1FOVA

Glutaredoxin 3 from escherichia coli in the fully oxidized form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
ANVEIYTKETCPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGRTTVPQIFIDAQHIGGYDDLYALDARGGLDPLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAREDOXIN 3
publication title NMR structure of oxidized glutaredoxin 3 from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 26
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2000-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1fovA00
4MMMA 3TCOA 2R6KA 2PERA 3FZ9A 1EGOA 1FAAA 5CYYA 4TR3A 5EPFA 4X0XA 2B7JA 2LS5A 4I8BA 3F4TA 5IMCA 4TR0A 2HI7A 2XPEA 3HYPA 3EMXA 3VFIA 3W6GA 2MYGA 3BBYA 1EEMA 4PNGA 3MAKA 2LJRA 2C1YA 11GSA 1T1VA 1GLPA 4TVEA 2EIOA 1Z7RA 5DCGA 5DJMA 2RM6A 5KN1A 3QAVA 3U5RE 5ECHB 2P0GA 1S3CA 2R2JA 5AN1A 4GF0A 1Y6EA 3EURA 4KE3A 4ML6A 3QR6A 3P7XA 4KUNA 1GH2A 2C0GA 3DKSA 4TRXA 2CVDA 3GUSA 2QGVA 1SL0B 5JCGA 5HR3A 3QAGA 3ZVJA 1V98A 4OFNA 2ES7A 3IPZA 2V32A 4AJ6A 4BVXA 4ECBA 1OKDA 3TB2A 3GHAA 2D2ZA 3IBHA 3VPQA 4GTUA 4MP4A 2VCTA 8GSSA 1T4YA 2P31A 4KDYA 1JFUA 4HDEA 4ZXGA 3KMNA 1U3AA 2VLVA 3KGKA 4POLA 5LD0A 5EY6A 4KAEA 1O6JA 4IN0A 4XHMA 3KEBA 1SK1A 3ZMKA 4LLRA 3FW2A 4I6XA 4TXVA 5CNWA 3RHCA 3APOA 5FWGA 4FIWA 3EVIA 4IJIA 2JSZA 1MTCA 4RI6A 3PINA 3TOTA 1QQ2A 2EIRA 1M2DA 2B5XA 1TK5B 3LSZA 2H6YA 3C73A 1SKRB 2YWOA 3RBTA 6GSUA 3D21A 4KA0A 3W8SA 3PGTA 3ERGA 2NPBA 2VAFA 2JSYA 4YAPA 1ERVA 2FGXA 17GSA 4NV5A 2JU5A 4OCFA 4X43A 1TRSA 2FUG2 2R37A 1PX7A 18GSA 2LRNA 2ZUPA 5A5KA 3L9SA 1Y25A 1JHBA 4NWYA 2LTKA 1T8EB 2HYXA 1FB6A 1V2AA 1PA3A 2DJJA 3M1GA 4ZB8A 4PNFA 1G7OA 2LNSA 1G0TA 1YKAA 1V40A 3FHKA 5H5QA 3GRXA 2H70A 4F0BA 5G30A 4CDOA 4NV2A 1U87A 1W4VA 4GSNA 1G7EA 4HI7A 4G2EA 1YQ1A 3G7IA 1NW2A 2HNLA 5IQYA 4I2TA 1SYRA 3ZITA 4TKYA 1O73A 2XC2A 2PVQA 2IMDA 2TRXA 3IK7A 2VUPA 2CV4A 2O7KA 2L5OA 3HKRA 3U6VA 1I5GA 4FH8A 5GSTA 2IL3A 1OC9A 3KD0A 3VURA 2CQ9A 1EOHA 3VWVA 2KP1A 2CZ3A 3H1NA 2DMMA 1GP1A 3ZVJD 4QQ7A 1R7HA 3NIVA 4GSSA 2DJKA 4ZL7A 4FYCA 5G1LA 4ECJA 4KGIA 2WCIA 5GZZB 4POBA 3UARA 3L0HA 5D9XA 4EVMA 3F3QA 3HY2A 4NPBA 4XS4B 1OE8A 1SL1B 3ERFA 2HZEA 2L4CA 3ZRDA 4IQ1A 3ZMLA 2OBIA 2P5RA 2C4JA 3LG6A 2YV7A 3E3EA 3LYPA 2CX3A 5CAXA 3GKMA 1Q4JA 4EKZA 16GSA 2M80A 4EDYA 4PQHA 1RK4A 3ME8A 1WRYA 1AQVA 2E7PA 5ECOB 1FO5A 5AGYA 1AAZA 3HXSA 4K2DA 2LQQA 3LQ7A 3IHQA 1AW9A 1PQNA 2CVBA 2FWFA 3VI7A 2CT6A 4Q5FA 2HT9A 4ILFA 3UEMA 3UOMA 3IE3A 1ILOA 3CTGA 1V9WA 4PQIA 1TXXA 2DJ3A 2MMAA 6GSXA 3VLNA 4YQMA 2A2SA 1KEBA 5GAND 2HE3A 3V1WA 3FRCA 2PUKC 1GTAA 2GS3A 2YNXA 1MDJA 2V6OA 3CBUA 4XS4A 5KN0A 4BL7A 2EC4A 4K0GA 2Z9SA 1WMJA 5HR1A 1RW1A 1MDIA 4KCAA 3RHBA 3O6TA 5IMVA 1GLQA 2VD1A 19GSA 1AQXA 3F63A 4GQCA 1ZGNA 1OYJA 3QAWA 3R2QA 2OJLA 3CXGA 4ZILA 3C7MA 1T00A 2C3QA 2DIZA 1U88A 2H01A 1A0FA 4L0WA 3FZ5A 4IVFA 4MPGA 4MZWA 1ZOFA 2AJQB 3TDGA 2RUFA 3CTFA 4WF4A 3CYNA 1AQWA 3KP8A 2X99A 3N5OA 5G5FA 3GH6A 1EOGA 2XBIA 2C3NA 3KTLA 1B4PA 3KZQA 4ZB9A 4HQSA 3ZLPA 1ST9A 2K18A 4L8EA 3F6DA 1X9MB 5AIVA 2JL4A 1PGTA 3D22A 1EP8A 3HJPA 5DAKA 1QUWA 4XS1A 3D6IA 4WBJA 1WJKA 2H1BA 2IMEA 3LXZA 4EL1A 22GSA 3J7Yb 2G0FA 4HJ2A 1H4OA 1PSQA 3CSIA 4HZ4A 1XW9A 1VGLA 1SENA 4IQAA 1XZOA 1F6MC 4GLTA 5A4VA 2WRTA 1E2YA 1DE1A 3GSTA 5A4WA 1K0BA 4OO5A 4JU5A 4GCIA 3GYKA 4EC0A 4I2UA 2DJ1A 1KTEA 1GSYA 5CRDA 4PQ1A 3MDKA 1GSFA 4OO4A 2F51A 2DMLA 2P5QA 4V2LA 3TKQA 3F8UA 3FR3A 5JWRB 4DSSB 2IIYA 1Q98A 4PGTA 3M3MA 4ZL9A 2I9HA 3UBKA 5D9TA 4GWRA 1YDKA 5HR2A 2GZYA 1EGRA 3N9JA 1E6BA 2XBQA 3NOFA 3UVHA 4DSQA 3UVTA 3KH7A 2B6MA 5C00A 3EWLA 2PU9C 5J3RA 2H74A 2AV4A 2IMIA 2YV9A 1UC7A 2GQMA 3A2WA 1TP9A 1O81A 1MD3A 4WBRD 3HD5A 1Z6MA 1XWCA 3ME7A 2B1KA 1ZYEA 2HXKA 2CAIA 3D4MA 2KLXA 2WFCA 4D73B 4F2IA 1GNEA 2VD0A 1TK0B 4WF5A 2C0DA 4F9ZA 4XRAA 1K0MA 4N30A 1S3DA 2YWMA 2VL9A 2PWJA 4GSTA 2TIRA 1FVJA 1GULA 4O5RA 5ELAA 1K3OA 3VK9A 4MZBA 5HFGA 3DRNA 3APQA 3ZIVA 2N5FA 1Z3EA 1PN9A 3WGXA 4O32A 5DALA 4HU9A 5EVOA 4KX4A 2GSQA 2X8GA 3CRUA 2GLRA 2EIQA 2C0FA 2PN8A 2N5AA 5AISA 4ID0A 5D9VA 1G6YA 2RM5A 3LORA 1TDIA 1TTZA 1FG4A 3GL3A 4HQZA 3KMOA 3EE2A 1G6WA 2H66A 4YQVA 3FR6A 3TKSA 1X9WB 1W89A 4MPFA 5HQPA 4EDZA 2GQLA 4KNDA 4NAXA 3GN3A 4I5QA 4IBPA 5J9CA 5JCWA 2WB9A 3AY8A 3GL5A 3C71A 1URMA 4JRRA 1YZXA 5CP1A 6GSVA 1YF1A 5L71A 3HJOA 2IPAA 1XOAA 2OE3A 2M46A 3PH9A 3LFLA 4AJ8A 4POMA 4F0CA 2I81A 4FO5A 1OC3A 1PL1A 5CRHA 1XVQA 3IR4A 5G1KA 1UA5A 5G2ZA 1J9BA 3US3A 4PUFC 2LUSA 2B5EA 5IMFA 2H30A 4I97A 3DIEA 3F4SA 1GTBA 2VL2C 3GKNA 1N8JA 1ABAA 2XHFA 1XBSA 3NZNA 1O8XA 4JEDA 2C0EA 5DVBA 3E9JB 1XWGA 3DVWA 3GX8A 1EV9A 3LYKA 3MNGA 2ON5A 1YF0A 2I3YA 3IOSA 4MJAA 2DIYA 2GTUA 1EWXA 1XVWA 1ERWA 2H73A 2VO4A 2PGTA 5ENUA 4RI7A 1TJDA 3VWXA 5LNKe 5IIZA 4L5OA 3ZTLA 1YEPA 5D9WA 4MLYA 2F8FA 2YP6A 2R5GA 3WGDA 5GSSA 1J08A 1JLWA 3C1RA 1AIUA 5C04A 4L5LA 2AYTA 2DJ2A 3F4RA 3UJ1A 4BWQA 4TN8A 2VCXA 4WETA 14GSA 4ZIJA 3Q74A 9GSSA 5DDLA 3BOAA 2WS2A 3FKFA 4HUAA 1PKZA 1U6TA 3G7JA 3L4NA 1GUMA 4MJEA 4HOJA 1EZKA 2H71A 4LL1B 3HVSA 3UAPA 1ACVA 5B8AA 2DJ0A 1TI1A 6GSWA 3FEUA 2DBCA 5IOWA 4OFTA 3RDWA 5ECQB 2JACA 2VCVA 2FWHA 3P90A 2FCHA 4LA1A 2PPTA 1QMVA 1XOBA 4HZ2A 7GSSA 3SBCA 3KCMA 1U3IA 2CZ2A 2NBSA 2YJHA 5F0GA 1NHOA 3VWUA 4QL9A 2E2MA 3PR8A 3GSSA 2FD3A 4V1Ag 1A2MA 3TJKA 2AUVA 4JR4A 1GSEA 1WP0A 4V2MA 1TRVA 5JWOB 1BAYA 1IYIA 1YJ6A 1EV4A 2R4VA 1R5PA 4RUVA 2CVKA 1PX6A 3I43A 4F03A 3FY7A 4HEA2 2X8HA 3WYWA 3G7YA 3LEFA 1PL2A 4V2NA 2PBJA 3JCML 4OWYA 4IGJA 4TXOB 1VF2A 3P8WA 2LEGA 3H4KA 2H72A 2N5BA 2O85A 5CRWA 3ZREA 5IPGA 3KXOA 2K8VA 3P2AA 5D73A 2GDRA 4MF6A 4WXTA 1HNCA 2E0QA 3F6FA 5E4WA 2H1AA 1VF1A 2H1GA 1K0OA 1A2LA 3GX0A 6GSSA 1X5DA 3QPMA 4FYBA 4MF7A 1T3BA 3OR5A 2HLSA 1GWCA 1M2AA 4XRDA 1BG5A 5IM9A 4J57E 3DYRA 1O8WA 2VIMA 2LJKA 1MEKA 1JZRA 3ISOA 3F9UA 4YAVA 2IWTA 2AHEA 3IAM2 2RLIA 2FHEA 4KW6A 2OACA 1X0RA 1KNGA 4PXOA 1ZCPA 5JWQB 3WT2A 1BJXA 1WE0A 4TR1B 3HJMA 1UN2A 4MJBA 1Z9HA 5DBQA 1FW1A 3UIWA 1XPVA 3GKXA 4LL4B 2H76A 3D4TA 2V6KA 4ZBAA 2IJYA 1B8XA 12GSA 1NM3A 1GSDA 3MWHA 1SYXA 5FHIA 3WD6A 4XCSA 3DWVA 4CHSA 1THOA 3DEXA 2C3TA 1ZYQB 4N0ZA 4K9ZA 2ALBA 2X64A 3HCZA 5IMAA 2YWIA 4IP1A 2WGRA 1AUCA 3M0FA 1M7TA 4ZBBA 4BWSA 2KUCA 4EF0A 2FLSA 2HSYA 2LKUA 1GUKA 3C1SA 2A4VA 2I1UA 3H93A 1A8YA 2H8LA 3EC3A 4LMVA 2RUEA 5ECLB 1RQMA 2VLTA 5ECNB 3O3TA 3TJBA 2GVPA 3LWAA 2YOIA 4ECIA 4K0NA 4BA7A 4AGSA 1N2AA 3ERWA 3LJRA 5CO3A 2R3XA 2CAQA 3LGCA 3I6AA 1B9XC 2TRCP 2B1LA 3D5JA 1B48A 4H86A 2V41A 1NSWA 1FB0A 2DSAA 4IKHA 2MBSA 2L4QA 1DUGA 3QCPA 2H0GA 3G9BA 2YJ7A 3GV1A 1CQGA 1F37A 5ECMB 3KM6A 4EXJA 4MA9A 1DE2A 4X1UA 1GSUA 5DJLA 2KOKA 2FWGA 5DQYA 2C8UA 2FNOA 1F2EA 4K7NA 2L57A 2FY6A 1TRUA 1K0AA 1X5CA 4IP6A 2YN1A 2WZ9A 3FR9A 1WWJA 1BEDA 3FZAA 5HFIA 3QMXA 2QC7A 5ECIB 3IV4A 4HS1A 4K7IA 3EU4A 1QK8A 4ZL8A 1A0RP 1USBA 1JZOA 1EP7A 2HRFA 2OADA 4EE0A 2L59A 5KN2A 2JZTA 4PURA 1VF3A 1PRXA 1M2BA 2GSTA 1I9DA 1LU4A 4JBBA 2E2GA 1HQOA 4OFMA 1CQHA 2VM1A 3DXBA 5IO0A 4KH7A 2GSRA 5J9BA 4DSSA 3TRXA 2H6ZA 2F8AA 1K0NA 3DGQA 1BYEA 1K3YA 3IC4A 5COHA 3A3TA 1PKWA 3IK9A 3DMLA 2VLUA 3CSJA 2AB6A 2H1DA 1R26A 3KIJA 2QKEA 2GT6A 2OE0A 5H5RA 3ZFLA 2AAWA 3UMAA 3O76A 5G5EA 1UVZA 1SD8A 2GSSA 3VPTA 2B3SA 4MCUA 4GXZA 1XWBA 4DEJA 4D73A 4LMWA 5ELGA 4NXIA 4RQXA 1OC8A 2RIIA 1PMTA 3GFKA 2WULA 4G9HA 2WJUA 1XW5A 2LRTA 4HJMA 3LXTA 4BPYA 1TU8A 2NVLA 4F82A 4IS0A 2VOCA 4MABA 3TRQA 1B4QA 3CSHA 2ZCTA 3IRAA 4MDCA 4IHUA 3M8NA 4KB3A 3TJGA 2K8SA 1WOUA 3FZ4A 3SWLA 1BQ7A 4N11A 4K1FA 5G31A 3M9JA 4RQRA 2QSIA 3L78A 3K8NA 4BVYA 4NHWA 2VM2A 2YCDA 2YANA 3TKSE 2MMZA 5HFKA 1SKWB 4ZB6A 3HVVA 6GSTA 5LCZA 2O87A 1SK0A 1TW9A 1DBYA 1HNBA 5ID2B 3L9VA 5D93A 2H6XA 1M99A 3DD3A 4EO3A 1WPIA 2F3MA 3TKSC 3VWWA 3MSZA 2HRNA 1JLVA 1FOVA 2O8VB 1HNAA 4E8EA 4ISDA 1M0UA 5INYA 3BJ5A 3FYGA 5F06A 5B6NA 3GA4A 1GSSA 3F0IA 5KN3A 5F05A 1FHEA 4YH2A 1TI3A 2F9SA 2HSHA 20GSA 3IAS2 4KSMA 4Q5RA 4ML1A 4GQFA 3GNJA 1O7UA 1SJZA 1OC9B 2LQOA 5ECSA 4AJ7A 1MDKA 4KDUA 1JZDA 3CMIA 1B9YC 3KH9A 5F07A 3KP9A 4TOPA 4K8MA 2VCQA 2YZUA 3VI5A 3TRPA 2YWNA 2VCWA 1XWAA 1J0FA 3A5WA 5DQSA 2NDOA 3TGZA 1AXDA 4Z7XA 5ID2A 5GAPD 3QFAC 4JE1A 3RAZA 1MD4A 1TOFA 2JZSA 1SL2B 2HZEB 4MF5A 4CW9A 3QFBC 1A24A 1BX9A 4K7OA 1R4WA 4OCEA 2HZFA 1YEXA 1XFLA 2A2RA 4GRFA 3C8EA 4DSRA 3DVXA 1XW6A 4NMUA 4XIHA 2K6VA 4TR4A 1ERTA 1HD2A 1AC1A 4J2FA 1A8LA 4JR6A 1QFNA 3RPNA 5D8IA 2BTOT 5B8BA 1F9MA 3UBLA 2MBTA 4ULXA 1OAZA 3EMPA 1WIKA 1QXHA 2CA8A 2FWEA 2V1MA 3IXRA 2WDUA 3FK8A 1GRXA 5ECKB 3QOUA 1YY7A 5J41A 2FA4A 3GH9A 2JADA 1SJIA 1M9AA 5J4UA 3Q18A 4ACSA 1VF4A 3WT1A 4IJ3A 1SKSB 4IELA 2IN3A 4XS6A 1ZZYA 5ECPB 5J5NA 2OBKA 4MZCA 1ERUA 1OKTA 3CRTA 5IO2A 1KBNA 1XIYA 3EU3A 3UL3A 1T7PB 1TU7A 1THXA 4WEYA 5E59A 3TOUA 2MMOA 4K6XA 2NTOA 1ML6A 4YQUA 2G2QA 2OKAA 2MMNA 2REMA 2V2GA 1Z5YE 1JZWA 3A2XA 3ZZXA 1PD21 2PVOC 1H75A 2OE1A 3TJJA 3HA9A 5CREA 1S3AA 1GTUA 3BD2A 5AIXA 1ZL9A 5D96A 3HZ4A 4MJCA 2ZNMA 4POKA 3F3RA 3ZFBA 1VRSD 5B6MA 3TKPA 3APSA 1K3LA 3ZL5A 4TXOA 1TK8B 3L9UA 2DC5A 5IPHA 3GKKA 5DAKB 4FYUA 1FVKA 3ZIJA 5DCHA 2ON7A 2M72A 3KTBA 1A23A 2GGTA 1A2JA 2GT5A 1X5EA 4ECCA 2GQKA 2JZRA 1M9BA 5EL8A 4JZQA 3HVXA 1LBKA 1QGVA 1OE7A 2L6CA 3A2VA 1V57A 2OA7A 3WGEA 2KP2A 4L0UA 4DVCA 1SD9A 1SJ6A 4AF2A 3HZ8A 4P3YB 2IMKA 2CX4A 10GSA 2YZHA 3ZYWA 4NHZA 1Z6NA 2C80A 1OVNA 3GIXA 3QD9A 2VCZA 3H8QA 1K0CA 4MH2A 2BJXA 4WR4A 2HFDA 5IMDA 1O85A 2H0HA 1GSQA 2DLXA 4KSOA 4TW5A 3HDCA 3M9KA 1GTIA 1LJRA 4WKWA 1C72A 3Q19A 3W8JA 3GTUB 4G19A 1XWKA 2FA8A 3H79A 4MK3A 3KJYA 3Q6OA 5IMZA 1V58A 2MZCA 4TR1A 2J23A 2LNTA 2K9FA 1NHYA 3BCKA 3IA1A 4ZBDA 2GZPA 4G10A 2O89A 2XPDA 5ABRA 3GURA 2VL3A 1DSBA 4O7HA 1GNWA 5ECRB 2LRCA 3TUEA 2B7KA 2H75A 4MH3A 4IW9A 2LV3A 4N10A 5KEJA 1XCCA 2IFQB 3HHVA 3D0ZA 2LJAA 2L5LA 1EEJA 5FT3A 5DALB 3GMFA 5B7CA 4N0VA 2BMXA 1R5AA 2J9HA 1X9SB 2H19A 4OD7A 3J7Yk 2L6DA 2KHPA 5JCUA 4WR5A 1TRWA 3QDNA 1TKDB 2PMTA 4PX1A 3GTUA 3BCIA 4Q5QA 4E8HA 4KCEA 3ED3A 4V1Ap 2B5YA 2I4AA 3RPPA 3TKRA 5IOXA 2X8CA 2LSTA 1F3AA 4OMVA 5A4UA 1HYUA 5F8BA 2IMFA 4QL7A 3E0UA 1YKCA 4XTSA 1ZMAA 4O92A 5HR0A 1T4ZA 1K0DA 3EINA 2H0IA 2GZZA 3S9FA 3EYTA 13GSA 1Z7PA 2VL2A 3IDVA 3I69A 1ON4A 2YPMA 2IFQA 1GL8A 3I9V2 4KDXA 1SK2A 4PUAA 6GSYA 5H5SA 3TJFA 4J56E 5CRGA 4EUYA 1IYHA 1XXUA 4HU7A 1GUHA 1F3BA 1SU9A 4Q5NA
chains in the Genus database with same CATH superfamily
4MMMA 3TCOA 2R6KA 1PFOA 2PERA 3FZ9A 1EGOA 1FAAA 5CYYA 4TR3A 5EPFA 4X0XA 2B7JA 2LS5A 4I8BA 3F4TA 5IMCA 4TR0A 2HI7A 2XPEA 3HYPA 3EMXA 1PN0A 3VFIA 3W6GA 2MYGA 3BBYA 1EEMA 4PNGA 3MAKA 2LJRA 2C1YA 11GSA 1T1VA 1GLPA 4TVEA 2EIOA 1Z7RA 4CY8A 5DCGA 5DJMA 2RM6A 5KN1A 3QAVA 4PTSA 3U5RE 5ECHB 2P0GA 4O5QA 1S3CA 2R2JA 5AN1A 4GF0A 1Y6EA 3EURA 4KE3A 4ML6A 3QR6A 4X4JA 3P7XA 4KUNA 1GH2A 2C0GA 3DKSA 4TRXA 2CVDA 3GUSA 2QGVA 1SL0B 5JCGA 5HR3A 3QAGA 3ZVJA 1V98A 4OFNA 2ES7A 3IPZA 2V32A 4AJ6A 4BVXA 4ECBA 1OKDA 3TB2A 3GHAA 2D2ZA 3IBHA 3VPQA 4GTUA 4MP4A 2VCTA 8GSSA 1T4YA 2P31A 4KDYA 1JFUA 2R0CA 4HDEA 4ZXGA 3KMNA 1U3AA 2VLVA 3KGKA 4POLA 5LD0A 5EY6A 4KAEA 1O6JA 4IN0A 4XHMA 3KEBA 1SK1A 3ZMKA 4LLRA 3FW2A 4I6XA 4TXVA 5CNWA 3RHCA 3APOA 5FWGA 4FIWA 3EVIA 4IJIA 2JSZA 1MTCA 4RI6A 3PINA 3TOTA 5BRTA 1QQ2A 2EIRA 1M2DA 2B5XA 1TK5B 3LSZA 2H6YA 3C73A 1SKRB 2YWOA 3RBTA 6GSUA 3D21A 4KA0A 3W8SA 3PGTA 3ERGA 2NPBA 2VAFA 2JSYA 4YAPA 1ERVA 2FGXA 17GSA 4NV5A 2JU5A 4OCFA 4X43A 1TRSA 2FUG2 3IHGA 2R37A 1PX7A 18GSA 2LRNA 2ZUPA 5A5KA 3L9SA 1Y25A 1JHBA 4NWYA 2LTKA 1T8EB 2HYXA 2R0GA 1ZYNA 1FB6A 1V2AA 1PA3A 4O5UA 2DJJA 3M1GA 4ZB8A 4PNFA 1G7OA 2LNSA 1G0TA 1YKAA 1V40A 3FHKA 5H5QA 3GRXA 2H70A 4F0BA 5G30A 4CDOA 4NV2A 1U87A 1W4VA 4GSNA 1G7EA 4HI7A 4G2EA 1YQ1A 3G7IA 1NW2A 2HNLA 5IQYA 4I2TA 1SYRA 3ZITA 4TKYA 1O73A 2XC2A 2PVQA 2IMDA 2TRXA 3IK7A 2VUPA 2CV4A 2O7KA 2L5OA 3HKRA 3U6VA 1I5GA 4FH8A 5GSTA 2IL3A 1OC9A 3KD0A 3VURA 2CQ9A 1EOHA 3VWVA 2KP1A 2CZ3A 3H1NA 2DMMA 1GP1A 3ZVJD 4QQ7A 1R7HA 3NIVA 4GSSA 2DJKA 5KOXA 4ZL7A 4FYCA 5G1LA 4ECJA 4KGIA 1XG8A 2WCIA 5GZZB 4POBA 3UARA 3L0HA 5D9XA 4EVMA 3F3QA 3HY2A 4NPBA 4XS4B 1OE8A 1SL1B 3ERFA 2HZEA 2L4CA 3ZRDA 4IQ1A 2HRAA 3ZMLA 2OBIA 2P5RA 2C4JA 3LG6A 2YV7A 3E3EA 3LYPA 2CX3A 5CAXA 3GKMA 1Q4JA 2R0PA 4EKZA 16GSA 2M80A 4EDYA 4PQHA 1RK4A 3ME8A 1WRYA 1AQVA 2E7PA 5ECOB 4YKGA 1FO5A 5AGYA 1AAZA 3HXSA 4K2DA 2LQQA 3LQ7A 3IHQA 1AW9A 1PQNA 2CVBA 4Z2TA 3R3EA 2FWFA 3VI7A 2CT6A 4Q5FA 2HT9A 4ILFA 3A5IA 3UEMA 3UOMA 3IE3A 1ILOA 3CTGA 1V9WA 4PQIA 1TXXA 2DJ3A 2MMAA 6GSXA 3VLNA 4YQMA 2A2SA 1KEBA 5GAND 2HE3A 3V1WA 3FRCA 2PUKC 1GTAA 2GS3A 2YNXA 1MDJA 2V6OA 3CBUA 4XS4A 5KN0A 4BL7A 2EC4A 4K0GA 2Z9SA 1WMJA 5HR1A 1RW1A 1MDIA 4KCAA 3RHBA 3O6TA 5IMVA 1GLQA 2VD1A 19GSA 1AQXA 3F63A 4GQCA 1ZGNA 1OYJA 3QAWA 3R2QA 2OJLA 3CXGA 4ZILA 3C7MA 1T00A 2C3QA 2DIZA 1U88A 2H01A 1A0FA 4L0WA 3FZ5A 4IVFA 4MPGA 4MZWA 1ZOFA 2AJQB 2X49A 2RUFA 3CTFA 3TDGA 4WF4A 3CYNA 1AQWA 3KP8A 2X99A 3N5OA 5G5FA 3GH6A 1EOGA 2XBIA 2C3NA 3KTLA 1B4PA 3KZQA 4ZB9A 4HQSA 3ZLPA 1ST9A 2K18A 4L8EA 3F6DA 1X9MB 5AIVA 2JL4A 1PGTA 3D22A 1EP8A 3HJPA 5DAKA 1QUWA 4XS1A 3D6IA 4WBJA 1WJKA 2H1BA 2IMEA 3LXZA 4EL1A 22GSA 3J7Yb 2G0FA 4HJ2A 1H4OA 1PSQA 3CSIA 4HZ4A 1XW9A 1VGLA 1SENA 4IQAA 1XZOA 1F6MC 4GLTA 3IC8A 5A4VA 2WRTA 1E2YA 1DE1A 3GSTA 5A4WA 1K0BA 4OO5A 4JU5A 4GCIA 3GYKA 4EC0A 2A4HA 4I2UA 2DJ1A 1KTEA 1GSYA 5CRDA 4PQ1A 3MDKA 1GSFA 4OO4A 2F51A 4BIKA 2DMLA 2P5QA 4V2LA 3TKQA 3F8UA 3FR3A 5JWRB 4DSSB 2IIYA 1Q98A 4PGTA 3M3MA 4ZL9A 2I9HA 3UBKA 5D9TA 4GWRA 1YDKA 5HR2A 2GZYA 1EGRA 3N9JA 1E6BA 2XBQA 2QA2A 3NOFA 3UVHA 4DSQA 3UVTA 3KH7A 2B6MA 5C00A 3EWLA 2PU9C 5J3RA 2H74A 2AV4A 2IMIA 2YV9A 1UC7A 2GQMA 3A2WA 1TP9A 1O81A 1MD3A 4WBRD 3HD5A 1Z6MA 1XWCA 3ME7A 2B1KA 1ZYEA 2HXKA 2CAIA 3D4MA 2KLXA 2WFCA 4D73B 4F2IA 1GNEA 2VD0A 1TK0B 4WF5A 2C0DA 4F9ZA 4XRAA 1K0MA 4N30A 1S3DA 2YWMA 2VL9A 2PWJA 4GSTA 2TIRA 1FVJA 1GULA 4O5RA 5ELAA 1K3OA 3VK9A 4MZBA 5HFGA 3DRNA 3APQA 3ZIVA 2N5FA 1Z3EA 4KF9A 1PN9A 3WGXA 4O32A 5DALA 4HU9A 5EVOA 4KX4A 2GSQA 2X4AA 2X8GA 3CRUA 2GLRA 2EIQA 2C0FA 2PN8A 2N5AA 5AISA 4ID0A 5D9VA 1G6YA 2RM5A 3LORA 1TDIA 1TTZA 1FG4A 5BMUA 3GL3A 4HQZA 3KMOA 3EE2A 1G6WA 4BVYB 2H66A 4YQVA 3FR6A 3TKSA 3EPTA 4EIPA 1X9WB 1W89A 4MPFA 5HQPA 4EDZA 2GQLA 4KNDA 4NAXA 3GN3A 4I5QA 4IBPA 5J9CA 5JCWA 2WB9A 3AY8A 3GL5A 3C71A 1URMA 4JRRA 4A5PA 1YZXA 5CP1A 6GSVA 1YF1A 5L71A 3HJOA 2IPAA 1XOAA 2OE3A 2M46A 3PH9A 3LFLA 4AJ8A 3CQFA 4POMA 4F0CA 2I81A 4FO5A 1OC3A 1PL1A 5CRHA 1XVQA 3IR4A 5G1KA 1UA5A 5G2ZA 1J9BA 3US3A 4PUFC 2LUSA 2B5EA 5IMFA 2H30A 4I97A 3DIEA 3F4SA 1GTBA 2VL2C 1FOHA 3GKNA 1N8JA 1ABAA 2XHFA 1XBSA 3NZNA 1O8XA 4JEDA 2C0EA 5DVBA 3E9JB 1XWGA 3DVWA 3GX8A 1EV9A 3LYKA 3MNGA 2ON5A 1YF0A 2I3YA 3IOSA 4MJAA 2DIYA 2GTUA 1EWXA 1XVWA 1ERWA 2H73A 2VO4A 2PGTA 5ENUA 4RI7A 1TJDA 3VWXA 5LNKe 5IIZA 4L5OA 3ZTLA 1YEPA 5D9WA 4MLYA 2F8FA 2YP6A 2R5GA 3WGDA 5GSSA 1J08A 1JLWA 3C1RA 1AIUA 5C04A 4L5LA 2AYTA 2DJ2A 3F4RA 3UJ1A 4BWQA 4TN8A 2VCXA 4WETA 14GSA 4ZIJA 3Q74A 9GSSA 5DDLA 3BOAA 2WS2A 3FKFA 4HUAA 1PKZA 1U6TA 3G7JA 3L4NA 1GUMA 4MJEA 4HOJA 1EZKA 2H71A 4LL1B 3HVSA 3UAPA 1ACVA 5B8AA 2DJ0A 1TI1A 6GSWA 3FEUA 2DBCA 5IOWA 4OFTA 3RDWA 5ECQB 2JACA 2VCVA 2FWHA 3P90A 2FCHA 4LA1A 2PPTA 1QMVA 1XOBA 4HZ2A 7GSSA 3SBCA 3KCMA 1U3IA 2CZ2A 2NBSA 2YJHA 5F0GA 1NHOA 3VWUA 4QL9A 2E2MA 3PR8A 3GSSA 2FD3A 4V1Ag 1A2MA 3TJKA 2AUVA 4JR4A 1GSEA 1WP0A 4V2MA 1TRVA 3MYDA 5JWOB 1BAYA 1IYIA 4EIQA 1YJ6A 1EV4A 2R4VA 1R5PA 4RUVA 2CVKA 1PX6A 3I43A 4F03A 3FY7A 4HEA2 2X8HA 3WYWA 3G7YA 3LEFA 1PL2A 4V2NA 2PBJA 3JCML 4OWYA 4IGJA 4TXOB 1VF2A 3P8WA 2LEGA 3H4KA 2H72A 2N5BA 2O85A 5CRWA 3ZREA 2QA1A 5IPGA 3KXOA 2K8VA 3P2AA 4ICYA 5D73A 2GDRA 4MF6A 3FMWA 4WXTA 1HNCA 2E0QA 3F6FA 5E4WA 2H1AA 1VF1A 2H1GA 1K0OA 1A2LA 3GX0A 6GSSA 1X5DA 3QPMA 4FYBA 4MF7A 1T3BA 3OR5A 2HLSA 1GWCA 1M2AA 4XRDA 1BG5A 5IM9A 4J57E 3DYRA 1O8WA 2VIMA 2LJKA 1MEKA 1JZRA 3ISOA 3F9UA 4YAVA 2IWTA 2AHEA 3IAM2 2RLIA 2FHEA 4KW6A 2OACA 1X0RA 1KNGA 4PXOA 1ZCPA 5JWQB 3WT2A 1BJXA 1WE0A 4TR1B 3HJMA 1UN2A 4MJBA 1Z9HA 5DBQA 1FW1A 3UIWA 1XPVA 3GKXA 4LL4B 2H76A 3D4TA 2V6KA 4ZBAA 2IJYA 1B8XA 12GSA 1NM3A 2UZ8A 1GSDA 3MWHA 1SYXA 5FHIA 3WD6A 4XCSA 3DWVA 4CHSA 1THOA 3DEXA 2C3TA 1ZYQB 4N0ZA 4K9ZA 2ALBA 2X64A 3HCZA 5IMAA 2YWIA 4IP1A 2WGRA 1AUCA 3M0FA 1M7TA 4ZBBA 4BWSA 2KUCA 4EF0A 2FLSA 2HSYA 2LKUA 1GUKA 3C1SA 2A4VA 2I1UA 3H93A 1A8YA 2H8LA 3EC3A 4LMVA 2RUEA 5ECLB 1RQMA 2VLTA 5ECNB 3O3TA 3TJBA 2GVPA 3LWAA 2YOIA 4ECIA 4K0NA 4BA7A 4AGSA 1N2AA 3ERWA 3LJRA 5CO3A 2R3XA 2CAQA 3LGCA 3I6AA 1B9XC 2TRCP 2B1LA 3D5JA 1B48A 4H86A 2V41A 1NSWA 1FB0A 2DSAA 4Z2RA 4IKHA 2MBSA 2L4QA 1DUGA 3QCPA 2H0GA 3G9BA 2YJ7A 3GV1A 1CQGA 1F37A 5ECMB 3KM6A 4EXJA 4MA9A 1DE2A 4X1UA 1GSUA 5DJLA 4K2XA 2KOKA 2FWGA 5DQYA 2C8UA 2FNOA 1F2EA 4K7NA 2L57A 1M3JA 2FY6A 1TRUA 1K0AA 1X5CA 4IP6A 2YN1A 2WZ9A 3FR9A 1WWJA 1BEDA 3FZAA 5HFIA 3QMXA 2QC7A 5ECIB 3IV4A 4HS1A 4YKFA 4K7IA 3EU4A 1QK8A 4ZL8A 3PPUA 1A0RP 1USBA 1JZOA 1EP7A 2HRFA 2OADA 4EE0A 2L59A 5KN2A 2JZTA 4PURA 1VF3A 1PRXA 1M2BA 2GSTA 1I9DA 1LU4A 4JBBA 2E2GA 1HQOA 4OFMA 1CQHA 2VM1A 3DXBA 5IO0A 4KH7A 2GSRA 5J9BA 4DSSA 3TRXA 2H6ZA 2F8AA 1K0NA 3DGQA 4BVXB 1BYEA 1K3YA 3IC4A 5COHA 3A3TA 1PKWA 3IK9A 2DKHA 3DMLA 2VLUA 3CSJA 2AB6A 2H1DA 1R26A 3KIJA 2QKEA 2GT6A 2OE0A 5H5RA 3ZFLA 2AAWA 3UMAA 3O76A 5G5EA 1UVZA 1SD8A 2GSSA 3VPTA 2B3SA 3LW9A 4K5RA 4MCUA 4GXZA 1XWBA 4DEJA 4D73A 4LMWA 5ELGA 4NXIA 4RQXA 2HSMA 1OC8A 2RIIA 1PMTA 3GFKA 2WULA 4G9HA 2WJUA 4Z2UA 1XW5A 2LRTA 4HJMA 3LXTA 4BPYA 1TU8A 2NVLA 4F82A 4IS0A 2VOCA 4MABA 3TRQA 1B4QA 3CSHA 2ZCTA 3IRAA 4MDCA 4IHUA 3M8NA 4USSA 4KB3A 3TJGA 4MNNA 2K8SA 1WOUA 3FZ4A 3SWLA 1BQ7A 4N11A 4K1FA 5G31A 3M9JA 4RQRA 2QSIA 3L78A 3K8NA 4BVYA 4NHWA 2VM2A 2YCDA 2YANA 3TKSE 2MMZA 5HFKA 1SKWB 4ZB6A 3HVVA 6GSTA 5LCZA 2O87A 1SK0A 1TW9A 1DBYA 1HNBA 5ID2B 3L9VA 5D93A 2H6XA 1M99A 3DD3A 4EO3A 1WPIA 2F3MA 3TKSC 3VWWA 3MSZA 2HRNA 1JLVA 1FOVA 2O8VB 1HNAA 4E8EA 4ISDA 1M0UA 5INYA 3BJ5A 3FYGA 5F06A 5B6NA 3GA4A 1GSSA 3F0IA 5KN3A 5F05A 1FHEA 4YH2A 1TI3A 2F9SA 2HSHA 20GSA 3IAS2 4KSMA 4Q5RA 4ML1A 4GQFA 3GNJA 1O7UA 1SJZA 1OC9B 2LQOA 5ECSA 4AJ7A 1MDKA 4KDUA 1JZDA 3CMIA 1B9YC 3KH9A 5F07A 3KP9A 4TOPA 4K8MA 2VCQA 2YZUA 3VI5A 3TRPA 2YWNA 2VCWA 1XWAA 1J0FA 3A5WA 5DQSA 2NDOA 3TGZA 1AXDA 4Z7XA 5ID2A 5GAPD 3QFAC 4JE1A 3RAZA 1MD4A 1TOFA 1S3RA 2JZSA 1SL2B 2HZEB 5KOWA 4MF5A 4CW9A 3QFBC 1A24A 2A2PA 1BX9A 4K7OA 1R4WA 4OCEA 2HZFA 4FQUA 1YEXA 1XFLA 2A2RA 4GRFA 3C8EA 4DSRA 3DVXA 1XW6A 4NMUA 4XIHA 2K6VA 4TR4A 1ERTA 1HD2A 1AC1A 4J2FA 1A8LA 4JR6A 1QFNA 3RPNA 5D8IA 2BTOT 5B8BA 1F9MA 3UBLA 2MBTA 4ULXA 1OAZA 3EMPA 4G0IA 1WIKA 1QXHA 2CA8A 2FWEA 2V1MA 3IXRA 2WDUA 3FK8A 1GRXA 5ECKB 3QOUA 1YY7A 5J41A 2FA4A 3GH9A 2JADA 1SJIA 1M9AA 5J4UA 3Q18A 4ACSA 1VF4A 3WT1A 4IJ3A 1SKSB 4IELA 2IN3A 4XS6A 1ZZYA 4BL7B 5ECPB 5J5NA 2OBKA 4MZCA 1ERUA 1OKTA 3CRTA 5IO2A 1KBNA 1XIYA 3EU3A 3UL3A 1T7PB 1TU7A 1THXA 4WEYA 5E59A 3TOUA 2MMOA 4K6XA 2NTOA 1ML6A 4YQUA 2G2QA 2OKAA 2MMNA 2REMA 2V2GA 1Z5YE 1JZWA 3A2XA 3ZZXA 1PD21 2PVOC 1H75A 2OE1A 3TJJA 3HA9A 5CREA 1S3AA 1GTUA 2HRKA 3BD2A 5AIXA 1ZL9A 5D96A 3HZ4A 4MJCA 2ZNMA 4POKA 3F3RA 3ZFBA 1VRSD 5B6MA 4G0KA 3TKPA 3APSA 1K3LA 3ZL5A 4TXOA 1TK8B 3L9UA 2DC5A 5IPHA 3GKKA 5DAKB 4FYUA 1FVKA 3ZIJA 5DCHA 2ON7A 2M72A 3KTBA 1A23A 2GGTA 1A2JA 2GT5A 1X5EA 4ECCA 2GQKA 2JZRA 1M9BA 5EL8A 4JZQA 3HVXA 1LBKA 1QGVA 1OE7A 2L6CA 3A2VA 1V57A 2OA7A 3WGEA 2DKIA 2KP2A 4L0UA 4DVCA 1SD9A 1SJ6A 4AF2A 3HZ8A 4P3YB 2IMKA 2CX4A 10GSA 2YZHA 3ZYWA 4NHZA 1Z6NA 2C80A 1OVNA 3GIXA 3QD9A 2VCZA 3H8QA 1K0CA 4MH2A 2BJXA 4WR4A 2HFDA 5IMDA 1O85A 2H0HA 1GSQA 2DLXA 4KSOA 4TW5A 3HDCA 3M9KA 1GTIA 1LJRA 4WKWA 1C72A 3Q19A 3W8JA 3GTUB 4G19A 1XWKA 2FA8A 3H79A 4MK3A 3KJYA 3Q6OA 5IMZA 1V58A 2MZCA 4K5SA 4TR1A 2J23A 2LNTA 2K9FA 1NHYA 3BCKA 3IA1A 4ZBDA 2GZPA 4G10A 2O89A 2XPDA 5ABRA 3GURA 2VL3A 1DSBA 4O7HA 1GNWA 5ECRB 2LRCA 3TUEA 2B7KA 2H75A 4MH3A 4IW9A 2LV3A 4N10A 5KEJA 1XCCA 2IFQB 3HHVA 3D0ZA 2LJAA 2L5LA 1EEJA 5FT3A 5DALB 3GMFA 5B7CA 4N0VA 2BMXA 1R5AA 2J9HA 1X9SB 2H19A 4OD7A 4G0LA 3J7Yk 2L6DA 2KHPA 5JCUA 4WR5A 1TRWA 3QDNA 1TKDB 1ZYPA 2PMTA 3HVNA 3GTUA 4PX1A 3BCIA 4Q5QA 4E8HA 4HSCX 4KCEA 3ED3A 4V1Ap 2B5YA 2I4AA 3RPPA 3TKRA 5IOXA 2X8CA 2LSTA 1F3AA 4OMVA 5A4UA 1HYUA 5F8BA 2IMFA 4QL7A 3E0UA 1YKCA 1M3IA 4XTSA 1ZMAA 4O92A 5HR0A 1T4ZA 1K0DA 3EINA 2H0IA 4CY6A 2GZZA 3S9FA 3EYTA 13GSA 1Z7PA 2VL2A 3IDVA 3I69A 1ON4A 2YPMA 2IFQA 1GL8A 3I9V2 4KDXA 1SK2A 4PUAA 6GSYA 5H5SA 3TJFA 4J56E 5CRGA 4EUYA 1IYHA 1XXUA 3MIXA 4HU7A 1GUHA 1F3BA 1SU9A 4Q5NA
chains in the Genus database with same CATH topology
4MMMA 3TCOA 2R6KA 2PERA 3FZ9A 1EGOA 1FAAA 5CYYA 4TR3A 5EPFA 4X0XA 2B7JA 2LS5A 4I8BA 3F4TA 5IMCA 4TR0A 2HI7A 2XPEA 3HYPA 3EMXA 1PN0A 3VFIA 3W6GA 2MYGA 3BBYA 1EEMA 4PNGA 3MAKA 2LJRA 2C1YA 11GSA 1T1VA 1GLPA 4TVEA 2EIOA 1Z7RA 4CY8A 5DCGA 5DJMA 2RM6A 5KN1A 3QAVA 4PTSA 3U5RE 5ECHB 2P0GA 4O5QA 1S3CA 2R2JA 5AN1A 4GF0A 1Y6EA 3EURA 4KE3A 4ML6A 3QR6A 4X4JA 3P7XA 4KUNA 1GH2A 2C0GA 3DKSA 4TRXA 2CVDA 3GUSA 2QGVA 1SL0B 5JCGA 5HR3A 3QAGA 3ZVJA 1V98A 4OFNA 2ES7A 3IPZA 2V32A 4AJ6A 4BVXA 4ECBA 1OKDA 3TB2A 3GHAA 2D2ZA 3IBHA 3VPQA 4GTUA 4MP4A 2VCTA 8GSSA 1T4YA 2P31A 4KDYA 1JFUA 2R0CA 4HDEA 4ZXGA 3KMNA 1U3AA 2VLVA 3KGKA 4POLA 5LD0A 5EY6A 4KAEA 1O6JA 4IN0A 4XHMA 3KEBA 1SK1A 3ZMKA 4LLRA 3FW2A 4I6XA 4TXVA 5CNWA 3RHCA 3APOA 5FWGA 4FIWA 3EVIA 4IJIA 2JSZA 1MTCA 4RI6A 3PINA 3TOTA 5BRTA 1QQ2A 2EIRA 1M2DA 2B5XA 1TK5B 3LSZA 2H6YA 3C73A 1SKRB 2YWOA 3RBTA 6GSUA 3D21A 4KA0A 3W8SA 3PGTA 3ERGA 2NPBA 2VAFA 2JSYA 4YAPA 1ERVA 2FGXA 17GSA 4NV5A 2JU5A 4OCFA 4X43A 1TRSA 2FUG2 3IHGA 2R37A 1PX7A 18GSA 2LRNA 2ZUPA 5A5KA 3L9SA 1Y25A 1JHBA 4NWYA 2LTKA 1T8EB 2HYXA 2R0GA 1ZYNA 1FB6A 1V2AA 1PA3A 4O5UA 2DJJA 3M1GA 4ZB8A 4PNFA 1G7OA 2LNSA 1G0TA 1YKAA 1V40A 3FHKA 5H5QA 3GRXA 2H70A 4F0BA 5G30A 4CDOA 4NV2A 1U87A 1W4VA 4GSNA 1G7EA 4HI7A 4G2EA 1YQ1A 3G7IA 1NW2A 2HNLA 5IQYA 4I2TA 1SYRA 3ZITA 4TKYA 1O73A 2XC2A 2PVQA 2IMDA 2TRXA 3IK7A 2VUPA 2CV4A 2O7KA 2L5OA 3HKRA 3U6VA 1I5GA 4FH8A 5GSTA 2IL3A 1OC9A 3KD0A 3VURA 2CQ9A 1EOHA 3VWVA 2KP1A 2CZ3A 3H1NA 2DMMA 1GP1A 3ZVJD 4QQ7A 1R7HA 3NIVA 4GSSA 2DJKA 5KOXA 4ZL7A 4FYCA 5G1LA 4ECJA 4KGIA 2WCIA 5GZZB 4POBA 3UARA 3L0HA 5D9XA 4EVMA 3F3QA 3HY2A 4NPBA 4XS4B 1OE8A 1SL1B 3ERFA 2HZEA 2L4CA 3ZRDA 4IQ1A 2HRAA 3ZMLA 2OBIA 2P5RA 2C4JA 3LG6A 2YV7A 3E3EA 3LYPA 2CX3A 5CAXA 3GKMA 1Q4JA 2R0PA 4EKZA 16GSA 2M80A 4EDYA 4PQHA 1RK4A 3ME8A 1WRYA 1AQVA 2E7PA 5ECOB 4YKGA 1FO5A 5AGYA 1AAZA 3HXSA 4K2DA 2LQQA 3LQ7A 3IHQA 1AW9A 1PQNA 2CVBA 4Z2TA 3R3EA 2FWFA 3VI7A 2CT6A 4Q5FA 2HT9A 4ILFA 3A5IA 3UEMA 3UOMA 3IE3A 1ILOA 3CTGA 1V9WA 4PQIA 1TXXA 2DJ3A 2MMAA 6GSXA 3VLNA 4YQMA 2A2SA 1KEBA 5GAND 2HE3A 3V1WA 3FRCA 2PUKC 1GTAA 2GS3A 2YNXA 1MDJA 2V6OA 3CBUA 4XS4A 5KN0A 4BL7A 2EC4A 4K0GA 2Z9SA 1WMJA 5HR1A 1RW1A 1MDIA 4KCAA 3RHBA 3O6TA 5IMVA 1GLQA 2VD1A 19GSA 1AQXA 3F63A 4GQCA 1ZGNA 1OYJA 3QAWA 3R2QA 2OJLA 3CXGA 4ZILA 3C7MA 1T00A 2C3QA 2DIZA 1U88A 2H01A 1A0FA 4L0WA 3FZ5A 4IVFA 4MPGA 4MZWA 1ZOFA 2AJQB 2X49A 2RUFA 3CTFA 3TDGA 4WF4A 3CYNA 1AQWA 3KP8A 2X99A 3N5OA 5G5FA 3GH6A 1EOGA 2XBIA 2C3NA 3KTLA 1B4PA 3KZQA 4ZB9A 4HQSA 3ZLPA 1ST9A 2K18A 4L8EA 3F6DA 1X9MB 5AIVA 2JL4A 1PGTA 3D22A 1EP8A 3HJPA 5DAKA 1QUWA 4XS1A 3D6IA 4WBJA 1WJKA 2H1BA 2IMEA 3LXZA 4EL1A 22GSA 3J7Yb 2G0FA 4HJ2A 1H4OA 1PSQA 3CSIA 4HZ4A 1XW9A 1VGLA 1SENA 4IQAA 1XZOA 1F6MC 4GLTA 3IC8A 5A4VA 2WRTA 1E2YA 1DE1A 3GSTA 5A4WA 1K0BA 4OO5A 4JU5A 4GCIA 3GYKA 4EC0A 2A4HA 4I2UA 2DJ1A 1KTEA 1GSYA 5CRDA 4PQ1A 3MDKA 1GSFA 4OO4A 2F51A 2DMLA 2P5QA 4V2LA 3TKQA 3F8UA 3FR3A 5JWRB 4DSSB 2IIYA 1Q98A 4PGTA 3M3MA 4ZL9A 2I9HA 3UBKA 5D9TA 4GWRA 1YDKA 5HR2A 2GZYA 1EGRA 3N9JA 1E6BA 2XBQA 2QA2A 3NOFA 3UVHA 4DSQA 3UVTA 3KH7A 2B6MA 5C00A 3EWLA 2PU9C 5J3RA 2H74A 2AV4A 2IMIA 2YV9A 1UC7A 2GQMA 3A2WA 1TP9A 1O81A 1MD3A 4WBRD 3HD5A 1Z6MA 1XWCA 3ME7A 2B1KA 1ZYEA 2HXKA 2CAIA 3D4MA 2KLXA 2WFCA 4D73B 4F2IA 1GNEA 2VD0A 1TK0B 4WF5A 2C0DA 4F9ZA 4XRAA 1K0MA 4N30A 1S3DA 2YWMA 2VL9A 2PWJA 4GSTA 2TIRA 1FVJA 1GULA 4O5RA 5ELAA 1K3OA 3VK9A 4MZBA 5HFGA 3DRNA 3APQA 3ZIVA 2N5FA 1Z3EA 4KF9A 1PN9A 3WGXA 4O32A 5DALA 4HU9A 5EVOA 4KX4A 2GSQA 2X4AA 2X8GA 3CRUA 2GLRA 2EIQA 2C0FA 2PN8A 2N5AA 5AISA 4ID0A 5D9VA 1G6YA 2RM5A 3LORA 1TDIA 1TTZA 1FG4A 5BMUA 3GL3A 4HQZA 3KMOA 3EE2A 1G6WA 4BVYB 2H66A 4YQVA 3FR6A 3TKSA 3EPTA 4EIPA 1X9WB 1W89A 4MPFA 5HQPA 4EDZA 2GQLA 4KNDA 4NAXA 3GN3A 4I5QA 4IBPA 5J9CA 5JCWA 2WB9A 3AY8A 3GL5A 3C71A 1URMA 4JRRA 4A5PA 1YZXA 5CP1A 6GSVA 1YF1A 5L71A 3HJOA 2IPAA 1XOAA 2OE3A 2M46A 3PH9A 3LFLA 4AJ8A 4POMA 4F0CA 2I81A 4FO5A 1OC3A 1PL1A 5CRHA 1XVQA 3IR4A 5G1KA 1UA5A 5G2ZA 1J9BA 3US3A 4PUFC 2LUSA 2B5EA 5IMFA 2H30A 4I97A 3DIEA 3F4SA 1GTBA 2VL2C 1FOHA 3GKNA 1N8JA 1ABAA 2XHFA 1XBSA 3NZNA 1O8XA 4JEDA 2C0EA 5DVBA 3E9JB 1XWGA 3DVWA 3GX8A 1EV9A 3LYKA 3MNGA 2ON5A 1YF0A 2I3YA 3IOSA 4MJAA 2DIYA 2GTUA 1EWXA 1XVWA 1ERWA 2H73A 2VO4A 2PGTA 5ENUA 4RI7A 1TJDA 3VWXA 5LNKe 5IIZA 4L5OA 3ZTLA 1YEPA 5D9WA 4MLYA 2F8FA 2YP6A 2R5GA 3WGDA 5GSSA 1J08A 1JLWA 3C1RA 1AIUA 5C04A 4L5LA 2AYTA 2DJ2A 3F4RA 3UJ1A 4BWQA 4TN8A 2VCXA 4WETA 14GSA 4ZIJA 3Q74A 9GSSA 5DDLA 3BOAA 2WS2A 3FKFA 4HUAA 1PKZA 1U6TA 3G7JA 3L4NA 1GUMA 4MJEA 4HOJA 1EZKA 2H71A 4LL1B 3HVSA 3UAPA 1ACVA 5B8AA 2DJ0A 1TI1A 6GSWA 3FEUA 2DBCA 5IOWA 4OFTA 3RDWA 5ECQB 2JACA 2VCVA 2FWHA 3P90A 2FCHA 4LA1A 2PPTA 1QMVA 1XOBA 4HZ2A 7GSSA 3SBCA 3KCMA 1U3IA 2CZ2A 2NBSA 2YJHA 5F0GA 1NHOA 3VWUA 4QL9A 2E2MA 3PR8A 3GSSA 2FD3A 4V1Ag 1A2MA 3TJKA 2AUVA 4JR4A 1GSEA 1WP0A 4V2MA 1TRVA 3MYDA 5JWOB 1BAYA 1IYIA 4EIQA 1YJ6A 1EV4A 2R4VA 1R5PA 4RUVA 2CVKA 1PX6A 3I43A 4F03A 3FY7A 4HEA2 2X8HA 3WYWA 3G7YA 3LEFA 1PL2A 4V2NA 2PBJA 3JCML 4OWYA 4IGJA 4TXOB 1VF2A 3P8WA 2LEGA 3H4KA 2H72A 2N5BA 2O85A 5CRWA 3ZREA 2QA1A 5IPGA 3KXOA 2K8VA 3P2AA 4ICYA 5D73A 2GDRA 4MF6A 3FMWA 4WXTA 1HNCA 2E0QA 3F6FA 5E4WA 2H1AA 1VF1A 2H1GA 1K0OA 1A2LA 3GX0A 6GSSA 1X5DA 3QPMA 4FYBA 4MF7A 1T3BA 3OR5A 2HLSA 1GWCA 1M2AA 4XRDA 1BG5A 5IM9A 4J57E 3DYRA 1O8WA 2VIMA 2LJKA 1MEKA 1JZRA 3ISOA 3F9UA 4YAVA 2IWTA 2AHEA 3IAM2 2RLIA 2FHEA 4KW6A 2OACA 1X0RA 1KNGA 4PXOA 1ZCPA 5JWQB 3WT2A 1BJXA 1WE0A 4TR1B 3HJMA 1UN2A 4MJBA 1Z9HA 5DBQA 1FW1A 3UIWA 1XPVA 3GKXA 4LL4B 2H76A 3D4TA 2V6KA 4ZBAA 2IJYA 1B8XA 12GSA 1NM3A 2UZ8A 1GSDA 3MWHA 1SYXA 5FHIA 3WD6A 4XCSA 3DWVA 4CHSA 1THOA 3DEXA 2C3TA 1ZYQB 4N0ZA 4K9ZA 2ALBA 2X64A 3HCZA 5IMAA 2YWIA 4IP1A 2WGRA 1AUCA 3M0FA 1M7TA 4ZBBA 4BWSA 2KUCA 4EF0A 2FLSA 2HSYA 2LKUA 1GUKA 3C1SA 2A4VA 2I1UA 3H93A 1A8YA 2H8LA 3EC3A 4LMVA 2RUEA 5ECLB 1RQMA 2VLTA 5ECNB 3O3TA 3TJBA 2GVPA 3LWAA 2YOIA 4ECIA 4K0NA 4BA7A 4AGSA 1N2AA 3ERWA 3LJRA 5CO3A 2R3XA 2CAQA 3LGCA 3I6AA 1B9XC 2TRCP 2B1LA 3D5JA 1B48A 4H86A 2V41A 1NSWA 1FB0A 2DSAA 4Z2RA 4IKHA 2MBSA 2L4QA 1DUGA 3QCPA 2H0GA 3G9BA 2YJ7A 3GV1A 1CQGA 1F37A 5ECMB 3KM6A 4EXJA 4MA9A 1DE2A 4X1UA 1GSUA 5DJLA 4K2XA 2KOKA 2FWGA 5DQYA 2C8UA 2FNOA 1F2EA 4K7NA 2L57A 2FY6A 1TRUA 1K0AA 1X5CA 4IP6A 2YN1A 2WZ9A 3FR9A 1WWJA 1BEDA 3FZAA 5HFIA 3QMXA 2QC7A 5ECIB 3IV4A 4HS1A 4YKFA 4K7IA 3EU4A 1QK8A 4ZL8A 3PPUA 1A0RP 1USBA 1JZOA 1EP7A 2HRFA 2OADA 4EE0A 2L59A 5KN2A 2JZTA 4PURA 1VF3A 1PRXA 1M2BA 2GSTA 1I9DA 1LU4A 4JBBA 2E2GA 1HQOA 4OFMA 1CQHA 2VM1A 3DXBA 5IO0A 4KH7A 2GSRA 5J9BA 4DSSA 3TRXA 2H6ZA 2F8AA 1K0NA 3DGQA 4BVXB 1BYEA 1K3YA 3IC4A 5COHA 3A3TA 1PKWA 3IK9A 2DKHA 3DMLA 2VLUA 3CSJA 2AB6A 2H1DA 1R26A 3KIJA 2QKEA 2GT6A 2OE0A 5H5RA 3ZFLA 2AAWA 3UMAA 3O76A 5G5EA 1UVZA 1SD8A 2GSSA 3VPTA 2B3SA 3LW9A 4K5RA 4MCUA 4GXZA 1XWBA 4DEJA 4D73A 4LMWA 5ELGA 4NXIA 4RQXA 2HSMA 1OC8A 2RIIA 1PMTA 3GFKA 2WULA 4G9HA 2WJUA 4Z2UA 1XW5A 2LRTA 4HJMA 3LXTA 4BPYA 1TU8A 2NVLA 4F82A 4IS0A 2VOCA 4MABA 3TRQA 1B4QA 3CSHA 2ZCTA 3IRAA 4MDCA 4IHUA 3M8NA 4USSA 4KB3A 3TJGA 4MNNA 2K8SA 1WOUA 3FZ4A 3SWLA 1BQ7A 4N11A 4K1FA 5G31A 3M9JA 4RQRA 2QSIA 3L78A 3K8NA 4BVYA 4NHWA 2VM2A 2YCDA 2YANA 3TKSE 2MMZA 5HFKA 1SKWB 4ZB6A 3HVVA 6GSTA 5LCZA 2O87A 1SK0A 1TW9A 1DBYA 1HNBA 5ID2B 3L9VA 5D93A 2H6XA 1M99A 3DD3A 4EO3A 1WPIA 2F3MA 3TKSC 3VWWA 3MSZA 2HRNA 1JLVA 1FOVA 2O8VB 1HNAA 4E8EA 4ISDA 1M0UA 5INYA 3BJ5A 3FYGA 5F06A 5B6NA 3GA4A 1GSSA 3F0IA 5KN3A 5F05A 1FHEA 4YH2A 1TI3A 2F9SA 2HSHA 20GSA 3IAS2 4KSMA 4Q5RA 4ML1A 4GQFA 3GNJA 1O7UA 1SJZA 1OC9B 2LQOA 5ECSA 4AJ7A 1MDKA 4KDUA 1JZDA 3CMIA 1B9YC 3KH9A 5F07A 3KP9A 4TOPA 4K8MA 2VCQA 2YZUA 3VI5A 3TRPA 2YWNA 2VCWA 1XWAA 1J0FA 3A5WA 5DQSA 2NDOA 3TGZA 1AXDA 4Z7XA 5ID2A 5GAPD 3QFAC 4JE1A 3RAZA 1MD4A 1TOFA 2JZSA 1SL2B 2HZEB 5KOWA 4MF5A 4CW9A 3QFBC 1A24A 2A2PA 1BX9A 4K7OA 1R4WA 4OCEA 2HZFA 4FQUA 1YEXA 1XFLA 2A2RA 4GRFA 3C8EA 4DSRA 3DVXA 1XW6A 4NMUA 4XIHA 2K6VA 4TR4A 1ERTA 1HD2A 1AC1A 4J2FA 1A8LA 4JR6A 1QFNA 3RPNA 5D8IA 2BTOT 5B8BA 1F9MA 3UBLA 2MBTA 4ULXA 1OAZA 3EMPA 4G0IA 1WIKA 1QXHA 2CA8A 2FWEA 2V1MA 3IXRA 2WDUA 3FK8A 1GRXA 5ECKB 3QOUA 1YY7A 5J41A 2FA4A 3GH9A 2JADA 1SJIA 1M9AA 5J4UA 3Q18A 4ACSA 1VF4A 3WT1A 4IJ3A 1SKSB 4IELA 2IN3A 4XS6A 1ZZYA 4BL7B 5ECPB 5J5NA 2OBKA 4MZCA 1ERUA 1OKTA 3CRTA 5IO2A 1KBNA 1XIYA 3EU3A 3UL3A 1T7PB 1TU7A 1THXA 4WEYA 5E59A 3TOUA 2MMOA 4K6XA 2NTOA 1ML6A 4YQUA 2G2QA 2OKAA 2MMNA 2REMA 2V2GA 1Z5YE 1JZWA 3A2XA 3ZZXA 1PD21 2PVOC 1H75A 2OE1A 3TJJA 3HA9A 5CREA 1S3AA 1GTUA 2HRKA 3BD2A 5AIXA 1ZL9A 5D96A 3HZ4A 4MJCA 2ZNMA 4POKA 3F3RA 3ZFBA 1VRSD 5B6MA 4G0KA 3TKPA 3APSA 1K3LA 3ZL5A 4TXOA 1TK8B 3L9UA 2DC5A 5IPHA 3GKKA 5DAKB 4FYUA 1FVKA 3ZIJA 5DCHA 2ON7A 2M72A 3KTBA 1A23A 2GGTA 1A2JA 2GT5A 1X5EA 4ECCA 2GQKA 2JZRA 1M9BA 5EL8A 4JZQA 3HVXA 1LBKA 1QGVA 1OE7A 2L6CA 3A2VA 1V57A 2OA7A 3WGEA 2DKIA 2KP2A 4L0UA 4DVCA 1SD9A 1SJ6A 4AF2A 3HZ8A 4P3YB 2IMKA 2CX4A 10GSA 2YZHA 3ZYWA 4NHZA 1Z6NA 2C80A 1OVNA 3GIXA 3QD9A 2VCZA 3H8QA 1K0CA 4MH2A 2BJXA 4WR4A 2HFDA 5IMDA 1O85A 2H0HA 1GSQA 2DLXA 4KSOA 4TW5A 3HDCA 3M9KA 1GTIA 1LJRA 4WKWA 1C72A 3Q19A 3W8JA 3GTUB 4G19A 1XWKA 2FA8A 3H79A 4MK3A 3KJYA 3Q6OA 5IMZA 1V58A 2MZCA 4K5SA 4TR1A 2J23A 2LNTA 2K9FA 1NHYA 3BCKA 3IA1A 4ZBDA 2GZPA 4G10A 2O89A 2XPDA 5ABRA 3GURA 2VL3A 1DSBA 4O7HA 1GNWA 5ECRB 2LRCA 3TUEA 2B7KA 2H75A 4MH3A 4IW9A 2LV3A 4N10A 5KEJA 1XCCA 2IFQB 3HHVA 3D0ZA 2LJAA 2L5LA 1EEJA 5FT3A 5DALB 3GMFA 5B7CA 4N0VA 2BMXA 1R5AA 2J9HA 1X9SB 2H19A 4OD7A 4G0LA 3J7Yk 2L6DA 2KHPA 5JCUA 4WR5A 1TRWA 3QDNA 1TKDB 1ZYPA 2PMTA 4PX1A 3GTUA 3BCIA 4Q5QA 4E8HA 4KCEA 3ED3A 4V1Ap 2B5YA 2I4AA 3RPPA 3TKRA 5IOXA 2X8CA 2LSTA 1F3AA 4OMVA 5A4UA 1HYUA 5F8BA 2IMFA 4QL7A 3E0UA 1YKCA 4XTSA 1ZMAA 4O92A 5HR0A 1T4ZA 1K0DA 3EINA 2H0IA 4CY6A 2GZZA 3S9FA 3EYTA 13GSA 1Z7PA 2VL2A 3IDVA 3I69A 1ON4A 2YPMA 2IFQA 1GL8A 3I9V2 4KDXA 1SK2A 4PUAA 6GSYA 5H5SA 3TJFA 4J56E 5CRGA 4EUYA 1IYHA 1XXUA 3MIXA 4HU7A 1GUHA 1F3BA 1SU9A 4Q5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MMM A;  3TCO A;  2R6K A;  2PER A;  3FZ9 A;  1EGO A;  1FAA A;  5CYY A;  4TR3 A;  5EPF A;  4X0X A;  2B7J A;  2LS5 A;  4I8B A;  3F4T A;  5IMC A;  4TR0 A;  2HI7 A;  2XPE A;  3HYP A;  3EMX A;  3VFI A;  3W6G A;  2MYG A;  3BBY A;  1EEM A;  4PNG A;  3MAK A;  2LJR A;  2C1Y A;  11GS A;  1T1V A;  1GLP A;  4TVE A;  2EIO A;  1Z7R A;  5DCG A;  5DJM A;  2RM6 A;  5KN1 A;  3QAV A;  3U5R E;  5ECH B;  2P0G A;  1S3C A;  2R2J A;  5AN1 A;  4GF0 A;  1Y6E A;  3EUR A;  4KE3 A;  4ML6 A;  3QR6 A;  3P7X A;  4KUN A;  1GH2 A;  2C0G A;  3DKS A;  4TRX A;  2CVD A;  3GUS A;  2QGV A;  1SL0 B;  5JCG A;  5HR3 A;  3QAG A;  3ZVJ A;  1V98 A;  4OFN A;  2ES7 A;  3IPZ A;  2V32 A;  4AJ6 A;  4BVX A;  4ECB A;  1OKD A;  3TB2 A;  3GHA A;  2D2Z A;  3IBH A;  3VPQ A;  4GTU A;  4MP4 A;  2VCT A;  8GSS A;  1T4Y A;  2P31 A;  4KDY A;  1JFU A;  4HDE A;  4ZXG A;  3KMN A;  1U3A A;  2VLV A;  3KGK A;  4POL A;  5LD0 A;  5EY6 A;  4KAE A;  1O6J A;  4IN0 A;  4XHM A;  3KEB A;  1SK1 A;  3ZMK A;  4LLR A;  3FW2 A;  4I6X A;  4TXV A;  5CNW A;  3RHC A;  3APO A;  5FWG A;  4FIW A;  3EVI A;  4IJI A;  2JSZ A;  1MTC A;  4RI6 A;  3PIN A;  3TOT A;  1QQ2 A;  2EIR A;  1M2D A;  2B5X A;  1TK5 B;  3LSZ A;  2H6Y A;  3C73 A;  1SKR B;  2YWO A;  3RBT A;  6GSU A;  3D21 A;  4KA0 A;  3W8S A;  3PGT A;  3ERG A;  2NPB A;  2VAF A;  2JSY A;  4YAP A;  1ERV A;  2FGX A;  17GS A;  4NV5 A;  2JU5 A;  4OCF A;  4X43 A;  1TRS A;  2FUG 2;  2R37 A;  1PX7 A;  18GS A;  2LRN A;  2ZUP A;  5A5K A;  3L9S A;  1Y25 A;  1JHB A;  4NWY A;  2LTK A;  1T8E B;  2HYX A;  1FB6 A;  1V2A A;  1PA3 A;  2DJJ A;  3M1G A;  4ZB8 A;  4PNF A;  1G7O A;  2LNS A;  1G0T A;  1YKA A;  1V40 A;  3FHK A;  5H5Q A;  3GRX A;  2H70 A;  4F0B A;  5G30 A;  4CDO A;  4NV2 A;  1U87 A;  1W4V A;  4GSN A;  1G7E A;  4HI7 A;  4G2E A;  1YQ1 A;  3G7I A;  1NW2 A;  2HNL A;  5IQY A;  4I2T A;  1SYR A;  3ZIT A;  4TKY A;  1O73 A;  2XC2 A;  2PVQ A;  2IMD A;  2TRX A;  3IK7 A;  2VUP A;  2CV4 A;  2O7K A;  2L5O A;  3HKR A;  3U6V A;  1I5G A;  4FH8 A;  5GST A;  2IL3 A;  1OC9 A;  3KD0 A;  3VUR A;  2CQ9 A;  1EOH A;  3VWV A;  2KP1 A;  2CZ3 A;  3H1N A;  2DMM A;  1GP1 A;  3ZVJ D;  4QQ7 A;  1R7H A;  3NIV A;  4GSS A;  2DJK A;  4ZL7 A;  4FYC A;  5G1L A;  4ECJ A;  4KGI A;  2WCI A;  5GZZ B;  4POB A;  3UAR A;  3L0H A;  5D9X A;  4EVM A;  3F3Q A;  3HY2 A;  4NPB A;  4XS4 B;  1OE8 A;  1SL1 B;  3ERF A;  2HZE A;  2L4C A;  3ZRD A;  4IQ1 A;  3ZML A;  2OBI A;  2P5R A;  2C4J A;  3LG6 A;  2YV7 A;  3E3E A;  3LYP A;  2CX3 A;  5CAX A;  3GKM A;  1Q4J A;  4EKZ A;  16GS A;  2M80 A;  4EDY A;  4PQH A;  1RK4 A;  3ME8 A;  1WRY A;  1AQV A;  2E7P A;  5ECO B;  1FO5 A;  5AGY A;  1AAZ A;  3HXS A;  4K2D A;  2LQQ A;  3LQ7 A;  3IHQ A;  1AW9 A;  1PQN A;  2CVB A;  2FWF A;  3VI7 A;  2CT6 A;  4Q5F A;  2HT9 A;  4ILF A;  3UEM A;  3UOM A;  3IE3 A;  1ILO A;  3CTG A;  1V9W A;  4PQI A;  1TXX A;  2DJ3 A;  2MMA A;  6GSX A;  3VLN A;  4YQM A;  2A2S A;  1KEB A;  5GAN D;  2HE3 A;  3V1W A;  3FRC A;  2PUK C;  1GTA A;  2GS3 A;  2YNX A;  1MDJ A;  2V6O A;  3CBU A;  4XS4 A;  5KN0 A;  4BL7 A;  2EC4 A;  4K0G A;  2Z9S A;  1WMJ A;  5HR1 A;  1RW1 A;  1MDI A;  4KCA A;  3RHB A;  3O6T A;  5IMV A;  1GLQ A;  2VD1 A;  19GS A;  1AQX A;  3F63 A;  4GQC A;  1ZGN A;  1OYJ A;  3QAW A;  3R2Q A;  2OJL A;  3CXG A;  4ZIL A;  3C7M A;  1T00 A;  2C3Q A;  2DIZ A;  1U88 A;  2H01 A;  1A0F A;  4L0W A;  3FZ5 A;  4IVF A;  4MPG A;  4MZW A;  1ZOF A;  2AJQ B;  3TDG A;  2RUF A;  3CTF A;  4WF4 A;  3CYN A;  1AQW A;  3KP8 A;  2X99 A;  3N5O A;  5G5F A;  3GH6 A;  1EOG A;  2XBI A;  2C3N A;  3KTL A;  1B4P A;  3KZQ A;  4ZB9 A;  4HQS A;  3ZLP A;  1ST9 A;  2K18 A;  4L8E A;  3F6D A;  1X9M B;  5AIV A;  2JL4 A;  1PGT A;  3D22 A;  1EP8 A;  3HJP A;  5DAK A;  1QUW A;  4XS1 A;  3D6I A;  4WBJ A;  1WJK A;  2H1B A;  2IME A;  3LXZ A;  4EL1 A;  22GS A;  3J7Y b;  2G0F A;  4HJ2 A;  1H4O A;  1PSQ A;  3CSI A;  4HZ4 A;  1XW9 A;  1VGL A;  1SEN A;  4IQA A;  1XZO A;  1F6M C;  4GLT A;  5A4V A;  2WRT A;  1E2Y A;  1DE1 A;  3GST A;  5A4W A;  1K0B A;  4OO5 A;  4JU5 A;  4GCI A;  3GYK A;  4EC0 A;  4I2U A;  2DJ1 A;  1KTE A;  1GSY A;  5CRD A;  4PQ1 A;  3MDK A;  1GSF A;  4OO4 A;  2F51 A;  2DML A;  2P5Q A;  4V2L A;  3TKQ A;  3F8U A;  3FR3 A;  5JWR B;  4DSS B;  2IIY A;  1Q98 A;  4PGT A;  3M3M A;  4ZL9 A;  2I9H A;  3UBK A;  5D9T A;  4GWR A;  1YDK A;  5HR2 A;  2GZY A;  1EGR A;  3N9J A;  1E6B A;  2XBQ A;  3NOF A;  3UVH A;  4DSQ A;  3UVT A;  3KH7 A;  2B6M A;  5C00 A;  3EWL A;  2PU9 C;  5J3R A;  2H74 A;  2AV4 A;  2IMI A;  2YV9 A;  1UC7 A;  2GQM A;  3A2W A;  1TP9 A;  1O81 A;  1MD3 A;  4WBR D;  3HD5 A;  1Z6M A;  1XWC A;  3ME7 A;  2B1K A;  1ZYE A;  2HXK A;  2CAI A;  3D4M A;  2KLX A;  2WFC A;  4D73 B;  4F2I A;  1GNE A;  2VD0 A;  1TK0 B;  4WF5 A;  2C0D A;  4F9Z A;  4XRA A;  1K0M A;  4N30 A;  1S3D A;  2YWM A;  2VL9 A;  2PWJ A;  4GST A;  2TIR A;  1FVJ A;  1GUL A;  4O5R A;  5ELA A;  1K3O A;  3VK9 A;  4MZB A;  5HFG A;  3DRN A;  3APQ A;  3ZIV A;  2N5F A;  1Z3E A;  1PN9 A;  3WGX A;  4O32 A;  5DAL A;  4HU9 A;  5EVO A;  4KX4 A;  2GSQ A;  2X8G A;  3CRU A;  2GLR A;  2EIQ A;  2C0F A;  2PN8 A;  2N5A A;  5AIS A;  4ID0 A;  5D9V A;  1G6Y A;  2RM5 A;  3LOR A;  1TDI A;  1TTZ A;  1FG4 A;  3GL3 A;  4HQZ A;  3KMO A;  3EE2 A;  1G6W A;  2H66 A;  4YQV A;  3FR6 A;  3TKS A;  1X9W B;  1W89 A;  4MPF A;  5HQP A;  4EDZ A;  2GQL A;  4KND A;  4NAX A;  3GN3 A;  4I5Q A;  4IBP A;  5J9C A;  5JCW A;  2WB9 A;  3AY8 A;  3GL5 A;  3C71 A;  1URM A;  4JRR A;  1YZX A;  5CP1 A;  6GSV A;  1YF1 A;  5L71 A;  3HJO A;  2IPA A;  1XOA A;  2OE3 A;  2M46 A;  3PH9 A;  3LFL A;  4AJ8 A;  4POM A;  4F0C A;  2I81 A;  4FO5 A;  1OC3 A;  1PL1 A;  5CRH A;  1XVQ A;  3IR4 A;  5G1K A;  1UA5 A;  5G2Z A;  1J9B A;  3US3 A;  4PUF C;  2LUS A;  2B5E A;  5IMF A;  2H30 A;  4I97 A;  3DIE A;  3F4S A;  1GTB A;  2VL2 C;  3GKN A;  1N8J A;  1ABA A;  2XHF A;  1XBS A;  3NZN A;  1O8X A;  4JED A;  2C0E A;  5DVB A;  3E9J B;  1XWG A;  3DVW A;  3GX8 A;  1EV9 A;  3LYK A;  3MNG A;  2ON5 A;  1YF0 A;  2I3Y A;  3IOS A;  4MJA A;  2DIY A;  2GTU A;  1EWX A;  1XVW A;  1ERW A;  2H73 A;  2VO4 A;  2PGT A;  5ENU A;  4RI7 A;  1TJD A;  3VWX A;  5LNK e;  5IIZ A;  4L5O A;  3ZTL A;  1YEP A;  5D9W A;  4MLY A;  2F8F A;  2YP6 A;  2R5G A;  3WGD A;  5GSS A;  1J08 A;  1JLW A;  3C1R A;  1AIU A;  5C04 A;  4L5L A;  2AYT A;  2DJ2 A;  3F4R A;  3UJ1 A;  4BWQ A;  4TN8 A;  2VCX A;  4WET A;  14GS A;  4ZIJ A;  3Q74 A;  9GSS A;  5DDL A;  3BOA A;  2WS2 A;  3FKF A;  4HUA A;  1PKZ A;  1U6T A;  3G7J A;  3L4N A;  1GUM A;  4MJE A;  4HOJ A;  1EZK A;  2H71 A;  4LL1 B;  3HVS A;  3UAP A;  1ACV A;  5B8A A;  2DJ0 A;  1TI1 A;  6GSW A;  3FEU A;  2DBC A;  5IOW A;  4OFT A;  3RDW A;  5ECQ B;  2JAC A;  2VCV A;  2FWH A;  3P90 A;  2FCH A;  4LA1 A;  2PPT A;  1QMV A;  1XOB A;  4HZ2 A;  7GSS A;  3SBC A;  3KCM A;  1U3I A;  2CZ2 A;  2NBS A;  2YJH A;  5F0G A;  1NHO A;  3VWU A;  4QL9 A;  2E2M A;  3PR8 A;  3GSS A;  2FD3 A;  4V1A g;  1A2M A;  3TJK A;  2AUV A;  4JR4 A;  1GSE A;  1WP0 A;  4V2M A;  1TRV A;  5JWO B;  1BAY A;  1IYI A;  1YJ6 A;  1EV4 A;  2R4V A;  1R5P A;  4RUV A;  2CVK A;  1PX6 A;  3I43 A;  4F03 A;  3FY7 A;  4HEA 2;  2X8H A;  3WYW A;  3G7Y A;  3LEF A;  1PL2 A;  4V2N A;  2PBJ A;  3JCM L;  4OWY A;  4IGJ A;  4TXO B;  1VF2 A;  3P8W A;  2LEG A;  3H4K A;  2H72 A;  2N5B A;  2O85 A;  5CRW A;  3ZRE A;  5IPG A;  3KXO A;  2K8V A;  3P2A A;  5D73 A;  2GDR A;  4MF6 A;  4WXT A;  1HNC A;  2E0Q A;  3F6F A;  5E4W A;  2H1A A;  1VF1 A;  2H1G A;  1K0O A;  1A2L A;  3GX0 A;  6GSS A;  1X5D A;  3QPM A;  4FYB A;  4MF7 A;  1T3B A;  3OR5 A;  2HLS A;  1GWC A;  1M2A A;  4XRD A;  1BG5 A;  5IM9 A;  4J57 E;  3DYR A;  1O8W A;  2VIM A;  2LJK A;  1MEK A;  1JZR A;  3ISO A;  3F9U A;  4YAV A;  2IWT A;  2AHE A;  3IAM 2;  2RLI A;  2FHE A;  4KW6 A;  2OAC A;  1X0R A;  1KNG A;  4PXO A;  1ZCP A;  5JWQ B;  3WT2 A;  1BJX A;  1WE0 A;  4TR1 B;  3HJM A;  1UN2 A;  4MJB A;  1Z9H A;  5DBQ A;  1FW1 A;  3UIW A;  1XPV A;  3GKX A;  4LL4 B;  2H76 A;  3D4T A;  2V6K A;  4ZBA A;  2IJY A;  1B8X A;  12GS A;  1NM3 A;  1GSD A;  3MWH A;  1SYX A;  5FHI A;  3WD6 A;  4XCS A;  3DWV A;  4CHS A;  1THO A;  3DEX A;  2C3T A;  1ZYQ B;  4N0Z A;  4K9Z A;  2ALB A;  2X64 A;  3HCZ A;  5IMA A;  2YWI A;  4IP1 A;  2WGR A;  1AUC A;  3M0F A;  1M7T A;  4ZBB A;  4BWS A;  2KUC A;  4EF0 A;  2FLS A;  2HSY A;  2LKU A;  1GUK A;  3C1S A;  2A4V A;  2I1U A;  3H93 A;  1A8Y A;  2H8L A;  3EC3 A;  4LMV A;  2RUE A;  5ECL B;  1RQM A;  2VLT A;  5ECN B;  3O3T A;  3TJB A;  2GVP A;  3LWA A;  2YOI A;  4ECI A;  4K0N A;  4BA7 A;  4AGS A;  1N2A A;  3ERW A;  3LJR A;  5CO3 A;  2R3X A;  2CAQ A;  3LGC A;  3I6A A;  1B9X C;  2TRC P;  2B1L A;  3D5J A;  1B48 A;  4H86 A;  2V41 A;  1NSW A;  1FB0 A;  2DSA A;  4IKH A;  2MBS A;  2L4Q A;  1DUG A;  3QCP A;  2H0G A;  3G9B A;  2YJ7 A;  3GV1 A;  1CQG A;  1F37 A;  5ECM B;  3KM6 A;  4EXJ A;  4MA9 A;  1DE2 A;  4X1U A;  1GSU A;  5DJL A;  2KOK A;  2FWG A;  5DQY A;  2C8U A;  2FNO A;  1F2E A;  4K7N A;  2L57 A;  2FY6 A;  1TRU A;  1K0A A;  1X5C A;  4IP6 A;  2YN1 A;  2WZ9 A;  3FR9 A;  1WWJ A;  1BED A;  3FZA A;  5HFI A;  3QMX A;  2QC7 A;  5ECI B;  3IV4 A;  4HS1 A;  4K7I A;  3EU4 A;  1QK8 A;  4ZL8 A;  1A0R P;  1USB A;  1JZO A;  1EP7 A;  2HRF A;  2OAD A;  4EE0 A;  2L59 A;  5KN2 A;  2JZT A;  4PUR A;  1VF3 A;  1PRX A;  1M2B A;  2GST A;  1I9D A;  1LU4 A;  4JBB A;  2E2G A;  1HQO A;  4OFM A;  1CQH A;  2VM1 A;  3DXB A;  5IO0 A;  4KH7 A;  2GSR A;  5J9B A;  4DSS A;  3TRX A;  2H6Z A;  2F8A A;  1K0N A;  3DGQ A;  1BYE A;  1K3Y A;  3IC4 A;  5COH A;  3A3T A;  1PKW A;  3IK9 A;  3DML A;  2VLU A;  3CSJ A;  2AB6 A;  2H1D A;  1R26 A;  3KIJ A;  2QKE A;  2GT6 A;  2OE0 A;  5H5R A;  3ZFL A;  2AAW A;  3UMA A;  3O76 A;  5G5E A;  1UVZ A;  1SD8 A;  2GSS A;  3VPT A;  2B3S A;  4MCU A;  4GXZ A;  1XWB A;  4DEJ A;  4D73 A;  4LMW A;  5ELG A;  4NXI A;  4RQX A;  1OC8 A;  2RII A;  1PMT A;  3GFK A;  2WUL A;  4G9H A;  2WJU A;  1XW5 A;  2LRT A;  4HJM A;  3LXT A;  4BPY A;  1TU8 A;  2NVL A;  4F82 A;  4IS0 A;  2VOC A;  4MAB A;  3TRQ A;  1B4Q A;  3CSH A;  2ZCT A;  3IRA A;  4MDC A;  4IHU A;  3M8N A;  4KB3 A;  3TJG A;  2K8S A;  1WOU A;  3FZ4 A;  3SWL A;  1BQ7 A;  4N11 A;  4K1F A;  5G31 A;  3M9J A;  4RQR A;  2QSI A;  3L78 A;  3K8N A;  4BVY A;  4NHW A;  2VM2 A;  2YCD A;  2YAN A;  3TKS E;  2MMZ A;  5HFK A;  1SKW B;  4ZB6 A;  3HVV A;  6GST A;  5LCZ A;  2O87 A;  1SK0 A;  1TW9 A;  1DBY A;  1HNB A;  5ID2 B;  3L9V A;  5D93 A;  2H6X A;  1M99 A;  3DD3 A;  4EO3 A;  1WPI A;  2F3M A;  3TKS C;  3VWW A;  3MSZ A;  2HRN A;  1JLV A;  1FOV A;  2O8V B;  1HNA A;  4E8E A;  4ISD A;  1M0U A;  5INY A;  3BJ5 A;  3FYG A;  5F06 A;  5B6N A;  3GA4 A;  1GSS A;  3F0I A;  5KN3 A;  5F05 A;  1FHE A;  4YH2 A;  1TI3 A;  2F9S A;  2HSH A;  20GS A;  3IAS 2;  4KSM A;  4Q5R A;  4ML1 A;  4GQF A;  3GNJ A;  1O7U A;  1SJZ A;  1OC9 B;  2LQO A;  5ECS A;  4AJ7 A;  1MDK A;  4KDU A;  1JZD A;  3CMI A;  1B9Y C;  3KH9 A;  5F07 A;  3KP9 A;  4TOP A;  4K8M A;  2VCQ A;  2YZU A;  3VI5 A;  3TRP A;  2YWN A;  2VCW A;  1XWA A;  1J0F A;  3A5W A;  5DQS A;  2NDO A;  3TGZ A;  1AXD A;  4Z7X A;  5ID2 A;  5GAP D;  3QFA C;  4JE1 A;  3RAZ A;  1MD4 A;  1TOF A;  2JZS A;  1SL2 B;  2HZE B;  4MF5 A;  4CW9 A;  3QFB C;  1A24 A;  1BX9 A;  4K7O A;  1R4W A;  4OCE A;  2HZF A;  1YEX A;  1XFL A;  2A2R A;  4GRF A;  3C8E A;  4DSR A;  3DVX A;  1XW6 A;  4NMU A;  4XIH A;  2K6V A;  4TR4 A;  1ERT A;  1HD2 A;  1AC1 A;  4J2F A;  1A8L A;  4JR6 A;  1QFN A;  3RPN A;  5D8I A;  2BTO T;  5B8B A;  1F9M A;  3UBL A;  2MBT A;  4ULX A;  1OAZ A;  3EMP A;  1WIK A;  1QXH A;  2CA8 A;  2FWE A;  2V1M A;  3IXR A;  2WDU A;  3FK8 A;  1GRX A;  5ECK B;  3QOU A;  1YY7 A;  5J41 A;  2FA4 A;  3GH9 A;  2JAD A;  1SJI A;  1M9A A;  5J4U A;  3Q18 A;  4ACS A;  1VF4 A;  3WT1 A;  4IJ3 A;  1SKS B;  4IEL A;  2IN3 A;  4XS6 A;  1ZZY A;  5ECP B;  5J5N A;  2OBK A;  4MZC A;  1ERU A;  1OKT A;  3CRT A;  5IO2 A;  1KBN A;  1XIY A;  3EU3 A;  3UL3 A;  1T7P B;  1TU7 A;  1THX A;  4WEY A;  5E59 A;  3TOU A;  2MMO A;  4K6X A;  2NTO A;  1ML6 A;  4YQU A;  2G2Q A;  2OKA A;  2MMN A;  2REM A;  2V2G A;  1Z5Y E;  1JZW A;  3A2X A;  3ZZX A;  1PD2 1;  2PVO C;  1H75 A;  2OE1 A;  3TJJ A;  3HA9 A;  5CRE A;  1S3A A;  1GTU A;  3BD2 A;  5AIX A;  1ZL9 A;  5D96 A;  3HZ4 A;  4MJC A;  2ZNM A;  4POK A;  3F3R A;  3ZFB A;  1VRS D;  5B6M A;  3TKP A;  3APS A;  1K3L A;  3ZL5 A;  4TXO A;  1TK8 B;  3L9U A;  2DC5 A;  5IPH A;  3GKK A;  5DAK B;  4FYU A;  1FVK A;  3ZIJ A;  5DCH A;  2ON7 A;  2M72 A;  3KTB A;  1A23 A;  2GGT A;  1A2J A;  2GT5 A;  1X5E A;  4ECC A;  2GQK A;  2JZR A;  1M9B A;  5EL8 A;  4JZQ A;  3HVX A;  1LBK A;  1QGV A;  1OE7 A;  2L6C A;  3A2V A;  1V57 A;  2OA7 A;  3WGE A;  2KP2 A;  4L0U A;  4DVC A;  1SD9 A;  1SJ6 A;  4AF2 A;  3HZ8 A;  4P3Y B;  2IMK A;  2CX4 A;  10GS A;  2YZH A;  3ZYW A;  4NHZ A;  1Z6N A;  2C80 A;  1OVN A;  3GIX A;  3QD9 A;  2VCZ A;  3H8Q A;  1K0C A;  4MH2 A;  2BJX A;  4WR4 A;  2HFD A;  5IMD A;  1O85 A;  2H0H A;  1GSQ A;  2DLX A;  4KSO A;  4TW5 A;  3HDC A;  3M9K A;  1GTI A;  1LJR A;  4WKW A;  1C72 A;  3Q19 A;  3W8J A;  3GTU B;  4G19 A;  1XWK A;  2FA8 A;  3H79 A;  4MK3 A;  3KJY A;  3Q6O A;  5IMZ A;  1V58 A;  2MZC A;  4TR1 A;  2J23 A;  2LNT A;  2K9F A;  1NHY A;  3BCK A;  3IA1 A;  4ZBD A;  2GZP A;  4G10 A;  2O89 A;  2XPD A;  5ABR A;  3GUR A;  2VL3 A;  1DSB A;  4O7H A;  1GNW A;  5ECR B;  2LRC A;  3TUE A;  2B7K A;  2H75 A;  4MH3 A;  4IW9 A;  2LV3 A;  4N10 A;  5KEJ A;  1XCC A;  2IFQ B;  3HHV A;  3D0Z A;  2LJA A;  2L5L A;  1EEJ A;  5FT3 A;  5DAL B;  3GMF A;  5B7C A;  4N0V A;  2BMX A;  1R5A A;  2J9H A;  1X9S B;  2H19 A;  4OD7 A;  3J7Y k;  2L6D A;  2KHP A;  5JCU A;  4WR5 A;  1TRW A;  3QDN A;  1TKD B;  2PMT A;  4PX1 A;  3GTU A;  3BCI A;  4Q5Q A;  4E8H A;  4KCE A;  3ED3 A;  4V1A p;  2B5Y A;  2I4A A;  3RPP A;  3TKR A;  5IOX A;  2X8C A;  2LST A;  1F3A A;  4OMV A;  5A4U A;  1HYU A;  5F8B A;  2IMF A;  4QL7 A;  3E0U A;  1YKC A;  4XTS A;  1ZMA A;  4O92 A;  5HR0 A;  1T4Z A;  1K0D A;  3EIN A;  2H0I A;  2GZZ A;  3S9F A;  3EYT A;  13GS A;  1Z7P A;  2VL2 A;  3IDV A;  3I69 A;  1ON4 A;  2YPM A;  2IFQ A;  1GL8 A;  3I9V 2;  4KDX A;  1SK2 A;  4PUA A;  6GSY A;  5H5S A;  3TJF A;  4J56 E;  5CRG A;  4EUY A;  1IYH A;  1XXU A;  4HU7 A;  1GUH A;  1F3B A;  1SU9 A;  4Q5N A; 
#chains in the Genus database with same CATH topology
 4MMM A;  3TCO A;  2R6K A;  1PFO A;  2PER A;  3FZ9 A;  1EGO A;  1FAA A;  5CYY A;  4TR3 A;  5EPF A;  4X0X A;  2B7J A;  2LS5 A;  4I8B A;  3F4T A;  5IMC A;  4TR0 A;  2HI7 A;  2XPE A;  3HYP A;  3EMX A;  1PN0 A;  3VFI A;  3W6G A;  2MYG A;  3BBY A;  1EEM A;  4PNG A;  3MAK A;  2LJR A;  2C1Y A;  11GS A;  1T1V A;  1GLP A;  4TVE A;  2EIO A;  1Z7R A;  4CY8 A;  5DCG A;  5DJM A;  2RM6 A;  5KN1 A;  3QAV A;  4PTS A;  3U5R E;  5ECH B;  2P0G A;  4O5Q A;  1S3C A;  2R2J A;  5AN1 A;  4GF0 A;  1Y6E A;  3EUR A;  4KE3 A;  4ML6 A;  3QR6 A;  4X4J A;  3P7X A;  4KUN A;  1GH2 A;  2C0G A;  3DKS A;  4TRX A;  2CVD A;  3GUS A;  2QGV A;  1SL0 B;  5JCG A;  5HR3 A;  3QAG A;  3ZVJ A;  1V98 A;  4OFN A;  2ES7 A;  3IPZ A;  2V32 A;  4AJ6 A;  4BVX A;  4ECB A;  1OKD A;  3TB2 A;  3GHA A;  2D2Z A;  3IBH A;  3VPQ A;  4GTU A;  4MP4 A;  2VCT A;  8GSS A;  1T4Y A;  2P31 A;  4KDY A;  1JFU A;  2R0C A;  4HDE A;  4ZXG A;  3KMN A;  1U3A A;  2VLV A;  3KGK A;  4POL A;  5LD0 A;  5EY6 A;  4KAE A;  1O6J A;  4IN0 A;  4XHM A;  3KEB A;  1SK1 A;  3ZMK A;  4LLR A;  3FW2 A;  4I6X A;  4TXV A;  5CNW A;  3RHC A;  3APO A;  5FWG A;  4FIW A;  3EVI A;  4IJI A;  2JSZ A;  1MTC A;  4RI6 A;  3PIN A;  3TOT A;  5BRT A;  1QQ2 A;  2EIR A;  1M2D A;  2B5X A;  1TK5 B;  3LSZ A;  2H6Y A;  3C73 A;  1SKR B;  2YWO A;  3RBT A;  6GSU A;  3D21 A;  4KA0 A;  3W8S A;  3PGT A;  3ERG A;  2NPB A;  2VAF A;  2JSY A;  4YAP A;  1ERV A;  2FGX A;  17GS A;  4NV5 A;  2JU5 A;  4OCF A;  4X43 A;  1TRS A;  2FUG 2;  3IHG A;  2R37 A;  1PX7 A;  18GS A;  2LRN A;  2ZUP A;  5A5K A;  3L9S A;  1Y25 A;  1JHB A;  4NWY A;  2LTK A;  1T8E B;  2HYX A;  2R0G A;  1ZYN A;  1FB6 A;  1V2A A;  1PA3 A;  4O5U A;  2DJJ A;  3M1G A;  4ZB8 A;  4PNF A;  1G7O A;  2LNS A;  1G0T A;  1YKA A;  1V40 A;  3FHK A;  5H5Q A;  3GRX A;  2H70 A;  4F0B A;  5G30 A;  4CDO A;  4NV2 A;  1U87 A;  1W4V A;  4GSN A;  1G7E A;  4HI7 A;  4G2E A;  1YQ1 A;  3G7I A;  1NW2 A;  2HNL A;  5IQY A;  4I2T A;  1SYR A;  3ZIT A;  4TKY A;  1O73 A;  2XC2 A;  2PVQ A;  2IMD A;  2TRX A;  3IK7 A;  2VUP A;  2CV4 A;  2O7K A;  2L5O A;  3HKR A;  3U6V A;  1I5G A;  4FH8 A;  5GST A;  2IL3 A;  1OC9 A;  3KD0 A;  3VUR A;  2CQ9 A;  1EOH A;  3VWV A;  2KP1 A;  2CZ3 A;  3H1N A;  2DMM A;  1GP1 A;  3ZVJ D;  4QQ7 A;  1R7H A;  3NIV A;  4GSS A;  2DJK A;  5KOX A;  4ZL7 A;  4FYC A;  5G1L A;  4ECJ A;  4KGI A;  1XG8 A;  2WCI A;  5GZZ B;  4POB A;  3UAR A;  3L0H A;  5D9X A;  4EVM A;  3F3Q A;  3HY2 A;  4NPB A;  4XS4 B;  1OE8 A;  1SL1 B;  3ERF A;  2HZE A;  2L4C A;  3ZRD A;  4IQ1 A;  2HRA A;  3ZML A;  2OBI A;  2P5R A;  2C4J A;  3LG6 A;  2YV7 A;  3E3E A;  3LYP A;  2CX3 A;  5CAX A;  3GKM A;  1Q4J A;  2R0P A;  4EKZ A;  16GS A;  2M80 A;  4EDY A;  4PQH A;  1RK4 A;  3ME8 A;  1WRY A;  1AQV A;  2E7P A;  5ECO B;  4YKG A;  1FO5 A;  5AGY A;  1AAZ A;  3HXS A;  4K2D A;  2LQQ A;  3LQ7 A;  3IHQ A;  1AW9 A;  1PQN A;  2CVB A;  4Z2T A;  3R3E A;  2FWF A;  3VI7 A;  2CT6 A;  4Q5F A;  2HT9 A;  4ILF A;  3A5I A;  3UEM A;  3UOM A;  3IE3 A;  1ILO A;  3CTG A;  1V9W A;  4PQI A;  1TXX A;  2DJ3 A;  2MMA A;  6GSX A;  3VLN A;  4YQM A;  2A2S A;  1KEB A;  5GAN D;  2HE3 A;  3V1W A;  3FRC A;  2PUK C;  1GTA A;  2GS3 A;  2YNX A;  1MDJ A;  2V6O A;  3CBU A;  4XS4 A;  5KN0 A;  4BL7 A;  2EC4 A;  4K0G A;  2Z9S A;  1WMJ A;  5HR1 A;  1RW1 A;  1MDI A;  4KCA A;  3RHB A;  3O6T A;  5IMV A;  1GLQ A;  2VD1 A;  19GS A;  1AQX A;  3F63 A;  4GQC A;  1ZGN A;  1OYJ A;  3QAW A;  3R2Q A;  2OJL A;  3CXG A;  4ZIL A;  3C7M A;  1T00 A;  2C3Q A;  2DIZ A;  1U88 A;  2H01 A;  1A0F A;  4L0W A;  3FZ5 A;  4IVF A;  4MPG A;  4MZW A;  1ZOF A;  2AJQ B;  2X49 A;  2RUF A;  3CTF A;  3TDG A;  4WF4 A;  3CYN A;  1AQW A;  3KP8 A;  2X99 A;  3N5O A;  5G5F A;  3GH6 A;  1EOG A;  2XBI A;  2C3N A;  3KTL A;  1B4P A;  3KZQ A;  4ZB9 A;  4HQS A;  3ZLP A;  1ST9 A;  2K18 A;  4L8E A;  3F6D A;  1X9M B;  5AIV A;  2JL4 A;  1PGT A;  3D22 A;  1EP8 A;  3HJP A;  5DAK A;  1QUW A;  4XS1 A;  3D6I A;  4WBJ A;  1WJK A;  2H1B A;  2IME A;  3LXZ A;  4EL1 A;  22GS A;  3J7Y b;  2G0F A;  4HJ2 A;  1H4O A;  1PSQ A;  3CSI A;  4HZ4 A;  1XW9 A;  1VGL A;  1SEN A;  4IQA A;  1XZO A;  1F6M C;  4GLT A;  3IC8 A;  5A4V A;  2WRT A;  1E2Y A;  1DE1 A;  3GST A;  5A4W A;  1K0B A;  4OO5 A;  4JU5 A;  4GCI A;  3GYK A;  4EC0 A;  2A4H A;  4I2U A;  2DJ1 A;  1KTE A;  1GSY A;  5CRD A;  4PQ1 A;  3MDK A;  1GSF A;  4OO4 A;  2F51 A;  4BIK A;  2DML A;  2P5Q A;  4V2L A;  3TKQ A;  3F8U A;  3FR3 A;  5JWR B;  4DSS B;  2IIY A;  1Q98 A;  4PGT A;  3M3M A;  4ZL9 A;  2I9H A;  3UBK A;  5D9T A;  4GWR A;  1YDK A;  5HR2 A;  2GZY A;  1EGR A;  3N9J A;  1E6B A;  2XBQ A;  2QA2 A;  3NOF A;  3UVH A;  4DSQ A;  3UVT A;  3KH7 A;  2B6M A;  5C00 A;  3EWL A;  2PU9 C;  5J3R A;  2H74 A;  2AV4 A;  2IMI A;  2YV9 A;  1UC7 A;  2GQM A;  3A2W A;  1TP9 A;  1O81 A;  1MD3 A;  4WBR D;  3HD5 A;  1Z6M A;  1XWC A;  3ME7 A;  2B1K A;  1ZYE A;  2HXK A;  2CAI A;  3D4M A;  2KLX A;  2WFC A;  4D73 B;  4F2I A;  1GNE A;  2VD0 A;  1TK0 B;  4WF5 A;  2C0D A;  4F9Z A;  4XRA A;  1K0M A;  4N30 A;  1S3D A;  2YWM A;  2VL9 A;  2PWJ A;  4GST A;  2TIR A;  1FVJ A;  1GUL A;  4O5R A;  5ELA A;  1K3O A;  3VK9 A;  4MZB A;  5HFG A;  3DRN A;  3APQ A;  3ZIV A;  2N5F A;  1Z3E A;  4KF9 A;  1PN9 A;  3WGX A;  4O32 A;  5DAL A;  4HU9 A;  5EVO A;  4KX4 A;  2GSQ A;  2X4A A;  2X8G A;  3CRU A;  2GLR A;  2EIQ A;  2C0F A;  2PN8 A;  2N5A A;  5AIS A;  4ID0 A;  5D9V A;  1G6Y A;  2RM5 A;  3LOR A;  1TDI A;  1TTZ A;  1FG4 A;  5BMU A;  3GL3 A;  4HQZ A;  3KMO A;  3EE2 A;  1G6W A;  4BVY B;  2H66 A;  4YQV A;  3FR6 A;  3TKS A;  3EPT A;  4EIP A;  1X9W B;  1W89 A;  4MPF A;  5HQP A;  4EDZ A;  2GQL A;  4KND A;  4NAX A;  3GN3 A;  4I5Q A;  4IBP A;  5J9C A;  5JCW A;  2WB9 A;  3AY8 A;  3GL5 A;  3C71 A;  1URM A;  4JRR A;  4A5P A;  1YZX A;  5CP1 A;  6GSV A;  1YF1 A;  5L71 A;  3HJO A;  2IPA A;  1XOA A;  2OE3 A;  2M46 A;  3PH9 A;  3LFL A;  4AJ8 A;  3CQF A;  4POM A;  4F0C A;  2I81 A;  4FO5 A;  1OC3 A;  1PL1 A;  5CRH A;  1XVQ A;  3IR4 A;  5G1K A;  1UA5 A;  5G2Z A;  1J9B A;  3US3 A;  4PUF C;  2LUS A;  2B5E A;  5IMF A;  2H30 A;  4I97 A;  3DIE A;  3F4S A;  1GTB A;  2VL2 C;  1FOH A;  3GKN A;  1N8J A;  1ABA A;  2XHF A;  1XBS A;  3NZN A;  1O8X A;  4JED A;  2C0E A;  5DVB A;  3E9J B;  1XWG A;  3DVW A;  3GX8 A;  1EV9 A;  3LYK A;  3MNG A;  2ON5 A;  1YF0 A;  2I3Y A;  3IOS A;  4MJA A;  2DIY A;  2GTU A;  1EWX A;  1XVW A;  1ERW A;  2H73 A;  2VO4 A;  2PGT A;  5ENU A;  4RI7 A;  1TJD A;  3VWX A;  5LNK e;  5IIZ A;  4L5O A;  3ZTL A;  1YEP A;  5D9W A;  4MLY A;  2F8F A;  2YP6 A;  2R5G A;  3WGD A;  5GSS A;  1J08 A;  1JLW A;  3C1R A;  1AIU A;  5C04 A;  4L5L A;  2AYT A;  2DJ2 A;  3F4R A;  3UJ1 A;  4BWQ A;  4TN8 A;  2VCX A;  4WET A;  14GS A;  4ZIJ A;  3Q74 A;  9GSS A;  5DDL A;  3BOA A;  2WS2 A;  3FKF A;  4HUA A;  1PKZ A;  1U6T A;  3G7J A;  3L4N A;  1GUM A;  4MJE A;  4HOJ A;  1EZK A;  2H71 A;  4LL1 B;  3HVS A;  3UAP A;  1ACV A;  5B8A A;  2DJ0 A;  1TI1 A;  6GSW A;  3FEU A;  2DBC A;  5IOW A;  4OFT A;  3RDW A;  5ECQ B;  2JAC A;  2VCV A;  2FWH A;  3P90 A;  2FCH A;  4LA1 A;  2PPT A;  1QMV A;  1XOB A;  4HZ2 A;  7GSS A;  3SBC A;  3KCM A;  1U3I A;  2CZ2 A;  2NBS A;  2YJH A;  5F0G A;  1NHO A;  3VWU A;  4QL9 A;  2E2M A;  3PR8 A;  3GSS A;  2FD3 A;  4V1A g;  1A2M A;  3TJK A;  2AUV A;  4JR4 A;  1GSE A;  1WP0 A;  4V2M A;  1TRV A;  3MYD A;  5JWO B;  1BAY A;  1IYI A;  4EIQ A;  1YJ6 A;  1EV4 A;  2R4V A;  1R5P A;  4RUV A;  2CVK A;  1PX6 A;  3I43 A;  4F03 A;  3FY7 A;  4HEA 2;  2X8H A;  3WYW A;  3G7Y A;  3LEF A;  1PL2 A;  4V2N A;  2PBJ A;  3JCM L;  4OWY A;  4IGJ A;  4TXO B;  1VF2 A;  3P8W A;  2LEG A;  3H4K A;  2H72 A;  2N5B A;  2O85 A;  5CRW A;  3ZRE A;  2QA1 A;  5IPG A;  3KXO A;  2K8V A;  3P2A A;  4ICY A;  5D73 A;  2GDR A;  4MF6 A;  3FMW A;  4WXT A;  1HNC A;  2E0Q A;  3F6F A;  5E4W A;  2H1A A;  1VF1 A;  2H1G A;  1K0O A;  1A2L A;  3GX0 A;  6GSS A;  1X5D A;  3QPM A;  4FYB A;  4MF7 A;  1T3B A;  3OR5 A;  2HLS A;  1GWC A;  1M2A A;  4XRD A;  1BG5 A;  5IM9 A;  4J57 E;  3DYR A;  1O8W A;  2VIM A;  2LJK A;  1MEK A;  1JZR A;  3ISO A;  3F9U A;  4YAV A;  2IWT A;  2AHE A;  3IAM 2;  2RLI A;  2FHE A;  4KW6 A;  2OAC A;  1X0R A;  1KNG A;  4PXO A;  1ZCP A;  5JWQ B;  3WT2 A;  1BJX A;  1WE0 A;  4TR1 B;  3HJM A;  1UN2 A;  4MJB A;  1Z9H A;  5DBQ A;  1FW1 A;  3UIW A;  1XPV A;  3GKX A;  4LL4 B;  2H76 A;  3D4T A;  2V6K A;  4ZBA A;  2IJY A;  1B8X A;  12GS A;  1NM3 A;  2UZ8 A;  1GSD A;  3MWH A;  1SYX A;  5FHI A;  3WD6 A;  4XCS A;  3DWV A;  4CHS A;  1THO A;  3DEX A;  2C3T A;  1ZYQ B;  4N0Z A;  4K9Z A;  2ALB A;  2X64 A;  3HCZ A;  5IMA A;  2YWI A;  4IP1 A;  2WGR A;  1AUC A;  3M0F A;  1M7T A;  4ZBB A;  4BWS A;  2KUC A;  4EF0 A;  2FLS A;  2HSY A;  2LKU A;  1GUK A;  3C1S A;  2A4V A;  2I1U A;  3H93 A;  1A8Y A;  2H8L A;  3EC3 A;  4LMV A;  2RUE A;  5ECL B;  1RQM A;  2VLT A;  5ECN B;  3O3T A;  3TJB A;  2GVP A;  3LWA A;  2YOI A;  4ECI A;  4K0N A;  4BA7 A;  4AGS A;  1N2A A;  3ERW A;  3LJR A;  5CO3 A;  2R3X A;  2CAQ A;  3LGC A;  3I6A A;  1B9X C;  2TRC P;  2B1L A;  3D5J A;  1B48 A;  4H86 A;  2V41 A;  1NSW A;  1FB0 A;  2DSA A;  4Z2R A;  4IKH A;  2MBS A;  2L4Q A;  1DUG A;  3QCP A;  2H0G A;  3G9B A;  2YJ7 A;  3GV1 A;  1CQG A;  1F37 A;  5ECM B;  3KM6 A;  4EXJ A;  4MA9 A;  1DE2 A;  4X1U A;  1GSU A;  5DJL A;  4K2X A;  2KOK A;  2FWG A;  5DQY A;  2C8U A;  2FNO A;  1F2E A;  4K7N A;  2L57 A;  1M3J A;  2FY6 A;  1TRU A;  1K0A A;  1X5C A;  4IP6 A;  2YN1 A;  2WZ9 A;  3FR9 A;  1WWJ A;  1BED A;  3FZA A;  5HFI A;  3QMX A;  2QC7 A;  5ECI B;  3IV4 A;  4HS1 A;  4YKF A;  4K7I A;  3EU4 A;  1QK8 A;  4ZL8 A;  3PPU A;  1A0R P;  1USB A;  1JZO A;  1EP7 A;  2HRF A;  2OAD A;  4EE0 A;  2L59 A;  5KN2 A;  2JZT A;  4PUR A;  1VF3 A;  1PRX A;  1M2B A;  2GST A;  1I9D A;  1LU4 A;  4JBB A;  2E2G A;  1HQO A;  4OFM A;  1CQH A;  2VM1 A;  3DXB A;  5IO0 A;  4KH7 A;  2GSR A;  5J9B A;  4DSS A;  3TRX A;  2H6Z A;  2F8A A;  1K0N A;  3DGQ A;  4BVX B;  1BYE A;  1K3Y A;  3IC4 A;  5COH A;  3A3T A;  1PKW A;  3IK9 A;  2DKH A;  3DML A;  2VLU A;  3CSJ A;  2AB6 A;  2H1D A;  1R26 A;  3KIJ A;  2QKE A;  2GT6 A;  2OE0 A;  5H5R A;  3ZFL A;  2AAW A;  3UMA A;  3O76 A;  5G5E A;  1UVZ A;  1SD8 A;  2GSS A;  3VPT A;  2B3S A;  3LW9 A;  4K5R A;  4MCU A;  4GXZ A;  1XWB A;  4DEJ A;  4D73 A;  4LMW A;  5ELG A;  4NXI A;  4RQX A;  2HSM A;  1OC8 A;  2RII A;  1PMT A;  3GFK A;  2WUL A;  4G9H A;  2WJU A;  4Z2U A;  1XW5 A;  2LRT A;  4HJM A;  3LXT A;  4BPY A;  1TU8 A;  2NVL A;  4F82 A;  4IS0 A;  2VOC A;  4MAB A;  3TRQ A;  1B4Q A;  3CSH A;  2ZCT A;  3IRA A;  4MDC A;  4IHU A;  3M8N A;  4USS A;  4KB3 A;  3TJG A;  4MNN A;  2K8S A;  1WOU A;  3FZ4 A;  3SWL A;  1BQ7 A;  4N11 A;  4K1F A;  5G31 A;  3M9J A;  4RQR A;  2QSI A;  3L78 A;  3K8N A;  4BVY A;  4NHW A;  2VM2 A;  2YCD A;  2YAN A;  3TKS E;  2MMZ A;  5HFK A;  1SKW B;  4ZB6 A;  3HVV A;  6GST A;  5LCZ A;  2O87 A;  1SK0 A;  1TW9 A;  1DBY A;  1HNB A;  5ID2 B;  3L9V A;  5D93 A;  2H6X A;  1M99 A;  3DD3 A;  4EO3 A;  1WPI A;  2F3M A;  3TKS C;  3VWW A;  3MSZ A;  2HRN A;  1JLV A;  1FOV A;  2O8V B;  1HNA A;  4E8E A;  4ISD A;  1M0U A;  5INY A;  3BJ5 A;  3FYG A;  5F06 A;  5B6N A;  3GA4 A;  1GSS A;  3F0I A;  5KN3 A;  5F05 A;  1FHE A;  4YH2 A;  1TI3 A;  2F9S A;  2HSH A;  20GS A;  3IAS 2;  4KSM A;  4Q5R A;  4ML1 A;  4GQF A;  3GNJ A;  1O7U A;  1SJZ A;  1OC9 B;  2LQO A;  5ECS A;  4AJ7 A;  1MDK A;  4KDU A;  1JZD A;  3CMI A;  1B9Y C;  3KH9 A;  5F07 A;  3KP9 A;  4TOP A;  4K8M A;  2VCQ A;  2YZU A;  3VI5 A;  3TRP A;  2YWN A;  2VCW A;  1XWA A;  1J0F A;  3A5W A;  5DQS A;  2NDO A;  3TGZ A;  1AXD A;  4Z7X A;  5ID2 A;  5GAP D;  3QFA C;  4JE1 A;  3RAZ A;  1MD4 A;  1TOF A;  1S3R A;  2JZS A;  1SL2 B;  2HZE B;  5KOW A;  4MF5 A;  4CW9 A;  3QFB C;  1A24 A;  2A2P A;  1BX9 A;  4K7O A;  1R4W A;  4OCE A;  2HZF A;  4FQU A;  1YEX A;  1XFL A;  2A2R A;  4GRF A;  3C8E A;  4DSR A;  3DVX A;  1XW6 A;  4NMU A;  4XIH A;  2K6V A;  4TR4 A;  1ERT A;  1HD2 A;  1AC1 A;  4J2F A;  1A8L A;  4JR6 A;  1QFN A;  3RPN A;  5D8I A;  2BTO T;  5B8B A;  1F9M A;  3UBL A;  2MBT A;  4ULX A;  1OAZ A;  3EMP A;  4G0I A;  1WIK A;  1QXH A;  2CA8 A;  2FWE A;  2V1M A;  3IXR A;  2WDU A;  3FK8 A;  1GRX A;  5ECK B;  3QOU A;  1YY7 A;  5J41 A;  2FA4 A;  3GH9 A;  2JAD A;  1SJI A;  1M9A A;  5J4U A;  3Q18 A;  4ACS A;  1VF4 A;  3WT1 A;  4IJ3 A;  1SKS B;  4IEL A;  2IN3 A;  4XS6 A;  1ZZY A;  4BL7 B;  5ECP B;  5J5N A;  2OBK A;  4MZC A;  1ERU A;  1OKT A;  3CRT A;  5IO2 A;  1KBN A;  1XIY A;  3EU3 A;  3UL3 A;  1T7P B;  1TU7 A;  1THX A;  4WEY A;  5E59 A;  3TOU A;  2MMO A;  4K6X A;  2NTO A;  1ML6 A;  4YQU A;  2G2Q A;  2OKA A;  2MMN A;  2REM A;  2V2G A;  1Z5Y E;  1JZW A;  3A2X A;  3ZZX A;  1PD2 1;  2PVO C;  1H75 A;  2OE1 A;  3TJJ A;  3HA9 A;  5CRE A;  1S3A A;  1GTU A;  2HRK A;  3BD2 A;  5AIX A;  1ZL9 A;  5D96 A;  3HZ4 A;  4MJC A;  2ZNM A;  4POK A;  3F3R A;  3ZFB A;  1VRS D;  5B6M A;  4G0K A;  3TKP A;  3APS A;  1K3L A;  3ZL5 A;  4TXO A;  1TK8 B;  3L9U A;  2DC5 A;  5IPH A;  3GKK A;  5DAK B;  4FYU A;  1FVK A;  3ZIJ A;  5DCH A;  2ON7 A;  2M72 A;  3KTB A;  1A23 A;  2GGT A;  1A2J A;  2GT5 A;  1X5E A;  4ECC A;  2GQK A;  2JZR A;  1M9B A;  5EL8 A;  4JZQ A;  3HVX A;  1LBK A;  1QGV A;  1OE7 A;  2L6C A;  3A2V A;  1V57 A;  2OA7 A;  3WGE A;  2DKI A;  2KP2 A;  4L0U A;  4DVC A;  1SD9 A;  1SJ6 A;  4AF2 A;  3HZ8 A;  4P3Y B;  2IMK A;  2CX4 A;  10GS A;  2YZH A;  3ZYW A;  4NHZ A;  1Z6N A;  2C80 A;  1OVN A;  3GIX A;  3QD9 A;  2VCZ A;  3H8Q A;  1K0C A;  4MH2 A;  2BJX A;  4WR4 A;  2HFD A;  5IMD A;  1O85 A;  2H0H A;  1GSQ A;  2DLX A;  4KSO A;  4TW5 A;  3HDC A;  3M9K A;  1GTI A;  1LJR A;  4WKW A;  1C72 A;  3Q19 A;  3W8J A;  3GTU B;  4G19 A;  1XWK A;  2FA8 A;  3H79 A;  4MK3 A;  3KJY A;  3Q6O A;  5IMZ A;  1V58 A;  2MZC A;  4K5S A;  4TR1 A;  2J23 A;  2LNT A;  2K9F A;  1NHY A;  3BCK A;  3IA1 A;  4ZBD A;  2GZP A;  4G10 A;  2O89 A;  2XPD A;  5ABR A;  3GUR A;  2VL3 A;  1DSB A;  4O7H A;  1GNW A;  5ECR B;  2LRC A;  3TUE A;  2B7K A;  2H75 A;  4MH3 A;  4IW9 A;  2LV3 A;  4N10 A;  5KEJ A;  1XCC A;  2IFQ B;  3HHV A;  3D0Z A;  2LJA A;  2L5L A;  1EEJ A;  5FT3 A;  5DAL B;  3GMF A;  5B7C A;  4N0V A;  2BMX A;  1R5A A;  2J9H A;  1X9S B;  2H19 A;  4OD7 A;  4G0L A;  3J7Y k;  2L6D A;  2KHP A;  5JCU A;  4WR5 A;  1TRW A;  3QDN A;  1TKD B;  1ZYP A;  2PMT A;  3HVN A;  3GTU A;  4PX1 A;  3BCI A;  4Q5Q A;  4E8H A;  4HSC X;  4KCE A;  3ED3 A;  4V1A p;  2B5Y A;  2I4A A;  3RPP A;  3TKR A;  5IOX A;  2X8C A;  2LST A;  1F3A A;  4OMV A;  5A4U A;  1HYU A;  5F8B A;  2IMF A;  4QL7 A;  3E0U A;  1YKC A;  1M3I A;  4XTS A;  1ZMA A;  4O92 A;  5HR0 A;  1T4Z A;  1K0D A;  3EIN A;  2H0I A;  4CY6 A;  2GZZ A;  3S9F A;  3EYT A;  13GS A;  1Z7P A;  2VL2 A;  3IDV A;  3I69 A;  1ON4 A;  2YPM A;  2IFQ A;  1GL8 A;  3I9V 2;  4KDX A;  1SK2 A;  4PUA A;  6GSY A;  5H5S A;  3TJF A;  4J56 E;  5CRG A;  4EUY A;  1IYH A;  1XXU A;  3MIX A;  4HU7 A;  1GUH A;  1F3B A;  1SU9 A;  4Q5N A; 
#chains in the Genus database with same CATH homology
 4MMM A;  3TCO A;  2R6K A;  2PER A;  3FZ9 A;  1EGO A;  1FAA A;  5CYY A;  4TR3 A;  5EPF A;  4X0X A;  2B7J A;  2LS5 A;  4I8B A;  3F4T A;  5IMC A;  4TR0 A;  2HI7 A;  2XPE A;  3HYP A;  3EMX A;  1PN0 A;  3VFI A;  3W6G A;  2MYG A;  3BBY A;  1EEM A;  4PNG A;  3MAK A;  2LJR A;  2C1Y A;  11GS A;  1T1V A;  1GLP A;  4TVE A;  2EIO A;  1Z7R A;  4CY8 A;  5DCG A;  5DJM A;  2RM6 A;  5KN1 A;  3QAV A;  4PTS A;  3U5R E;  5ECH B;  2P0G A;  4O5Q A;  1S3C A;  2R2J A;  5AN1 A;  4GF0 A;  1Y6E A;  3EUR A;  4KE3 A;  4ML6 A;  3QR6 A;  4X4J A;  3P7X A;  4KUN A;  1GH2 A;  2C0G A;  3DKS A;  4TRX A;  2CVD A;  3GUS A;  2QGV A;  1SL0 B;  5JCG A;  5HR3 A;  3QAG A;  3ZVJ A;  1V98 A;  4OFN A;  2ES7 A;  3IPZ A;  2V32 A;  4AJ6 A;  4BVX A;  4ECB A;  1OKD A;  3TB2 A;  3GHA A;  2D2Z A;  3IBH A;  3VPQ A;  4GTU A;  4MP4 A;  2VCT A;  8GSS A;  1T4Y A;  2P31 A;  4KDY A;  1JFU A;  2R0C A;  4HDE A;  4ZXG A;  3KMN A;  1U3A A;  2VLV A;  3KGK A;  4POL A;  5LD0 A;  5EY6 A;  4KAE A;  1O6J A;  4IN0 A;  4XHM A;  3KEB A;  1SK1 A;  3ZMK A;  4LLR A;  3FW2 A;  4I6X A;  4TXV A;  5CNW A;  3RHC A;  3APO A;  5FWG A;  4FIW A;  3EVI A;  4IJI A;  2JSZ A;  1MTC A;  4RI6 A;  3PIN A;  3TOT A;  5BRT A;  1QQ2 A;  2EIR A;  1M2D A;  2B5X A;  1TK5 B;  3LSZ A;  2H6Y A;  3C73 A;  1SKR B;  2YWO A;  3RBT A;  6GSU A;  3D21 A;  4KA0 A;  3W8S A;  3PGT A;  3ERG A;  2NPB A;  2VAF A;  2JSY A;  4YAP A;  1ERV A;  2FGX A;  17GS A;  4NV5 A;  2JU5 A;  4OCF A;  4X43 A;  1TRS A;  2FUG 2;  3IHG A;  2R37 A;  1PX7 A;  18GS A;  2LRN A;  2ZUP A;  5A5K A;  3L9S A;  1Y25 A;  1JHB A;  4NWY A;  2LTK A;  1T8E B;  2HYX A;  2R0G A;  1ZYN A;  1FB6 A;  1V2A A;  1PA3 A;  4O5U A;  2DJJ A;  3M1G A;  4ZB8 A;  4PNF A;  1G7O A;  2LNS A;  1G0T A;  1YKA A;  1V40 A;  3FHK A;  5H5Q A;  3GRX A;  2H70 A;  4F0B A;  5G30 A;  4CDO A;  4NV2 A;  1U87 A;  1W4V A;  4GSN A;  1G7E A;  4HI7 A;  4G2E A;  1YQ1 A;  3G7I A;  1NW2 A;  2HNL A;  5IQY A;  4I2T A;  1SYR A;  3ZIT A;  4TKY A;  1O73 A;  2XC2 A;  2PVQ A;  2IMD A;  2TRX A;  3IK7 A;  2VUP A;  2CV4 A;  2O7K A;  2L5O A;  3HKR A;  3U6V A;  1I5G A;  4FH8 A;  5GST A;  2IL3 A;  1OC9 A;  3KD0 A;  3VUR A;  2CQ9 A;  1EOH A;  3VWV A;  2KP1 A;  2CZ3 A;  3H1N A;  2DMM A;  1GP1 A;  3ZVJ D;  4QQ7 A;  1R7H A;  3NIV A;  4GSS A;  2DJK A;  5KOX A;  4ZL7 A;  4FYC A;  5G1L A;  4ECJ A;  4KGI A;  2WCI A;  5GZZ B;  4POB A;  3UAR A;  3L0H A;  5D9X A;  4EVM A;  3F3Q A;  3HY2 A;  4NPB A;  4XS4 B;  1OE8 A;  1SL1 B;  3ERF A;  2HZE A;  2L4C A;  3ZRD A;  4IQ1 A;  2HRA A;  3ZML A;  2OBI A;  2P5R A;  2C4J A;  3LG6 A;  2YV7 A;  3E3E A;  3LYP A;  2CX3 A;  5CAX A;  3GKM A;  1Q4J A;  2R0P A;  4EKZ A;  16GS A;  2M80 A;  4EDY A;  4PQH A;  1RK4 A;  3ME8 A;  1WRY A;  1AQV A;  2E7P A;  5ECO B;  4YKG A;  1FO5 A;  5AGY A;  1AAZ A;  3HXS A;  4K2D A;  2LQQ A;  3LQ7 A;  3IHQ A;  1AW9 A;  1PQN A;  2CVB A;  4Z2T A;  3R3E A;  2FWF A;  3VI7 A;  2CT6 A;  4Q5F A;  2HT9 A;  4ILF A;  3A5I A;  3UEM A;  3UOM A;  3IE3 A;  1ILO A;  3CTG A;  1V9W A;  4PQI A;  1TXX A;  2DJ3 A;  2MMA A;  6GSX A;  3VLN A;  4YQM A;  2A2S A;  1KEB A;  5GAN D;  2HE3 A;  3V1W A;  3FRC A;  2PUK C;  1GTA A;  2GS3 A;  2YNX A;  1MDJ A;  2V6O A;  3CBU A;  4XS4 A;  5KN0 A;  4BL7 A;  2EC4 A;  4K0G A;  2Z9S A;  1WMJ A;  5HR1 A;  1RW1 A;  1MDI A;  4KCA A;  3RHB A;  3O6T A;  5IMV A;  1GLQ A;  2VD1 A;  19GS A;  1AQX A;  3F63 A;  4GQC A;  1ZGN A;  1OYJ A;  3QAW A;  3R2Q A;  2OJL A;  3CXG A;  4ZIL A;  3C7M A;  1T00 A;  2C3Q A;  2DIZ A;  1U88 A;  2H01 A;  1A0F A;  4L0W A;  3FZ5 A;  4IVF A;  4MPG A;  4MZW A;  1ZOF A;  2AJQ B;  2X49 A;  2RUF A;  3CTF A;  3TDG A;  4WF4 A;  3CYN A;  1AQW A;  3KP8 A;  2X99 A;  3N5O A;  5G5F A;  3GH6 A;  1EOG A;  2XBI A;  2C3N A;  3KTL A;  1B4P A;  3KZQ A;  4ZB9 A;  4HQS A;  3ZLP A;  1ST9 A;  2K18 A;  4L8E A;  3F6D A;  1X9M B;  5AIV A;  2JL4 A;  1PGT A;  3D22 A;  1EP8 A;  3HJP A;  5DAK A;  1QUW A;  4XS1 A;  3D6I A;  4WBJ A;  1WJK A;  2H1B A;  2IME A;  3LXZ A;  4EL1 A;  22GS A;  3J7Y b;  2G0F A;  4HJ2 A;  1H4O A;  1PSQ A;  3CSI A;  4HZ4 A;  1XW9 A;  1VGL A;  1SEN A;  4IQA A;  1XZO A;  1F6M C;  4GLT A;  3IC8 A;  5A4V A;  2WRT A;  1E2Y A;  1DE1 A;  3GST A;  5A4W A;  1K0B A;  4OO5 A;  4JU5 A;  4GCI A;  3GYK A;  4EC0 A;  2A4H A;  4I2U A;  2DJ1 A;  1KTE A;  1GSY A;  5CRD A;  4PQ1 A;  3MDK A;  1GSF A;  4OO4 A;  2F51 A;  2DML A;  2P5Q A;  4V2L A;  3TKQ A;  3F8U A;  3FR3 A;  5JWR B;  4DSS B;  2IIY A;  1Q98 A;  4PGT A;  3M3M A;  4ZL9 A;  2I9H A;  3UBK A;  5D9T A;  4GWR A;  1YDK A;  5HR2 A;  2GZY A;  1EGR A;  3N9J A;  1E6B A;  2XBQ A;  2QA2 A;  3NOF A;  3UVH A;  4DSQ A;  3UVT A;  3KH7 A;  2B6M A;  5C00 A;  3EWL A;  2PU9 C;  5J3R A;  2H74 A;  2AV4 A;  2IMI A;  2YV9 A;  1UC7 A;  2GQM A;  3A2W A;  1TP9 A;  1O81 A;  1MD3 A;  4WBR D;  3HD5 A;  1Z6M A;  1XWC A;  3ME7 A;  2B1K A;  1ZYE A;  2HXK A;  2CAI A;  3D4M A;  2KLX A;  2WFC A;  4D73 B;  4F2I A;  1GNE A;  2VD0 A;  1TK0 B;  4WF5 A;  2C0D A;  4F9Z A;  4XRA A;  1K0M A;  4N30 A;  1S3D A;  2YWM A;  2VL9 A;  2PWJ A;  4GST A;  2TIR A;  1FVJ A;  1GUL A;  4O5R A;  5ELA A;  1K3O A;  3VK9 A;  4MZB A;  5HFG A;  3DRN A;  3APQ A;  3ZIV A;  2N5F A;  1Z3E A;  4KF9 A;  1PN9 A;  3WGX A;  4O32 A;  5DAL A;  4HU9 A;  5EVO A;  4KX4 A;  2GSQ A;  2X4A A;  2X8G A;  3CRU A;  2GLR A;  2EIQ A;  2C0F A;  2PN8 A;  2N5A A;  5AIS A;  4ID0 A;  5D9V A;  1G6Y A;  2RM5 A;  3LOR A;  1TDI A;  1TTZ A;  1FG4 A;  5BMU A;  3GL3 A;  4HQZ A;  3KMO A;  3EE2 A;  1G6W A;  4BVY B;  2H66 A;  4YQV A;  3FR6 A;  3TKS A;  3EPT A;  4EIP A;  1X9W B;  1W89 A;  4MPF A;  5HQP A;  4EDZ A;  2GQL A;  4KND A;  4NAX A;  3GN3 A;  4I5Q A;  4IBP A;  5J9C A;  5JCW A;  2WB9 A;  3AY8 A;  3GL5 A;  3C71 A;  1URM A;  4JRR A;  4A5P A;  1YZX A;  5CP1 A;  6GSV A;  1YF1 A;  5L71 A;  3HJO A;  2IPA A;  1XOA A;  2OE3 A;  2M46 A;  3PH9 A;  3LFL A;  4AJ8 A;  4POM A;  4F0C A;  2I81 A;  4FO5 A;  1OC3 A;  1PL1 A;  5CRH A;  1XVQ A;  3IR4 A;  5G1K A;  1UA5 A;  5G2Z A;  1J9B A;  3US3 A;  4PUF C;  2LUS A;  2B5E A;  5IMF A;  2H30 A;  4I97 A;  3DIE A;  3F4S A;  1GTB A;  2VL2 C;  1FOH A;  3GKN A;  1N8J A;  1ABA A;  2XHF A;  1XBS A;  3NZN A;  1O8X A;  4JED A;  2C0E A;  5DVB A;  3E9J B;  1XWG A;  3DVW A;  3GX8 A;  1EV9 A;  3LYK A;  3MNG A;  2ON5 A;  1YF0 A;  2I3Y A;  3IOS A;  4MJA A;  2DIY A;  2GTU A;  1EWX A;  1XVW A;  1ERW A;  2H73 A;  2VO4 A;  2PGT A;  5ENU A;  4RI7 A;  1TJD A;  3VWX A;  5LNK e;  5IIZ A;  4L5O A;  3ZTL A;  1YEP A;  5D9W A;  4MLY A;  2F8F A;  2YP6 A;  2R5G A;  3WGD A;  5GSS A;  1J08 A;  1JLW A;  3C1R A;  1AIU A;  5C04 A;  4L5L A;  2AYT A;  2DJ2 A;  3F4R A;  3UJ1 A;  4BWQ A;  4TN8 A;  2VCX A;  4WET A;  14GS A;  4ZIJ A;  3Q74 A;  9GSS A;  5DDL A;  3BOA A;  2WS2 A;  3FKF A;  4HUA A;  1PKZ A;  1U6T A;  3G7J A;  3L4N A;  1GUM A;  4MJE A;  4HOJ A;  1EZK A;  2H71 A;  4LL1 B;  3HVS A;  3UAP A;  1ACV A;  5B8A A;  2DJ0 A;  1TI1 A;  6GSW A;  3FEU A;  2DBC A;  5IOW A;  4OFT A;  3RDW A;  5ECQ B;  2JAC A;  2VCV A;  2FWH A;  3P90 A;  2FCH A;  4LA1 A;  2PPT A;  1QMV A;  1XOB A;  4HZ2 A;  7GSS A;  3SBC A;  3KCM A;  1U3I A;  2CZ2 A;  2NBS A;  2YJH A;  5F0G A;  1NHO A;  3VWU A;  4QL9 A;  2E2M A;  3PR8 A;  3GSS A;  2FD3 A;  4V1A g;  1A2M A;  3TJK A;  2AUV A;  4JR4 A;  1GSE A;  1WP0 A;  4V2M A;  1TRV A;  3MYD A;  5JWO B;  1BAY A;  1IYI A;  4EIQ A;  1YJ6 A;  1EV4 A;  2R4V A;  1R5P A;  4RUV A;  2CVK A;  1PX6 A;  3I43 A;  4F03 A;  3FY7 A;  4HEA 2;  2X8H A;  3WYW A;  3G7Y A;  3LEF A;  1PL2 A;  4V2N A;  2PBJ A;  3JCM L;  4OWY A;  4IGJ A;  4TXO B;  1VF2 A;  3P8W A;  2LEG A;  3H4K A;  2H72 A;  2N5B A;  2O85 A;  5CRW A;  3ZRE A;  2QA1 A;  5IPG A;  3KXO A;  2K8V A;  3P2A A;  4ICY A;  5D73 A;  2GDR A;  4MF6 A;  3FMW A;  4WXT A;  1HNC A;  2E0Q A;  3F6F A;  5E4W A;  2H1A A;  1VF1 A;  2H1G A;  1K0O A;  1A2L A;  3GX0 A;  6GSS A;  1X5D A;  3QPM A;  4FYB A;  4MF7 A;  1T3B A;  3OR5 A;  2HLS A;  1GWC A;  1M2A A;  4XRD A;  1BG5 A;  5IM9 A;  4J57 E;  3DYR A;  1O8W A;  2VIM A;  2LJK A;  1MEK A;  1JZR A;  3ISO A;  3F9U A;  4YAV A;  2IWT A;  2AHE A;  3IAM 2;  2RLI A;  2FHE A;  4KW6 A;  2OAC A;  1X0R A;  1KNG A;  4PXO A;  1ZCP A;  5JWQ B;  3WT2 A;  1BJX A;  1WE0 A;  4TR1 B;  3HJM A;  1UN2 A;  4MJB A;  1Z9H A;  5DBQ A;  1FW1 A;  3UIW A;  1XPV A;  3GKX A;  4LL4 B;  2H76 A;  3D4T A;  2V6K A;  4ZBA A;  2IJY A;  1B8X A;  12GS A;  1NM3 A;  2UZ8 A;  1GSD A;  3MWH A;  1SYX A;  5FHI A;  3WD6 A;  4XCS A;  3DWV A;  4CHS A;  1THO A;  3DEX A;  2C3T A;  1ZYQ B;  4N0Z A;  4K9Z A;  2ALB A;  2X64 A;  3HCZ A;  5IMA A;  2YWI A;  4IP1 A;  2WGR A;  1AUC A;  3M0F A;  1M7T A;  4ZBB A;  4BWS A;  2KUC A;  4EF0 A;  2FLS A;  2HSY A;  2LKU A;  1GUK A;  3C1S A;  2A4V A;  2I1U A;  3H93 A;  1A8Y A;  2H8L A;  3EC3 A;  4LMV A;  2RUE A;  5ECL B;  1RQM A;  2VLT A;  5ECN B;  3O3T A;  3TJB A;  2GVP A;  3LWA A;  2YOI A;  4ECI A;  4K0N A;  4BA7 A;  4AGS A;  1N2A A;  3ERW A;  3LJR A;  5CO3 A;  2R3X A;  2CAQ A;  3LGC A;  3I6A A;  1B9X C;  2TRC P;  2B1L A;  3D5J A;  1B48 A;  4H86 A;  2V41 A;  1NSW A;  1FB0 A;  2DSA A;  4Z2R A;  4IKH A;  2MBS A;  2L4Q A;  1DUG A;  3QCP A;  2H0G A;  3G9B A;  2YJ7 A;  3GV1 A;  1CQG A;  1F37 A;  5ECM B;  3KM6 A;  4EXJ A;  4MA9 A;  1DE2 A;  4X1U A;  1GSU A;  5DJL A;  4K2X A;  2KOK A;  2FWG A;  5DQY A;  2C8U A;  2FNO A;  1F2E A;  4K7N A;  2L57 A;  2FY6 A;  1TRU A;  1K0A A;  1X5C A;  4IP6 A;  2YN1 A;  2WZ9 A;  3FR9 A;  1WWJ A;  1BED A;  3FZA A;  5HFI A;  3QMX A;  2QC7 A;  5ECI B;  3IV4 A;  4HS1 A;  4YKF A;  4K7I A;  3EU4 A;  1QK8 A;  4ZL8 A;  3PPU A;  1A0R P;  1USB A;  1JZO A;  1EP7 A;  2HRF A;  2OAD A;  4EE0 A;  2L59 A;  5KN2 A;  2JZT A;  4PUR A;  1VF3 A;  1PRX A;  1M2B A;  2GST A;  1I9D A;  1LU4 A;  4JBB A;  2E2G A;  1HQO A;  4OFM A;  1CQH A;  2VM1 A;  3DXB A;  5IO0 A;  4KH7 A;  2GSR A;  5J9B A;  4DSS A;  3TRX A;  2H6Z A;  2F8A A;  1K0N A;  3DGQ A;  4BVX B;  1BYE A;  1K3Y A;  3IC4 A;  5COH A;  3A3T A;  1PKW A;  3IK9 A;  2DKH A;  3DML A;  2VLU A;  3CSJ A;  2AB6 A;  2H1D A;  1R26 A;  3KIJ A;  2QKE A;  2GT6 A;  2OE0 A;  5H5R A;  3ZFL A;  2AAW A;  3UMA A;  3O76 A;  5G5E A;  1UVZ A;  1SD8 A;  2GSS A;  3VPT A;  2B3S A;  3LW9 A;  4K5R A;  4MCU A;  4GXZ A;  1XWB A;  4DEJ A;  4D73 A;  4LMW A;  5ELG A;  4NXI A;  4RQX A;  2HSM A;  1OC8 A;  2RII A;  1PMT A;  3GFK A;  2WUL A;  4G9H A;  2WJU A;  4Z2U A;  1XW5 A;  2LRT A;  4HJM A;  3LXT A;  4BPY A;  1TU8 A;  2NVL A;  4F82 A;  4IS0 A;  2VOC A;  4MAB A;  3TRQ A;  1B4Q A;  3CSH A;  2ZCT A;  3IRA A;  4MDC A;  4IHU A;  3M8N A;  4USS A;  4KB3 A;  3TJG A;  4MNN A;  2K8S A;  1WOU A;  3FZ4 A;  3SWL A;  1BQ7 A;  4N11 A;  4K1F A;  5G31 A;  3M9J A;  4RQR A;  2QSI A;  3L78 A;  3K8N A;  4BVY A;  4NHW A;  2VM2 A;  2YCD A;  2YAN A;  3TKS E;  2MMZ A;  5HFK A;  1SKW B;  4ZB6 A;  3HVV A;  6GST A;  5LCZ A;  2O87 A;  1SK0 A;  1TW9 A;  1DBY A;  1HNB A;  5ID2 B;  3L9V A;  5D93 A;  2H6X A;  1M99 A;  3DD3 A;  4EO3 A;  1WPI A;  2F3M A;  3TKS C;  3VWW A;  3MSZ A;  2HRN A;  1JLV A;  1FOV A;  2O8V B;  1HNA A;  4E8E A;  4ISD A;  1M0U A;  5INY A;  3BJ5 A;  3FYG A;  5F06 A;  5B6N A;  3GA4 A;  1GSS A;  3F0I A;  5KN3 A;  5F05 A;  1FHE A;  4YH2 A;  1TI3 A;  2F9S A;  2HSH A;  20GS A;  3IAS 2;  4KSM A;  4Q5R A;  4ML1 A;  4GQF A;  3GNJ A;  1O7U A;  1SJZ A;  1OC9 B;  2LQO A;  5ECS A;  4AJ7 A;  1MDK A;  4KDU A;  1JZD A;  3CMI A;  1B9Y C;  3KH9 A;  5F07 A;  3KP9 A;  4TOP A;  4K8M A;  2VCQ A;  2YZU A;  3VI5 A;  3TRP A;  2YWN A;  2VCW A;  1XWA A;  1J0F A;  3A5W A;  5DQS A;  2NDO A;  3TGZ A;  1AXD A;  4Z7X A;  5ID2 A;  5GAP D;  3QFA C;  4JE1 A;  3RAZ A;  1MD4 A;  1TOF A;  2JZS A;  1SL2 B;  2HZE B;  5KOW A;  4MF5 A;  4CW9 A;  3QFB C;  1A24 A;  2A2P A;  1BX9 A;  4K7O A;  1R4W A;  4OCE A;  2HZF A;  4FQU A;  1YEX A;  1XFL A;  2A2R A;  4GRF A;  3C8E A;  4DSR A;  3DVX A;  1XW6 A;  4NMU A;  4XIH A;  2K6V A;  4TR4 A;  1ERT A;  1HD2 A;  1AC1 A;  4J2F A;  1A8L A;  4JR6 A;  1QFN A;  3RPN A;  5D8I A;  2BTO T;  5B8B A;  1F9M A;  3UBL A;  2MBT A;  4ULX A;  1OAZ A;  3EMP A;  4G0I A;  1WIK A;  1QXH A;  2CA8 A;  2FWE A;  2V1M A;  3IXR A;  2WDU A;  3FK8 A;  1GRX A;  5ECK B;  3QOU A;  1YY7 A;  5J41 A;  2FA4 A;  3GH9 A;  2JAD A;  1SJI A;  1M9A A;  5J4U A;  3Q18 A;  4ACS A;  1VF4 A;  3WT1 A;  4IJ3 A;  1SKS B;  4IEL A;  2IN3 A;  4XS6 A;  1ZZY A;  4BL7 B;  5ECP B;  5J5N A;  2OBK A;  4MZC A;  1ERU A;  1OKT A;  3CRT A;  5IO2 A;  1KBN A;  1XIY A;  3EU3 A;  3UL3 A;  1T7P B;  1TU7 A;  1THX A;  4WEY A;  5E59 A;  3TOU A;  2MMO A;  4K6X A;  2NTO A;  1ML6 A;  4YQU A;  2G2Q A;  2OKA A;  2MMN A;  2REM A;  2V2G A;  1Z5Y E;  1JZW A;  3A2X A;  3ZZX A;  1PD2 1;  2PVO C;  1H75 A;  2OE1 A;  3TJJ A;  3HA9 A;  5CRE A;  1S3A A;  1GTU A;  2HRK A;  3BD2 A;  5AIX A;  1ZL9 A;  5D96 A;  3HZ4 A;  4MJC A;  2ZNM A;  4POK A;  3F3R A;  3ZFB A;  1VRS D;  5B6M A;  4G0K A;  3TKP A;  3APS A;  1K3L A;  3ZL5 A;  4TXO A;  1TK8 B;  3L9U A;  2DC5 A;  5IPH A;  3GKK A;  5DAK B;  4FYU A;  1FVK A;  3ZIJ A;  5DCH A;  2ON7 A;  2M72 A;  3KTB A;  1A23 A;  2GGT A;  1A2J A;  2GT5 A;  1X5E A;  4ECC A;  2GQK A;  2JZR A;  1M9B A;  5EL8 A;  4JZQ A;  3HVX A;  1LBK A;  1QGV A;  1OE7 A;  2L6C A;  3A2V A;  1V57 A;  2OA7 A;  3WGE A;  2DKI A;  2KP2 A;  4L0U A;  4DVC A;  1SD9 A;  1SJ6 A;  4AF2 A;  3HZ8 A;  4P3Y B;  2IMK A;  2CX4 A;  10GS A;  2YZH A;  3ZYW A;  4NHZ A;  1Z6N A;  2C80 A;  1OVN A;  3GIX A;  3QD9 A;  2VCZ A;  3H8Q A;  1K0C A;  4MH2 A;  2BJX A;  4WR4 A;  2HFD A;  5IMD A;  1O85 A;  2H0H A;  1GSQ A;  2DLX A;  4KSO A;  4TW5 A;  3HDC A;  3M9K A;  1GTI A;  1LJR A;  4WKW A;  1C72 A;  3Q19 A;  3W8J A;  3GTU B;  4G19 A;  1XWK A;  2FA8 A;  3H79 A;  4MK3 A;  3KJY A;  3Q6O A;  5IMZ A;  1V58 A;  2MZC A;  4K5S A;  4TR1 A;  2J23 A;  2LNT A;  2K9F A;  1NHY A;  3BCK A;  3IA1 A;  4ZBD A;  2GZP A;  4G10 A;  2O89 A;  2XPD A;  5ABR A;  3GUR A;  2VL3 A;  1DSB A;  4O7H A;  1GNW A;  5ECR B;  2LRC A;  3TUE A;  2B7K A;  2H75 A;  4MH3 A;  4IW9 A;  2LV3 A;  4N10 A;  5KEJ A;  1XCC A;  2IFQ B;  3HHV A;  3D0Z A;  2LJA A;  2L5L A;  1EEJ A;  5FT3 A;  5DAL B;  3GMF A;  5B7C A;  4N0V A;  2BMX A;  1R5A A;  2J9H A;  1X9S B;  2H19 A;  4OD7 A;  4G0L A;  3J7Y k;  2L6D A;  2KHP A;  5JCU A;  4WR5 A;  1TRW A;  3QDN A;  1TKD B;  1ZYP A;  2PMT A;  4PX1 A;  3GTU A;  3BCI A;  4Q5Q A;  4E8H A;  4KCE A;  3ED3 A;  4V1A p;  2B5Y A;  2I4A A;  3RPP A;  3TKR A;  5IOX A;  2X8C A;  2LST A;  1F3A A;  4OMV A;  5A4U A;  1HYU A;  5F8B A;  2IMF A;  4QL7 A;  3E0U A;  1YKC A;  4XTS A;  1ZMA A;  4O92 A;  5HR0 A;  1T4Z A;  1K0D A;  3EIN A;  2H0I A;  4CY6 A;  2GZZ A;  3S9F A;  3EYT A;  13GS A;  1Z7P A;  2VL2 A;  3IDV A;  3I69 A;  1ON4 A;  2YPM A;  2IFQ A;  1GL8 A;  3I9V 2;  4KDX A;  1SK2 A;  4PUA A;  6GSY A;  5H5S A;  3TJF A;  4J56 E;  5CRG A;  4EUY A;  1IYH A;  1XXU A;  3MIX A;  4HU7 A;  1GUH A;  1F3B A;  1SU9 A;  4Q5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...