1FOVA

Glutaredoxin 3 from escherichia coli in the fully oxidized form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
ANVEIYTKETCPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGRTTVPQIFIDAQHIGGYDDLYALDARGGLDPLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords GLUTAREDOXIN 3
publication title NMR structure of oxidized glutaredoxin 3 from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 26
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2000-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1fovA00
4JZQA 3KMOA 5D9XA 1Q98A 2C0DA 4OCEA 2LRCA 3FYGA 5G5FA 5J5NA 1G7OA 3UBLA 4YAVA 1Y25A 4ZIJA 3CSJA 2GT5A 2MZCA 1GNWA 4NV5A 2IMFA 3A2XA 5IMCA 2P0GA 4PXOA 1ZOFA 4N11A 2L4CA 5HQPA 2NBSA 2IFQB 3TRPA 1SENA 1DE2A 4P3YB 3ERFA 2O7KA 3ZFLA 4HZ2A 4IBPA 2DJ0A 4DSSB 2YV9A 3WYWA 2A2RA 3DKSA 3GIXA 3FZAA 4K0GA 1EGOA 3CBUA 4LLRA 3TKPA 2R2JA 4KDYA 1F37A 2LKUA 1XWGA 3GUSA 1B4QA 2L5OA 4QL7A 3IE3A 3TRQA 1XW6A 1GH2A 1Z6MA 2LUSA 1M2BA 3HJMA 2H75A 4ILFA 1FVJA 3QCPA 4TR1A 1OC8A 4ECJA 4DSQA 5J41A 3CMIA 2GZPA 4AJ8A 3H4KA 2AB6A 2JL4A 3NIVA 1EV4A 2DJKA 5AN1A 1MEKA 2WZ9A 1NHOA 4OMVA 3EYTA 2M80A 2XC2A 1ZYQB 1TK0B 1O8WA 2H6YA 1ERUA 4TR3A 2O8VB 3D0ZA 3CYNA 5HR2A 3RDWA 1VF3A 3IK7A 3H79A 3D4MA 5HR1A 4IHUA 1ABAA 2FWGA 3F63A 3HKRA 1ERTA 3F3QA 5GZZB 2DLXA 5HR3A 2GQMA 3FKFA 4IJIA 4MZBA 4OFNA 3D6IA 2H1AA 5DJLA 4GTUA 2X8CA 2CVKA 11GSA 3I69A 1LBKA 2O89A 1TXXA 3GH9A 1U87A 2JU5A 5IMAA 4WKWA 2YV7A 4MPGA 1TDIA 1J9BA 1Z6NA 1KTEA 5HFIA 4YQUA 2H1BA 5ENUA 3HZ8A 2WCIA 2GSTA 3VLNA 4EL1A 3I43A 3RPNA 4GF0A 4YAPA 3J7Yk 3SBCA 4YQVA 1YKCA 1R7HA 1XVQA 1YEPA 2IN3A 2YPMA 2RUEA 3FEUA 2CZ2A 1OKDA 1OC9B 1TJDA 5J9CA 4FO5A 1A23A 4IQAA 4ZL9A 2V6OA 4PQ1A 2Z9SA 4KSMA 3UEMA 3TJBA 1V57A 1F9MA 5ELGA 6GSSA 2C0FA 4OO5A 1XW9A 4F0CA 1ZYEA 1EOGA 3VK9A 4WBRD 1GRXA 2CVBA 2HZEB 3GTUB 5LD0A 1AQVA 4BL7A 3G7JA 4OFTA 2HT9A 1QMVA 3ZZXA 1JHBA 3ZREA 5HR0A 3MNGA 3FZ9A 4F82A 1T3BA 2KHPA 3TJFA 2GQLA 2HZFA 3RHCA 1OE8A 4FH8A 3WGXA 3P90A 2AHEA 3KJYA 2C1YA 1TU7A 2MBSA 3IDVA 1QQ2A 1UVZA 1IYIA 1XVWA 1AIUA 5G1LA 4NHWA 1XOBA 2R6KA 3TKRA 4YQMA 2YCDA 4AJ6A 2HLSA 4EO3A 3DRNA 3QPMA 1PGTA 1DE1A 3KH9A 1Z3EA 3TGZA 2CZ3A 3EWLA 2C0GA 5ECLB 1H75A 5C00A 4TN8A 1SU9A 4V1Ap 4DVCA 3IBHA 2GGTA 3E3EA 2K8SA 3F4SA 4MZWA 5ECPB 2CAQA 2MYGA 4MH3A 2V2GA 2FCHA 1EGRA 1JZDA 1Q4JA 3F3RA 3C1RA 1EV9A 5A4VA 3QOUA 2DIYA 3GKKA 5ECQB 3HD5A 3KD0A 4GRFA 3A2VA 1PD21 5DALA 2B5XA 1K0BA 3EMXA 5AIXA 2XBQA 7GSSA 2VLTA 3DMLA 2G2QA 2C8UA 1B9YC 1KNGA 4J57E 3F4TA 3S9FA 2LRNA 3CRUA 2YWNA 3QFAC 5ID2A 1F3BA 4BVXA 4XHMA 5IOWA 3Q19A 2V1MA 2FNOA 5IO0A 5CP1A 5EPFA 2I81A 4MZCA 4TR0A 2V41A 3HVVA 5B6MA 1V58A 5B7CA 3M1GA 4MLYA 3DXBA 4AJ7A 4KNDA 4JRRA 1FHEA 4GLTA 3P2AA 1XZOA 4MH2A 5ECHB 4XS4A 4GQCA 4MJEA 2GSQA 5G31A 18GSA 2M46A 3ZYWA 3FY7A 1G6YA 4OO4A 3GX0A 3KZQA 2H19A 3ZVJD 5J4UA 3RPPA 2J9HA 6GSXA 4IJ3A 2DJ3A 3TUEA 3BCKA 2H0HA 2I4AA 3I9V2 4ZXGA 3H8QA 2DSAA 1T00A 1EWXA 1OVNA 2J23A 2OACA 3QD9A 4PGTA 4IQ1A 3WT1A 3RHBA 1AUCA 1N8JA 4PURA 1HNAA 22GSA 2GSSA 5A5KA 2EC4A 1TKDB 2IPAA 4O32A 5CO3A 3IV4A 2ON7A 3TJGA 3TKSA 1PN9A 3EVIA 5LCZA 1F3AA 2MMNA 2GQKA 1XPVA 1SL0B 1TW9A 2C3TA 1JLWA 2JACA 1YZXA 3O6TA 1GUMA 1TU8A 5EL8A 1GUHA 4GSTA 5A4WA 4D73B 1JFUA 2FLSA 5IMVA 3ZFBA 2FWHA 3QAGA 1U3AA 4WEYA 1Z7RA 2F9SA 1OAZA 2VOCA 5IMFA 4HUAA 1USBA 1RK4A 4IW9A 5E4WA 2LNTA 3PINA 2HXKA 4RQRA 4HOJA 1F6MC 3DD3A 4Z7XA 4RUVA 2I1UA 4IELA 4Q5FA 1TK8B 1ERWA 1V98A 3APQA 1BX9A 1Z7PA 2K18A 5FHIA 1QK8A 1K3YA 4ZBDA 3IR4A 3VI5A 2FA4A 2OE3A 1SK1A 3HDCA 3QAWA 3FR9A 3W6GA 4KX4A 1NW2A 1YEXA 13GSA 4HZ4A 1THXA 1V40A 5ECSA 2VCTA 3LJRA 1A0RP 4I2TA 5L71A 10GSA 2TRXA 1OKTA 3ZL5A 3RAZA 5B8BA 3LEFA 2L57A 2FA8A 2XPDA 5EY6A 2KP2A 2DMLA 4TXVA 4I2UA 2CQ9A 3OR5A 4BWQA 3NOFA 3Q18A 4TR1B 2MMOA 3HCZA 4JE1A 5F8BA 1JZWA 3LXTA 2GSRA 1V2AA 3KEBA 4O92A 1YJ6A 3KMNA 1K0DA 1X5DA 4HQZA 3W8JA 1TTZA 2N5FA 3M8NA 3ZIJA 5CYYA 1BEDA 2AV4A 1TRWA 2OE1A 2QGVA 5AISA 1X9SB 2RIIA 5KN3A 2OBIA 4ACSA 2A2SA 3UAPA 3H93A 1DUGA 1N2AA 1VRSD 3M0FA 4TR4A 2H0GA 4FYBA 3EURA 3TCOA 2MMZA 4XS1A 3UBKA 1TRUA 1SD8A 1JZRA 3N5OA 2CX3A 4IGJA 2DJ1A 3ZMLA 5J3RA 2KUCA 2YOIA 2VLVA 4IP6A 3R2QA 4NV2A 1MDIA 1ACVA 5CRWA 1OYJA 1BJXA 3DGQA 3F9UA 4MPFA 5CREA 1G6WA 3UJ1A 4XRDA 1SKSB 2KOKA 3LSZA 3D5JA 3IOSA 4MP4A 3VWUA 3GX8A 1T1VA 2JZTA 2LV3A 4ZB9A 3VI7A 1YQ1A 4LMVA 5FT3A 3UL3A 2IIYA 1T8EB 2V6KA 3ME8A 1Z9HA 2HSHA 2E2GA 2E2MA 2ES7A 1S3AA 5F07A 5IIZA 4POLA 2D2ZA 1K0CA 5D9WA 4J2FA 3LG6A 3GSTA 4L0WA 4XCSA 3QAVA 4WF5A 4WBJA 2VM1A 2DJJA 3P8WA 3L4NA 4EC0A 3L9UA 4EE0A 4ZB6A 4TOPA 2H6ZA 2FD3A 2FY6A 2CVDA 3VPTA 2VM2A 2VO4A 4MF5A 1GUKA 4KW6A 2H71A 3IRAA 4ECBA 2GS3A 2H0IA 5G2ZA 3HHVA 3U6VA 2QKEA 4K2DA 3L78A 4NHZA 1UN2A 1XWCA 1R5AA 3FHKA 4WF4A 2P5RA 1YY7A 3GYKA 3L9SA 5H5RA 2LJRA 1TRVA 1WRYA 1XWKA 5D9TA 2PMTA 2VD1A 5INYA 1R26A 5HFKA 1VF4A 3DWVA 3M3MA 4MJCA 3IK9A 1GTBA 1PSQA 1AAZA 2RM5A 4I8BA 3LWAA 3M9KA 4POBA 1FB6A 2E0QA 5ELAA 2LJAA 3DVXA 2LQQA 1GSQA 1B48A 6GSUA 3QMXA 3UMAA 4HS1A 19GSA 4XTSA 2X8GA 1VF1A 4ECCA 1SL1B 2LSTA 4V2NA 4ID0A 3D21A 3DEXA 14GSA 2H01A 4L5OA 3LQ7A 4RI7A 4TRXA 2XHFA 1ST9A 2CT6A 2ZUPA 5ECRB 5HFGA 1K3LA 1FAAA 1WPIA 1M7TA 2B1KA 2HSYA 2PVOC 2AAWA 3IPZA 3GRXA 3BJ5A 4X1UA 1GTUA 1SYRA 2PU9C 5D8IA 4IKHA 2LQOA 5DALB 5AGYA 2B6MA 1WWJA 1BAYA 3UARA 4WR4A 3FW2A 3F4RA 3KTBA 4N10A 3E9JB 5J9BA 3KP8A 4XS6A 1ZZYA 2YZUA 3VURA 3CTGA 2GT6A 5IOXA 1PQNA 5ID2B 4G10A 2CA8A 4L5LA 4MF7A 4BA7A 2H30A 1XW5A 4KE3A 2HI7A 3BD2A 1SJZA 4HEA2 1S3DA 1HNCA 2QC7A 3HJPA 4K8MA 2PERA 2WULA 1ZMAA 1B4PA 1XWAA 5DAKA 1QFNA 5DQSA 2GZYA 2FGXA 5KEJA 1GTIA 3L0HA 5GAND 3QDNA 3EC3A 1GLQA 1PX6A 3GL3A 2CV4A 5COHA 3UIWA 4XS4B 1LJRA 4EKZA 1EEJA 3LGCA 1Z5YE 1HQOA 4Q5RA 2NTOA 1PL1A 1EZKA 2YJ7A 5CRDA 3WGEA 1F2EA 5IMDA 4LMWA 2K9FA 1ZL9A 1FO5A 4WXTA 2LTKA 1ILOA 2IWTA 4G9HA 3O76A 2LRTA 1GNEA 1BQ7A 2WGRA 4MMMA 4NPBA 1I9DA 3F0IA 1A8LA 1RQMA 2IMKA 2G0FA 3GA4A 3EMPA 3D4TA 2K8VA 3KTLA 2EIOA 3ZTLA 4NAXA 2I9HA 2HRNA 5ECKB 4EXJA 2KP1A 3L9VA 2YJHA 4GCIA 3GNJA 4ECIA 5DDLA 3HVXA 1T7PB 3IAM2 2VUPA 3IC4A 3FRCA 1J0FA 4MJBA 1XOAA 4GSNA 1S3CA 2ALBA 4KH7A 1M99A 4IS0A 2ZNMA 1SD9A 1YKAA 2LJKA 2NPBA 3FZ4A 5B8AA 1UC7A 4IN0A 12GSA 2FHEA 1U6TA 2BTOT 1A0FA 2OKAA 2F51A 1G7EA 1I5GA 3G7YA 4MK3A 5JCWA 3IHQA 3UVTA 1GSUA 2IL3A 3DVWA 2GZZA 3TOUA 2GTUA 5JWRB 1XCCA 3PR8A 5GAPD 5JCGA 2DC5A 5IO2A 3TOTA 4EDYA 2V32A 1G0TA 2OBKA 3C7MA 4ISDA 4O5RA 3WGDA 1X5EA 1GTAA 3PGTA 4NXIA 2NDOA 2OJLA 2FUG2 1FB0A 2E7PA 4GQFA 1FVKA 4MABA 5IMZA 4AF2A 4DEJA 1EP7A 1C72A 2O85A 2IMEA 1RW1A 2P5QA 2N5AA 4Q5NA 3ZVJA 1BYEA 3CTFA 4XRAA 1M2AA 2OADA 2A4VA 4AGSA 1TI1A 4E8HA 2K6VA 4TXOA 2LEGA 3RBTA 2X8HA 4EDZA 3AY8A 8GSSA 1JLVA 4KSOA 1EOHA 1OC3A 4RQXA 4K6XA 3C71A 3ERGA 16GSA 2P31A 2H70A 5KN1A 1WIKA 2DBCA 2H73A 3HZ4A 1T4ZA 2QSIA 2R3XA 4PUAA 4X0XA 1WJKA 5JCUA 3NZNA 1TRSA 1YDKA 3HA9A 3H1NA 4F03A 4YH2A 3TRXA 2HE3A 3A5WA 1SJIA 2YANA 2MMAA 2VL2C 2JSZA 1XBSA 2L6CA 3GSSA 2JSYA 2YP6A 2C80A 1PL2A 1V9WA 1U88A 4H86A 1MDKA 5ABRA 1OE7A 3U5RE 1FG4A 3ZLPA 20GSA 2VL9A 3LYPA 2H74A 4CDOA 4BWSA 1O85A 4CW9A 3GKMA 4CHSA 2VCXA 5JWOB 1VGLA 2F8AA 3W8SA 1U3IA 2X64A 1WOUA 3TDGA 1K3OA 4KCEA 1GP1A 5G5EA 2PBJA 3KH7A 3A3TA 2JZRA 1XXUA 3E0UA 1WP0A 3F6DA 2O87A 2TIRA 2B7KA 1PKZA 4BPYA 2ON5A 1BG5A 2C3QA 5ECOB 3SWLA 5AIVA 1X9MB 2DMMA 2XPEA 3VWVA 1Y6EA 4V2LA 3FK8A 2EIRA 3Q6OA 4GWRA 1ON4A 4TKYA 3GMFA 5D73A 4OD7A 3TJKA 4N30A 5CRHA 3VFIA 3UVHA 4PNFA 3ZIVA 6GSYA 3LXZA 3ZITA 1SL2B 1M2DA 1GSEA 1NHYA 2WJUA 1AC1A 2IFQA 2VCWA 4OWYA 4PQHA 2RM6A 4JBBA 3K8NA 4GSSA 3TB2A 4JR6A 1QGVA 4DSSA 2X99A 4KDUA 4MA9A 1KBNA 5F0GA 2RUFA 1X5CA 3GH6A 1K0MA 4V2MA 1AW9A 3APSA 2R37A 3G9BA 2HYXA 4K7NA 2H72A 5D93A 3HY2A 2WS2A 2WDUA 2L4QA 2GLRA 3GFKA 17GSA 3IA1A 5IQYA 3A2WA 3DYRA 1NM3A 2KLXA 2YWMA 4K1FA 1T4YA 4K0NA 1A2JA 2B3SA 4MDCA 5D9VA 2DJ2A 2PPTA 1EEMA 1O6JA 5GSSA 5G30A 1M0UA 3TKSE 3GV1A 5LNKe 2H76A 2RLIA 3GURA 2VL3A 2L6DA 4TVEA 1R4WA 1PX7A 1WE0A 5CRGA 5C04A 3GL5A 2BJXA 4Q5QA 3ZMKA 2IMDA 2PUKC 1XFLA 5FWGA 4POKA 3WD6A 1E6BA 2N5BA 1SYXA 4KCAA 2LS5A 4XIHA 1KEBA 1PKWA 3MDKA 2NVLA 2C4JA 4KUNA 4OFMA 1THOA 4HU7A 2B7JA 3LYKA 5F06A 5A4UA 4HQSA 3UOMA 3BCIA 4I5QA 1R5PA 1J08A 3GKXA 3WT2A 3I6AA 3BBYA 2IMIA 3HVSA 1SKRB 2VD0A 1AXDA 4PX1A 2L5LA 2YNXA 5DVBA 2VCQA 3P7XA 4JR4A 2CAIA 2OA7A 3C8EA 3GHAA 5D96A 3ME7A 5DCGA 4ZL8A 2HRFA 2M72A 1A24A 1O81A 3ZRDA 1WMJA 1OC9A 2HNLA 5DAKB 1FOVA 3HJOA 2DIZA 2VLUA 2WB9A 1GLPA 1UA5A 2F8FA 2YWOA 1TI3A 2LNSA 1MTCA 2C0EA 2VCZA 4QQ7A 3CRTA 3G7IA 4ML6A 2YZHA 1ZGNA 5CNWA 1GULA 2PVQA 4F0BA 2FWEA 1HYUA 3CXGA 2H8LA 2HZEA 3GTUA 3LFLA 5ECIB 2JZSA 3VWWA 2ZCTA 1URMA 6GSTA 2C3NA 6GSWA 4MF6A 4G2EA 3F6FA 3KP9A 5JWQB 5IM9A 4PNGA 4TW5A 2R4VA 5DQYA 2IJYA 3VPQA 5H5QA 4KB3A 5IPGA 4L8EA 1VF2A 1AQXA 2PWJA 1CQGA 5EVOA 1GL8A 1A2MA 3QFBC 5DCHA 4NWYA 5F05A 1DSBA 3GKNA 4ULXA 1O73A 3EINA 4POMA 4QL9A 3VWXA 3IXRA 1EP8A 4J56E 4KA0A 3PH9A 1HD2A 3DIEA 1IYHA 2VIMA 4JU5A 3KIJA 5E59A 1M9BA 1JZOA 1O8XA 3KXOA 4HJ2A 1A2LA 2TRCP 3FR6A 4K7OA 3O3TA 5CAXA 5ECMB 2BMXA 1GWCA 2H6XA 1E2YA 3CSHA 4ML1A 2YWIA 1GSSA 2WRTA 1XIYA 4N0ZA 4ZILA 3LORA 3ED3A 6GSVA 4E8EA 3FZ5A 5B6NA 4FYCA 3EU3A 4GXZA 5ECNB 2EIQA 1K0AA 1B8XA 2H66A 5DJMA 1GSFA 3MAKA 5KN2A 1W4VA 3ERWA 3BOAA 1SK2A 1AQWA 2H1GA 1H4OA 2B1LA 3TKQA 3APOA 3QR6A 3EE2A 1O7UA 3KCMA 4EF0A 4L0UA 1HNBA 1MDJA 4LL1B 3IAS2 1YF0A 4K9ZA 1X0RA 3JCML 3KGKA 2PGTA 1NSWA 4FYUA 4BVYA 2B5YA 1FW1A 4WETA 3TJJA 2B5EA 3ISOA 3CSIA 2MBTA 4G19A 3US3A 4TXOB 5DBQA 4K7IA 4KDXA 4ZB8A 1MD4A 2JADA 1YF1A 3HYPA 3C73A 4JEDA 4MCUA 2OE0A 2F3MA 3Q74A 5KN0A 1W89A 3EU4A 4EVMA 3FR3A 3F8UA 2HFDA 3KM6A 2VCVA 1QUWA 4OCFA 3MSZA 5H5SA 1TOFA 2AYTA 2VL2A 2WFCA 4I6XA 2AJQB 4ZBAA 1K0NA 4F2IA 1LU4A 4PQIA 1CQHA 1M9AA 3MWHA 9GSSA 1PA3A 2PN8A 4HI7A 4NMUA 1XWBA 2XBIA 1GSYA 4O7HA 1ML6A 2H1DA 4KGIA 2I3YA 4PUFC 2FWFA 4ZBBA 1TK5B 1DBYA 4HDEA 2REMA 4ZL7A 3N9JA 4MJAA 2VAFA 4F9ZA 3C1SA 1SJ6A 1PRXA 1SKWB 4LL4B 3J7Yb 2R5GA 4FIWA 1K0OA 1B9XC 2CX4A 4IP1A 4DSRA 4RI6A 3V1WA 4I97A 4N0VA 1PMTA 1X9WB 4KAEA 1SK0A 4IVFA 3TKSC 1ZCPA 2L59A 1A8YA 3D22A 4WR5A 2AUVA 3GN3A 2YN1A 4HU9A 1MD3A 4LA1A 4EUYA 4HJMA 4D73A 5G1KA 1GSDA 3M9JA 2GVPA 4V1Ag 4X43A 5IPHA 1ERVA 1TP9A 2GDRA 1QXHA 3HXSA 5GSTA
chains in the Genus database with same CATH superfamily
4JZQA 3KMOA 5D9XA 1Q98A 2C0DA 4OCEA 2LRCA 3FYGA 5G5FA 5J5NA 1G7OA 3UBLA 4YAVA 1Y25A 4ZIJA 3CSJA 2GT5A 2MZCA 1GNWA 4NV5A 2IMFA 3A2XA 5IMCA 2P0GA 4PXOA 1ZOFA 4N11A 2L4CA 5HQPA 2NBSA 2IFQB 3TRPA 1SENA 1DE2A 4P3YB 3ERFA 2O7KA 3ZFLA 4HZ2A 4IBPA 2DJ0A 4DSSB 2YV9A 3WYWA 2A2RA 3DKSA 3GIXA 3FZAA 4K0GA 1EGOA 3CBUA 4LLRA 3TKPA 2R2JA 4KDYA 1F37A 2LKUA 1XWGA 3GUSA 1B4QA 2L5OA 4QL7A 3IE3A 3TRQA 1XW6A 1GH2A 4ICYA 1Z6MA 2LUSA 1M2BA 3HJMA 2H75A 4ILFA 1FVJA 3QCPA 4TR1A 1OC8A 4ECJA 4DSQA 5J41A 3CMIA 2GZPA 4AJ8A 3H4KA 2AB6A 2JL4A 3NIVA 1EV4A 2DJKA 5AN1A 1MEKA 2WZ9A 1NHOA 4OMVA 3EYTA 2M80A 2XC2A 1ZYQB 1TK0B 1O8WA 2H6YA 1ERUA 4TR3A 2O8VB 3D0ZA 3CYNA 5HR2A 3RDWA 1VF3A 3IK7A 3H79A 3D4MA 5HR1A 4IHUA 1ABAA 2FWGA 3F63A 3HKRA 1ERTA 3F3QA 5GZZB 2DLXA 5HR3A 2GQMA 3FKFA 4IJIA 4MZBA 4OFNA 3D6IA 2H1AA 5DJLA 4GTUA 2X8CA 2CVKA 11GSA 3I69A 1LBKA 2O89A 1TXXA 3GH9A 1U87A 2JU5A 5IMAA 4G0IA 4WKWA 2YV7A 4MPGA 1TDIA 1J9BA 1Z6NA 1KTEA 5HFIA 4YQUA 2H1BA 5ENUA 3HZ8A 2WCIA 2GSTA 3VLNA 4EL1A 3I43A 3RPNA 4EIQA 4GF0A 2A4HA 4YAPA 3J7Yk 3SBCA 4YQVA 1YKCA 1R7HA 1XVQA 1YEPA 2IN3A 2YPMA 2RUEA 3FEUA 2CZ2A 1OKDA 1OC9B 1TJDA 5J9CA 4FO5A 1A23A 4IQAA 1ZYPA 4ZL9A 2V6OA 4PQ1A 2Z9SA 4KSMA 3UEMA 3TJBA 1V57A 3MYDA 1F9MA 4Z2TA 5ELGA 6GSSA 2C0FA 4OO5A 1XW9A 4F0CA 1ZYEA 1EOGA 3VK9A 4WBRD 1GRXA 2CVBA 2HZEB 3GTUB 5LD0A 1AQVA 4BL7A 3G7JA 4OFTA 2HT9A 1QMVA 2X4AA 3MIXA 3ZZXA 1JHBA 3ZREA 3R3EA 5HR0A 3MNGA 3FZ9A 4F82A 1T3BA 2KHPA 3TJFA 2GQLA 2HZFA 3RHCA 1OE8A 4FH8A 3WGXA 3P90A 4CY6A 2AHEA 3KJYA 2C1YA 1TU7A 2MBSA 3IDVA 1QQ2A 1UVZA 1IYIA 1XVWA 1AIUA 5G1LA 4NHWA 1XOBA 2R6KA 3TKRA 4YQMA 2YCDA 4AJ6A 2HLSA 4EO3A 3DRNA 3QPMA 1PGTA 1DE1A 3KH9A 1Z3EA 3TGZA 2CZ3A 3EWLA 2C0GA 5ECLB 1H75A 5C00A 4TN8A 1SU9A 4V1Ap 4DVCA 4O5QA 3IBHA 2GGTA 3E3EA 2K8SA 3F4SA 4MZWA 5ECPB 2CAQA 2MYGA 4MH3A 2V2GA 2FCHA 1EGRA 1JZDA 1Q4JA 3F3RA 3C1RA 1EV9A 5A4VA 3QOUA 2DIYA 3GKKA 5ECQB 3HD5A 3KD0A 4GRFA 3A2VA 1PD21 5DALA 2B5XA 1K0BA 3EMXA 5AIXA 2XBQA 7GSSA 2VLTA 3DMLA 4K5SA 4G0LA 2G2QA 2C8UA 1B9YC 1KNGA 4J57E 2HRKA 3F4TA 3S9FA 2LRNA 3CRUA 2YWNA 3QFAC 5ID2A 1F3BA 4BVXA 4XHMA 5IOWA 3Q19A 2V1MA 2FNOA 5IO0A 5CP1A 5EPFA 2I81A 4MZCA 4TR0A 2V41A 3HVVA 4BVYB 5B6MA 1V58A 5B7CA 3M1GA 4MLYA 3DXBA 4AJ7A 4KNDA 4JRRA 1FHEA 4GLTA 3P2AA 1XZOA 4MH2A 5ECHB 4XS4A 3PPUA 4GQCA 4MJEA 2GSQA 5G31A 18GSA 2M46A 3ZYWA 3FY7A 1G6YA 4OO4A 3GX0A 3KZQA 2H19A 3ZVJD 5J4UA 2UZ8A 3RPPA 2J9HA 6GSXA 4IJ3A 2DJ3A 3TUEA 3BCKA 2H0HA 2I4AA 3I9V2 4ZXGA 3H8QA 2DSAA 1T00A 1EWXA 1OVNA 2J23A 2OACA 3QD9A 4PGTA 4IQ1A 3WT1A 3RHBA 1AUCA 1N8JA 4PURA 1HNAA 22GSA 2GSSA 5A5KA 2EC4A 1TKDB 2IPAA 4O32A 5CO3A 3IV4A 2ON7A 3TJGA 3TKSA 4KF9A 1PN9A 3EVIA 5LCZA 1F3AA 2MMNA 2GQKA 1XPVA 4YKGA 1SL0B 1TW9A 2C3TA 1JLWA 2JACA 1YZXA 3O6TA 3A5IA 1GUMA 1TU8A 5EL8A 1GUHA 4GSTA 4EIPA 5A4WA 4D73B 1JFUA 2FLSA 5IMVA 3ZFBA 2FWHA 3QAGA 1U3AA 4WEYA 1Z7RA 2F9SA 1OAZA 2VOCA 5IMFA 4HUAA 1USBA 1RK4A 4IW9A 5E4WA 2LNTA 3PINA 2HXKA 4RQRA 4HOJA 1F6MC 3DD3A 4Z7XA 4RUVA 2I1UA 4IELA 4Q5FA 1TK8B 1ERWA 1V98A 3APQA 1BX9A 1Z7PA 2K18A 5FHIA 1QK8A 1K3YA 4ZBDA 3IR4A 3VI5A 2FA4A 2OE3A 1SK1A 3HDCA 3QAWA 3FR9A 3W6GA 4KX4A 1NW2A 1YEXA 13GSA 4HZ4A 1THXA 1V40A 5ECSA 2VCTA 3LJRA 1A0RP 4I2TA 5L71A 10GSA 2TRXA 1OKTA 3ZL5A 3RAZA 5B8BA 3LEFA 2L57A 2FA8A 2XPDA 5EY6A 2KP2A 2DMLA 4TXVA 4I2UA 2CQ9A 3OR5A 4BWQA 3NOFA 3Q18A 4TR1B 2MMOA 3HCZA 4JE1A 5F8BA 1JZWA 3LXTA 2GSRA 1V2AA 3KEBA 4O92A 1YJ6A 3KMNA 1K0DA 1X5DA 4HQZA 3W8JA 1TTZA 2N5FA 3M8NA 3ZIJA 5CYYA 1BEDA 2AV4A 1TRWA 2OE1A 2QGVA 5AISA 1X9SB 2RIIA 3IC8A 5KN3A 2OBIA 4ACSA 2A2SA 3UAPA 3H93A 1DUGA 1N2AA 1VRSD 3M0FA 4TR4A 2H0GA 4FYBA 3EURA 3TCOA 2MMZA 4XS1A 3UBKA 1TRUA 1SD8A 1JZRA 3N5OA 2CX3A 4IGJA 2DJ1A 3ZMLA 5J3RA 2KUCA 2YOIA 2VLVA 4IP6A 3R2QA 4NV2A 1MDIA 1ACVA 2X49A 5CRWA 1OYJA 1BJXA 3DGQA 3F9UA 4MPFA 5CREA 1G6WA 3UJ1A 4XRDA 1SKSB 2KOKA 3LSZA 3D5JA 3IOSA 4MP4A 3VWUA 3GX8A 1T1VA 2JZTA 2LV3A 4ZB9A 3VI7A 1YQ1A 4LMVA 5FT3A 3UL3A 2IIYA 1T8EB 2V6KA 3ME8A 1Z9HA 2HSHA 2E2GA 2E2MA 2ES7A 1S3AA 5F07A 5IIZA 4POLA 2D2ZA 1K0CA 5D9WA 4J2FA 3LG6A 3GSTA 4L0WA 4XCSA 3QAVA 4WF5A 4WBJA 2VM1A 2DJJA 3P8WA 3L4NA 4EC0A 3L9UA 4EE0A 4ZB6A 4TOPA 2H6ZA 2FD3A 2R0PA 2FY6A 2CVDA 3VPTA 2VM2A 2VO4A 4MF5A 1GUKA 4KW6A 2H71A 3IRAA 4ECBA 2GS3A 2H0IA 5G2ZA 3HHVA 3U6VA 2QKEA 4K2DA 4Z2UA 3L78A 4BL7B 4NHZA 1UN2A 1XWCA 1R5AA 3FHKA 4WF4A 2P5RA 1YY7A 3GYKA 3L9SA 5H5RA 2LJRA 1TRVA 1WRYA 1XWKA 5D9TA 2PMTA 2VD1A 5INYA 1R26A 5HFKA 1VF4A 3DWVA 3M3MA 4PTSA 4MJCA 3IK9A 1GTBA 1PSQA 1AAZA 2RM5A 4I8BA 3LWAA 3M9KA 4POBA 1FB6A 2E0QA 5ELAA 2LJAA 3DVXA 2LQQA 1GSQA 1B48A 6GSUA 3QMXA 3UMAA 4HS1A 19GSA 4XTSA 2X8GA 1VF1A 4ECCA 1SL1B 2LSTA 4V2NA 4ID0A 4X4JA 3D21A 1M3JA 3DEXA 14GSA 2H01A 4L5OA 3LQ7A 4RI7A 4TRXA 2XHFA 1ST9A 3CQFA 2CT6A 2ZUPA 5ECRB 5HFGA 1K3LA 1FAAA 1WPIA 1M7TA 2B1KA 2HSYA 2PVOC 2AAWA 3IPZA 3GRXA 3BJ5A 4X1UA 1GTUA 1SYRA 2PU9C 5D8IA 4IKHA 2LQOA 5DALB 5AGYA 4CY8A 2B6MA 1WWJA 1BAYA 3UARA 4WR4A 3FW2A 3F4RA 3KTBA 4N10A 3E9JB 5J9BA 3KP8A 4XS6A 1ZZYA 5KOWA 2YZUA 3VURA 3CTGA 2GT6A 5IOXA 1PQNA 5ID2B 4G10A 2CA8A 4BVXB 4L5LA 4MF7A 4BA7A 2H30A 1XW5A 4KE3A 2HI7A 3BD2A 1SJZA 4HEA2 1S3DA 1HNCA 2QC7A 3HJPA 4K8MA 2PERA 2WULA 1ZMAA 1B4PA 1XWAA 5DAKA 1QFNA 5DQSA 2GZYA 2FGXA 5KEJA 1GTIA 3L0HA 5GAND 3QDNA 3EC3A 1GLQA 1PX6A 3GL3A 2CV4A 5COHA 3UIWA 4XS4B 1LJRA 4EKZA 1EEJA 3LGCA 1Z5YE 1HQOA 4Q5RA 2NTOA 1PL1A 1EZKA 2YJ7A 5CRDA 3WGEA 1F2EA 5IMDA 4LMWA 2K9FA 1ZL9A 1FO5A 1ZYNA 4WXTA 2LTKA 1ILOA 4USSA 2IWTA 4G9HA 3O76A 2LRTA 1GNEA 1BQ7A 2WGRA 4MMMA 4NPBA 1I9DA 3F0IA 1A8LA 1RQMA 2IMKA 2G0FA 3GA4A 1XG8A 3EMPA 3D4TA 2K8VA 3KTLA 2EIOA 3ZTLA 4NAXA 2I9HA 2HRNA 5ECKB 4EXJA 2KP1A 3L9VA 2HSMA 2YJHA 4GCIA 3GNJA 4ECIA 5DDLA 3HVXA 1T7PB 3IAM2 2VUPA 3IC4A 3FRCA 1J0FA 4MJBA 1XOAA 4GSNA 1S3CA 2ALBA 4KH7A 1M99A 4IS0A 2ZNMA 1SD9A 1YKAA 2LJKA 2NPBA 3FZ4A 5B8AA 1UC7A 4IN0A 12GSA 2FHEA 1U6TA 2BTOT 1A0FA 2OKAA 2F51A 1G7EA 1I5GA 3G7YA 4MK3A 5JCWA 3IHQA 3UVTA 1GSUA 1S3RA 2IL3A 3DVWA 2GZZA 3TOUA 2GTUA 5JWRB 1XCCA 3PR8A 5GAPD 5JCGA 2DC5A 5IO2A 3TOTA 4EDYA 2V32A 1G0TA 2OBKA 3C7MA 4ISDA 4O5RA 3WGDA 1X5EA 1GTAA 3PGTA 4NXIA 2NDOA 2OJLA 2FUG2 1FB0A 2E7PA 4GQFA 1FVKA 4MABA 5IMZA 4AF2A 4DEJA 4K2XA 1EP7A 1C72A 2O85A 2IMEA 1RW1A 2P5QA 2N5AA 4Q5NA 3ZVJA 1BYEA 3CTFA 4XRAA 1M2AA 2OADA 2A4VA 4AGSA 1TI1A 4E8HA 2K6VA 4TXOA 2LEGA 3RBTA 2X8HA 4EDZA 3AY8A 8GSSA 1JLVA 4Z2RA 4KSOA 1EOHA 1OC3A 4RQXA 4K6XA 3C71A 3ERGA 16GSA 2P31A 2H70A 4A5PA 5KN1A 1WIKA 2DKIA 2DBCA 2H73A 3HZ4A 1T4ZA 2QSIA 2R3XA 4PUAA 4X0XA 1WJKA 5JCUA 3NZNA 1TRSA 1YDKA 2A2PA 3HA9A 3H1NA 4F03A 4YH2A 3TRXA 2HE3A 3A5WA 1SJIA 2YANA 2MMAA 2VL2C 2JSZA 1XBSA 2L6CA 3GSSA 2JSYA 2YP6A 2C80A 1PL2A 1V9WA 1U88A 4H86A 1MDKA 5ABRA 1OE7A 1PFOA 3U5RE 1FG4A 3ZLPA 20GSA 2VL9A 3LYPA 2H74A 4CDOA 4BWSA 1O85A 4CW9A 3GKMA 4CHSA 2VCXA 5JWOB 1VGLA 1PN0A 2F8AA 3W8SA 1U3IA 2X64A 1WOUA 3TDGA 1K3OA 4KCEA 1GP1A 5G5EA 2PBJA 3KH7A 3A3TA 2JZRA 1XXUA 3E0UA 1WP0A 3F6DA 2O87A 2TIRA 2B7KA 1PKZA 4BPYA 2ON5A 1BG5A 2C3QA 3IHGA 5ECOB 3SWLA 5AIVA 1X9MB 2DMMA 2XPEA 3VWVA 1Y6EA 4V2LA 3FK8A 2EIRA 3Q6OA 4GWRA 1M3IA 1ON4A 4TKYA 3GMFA 5D73A 4OD7A 3TJKA 4N30A 5CRHA 3VFIA 3UVHA 4PNFA 3ZIVA 6GSYA 3LXZA 3ZITA 5BRTA 1SL2B 1M2DA 1GSEA 1NHYA 2WJUA 1AC1A 2IFQA 2VCWA 4OWYA 4PQHA 2RM6A 4JBBA 3K8NA 4GSSA 3TB2A 4JR6A 1QGVA 4DSSA 2X99A 4KDUA 4MA9A 1KBNA 5F0GA 2RUFA 1X5CA 3GH6A 1K0MA 4V2MA 1AW9A 3APSA 2R37A 3G9BA 2HYXA 4K7NA 4G0KA 3EPTA 2H72A 5D93A 3HY2A 2WS2A 2WDUA 2L4QA 2QA1A 2GLRA 3GFKA 17GSA 3IA1A 5IQYA 3A2WA 3DYRA 1NM3A 2KLXA 2YWMA 4K1FA 1T4YA 4K0NA 1A2JA 2B3SA 4MDCA 5D9VA 2DJ2A 2PPTA 1EEMA 1O6JA 5GSSA 5G30A 1M0UA 3TKSE 3GV1A 5LNKe 2H76A 2RLIA 3GURA 2VL3A 2L6DA 4TVEA 1R4WA 1PX7A 1WE0A 5CRGA 5C04A 3GL5A 2BJXA 4Q5QA 3ZMKA 2IMDA 2PUKC 1XFLA 5FWGA 4POKA 3WD6A 1E6BA 2N5BA 1SYXA 4KCAA 2LS5A 4XIHA 1KEBA 1PKWA 3MDKA 2NVLA 2C4JA 4KUNA 4OFMA 1THOA 4HU7A 2B7JA 2R0CA 3LYKA 5F06A 5A4UA 4HQSA 3UOMA 3BCIA 4I5QA 1R5PA 3LW9A 1J08A 3GKXA 3WT2A 3I6AA 3BBYA 2IMIA 3HVSA 1SKRB 2VD0A 1AXDA 4PX1A 2L5LA 2YNXA 5DVBA 2VCQA 4FQUA 3P7XA 4JR4A 2CAIA 2OA7A 3C8EA 3GHAA 5D96A 3ME7A 5DCGA 4ZL8A 2HRFA 2M72A 1A24A 1O81A 3ZRDA 1WMJA 1OC9A 2HNLA 5DAKB 1FOVA 3HJOA 2DIZA 2VLUA 2WB9A 1GLPA 1UA5A 2F8FA 2YWOA 1TI3A 2LNSA 1MTCA 2C0EA 4BIKA 2VCZA 4QQ7A 3CRTA 3G7IA 4ML6A 2YZHA 1ZGNA 5CNWA 1GULA 2PVQA 4F0BA 2FWEA 1HYUA 3CXGA 2H8LA 2HZEA 3GTUA 3LFLA 5ECIB 2JZSA 3VWWA 2ZCTA 5KOXA 1URMA 6GSTA 2C3NA 6GSWA 4MF6A 4G2EA 3F6FA 3KP9A 5JWQB 5IM9A 4PNGA 4TW5A 2R4VA 5DQYA 2IJYA 3VPQA 5H5QA 2DKHA 4KB3A 5IPGA 4L8EA 1VF2A 4O5UA 1AQXA 2PWJA 1CQGA 2HRAA 5EVOA 1GL8A 1A2MA 3QFBC 5DCHA 4NWYA 5F05A 1DSBA 3GKNA 3FMWA 4ULXA 1O73A 3EINA 4POMA 4QL9A 3VWXA 3IXRA 1EP8A 4J56E 4KA0A 3PH9A 1HD2A 3DIEA 1IYHA 2VIMA 4JU5A 3KIJA 5E59A 1M9BA 1JZOA 4YKFA 1O8XA 3KXOA 4HJ2A 1A2LA 2TRCP 3FR6A 4K7OA 3O3TA 5CAXA 5ECMB 2BMXA 1GWCA 2H6XA 1E2YA 3CSHA 4ML1A 2YWIA 1GSSA 2WRTA 1XIYA 4N0ZA 4ZILA 3LORA 3ED3A 6GSVA 4E8EA 3FZ5A 5B6NA 4FYCA 3EU3A 4GXZA 5ECNB 2EIQA 1K0AA 1B8XA 2H66A 5DJMA 1GSFA 3MAKA 5KN2A 1W4VA 2R0GA 3ERWA 3BOAA 1SK2A 1AQWA 2H1GA 1H4OA 2B1LA 3TKQA 5BMUA 3APOA 3QR6A 3EE2A 1O7UA 3KCMA 4EF0A 4L0UA 1HNBA 1MDJA 4LL1B 3IAS2 1YF0A 4K9ZA 1X0RA 3JCML 3KGKA 4HSCX 2PGTA 1NSWA 4FYUA 4BVYA 2B5YA 1FW1A 3HVNA 4WETA 3TJJA 2B5EA 3ISOA 4K5RA 3CSIA 2MBTA 4G19A 3US3A 4TXOB 5DBQA 4K7IA 4KDXA 4ZB8A 1MD4A 2JADA 1YF1A 3HYPA 3C73A 4JEDA 4MCUA 2OE0A 2F3MA 3Q74A 5KN0A 1W89A 3EU4A 4EVMA 3FR3A 3F8UA 2HFDA 3KM6A 2VCVA 1QUWA 4OCFA 3MSZA 5H5SA 1TOFA 2AYTA 2VL2A 2WFCA 4I6XA 2AJQB 4ZBAA 1K0NA 4F2IA 1LU4A 4PQIA 1CQHA 1M9AA 3MWHA 9GSSA 1PA3A 2PN8A 4HI7A 4NMUA 1XWBA 2XBIA 1GSYA 4O7HA 1ML6A 2H1DA 4KGIA 2I3YA 4PUFC 2FWFA 4ZBBA 1TK5B 1DBYA 4HDEA 2REMA 4ZL7A 3N9JA 4MJAA 2VAFA 4F9ZA 3C1SA 1SJ6A 1PRXA 1SKWB 4LL4B 3J7Yb 2R5GA 1FOHA 4FIWA 1K0OA 1B9XC 2CX4A 4IP1A 4DSRA 4RI6A 3V1WA 4I97A 4N0VA 1PMTA 1X9WB 4KAEA 1SK0A 4IVFA 3TKSC 1ZCPA 2L59A 1A8YA 3D22A 4MNNA 4WR5A 2AUVA 3GN3A 2QA2A 2YN1A 4HU9A 1MD3A 4LA1A 4EUYA 4HJMA 4D73A 5G1KA 1GSDA 3M9JA 2GVPA 4V1Ag 4X43A 5IPHA 1ERVA 1TP9A 2GDRA 1QXHA 3HXSA 5GSTA
chains in the Genus database with same CATH topology
4JZQA 3KMOA 5D9XA 1Q98A 2C0DA 4OCEA 2LRCA 3FYGA 5G5FA 5J5NA 1G7OA 3UBLA 4YAVA 1Y25A 4ZIJA 3CSJA 2GT5A 2MZCA 1GNWA 4NV5A 2IMFA 3A2XA 5IMCA 2P0GA 4PXOA 1ZOFA 4N11A 2L4CA 5HQPA 2NBSA 2IFQB 3TRPA 1SENA 1DE2A 4P3YB 3ERFA 2O7KA 3ZFLA 4HZ2A 4IBPA 2DJ0A 4DSSB 2YV9A 3WYWA 2A2RA 3DKSA 3GIXA 3FZAA 4K0GA 1EGOA 3CBUA 4LLRA 3TKPA 2R2JA 4KDYA 1F37A 2LKUA 1XWGA 3GUSA 1B4QA 2L5OA 4QL7A 3IE3A 3TRQA 1XW6A 1GH2A 4ICYA 1Z6MA 2LUSA 1M2BA 3HJMA 2H75A 4ILFA 1FVJA 3QCPA 4TR1A 1OC8A 4ECJA 4DSQA 5J41A 3CMIA 2GZPA 4AJ8A 3H4KA 2AB6A 2JL4A 3NIVA 1EV4A 2DJKA 5AN1A 1MEKA 2WZ9A 1NHOA 4OMVA 3EYTA 2M80A 2XC2A 1ZYQB 1TK0B 1O8WA 2H6YA 1ERUA 4TR3A 2O8VB 3D0ZA 3CYNA 5HR2A 3RDWA 1VF3A 3IK7A 3H79A 3D4MA 5HR1A 4IHUA 1ABAA 2FWGA 3F63A 3HKRA 1ERTA 3F3QA 5GZZB 2DLXA 5HR3A 2GQMA 3FKFA 4IJIA 4MZBA 4OFNA 3D6IA 2H1AA 5DJLA 4GTUA 2X8CA 2CVKA 11GSA 3I69A 1LBKA 2O89A 1TXXA 3GH9A 1U87A 2JU5A 5IMAA 4G0IA 4WKWA 2YV7A 4MPGA 1TDIA 1J9BA 1Z6NA 1KTEA 5HFIA 4YQUA 2H1BA 5ENUA 3HZ8A 2WCIA 2GSTA 3VLNA 4EL1A 3I43A 3RPNA 4EIQA 4GF0A 2A4HA 4YAPA 3J7Yk 3SBCA 4YQVA 1YKCA 1R7HA 1XVQA 1YEPA 2IN3A 2YPMA 2RUEA 3FEUA 2CZ2A 1OKDA 1OC9B 1TJDA 5J9CA 4FO5A 1A23A 4IQAA 1ZYPA 4ZL9A 2V6OA 4PQ1A 2Z9SA 4KSMA 3UEMA 3TJBA 1V57A 3MYDA 1F9MA 4Z2TA 5ELGA 6GSSA 2C0FA 4OO5A 1XW9A 4F0CA 1ZYEA 1EOGA 3VK9A 4WBRD 1GRXA 2CVBA 2HZEB 3GTUB 5LD0A 1AQVA 4BL7A 3G7JA 4OFTA 2HT9A 1QMVA 2X4AA 3MIXA 3ZZXA 1JHBA 3ZREA 3R3EA 5HR0A 3MNGA 3FZ9A 4F82A 1T3BA 2KHPA 3TJFA 2GQLA 2HZFA 3RHCA 1OE8A 4FH8A 3WGXA 3P90A 4CY6A 2AHEA 3KJYA 2C1YA 1TU7A 2MBSA 3IDVA 1QQ2A 1UVZA 1IYIA 1XVWA 1AIUA 5G1LA 4NHWA 1XOBA 2R6KA 3TKRA 4YQMA 2YCDA 4AJ6A 2HLSA 4EO3A 3DRNA 3QPMA 1PGTA 1DE1A 3KH9A 1Z3EA 3TGZA 2CZ3A 3EWLA 2C0GA 5ECLB 1H75A 5C00A 4TN8A 1SU9A 4V1Ap 4DVCA 4O5QA 3IBHA 2GGTA 3E3EA 2K8SA 3F4SA 4MZWA 5ECPB 2CAQA 2MYGA 4MH3A 2V2GA 2FCHA 1EGRA 1JZDA 1Q4JA 3F3RA 3C1RA 1EV9A 5A4VA 3QOUA 2DIYA 3GKKA 5ECQB 3HD5A 3KD0A 4GRFA 3A2VA 1PD21 5DALA 2B5XA 1K0BA 3EMXA 5AIXA 2XBQA 7GSSA 2VLTA 3DMLA 4K5SA 4G0LA 2G2QA 2C8UA 1B9YC 1KNGA 4J57E 2HRKA 3F4TA 3S9FA 2LRNA 3CRUA 2YWNA 3QFAC 5ID2A 1F3BA 4BVXA 4XHMA 5IOWA 3Q19A 2V1MA 2FNOA 5IO0A 5CP1A 5EPFA 2I81A 4MZCA 4TR0A 2V41A 3HVVA 4BVYB 5B6MA 1V58A 5B7CA 3M1GA 4MLYA 3DXBA 4AJ7A 4KNDA 4JRRA 1FHEA 4GLTA 3P2AA 1XZOA 4MH2A 5ECHB 4XS4A 3PPUA 4GQCA 4MJEA 2GSQA 5G31A 18GSA 2M46A 3ZYWA 3FY7A 1G6YA 4OO4A 3GX0A 3KZQA 2H19A 3ZVJD 5J4UA 2UZ8A 3RPPA 2J9HA 6GSXA 4IJ3A 2DJ3A 3TUEA 3BCKA 2H0HA 2I4AA 3I9V2 4ZXGA 3H8QA 2DSAA 1T00A 1EWXA 1OVNA 2J23A 2OACA 3QD9A 4PGTA 4IQ1A 3WT1A 3RHBA 1AUCA 1N8JA 4PURA 1HNAA 22GSA 2GSSA 5A5KA 2EC4A 1TKDB 2IPAA 4O32A 5CO3A 3IV4A 2ON7A 3TJGA 3TKSA 4KF9A 1PN9A 3EVIA 5LCZA 1F3AA 2MMNA 2GQKA 1XPVA 4YKGA 1SL0B 1TW9A 2C3TA 1JLWA 2JACA 1YZXA 3O6TA 3A5IA 1GUMA 1TU8A 5EL8A 1GUHA 4GSTA 4EIPA 5A4WA 4D73B 1JFUA 2FLSA 5IMVA 3ZFBA 2FWHA 3QAGA 1U3AA 4WEYA 1Z7RA 2F9SA 1OAZA 2VOCA 5IMFA 4HUAA 1USBA 1RK4A 4IW9A 5E4WA 2LNTA 3PINA 2HXKA 4RQRA 4HOJA 1F6MC 3DD3A 4Z7XA 4RUVA 2I1UA 4IELA 4Q5FA 1TK8B 1ERWA 1V98A 3APQA 1BX9A 1Z7PA 2K18A 5FHIA 1QK8A 1K3YA 4ZBDA 3IR4A 3VI5A 2FA4A 2OE3A 1SK1A 3HDCA 3QAWA 3FR9A 3W6GA 4KX4A 1NW2A 1YEXA 13GSA 4HZ4A 1THXA 1V40A 5ECSA 2VCTA 3LJRA 1A0RP 4I2TA 5L71A 10GSA 2TRXA 1OKTA 3ZL5A 3RAZA 5B8BA 3LEFA 2L57A 2FA8A 2XPDA 5EY6A 2KP2A 2DMLA 4TXVA 4I2UA 2CQ9A 3OR5A 4BWQA 3NOFA 3Q18A 4TR1B 2MMOA 3HCZA 4JE1A 5F8BA 1JZWA 3LXTA 2GSRA 1V2AA 3KEBA 4O92A 1YJ6A 3KMNA 1K0DA 1X5DA 4HQZA 3W8JA 1TTZA 2N5FA 3M8NA 3ZIJA 5CYYA 1BEDA 2AV4A 1TRWA 2OE1A 2QGVA 5AISA 1X9SB 2RIIA 3IC8A 5KN3A 2OBIA 4ACSA 2A2SA 3UAPA 3H93A 1DUGA 1N2AA 1VRSD 3M0FA 4TR4A 2H0GA 4FYBA 3EURA 3TCOA 2MMZA 4XS1A 3UBKA 1TRUA 1SD8A 1JZRA 3N5OA 2CX3A 4IGJA 2DJ1A 3ZMLA 5J3RA 2KUCA 2YOIA 2VLVA 4IP6A 3R2QA 4NV2A 1MDIA 1ACVA 2X49A 5CRWA 1OYJA 1BJXA 3DGQA 3F9UA 4MPFA 5CREA 1G6WA 3UJ1A 4XRDA 1SKSB 2KOKA 3LSZA 3D5JA 3IOSA 4MP4A 3VWUA 3GX8A 1T1VA 2JZTA 2LV3A 4ZB9A 3VI7A 1YQ1A 4LMVA 5FT3A 3UL3A 2IIYA 1T8EB 2V6KA 3ME8A 1Z9HA 2HSHA 2E2GA 2E2MA 2ES7A 1S3AA 5F07A 5IIZA 4POLA 2D2ZA 1K0CA 5D9WA 4J2FA 3LG6A 3GSTA 4L0WA 4XCSA 3QAVA 4WF5A 4WBJA 2VM1A 2DJJA 3P8WA 3L4NA 4EC0A 3L9UA 4EE0A 4ZB6A 4TOPA 2H6ZA 2FD3A 2R0PA 2FY6A 2CVDA 3VPTA 2VM2A 2VO4A 4MF5A 1GUKA 4KW6A 2H71A 3IRAA 4ECBA 2GS3A 2H0IA 5G2ZA 3HHVA 3U6VA 2QKEA 4K2DA 4Z2UA 3L78A 4BL7B 4NHZA 1UN2A 1XWCA 1R5AA 3FHKA 4WF4A 2P5RA 1YY7A 3GYKA 3L9SA 5H5RA 2LJRA 1TRVA 1WRYA 1XWKA 5D9TA 2PMTA 2VD1A 5INYA 1R26A 5HFKA 1VF4A 3DWVA 3M3MA 4PTSA 4MJCA 3IK9A 1GTBA 1PSQA 1AAZA 2RM5A 4I8BA 3LWAA 3M9KA 4POBA 1FB6A 2E0QA 5ELAA 2LJAA 3DVXA 2LQQA 1GSQA 1B48A 6GSUA 3QMXA 3UMAA 4HS1A 19GSA 4XTSA 2X8GA 1VF1A 4ECCA 1SL1B 2LSTA 4V2NA 4ID0A 4X4JA 3D21A 3DEXA 14GSA 2H01A 4L5OA 3LQ7A 4RI7A 4TRXA 2XHFA 1ST9A 2CT6A 2ZUPA 5ECRB 5HFGA 1K3LA 1FAAA 1WPIA 1M7TA 2B1KA 2HSYA 2PVOC 2AAWA 3IPZA 3GRXA 3BJ5A 4X1UA 1GTUA 1SYRA 2PU9C 5D8IA 4IKHA 2LQOA 5DALB 5AGYA 4CY8A 2B6MA 1WWJA 1BAYA 3UARA 4WR4A 3FW2A 3F4RA 3KTBA 4N10A 3E9JB 5J9BA 3KP8A 4XS6A 1ZZYA 5KOWA 2YZUA 3VURA 3CTGA 2GT6A 5IOXA 1PQNA 5ID2B 4G10A 2CA8A 4BVXB 4L5LA 4MF7A 4BA7A 2H30A 1XW5A 4KE3A 2HI7A 3BD2A 1SJZA 4HEA2 1S3DA 1HNCA 2QC7A 3HJPA 4K8MA 2PERA 2WULA 1ZMAA 1B4PA 1XWAA 5DAKA 1QFNA 5DQSA 2GZYA 2FGXA 5KEJA 1GTIA 3L0HA 5GAND 3QDNA 3EC3A 1GLQA 1PX6A 3GL3A 2CV4A 5COHA 3UIWA 4XS4B 1LJRA 4EKZA 1EEJA 3LGCA 1Z5YE 1HQOA 4Q5RA 2NTOA 1PL1A 1EZKA 2YJ7A 5CRDA 3WGEA 1F2EA 5IMDA 4LMWA 2K9FA 1ZL9A 1FO5A 1ZYNA 4WXTA 2LTKA 1ILOA 4USSA 2IWTA 4G9HA 3O76A 2LRTA 1GNEA 1BQ7A 2WGRA 4MMMA 4NPBA 1I9DA 3F0IA 1A8LA 1RQMA 2IMKA 2G0FA 3GA4A 3EMPA 3D4TA 2K8VA 3KTLA 2EIOA 3ZTLA 4NAXA 2I9HA 2HRNA 5ECKB 4EXJA 2KP1A 3L9VA 2HSMA 2YJHA 4GCIA 3GNJA 4ECIA 5DDLA 3HVXA 1T7PB 3IAM2 2VUPA 3IC4A 3FRCA 1J0FA 4MJBA 1XOAA 4GSNA 1S3CA 2ALBA 4KH7A 1M99A 4IS0A 2ZNMA 1SD9A 1YKAA 2LJKA 2NPBA 3FZ4A 5B8AA 1UC7A 4IN0A 12GSA 2FHEA 1U6TA 2BTOT 1A0FA 2OKAA 2F51A 1G7EA 1I5GA 3G7YA 4MK3A 5JCWA 3IHQA 3UVTA 1GSUA 2IL3A 3DVWA 2GZZA 3TOUA 2GTUA 5JWRB 1XCCA 3PR8A 5GAPD 5JCGA 2DC5A 5IO2A 3TOTA 4EDYA 2V32A 1G0TA 2OBKA 3C7MA 4ISDA 4O5RA 3WGDA 1X5EA 1GTAA 3PGTA 4NXIA 2NDOA 2OJLA 2FUG2 1FB0A 2E7PA 4GQFA 1FVKA 4MABA 5IMZA 4AF2A 4DEJA 4K2XA 1EP7A 1C72A 2O85A 2IMEA 1RW1A 2P5QA 2N5AA 4Q5NA 3ZVJA 1BYEA 3CTFA 4XRAA 1M2AA 2OADA 2A4VA 4AGSA 1TI1A 4E8HA 2K6VA 4TXOA 2LEGA 3RBTA 2X8HA 4EDZA 3AY8A 8GSSA 1JLVA 4Z2RA 4KSOA 1EOHA 1OC3A 4RQXA 4K6XA 3C71A 3ERGA 16GSA 2P31A 2H70A 4A5PA 5KN1A 1WIKA 2DKIA 2DBCA 2H73A 3HZ4A 1T4ZA 2QSIA 2R3XA 4PUAA 4X0XA 1WJKA 5JCUA 3NZNA 1TRSA 1YDKA 2A2PA 3HA9A 3H1NA 4F03A 4YH2A 3TRXA 2HE3A 3A5WA 1SJIA 2YANA 2MMAA 2VL2C 2JSZA 1XBSA 2L6CA 3GSSA 2JSYA 2YP6A 2C80A 1PL2A 1V9WA 1U88A 4H86A 1MDKA 5ABRA 1OE7A 3U5RE 1FG4A 3ZLPA 20GSA 2VL9A 3LYPA 2H74A 4CDOA 4BWSA 1O85A 4CW9A 3GKMA 4CHSA 2VCXA 5JWOB 1VGLA 1PN0A 2F8AA 3W8SA 1U3IA 2X64A 1WOUA 3TDGA 1K3OA 4KCEA 1GP1A 5G5EA 2PBJA 3KH7A 3A3TA 2JZRA 1XXUA 3E0UA 1WP0A 3F6DA 2O87A 2TIRA 2B7KA 1PKZA 4BPYA 2ON5A 1BG5A 2C3QA 3IHGA 5ECOB 3SWLA 5AIVA 1X9MB 2DMMA 2XPEA 3VWVA 1Y6EA 4V2LA 3FK8A 2EIRA 3Q6OA 4GWRA 1ON4A 4TKYA 3GMFA 5D73A 4OD7A 3TJKA 4N30A 5CRHA 3VFIA 3UVHA 4PNFA 3ZIVA 6GSYA 3LXZA 3ZITA 5BRTA 1SL2B 1M2DA 1GSEA 1NHYA 2WJUA 1AC1A 2IFQA 2VCWA 4OWYA 4PQHA 2RM6A 4JBBA 3K8NA 4GSSA 3TB2A 4JR6A 1QGVA 4DSSA 2X99A 4KDUA 4MA9A 1KBNA 5F0GA 2RUFA 1X5CA 3GH6A 1K0MA 4V2MA 1AW9A 3APSA 2R37A 3G9BA 2HYXA 4K7NA 4G0KA 3EPTA 2H72A 5D93A 3HY2A 2WS2A 2WDUA 2L4QA 2QA1A 2GLRA 3GFKA 17GSA 3IA1A 5IQYA 3A2WA 3DYRA 1NM3A 2KLXA 2YWMA 4K1FA 1T4YA 4K0NA 1A2JA 2B3SA 4MDCA 5D9VA 2DJ2A 2PPTA 1EEMA 1O6JA 5GSSA 5G30A 1M0UA 3TKSE 3GV1A 5LNKe 2H76A 2RLIA 3GURA 2VL3A 2L6DA 4TVEA 1R4WA 1PX7A 1WE0A 5CRGA 5C04A 3GL5A 2BJXA 4Q5QA 3ZMKA 2IMDA 2PUKC 1XFLA 5FWGA 4POKA 3WD6A 1E6BA 2N5BA 1SYXA 4KCAA 2LS5A 4XIHA 1KEBA 1PKWA 3MDKA 2NVLA 2C4JA 4KUNA 4OFMA 1THOA 4HU7A 2B7JA 2R0CA 3LYKA 5F06A 5A4UA 4HQSA 3UOMA 3BCIA 4I5QA 1R5PA 3LW9A 1J08A 3GKXA 3WT2A 3I6AA 3BBYA 2IMIA 3HVSA 1SKRB 2VD0A 1AXDA 4PX1A 2L5LA 2YNXA 5DVBA 2VCQA 4FQUA 3P7XA 4JR4A 2CAIA 2OA7A 3C8EA 3GHAA 5D96A 3ME7A 5DCGA 4ZL8A 2HRFA 2M72A 1A24A 1O81A 3ZRDA 1WMJA 1OC9A 2HNLA 5DAKB 1FOVA 3HJOA 2DIZA 2VLUA 2WB9A 1GLPA 1UA5A 2F8FA 2YWOA 1TI3A 2LNSA 1MTCA 2C0EA 2VCZA 4QQ7A 3CRTA 3G7IA 4ML6A 2YZHA 1ZGNA 5CNWA 1GULA 2PVQA 4F0BA 2FWEA 1HYUA 3CXGA 2H8LA 2HZEA 3GTUA 3LFLA 5ECIB 2JZSA 3VWWA 2ZCTA 5KOXA 1URMA 6GSTA 2C3NA 6GSWA 4MF6A 4G2EA 3F6FA 3KP9A 5JWQB 5IM9A 4PNGA 4TW5A 2R4VA 5DQYA 2IJYA 3VPQA 5H5QA 2DKHA 4KB3A 5IPGA 4L8EA 1VF2A 4O5UA 1AQXA 2PWJA 1CQGA 2HRAA 5EVOA 1GL8A 1A2MA 3QFBC 5DCHA 4NWYA 5F05A 1DSBA 3GKNA 3FMWA 4ULXA 1O73A 3EINA 4POMA 4QL9A 3VWXA 3IXRA 1EP8A 4J56E 4KA0A 3PH9A 1HD2A 3DIEA 1IYHA 2VIMA 4JU5A 3KIJA 5E59A 1M9BA 1JZOA 4YKFA 1O8XA 3KXOA 4HJ2A 1A2LA 2TRCP 3FR6A 4K7OA 3O3TA 5CAXA 5ECMB 2BMXA 1GWCA 2H6XA 1E2YA 3CSHA 4ML1A 2YWIA 1GSSA 2WRTA 1XIYA 4N0ZA 4ZILA 3LORA 3ED3A 6GSVA 4E8EA 3FZ5A 5B6NA 4FYCA 3EU3A 4GXZA 5ECNB 2EIQA 1K0AA 1B8XA 2H66A 5DJMA 1GSFA 3MAKA 5KN2A 1W4VA 2R0GA 3ERWA 3BOAA 1SK2A 1AQWA 2H1GA 1H4OA 2B1LA 3TKQA 5BMUA 3APOA 3QR6A 3EE2A 1O7UA 3KCMA 4EF0A 4L0UA 1HNBA 1MDJA 4LL1B 3IAS2 1YF0A 4K9ZA 1X0RA 3JCML 3KGKA 2PGTA 1NSWA 4FYUA 4BVYA 2B5YA 1FW1A 4WETA 3TJJA 2B5EA 3ISOA 4K5RA 3CSIA 2MBTA 4G19A 3US3A 4TXOB 5DBQA 4K7IA 4KDXA 4ZB8A 1MD4A 2JADA 1YF1A 3HYPA 3C73A 4JEDA 4MCUA 2OE0A 2F3MA 3Q74A 5KN0A 1W89A 3EU4A 4EVMA 3FR3A 3F8UA 2HFDA 3KM6A 2VCVA 1QUWA 4OCFA 3MSZA 5H5SA 1TOFA 2AYTA 2VL2A 2WFCA 4I6XA 2AJQB 4ZBAA 1K0NA 4F2IA 1LU4A 4PQIA 1CQHA 1M9AA 3MWHA 9GSSA 1PA3A 2PN8A 4HI7A 4NMUA 1XWBA 2XBIA 1GSYA 4O7HA 1ML6A 2H1DA 4KGIA 2I3YA 4PUFC 2FWFA 4ZBBA 1TK5B 1DBYA 4HDEA 2REMA 4ZL7A 3N9JA 4MJAA 2VAFA 4F9ZA 3C1SA 1SJ6A 1PRXA 1SKWB 4LL4B 3J7Yb 2R5GA 1FOHA 4FIWA 1K0OA 1B9XC 2CX4A 4IP1A 4DSRA 4RI6A 3V1WA 4I97A 4N0VA 1PMTA 1X9WB 4KAEA 1SK0A 4IVFA 3TKSC 1ZCPA 2L59A 1A8YA 3D22A 4MNNA 4WR5A 2AUVA 3GN3A 2QA2A 2YN1A 4HU9A 1MD3A 4LA1A 4EUYA 4HJMA 4D73A 5G1KA 1GSDA 3M9JA 2GVPA 4V1Ag 4X43A 5IPHA 1ERVA 1TP9A 2GDRA 1QXHA 3HXSA 5GSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZQ A;  3KMO A;  5D9X A;  1Q98 A;  2C0D A;  4OCE A;  2LRC A;  3FYG A;  5G5F A;  5J5N A;  1G7O A;  3UBL A;  4YAV A;  1Y25 A;  4ZIJ A;  3CSJ A;  2GT5 A;  2MZC A;  1GNW A;  4NV5 A;  2IMF A;  3A2X A;  5IMC A;  2P0G A;  4PXO A;  1ZOF A;  4N11 A;  2L4C A;  5HQP A;  2NBS A;  2IFQ B;  3TRP A;  1SEN A;  1DE2 A;  4P3Y B;  3ERF A;  2O7K A;  3ZFL A;  4HZ2 A;  4IBP A;  2DJ0 A;  4DSS B;  2YV9 A;  3WYW A;  2A2R A;  3DKS A;  3GIX A;  3FZA A;  4K0G A;  1EGO A;  3CBU A;  4LLR A;  3TKP A;  2R2J A;  4KDY A;  1F37 A;  2LKU A;  1XWG A;  3GUS A;  1B4Q A;  2L5O A;  4QL7 A;  3IE3 A;  3TRQ A;  1XW6 A;  1GH2 A;  1Z6M A;  2LUS A;  1M2B A;  3HJM A;  2H75 A;  4ILF A;  1FVJ A;  3QCP A;  4TR1 A;  1OC8 A;  4ECJ A;  4DSQ A;  5J41 A;  3CMI A;  2GZP A;  4AJ8 A;  3H4K A;  2AB6 A;  2JL4 A;  3NIV A;  1EV4 A;  2DJK A;  5AN1 A;  1MEK A;  2WZ9 A;  1NHO A;  4OMV A;  3EYT A;  2M80 A;  2XC2 A;  1ZYQ B;  1TK0 B;  1O8W A;  2H6Y A;  1ERU A;  4TR3 A;  2O8V B;  3D0Z A;  3CYN A;  5HR2 A;  3RDW A;  1VF3 A;  3IK7 A;  3H79 A;  3D4M A;  5HR1 A;  4IHU A;  1ABA A;  2FWG A;  3F63 A;  3HKR A;  1ERT A;  3F3Q A;  5GZZ B;  2DLX A;  5HR3 A;  2GQM A;  3FKF A;  4IJI A;  4MZB A;  4OFN A;  3D6I A;  2H1A A;  5DJL A;  4GTU A;  2X8C A;  2CVK A;  11GS A;  3I69 A;  1LBK A;  2O89 A;  1TXX A;  3GH9 A;  1U87 A;  2JU5 A;  5IMA A;  4WKW A;  2YV7 A;  4MPG A;  1TDI A;  1J9B A;  1Z6N A;  1KTE A;  5HFI A;  4YQU A;  2H1B A;  5ENU A;  3HZ8 A;  2WCI A;  2GST A;  3VLN A;  4EL1 A;  3I43 A;  3RPN A;  4GF0 A;  4YAP A;  3J7Y k;  3SBC A;  4YQV A;  1YKC A;  1R7H A;  1XVQ A;  1YEP A;  2IN3 A;  2YPM A;  2RUE A;  3FEU A;  2CZ2 A;  1OKD A;  1OC9 B;  1TJD A;  5J9C A;  4FO5 A;  1A23 A;  4IQA A;  4ZL9 A;  2V6O A;  4PQ1 A;  2Z9S A;  4KSM A;  3UEM A;  3TJB A;  1V57 A;  1F9M A;  5ELG A;  6GSS A;  2C0F A;  4OO5 A;  1XW9 A;  4F0C A;  1ZYE A;  1EOG A;  3VK9 A;  4WBR D;  1GRX A;  2CVB A;  2HZE B;  3GTU B;  5LD0 A;  1AQV A;  4BL7 A;  3G7J A;  4OFT A;  2HT9 A;  1QMV A;  3ZZX A;  1JHB A;  3ZRE A;  5HR0 A;  3MNG A;  3FZ9 A;  4F82 A;  1T3B A;  2KHP A;  3TJF A;  2GQL A;  2HZF A;  3RHC A;  1OE8 A;  4FH8 A;  3WGX A;  3P90 A;  2AHE A;  3KJY A;  2C1Y A;  1TU7 A;  2MBS A;  3IDV A;  1QQ2 A;  1UVZ A;  1IYI A;  1XVW A;  1AIU A;  5G1L A;  4NHW A;  1XOB A;  2R6K A;  3TKR A;  4YQM A;  2YCD A;  4AJ6 A;  2HLS A;  4EO3 A;  3DRN A;  3QPM A;  1PGT A;  1DE1 A;  3KH9 A;  1Z3E A;  3TGZ A;  2CZ3 A;  3EWL A;  2C0G A;  5ECL B;  1H75 A;  5C00 A;  4TN8 A;  1SU9 A;  4V1A p;  4DVC A;  3IBH A;  2GGT A;  3E3E A;  2K8S A;  3F4S A;  4MZW A;  5ECP B;  2CAQ A;  2MYG A;  4MH3 A;  2V2G A;  2FCH A;  1EGR A;  1JZD A;  1Q4J A;  3F3R A;  3C1R A;  1EV9 A;  5A4V A;  3QOU A;  2DIY A;  3GKK A;  5ECQ B;  3HD5 A;  3KD0 A;  4GRF A;  3A2V A;  1PD2 1;  5DAL A;  2B5X A;  1K0B A;  3EMX A;  5AIX A;  2XBQ A;  7GSS A;  2VLT A;  3DML A;  2G2Q A;  2C8U A;  1B9Y C;  1KNG A;  4J57 E;  3F4T A;  3S9F A;  2LRN A;  3CRU A;  2YWN A;  3QFA C;  5ID2 A;  1F3B A;  4BVX A;  4XHM A;  5IOW A;  3Q19 A;  2V1M A;  2FNO A;  5IO0 A;  5CP1 A;  5EPF A;  2I81 A;  4MZC A;  4TR0 A;  2V41 A;  3HVV A;  5B6M A;  1V58 A;  5B7C A;  3M1G A;  4MLY A;  3DXB A;  4AJ7 A;  4KND A;  4JRR A;  1FHE A;  4GLT A;  3P2A A;  1XZO A;  4MH2 A;  5ECH B;  4XS4 A;  4GQC A;  4MJE A;  2GSQ A;  5G31 A;  18GS A;  2M46 A;  3ZYW A;  3FY7 A;  1G6Y A;  4OO4 A;  3GX0 A;  3KZQ A;  2H19 A;  3ZVJ D;  5J4U A;  3RPP A;  2J9H A;  6GSX A;  4IJ3 A;  2DJ3 A;  3TUE A;  3BCK A;  2H0H A;  2I4A A;  3I9V 2;  4ZXG A;  3H8Q A;  2DSA A;  1T00 A;  1EWX A;  1OVN A;  2J23 A;  2OAC A;  3QD9 A;  4PGT A;  4IQ1 A;  3WT1 A;  3RHB A;  1AUC A;  1N8J A;  4PUR A;  1HNA A;  22GS A;  2GSS A;  5A5K A;  2EC4 A;  1TKD B;  2IPA A;  4O32 A;  5CO3 A;  3IV4 A;  2ON7 A;  3TJG A;  3TKS A;  1PN9 A;  3EVI A;  5LCZ A;  1F3A A;  2MMN A;  2GQK A;  1XPV A;  1SL0 B;  1TW9 A;  2C3T A;  1JLW A;  2JAC A;  1YZX A;  3O6T A;  1GUM A;  1TU8 A;  5EL8 A;  1GUH A;  4GST A;  5A4W A;  4D73 B;  1JFU A;  2FLS A;  5IMV A;  3ZFB A;  2FWH A;  3QAG A;  1U3A A;  4WEY A;  1Z7R A;  2F9S A;  1OAZ A;  2VOC A;  5IMF A;  4HUA A;  1USB A;  1RK4 A;  4IW9 A;  5E4W A;  2LNT A;  3PIN A;  2HXK A;  4RQR A;  4HOJ A;  1F6M C;  3DD3 A;  4Z7X A;  4RUV A;  2I1U A;  4IEL A;  4Q5F A;  1TK8 B;  1ERW A;  1V98 A;  3APQ A;  1BX9 A;  1Z7P A;  2K18 A;  5FHI A;  1QK8 A;  1K3Y A;  4ZBD A;  3IR4 A;  3VI5 A;  2FA4 A;  2OE3 A;  1SK1 A;  3HDC A;  3QAW A;  3FR9 A;  3W6G A;  4KX4 A;  1NW2 A;  1YEX A;  13GS A;  4HZ4 A;  1THX A;  1V40 A;  5ECS A;  2VCT A;  3LJR A;  1A0R P;  4I2T A;  5L71 A;  10GS A;  2TRX A;  1OKT A;  3ZL5 A;  3RAZ A;  5B8B A;  3LEF A;  2L57 A;  2FA8 A;  2XPD A;  5EY6 A;  2KP2 A;  2DML A;  4TXV A;  4I2U A;  2CQ9 A;  3OR5 A;  4BWQ A;  3NOF A;  3Q18 A;  4TR1 B;  2MMO A;  3HCZ A;  4JE1 A;  5F8B A;  1JZW A;  3LXT A;  2GSR A;  1V2A A;  3KEB A;  4O92 A;  1YJ6 A;  3KMN A;  1K0D A;  1X5D A;  4HQZ A;  3W8J A;  1TTZ A;  2N5F A;  3M8N A;  3ZIJ A;  5CYY A;  1BED A;  2AV4 A;  1TRW A;  2OE1 A;  2QGV A;  5AIS A;  1X9S B;  2RII A;  5KN3 A;  2OBI A;  4ACS A;  2A2S A;  3UAP A;  3H93 A;  1DUG A;  1N2A A;  1VRS D;  3M0F A;  4TR4 A;  2H0G A;  4FYB A;  3EUR A;  3TCO A;  2MMZ A;  4XS1 A;  3UBK A;  1TRU A;  1SD8 A;  1JZR A;  3N5O A;  2CX3 A;  4IGJ A;  2DJ1 A;  3ZML A;  5J3R A;  2KUC A;  2YOI A;  2VLV A;  4IP6 A;  3R2Q A;  4NV2 A;  1MDI A;  1ACV A;  5CRW A;  1OYJ A;  1BJX A;  3DGQ A;  3F9U A;  4MPF A;  5CRE A;  1G6W A;  3UJ1 A;  4XRD A;  1SKS B;  2KOK A;  3LSZ A;  3D5J A;  3IOS A;  4MP4 A;  3VWU A;  3GX8 A;  1T1V A;  2JZT A;  2LV3 A;  4ZB9 A;  3VI7 A;  1YQ1 A;  4LMV A;  5FT3 A;  3UL3 A;  2IIY A;  1T8E B;  2V6K A;  3ME8 A;  1Z9H A;  2HSH A;  2E2G A;  2E2M A;  2ES7 A;  1S3A A;  5F07 A;  5IIZ A;  4POL A;  2D2Z A;  1K0C A;  5D9W A;  4J2F A;  3LG6 A;  3GST A;  4L0W A;  4XCS A;  3QAV A;  4WF5 A;  4WBJ A;  2VM1 A;  2DJJ A;  3P8W A;  3L4N A;  4EC0 A;  3L9U A;  4EE0 A;  4ZB6 A;  4TOP A;  2H6Z A;  2FD3 A;  2FY6 A;  2CVD A;  3VPT A;  2VM2 A;  2VO4 A;  4MF5 A;  1GUK A;  4KW6 A;  2H71 A;  3IRA A;  4ECB A;  2GS3 A;  2H0I A;  5G2Z A;  3HHV A;  3U6V A;  2QKE A;  4K2D A;  3L78 A;  4NHZ A;  1UN2 A;  1XWC A;  1R5A A;  3FHK A;  4WF4 A;  2P5R A;  1YY7 A;  3GYK A;  3L9S A;  5H5R A;  2LJR A;  1TRV A;  1WRY A;  1XWK A;  5D9T A;  2PMT A;  2VD1 A;  5INY A;  1R26 A;  5HFK A;  1VF4 A;  3DWV A;  3M3M A;  4MJC A;  3IK9 A;  1GTB A;  1PSQ A;  1AAZ A;  2RM5 A;  4I8B A;  3LWA A;  3M9K A;  4POB A;  1FB6 A;  2E0Q A;  5ELA A;  2LJA A;  3DVX A;  2LQQ A;  1GSQ A;  1B48 A;  6GSU A;  3QMX A;  3UMA A;  4HS1 A;  19GS A;  4XTS A;  2X8G A;  1VF1 A;  4ECC A;  1SL1 B;  2LST A;  4V2N A;  4ID0 A;  3D21 A;  3DEX A;  14GS A;  2H01 A;  4L5O A;  3LQ7 A;  4RI7 A;  4TRX A;  2XHF A;  1ST9 A;  2CT6 A;  2ZUP A;  5ECR B;  5HFG A;  1K3L A;  1FAA A;  1WPI A;  1M7T A;  2B1K A;  2HSY A;  2PVO C;  2AAW A;  3IPZ A;  3GRX A;  3BJ5 A;  4X1U A;  1GTU A;  1SYR A;  2PU9 C;  5D8I A;  4IKH A;  2LQO A;  5DAL B;  5AGY A;  2B6M A;  1WWJ A;  1BAY A;  3UAR A;  4WR4 A;  3FW2 A;  3F4R A;  3KTB A;  4N10 A;  3E9J B;  5J9B A;  3KP8 A;  4XS6 A;  1ZZY A;  2YZU A;  3VUR A;  3CTG A;  2GT6 A;  5IOX A;  1PQN A;  5ID2 B;  4G10 A;  2CA8 A;  4L5L A;  4MF7 A;  4BA7 A;  2H30 A;  1XW5 A;  4KE3 A;  2HI7 A;  3BD2 A;  1SJZ A;  4HEA 2;  1S3D A;  1HNC A;  2QC7 A;  3HJP A;  4K8M A;  2PER A;  2WUL A;  1ZMA A;  1B4P A;  1XWA A;  5DAK A;  1QFN A;  5DQS A;  2GZY A;  2FGX A;  5KEJ A;  1GTI A;  3L0H A;  5GAN D;  3QDN A;  3EC3 A;  1GLQ A;  1PX6 A;  3GL3 A;  2CV4 A;  5COH A;  3UIW A;  4XS4 B;  1LJR A;  4EKZ A;  1EEJ A;  3LGC A;  1Z5Y E;  1HQO A;  4Q5R A;  2NTO A;  1PL1 A;  1EZK A;  2YJ7 A;  5CRD A;  3WGE A;  1F2E A;  5IMD A;  4LMW A;  2K9F A;  1ZL9 A;  1FO5 A;  4WXT A;  2LTK A;  1ILO A;  2IWT A;  4G9H A;  3O76 A;  2LRT A;  1GNE A;  1BQ7 A;  2WGR A;  4MMM A;  4NPB A;  1I9D A;  3F0I A;  1A8L A;  1RQM A;  2IMK A;  2G0F A;  3GA4 A;  3EMP A;  3D4T A;  2K8V A;  3KTL A;  2EIO A;  3ZTL A;  4NAX A;  2I9H A;  2HRN A;  5ECK B;  4EXJ A;  2KP1 A;  3L9V A;  2YJH A;  4GCI A;  3GNJ A;  4ECI A;  5DDL A;  3HVX A;  1T7P B;  3IAM 2;  2VUP A;  3IC4 A;  3FRC A;  1J0F A;  4MJB A;  1XOA A;  4GSN A;  1S3C A;  2ALB A;  4KH7 A;  1M99 A;  4IS0 A;  2ZNM A;  1SD9 A;  1YKA A;  2LJK A;  2NPB A;  3FZ4 A;  5B8A A;  1UC7 A;  4IN0 A;  12GS A;  2FHE A;  1U6T A;  2BTO T;  1A0F A;  2OKA A;  2F51 A;  1G7E A;  1I5G A;  3G7Y A;  4MK3 A;  5JCW A;  3IHQ A;  3UVT A;  1GSU A;  2IL3 A;  3DVW A;  2GZZ A;  3TOU A;  2GTU A;  5JWR B;  1XCC A;  3PR8 A;  5GAP D;  5JCG A;  2DC5 A;  5IO2 A;  3TOT A;  4EDY A;  2V32 A;  1G0T A;  2OBK A;  3C7M A;  4ISD A;  4O5R A;  3WGD A;  1X5E A;  1GTA A;  3PGT A;  4NXI A;  2NDO A;  2OJL A;  2FUG 2;  1FB0 A;  2E7P A;  4GQF A;  1FVK A;  4MAB A;  5IMZ A;  4AF2 A;  4DEJ A;  1EP7 A;  1C72 A;  2O85 A;  2IME A;  1RW1 A;  2P5Q A;  2N5A A;  4Q5N A;  3ZVJ A;  1BYE A;  3CTF A;  4XRA A;  1M2A A;  2OAD A;  2A4V A;  4AGS A;  1TI1 A;  4E8H A;  2K6V A;  4TXO A;  2LEG A;  3RBT A;  2X8H A;  4EDZ A;  3AY8 A;  8GSS A;  1JLV A;  4KSO A;  1EOH A;  1OC3 A;  4RQX A;  4K6X A;  3C71 A;  3ERG A;  16GS A;  2P31 A;  2H70 A;  5KN1 A;  1WIK A;  2DBC A;  2H73 A;  3HZ4 A;  1T4Z A;  2QSI A;  2R3X A;  4PUA A;  4X0X A;  1WJK A;  5JCU A;  3NZN A;  1TRS A;  1YDK A;  3HA9 A;  3H1N A;  4F03 A;  4YH2 A;  3TRX A;  2HE3 A;  3A5W A;  1SJI A;  2YAN A;  2MMA A;  2VL2 C;  2JSZ A;  1XBS A;  2L6C A;  3GSS A;  2JSY A;  2YP6 A;  2C80 A;  1PL2 A;  1V9W A;  1U88 A;  4H86 A;  1MDK A;  5ABR A;  1OE7 A;  3U5R E;  1FG4 A;  3ZLP A;  20GS A;  2VL9 A;  3LYP A;  2H74 A;  4CDO A;  4BWS A;  1O85 A;  4CW9 A;  3GKM A;  4CHS A;  2VCX A;  5JWO B;  1VGL A;  2F8A A;  3W8S A;  1U3I A;  2X64 A;  1WOU A;  3TDG A;  1K3O A;  4KCE A;  1GP1 A;  5G5E A;  2PBJ A;  3KH7 A;  3A3T A;  2JZR A;  1XXU A;  3E0U A;  1WP0 A;  3F6D A;  2O87 A;  2TIR A;  2B7K A;  1PKZ A;  4BPY A;  2ON5 A;  1BG5 A;  2C3Q A;  5ECO B;  3SWL A;  5AIV A;  1X9M B;  2DMM A;  2XPE A;  3VWV A;  1Y6E A;  4V2L A;  3FK8 A;  2EIR A;  3Q6O A;  4GWR A;  1ON4 A;  4TKY A;  3GMF A;  5D73 A;  4OD7 A;  3TJK A;  4N30 A;  5CRH A;  3VFI A;  3UVH A;  4PNF A;  3ZIV A;  6GSY A;  3LXZ A;  3ZIT A;  1SL2 B;  1M2D A;  1GSE A;  1NHY A;  2WJU A;  1AC1 A;  2IFQ A;  2VCW A;  4OWY A;  4PQH A;  2RM6 A;  4JBB A;  3K8N A;  4GSS A;  3TB2 A;  4JR6 A;  1QGV A;  4DSS A;  2X99 A;  4KDU A;  4MA9 A;  1KBN A;  5F0G A;  2RUF A;  1X5C A;  3GH6 A;  1K0M A;  4V2M A;  1AW9 A;  3APS A;  2R37 A;  3G9B A;  2HYX A;  4K7N A;  2H72 A;  5D93 A;  3HY2 A;  2WS2 A;  2WDU A;  2L4Q A;  2GLR A;  3GFK A;  17GS A;  3IA1 A;  5IQY A;  3A2W A;  3DYR A;  1NM3 A;  2KLX A;  2YWM A;  4K1F A;  1T4Y A;  4K0N A;  1A2J A;  2B3S A;  4MDC A;  5D9V A;  2DJ2 A;  2PPT A;  1EEM A;  1O6J A;  5GSS A;  5G30 A;  1M0U A;  3TKS E;  3GV1 A;  5LNK e;  2H76 A;  2RLI A;  3GUR A;  2VL3 A;  2L6D A;  4TVE A;  1R4W A;  1PX7 A;  1WE0 A;  5CRG A;  5C04 A;  3GL5 A;  2BJX A;  4Q5Q A;  3ZMK A;  2IMD A;  2PUK C;  1XFL A;  5FWG A;  4POK A;  3WD6 A;  1E6B A;  2N5B A;  1SYX A;  4KCA A;  2LS5 A;  4XIH A;  1KEB A;  1PKW A;  3MDK A;  2NVL A;  2C4J A;  4KUN A;  4OFM A;  1THO A;  4HU7 A;  2B7J A;  3LYK A;  5F06 A;  5A4U A;  4HQS A;  3UOM A;  3BCI A;  4I5Q A;  1R5P A;  1J08 A;  3GKX A;  3WT2 A;  3I6A A;  3BBY A;  2IMI A;  3HVS A;  1SKR B;  2VD0 A;  1AXD A;  4PX1 A;  2L5L A;  2YNX A;  5DVB A;  2VCQ A;  3P7X A;  4JR4 A;  2CAI A;  2OA7 A;  3C8E A;  3GHA A;  5D96 A;  3ME7 A;  5DCG A;  4ZL8 A;  2HRF A;  2M72 A;  1A24 A;  1O81 A;  3ZRD A;  1WMJ A;  1OC9 A;  2HNL A;  5DAK B;  1FOV A;  3HJO A;  2DIZ A;  2VLU A;  2WB9 A;  1GLP A;  1UA5 A;  2F8F A;  2YWO A;  1TI3 A;  2LNS A;  1MTC A;  2C0E A;  2VCZ A;  4QQ7 A;  3CRT A;  3G7I A;  4ML6 A;  2YZH A;  1ZGN A;  5CNW A;  1GUL A;  2PVQ A;  4F0B A;  2FWE A;  1HYU A;  3CXG A;  2H8L A;  2HZE A;  3GTU A;  3LFL A;  5ECI B;  2JZS A;  3VWW A;  2ZCT A;  1URM A;  6GST A;  2C3N A;  6GSW A;  4MF6 A;  4G2E A;  3F6F A;  3KP9 A;  5JWQ B;  5IM9 A;  4PNG A;  4TW5 A;  2R4V A;  5DQY A;  2IJY A;  3VPQ A;  5H5Q A;  4KB3 A;  5IPG A;  4L8E A;  1VF2 A;  1AQX A;  2PWJ A;  1CQG A;  5EVO A;  1GL8 A;  1A2M A;  3QFB C;  5DCH A;  4NWY A;  5F05 A;  1DSB A;  3GKN A;  4ULX A;  1O73 A;  3EIN A;  4POM A;  4QL9 A;  3VWX A;  3IXR A;  1EP8 A;  4J56 E;  4KA0 A;  3PH9 A;  1HD2 A;  3DIE A;  1IYH A;  2VIM A;  4JU5 A;  3KIJ A;  5E59 A;  1M9B A;  1JZO A;  1O8X A;  3KXO A;  4HJ2 A;  1A2L A;  2TRC P;  3FR6 A;  4K7O A;  3O3T A;  5CAX A;  5ECM B;  2BMX A;  1GWC A;  2H6X A;  1E2Y A;  3CSH A;  4ML1 A;  2YWI A;  1GSS A;  2WRT A;  1XIY A;  4N0Z A;  4ZIL A;  3LOR A;  3ED3 A;  6GSV A;  4E8E A;  3FZ5 A;  5B6N A;  4FYC A;  3EU3 A;  4GXZ A;  5ECN B;  2EIQ A;  1K0A A;  1B8X A;  2H66 A;  5DJM A;  1GSF A;  3MAK A;  5KN2 A;  1W4V A;  3ERW A;  3BOA A;  1SK2 A;  1AQW A;  2H1G A;  1H4O A;  2B1L A;  3TKQ A;  3APO A;  3QR6 A;  3EE2 A;  1O7U A;  3KCM A;  4EF0 A;  4L0U A;  1HNB A;  1MDJ A;  4LL1 B;  3IAS 2;  1YF0 A;  4K9Z A;  1X0R A;  3JCM L;  3KGK A;  2PGT A;  1NSW A;  4FYU A;  4BVY A;  2B5Y A;  1FW1 A;  4WET A;  3TJJ A;  2B5E A;  3ISO A;  3CSI A;  2MBT A;  4G19 A;  3US3 A;  4TXO B;  5DBQ A;  4K7I A;  4KDX A;  4ZB8 A;  1MD4 A;  2JAD A;  1YF1 A;  3HYP A;  3C73 A;  4JED A;  4MCU A;  2OE0 A;  2F3M A;  3Q74 A;  5KN0 A;  1W89 A;  3EU4 A;  4EVM A;  3FR3 A;  3F8U A;  2HFD A;  3KM6 A;  2VCV A;  1QUW A;  4OCF A;  3MSZ A;  5H5S A;  1TOF A;  2AYT A;  2VL2 A;  2WFC A;  4I6X A;  2AJQ B;  4ZBA A;  1K0N A;  4F2I A;  1LU4 A;  4PQI A;  1CQH A;  1M9A A;  3MWH A;  9GSS A;  1PA3 A;  2PN8 A;  4HI7 A;  4NMU A;  1XWB A;  2XBI A;  1GSY A;  4O7H A;  1ML6 A;  2H1D A;  4KGI A;  2I3Y A;  4PUF C;  2FWF A;  4ZBB A;  1TK5 B;  1DBY A;  4HDE A;  2REM A;  4ZL7 A;  3N9J A;  4MJA A;  2VAF A;  4F9Z A;  3C1S A;  1SJ6 A;  1PRX A;  1SKW B;  4LL4 B;  3J7Y b;  2R5G A;  4FIW A;  1K0O A;  1B9X C;  2CX4 A;  4IP1 A;  4DSR A;  4RI6 A;  3V1W A;  4I97 A;  4N0V A;  1PMT A;  1X9W B;  4KAE A;  1SK0 A;  4IVF A;  3TKS C;  1ZCP A;  2L59 A;  1A8Y A;  3D22 A;  4WR5 A;  2AUV A;  3GN3 A;  2YN1 A;  4HU9 A;  1MD3 A;  4LA1 A;  4EUY A;  4HJM A;  4D73 A;  5G1K A;  1GSD A;  3M9J A;  2GVP A;  4V1A g;  4X43 A;  5IPH A;  1ERV A;  1TP9 A;  2GDR A;  1QXH A;  3HXS A;  5GST A; 
#chains in the Genus database with same CATH topology
 4JZQ A;  3KMO A;  5D9X A;  1Q98 A;  2C0D A;  4OCE A;  2LRC A;  3FYG A;  5G5F A;  5J5N A;  1G7O A;  3UBL A;  4YAV A;  1Y25 A;  4ZIJ A;  3CSJ A;  2GT5 A;  2MZC A;  1GNW A;  4NV5 A;  2IMF A;  3A2X A;  5IMC A;  2P0G A;  4PXO A;  1ZOF A;  4N11 A;  2L4C A;  5HQP A;  2NBS A;  2IFQ B;  3TRP A;  1SEN A;  1DE2 A;  4P3Y B;  3ERF A;  2O7K A;  3ZFL A;  4HZ2 A;  4IBP A;  2DJ0 A;  4DSS B;  2YV9 A;  3WYW A;  2A2R A;  3DKS A;  3GIX A;  3FZA A;  4K0G A;  1EGO A;  3CBU A;  4LLR A;  3TKP A;  2R2J A;  4KDY A;  1F37 A;  2LKU A;  1XWG A;  3GUS A;  1B4Q A;  2L5O A;  4QL7 A;  3IE3 A;  3TRQ A;  1XW6 A;  1GH2 A;  4ICY A;  1Z6M A;  2LUS A;  1M2B A;  3HJM A;  2H75 A;  4ILF A;  1FVJ A;  3QCP A;  4TR1 A;  1OC8 A;  4ECJ A;  4DSQ A;  5J41 A;  3CMI A;  2GZP A;  4AJ8 A;  3H4K A;  2AB6 A;  2JL4 A;  3NIV A;  1EV4 A;  2DJK A;  5AN1 A;  1MEK A;  2WZ9 A;  1NHO A;  4OMV A;  3EYT A;  2M80 A;  2XC2 A;  1ZYQ B;  1TK0 B;  1O8W A;  2H6Y A;  1ERU A;  4TR3 A;  2O8V B;  3D0Z A;  3CYN A;  5HR2 A;  3RDW A;  1VF3 A;  3IK7 A;  3H79 A;  3D4M A;  5HR1 A;  4IHU A;  1ABA A;  2FWG A;  3F63 A;  3HKR A;  1ERT A;  3F3Q A;  5GZZ B;  2DLX A;  5HR3 A;  2GQM A;  3FKF A;  4IJI A;  4MZB A;  4OFN A;  3D6I A;  2H1A A;  5DJL A;  4GTU A;  2X8C A;  2CVK A;  11GS A;  3I69 A;  1LBK A;  2O89 A;  1TXX A;  3GH9 A;  1U87 A;  2JU5 A;  5IMA A;  4G0I A;  4WKW A;  2YV7 A;  4MPG A;  1TDI A;  1J9B A;  1Z6N A;  1KTE A;  5HFI A;  4YQU A;  2H1B A;  5ENU A;  3HZ8 A;  2WCI A;  2GST A;  3VLN A;  4EL1 A;  3I43 A;  3RPN A;  4EIQ A;  4GF0 A;  2A4H A;  4YAP A;  3J7Y k;  3SBC A;  4YQV A;  1YKC A;  1R7H A;  1XVQ A;  1YEP A;  2IN3 A;  2YPM A;  2RUE A;  3FEU A;  2CZ2 A;  1OKD A;  1OC9 B;  1TJD A;  5J9C A;  4FO5 A;  1A23 A;  4IQA A;  1ZYP A;  4ZL9 A;  2V6O A;  4PQ1 A;  2Z9S A;  4KSM A;  3UEM A;  3TJB A;  1V57 A;  3MYD A;  1F9M A;  4Z2T A;  5ELG A;  6GSS A;  2C0F A;  4OO5 A;  1XW9 A;  4F0C A;  1ZYE A;  1EOG A;  3VK9 A;  4WBR D;  1GRX A;  2CVB A;  2HZE B;  3GTU B;  5LD0 A;  1AQV A;  4BL7 A;  3G7J A;  4OFT A;  2HT9 A;  1QMV A;  2X4A A;  3MIX A;  3ZZX A;  1JHB A;  3ZRE A;  3R3E A;  5HR0 A;  3MNG A;  3FZ9 A;  4F82 A;  1T3B A;  2KHP A;  3TJF A;  2GQL A;  2HZF A;  3RHC A;  1OE8 A;  4FH8 A;  3WGX A;  3P90 A;  4CY6 A;  2AHE A;  3KJY A;  2C1Y A;  1TU7 A;  2MBS A;  3IDV A;  1QQ2 A;  1UVZ A;  1IYI A;  1XVW A;  1AIU A;  5G1L A;  4NHW A;  1XOB A;  2R6K A;  3TKR A;  4YQM A;  2YCD A;  4AJ6 A;  2HLS A;  4EO3 A;  3DRN A;  3QPM A;  1PGT A;  1DE1 A;  3KH9 A;  1Z3E A;  3TGZ A;  2CZ3 A;  3EWL A;  2C0G A;  5ECL B;  1H75 A;  5C00 A;  4TN8 A;  1SU9 A;  4V1A p;  4DVC A;  4O5Q A;  3IBH A;  2GGT A;  3E3E A;  2K8S A;  3F4S A;  4MZW A;  5ECP B;  2CAQ A;  2MYG A;  4MH3 A;  2V2G A;  2FCH A;  1EGR A;  1JZD A;  1Q4J A;  3F3R A;  3C1R A;  1EV9 A;  5A4V A;  3QOU A;  2DIY A;  3GKK A;  5ECQ B;  3HD5 A;  3KD0 A;  4GRF A;  3A2V A;  1PD2 1;  5DAL A;  2B5X A;  1K0B A;  3EMX A;  5AIX A;  2XBQ A;  7GSS A;  2VLT A;  3DML A;  4K5S A;  4G0L A;  2G2Q A;  2C8U A;  1B9Y C;  1KNG A;  4J57 E;  2HRK A;  3F4T A;  3S9F A;  2LRN A;  3CRU A;  2YWN A;  3QFA C;  5ID2 A;  1F3B A;  4BVX A;  4XHM A;  5IOW A;  3Q19 A;  2V1M A;  2FNO A;  5IO0 A;  5CP1 A;  5EPF A;  2I81 A;  4MZC A;  4TR0 A;  2V41 A;  3HVV A;  4BVY B;  5B6M A;  1V58 A;  5B7C A;  3M1G A;  4MLY A;  3DXB A;  4AJ7 A;  4KND A;  4JRR A;  1FHE A;  4GLT A;  3P2A A;  1XZO A;  4MH2 A;  5ECH B;  4XS4 A;  3PPU A;  4GQC A;  4MJE A;  2GSQ A;  5G31 A;  18GS A;  2M46 A;  3ZYW A;  3FY7 A;  1G6Y A;  4OO4 A;  3GX0 A;  3KZQ A;  2H19 A;  3ZVJ D;  5J4U A;  2UZ8 A;  3RPP A;  2J9H A;  6GSX A;  4IJ3 A;  2DJ3 A;  3TUE A;  3BCK A;  2H0H A;  2I4A A;  3I9V 2;  4ZXG A;  3H8Q A;  2DSA A;  1T00 A;  1EWX A;  1OVN A;  2J23 A;  2OAC A;  3QD9 A;  4PGT A;  4IQ1 A;  3WT1 A;  3RHB A;  1AUC A;  1N8J A;  4PUR A;  1HNA A;  22GS A;  2GSS A;  5A5K A;  2EC4 A;  1TKD B;  2IPA A;  4O32 A;  5CO3 A;  3IV4 A;  2ON7 A;  3TJG A;  3TKS A;  4KF9 A;  1PN9 A;  3EVI A;  5LCZ A;  1F3A A;  2MMN A;  2GQK A;  1XPV A;  4YKG A;  1SL0 B;  1TW9 A;  2C3T A;  1JLW A;  2JAC A;  1YZX A;  3O6T A;  3A5I A;  1GUM A;  1TU8 A;  5EL8 A;  1GUH A;  4GST A;  4EIP A;  5A4W A;  4D73 B;  1JFU A;  2FLS A;  5IMV A;  3ZFB A;  2FWH A;  3QAG A;  1U3A A;  4WEY A;  1Z7R A;  2F9S A;  1OAZ A;  2VOC A;  5IMF A;  4HUA A;  1USB A;  1RK4 A;  4IW9 A;  5E4W A;  2LNT A;  3PIN A;  2HXK A;  4RQR A;  4HOJ A;  1F6M C;  3DD3 A;  4Z7X A;  4RUV A;  2I1U A;  4IEL A;  4Q5F A;  1TK8 B;  1ERW A;  1V98 A;  3APQ A;  1BX9 A;  1Z7P A;  2K18 A;  5FHI A;  1QK8 A;  1K3Y A;  4ZBD A;  3IR4 A;  3VI5 A;  2FA4 A;  2OE3 A;  1SK1 A;  3HDC A;  3QAW A;  3FR9 A;  3W6G A;  4KX4 A;  1NW2 A;  1YEX A;  13GS A;  4HZ4 A;  1THX A;  1V40 A;  5ECS A;  2VCT A;  3LJR A;  1A0R P;  4I2T A;  5L71 A;  10GS A;  2TRX A;  1OKT A;  3ZL5 A;  3RAZ A;  5B8B A;  3LEF A;  2L57 A;  2FA8 A;  2XPD A;  5EY6 A;  2KP2 A;  2DML A;  4TXV A;  4I2U A;  2CQ9 A;  3OR5 A;  4BWQ A;  3NOF A;  3Q18 A;  4TR1 B;  2MMO A;  3HCZ A;  4JE1 A;  5F8B A;  1JZW A;  3LXT A;  2GSR A;  1V2A A;  3KEB A;  4O92 A;  1YJ6 A;  3KMN A;  1K0D A;  1X5D A;  4HQZ A;  3W8J A;  1TTZ A;  2N5F A;  3M8N A;  3ZIJ A;  5CYY A;  1BED A;  2AV4 A;  1TRW A;  2OE1 A;  2QGV A;  5AIS A;  1X9S B;  2RII A;  3IC8 A;  5KN3 A;  2OBI A;  4ACS A;  2A2S A;  3UAP A;  3H93 A;  1DUG A;  1N2A A;  1VRS D;  3M0F A;  4TR4 A;  2H0G A;  4FYB A;  3EUR A;  3TCO A;  2MMZ A;  4XS1 A;  3UBK A;  1TRU A;  1SD8 A;  1JZR A;  3N5O A;  2CX3 A;  4IGJ A;  2DJ1 A;  3ZML A;  5J3R A;  2KUC A;  2YOI A;  2VLV A;  4IP6 A;  3R2Q A;  4NV2 A;  1MDI A;  1ACV A;  2X49 A;  5CRW A;  1OYJ A;  1BJX A;  3DGQ A;  3F9U A;  4MPF A;  5CRE A;  1G6W A;  3UJ1 A;  4XRD A;  1SKS B;  2KOK A;  3LSZ A;  3D5J A;  3IOS A;  4MP4 A;  3VWU A;  3GX8 A;  1T1V A;  2JZT A;  2LV3 A;  4ZB9 A;  3VI7 A;  1YQ1 A;  4LMV A;  5FT3 A;  3UL3 A;  2IIY A;  1T8E B;  2V6K A;  3ME8 A;  1Z9H A;  2HSH A;  2E2G A;  2E2M A;  2ES7 A;  1S3A A;  5F07 A;  5IIZ A;  4POL A;  2D2Z A;  1K0C A;  5D9W A;  4J2F A;  3LG6 A;  3GST A;  4L0W A;  4XCS A;  3QAV A;  4WF5 A;  4WBJ A;  2VM1 A;  2DJJ A;  3P8W A;  3L4N A;  4EC0 A;  3L9U A;  4EE0 A;  4ZB6 A;  4TOP A;  2H6Z A;  2FD3 A;  2R0P A;  2FY6 A;  2CVD A;  3VPT A;  2VM2 A;  2VO4 A;  4MF5 A;  1GUK A;  4KW6 A;  2H71 A;  3IRA A;  4ECB A;  2GS3 A;  2H0I A;  5G2Z A;  3HHV A;  3U6V A;  2QKE A;  4K2D A;  4Z2U A;  3L78 A;  4BL7 B;  4NHZ A;  1UN2 A;  1XWC A;  1R5A A;  3FHK A;  4WF4 A;  2P5R A;  1YY7 A;  3GYK A;  3L9S A;  5H5R A;  2LJR A;  1TRV A;  1WRY A;  1XWK A;  5D9T A;  2PMT A;  2VD1 A;  5INY A;  1R26 A;  5HFK A;  1VF4 A;  3DWV A;  3M3M A;  4PTS A;  4MJC A;  3IK9 A;  1GTB A;  1PSQ A;  1AAZ A;  2RM5 A;  4I8B A;  3LWA A;  3M9K A;  4POB A;  1FB6 A;  2E0Q A;  5ELA A;  2LJA A;  3DVX A;  2LQQ A;  1GSQ A;  1B48 A;  6GSU A;  3QMX A;  3UMA A;  4HS1 A;  19GS A;  4XTS A;  2X8G A;  1VF1 A;  4ECC A;  1SL1 B;  2LST A;  4V2N A;  4ID0 A;  4X4J A;  3D21 A;  1M3J A;  3DEX A;  14GS A;  2H01 A;  4L5O A;  3LQ7 A;  4RI7 A;  4TRX A;  2XHF A;  1ST9 A;  3CQF A;  2CT6 A;  2ZUP A;  5ECR B;  5HFG A;  1K3L A;  1FAA A;  1WPI A;  1M7T A;  2B1K A;  2HSY A;  2PVO C;  2AAW A;  3IPZ A;  3GRX A;  3BJ5 A;  4X1U A;  1GTU A;  1SYR A;  2PU9 C;  5D8I A;  4IKH A;  2LQO A;  5DAL B;  5AGY A;  4CY8 A;  2B6M A;  1WWJ A;  1BAY A;  3UAR A;  4WR4 A;  3FW2 A;  3F4R A;  3KTB A;  4N10 A;  3E9J B;  5J9B A;  3KP8 A;  4XS6 A;  1ZZY A;  5KOW A;  2YZU A;  3VUR A;  3CTG A;  2GT6 A;  5IOX A;  1PQN A;  5ID2 B;  4G10 A;  2CA8 A;  4BVX B;  4L5L A;  4MF7 A;  4BA7 A;  2H30 A;  1XW5 A;  4KE3 A;  2HI7 A;  3BD2 A;  1SJZ A;  4HEA 2;  1S3D A;  1HNC A;  2QC7 A;  3HJP A;  4K8M A;  2PER A;  2WUL A;  1ZMA A;  1B4P A;  1XWA A;  5DAK A;  1QFN A;  5DQS A;  2GZY A;  2FGX A;  5KEJ A;  1GTI A;  3L0H A;  5GAN D;  3QDN A;  3EC3 A;  1GLQ A;  1PX6 A;  3GL3 A;  2CV4 A;  5COH A;  3UIW A;  4XS4 B;  1LJR A;  4EKZ A;  1EEJ A;  3LGC A;  1Z5Y E;  1HQO A;  4Q5R A;  2NTO A;  1PL1 A;  1EZK A;  2YJ7 A;  5CRD A;  3WGE A;  1F2E A;  5IMD A;  4LMW A;  2K9F A;  1ZL9 A;  1FO5 A;  1ZYN A;  4WXT A;  2LTK A;  1ILO A;  4USS A;  2IWT A;  4G9H A;  3O76 A;  2LRT A;  1GNE A;  1BQ7 A;  2WGR A;  4MMM A;  4NPB A;  1I9D A;  3F0I A;  1A8L A;  1RQM A;  2IMK A;  2G0F A;  3GA4 A;  1XG8 A;  3EMP A;  3D4T A;  2K8V A;  3KTL A;  2EIO A;  3ZTL A;  4NAX A;  2I9H A;  2HRN A;  5ECK B;  4EXJ A;  2KP1 A;  3L9V A;  2HSM A;  2YJH A;  4GCI A;  3GNJ A;  4ECI A;  5DDL A;  3HVX A;  1T7P B;  3IAM 2;  2VUP A;  3IC4 A;  3FRC A;  1J0F A;  4MJB A;  1XOA A;  4GSN A;  1S3C A;  2ALB A;  4KH7 A;  1M99 A;  4IS0 A;  2ZNM A;  1SD9 A;  1YKA A;  2LJK A;  2NPB A;  3FZ4 A;  5B8A A;  1UC7 A;  4IN0 A;  12GS A;  2FHE A;  1U6T A;  2BTO T;  1A0F A;  2OKA A;  2F51 A;  1G7E A;  1I5G A;  3G7Y A;  4MK3 A;  5JCW A;  3IHQ A;  3UVT A;  1GSU A;  1S3R A;  2IL3 A;  3DVW A;  2GZZ A;  3TOU A;  2GTU A;  5JWR B;  1XCC A;  3PR8 A;  5GAP D;  5JCG A;  2DC5 A;  5IO2 A;  3TOT A;  4EDY A;  2V32 A;  1G0T A;  2OBK A;  3C7M A;  4ISD A;  4O5R A;  3WGD A;  1X5E A;  1GTA A;  3PGT A;  4NXI A;  2NDO A;  2OJL A;  2FUG 2;  1FB0 A;  2E7P A;  4GQF A;  1FVK A;  4MAB A;  5IMZ A;  4AF2 A;  4DEJ A;  4K2X A;  1EP7 A;  1C72 A;  2O85 A;  2IME A;  1RW1 A;  2P5Q A;  2N5A A;  4Q5N A;  3ZVJ A;  1BYE A;  3CTF A;  4XRA A;  1M2A A;  2OAD A;  2A4V A;  4AGS A;  1TI1 A;  4E8H A;  2K6V A;  4TXO A;  2LEG A;  3RBT A;  2X8H A;  4EDZ A;  3AY8 A;  8GSS A;  1JLV A;  4Z2R A;  4KSO A;  1EOH A;  1OC3 A;  4RQX A;  4K6X A;  3C71 A;  3ERG A;  16GS A;  2P31 A;  2H70 A;  4A5P A;  5KN1 A;  1WIK A;  2DKI A;  2DBC A;  2H73 A;  3HZ4 A;  1T4Z A;  2QSI A;  2R3X A;  4PUA A;  4X0X A;  1WJK A;  5JCU A;  3NZN A;  1TRS A;  1YDK A;  2A2P A;  3HA9 A;  3H1N A;  4F03 A;  4YH2 A;  3TRX A;  2HE3 A;  3A5W A;  1SJI A;  2YAN A;  2MMA A;  2VL2 C;  2JSZ A;  1XBS A;  2L6C A;  3GSS A;  2JSY A;  2YP6 A;  2C80 A;  1PL2 A;  1V9W A;  1U88 A;  4H86 A;  1MDK A;  5ABR A;  1OE7 A;  1PFO A;  3U5R E;  1FG4 A;  3ZLP A;  20GS A;  2VL9 A;  3LYP A;  2H74 A;  4CDO A;  4BWS A;  1O85 A;  4CW9 A;  3GKM A;  4CHS A;  2VCX A;  5JWO B;  1VGL A;  1PN0 A;  2F8A A;  3W8S A;  1U3I A;  2X64 A;  1WOU A;  3TDG A;  1K3O A;  4KCE A;  1GP1 A;  5G5E A;  2PBJ A;  3KH7 A;  3A3T A;  2JZR A;  1XXU A;  3E0U A;  1WP0 A;  3F6D A;  2O87 A;  2TIR A;  2B7K A;  1PKZ A;  4BPY A;  2ON5 A;  1BG5 A;  2C3Q A;  3IHG A;  5ECO B;  3SWL A;  5AIV A;  1X9M B;  2DMM A;  2XPE A;  3VWV A;  1Y6E A;  4V2L A;  3FK8 A;  2EIR A;  3Q6O A;  4GWR A;  1M3I A;  1ON4 A;  4TKY A;  3GMF A;  5D73 A;  4OD7 A;  3TJK A;  4N30 A;  5CRH A;  3VFI A;  3UVH A;  4PNF A;  3ZIV A;  6GSY A;  3LXZ A;  3ZIT A;  5BRT A;  1SL2 B;  1M2D A;  1GSE A;  1NHY A;  2WJU A;  1AC1 A;  2IFQ A;  2VCW A;  4OWY A;  4PQH A;  2RM6 A;  4JBB A;  3K8N A;  4GSS A;  3TB2 A;  4JR6 A;  1QGV A;  4DSS A;  2X99 A;  4KDU A;  4MA9 A;  1KBN A;  5F0G A;  2RUF A;  1X5C A;  3GH6 A;  1K0M A;  4V2M A;  1AW9 A;  3APS A;  2R37 A;  3G9B A;  2HYX A;  4K7N A;  4G0K A;  3EPT A;  2H72 A;  5D93 A;  3HY2 A;  2WS2 A;  2WDU A;  2L4Q A;  2QA1 A;  2GLR A;  3GFK A;  17GS A;  3IA1 A;  5IQY A;  3A2W A;  3DYR A;  1NM3 A;  2KLX A;  2YWM A;  4K1F A;  1T4Y A;  4K0N A;  1A2J A;  2B3S A;  4MDC A;  5D9V A;  2DJ2 A;  2PPT A;  1EEM A;  1O6J A;  5GSS A;  5G30 A;  1M0U A;  3TKS E;  3GV1 A;  5LNK e;  2H76 A;  2RLI A;  3GUR A;  2VL3 A;  2L6D A;  4TVE A;  1R4W A;  1PX7 A;  1WE0 A;  5CRG A;  5C04 A;  3GL5 A;  2BJX A;  4Q5Q A;  3ZMK A;  2IMD A;  2PUK C;  1XFL A;  5FWG A;  4POK A;  3WD6 A;  1E6B A;  2N5B A;  1SYX A;  4KCA A;  2LS5 A;  4XIH A;  1KEB A;  1PKW A;  3MDK A;  2NVL A;  2C4J A;  4KUN A;  4OFM A;  1THO A;  4HU7 A;  2B7J A;  2R0C A;  3LYK A;  5F06 A;  5A4U A;  4HQS A;  3UOM A;  3BCI A;  4I5Q A;  1R5P A;  3LW9 A;  1J08 A;  3GKX A;  3WT2 A;  3I6A A;  3BBY A;  2IMI A;  3HVS A;  1SKR B;  2VD0 A;  1AXD A;  4PX1 A;  2L5L A;  2YNX A;  5DVB A;  2VCQ A;  4FQU A;  3P7X A;  4JR4 A;  2CAI A;  2OA7 A;  3C8E A;  3GHA A;  5D96 A;  3ME7 A;  5DCG A;  4ZL8 A;  2HRF A;  2M72 A;  1A24 A;  1O81 A;  3ZRD A;  1WMJ A;  1OC9 A;  2HNL A;  5DAK B;  1FOV A;  3HJO A;  2DIZ A;  2VLU A;  2WB9 A;  1GLP A;  1UA5 A;  2F8F A;  2YWO A;  1TI3 A;  2LNS A;  1MTC A;  2C0E A;  4BIK A;  2VCZ A;  4QQ7 A;  3CRT A;  3G7I A;  4ML6 A;  2YZH A;  1ZGN A;  5CNW A;  1GUL A;  2PVQ A;  4F0B A;  2FWE A;  1HYU A;  3CXG A;  2H8L A;  2HZE A;  3GTU A;  3LFL A;  5ECI B;  2JZS A;  3VWW A;  2ZCT A;  5KOX A;  1URM A;  6GST A;  2C3N A;  6GSW A;  4MF6 A;  4G2E A;  3F6F A;  3KP9 A;  5JWQ B;  5IM9 A;  4PNG A;  4TW5 A;  2R4V A;  5DQY A;  2IJY A;  3VPQ A;  5H5Q A;  2DKH A;  4KB3 A;  5IPG A;  4L8E A;  1VF2 A;  4O5U A;  1AQX A;  2PWJ A;  1CQG A;  2HRA A;  5EVO A;  1GL8 A;  1A2M A;  3QFB C;  5DCH A;  4NWY A;  5F05 A;  1DSB A;  3GKN A;  3FMW A;  4ULX A;  1O73 A;  3EIN A;  4POM A;  4QL9 A;  3VWX A;  3IXR A;  1EP8 A;  4J56 E;  4KA0 A;  3PH9 A;  1HD2 A;  3DIE A;  1IYH A;  2VIM A;  4JU5 A;  3KIJ A;  5E59 A;  1M9B A;  1JZO A;  4YKF A;  1O8X A;  3KXO A;  4HJ2 A;  1A2L A;  2TRC P;  3FR6 A;  4K7O A;  3O3T A;  5CAX A;  5ECM B;  2BMX A;  1GWC A;  2H6X A;  1E2Y A;  3CSH A;  4ML1 A;  2YWI A;  1GSS A;  2WRT A;  1XIY A;  4N0Z A;  4ZIL A;  3LOR A;  3ED3 A;  6GSV A;  4E8E A;  3FZ5 A;  5B6N A;  4FYC A;  3EU3 A;  4GXZ A;  5ECN B;  2EIQ A;  1K0A A;  1B8X A;  2H66 A;  5DJM A;  1GSF A;  3MAK A;  5KN2 A;  1W4V A;  2R0G A;  3ERW A;  3BOA A;  1SK2 A;  1AQW A;  2H1G A;  1H4O A;  2B1L A;  3TKQ A;  5BMU A;  3APO A;  3QR6 A;  3EE2 A;  1O7U A;  3KCM A;  4EF0 A;  4L0U A;  1HNB A;  1MDJ A;  4LL1 B;  3IAS 2;  1YF0 A;  4K9Z A;  1X0R A;  3JCM L;  3KGK A;  4HSC X;  2PGT A;  1NSW A;  4FYU A;  4BVY A;  2B5Y A;  1FW1 A;  3HVN A;  4WET A;  3TJJ A;  2B5E A;  3ISO A;  4K5R A;  3CSI A;  2MBT A;  4G19 A;  3US3 A;  4TXO B;  5DBQ A;  4K7I A;  4KDX A;  4ZB8 A;  1MD4 A;  2JAD A;  1YF1 A;  3HYP A;  3C73 A;  4JED A;  4MCU A;  2OE0 A;  2F3M A;  3Q74 A;  5KN0 A;  1W89 A;  3EU4 A;  4EVM A;  3FR3 A;  3F8U A;  2HFD A;  3KM6 A;  2VCV A;  1QUW A;  4OCF A;  3MSZ A;  5H5S A;  1TOF A;  2AYT A;  2VL2 A;  2WFC A;  4I6X A;  2AJQ B;  4ZBA A;  1K0N A;  4F2I A;  1LU4 A;  4PQI A;  1CQH A;  1M9A A;  3MWH A;  9GSS A;  1PA3 A;  2PN8 A;  4HI7 A;  4NMU A;  1XWB A;  2XBI A;  1GSY A;  4O7H A;  1ML6 A;  2H1D A;  4KGI A;  2I3Y A;  4PUF C;  2FWF A;  4ZBB A;  1TK5 B;  1DBY A;  4HDE A;  2REM A;  4ZL7 A;  3N9J A;  4MJA A;  2VAF A;  4F9Z A;  3C1S A;  1SJ6 A;  1PRX A;  1SKW B;  4LL4 B;  3J7Y b;  2R5G A;  1FOH A;  4FIW A;  1K0O A;  1B9X C;  2CX4 A;  4IP1 A;  4DSR A;  4RI6 A;  3V1W A;  4I97 A;  4N0V A;  1PMT A;  1X9W B;  4KAE A;  1SK0 A;  4IVF A;  3TKS C;  1ZCP A;  2L59 A;  1A8Y A;  3D22 A;  4MNN A;  4WR5 A;  2AUV A;  3GN3 A;  2QA2 A;  2YN1 A;  4HU9 A;  1MD3 A;  4LA1 A;  4EUY A;  4HJM A;  4D73 A;  5G1K A;  1GSD A;  3M9J A;  2GVP A;  4V1A g;  4X43 A;  5IPH A;  1ERV A;  1TP9 A;  2GDR A;  1QXH A;  3HXS A;  5GST A; 
#chains in the Genus database with same CATH homology
 4JZQ A;  3KMO A;  5D9X A;  1Q98 A;  2C0D A;  4OCE A;  2LRC A;  3FYG A;  5G5F A;  5J5N A;  1G7O A;  3UBL A;  4YAV A;  1Y25 A;  4ZIJ A;  3CSJ A;  2GT5 A;  2MZC A;  1GNW A;  4NV5 A;  2IMF A;  3A2X A;  5IMC A;  2P0G A;  4PXO A;  1ZOF A;  4N11 A;  2L4C A;  5HQP A;  2NBS A;  2IFQ B;  3TRP A;  1SEN A;  1DE2 A;  4P3Y B;  3ERF A;  2O7K A;  3ZFL A;  4HZ2 A;  4IBP A;  2DJ0 A;  4DSS B;  2YV9 A;  3WYW A;  2A2R A;  3DKS A;  3GIX A;  3FZA A;  4K0G A;  1EGO A;  3CBU A;  4LLR A;  3TKP A;  2R2J A;  4KDY A;  1F37 A;  2LKU A;  1XWG A;  3GUS A;  1B4Q A;  2L5O A;  4QL7 A;  3IE3 A;  3TRQ A;  1XW6 A;  1GH2 A;  4ICY A;  1Z6M A;  2LUS A;  1M2B A;  3HJM A;  2H75 A;  4ILF A;  1FVJ A;  3QCP A;  4TR1 A;  1OC8 A;  4ECJ A;  4DSQ A;  5J41 A;  3CMI A;  2GZP A;  4AJ8 A;  3H4K A;  2AB6 A;  2JL4 A;  3NIV A;  1EV4 A;  2DJK A;  5AN1 A;  1MEK A;  2WZ9 A;  1NHO A;  4OMV A;  3EYT A;  2M80 A;  2XC2 A;  1ZYQ B;  1TK0 B;  1O8W A;  2H6Y A;  1ERU A;  4TR3 A;  2O8V B;  3D0Z A;  3CYN A;  5HR2 A;  3RDW A;  1VF3 A;  3IK7 A;  3H79 A;  3D4M A;  5HR1 A;  4IHU A;  1ABA A;  2FWG A;  3F63 A;  3HKR A;  1ERT A;  3F3Q A;  5GZZ B;  2DLX A;  5HR3 A;  2GQM A;  3FKF A;  4IJI A;  4MZB A;  4OFN A;  3D6I A;  2H1A A;  5DJL A;  4GTU A;  2X8C A;  2CVK A;  11GS A;  3I69 A;  1LBK A;  2O89 A;  1TXX A;  3GH9 A;  1U87 A;  2JU5 A;  5IMA A;  4G0I A;  4WKW A;  2YV7 A;  4MPG A;  1TDI A;  1J9B A;  1Z6N A;  1KTE A;  5HFI A;  4YQU A;  2H1B A;  5ENU A;  3HZ8 A;  2WCI A;  2GST A;  3VLN A;  4EL1 A;  3I43 A;  3RPN A;  4EIQ A;  4GF0 A;  2A4H A;  4YAP A;  3J7Y k;  3SBC A;  4YQV A;  1YKC A;  1R7H A;  1XVQ A;  1YEP A;  2IN3 A;  2YPM A;  2RUE A;  3FEU A;  2CZ2 A;  1OKD A;  1OC9 B;  1TJD A;  5J9C A;  4FO5 A;  1A23 A;  4IQA A;  1ZYP A;  4ZL9 A;  2V6O A;  4PQ1 A;  2Z9S A;  4KSM A;  3UEM A;  3TJB A;  1V57 A;  3MYD A;  1F9M A;  4Z2T A;  5ELG A;  6GSS A;  2C0F A;  4OO5 A;  1XW9 A;  4F0C A;  1ZYE A;  1EOG A;  3VK9 A;  4WBR D;  1GRX A;  2CVB A;  2HZE B;  3GTU B;  5LD0 A;  1AQV A;  4BL7 A;  3G7J A;  4OFT A;  2HT9 A;  1QMV A;  2X4A A;  3MIX A;  3ZZX A;  1JHB A;  3ZRE A;  3R3E A;  5HR0 A;  3MNG A;  3FZ9 A;  4F82 A;  1T3B A;  2KHP A;  3TJF A;  2GQL A;  2HZF A;  3RHC A;  1OE8 A;  4FH8 A;  3WGX A;  3P90 A;  4CY6 A;  2AHE A;  3KJY A;  2C1Y A;  1TU7 A;  2MBS A;  3IDV A;  1QQ2 A;  1UVZ A;  1IYI A;  1XVW A;  1AIU A;  5G1L A;  4NHW A;  1XOB A;  2R6K A;  3TKR A;  4YQM A;  2YCD A;  4AJ6 A;  2HLS A;  4EO3 A;  3DRN A;  3QPM A;  1PGT A;  1DE1 A;  3KH9 A;  1Z3E A;  3TGZ A;  2CZ3 A;  3EWL A;  2C0G A;  5ECL B;  1H75 A;  5C00 A;  4TN8 A;  1SU9 A;  4V1A p;  4DVC A;  4O5Q A;  3IBH A;  2GGT A;  3E3E A;  2K8S A;  3F4S A;  4MZW A;  5ECP B;  2CAQ A;  2MYG A;  4MH3 A;  2V2G A;  2FCH A;  1EGR A;  1JZD A;  1Q4J A;  3F3R A;  3C1R A;  1EV9 A;  5A4V A;  3QOU A;  2DIY A;  3GKK A;  5ECQ B;  3HD5 A;  3KD0 A;  4GRF A;  3A2V A;  1PD2 1;  5DAL A;  2B5X A;  1K0B A;  3EMX A;  5AIX A;  2XBQ A;  7GSS A;  2VLT A;  3DML A;  4K5S A;  4G0L A;  2G2Q A;  2C8U A;  1B9Y C;  1KNG A;  4J57 E;  2HRK A;  3F4T A;  3S9F A;  2LRN A;  3CRU A;  2YWN A;  3QFA C;  5ID2 A;  1F3B A;  4BVX A;  4XHM A;  5IOW A;  3Q19 A;  2V1M A;  2FNO A;  5IO0 A;  5CP1 A;  5EPF A;  2I81 A;  4MZC A;  4TR0 A;  2V41 A;  3HVV A;  4BVY B;  5B6M A;  1V58 A;  5B7C A;  3M1G A;  4MLY A;  3DXB A;  4AJ7 A;  4KND A;  4JRR A;  1FHE A;  4GLT A;  3P2A A;  1XZO A;  4MH2 A;  5ECH B;  4XS4 A;  3PPU A;  4GQC A;  4MJE A;  2GSQ A;  5G31 A;  18GS A;  2M46 A;  3ZYW A;  3FY7 A;  1G6Y A;  4OO4 A;  3GX0 A;  3KZQ A;  2H19 A;  3ZVJ D;  5J4U A;  2UZ8 A;  3RPP A;  2J9H A;  6GSX A;  4IJ3 A;  2DJ3 A;  3TUE A;  3BCK A;  2H0H A;  2I4A A;  3I9V 2;  4ZXG A;  3H8Q A;  2DSA A;  1T00 A;  1EWX A;  1OVN A;  2J23 A;  2OAC A;  3QD9 A;  4PGT A;  4IQ1 A;  3WT1 A;  3RHB A;  1AUC A;  1N8J A;  4PUR A;  1HNA A;  22GS A;  2GSS A;  5A5K A;  2EC4 A;  1TKD B;  2IPA A;  4O32 A;  5CO3 A;  3IV4 A;  2ON7 A;  3TJG A;  3TKS A;  4KF9 A;  1PN9 A;  3EVI A;  5LCZ A;  1F3A A;  2MMN A;  2GQK A;  1XPV A;  4YKG A;  1SL0 B;  1TW9 A;  2C3T A;  1JLW A;  2JAC A;  1YZX A;  3O6T A;  3A5I A;  1GUM A;  1TU8 A;  5EL8 A;  1GUH A;  4GST A;  4EIP A;  5A4W A;  4D73 B;  1JFU A;  2FLS A;  5IMV A;  3ZFB A;  2FWH A;  3QAG A;  1U3A A;  4WEY A;  1Z7R A;  2F9S A;  1OAZ A;  2VOC A;  5IMF A;  4HUA A;  1USB A;  1RK4 A;  4IW9 A;  5E4W A;  2LNT A;  3PIN A;  2HXK A;  4RQR A;  4HOJ A;  1F6M C;  3DD3 A;  4Z7X A;  4RUV A;  2I1U A;  4IEL A;  4Q5F A;  1TK8 B;  1ERW A;  1V98 A;  3APQ A;  1BX9 A;  1Z7P A;  2K18 A;  5FHI A;  1QK8 A;  1K3Y A;  4ZBD A;  3IR4 A;  3VI5 A;  2FA4 A;  2OE3 A;  1SK1 A;  3HDC A;  3QAW A;  3FR9 A;  3W6G A;  4KX4 A;  1NW2 A;  1YEX A;  13GS A;  4HZ4 A;  1THX A;  1V40 A;  5ECS A;  2VCT A;  3LJR A;  1A0R P;  4I2T A;  5L71 A;  10GS A;  2TRX A;  1OKT A;  3ZL5 A;  3RAZ A;  5B8B A;  3LEF A;  2L57 A;  2FA8 A;  2XPD A;  5EY6 A;  2KP2 A;  2DML A;  4TXV A;  4I2U A;  2CQ9 A;  3OR5 A;  4BWQ A;  3NOF A;  3Q18 A;  4TR1 B;  2MMO A;  3HCZ A;  4JE1 A;  5F8B A;  1JZW A;  3LXT A;  2GSR A;  1V2A A;  3KEB A;  4O92 A;  1YJ6 A;  3KMN A;  1K0D A;  1X5D A;  4HQZ A;  3W8J A;  1TTZ A;  2N5F A;  3M8N A;  3ZIJ A;  5CYY A;  1BED A;  2AV4 A;  1TRW A;  2OE1 A;  2QGV A;  5AIS A;  1X9S B;  2RII A;  3IC8 A;  5KN3 A;  2OBI A;  4ACS A;  2A2S A;  3UAP A;  3H93 A;  1DUG A;  1N2A A;  1VRS D;  3M0F A;  4TR4 A;  2H0G A;  4FYB A;  3EUR A;  3TCO A;  2MMZ A;  4XS1 A;  3UBK A;  1TRU A;  1SD8 A;  1JZR A;  3N5O A;  2CX3 A;  4IGJ A;  2DJ1 A;  3ZML A;  5J3R A;  2KUC A;  2YOI A;  2VLV A;  4IP6 A;  3R2Q A;  4NV2 A;  1MDI A;  1ACV A;  2X49 A;  5CRW A;  1OYJ A;  1BJX A;  3DGQ A;  3F9U A;  4MPF A;  5CRE A;  1G6W A;  3UJ1 A;  4XRD A;  1SKS B;  2KOK A;  3LSZ A;  3D5J A;  3IOS A;  4MP4 A;  3VWU A;  3GX8 A;  1T1V A;  2JZT A;  2LV3 A;  4ZB9 A;  3VI7 A;  1YQ1 A;  4LMV A;  5FT3 A;  3UL3 A;  2IIY A;  1T8E B;  2V6K A;  3ME8 A;  1Z9H A;  2HSH A;  2E2G A;  2E2M A;  2ES7 A;  1S3A A;  5F07 A;  5IIZ A;  4POL A;  2D2Z A;  1K0C A;  5D9W A;  4J2F A;  3LG6 A;  3GST A;  4L0W A;  4XCS A;  3QAV A;  4WF5 A;  4WBJ A;  2VM1 A;  2DJJ A;  3P8W A;  3L4N A;  4EC0 A;  3L9U A;  4EE0 A;  4ZB6 A;  4TOP A;  2H6Z A;  2FD3 A;  2R0P A;  2FY6 A;  2CVD A;  3VPT A;  2VM2 A;  2VO4 A;  4MF5 A;  1GUK A;  4KW6 A;  2H71 A;  3IRA A;  4ECB A;  2GS3 A;  2H0I A;  5G2Z A;  3HHV A;  3U6V A;  2QKE A;  4K2D A;  4Z2U A;  3L78 A;  4BL7 B;  4NHZ A;  1UN2 A;  1XWC A;  1R5A A;  3FHK A;  4WF4 A;  2P5R A;  1YY7 A;  3GYK A;  3L9S A;  5H5R A;  2LJR A;  1TRV A;  1WRY A;  1XWK A;  5D9T A;  2PMT A;  2VD1 A;  5INY A;  1R26 A;  5HFK A;  1VF4 A;  3DWV A;  3M3M A;  4PTS A;  4MJC A;  3IK9 A;  1GTB A;  1PSQ A;  1AAZ A;  2RM5 A;  4I8B A;  3LWA A;  3M9K A;  4POB A;  1FB6 A;  2E0Q A;  5ELA A;  2LJA A;  3DVX A;  2LQQ A;  1GSQ A;  1B48 A;  6GSU A;  3QMX A;  3UMA A;  4HS1 A;  19GS A;  4XTS A;  2X8G A;  1VF1 A;  4ECC A;  1SL1 B;  2LST A;  4V2N A;  4ID0 A;  4X4J A;  3D21 A;  3DEX A;  14GS A;  2H01 A;  4L5O A;  3LQ7 A;  4RI7 A;  4TRX A;  2XHF A;  1ST9 A;  2CT6 A;  2ZUP A;  5ECR B;  5HFG A;  1K3L A;  1FAA A;  1WPI A;  1M7T A;  2B1K A;  2HSY A;  2PVO C;  2AAW A;  3IPZ A;  3GRX A;  3BJ5 A;  4X1U A;  1GTU A;  1SYR A;  2PU9 C;  5D8I A;  4IKH A;  2LQO A;  5DAL B;  5AGY A;  4CY8 A;  2B6M A;  1WWJ A;  1BAY A;  3UAR A;  4WR4 A;  3FW2 A;  3F4R A;  3KTB A;  4N10 A;  3E9J B;  5J9B A;  3KP8 A;  4XS6 A;  1ZZY A;  5KOW A;  2YZU A;  3VUR A;  3CTG A;  2GT6 A;  5IOX A;  1PQN A;  5ID2 B;  4G10 A;  2CA8 A;  4BVX B;  4L5L A;  4MF7 A;  4BA7 A;  2H30 A;  1XW5 A;  4KE3 A;  2HI7 A;  3BD2 A;  1SJZ A;  4HEA 2;  1S3D A;  1HNC A;  2QC7 A;  3HJP A;  4K8M A;  2PER A;  2WUL A;  1ZMA A;  1B4P A;  1XWA A;  5DAK A;  1QFN A;  5DQS A;  2GZY A;  2FGX A;  5KEJ A;  1GTI A;  3L0H A;  5GAN D;  3QDN A;  3EC3 A;  1GLQ A;  1PX6 A;  3GL3 A;  2CV4 A;  5COH A;  3UIW A;  4XS4 B;  1LJR A;  4EKZ A;  1EEJ A;  3LGC A;  1Z5Y E;  1HQO A;  4Q5R A;  2NTO A;  1PL1 A;  1EZK A;  2YJ7 A;  5CRD A;  3WGE A;  1F2E A;  5IMD A;  4LMW A;  2K9F A;  1ZL9 A;  1FO5 A;  1ZYN A;  4WXT A;  2LTK A;  1ILO A;  4USS A;  2IWT A;  4G9H A;  3O76 A;  2LRT A;  1GNE A;  1BQ7 A;  2WGR A;  4MMM A;  4NPB A;  1I9D A;  3F0I A;  1A8L A;  1RQM A;  2IMK A;  2G0F A;  3GA4 A;  3EMP A;  3D4T A;  2K8V A;  3KTL A;  2EIO A;  3ZTL A;  4NAX A;  2I9H A;  2HRN A;  5ECK B;  4EXJ A;  2KP1 A;  3L9V A;  2HSM A;  2YJH A;  4GCI A;  3GNJ A;  4ECI A;  5DDL A;  3HVX A;  1T7P B;  3IAM 2;  2VUP A;  3IC4 A;  3FRC A;  1J0F A;  4MJB A;  1XOA A;  4GSN A;  1S3C A;  2ALB A;  4KH7 A;  1M99 A;  4IS0 A;  2ZNM A;  1SD9 A;  1YKA A;  2LJK A;  2NPB A;  3FZ4 A;  5B8A A;  1UC7 A;  4IN0 A;  12GS A;  2FHE A;  1U6T A;  2BTO T;  1A0F A;  2OKA A;  2F51 A;  1G7E A;  1I5G A;  3G7Y A;  4MK3 A;  5JCW A;  3IHQ A;  3UVT A;  1GSU A;  2IL3 A;  3DVW A;  2GZZ A;  3TOU A;  2GTU A;  5JWR B;  1XCC A;  3PR8 A;  5GAP D;  5JCG A;  2DC5 A;  5IO2 A;  3TOT A;  4EDY A;  2V32 A;  1G0T A;  2OBK A;  3C7M A;  4ISD A;  4O5R A;  3WGD A;  1X5E A;  1GTA A;  3PGT A;  4NXI A;  2NDO A;  2OJL A;  2FUG 2;  1FB0 A;  2E7P A;  4GQF A;  1FVK A;  4MAB A;  5IMZ A;  4AF2 A;  4DEJ A;  4K2X A;  1EP7 A;  1C72 A;  2O85 A;  2IME A;  1RW1 A;  2P5Q A;  2N5A A;  4Q5N A;  3ZVJ A;  1BYE A;  3CTF A;  4XRA A;  1M2A A;  2OAD A;  2A4V A;  4AGS A;  1TI1 A;  4E8H A;  2K6V A;  4TXO A;  2LEG A;  3RBT A;  2X8H A;  4EDZ A;  3AY8 A;  8GSS A;  1JLV A;  4Z2R A;  4KSO A;  1EOH A;  1OC3 A;  4RQX A;  4K6X A;  3C71 A;  3ERG A;  16GS A;  2P31 A;  2H70 A;  4A5P A;  5KN1 A;  1WIK A;  2DKI A;  2DBC A;  2H73 A;  3HZ4 A;  1T4Z A;  2QSI A;  2R3X A;  4PUA A;  4X0X A;  1WJK A;  5JCU A;  3NZN A;  1TRS A;  1YDK A;  2A2P A;  3HA9 A;  3H1N A;  4F03 A;  4YH2 A;  3TRX A;  2HE3 A;  3A5W A;  1SJI A;  2YAN A;  2MMA A;  2VL2 C;  2JSZ A;  1XBS A;  2L6C A;  3GSS A;  2JSY A;  2YP6 A;  2C80 A;  1PL2 A;  1V9W A;  1U88 A;  4H86 A;  1MDK A;  5ABR A;  1OE7 A;  3U5R E;  1FG4 A;  3ZLP A;  20GS A;  2VL9 A;  3LYP A;  2H74 A;  4CDO A;  4BWS A;  1O85 A;  4CW9 A;  3GKM A;  4CHS A;  2VCX A;  5JWO B;  1VGL A;  1PN0 A;  2F8A A;  3W8S A;  1U3I A;  2X64 A;  1WOU A;  3TDG A;  1K3O A;  4KCE A;  1GP1 A;  5G5E A;  2PBJ A;  3KH7 A;  3A3T A;  2JZR A;  1XXU A;  3E0U A;  1WP0 A;  3F6D A;  2O87 A;  2TIR A;  2B7K A;  1PKZ A;  4BPY A;  2ON5 A;  1BG5 A;  2C3Q A;  3IHG A;  5ECO B;  3SWL A;  5AIV A;  1X9M B;  2DMM A;  2XPE A;  3VWV A;  1Y6E A;  4V2L A;  3FK8 A;  2EIR A;  3Q6O A;  4GWR A;  1ON4 A;  4TKY A;  3GMF A;  5D73 A;  4OD7 A;  3TJK A;  4N30 A;  5CRH A;  3VFI A;  3UVH A;  4PNF A;  3ZIV A;  6GSY A;  3LXZ A;  3ZIT A;  5BRT A;  1SL2 B;  1M2D A;  1GSE A;  1NHY A;  2WJU A;  1AC1 A;  2IFQ A;  2VCW A;  4OWY A;  4PQH A;  2RM6 A;  4JBB A;  3K8N A;  4GSS A;  3TB2 A;  4JR6 A;  1QGV A;  4DSS A;  2X99 A;  4KDU A;  4MA9 A;  1KBN A;  5F0G A;  2RUF A;  1X5C A;  3GH6 A;  1K0M A;  4V2M A;  1AW9 A;  3APS A;  2R37 A;  3G9B A;  2HYX A;  4K7N A;  4G0K A;  3EPT A;  2H72 A;  5D93 A;  3HY2 A;  2WS2 A;  2WDU A;  2L4Q A;  2QA1 A;  2GLR A;  3GFK A;  17GS A;  3IA1 A;  5IQY A;  3A2W A;  3DYR A;  1NM3 A;  2KLX A;  2YWM A;  4K1F A;  1T4Y A;  4K0N A;  1A2J A;  2B3S A;  4MDC A;  5D9V A;  2DJ2 A;  2PPT A;  1EEM A;  1O6J A;  5GSS A;  5G30 A;  1M0U A;  3TKS E;  3GV1 A;  5LNK e;  2H76 A;  2RLI A;  3GUR A;  2VL3 A;  2L6D A;  4TVE A;  1R4W A;  1PX7 A;  1WE0 A;  5CRG A;  5C04 A;  3GL5 A;  2BJX A;  4Q5Q A;  3ZMK A;  2IMD A;  2PUK C;  1XFL A;  5FWG A;  4POK A;  3WD6 A;  1E6B A;  2N5B A;  1SYX A;  4KCA A;  2LS5 A;  4XIH A;  1KEB A;  1PKW A;  3MDK A;  2NVL A;  2C4J A;  4KUN A;  4OFM A;  1THO A;  4HU7 A;  2B7J A;  2R0C A;  3LYK A;  5F06 A;  5A4U A;  4HQS A;  3UOM A;  3BCI A;  4I5Q A;  1R5P A;  3LW9 A;  1J08 A;  3GKX A;  3WT2 A;  3I6A A;  3BBY A;  2IMI A;  3HVS A;  1SKR B;  2VD0 A;  1AXD A;  4PX1 A;  2L5L A;  2YNX A;  5DVB A;  2VCQ A;  4FQU A;  3P7X A;  4JR4 A;  2CAI A;  2OA7 A;  3C8E A;  3GHA A;  5D96 A;  3ME7 A;  5DCG A;  4ZL8 A;  2HRF A;  2M72 A;  1A24 A;  1O81 A;  3ZRD A;  1WMJ A;  1OC9 A;  2HNL A;  5DAK B;  1FOV A;  3HJO A;  2DIZ A;  2VLU A;  2WB9 A;  1GLP A;  1UA5 A;  2F8F A;  2YWO A;  1TI3 A;  2LNS A;  1MTC A;  2C0E A;  2VCZ A;  4QQ7 A;  3CRT A;  3G7I A;  4ML6 A;  2YZH A;  1ZGN A;  5CNW A;  1GUL A;  2PVQ A;  4F0B A;  2FWE A;  1HYU A;  3CXG A;  2H8L A;  2HZE A;  3GTU A;  3LFL A;  5ECI B;  2JZS A;  3VWW A;  2ZCT A;  5KOX A;  1URM A;  6GST A;  2C3N A;  6GSW A;  4MF6 A;  4G2E A;  3F6F A;  3KP9 A;  5JWQ B;  5IM9 A;  4PNG A;  4TW5 A;  2R4V A;  5DQY A;  2IJY A;  3VPQ A;  5H5Q A;  2DKH A;  4KB3 A;  5IPG A;  4L8E A;  1VF2 A;  4O5U A;  1AQX A;  2PWJ A;  1CQG A;  2HRA A;  5EVO A;  1GL8 A;  1A2M A;  3QFB C;  5DCH A;  4NWY A;  5F05 A;  1DSB A;  3GKN A;  3FMW A;  4ULX A;  1O73 A;  3EIN A;  4POM A;  4QL9 A;  3VWX A;  3IXR A;  1EP8 A;  4J56 E;  4KA0 A;  3PH9 A;  1HD2 A;  3DIE A;  1IYH A;  2VIM A;  4JU5 A;  3KIJ A;  5E59 A;  1M9B A;  1JZO A;  4YKF A;  1O8X A;  3KXO A;  4HJ2 A;  1A2L A;  2TRC P;  3FR6 A;  4K7O A;  3O3T A;  5CAX A;  5ECM B;  2BMX A;  1GWC A;  2H6X A;  1E2Y A;  3CSH A;  4ML1 A;  2YWI A;  1GSS A;  2WRT A;  1XIY A;  4N0Z A;  4ZIL A;  3LOR A;  3ED3 A;  6GSV A;  4E8E A;  3FZ5 A;  5B6N A;  4FYC A;  3EU3 A;  4GXZ A;  5ECN B;  2EIQ A;  1K0A A;  1B8X A;  2H66 A;  5DJM A;  1GSF A;  3MAK A;  5KN2 A;  1W4V A;  2R0G A;  3ERW A;  3BOA A;  1SK2 A;  1AQW A;  2H1G A;  1H4O A;  2B1L A;  3TKQ A;  5BMU A;  3APO A;  3QR6 A;  3EE2 A;  1O7U A;  3KCM A;  4EF0 A;  4L0U A;  1HNB A;  1MDJ A;  4LL1 B;  3IAS 2;  1YF0 A;  4K9Z A;  1X0R A;  3JCM L;  3KGK A;  2PGT A;  1NSW A;  4FYU A;  4BVY A;  2B5Y A;  1FW1 A;  4WET A;  3TJJ A;  2B5E A;  3ISO A;  4K5R A;  3CSI A;  2MBT A;  4G19 A;  3US3 A;  4TXO B;  5DBQ A;  4K7I A;  4KDX A;  4ZB8 A;  1MD4 A;  2JAD A;  1YF1 A;  3HYP A;  3C73 A;  4JED A;  4MCU A;  2OE0 A;  2F3M A;  3Q74 A;  5KN0 A;  1W89 A;  3EU4 A;  4EVM A;  3FR3 A;  3F8U A;  2HFD A;  3KM6 A;  2VCV A;  1QUW A;  4OCF A;  3MSZ A;  5H5S A;  1TOF A;  2AYT A;  2VL2 A;  2WFC A;  4I6X A;  2AJQ B;  4ZBA A;  1K0N A;  4F2I A;  1LU4 A;  4PQI A;  1CQH A;  1M9A A;  3MWH A;  9GSS A;  1PA3 A;  2PN8 A;  4HI7 A;  4NMU A;  1XWB A;  2XBI A;  1GSY A;  4O7H A;  1ML6 A;  2H1D A;  4KGI A;  2I3Y A;  4PUF C;  2FWF A;  4ZBB A;  1TK5 B;  1DBY A;  4HDE A;  2REM A;  4ZL7 A;  3N9J A;  4MJA A;  2VAF A;  4F9Z A;  3C1S A;  1SJ6 A;  1PRX A;  1SKW B;  4LL4 B;  3J7Y b;  2R5G A;  1FOH A;  4FIW A;  1K0O A;  1B9X C;  2CX4 A;  4IP1 A;  4DSR A;  4RI6 A;  3V1W A;  4I97 A;  4N0V A;  1PMT A;  1X9W B;  4KAE A;  1SK0 A;  4IVF A;  3TKS C;  1ZCP A;  2L59 A;  1A8Y A;  3D22 A;  4MNN A;  4WR5 A;  2AUV A;  3GN3 A;  2QA2 A;  2YN1 A;  4HU9 A;  1MD3 A;  4LA1 A;  4EUY A;  4HJM A;  4D73 A;  5G1K A;  1GSD A;  3M9J A;  2GVP A;  4V1A g;  4X43 A;  5IPH A;  1ERV A;  1TP9 A;  2GDR A;  1QXH A;  3HXS A;  5GST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...