;  3UAR A;  1SJI A;  2C1Y A;  1ZZY A;  4Q5R A;  4NPB A;  1T7P B;  1Q98 A;  4HEA 2;  5HR2 A;  1K3L A;  2LQO A;  4AJ8 A;  3D22 A;  2HZE A;  4FYB A;  1ILO A;  1AIU A;  1S3A A;  3ZYW A;  2KLX A;  4V2N A;  1PL1 A;  2JZR A;  3GFK A;  4ZBB A;  2IME A;  1SYX A;  1S3C A;  2B1L A;  2OE3 A;  3GKM A;  3LXT A;  3GX8 A;  2LQQ A;  4DSR A;  3RAZ A;  2PVO C;  1EGO A;  4E8H A;  1M2D A;  3TKR A;  4WF5 A;  4GSN A;  4HQS A;  4N30 A;  1SKW B;  3IRA A;  1E2Y A;  4LMV A;  2WJU A;  2YZH A;  2OBK A;  3D0Z A;  3DML A;  4JZQ A;  5J9C A;  2DBC A;  4TKY A;  1RK4 A;  5HR0 A;  2YV7 A;  4ZL7 A;  3EIN A;  1GNW A;  2GZP A;  4ZL9 A;  4RQX A;  4YAP A;  4I6X A;  2LNS A;  1JZW A;  2O85 A;  4KH7 A;  1VF2 A;  4KAE A;  4PUR A;  3Q18 A;  1OE7 A;  2H6Y A;  3VI7 A;  3HDC A;  2JAD A;  1OKD A;  5DQS A;  5D8I A;  3IK7 A;  3LG6 A;  2GZZ A;  2PER A;  3HZ8 A;  1TU8 A;  3CTG A;  4X1U A;  1YF0 A;  3IA1 A;  2WRT A;  1V58 A;  2GQK A;  3A2W A;  4TR1 B;  3VWV A;  1T4Y A;  2H01 A;  3QAG A;  5D9W A;  3H79 A;  1BJX A;  3KD0 A;  3ZVJ A;  4ACS A;  1FVK A;  1RW1 A;  1SEN A;  4G9H A;  1XZO A;  2JAC A;  3UBK A;  2X99 A;  1Y25 A;  2ZNM A;  4BWQ A;  2GQM A;  2YJH A;  2OBI A;  1F6M C;  4JR4 A;  5ECL B;  2P5Q A;  1EEJ A;  4XS4 B;  4MP4 A;  2L4C A;  3MNG A;  2FCH A;  3DYR A;  1ZGN A;  3CSH A;  4IW9 A;  4JE1 A;  4EVM A;  3BBY A;  1SL0 B;  1X9S B;  2JZT A;  2VD1 A;  2LJR A;  4MMM A;  1EP7 A;  4YH2 A;  1RQM A;  1Z5Y E;  5IIZ A;  2BMX A;  5ELA A;  1U88 A;  2LRC A;  1FOV A;  2LTK A;  3CXG A;  4HOJ A;  4TR0 A;  1B9Y C;  1R7H A;  3GHA A;  1M9A A;  5DAL B;  4I2U A;  3A3T A;  1GSF A;  2AV4 A;  3VK9 A;  2E2G A;  12GS A;  2GST A;  1GWC A;  3EU3 A;  2IMI A;  1ACV A;  2M72 A;  4IBP A;  2PMT A;  3ERG A;  4HS1 A;  2EIO A;  3DRN A;  2GT6 A;  4MZW A;  5EL8 A;  1DSB A;  1K0M A;  3FY7 A;  4J57 E;  1UVZ A;  1LJR A;  4TN8 A;  5F8B A;  2B5E A;  2AJQ B;  4KDU A;  1EV9 A;  1XW9 A;  3G9B A;  3QFB C;  1QFN A;  3KCM A;  4AGS A;  4YAV A;  1T00 A;  2QGV A;  1XWB A;  1AQV A;  3QD9 A;  2FUG 2;  2VCV A;  1PD2 1;  1B48 A;  3FR9 A;  22GS A;  3GSS A;  4K0G A;  3F3Q A;  2LNT A;  3IK9 A;  2C80 A;  1VF3 A;  3EU4 A;  1GRX A;  1C72 A;  2GQL A;  3QAV A;  3FW2 A;  3GKX A;  3L78 A;  20GS A;  3ME8 A;  3H4K A;  4HJ2 A;  4GQC A;  4F9Z A;  4KDY A;  2L5O A;  4POM A;  4MJA A;  4ZIJ A;  5LD0 A;  1PX6 A;  2DC5 A;  5IQY A;  2AYT A;  4KB3 A;  1TK0 B;  2CQ9 A;  2JSY A;  4X43 A;  1V98 A;  4IQ1 A;  3LSZ A;  3C71 A;  4GQF A;  1K0D A;  5FHI A;  5CYY A;  2V6O A;  1O81 A;  1PRX A;  2Z9S A;  1M2B A;  3HA9 A;  1BX9 A;  2IPA A;  1B8X A;  3FZ5 A;  1U87 A;  2PUK C;  4D73 B;  1GSE A;  4K1F A;  3ME7 A;  3DKS A;  3UL3 A;  4IJ3 A;  3LJR A;  4HDE A;  5H5S A;  4XS1 A;  3D5J A;  5ECK B;  5HFK A;  2DJ3 A;  5ECR B;  1ERT A;  2VIM A;  1FO5 A;  1YDK A;  4KGI A;  4WF4 A;  1OKT A;  2OAD A;  5B6N A;  1EP8 A;  3WGD A;  3ZVJ D;  2GVP A;  3APO A;  1TKD B;  1X5E A;  1OE8 A;  3O76 A;  3HD5 A;  5B8A A;  4J2F A;  2EIQ A;  4OFM A;  6GSY A;  3CRU A;  1KNG A;  2V6K A;  2OE1 A;  2ZCT A;  3TKP A;  3NIV A;  3SBC A;  1OAZ A;  1VGL A;  2AAW A;  5LCZ A;  1YF1 A;  2HZE B;  3GTU A;  2DJ0 A;  5GZZ B;  3F4T A;  2XPE A;  4N10 A;  4EDY A;  2VCZ A;  3TKS E;  2A2R A;  2H1A A;  2KP1 A;  3KP8 A;  5LNK e;  4I97 A;  1EZK A;  2F8A A;  1SD9 A;  2J9H A;  3ZIV A;  4G2E A;  1HNB A;  5IMD A;  3VPT A;  4KCA A;  1R4W A;  3M8N A;  3RDW A;  4NV5 A;  2N5F A;  4MZC A;  1SK1 A;  4IS0 A;  2L59 A;  5DAL A;  2GS3 A;  1QQ2 A;  3C1R A;  1JZO A;  2X64 A;  2H0I A;  4ECI A;  3DVX A;  3I9V 2;  5J3R A;  2AB6 A;  2H8L A;  3H93 A;  3G7Y A;  2C3T A;  3M1G A;  1K0A A;  3FEU A;  3UBL A;  4IVF A;  2OE0 A;  1ST9 A;  3M3M A;  1GH2 A;  2WCI A;  1K0O A;  2I81 A;  2NBS A;  1A2J A;  4IP1 A;  2VCQ A;  1GSS A;  3KTB A;  1BG5 A;  3E0U A;  4EUY A;  1AQW A;  1GLQ A;  4MF7 A;  2CVD A;  2FHE A;  2YAN A;  4BPY A;  2F9S A;  2DJ1 A;  6GSW A;  3F8U A;  3ZLP A;  3PIN A;  3US3 A;  1T1V A;  9GSS A;  4BVY A; 
#chains in the Genus database with same CATH topology
 3F6F A;  2VCX A;  3EYT A;  3OR5 A;  3Q6O A;  2FD3 A;  1N8J A;  3W6G A;  1TXX A;  1QK8 A;  3TDG A;  3N9J A;  1XCC A;  3FHK A;  1X5D A;  3EC3 A;  4HI7 A;  2L5L A;  2L57 A;  5C00 A;  2IN3 A;  4IQA A;  1I5G A;  1M9B A;  2B7J A;  2XHF A;  1YEX A;  3LOR A;  3EMX A;  2DIY A;  1O8X A;  2MBT A;  1Z6M A;  5IMZ A;  4GCI A;  2F51 A;  2BTO T;  3EMP A;  3MAK A;  3KH9 A;  5G1L A;  4FYU A;  4I5Q A;  1PSQ A;  3TOU A;  1K0B A;  3RPN A;  1SKR B;  2GTU A;  4FYC A;  3JCM L;  2N5A A;  5HR1 A;  1V40 A;  3UEM A;  11GS A;  1DUG A;  1PGT A;  2OKA A;  8GSS A;  4K2X A;  4TXO A;  2C3N A;  4EO3 A;  4PQI A;  1UA5 A;  3C7M A;  4CY8 A;  4NMU A;  3F9U A;  3HHV A;  1HNA A;  2LS5 A;  1M2A A;  2NPB A;  5B7C A;  2FGX A;  5BRT A;  3HVV A;  2E2M A;  2YWM A;  1WOU A;  1AXD A;  2VOC A;  3PH9 A;  3I69 A;  2CZ3 A;  3U5R E;  2VL9 A;  1TK8 B;  1PL2 A;  1A8L A;  4V1A p;  2N5B A;  4KX4 A;  3HJO A;  4F0B A;  1TW9 A;  1PX7 A;  4EC0 A;  1SKS B;  2XC2 A;  5C04 A;  3L0H A;  2PPT A;  1GLP A;  1U6T A;  1WJK A;  3M9K A;  1NW2 A;  4X0X A;  4G0I A;  2HRK A;  4WBR D;  1PKZ A;  1SJZ A;  1UC7 A;  1JLV A;  1THO A;  5D73 A;  2P5R A;  5COH A;  2B5Y A;  1USB A;  2ES7 A;  2L4Q A;  3ERF A;  4MK3 A;  2RLI A;  1R5A A;  5D96 A;  2M46 A;  2C3Q A;  2WS2 A;  1GTA A;  4QL7 A;  5JCG A;  1AW9 A;  3KXO A;  1WIK A;  2HLS A;  2YWO A;  4RI6 A;  3DEX A;  3GV1 A;  1G0T A;  1XG8 A;  3G7J A;  3HXS A;  2OA7 A;  2RM6 A;  4XIH A;  4MAB A;  3O6T A;  3J7Y k;  1TI1 A;  4MH3 A;  1EV4 A;  4JR6 A;  4OCF A;  6GSV A;  5G31 A;  2R0G A;  1WE0 A;  3EVI A;  5HR3 A;  3I43 A;  1QMV A;  2LST A;  3QOU A;  2VM2 A;  1F37 A;  3HVX A;  4TVE A;  4POB A;  3D4T A;  3WD6 A;  2FWH A;  5ECN B;  1KTE A;  2REM A;  4G0K A;  2FA8 A;  1WMJ A;  1FOH A;  4EKZ A;  5JWO B;  1A8Y A;  3IDV A;  5B8B A;  2DIZ A;  3LFL A;  2EC4 A;  1SD8 A;  5ENU A;  1X9W B;  1AUC A;  2HE3 A;  1JZD A;  4IP6 A;  2K18 A;  5F0G A;  1MDI A;  4MJE A;  4WBJ A;  2ON7 A;  4IKH A;  3PPU A;  3CSI A;  4EXJ A;  3RHB A;  5KN1 A;  3J7Y b;  1GSU A;  3GST A;  3WGX A;  3M9J A;  4GTU A;  3APQ A;  4ILF A;  4P3Y B;  2YWI A;  1U3A A;  4XCS A;  3PGT A;  4Q5F A;  4Z7X A;  4ZB9 A;  2YWN A;  2NDO A;  4MLY A;  3TKS A;  2R4V A;  1KEB A;  3BCK A;  3KTL A;  3SWL A;  3GTU B;  5E4W A;  3HKR A;  1AQX A;  1S3D A;  1TI3 A;  3P8W A;  4IJI A;  4ZXG A;  3IPZ A;  3TRQ A;  3GL5 A;  4MH2 A;  5CRD A;  2V41 A;  2XPD A;  1EGR A;  5IMF A;  2QSI A;  6GSX A;  4POL A;  1GNE A;  2I1U A;  3UAP A;  2UZ8 A;  6GSU A;  2DKI A;  1ERV A;  1MD4 A;  1FB6 A;  1V2A A;  4KSM A;  1Z6N A;  2CX4 A;  4MJC A;  5ECH B;  3TOT A;  4F03 A;  4ZB8 A;  4LMW A;  2E0Q A;  4K7N A;  1B4P A;  14GS A;  3P90 A;  1FG4 A;  3R2Q A;  1QUW A;  1A0R P;  2CZ2 A;  4LLR A;  3IC8 A;  2ALB A;  3D6I A;  2R3X A;  2BJX A;  3GN3 A;  2CVB A;  1GUH A;  3KZQ A;  2JZS A;  4ID0 A;  2I9H A;  1SU9 A;  2X4A A;  2HSH A;  4PXO A;  2DJJ A;  1SK0 A;  2H1G A;  1XIY A;  4OFT A;  3HJP A;  3K8N A;  4IHU A;  2FA4 A;  3KMO A;  5D9V A;  1A23 A;  1J9B A;  4DSQ A;  5JCW A;  1IYI A;  1NSW A;  3LGC A;  2WGR A;  4EL1 A;  1YKC A;  4BVY B;  2J23 A;  4J56 E;  2GLR A;  4L0U A;  1Z7P A;  3ZZX A;  1O85 A;  5CRW A;  3GIX A;  2WFC A;  19GS A;  4K5R A;  2GZY A;  3GUR A;  3TJB A;  5D9X A;  1SL1 B;  1M99 A;  2H70 A;  1VRS D;  5G5F A;  1K0C A;  1M0U A;  3TJK A;  4L5O A;  3W8S A;  1XOA A;  2RUF A;  1HYU A;  4GF0 A;  4L8E A;  2A4V A;  4WR4 A;  1XWC A;  3HY2 A;  4O5R A;  5ECP B;  2OJL A;  2L6C A;  5A4U A;  5CAX A;  5ID2 A;  1OC9 A;  1A2L A;  4O5U A;  1GUM A;  3ZMK A;  1FB0 A;  3LWA A;  2IWT A;  5KEJ A;  5ECM B;  1OVN A;  1K3Y A;  4TXO B;  5FWG A;  4O32 A;  1ABA A;  3DD3 A;  2R0P A;  2H6Z A;  4NWY A;  1F9M A;  4NAX A;  2QC7 A;  3HJM A;  3PR8 A;  5B6M A;  2HRA A;  3D21 A;  3ISO A;  3UVH A;  4WET A;  2O89 A;  2LUS A;  4DSS A;  4MDC A;  1XFL A;  4BVX A;  1ML6 A;  4YKG A;  2A2S A;  4KCE A;  2B7K A;  3G7I A;  2B3S A;  4KND A;  2GDR A;  3DWV A;  2DLX A;  5CRG A;  2VL2 C;  3RHC A;  4K0N A;  1ZL9 A;  4PNF A;  2YOI A;  3GX0 A;  1MDK A;  5DCH A;  1ON4 A;  5FT3 A;  4N0V A;  3GUS A;  4KE3 A;  1W89 A;  1WPI A;  1PA3 A;  4IEL A;  1PMT A;  3DXB A;  2JU5 A;  5F05 A;  3UJ1 A;  5EPF A;  1GSQ A;  1GL8 A;  4TRX A;  4PNG A;  2CX3 A;  5ELG A;  2HFD A;  1GP1 A;  3NZN A;  4GRF A;  3LQ7 A;  1TRW A;  2FNO A;  3QAW A;  1H75 A;  3TRP A;  1CQG A;  2P31 A;  3DIE A;  4IGJ A;  2O87 A;  3GNJ A;  4PUF C;  4BA7 A;  4PUA A;  3ZIJ A;  5L71 A;  4ECC A;  5J9B A;  3QPM A;  4KW6 A;  2VAF A;  5H5R A;  4ZIL A;  2I3Y A;  1R5P A;  4V2M A;  4G10 A;  1X5C A;  4KA0 A;  4BWS A;  4HZ2 A;  1F3B A;  3EPT A;  4CW9 A;  5DCG A;  1T8E B;  1Z7R A;  3GL3 A;  3W8J A;  4FQU A;  1XW5 A;  2LEG A;  4IN0 A;  4HU9 A;  2H19 A;  2K8V A;  5HQP A;  2HSY A;  3TKQ A;  2CAQ A;  5G2Z A;  3L4N A;  2IL3 A;  4KUN A;  2H74 A;  4NHZ A;  1ERU A;  2C8U A;  7GSS A;  1TTZ A;  3KIJ A;  4Q5N A;  3CSJ A;  3CQF A;  4RI7 A;  2YPM A;  2B1K A;  1J0F A;  3QDN A;  1QXH A;  2EIR A;  2L6D A;  3ZIT A;  3P2A A;  4MZB A;  4MF5 A;  4FO5 A;  3BJ5 A;  3IAM 2;  5H5Q A;  2RM5 A;  1YJ6 A;  4OO4 A;  5G30 A;  1MD3 A;  1A24 A;  4TOP A;  1YKA A;  2OAC A;  1MDJ A;  5CO3 A;  3HZ4 A;  1DBY A;  4XRA A;  3TUE A;  5GST A;  3TRX A;  2MMO A;  4G19 A;  1BAY A;  2PWJ A;  4PX1 A;  2HI7 A;  2XBQ A;  3IBH A;  1NHY A;  3CMI A;  2DMM A;  1KBN A;  18GS A;  3Q74 A;  1WP0 A;  1JFU A;  5J4U A;  5IO0 A;  3L9S A;  2LRN A;  2DJK A;  5F07 A;  2HRF A;  1LU4 A;  3BD2 A;  3M0F A;  3LXZ A;  2H66 A;  1B4Q A;  2I4A A;  3VWW A;  2HT9 A;  2VLV A;  3CYN A;  2LJA A;  1U3I A;  2X49 A;  2X8H A;  5DAK A;  4ECB A;  4QQ7 A;  1GSY A;  4HQZ A;  1OYJ A;  4KDX A;  1VF1 A;  3LEF A;  4FIW A;  5DBQ A;  4ECJ A;  4F82 A;  1GTI A;  1AC1 A;  5KOW A;  1YY7 A;  1TOF A;  3FMW A;  1YZX A;  3EUR A;  3FZ4 A;  1TRV A;  2MMA A;  1LBK A;  2B5X A;  2C0F A;  5ECS A;  4LL1 B;  3GKK A;  2YN1 A;  3EE2 A;  3F0I A;  3WYW A;  5F06 A;  1QGV A;  2YCD A;  4TR4 A;  3GH9 A;  1ZYN A;  2ON5 A;  2QA2 A;  2DML A;  3GH6 A;  1G6Y A;  2C0D A;  3IHG A;  2WZ9 A;  1O6J A;  2DJ2 A;  5AN1 A;  1XOB A;  1XWK A;  3UIW A;  3NOF A;  5D93 A;  2KUC A;  4JRR A;  1A0F A;  3MSZ A;  4LL4 B;  2WDU A;  1T4Z A;  4JU5 A;  2GT5 A;  2IMF A;  2R5G A;  3FZ9 A;  3F63 A;  4WR5 A;  1TRU A;  4RUV A;  16GS A;  3FK8 A;  1ZYE A;  2FY6 A;  1XXU A;  2H6X A;  3IHQ A;  2KHP A;  2HXK A;  5A5K A;  1CQH A;  2QA1 A;  2G2Q A;  5ID2 B;  1OC9 B;  5ECQ B;  2G0F A;  3VFI A;  2H0H A;  3I6A A;  1S3R A;  2YNX A;  2IIY A;  3GMF A;  4USS A;  4JBB A;  1B9X C;  3E9J B;  5IM9 A;  3D4M A;  5AGY A;  1MTC A;  5G1K A;  1EOG A;  3VWX A;  4AF2 A;  1O7U A;  2HRN A;  4CDO A;  2TRX A;  5DJL A;  3AY8 A;  3KGK A;  1E6B A;  1GTU A;  1XWA A;  2IMD A;  2E7P A;  1PN9 A;  3TJG A;  2MMN A;  3FRC A;  1ZYQ B;  2H73 A;  13GS A;  5CRH A;  4DSS B;  2R6K A;  1K0N A;  4BVX B;  3DGQ A;  1Y6E A;  3ZFB A;  3TJJ A;  2V2G A;  2AHE A;  3P7X A;  1NHO A;  1A2M A;  2CAI A;  1XWG A;  4N0Z A;  5JCU A;  3QCP A;  3L9U A;  1M7T A;  4GLT A;  4I2T A;  1OC3 A;  3EWL A;  3HCZ A;  3LYP A;  1EOH A;  2WB9 A;  2NTO A;  1N2A A;  4V1A g;  6GSS A;  4PQH A;  2VLU A;  3GRX A;  4K8M A;  1EWX A;  1HQO A;  3ERW A;  1TK5 B;  1FVJ A;  4EF0 A;  5GAN D;  2VCT A;  1JLW A;  4KSO A;  4F2I A;  4XS6 A;  2GSR A;  4HU7 A;  5AIV A;  2K6V A;  2IFQ A;  1TJD A;  4EIP A;  1V57 A;  1URM A;  2HYX A;  4O7H A;  4LA1 A;  5AIX A;  3MDK A;  4A5P A;  5KN2 A;  2R2J A;  2H1D A;  2VL2 A;  4WKW A;  5CRE A;  2F3M A;  2FWF A;  2VCW A;  4MF6 A;  4YQM A;  1TP9 A;  5IMC A;  5CP1 A;  4ZBD A;  1V9W A;  3VI5 A;  5KN0 A;  5IO2 A;  5JWR B;  3GKN A;  2H76 A;  2FWG A;  5G5E A;  2PGT A;  2QKE A;  1G7E A;  1SJ6 A;  5IPH A;  2YP6 A;  1YEP A;  1XW6 A;  3QMX A;  4MCU A;  4OO5 A;  4EDZ A;  3CBU A;  1UN2 A;  1GTB A;  4ML1 A;  3IR4 A;  4ULX A;  1YQ1 A;  4WXT A;  1K3O A;  5IMV A;  3WT1 A;  1G6W A;  1Z3E A;  2GGT A;  1DE2 A;  1FAA A;  2F8F A;  3KP9 A;  4YQU A;  2R37 A;  1WRY A;  5DDL A;  3UVT A;  3TB2 A;  3ZL5 A;  4TXV A;  5D9T A;  3E3E A;  2H1B A;  4ML6 A;  4X4J A;  1BED A;  2MBS A;  3IOS A;  3KEB A;  4XTS A;  4K6X A;  5DVB A;  1GSD A;  3A2X A;  4AJ6 A;  5JWQ B;  2HZF A;  1XVW A;  4K9Z A;  2V1M A;  4XHM A;  2KP2 A;  5DQY A;  5A4V A;  3KMN A;  4MPF A;  2IMK A;  2VM1 A;  3HYP A;  3L9V A;  5E59 A;  1EEM A;  2MZC A;  3ZRD A;  4ZBA A;  3ZTL A;  3UOM A;  3C1S A;  3QR6 A;  2V32 A;  3IE3 A;  5HFG A;  3TCO A;  2X8G A;  5GSS A;  5HFI A;  3ZRE A;  5ECO B;  3KM6 A;  3TKS C;  1X9M B;  1OC8 A;  5DAK B;  2PN8 A;  3FKF A;  2GSS A;  5GAP D;  1M3I A;  1ZCP A;  4MJB A;  3UMA A;  1ERW A;  5ECI B;  3U6V A;  4I8B A;  4CHS A;  2VLT A;  2H71 A;  3WT2 A;  5EY6 A;  2YV9 A;  2NVL A;  3CRT A;  1R26 A;  3ED3 A;  4DVC A;  3R3E A;  4L0W A;  4OMV A;  2DKH A;  4EE0 A;  2H30 A;  2D2Z A;  2DSA A;  2AUV A;  3A2V A;  3ZFL A;  5IMA A;  5ABR A;  1PFO A;  2C0E A;  1BQ7 A;  4PGT A;  3HVS A;  4TR1 A;  2FWE A;  4MA9 A;  3VPQ A;  3O3T A;  5DJM A;  2O7K A;  3GYK A;  3F6D A;  5IOX A;  4OFN A;  2CV4 A;  4K7I A;  1PQN A;  3FYG A;  2XBI A;  3CTF A;  2VO4 A;  1BYE A;  5KOX A;  4ZL8 A;  2H0G A;  2K8S A;  3QFA C;  4WEY A;  2PBJ A;  5EVO A;  4RQR A;  3Q19 A;  1T3B A;  4XS4 A;  2LV3 A;  4YQV A;  4HZ4 A;  4MPG A;  3KJY A;  5A4W A;  2PVQ A;  5IPG A;  1FHE A;  3TGZ A;  1NM3 A;  4FH8 A;  2C0G A;  4Q5Q A;  1G7O A;  3C73 A;  4TW5 A;  3APS A;  4Z2R A;  1Q4J A;  1XPV A;  4TR3 A;  4ZB6 A;  2IJY A;  4NXI A;  2MMZ A;  2M80 A;  1W4V A;  4V2L A;  1GUL A;  1SK2 A;  10GS A;  2CT6 A;  3VWU A;  4HJM A;  3F4S A;  1J08 A;  4GST A;  1JZR A;  2JL4 A;  4JED A;  2VD0 A;  3RPP A;  1THX A;  3A5W A;  5J5N A;  1XBS A;  1O73 A;  2CVK A;  1PKW A;  2RII A;  2H72 A;  3VUR A;  4DEJ A;  2O8V B;  4QL9 A;  2JSZ A;  1HD2 A;  2RUE A;  5KN3 A;  1I9D A;  4K2D A;  3FR3 A;  2C4J A;  3HVN A;  1GUK A;  2H75 A;  3V1W A;  2B6M A;  2TIR A;  1DE1 A;  3IAS 2;  5IOW A;  4GSS A;  1H4O A;  2LJK A;  2X8C A;  3DVW A;  3KH7 A;  2LRT A;  3LYK A;  2VL3 A;  4BL7 A;  2LKU A;  4BIK A;  4OCE A;  2TRC P;  1SL2 B;  4POK A;  17GS A;  5J41 A;  3IV4 A;  2K9F A;  1FW1 A;  3BCI A;  1ZMA A;  3BOA A;  1F3A A;  4ISD A;  4XRD A;  3IC4 A;  3IXR A;  4O92 A;  2IFQ B;  2GSQ A;  2CA8 A;  2MYG A;  2HNL A;  5INY A;  1AAZ A;  1IYH A;  4NV2 A;  4PQ1 A;  5CNW A;  1TRS A;  4E8E A;  3VLN A;  2KOK A;  4HUA A;  3N5O A;  3LW9 A;  3FZA A;  3C8E A;  3ZML A;  3FR6 A;  1VF4 A;  4K7O A;  2FLS A;  2VUP A;  1TDI A;  1XVQ A;  1ZOF A;  3H8Q A;  4D73 A;  4H86 A;  4OWY A;  3GA4 A;  4AJ7 A;  5AIS A;  1MEK A;  1F2E A;  3S9F A;  1O8W A;  1WWJ A;  2WUL A;  1X0R A;  3TJF A;  4L5L A;  1TU7 A;  5BMU A;  3MWH A;  4GXZ A;  2ZUP A;  3RBT A;  4OD7 A;  1HNC A;  3WGE A;  3F4R A;  4F0C A;  6GST A;  3F3R A;  2PU9 C;  4NHW A;  2YZU A;  1Z9H A;  2P0G A;  3H1N A;  1JHB A;  4GWR A;  4N11 A;  1SYR A;  2YJ7 A;  3UAR A;  1SJI A;  2C1Y A;  1ZZY A;  4Q5R A;  4NPB A;  1T7P B;  1Q98 A;  4HEA 2;  5HR2 A;  1K3L A;  2LQO A;  4AJ8 A;  3D22 A;  2HZE A;  1ZYP A;  4FYB A;  1ILO A;  1AIU A;  1S3A A;  3ZYW A;  2HSM A;  4V2N A;  2KLX A;  1PL1 A;  2JZR A;  3GFK A;  4ZBB A;  2IME A;  1SYX A;  1S3C A;  2B1L A;  2OE3 A;  3GKM A;  3LXT A;  3GX8 A;  2LQQ A;  4DSR A;  3RAZ A;  2PVO C;  1EGO A;  4E8H A;  1M2D A;  3TKR A;  4WF5 A;  4GSN A;  4HQS A;  4N30 A;  1SKW B;  3IRA A;  1E2Y A;  4LMV A;  2WJU A;  2YZH A;  2OBK A;  3D0Z A;  3DML A;  4JZQ A;  5J9C A;  2DBC A;  4TKY A;  1RK4 A;  5HR0 A;  2YV7 A;  4ZL7 A;  3EIN A;  1GNW A;  2GZP A;  4ZL9 A;  4RQX A;  4YAP A;  4I6X A;  2LNS A;  1JZW A;  2O85 A;  4KH7 A;  1VF2 A;  4KAE A;  4PUR A;  3Q18 A;  1OE7 A;  2H6Y A;  3VI7 A;  3HDC A;  2JAD A;  1OKD A;  5DQS A;  5D8I A;  3IK7 A;  3LG6 A;  2GZZ A;  2PER A;  3HZ8 A;  1TU8 A;  3CTG A;  4X1U A;  1YF0 A;  3IA1 A;  2WRT A;  1V58 A;  2GQK A;  3A2W A;  4TR1 B;  3VWV A;  1T4Y A;  2H01 A;  3QAG A;  5D9W A;  3H79 A;  1BJX A;  3KD0 A;  3ZVJ A;  4ACS A;  1FVK A;  1RW1 A;  1SEN A;  4G9H A;  1XZO A;  2JAC A;  3UBK A;  2X99 A;  1Y25 A;  2ZNM A;  4BWQ A;  2GQM A;  2YJH A;  1M3J A;  2OBI A;  1F6M C;  4K5S A;  4JR4 A;  5ECL B;  2P5Q A;  1EEJ A;  4XS4 B;  4MP4 A;  2L4C A;  3MNG A;  2FCH A;  3DYR A;  1ZGN A;  3CSH A;  4IW9 A;  4JE1 A;  4EVM A;  3BBY A;  1SL0 B;  1X9S B;  2JZT A;  2VD1 A;  2LJR A;  4MMM A;  1EP7 A;  4YH2 A;  1RQM A;  1Z5Y E;  5IIZ A;  2BMX A;  5ELA A;  1U88 A;  2LRC A;  1FOV A;  4KF9 A;  2LTK A;  3CXG A;  4HOJ A;  4TR0 A;  1B9Y C;  1R7H A;  3GHA A;  1M9A A;  5DAL B;  4I2U A;  4O5Q A;  3A3T A;  1GSF A;  4YKF A;  2AV4 A;  3VK9 A;  2E2G A;  12GS A;  2GST A;  1GWC A;  3EU3 A;  2IMI A;  1ACV A;  2M72 A;  4IBP A;  2PMT A;  3ERG A;  4HS1 A;  2EIO A;  3DRN A;  2GT6 A;  4MZW A;  5EL8 A;  1DSB A;  1K0M A;  3FY7 A;  4J57 E;  1UVZ A;  4Z2T A;  1LJR A;  4TN8 A;  5F8B A;  2B5E A;  2AJQ B;  4KDU A;  1EV9 A;  1XW9 A;  3G9B A;  3QFB C;  1QFN A;  3KCM A;  4AGS A;  4YAV A;  1T00 A;  2QGV A;  1XWB A;  1AQV A;  3QD9 A;  2FUG 2;  2VCV A;  1PD2 1;  1B48 A;  3FR9 A;  4BL7 B;  22GS A;  3GSS A;  4K0G A;  3F3Q A;  2LNT A;  3IK9 A;  2C80 A;  1VF3 A;  4ICY A;  3EU4 A;  3MIX A;  1GRX A;  1C72 A;  2GQL A;  3QAV A;  3FW2 A;  3GKX A;  3L78 A;  20GS A;  3ME8 A;  3H4K A;  4HJ2 A;  4GQC A;  4F9Z A;  4KDY A;  2L5O A;  4POM A;  4MJA A;  4ZIJ A;  5LD0 A;  4Z2U A;  4MNN A;  1PX6 A;  2DC5 A;  5IQY A;  2AYT A;  4KB3 A;  1TK0 B;  2CQ9 A;  2JSY A;  4X43 A;  1V98 A;  4IQ1 A;  3LSZ A;  3C71 A;  4GQF A;  1K0D A;  5FHI A;  4PTS A;  5CYY A;  2V6O A;  3MYD A;  1O81 A;  1PRX A;  2Z9S A;  1M2B A;  3HA9 A;  1BX9 A;  2IPA A;  1B8X A;  3FZ5 A;  1U87 A;  2PUK C;  4D73 B;  2R0C A;  1GSE A;  4K1F A;  4HSC X;  3ME7 A;  3DKS A;  3UL3 A;  4IJ3 A;  3LJR A;  4HDE A;  5H5S A;  4XS1 A;  3D5J A;  5ECK B;  5HFK A;  2DJ3 A;  5ECR B;  1ERT A;  2VIM A;  1FO5 A;  1YDK A;  4KGI A;  4WF4 A;  1OKT A;  2OAD A;  5B6N A;  1EP8 A;  3WGD A;  3ZVJ D;  2GVP A;  3APO A;  1TKD B;  1X5E A;  1OE8 A;  3O76 A;  3HD5 A;  5B8A A;  4J2F A;  2EIQ A;  4OFM A;  6GSY A;  3CRU A;  1KNG A;  2V6K A;  2OE1 A;  2ZCT A;  3TKP A;  3NIV A;  3SBC A;  1OAZ A;  1VGL A;  2AAW A;  5LCZ A;  1YF1 A;  2HZE B;  3GTU A;  2DJ0 A;  5GZZ B;  3F4T A;  2XPE A;  4N10 A;  4EDY A;  2VCZ A;  3TKS E;  2A2R A;  2H1A A;  2KP1 A;  3KP8 A;  5LNK e;  4I97 A;  1EZK A;  2F8A A;  1SD9 A;  2J9H A;  3ZIV A;  4G2E A;  1HNB A;  5IMD A;  3VPT A;  4KCA A;  1R4W A;  3M8N A;  3RDW A;  4NV5 A;  2N5F A;  4MZC A;  1SK1 A;  4IS0 A;  4EIQ A;  2L59 A;  5DAL A;  2GS3 A;  1QQ2 A;  3C1R A;  1JZO A;  2X64 A;  2H0I A;  4ECI A;  3DVX A;  3I9V 2;  5J3R A;  2AB6 A;  2H8L A;  2A4H A;  3H93 A;  3G7Y A;  2C3T A;  3M1G A;  1K0A A;  3FEU A;  3UBL A;  2A2P A;  4IVF A;  2OE0 A;  1ST9 A;  3M3M A;  1GH2 A;  2WCI A;  1K0O A;  4CY6 A;  2I81 A;  2NBS A;  1A2J A;  4IP1 A;  2VCQ A;  1GSS A;  3KTB A;  1BG5 A;  3E0U A;  4EUY A;  1AQW A;  1GLQ A;  4MF7 A;  4G0L A;  2CVD A;  2FHE A;  2YAN A;  4BPY A;  1PN0 A;  2F9S A;  2DJ1 A;  3A5I A;  6GSW A;  3F8U A;  3ZLP A;  3PIN A;  3US3 A;  1T1V A;  9GSS A;  4BVY A; 
#chains in the Genus database with same CATH homology
 3F6F A;  2VCX A;  3EYT A;  3OR5 A;  3Q6O A;  2FD3 A;  1N8J A;  3W6G A;  1TXX A;  1QK8 A;  3TDG A;  3N9J A;  1XCC A;  3FHK A;  1X5D A;  3EC3 A;  4HI7 A;  2L5L A;  2L57 A;  5C00 A;  2IN3 A;  4IQA A;  1I5G A;  1M9B A;  2B7J A;  2XHF A;  1YEX A;  3LOR A;  3EMX A;  2DIY A;  1O8X A;  2MBT A;  1Z6M A;  5IMZ A;  4GCI A;  2F51 A;  2BTO T;  3EMP A;  3MAK A;  3KH9 A;  5G1L A;  4FYU A;  4I5Q A;  1PSQ A;  3TOU A;  1K0B A;  3RPN A;  1SKR B;  2GTU A;  4FYC A;  3JCM L;  2N5A A;  5HR1 A;  1V40 A;  3UEM A;  11GS A;  1DUG A;  1PGT A;  2OKA A;  8GSS A;  4K2X A;  4TXO A;  2C3N A;  4EO3 A;  4PQI A;  1UA5 A;  3C7M A;  4CY8 A;  4NMU A;  3F9U A;  3HHV A;  1HNA A;  2LS5 A;  1M2A A;  2NPB A;  5B7C A;  2FGX A;  5BRT A;  3HVV A;  2E2M A;  2YWM A;  1WOU A;  1AXD A;  2VOC A;  3PH9 A;  3I69 A;  2CZ3 A;  3U5R E;  2VL9 A;  1TK8 B;  1PL2 A;  1A8L A;  4V1A p;  2N5B A;  4KX4 A;  3HJO A;  4F0B A;  1TW9 A;  1PX7 A;  4EC0 A;  1SKS B;  2XC2 A;  5C04 A;  3L0H A;  2PPT A;  1GLP A;  1U6T A;  1WJK A;  3M9K A;  1NW2 A;  4X0X A;  4G0I A;  2HRK A;  4WBR D;  1PKZ A;  1SJZ A;  1UC7 A;  1JLV A;  1THO A;  5D73 A;  2P5R A;  5COH A;  2B5Y A;  1USB A;  2ES7 A;  2L4Q A;  3ERF A;  4MK3 A;  2RLI A;  1R5A A;  5D96 A;  2M46 A;  2C3Q A;  2WS2 A;  1GTA A;  4QL7 A;  5JCG A;  1AW9 A;  3KXO A;  1WIK A;  2HLS A;  2YWO A;  4RI6 A;  3DEX A;  3GV1 A;  1G0T A;  3HXS A;  3G7J A;  2OA7 A;  2RM6 A;  4XIH A;  4MAB A;  3O6T A;  3J7Y k;  1TI1 A;  4MH3 A;  1EV4 A;  4JR6 A;  4OCF A;  6GSV A;  5G31 A;  2R0G A;  1WE0 A;  3EVI A;  5HR3 A;  3I43 A;  1QMV A;  2LST A;  3QOU A;  2VM2 A;  1F37 A;  3HVX A;  4TVE A;  4POB A;  3D4T A;  3WD6 A;  2FWH A;  5ECN B;  1KTE A;  2REM A;  4G0K A;  2FA8 A;  1WMJ A;  1FOH A;  4EKZ A;  5JWO B;  1A8Y A;  3IDV A;  5B8B A;  2DIZ A;  3LFL A;  2EC4 A;  1SD8 A;  5ENU A;  1X9W B;  1AUC A;  2HE3 A;  1JZD A;  4IP6 A;  2K18 A;  5F0G A;  1MDI A;  4MJE A;  4WBJ A;  2ON7 A;  4IKH A;  3PPU A;  3CSI A;  4EXJ A;  3RHB A;  5KN1 A;  3J7Y b;  1GSU A;  3GST A;  3WGX A;  3M9J A;  4GTU A;  3APQ A;  4ILF A;  4P3Y B;  2YWI A;  1U3A A;  4XCS A;  3PGT A;  4Q5F A;  4Z7X A;  4ZB9 A;  2YWN A;  2NDO A;  4MLY A;  3TKS A;  2R4V A;  1KEB A;  3BCK A;  3KTL A;  3SWL A;  3GTU B;  5E4W A;  3HKR A;  1AQX A;  1S3D A;  1TI3 A;  3P8W A;  4IJI A;  4ZXG A;  3IPZ A;  3TRQ A;  3GL5 A;  4MH2 A;  5CRD A;  2V41 A;  2XPD A;  1EGR A;  5IMF A;  2QSI A;  6GSX A;  4POL A;  1GNE A;  2I1U A;  3UAP A;  2UZ8 A;  6GSU A;  2DKI A;  1ERV A;  1MD4 A;  1FB6 A;  1V2A A;  4KSM A;  1Z6N A;  2CX4 A;  4MJC A;  5ECH B;  3TOT A;  4F03 A;  4ZB8 A;  4LMW A;  2E0Q A;  4K7N A;  1B4P A;  14GS A;  3P90 A;  1FG4 A;  3R2Q A;  1QUW A;  1A0R P;  2CZ2 A;  4LLR A;  3IC8 A;  2ALB A;  3D6I A;  2R3X A;  2BJX A;  3GN3 A;  2CVB A;  1GUH A;  3KZQ A;  2JZS A;  4ID0 A;  2I9H A;  1SU9 A;  2X4A A;  2HSH A;  4PXO A;  2DJJ A;  1SK0 A;  2H1G A;  1XIY A;  4OFT A;  3HJP A;  3K8N A;  4IHU A;  2FA4 A;  3KMO A;  5D9V A;  1A23 A;  1J9B A;  4DSQ A;  5JCW A;  1IYI A;  1NSW A;  3LGC A;  2WGR A;  4EL1 A;  1YKC A;  4BVY B;  2J23 A;  4J56 E;  2GLR A;  4L0U A;  1Z7P A;  3ZZX A;  1O85 A;  5CRW A;  3GIX A;  2WFC A;  19GS A;  4K5R A;  2GZY A;  3GUR A;  3TJB A;  5D9X A;  1SL1 B;  1M99 A;  2H70 A;  1VRS D;  5G5F A;  1K0C A;  1M0U A;  3TJK A;  4L5O A;  3W8S A;  1XOA A;  2RUF A;  1HYU A;  4GF0 A;  4L8E A;  2A4V A;  4WR4 A;  1XWC A;  3HY2 A;  4O5R A;  5ECP B;  2OJL A;  2L6C A;  5A4U A;  5CAX A;  5ID2 A;  1OC9 A;  1A2L A;  4O5U A;  1GUM A;  3ZMK A;  1FB0 A;  3LWA A;  2IWT A;  5KEJ A;  5ECM B;  1OVN A;  1K3Y A;  4TXO B;  5FWG A;  4O32 A;  1ABA A;  3DD3 A;  2R0P A;  2H6Z A;  4NWY A;  1F9M A;  4NAX A;  2QC7 A;  3HJM A;  3PR8 A;  5B6M A;  2HRA A;  3D21 A;  3ISO A;  3UVH A;  4WET A;  2O89 A;  2LUS A;  4DSS A;  4MDC A;  1XFL A;  4BVX A;  1ML6 A;  4YKG A;  2A2S A;  4KCE A;  2B7K A;  3G7I A;  2B3S A;  4KND A;  2GDR A;  3DWV A;  2DLX A;  5CRG A;  2VL2 C;  3RHC A;  4K0N A;  1ZL9 A;  4PNF A;  2YOI A;  3GX0 A;  1MDK A;  5DCH A;  1ON4 A;  5FT3 A;  4N0V A;  3GUS A;  4KE3 A;  1W89 A;  1WPI A;  1PA3 A;  4IEL A;  1PMT A;  3DXB A;  2JU5 A;  5F05 A;  3UJ1 A;  5EPF A;  1GSQ A;  1GL8 A;  4TRX A;  4PNG A;  2CX3 A;  5ELG A;  2HFD A;  1GP1 A;  3NZN A;  4GRF A;  3LQ7 A;  1TRW A;  2FNO A;  3QAW A;  1H75 A;  3TRP A;  1CQG A;  2P31 A;  3DIE A;  4IGJ A;  2O87 A;  3GNJ A;  4PUF C;  4BA7 A;  4PUA A;  3ZIJ A;  5L71 A;  4ECC A;  5J9B A;  3QPM A;  4KW6 A;  2VAF A;  5H5R A;  4ZIL A;  2I3Y A;  1R5P A;  4V2M A;  4G10 A;  1X5C A;  4KA0 A;  4BWS A;  4HZ2 A;  1F3B A;  3EPT A;  4CW9 A;  5DCG A;  1T8E B;  1Z7R A;  3GL3 A;  3W8J A;  4FQU A;  1XW5 A;  2LEG A;  4IN0 A;  4HU9 A;  2H19 A;  2K8V A;  5HQP A;  2HSY A;  3TKQ A;  2CAQ A;  5G2Z A;  3L4N A;  2IL3 A;  4KUN A;  2H74 A;  4NHZ A;  1ERU A;  2C8U A;  7GSS A;  1TTZ A;  3KIJ A;  4Q5N A;  3CSJ A;  4RI7 A;  2YPM A;  2B1K A;  1J0F A;  3QDN A;  1QXH A;  2EIR A;  2L6D A;  3ZIT A;  3P2A A;  4MZB A;  4MF5 A;  4FO5 A;  3BJ5 A;  3IAM 2;  5H5Q A;  2RM5 A;  1YJ6 A;  4OO4 A;  5G30 A;  1MD3 A;  1A24 A;  4TOP A;  1YKA A;  2OAC A;  1MDJ A;  5CO3 A;  3HZ4 A;  1DBY A;  4XRA A;  3TUE A;  5GST A;  3TRX A;  2MMO A;  4G19 A;  1BAY A;  2PWJ A;  4PX1 A;  2HI7 A;  2XBQ A;  3IBH A;  1NHY A;  3CMI A;  2DMM A;  1KBN A;  18GS A;  3Q74 A;  1WP0 A;  1JFU A;  5J4U A;  5IO0 A;  3L9S A;  2LRN A;  2DJK A;  5F07 A;  2HRF A;  1LU4 A;  3BD2 A;  3M0F A;  3LXZ A;  2H66 A;  1B4Q A;  2I4A A;  3VWW A;  2HT9 A;  2VLV A;  3CYN A;  2LJA A;  1U3I A;  2X49 A;  2X8H A;  5DAK A;  4ECB A;  4QQ7 A;  1GSY A;  4HQZ A;  1OYJ A;  4KDX A;  1VF1 A;  3LEF A;  4FIW A;  5DBQ A;  4ECJ A;  4F82 A;  1GTI A;  1AC1 A;  5KOW A;  1YY7 A;  1TOF A;  3FMW A;  1YZX A;  3EUR A;  3FZ4 A;  1TRV A;  2MMA A;  1LBK A;  2B5X A;  2C0F A;  5ECS A;  4LL1 B;  3GKK A;  2YN1 A;  3EE2 A;  3F0I A;  3WYW A;  5F06 A;  1QGV A;  2YCD A;  4TR4 A;  3GH9 A;  1ZYN A;  2ON5 A;  2QA2 A;  2DML A;  3GH6 A;  1G6Y A;  2C0D A;  3IHG A;  2WZ9 A;  1O6J A;  2DJ2 A;  5AN1 A;  1XOB A;  1XWK A;  3UIW A;  3NOF A;  5D93 A;  2KUC A;  4JRR A;  1A0F A;  3MSZ A;  4LL4 B;  2WDU A;  1T4Z A;  4JU5 A;  2GT5 A;  2IMF A;  2R5G A;  3FZ9 A;  3F63 A;  4WR5 A;  1TRU A;  4RUV A;  16GS A;  3FK8 A;  1ZYE A;  2FY6 A;  1XXU A;  2H6X A;  3IHQ A;  2KHP A;  2HXK A;  5A5K A;  1CQH A;  2QA1 A;  2G2Q A;  5ID2 B;  1OC9 B;  5ECQ B;  2G0F A;  3VFI A;  2H0H A;  3I6A A;  2YNX A;  2IIY A;  3GMF A;  4USS A;  4JBB A;  1B9X C;  3E9J B;  5IM9 A;  3D4M A;  5AGY A;  1MTC A;  5G1K A;  1EOG A;  3VWX A;  4AF2 A;  1O7U A;  2HRN A;  4CDO A;  2TRX A;  5DJL A;  3AY8 A;  3KGK A;  1E6B A;  1GTU A;  1XWA A;  2IMD A;  2E7P A;  1PN9 A;  3TJG A;  2MMN A;  3FRC A;  1ZYQ B;  2H73 A;  13GS A;  5CRH A;  4DSS B;  2R6K A;  1K0N A;  4BVX B;  3DGQ A;  1Y6E A;  3ZFB A;  3TJJ A;  2V2G A;  2AHE A;  3P7X A;  1NHO A;  1A2M A;  2CAI A;  1XWG A;  4N0Z A;  5JCU A;  3QCP A;  3L9U A;  1M7T A;  4GLT A;  4I2T A;  1OC3 A;  3EWL A;  3HCZ A;  3LYP A;  1EOH A;  2WB9 A;  2NTO A;  1N2A A;  4V1A g;  6GSS A;  4PQH A;  2VLU A;  3GRX A;  4K8M A;  1EWX A;  1HQO A;  3ERW A;  1TK5 B;  1FVJ A;  4EF0 A;  5GAN D;  2VCT A;  1JLW A;  4KSO A;  4F2I A;  4XS6 A;  2GSR A;  4HU7 A;  5AIV A;  2K6V A;  2IFQ A;  1TJD A;  4EIP A;  1V57 A;  1URM A;  2HYX A;  4O7H A;  4LA1 A;  5AIX A;  3MDK A;  4A5P A;  5KN2 A;  2R2J A;  2H1D A;  2VL2 A;  4WKW A;  5CRE A;  2F3M A;  2FWF A;  2VCW A;  4MF6 A;  4YQM A;  1TP9 A;  5IMC A;  5CP1 A;  4ZBD A;  1V9W A;  3VI5 A;  5KN0 A;  5IO2 A;  5JWR B;  3GKN A;  2H76 A;  2FWG A;  5G5E A;  2PGT A;  2QKE A;  1G7E A;  1SJ6 A;  5IPH A;  2YP6 A;  1YEP A;  1XW6 A;  3QMX A;  4MCU A;  4OO5 A;  4EDZ A;  3CBU A;  1UN2 A;  1GTB A;  4ML1 A;  3IR4 A;  4ULX A;  1YQ1 A;  4WXT A;  1K3O A;  5IMV A;  3WT1 A;  1G6W A;  1Z3E A;  2GGT A;  1DE2 A;  1FAA A;  2F8F A;  3KP9 A;  4YQU A;  2R37 A;  1WRY A;  5DDL A;  3UVT A;  3TB2 A;  3ZL5 A;  4TXV A;  5D9T A;  3E3E A;  2H1B A;  4ML6 A;  4X4J A;  1BED A;  2MBS A;  3IOS A;  3KEB A;  4XTS A;  4K6X A;  5DVB A;  1GSD A;  3A2X A;  4AJ6 A;  5JWQ B;  2HZF A;  1XVW A;  4K9Z A;  2V1M A;  4XHM A;  2KP2 A;  5DQY A;  5A4V A;  3KMN A;  4MPF A;  2IMK A;  2VM1 A;  3HYP A;  3L9V A;  5E59 A;  1EEM A;  2MZC A;  3ZRD A;  4ZBA A;  3ZTL A;  3UOM A;  3C1S A;  3QR6 A;  2V32 A;  3IE3 A;  5HFG A;  3TCO A;  2X8G A;  5GSS A;  5HFI A;  3ZRE A;  5ECO B;  3KM6 A;  3TKS C;  1X9M B;  1OC8 A;  5DAK B;  2PN8 A;  3FKF A;  2GSS A;  5GAP D;  1ZCP A;  4MJB A;  3UMA A;  1ERW A;  5ECI B;  3U6V A;  4I8B A;  4CHS A;  2VLT A;  2H71 A;  3WT2 A;  5EY6 A;  2YV9 A;  2NVL A;  3CRT A;  1R26 A;  3ED3 A;  4DVC A;  3R3E A;  4L0W A;  4OMV A;  2DKH A;  4EE0 A;  2H30 A;  2D2Z A;  2DSA A;  2AUV A;  3A2V A;  3ZFL A;  5IMA A;  5ABR A;  2C0E A;  1BQ7 A;  4PGT A;  3HVS A;  4TR1 A;  2FWE A;  4MA9 A;  3VPQ A;  3O3T A;  5DJM A;  2O7K A;  3GYK A;  3F6D A;  5IOX A;  4OFN A;  2CV4 A;  4K7I A;  1PQN A;  3FYG A;  2XBI A;  3CTF A;  2VO4 A;  1BYE A;  5KOX A;  4ZL8 A;  2H0G A;  2K8S A;  3QFA C;  4WEY A;  2PBJ A;  5EVO A;  4RQR A;  3Q19 A;  1T3B A;  4XS4 A;  2LV3 A;  4YQV A;  4HZ4 A;  4MPG A;  3KJY A;  5A4W A;  2PVQ A;  5IPG A;  1FHE A;  3TGZ A;  1NM3 A;  4FH8 A;  2C0G A;  4Q5Q A;  1G7O A;  3C73 A;  4TW5 A;  3APS A;  4Z2R A;  1Q4J A;  1XPV A;  4TR3 A;  4ZB6 A;  2IJY A;  4NXI A;  2MMZ A;  2M80 A;  1W4V A;  4V2L A;  1GUL A;  1SK2 A;  10GS A;  2CT6 A;  3VWU A;  4HJM A;  3F4S A;  1J08 A;  4GST A;  1JZR A;  2JL4 A;  4JED A;  2VD0 A;  3RPP A;  1THX A;  3A5W A;  5J5N A;  1XBS A;  1O73 A;  2CVK A;  1PKW A;  2RII A;  2H72 A;  3VUR A;  4DEJ A;  2O8V B;  4QL9 A;  2JSZ A;  1HD2 A;  2RUE A;  5KN3 A;  1I9D A;  4K2D A;  3FR3 A;  2C4J A;  1GUK A;  2H75 A;  3V1W A;  2B6M A;  2TIR A;  1DE1 A;  3IAS 2;  5IOW A;  4GSS A;  1H4O A;  2LJK A;  2X8C A;  3DVW A;  3KH7 A;  2LRT A;  3LYK A;  2VL3 A;  4BL7 A;  2LKU A;  4OCE A;  2TRC P;  1SL2 B;  4POK A;  17GS A;  5J41 A;  3IV4 A;  2K9F A;  1FW1 A;  3BCI A;  1ZMA A;  3BOA A;  1F3A A;  4ISD A;  4XRD A;  3IC4 A;  3IXR A;  4O92 A;  2IFQ B;  2GSQ A;  2CA8 A;  2MYG A;  2HNL A;  5INY A;  1AAZ A;  1IYH A;  4NV2 A;  4PQ1 A;  5CNW A;  1TRS A;  4E8E A;  3VLN A;  2KOK A;  4HUA A;  3N5O A;  3LW9 A;  3FZA A;  3C8E A;  3ZML A;  3FR6 A;  1VF4 A;  4K7O A;  2FLS A;  2VUP A;  1TDI A;  1XVQ A;  1ZOF A;  3H8Q A;  4D73 A;  4H86 A;  4OWY A;  3GA4 A;  4AJ7 A;  5AIS A;  1MEK A;  1F2E A;  3S9F A;  1O8W A;  1WWJ A;  2WUL A;  1X0R A;  3TJF A;  4L5L A;  1TU7 A;  5BMU A;  3MWH A;  4GXZ A;  2ZUP A;  3RBT A;  4OD7 A;  1HNC A;  3WGE A;  3F4R A;  4F0C A;  6GST A;  3F3R A;  2PU9 C;  4NHW A;  2YZU A;  1Z9H A;  2P0G A;  3H1N A;  1JHB A;  4GWR A;  4N11 A;  1SYR A;  2YJ7 A;  3UAR A;  1SJI A;  2C1Y A;  1ZZY A;  4Q5R A;  4NPB A;  1T7P B;  1Q98 A;  4HEA 2;  5HR2 A;  1K3L A;  2LQO A;  4AJ8 A;  3D22 A;  2HZE A;  1ZYP A;  4FYB A;  1ILO A;  1AIU A;  1S3A A;  3ZYW A;  2HSM A;  4V2N A;  2KLX A;  1PL1 A;  2JZR A;  3GFK A;  4ZBB A;  2IME A;  1SYX A;  1S3C A;  2B1L A;  2OE3 A;  3GKM A;  3LXT A;  3GX8 A;  2LQQ A;  4DSR A;  3RAZ A;  2PVO C;  1EGO A;  4E8H A;  1M2D A;  3TKR A;  4WF5 A;  4GSN A;  4HQS A;  4N30 A;  1SKW B;  3IRA A;  1E2Y A;  4LMV A;  2WJU A;  2YZH A;  2OBK A;  3D0Z A;  3DML A;  4JZQ A;  5J9C A;  2DBC A;  4TKY A;  1RK4 A;  5HR0 A;  2YV7 A;  4ZL7 A;  3EIN A;  1GNW A;  2GZP A;  4ZL9 A;  4RQX A;  4YAP A;  4I6X A;  2LNS A;  1JZW A;  2O85 A;  4KH7 A;  1VF2 A;  4KAE A;  4PUR A;  3Q18 A;  1OE7 A;  2H6Y A;  3VI7 A;  3HDC A;  2JAD A;  1OKD A;  5DQS A;  5D8I A;  3IK7 A;  3LG6 A;  2GZZ A;  2PER A;  3HZ8 A;  1TU8 A;  3CTG A;  4X1U A;  1YF0 A;  3IA1 A;  2WRT A;  1V58 A;  2GQK A;  3A2W A;  4TR1 B;  3VWV A;  1T4Y A;  2H01 A;  3QAG A;  5D9W A;  3H79 A;  1BJX A;  3KD0 A;  3ZVJ A;  4ACS A;  1FVK A;  1RW1 A;  1SEN A;  4G9H A;  1XZO A;  2JAC A;  3UBK A;  2X99 A;  1Y25 A;  2ZNM A;  4BWQ A;  2GQM A;  2YJH A;  2OBI A;  1F6M C;  4K5S A;  4JR4 A;  5ECL B;  2P5Q A;  1EEJ A;  4XS4 B;  4MP4 A;  2L4C A;  3MNG A;  2FCH A;  3DYR A;  1ZGN A;  3CSH A;  4IW9 A;  4JE1 A;  4EVM A;  3BBY A;  1SL0 B;  1X9S B;  2JZT A;  2VD1 A;  2LJR A;  4MMM A;  1EP7 A;  4YH2 A;  1RQM A;  1Z5Y E;  5IIZ A;  2BMX A;  5ELA A;  1U88 A;  2LRC A;  1FOV A;  4KF9 A;  2LTK A;  3CXG A;  4HOJ A;  4TR0 A;  1B9Y C;  1R7H A;  3GHA A;  1M9A A;  5DAL B;  4I2U A;  4O5Q A;  3A3T A;  1GSF A;  4YKF A;  2AV4 A;  3VK9 A;  2E2G A;  12GS A;  2GST A;  1GWC A;  3EU3 A;  2IMI A;  1ACV A;  2M72 A;  4IBP A;  2PMT A;  3ERG A;  4HS1 A;  2EIO A;  3DRN A;  2GT6 A;  4MZW A;  5EL8 A;  1DSB A;  1K0M A;  3FY7 A;  4J57 E;  1UVZ A;  4Z2T A;  1LJR A;  4TN8 A;  5F8B A;  2B5E A;  2AJQ B;  4KDU A;  1EV9 A;  1XW9 A;  3G9B A;  3QFB C;  1QFN A;  3KCM A;  4AGS A;  4YAV A;  1T00 A;  2QGV A;  1XWB A;  1AQV A;  3QD9 A;  2FUG 2;  2VCV A;  1PD2 1;  1B48 A;  3FR9 A;  4BL7 B;  22GS A;  3GSS A;  4K0G A;  3F3Q A;  2LNT A;  3IK9 A;  2C80 A;  1VF3 A;  4ICY A;  3EU4 A;  3MIX A;  1GRX A;  1C72 A;  2GQL A;  3QAV A;  3FW2 A;  3GKX A;  3L78 A;  20GS A;  3ME8 A;  3H4K A;  4HJ2 A;  4GQC A;  4F9Z A;  4KDY A;  2L5O A;  4POM A;  4MJA A;  4ZIJ A;  5LD0 A;  4Z2U A;  4MNN A;  1PX6 A;  2DC5 A;  5IQY A;  2AYT A;  4KB3 A;  1TK0 B;  2CQ9 A;  2JSY A;  4X43 A;  1V98 A;  4IQ1 A;  3LSZ A;  3C71 A;  4GQF A;  1K0D A;  5FHI A;  4PTS A;  5CYY A;  2V6O A;  3MYD A;  1O81 A;  1PRX A;  2Z9S A;  1M2B A;  3HA9 A;  1BX9 A;  2IPA A;  1B8X A;  3FZ5 A;  1U87 A;  2PUK C;  4D73 B;  2R0C A;  1GSE A;  4K1F A;  3ME7 A;  3DKS A;  3UL3 A;  4IJ3 A;  3LJR A;  4HDE A;  5H5S A;  4XS1 A;  3D5J A;  5ECK B;  5HFK A;  2DJ3 A;  5ECR B;  1ERT A;  2VIM A;  1FO5 A;  1YDK A;  4KGI A;  4WF4 A;  1OKT A;  2OAD A;  5B6N A;  1EP8 A;  3WGD A;  3ZVJ D;  2GVP A;  3APO A;  1TKD B;  1X5E A;  1OE8 A;  3O76 A;  3HD5 A;  5B8A A;  4J2F A;  2EIQ A;  4OFM A;  6GSY A;  3CRU A;  1KNG A;  2V6K A;  2OE1 A;  2ZCT A;  3TKP A;  3NIV A;  3SBC A;  1OAZ A;  1VGL A;  2AAW A;  5LCZ A;  1YF1 A;  2HZE B;  3GTU A;  2DJ0 A;  5GZZ B;  3F4T A;  2XPE A;  4N10 A;  4EDY A;  2VCZ A;  3TKS E;  2A2R A;  2H1A A;  2KP1 A;  3KP8 A;  5LNK e;  4I97 A;  1EZK A;  2F8A A;  1SD9 A;  2J9H A;  3ZIV A;  4G2E A;  1HNB A;  5IMD A;  3VPT A;  4KCA A;  1R4W A;  3M8N A;  3RDW A;  4NV5 A;  2N5F A;  4MZC A;  1SK1 A;  4IS0 A;  4EIQ A;  2L59 A;  5DAL A;  2GS3 A;  1QQ2 A;  3C1R A;  1JZO A;  2X64 A;  2H0I A;  4ECI A;  3DVX A;  3I9V 2;  5J3R A;  2AB6 A;  2H8L A;  2A4H A;  3H93 A;  3G7Y A;  2C3T A;  3M1G A;  1K0A A;  3FEU A;  3UBL A;  2A2P A;  4IVF A;  2OE0 A;  1ST9 A;  3M3M A;  1GH2 A;  2WCI A;  1K0O A;  4CY6 A;  2I81 A;  2NBS A;  1A2J A;  4IP1 A;  2VCQ A;  1GSS A;  3KTB A;  1BG5 A;  3E0U A;  4EUY A;  1AQW A;  1GLQ A;  4MF7 A;  4G0L A;  2CVD A;  2FHE A;  2YAN A;  4BPY A;  1PN0 A;  2F9S A;  2DJ1 A;  3A5I A;  6GSW A;  3F8U A;  3ZLP A;  3PIN A;  3US3 A;  1T1V A;  9GSS A;  4BVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...