3ZRDA

Oxidised thiol peroxidase (tpx) from yersinia pseudotuberculosis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
174
structure length
174
Chain Sequence
QGIDPFTMTQTVHFQGNPVSVAGKLPQIGDKAKDFTLVAKDLSDVALSSFAGKRKVLNIFPSIDTGVCAASVRKFNQLAGELENTVVLCISSDLPFAQSRFCGAEGLSNVITLSTLRGADFKQAYGVAITEGPLAGLTARAVVVLDGQDNVIYSELVNEITTEPNYDAALAALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL PEROXIDASE
publication title Structural Characterisation of Tpx from Yersinia Pseudotuberculosis Reveals Insights Into the Binding of Salicylidene Acylhydrazide Compounds.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Oxidoreductase
total genus 55
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zrdA00
3IV4A 2VCVA 2IPAA 5J3RA 2DJKA 1QXHA 2CAIA 4K8MA 4LLRA 1U88A 1X9MB 1XWCA 3KH7A 1TTZA 3D4TA 5C04A 2WRTA 3HZ8A 1OKDA 4G19A 2H1BA 4I5QA 2B5EA 3HA9A 2DBCA 4YAPA 4OO4A 3APSA 3E3EA 2VO4A 4KGIA 4FYCA 3I69A 3C1RA 3VK9A 1B4PA 2OADA 3HCZA 4JZQA 4GTUA 3UIWA 3CSJA 5AIVA 3ZVJD 4K6XA 1ACVA 2RIIA 2KP1A 1CQHA 1M99A 4QQ7A 4RI7A 4MF5A 4Q5RA 2A2RA 2B7JA 4DSRA 4BL7A 3U6VA 3TOTA 2WCIA 1V57A 3KGKA 3C8EA 2AUVA 4KX4A 2HRNA 3QMXA 6GSWA 2CVKA 3A2XA 4KNDA 1XOAA 3FYGA 4I2UA 4POKA 4EC0A 4XS6A 4NWYA 4AJ7A 5CAXA 2QSIA 3KXOA 2YNXA 4OD7A 5G5EA 4MDCA 2H75A 3L9SA 4I97A 3CRTA 2C0GA 2M80A 2EC4A 1VF4A 3M1GA 2LJAA 3JCML 1K0BA 5D93A 4JU5A 3O3TA 4NPBA 5IMCA 1RW1A 3F63A 1R5PA 3IHQA 1SK0A 4KE3A 1B9XC 4K7IA 2L57A 3TB2A 1O6JA 3KJYA 5H5RA 1M2DA 1GSQA 2K8VA 1A2JA 1CQGA 3G9BA 1TU7A 14GSA 3LEFA 5DBQA 5F05A 2L59A 1ABAA 5GSTA 4YQVA 3QAWA 4NXIA 4ECIA 3TUEA 2L4QA 1EOHA 3TKSC 1XOBA 2YANA 1ERWA 2E7PA 4WR5A 2O7KA 3WGXA 1O8WA 1QMVA 4K9ZA 2F3MA 1Z3EA 1ZYQB 2B6MA 3TRXA 5GSSA 1XBSA 5ELAA 3Q6OA 4OFMA 4F2IA 2P5RA 3L9VA 1ILOA 3EU4A 4GWRA 5EL8A 3APOA 2H74A 2R3XA 1EEMA 3FZAA 3UMAA 4OCFA 1ZZYA 3ZMKA 3ZIJA 4POMA 3F3QA 1R7HA 5ECRB 1ZOFA 1NHOA 1W4VA 5KN2A 3HY2A 4QL9A 4GSNA 1VF2A 2HLSA 2YJHA 4I8BA 3G7JA 1HYUA 5IOWA 4J57E 1XWGA 1HQOA 2C3NA 3IK9A 1FG4A 5ECKB 3MAKA 3IRAA 2FLSA 2PVQA 3IDVA 1SKWB 3J7Yb 3LYPA 1SKRB 4JEDA 2F8AA 4LL1B 4ZL9A 3A5WA 1A0FA 1XVQA 5ID2A 3E9JB 4MLYA 5B8AA 2IL3A 1FVKA 2YZHA 4P3YB 4L5LA 1K0OA 4K2DA 5ELGA 3D5JA 2LRNA 1Y25A 3H1NA 5B8BA 2JSZA 1M9AA 3ISOA 2DJ0A 3F4TA 1ZCPA 4FH8A 3PINA 5J41A 2L4CA 1HNAA 1TXXA 3C71A 4MZBA 3Q18A 3FW2A 3CRUA 1A8LA 1TRUA 4IBPA 4L0UA 1PL1A 5CRGA 2F9SA 3TKRA 5G31A 2PMTA 3FRCA 1KEBA 3BBYA 2PERA 1X9SB 3DMLA 4G9HA 5FHIA 1RK4A 2DJ2A 2AHEA 5A4VA 2GT5A 4JE1A 1EGOA 3ZL5A 1SJIA 1MTCA 4K7NA 1PD21 1GLPA 2VD1A 3A2WA 4PGTA 6GSVA 2PGTA 2K6VA 2M46A 2IJYA 5IIZA 5D9TA 3DVWA 2E2GA 1WWJA 1EV4A 2CX4A 3WGDA 3EMPA 1YKAA 1DE2A 3GKNA 3FR6A 5A4WA 1A8YA 4ZBAA 1JZRA 4PQ1A 4X1UA 4F03A 4MPFA 2IN3A 1YF1A 2KHPA 3TJBA 1UVZA 3GUSA 5J9CA 1GSFA 12GSA 4MZWA 2CZ2A 3F4SA 4FYBA 4EO3A 2HXKA 3QAGA 1E6BA 2A4VA 2VM2A 1N2AA 1EZKA 1UN2A 5HR1A 3RAZA 4EUYA 2V32A 3GX0A 3VWWA 2N5AA 1PRXA 1GUMA 1GP1A 2H8LA 4MA9A 2B7KA 3VWUA 5A4UA 2ES7A 2FNOA 3TRQA 4ECBA 4OFTA 2VL9A 1M9BA 2YV9A 2F51A 4V2NA 1F6MC 6GSUA 3LYKA 3ERGA 2OA7A 1K0AA 3EURA 1O73A 4HJMA 2ZUPA 4BPYA 1O7UA 5A5KA 2OJLA 4JR6A 4N0VA 3HJOA 2IIYA 1AC1A 4O7HA 3H4KA 22GSA 3ME7A 2FWFA 4HUAA 1GTUA 1TK8B 2QC7A 1S3AA 2LEGA 3ZFBA 2DMMA 3G7YA 1UA5A 4MH3A 1R26A 2YP6A 3DWVA 6GSYA 3I9V2 3DKSA 4TVEA 2MBSA 4IN0A 1MD3A 5CNWA 2JZSA 3FZ5A 4EF0A 3GTUA 5ECQB 1WIKA 2OBKA 1M0UA 2HT9A 1BX9A 4XS4A 5D9VA 4K7OA 3E0UA 4E8HA 5HR3A 4NV2A 2L6CA 2JZRA 4ML1A 3CMIA 2VLVA 4JBBA 3LWAA 5D8IA 4AJ6A 4HZ2A 2I9HA 2AJQB 4V1Ap 4D73A 1TW9A 4MCUA 3VI7A 2DMLA 4MJBA 4OCEA 1C72A 2L6DA 3QOUA 1U3AA 3LXZA 2GSRA 3FR9A 4PNFA 2GGTA 5DQYA 1SL1B 4RQRA 3TKSE 3AY8A 1PL2A 3C7MA 4XTSA 5F07A 3M8NA 5C00A 4X43A 4GXZA 3FZ4A 3HHVA 2MMAA 3F3RA 3EMXA 1SL0B 2FWGA 2R4VA 3DD3A 1FVJA 2I3YA 2VL3A 1Z9HA 1QQ2A 4NMUA 1WOUA 5KN0A 3ED3A 3CSIA 1U3IA 3SBCA 1Z7RA 1RQMA 2XBIA 2FD3A 5ID2B 2JL4A 2IMDA 2MYGA 2H19A 1BG5A 1MDIA 5D96A 4J56E 4PQHA 2JADA 1QK8A 1IYHA 1EP7A 3LXTA 2VCTA 3HXSA 19GSA 3W8SA 2GQKA 4JRRA 1YF0A 2WGRA 9GSSA 1WMJA 2H01A 4KB3A 2YN1A 2P5QA 1GLQA 1VGLA 4E8EA 6GSXA 3R2QA 2NBSA 3RDWA 2WULA 1DBYA 3GURA 4OO5A 4MF6A 1XIYA 16GSA 2RM6A 1T4YA 2WB9A 3CYNA 2R2JA 3EVIA 1TRWA 1URMA 2OE0A 1BJXA 1OC9B 2C3TA 1T1VA 1A2MA 1YJ6A 4PURA 5IMAA 3DGQA 2R6KA 2FY6A 3VI5A 2FUG2 1PMTA 5ABRA 2LRCA 4WF4A 1AUCA 4GLTA 1JFUA 4MF7A 5KEJA 3GN3A 1X9WB 5DVBA 4PQIA 2AAWA 1MEKA 1KTEA 2OE3A 1SJ6A 4KAEA 4WR4A 1XZOA 2GZPA 1YEPA 2RUEA 4AGSA 1OAZA 3FHKA 1GUHA 1A2LA 4POLA 2R5GA 4ECCA 1TI3A 1WRYA 2PWJA 5DAKB 2LNTA 1QGVA 3TOUA 3DVXA 1F9MA 2YPMA 3MDKA 1ZYEA 1WE0A 4CDOA 4N0ZA 4HI7A 1AQVA 8GSSA 4WETA 3IOSA 1EGRA 1XWBA 2FCHA 4PUFC 1G7EA 3H79A 4TOPA 1VRSD 1PX6A 4IW9A 1WJKA 5DJLA 1ERVA 3QD9A 3TJGA 4YQMA 1DE1A 5IOXA 3UL3A 2V1MA 3FK8A 4IS0A 4V1Ag 3Q74A 4HQZA 2REMA 5L71A 1GH2A 2MZCA 5E4WA 2IWTA 1KBNA 1X5EA 1AIUA 4TRXA 2QGVA 2WFCA 1PA3A 13GSA 2E0QA 3U5RE 4OMVA 3ZITA 1THOA 1SYRA 2ZNMA 4EDZA 2K8SA 4TR1A 5AGYA 1AQXA 2K18A 2YCDA 5ECOB 2TRCP 3EINA 1OC3A 2HRFA 2VIMA 4TXOB 4XS4B 2PBJA 5IO2A 2CX3A 4ZL8A 2CT6A 4WBJA 4ILFA 5KN1A 3GL3A 2DC5A 3M3MA 2JZTA 4RI6A 4IGJA 2R37A 3HVSA 2GQLA 2XBQA 4F9ZA 2H6YA 3KP8A 5IMDA 2V2GA 2VLUA 3ZYWA 5AIXA 1H75A 5E59A 1FO5A 2LTKA 4HU7A 2GVPA 3PH9A 5GAND 1SK2A 1Y6EA 4F0BA 2WZ9A 1GNEA 1DUGA 4MABA 1TOFA 1EWXA 1OYJA 2LQOA 3V1WA 1MD4A 1F3AA 3ZVJA 3DYRA 1M2AA 1A24A 2RLIA 5IMZA 1SU9A 4K1FA 1SENA 2I4AA 1T00A 3ME8A 4CHSA 4LA1A 4LMVA 2E2MA 3HZ4A 3GKKA 3UJ1A 1PN9A 1T3BA 3PR8A 3I43A 2D2ZA 4DSSA 2LJRA 1XWAA 4ZB6A 4O5RA 3LGCA 5ECLB 2I1UA 3BD2A 2O87A 1AAZA 2ALBA 4NHWA 2P0GA 3IXRA 2VOCA 2KOKA 3M9JA 5H5QA 4FO5A 2LRTA 3FZ9A 3ZIVA 2H70A 2TRXA 2C3QA 5CYYA 4AF2A 3WYWA 2AYTA 2GS3A 2J23A 2LUSA 1SD9A 4LMWA 4MJCA 2K9FA 1XFLA 1FOVA 4TR3A 3CBUA 2H6ZA 4O32A 2N5BA 3N9JA 2O85A 3KP9A 3CTGA 1F3BA 2CVDA 1FB6A 2IMEA 1SYXA 4PNGA 2DJ3A 3UBKA 2BTOT 2KP2A 2HI7A 1H4OA 1OC8A 3APQA 3P2AA 5G5FA 5DJMA 2H76A 3GX8A 4Q5FA 2V6OA 4TR0A 3DIEA 3P7XA 5CO3A 4GQCA 5JCGA 1PX7A 4MMMA 1VF1A 4NAXA 4HZ4A 1K3OA 4QL7A 1R4WA 3GHAA 4IHUA 3IAM2 4V2MA 4KW6A 2BJXA 4WF5A 3KTLA 2PVOC 1M7TA 3F6FA 3VPTA 1MDJA 5ECSA 1Z6NA 3WT2A 2GTUA 4ZBDA 4KA0A 3DEXA 1PQNA 3HJMA 4IP1A 2NVLA 2YZUA 5DALA 3C1SA 1PSQA 1X5DA 5DDLA 1GULA 5KN3A 3H8QA 1O81A 3BCIA 2H1AA 2DJJA 1UC7A 2DIYA 1T4ZA 2PUKC 2JSYA 3GKMA 1K0CA 2GSQA 1YZXA 3TCOA 2PU9C 3HD5A 2EIOA 4WEYA 4EE0A 1FB0A 2IMFA 5DCHA 2HFDA 5G2ZA 3O76A 2L5OA 3Q19A 2C8UA 4EL1A 3K8NA 2C0EA 1U6TA 2MMZA 2HYXA 4L5OA 4V2LA 1YEXA 1Q98A 1DSBA 1BEDA 1LBKA 5HR0A 1IYIA 4N11A 3HYPA 1K0NA 4FIWA 2HZEA 3ZMLA 4GF0A 3NIVA 2H6XA 5DQSA 3KTBA 1K0DA 3IC4A 5ECMB 4LL4B 4BWSA 4PX1A 3KMOA 2GSTA 2B1LA 2ON7A 2V41A 1XPVA 2B5YA 3QR6A 4POBA 2YJ7A 2ZCTA 1SJZA 3EC3A 4H86A 5INYA 1FW1A 2I81A 4YAVA 1ZMAA 1OVNA 4IQ1A 4ZB8A 2JACA 3IPZA 4TN8A 2GZYA 3RPPA 2HZFA 1BQ7A 11GSA 3LORA 4KUNA 3US3A 2Z9SA 5ENUA 5CRHA 3FEUA 3P90A 4IVFA 2VL2A 3EYTA 2XC2A 5JWRB 4ACSA 3IBHA 1GTBA 1XW9A 1N8JA 1WP0A 5JWOB 4PXOA 5B6NA 3WT1A 2LNSA 2VLTA 3TKQA 2ON5A 4IKHA 2F8FA 5EPFA 3IA1A 3KIJA 3A2VA 3UAPA 4CW9A 5HR2A 2FWEA 1EP8A 4HEA2 1GWCA 1I9DA 2H1GA 4MZCA 4KDUA 1ML6A 1GTIA 3QPMA 1TRVA 2TIRA 1J9BA 4GSSA 1OKTA 3FR3A 3KCMA 5F0GA 4Z7XA 4J2FA 1AXDA 3KD0A 3LFLA 1WPIA 1EEJA 2O89A 1B48A 3SWLA 4EXJA 2C0DA 3QFAC 2GZZA 1ERTA 2FA4A 6GSTA 3P8WA 2X8HA 2RM5A 1GSDA 4MPGA 1TDIA 2B5XA 3UBLA 3FKFA 3TJJA 4KSOA 5HFIA 4MK3A 3RHBA 3GV1A 2GQMA 1T7PB 4MH2A 4ZBBA 5HQPA 2HNLA 3KM6A 2NDOA 3ZREA 1V58A 4TXVA 1O8XA 2EIRA 2CV4A 1G6WA 4GSTA 1TI1A 2YWIA 1O85A 2CVBA 4RUVA 1SKSB 4X0XA 4ML6A 3VPQA 1XW5A 2A2SA 3CTFA 3S9FA 4Q5QA 3F9UA 3LG6A 2FHEA 3FY7A 5IMFA 5CRDA 3D22A 2YOIA 2V6KA 3A3TA 2KUCA 2H30A 3QFBC 2B1KA 2HSHA 5IMVA 1Q4JA 4HDEA 2H72A 5J9BA 1XXUA 5EY6A 2FGXA 2GSSA 3G7IA 4EKZA 2O8VB 5CP1A 4XRAA 1B4QA 4HS1A 4FYUA 3TRPA 3M0FA 3GYKA 3F6DA 2EIQA 4XIHA 4ID0A 4KH7A 1G0TA 5CREA 4ZXGA 3GSSA 1TU8A 1QFNA 3QAVA 1GNWA 3BOAA 4L0WA 2FA8A 3BCKA 1HD2A 2X8CA 1V2AA 5DALB 1G7OA 4XS1A 1OE8A 5ECIB 5G1LA 1EV9A 4ZB9A 1BAYA 3UVHA 3D21A 2HSYA 2H66A 6GSSA 3WGEA 4MJAA 1FHEA 3C73A 4F82A 1XW6A 3TJKA 1AQWA 3VFIA 3ERFA 3WD6A 3IE3A 1X5CA 4GRFA 5ECPB 3D0ZA 4ULXA 1A0RP 2N5FA 2WS2A 4BA7A 5FWGA 3GSTA 1BYEA 2VL2C 4HJ2A 2JU5A 1ERUA 1GUKA 2OE1A 3TGZA 2IMKA 3KH9A 3UEMA 4KSMA 1SK1A 3KMNA 1NW2A 4DSQA 3GTUB 4L8EA 3O6TA 1LU4A 4O92A 3NZNA 2P31A 1OE7A 1TJDA 4EVMA 1B8XA 10GSA 4MJEA 2AV4A 2HZEB 5EVOA 1GL8A 4XCSA 1J08A 2OACA 5GAPD 2LJKA 4MP4A 3LSZA 4F0CA 1SL2B 1XWKA 3TKPA 5J5NA 1U87A 2VCZA 4N10A 3EE2A 1NM3A 2AB6A 4D73B 2CQ9A 2VD0A 5ECHB 3F8UA 1ST9A 1GSEA 1JLVA 4HQSA 4OWYA 3VURA 2BMXA 2XPEA 2KLXA 1ON4A 4GQFA 2LKUA 5DCGA 3D6IA 4TW5A 4PUAA 1R5AA 3GRXA 1F2EA 3J7Yk 1JHBA 1THXA 3DXBA 4WBRD 3L0HA 3RBTA 2IFQA 1Z6MA 1GSSA 1MDKA 3MNGA 3GA4A 4YQUA 1M2BA 1PGTA 4HU9A 2DLXA 3KEBA 3M9KA 2B3SA 2LSTA 5IO0A 1S3CA 4GCIA 2VAFA 4XRDA 3VWXA 1HNCA 5ECNB 3GIXA 5HFGA 3HKRA 2VCWA 1V98A 2J9HA 3TJFA 4IP6A 4XHMA 3ZZXA 3VLNA 1V9WA 1GRXA 1XCCA 5D9XA 1JLWA 2LV3A 2MBTA 2MMOA 1PKWA 4OFNA 3EU3A 2DJ1A 3MSZA 1EOGA 5CRWA 1V40A 4ZL7A 3ERWA 1J0FA 4KCAA 5COHA 3D4MA 1XVWA 1I5GA 5JCWA 3BJ5A 5D9WA 1HNBA 1TP9A 17GSA 2M72A 1JZOA 4ECJA 2CA8A 5JCUA 3I6AA 4N30A 2NPBA 1K0MA 2YWMA 2C0FA 3NOFA 1SD8A 3VWVA 1PKZA 4Q5NA 5FT3A 1Z5YE 1X0RA 2HE3A 3KZQA 2DSAA 5IPGA 2IMIA 5IPHA 4WKWA 3HVVA 5H5SA 2H71A 4IQAA 5F8BA 2X64A 4IELA 1G6YA 5LD0A 1OC9A 2LQQA 1GSYA 4G10A 3IK7A 3UARA 1YKCA 4KDYA 3N5OA 3QCPA 3UOMA 2GDRA 4K0GA 1QUWA 2QKEA 4I2TA 5HFKA 1JZWA 1F37A 2YWOA 3GNJA 2C4JA 2H0HA 3IR4A 3ZFLA 2VUPA 3L9UA 3CSHA 3ZRDA 3CXGA 2G2QA 2OBIA 2YV7A 1YY7A 2C80A 1YQ1A 2LS5A 3DRNA 3GL5A 4IJ3A 3W8JA 3LQ7A 4G2EA 5J4UA 1S3DA 4ISDA 4IJIA 3W6GA 2GT6A 7GSSA 1YDKA 4ZIJA 4K0NA 3GKXA 5DAKA 5F06A 1E2YA 1LJRA 4JR4A 3IAS2 3QDNA 2XPDA 3GMFA 1K3YA 4I6XA 3L78A 1T8EB 5LCZA 3RPNA 1AW9A 2VCQA 3HVXA 1VF3A 4RQXA 3HJPA 1FAAA 18GSA 5IM9A 2GLRA 2X99A 4BWQA 3ZTLA 3H93A 3LJRA 4BVXA 2G0FA 20GSA 4KCEA 4DVCA 3TDGA 4TR1B 3F4RA 2YWNA 1NSWA 1B9YC 4ZILA 3OR5A 2RUFA 4WXTA 4HOJA 2H73A 5B6MA 4YH2A 3MWHA 1JZDA 2L5LA 3ZLPA 2OKAA 1Z7PA 2H0IA 5IQYA 5LNKe 5D73A 3RHCA 4TKYA 4TXOA 1TKDB 2NTOA 5B7CA 5JWQB 4NV5A 5G1KA 1TK0B 5AISA 2DIZA 3UVTA 2CZ3A 4KDXA 2PPTA 2WJUA 1USBA 3PGTA 3HDCA 4NHZA 5GZZB 3GH9A 3GFKA 2H1DA 2IFQB 1K3LA 2PN8A 4DEJA 1GTAA 2XHFA 5AN1A 2WDUA 3EWLA 3TKSA 1TK5B 3GH6A 4EDYA 2H0GA 1TRSA 3L4NA 1KNGA 2FWHA 2MMNA 2C1YA 2X8GA 3F0IA 1GSUA 4DSSB 4TR4A 5G30A 1ZL9A 1NHYA 4BVYA 1A23A 4AJ8A 1W89A 2VCXA 1ZGNA 2VM1A 2CAQA
chains in the Genus database with same CATH superfamily
3IV4A 2VCVA 2IPAA 5J3RA 2DJKA 1QXHA 2CAIA 4K8MA 4LLRA 1U88A 1X9MB 1XWCA 3KH7A 1TTZA 3D4TA 5C04A 4O5UA 2WRTA 3HZ8A 1OKDA 4G19A 2H1BA 4I5QA 2B5EA 3HA9A 2DBCA 4YAPA 4Z2TA 4OO4A 3APSA 3E3EA 2VO4A 4KGIA 4FYCA 3I69A 3C1RA 3VK9A 1B4PA 1M3JA 2OADA 3HCZA 4JZQA 4GTUA 3UIWA 3CSJA 5AIVA 3ZVJD 4K6XA 1ACVA 2RIIA 2KP1A 1CQHA 1M99A 4QQ7A 4RI7A 4MF5A 4Q5RA 2A2RA 2B7JA 4DSRA 4BL7A 3U6VA 3TOTA 2WCIA 1V57A 3KGKA 3CQFA 3C8EA 2AUVA 4KX4A 2HRNA 3QMXA 6GSWA 2CVKA 3A2XA 4KNDA 1XOAA 3FYGA 4I2UA 4POKA 4EC0A 4XS6A 4NWYA 4AJ7A 5CAXA 2QSIA 3KXOA 2YNXA 4OD7A 5G5EA 4MDCA 2H75A 3L9SA 4I97A 3CRTA 2C0GA 2M80A 2EC4A 1VF4A 4YKFA 3M1GA 2LJAA 3JCML 1K0BA 5D93A 4JU5A 3O3TA 3PPUA 4NPBA 5IMCA 1RW1A 3F63A 1R5PA 3IHQA 1SK0A 4KE3A 1ZYPA 1B9XC 3MYDA 4K7IA 2L57A 3TB2A 1O6JA 3KJYA 5H5RA 1M2DA 1GSQA 2K8VA 1A2JA 1CQGA 3G9BA 1TU7A 14GSA 3LEFA 5DBQA 5F05A 2L59A 1ABAA 5GSTA 4YQVA 3QAWA 4NXIA 4FQUA 4ECIA 3TUEA 4BVXB 2L4QA 1EOHA 3TKSC 1XOBA 2YANA 1ERWA 2E7PA 4WR5A 2O7KA 3WGXA 1O8WA 1QMVA 4K9ZA 2F3MA 1Z3EA 1ZYQB 2B6MA 3TRXA 5GSSA 1XBSA 5ELAA 3Q6OA 4OFMA 4F2IA 2P5RA 3L9VA 1ILOA 3EU4A 4GWRA 5EL8A 3APOA 2H74A 2R3XA 1EEMA 3FZAA 3UMAA 4OCFA 1ZZYA 3ZMKA 3ZIJA 4POMA 3F3QA 1R7HA 5ECRB 1ZOFA 1NHOA 1W4VA 5KN2A 3HY2A 4QL9A 4GSNA 1VF2A 2HLSA 2YJHA 4I8BA 3G7JA 1HYUA 5IOWA 4J57E 1XWGA 1HQOA 2C3NA 3IK9A 1FG4A 5ECKB 3MAKA 3IRAA 2FLSA 2PVQA 3IDVA 1SKWB 3J7Yb 3LYPA 1SKRB 4JEDA 2F8AA 4LL1B 4ZL9A 3A5WA 1A0FA 1XVQA 5ID2A 3E9JB 4MLYA 5B8AA 4BVYB 2IL3A 1FVKA 2YZHA 4P3YB 4L5LA 1K0OA 4K2DA 5ELGA 3D5JA 2LRNA 1Y25A 3H1NA 5B8BA 2JSZA 1M9AA 3ISOA 2DJ0A 3F4TA 1ZCPA 4FH8A 3PINA 5J41A 2L4CA 1HNAA 1TXXA 3C71A 4MZBA 3Q18A 3FW2A 3CRUA 1A8LA 1TRUA 4IBPA 4L0UA 1PL1A 5CRGA 2F9SA 3TKRA 5G31A 2PMTA 3FRCA 1KEBA 3BBYA 2PERA 1X9SB 3DMLA 4G9HA 5FHIA 1RK4A 2DJ2A 2AHEA 5A4VA 2GT5A 4JE1A 1EGOA 3ZL5A 1SJIA 1MTCA 4K7NA 1PD21 1GLPA 2VD1A 3A2WA 4PGTA 6GSVA 2PGTA 2K6VA 2M46A 2IJYA 5IIZA 5D9TA 3DVWA 2E2GA 1WWJA 1EV4A 2CX4A 3WGDA 3EMPA 3R3EA 1YKAA 4CY8A 2QA2A 1DE2A 3GKNA 3FR6A 5A4WA 1A8YA 2X4AA 4ZBAA 1JZRA 4PQ1A 4X1UA 4F03A 4MPFA 2IN3A 5KOWA 1YF1A 2KHPA 3TJBA 1UVZA 3GUSA 5J9CA 1GSFA 12GSA 4MZWA 2CZ2A 3F4SA 4FYBA 4EO3A 2HXKA 4K2XA 3QAGA 1E6BA 2A4VA 5BRTA 2VM2A 1N2AA 1EZKA 1UN2A 5HR1A 3RAZA 4EUYA 2V32A 3GX0A 3VWWA 2N5AA 1PRXA 1GUMA 1GP1A 2H8LA 4MA9A 2B7KA 3VWUA 5A4UA 2ES7A 2FNOA 3TRQA 4ECBA 4OFTA 1S3RA 1M9BA 2VL9A 1FOHA 2YV9A 2F51A 4V2NA 1F6MC 6GSUA 3LYKA 3ERGA 2OA7A 1K0AA 3EURA 1O73A 4HJMA 2ZUPA 4BPYA 1O7UA 5A5KA 2OJLA 4JR6A 4N0VA 3HJOA 2IIYA 1AC1A 4O7HA 3H4KA 22GSA 3ME7A 2FWFA 4HUAA 1GTUA 1TK8B 2QC7A 1S3AA 2LEGA 3ZFBA 2DMMA 3G7YA 1UA5A 4MH3A 1R26A 2YP6A 3DWVA 6GSYA 3I9V2 3DKSA 4TVEA 2MBSA 4IN0A 1MD3A 5CNWA 2JZSA 3FZ5A 4EF0A 3GTUA 5ECQB 2QA1A 1WIKA 2OBKA 1M0UA 2HT9A 1BX9A 4XS4A 5D9VA 4K7OA 3E0UA 4E8HA 5HR3A 4NV2A 2L6CA 2JZRA 4ML1A 3CMIA 2VLVA 4JBBA 3LWAA 5D8IA 4AJ6A 4HZ2A 2I9HA 2AJQB 4V1Ap 4D73A 1TW9A 4MCUA 3VI7A 2DMLA 4MJBA 4OCEA 1C72A 2L6DA 3QOUA 1U3AA 3LXZA 2GSRA 5BMUA 3FR9A 4PNFA 2GGTA 5DQYA 1SL1B 4RQRA 3TKSE 3AY8A 1PL2A 3C7MA 4XTSA 5F07A 3M8NA 5C00A 4X43A 4GXZA 3FZ4A 2UZ8A 3HHVA 2MMAA 3F3RA 3EMXA 1SL0B 2FWGA 2R4VA 3DD3A 1FVJA 2I3YA 2VL3A 2HRAA 1Z9HA 1QQ2A 2HRKA 4NMUA 1WOUA 5KN0A 3ED3A 3CSIA 1U3IA 3SBCA 1Z7RA 1RQMA 2XBIA 4G0IA 5KOXA 2FD3A 5ID2B 2JL4A 2IMDA 2MYGA 2H19A 1BG5A 1MDIA 5D96A 4J56E 4PQHA 2JADA 1QK8A 1IYHA 1EP7A 3LXTA 2VCTA 3HXSA 19GSA 3W8SA 2GQKA 4JRRA 1YF0A 2WGRA 9GSSA 1WMJA 2H01A 4KB3A 2YN1A 2P5QA 1GLQA 4K5RA 1VGLA 4E8EA 6GSXA 3R2QA 2NBSA 3RDWA 2WULA 1DBYA 3GURA 4OO5A 4MF6A 1XIYA 16GSA 2RM6A 1T4YA 2WB9A 1PN0A 3CYNA 2R2JA 3EVIA 1TRWA 1URMA 2OE0A 1BJXA 1OC9B 2C3TA 1T1VA 1A2MA 1YJ6A 4PURA 3LW9A 5IMAA 3DGQA 2R6KA 2FY6A 3VI5A 2FUG2 1PMTA 5ABRA 2LRCA 4WF4A 1AUCA 4GLTA 1JFUA 4MF7A 5KEJA 3GN3A 1X9WB 5DVBA 4PQIA 2AAWA 1MEKA 1KTEA 2OE3A 1SJ6A 4KAEA 4WR4A 1XZOA 2GZPA 2R0GA 1YEPA 2RUEA 4AGSA 1OAZA 3FHKA 1GUHA 1A2LA 4POLA 2R5GA 4ECCA 1TI3A 1WRYA 2PWJA 5DAKB 2LNTA 1QGVA 3TOUA 3DVXA 1F9MA 2YPMA 3MDKA 1ZYEA 1WE0A 4CDOA 4N0ZA 4HI7A 1AQVA 8GSSA 4WETA 3IOSA 1EGRA 1XWBA 2FCHA 4PUFC 1G7EA 3H79A 4TOPA 4G0KA 1VRSD 1PX6A 4IW9A 1WJKA 4K5SA 5DJLA 1ERVA 3QD9A 3TJGA 4YQMA 1DE1A 5IOXA 3UL3A 2V1MA 3FK8A 4IS0A 4V1Ag 3Q74A 4HQZA 2REMA 5L71A 1GH2A 2MZCA 5E4WA 2IWTA 1KBNA 1X5EA 1AIUA 4TRXA 2QGVA 2WFCA 1PA3A 13GSA 2E0QA 3U5RE 4OMVA 3ZITA 1THOA 1SYRA 2ZNMA 4EDZA 2K8SA 4TR1A 5AGYA 1AQXA 2K18A 2YCDA 5ECOB 2TRCP 3EINA 1OC3A 2HRFA 2VIMA 4TXOB 4XS4B 2PBJA 5IO2A 2CX3A 4ZL8A 2CT6A 4WBJA 4ILFA 5KN1A 3GL3A 2DC5A 3M3MA 2JZTA 4RI6A 4IGJA 2R37A 3HVSA 2GQLA 2XBQA 4F9ZA 2H6YA 3KP8A 5IMDA 2V2GA 2VLUA 3ZYWA 5AIXA 1H75A 5E59A 1FO5A 2LTKA 4HU7A 2GVPA 3PH9A 5GAND 1SK2A 1Y6EA 4F0BA 2WZ9A 1GNEA 1DUGA 4MABA 1TOFA 1EWXA 1OYJA 2LQOA 3V1WA 1MD4A 1F3AA 3ZVJA 3DYRA 1M2AA 1A24A 2RLIA 5IMZA 1SU9A 4K1FA 1SENA 2I4AA 1T00A 3ME8A 4CHSA 4LA1A 4LMVA 2E2MA 3HZ4A 3GKKA 3UJ1A 1PN9A 1T3BA 3PR8A 3I43A 2D2ZA 4DSSA 2LJRA 1XWAA 4ZB6A 4O5RA 3LGCA 5ECLB 2I1UA 3BD2A 2O87A 1AAZA 2ALBA 4NHWA 2P0GA 4EIQA 3IXRA 2VOCA 2KOKA 3M9JA 5H5QA 4FO5A 2LRTA 3EPTA 3FZ9A 3ZIVA 2H70A 2TRXA 2C3QA 4MNNA 4KF9A 5CYYA 4AF2A 3WYWA 2AYTA 2GS3A 2J23A 2LUSA 1SD9A 4LMWA 4MJCA 2K9FA 1XFLA 1FOVA 4TR3A 1ZYNA 3CBUA 2A4HA 2H6ZA 4O32A 2N5BA 3N9JA 2O85A 3KP9A 3CTGA 1F3BA 2CVDA 1FB6A 2IMEA 1SYXA 4PNGA 4BL7B 2DJ3A 3UBKA 2BTOT 2KP2A 2HI7A 1H4OA 1OC8A 3APQA 3P2AA 5G5FA 5DJMA 2H76A 3GX8A 4Q5FA 2V6OA 4TR0A 3DIEA 3P7XA 5CO3A 4GQCA 5JCGA 1PX7A 4MMMA 1VF1A 4NAXA 4HZ4A 1K3OA 4QL7A 1R4WA 3GHAA 4IHUA 3IAM2 4V2MA 4KW6A 2BJXA 4WF5A 3KTLA 2PVOC 1M7TA 3F6FA 3VPTA 1MDJA 5ECSA 1Z6NA 3WT2A 2GTUA 4ZBDA 4KA0A 3DEXA 1PQNA 3HJMA 4IP1A 2NVLA 2YZUA 3FMWA 5DALA 3C1SA 1PSQA 1X5DA 5DDLA 1GULA 5KN3A 3H8QA 1O81A 3BCIA 2H1AA 2DJJA 1UC7A 2DIYA 1T4ZA 2PUKC 2JSYA 3GKMA 1K0CA 2GSQA 1YZXA 3IC8A 3TCOA 2PU9C 3HD5A 2EIOA 4WEYA 4EE0A 1FB0A 2IMFA 5DCHA 2HFDA 5G2ZA 3O76A 2L5OA 3Q19A 2C8UA 4EL1A 3K8NA 2C0EA 1U6TA 2MMZA 2HYXA 4L5OA 4V2LA 1YEXA 1Q98A 1DSBA 1BEDA 1LBKA 5HR0A 1IYIA 4N11A 3HYPA 1K0NA 4FIWA 2HZEA 3ZMLA 4USSA 4GF0A 3NIVA 2H6XA 5DQSA 3KTBA 1K0DA 3IC4A 2R0PA 5ECMB 3IHGA 4LL4B 4BWSA 4PX1A 3KMOA 2GSTA 2B1LA 4BIKA 2ON7A 2V41A 1XPVA 2B5YA 3QR6A 4POBA 2YJ7A 2ZCTA 1SJZA 3EC3A 4H86A 5INYA 1FW1A 2I81A 4YAVA 1ZMAA 1OVNA 4IQ1A 4ZB8A 2JACA 3IPZA 4TN8A 2GZYA 3RPPA 2HZFA 1BQ7A 11GSA 3LORA 4KUNA 3US3A 2Z9SA 5ENUA 4O5QA 5CRHA 3FEUA 3P90A 4IVFA 2VL2A 3EYTA 2XC2A 5JWRB 4ACSA 3IBHA 1GTBA 1XW9A 1N8JA 1WP0A 5JWOB 4PXOA 5B6NA 3WT1A 2LNSA 2VLTA 3TKQA 2ON5A 4IKHA 2F8FA 5EPFA 3IA1A 3KIJA 3A2VA 3UAPA 4CW9A 5HR2A 2FWEA 1EP8A 4HEA2 1GWCA 1I9DA 2H1GA 4MZCA 4KDUA 1ML6A 1GTIA 3QPMA 1TRVA 2TIRA 1J9BA 4GSSA 1OKTA 3FR3A 3KCMA 5F0GA 4Z7XA 4J2FA 1PFOA 1AXDA 3KD0A 3LFLA 1WPIA 1EEJA 2O89A 1B48A 3SWLA 4EXJA 2C0DA 3QFAC 2GZZA 1ERTA 2FA4A 6GSTA 3P8WA 2X8HA 2RM5A 1GSDA 4MPGA 1TDIA 2B5XA 3UBLA 3FKFA 3TJJA 4KSOA 5HFIA 4MK3A 3RHBA 4YKGA 3GV1A 2GQMA 1T7PB 4MH2A 4ZBBA 5HQPA 3A5IA 2HNLA 3KM6A 2NDOA 3ZREA 1V58A 4TXVA 1O8XA 2EIRA 2CV4A 1G6WA 4GSTA 1TI1A 2YWIA 1O85A 2CVBA 4RUVA 1SKSB 4X0XA 4ML6A 3VPQA 1XW5A 2A2SA 3CTFA 3S9FA 4Q5QA 3F9UA 3LG6A 2FHEA 3FY7A 5IMFA 5CRDA 3D22A 2YOIA 2V6KA 2DKHA 3A3TA 2KUCA 2H30A 3QFBC 2B1KA 2HSHA 5IMVA 1Q4JA 4HDEA 2H72A 5J9BA 4EIPA 1XXUA 5EY6A 2FGXA 2GSSA 3G7IA 4EKZA 2O8VB 5CP1A 4XRAA 1B4QA 4HS1A 4FYUA 3TRPA 3M0FA 2R0CA 3GYKA 3F6DA 2EIQA 4XIHA 4ID0A 4KH7A 1G0TA 5CREA 4ZXGA 3GSSA 1TU8A 1QFNA 3QAVA 1GNWA 3BOAA 4L0WA 2FA8A 3BCKA 1HD2A 2X8CA 1V2AA 5DALB 1G7OA 4XS1A 1OE8A 5ECIB 5G1LA 1EV9A 4ZB9A 1BAYA 3UVHA 3D21A 2HSYA 2H66A 6GSSA 3WGEA 4MJAA 1FHEA 3C73A 4F82A 1XW6A 3TJKA 1AQWA 3VFIA 3ERFA 3WD6A 3IE3A 1X5CA 4GRFA 5ECPB 3D0ZA 4ULXA 1A0RP 2N5FA 2WS2A 4BA7A 5FWGA 3GSTA 1BYEA 2VL2C 4HJ2A 2JU5A 1ERUA 1GUKA 2OE1A 3TGZA 2IMKA 3KH9A 3UEMA 4KSMA 1SK1A 3KMNA 1NW2A 4DSQA 3GTUB 4L8EA 3O6TA 1LU4A 4O92A 3NZNA 2P31A 4G0LA 1OE7A 1TJDA 4EVMA 1B8XA 10GSA 4MJEA 2AV4A 2HZEB 4ICYA 5EVOA 1GL8A 4XCSA 1J08A 2OACA 5GAPD 2LJKA 4MP4A 3LSZA 4F0CA 1SL2B 1XWKA 3TKPA 5J5NA 1U87A 2VCZA 4N10A 3EE2A 1NM3A 2AB6A 4D73B 2CQ9A 3MIXA 2VD0A 5ECHB 3F8UA 1ST9A 1GSEA 1JLVA 4HQSA 4OWYA 3VURA 2BMXA 2XPEA 2KLXA 1ON4A 4GQFA 2LKUA 5DCGA 3D6IA 4TW5A 4PUAA 1R5AA 3GRXA 1F2EA 3J7Yk 1JHBA 1THXA 4PTSA 3DXBA 4WBRD 3L0HA 3RBTA 2IFQA 1Z6MA 1GSSA 1MDKA 3MNGA 3GA4A 4YQUA 1M2BA 1PGTA 4HU9A 2DLXA 3KEBA 3M9KA 2B3SA 2LSTA 5IO0A 1S3CA 4GCIA 4A5PA 2VAFA 4XRDA 3VWXA 1HNCA 3GIXA 5ECNB 5HFGA 3HKRA 2VCWA 1V98A 2J9HA 3TJFA 4IP6A 4XHMA 3ZZXA 3VLNA 1V9WA 1GRXA 1XCCA 5D9XA 1JLWA 2LV3A 2MBTA 2MMOA 1PKWA 4OFNA 3EU3A 2DJ1A 3MSZA 1EOGA 5CRWA 1V40A 4ZL7A 3ERWA 1XG8A 1J0FA 4KCAA 5COHA 3D4MA 1XVWA 1I5GA 5JCWA 3BJ5A 5D9WA 1HNBA 1TP9A 17GSA 2M72A 1JZOA 4ECJA 2CA8A 5JCUA 3I6AA 4N30A 2NPBA 1K0MA 4X4JA 2YWMA 2C0FA 3NOFA 2X49A 1SD8A 3VWVA 1PKZA 4Q5NA 5FT3A 1Z5YE 1X0RA 2HE3A 3KZQA 2DSAA 5IPGA 2IMIA 5IPHA 4WKWA 3HVVA 5H5SA 2H71A 4IQAA 5F8BA 2X64A 4IELA 1G6YA 5LD0A 2HSMA 1OC9A 2LQQA 1GSYA 4G10A 3IK7A 3UARA 1YKCA 4KDYA 3N5OA 3QCPA 3UOMA 2GDRA 4K0GA 1QUWA 2QKEA 4I2TA 5HFKA 1JZWA 1F37A 2YWOA 3GNJA 2C4JA 4Z2UA 2H0HA 3IR4A 3ZFLA 2VUPA 3L9UA 3CSHA 3ZRDA 4CY6A 3CXGA 2G2QA 2OBIA 2YV7A 1YY7A 2C80A 1YQ1A 2LS5A 3DRNA 3GL5A 4IJ3A 3W8JA 3LQ7A 4G2EA 4Z2RA 5J4UA 1S3DA 4ISDA 4IJIA 3W6GA 2GT6A 7GSSA 1YDKA 4ZIJA 4K0NA 3GKXA 5DAKA 5F06A 1E2YA 1LJRA 4JR4A 3IAS2 3QDNA 2XPDA 3GMFA 1K3YA 2DKIA 4I6XA 3L78A 1T8EB 5LCZA 3RPNA 1AW9A 2VCQA 3HVXA 1VF3A 4RQXA 3HJPA 1FAAA 18GSA 4HSCX 2A2PA 5IM9A 2GLRA 2X99A 4BWQA 3ZTLA 3H93A 3LJRA 4BVXA 2G0FA 20GSA 4KCEA 4DVCA 3TDGA 4TR1B 3F4RA 2YWNA 1NSWA 1B9YC 4ZILA 3OR5A 2RUFA 4WXTA 4HOJA 2H73A 5B6MA 4YH2A 3MWHA 1JZDA 2L5LA 3ZLPA 2OKAA 1Z7PA 2H0IA 5IQYA 5LNKe 5D73A 3RHCA 4TKYA 4TXOA 1TKDB 2NTOA 5B7CA 5JWQB 4NV5A 5G1KA 1TK0B 5AISA 2DIZA 3UVTA 2CZ3A 4KDXA 2PPTA 2WJUA 1USBA 3PGTA 3HDCA 4NHZA 5GZZB 3GH9A 3GFKA 1M3IA 2H1DA 2IFQB 1K3LA 2PN8A 4DEJA 1GTAA 3HVNA 2XHFA 5AN1A 2WDUA 3EWLA 3TKSA 1TK5B 3GH6A 4EDYA 2H0GA 1TRSA 3L4NA 1KNGA 2FWHA 2MMNA 2C1YA 2X8GA 3F0IA 1GSUA 4DSSB 4TR4A 5G30A 1ZL9A 1NHYA 4BVYA 1A23A 4AJ8A 1W89A 2VCXA 1ZGNA 2VM1A 2CAQA
chains in the Genus database with same CATH topology
3IV4A 2VCVA 2IPAA 5J3RA 2DJKA 1QXHA 2CAIA 4K8MA 4LLRA 1U88A 1X9MB 1XWCA 3KH7A 1TTZA 3D4TA 5C04A 4O5UA 2WRTA 3HZ8A 1OKDA 4G19A 2H1BA 4I5QA 2B5EA 3HA9A 2DBCA 4YAPA 4Z2TA 4OO4A 3APSA 3E3EA 2VO4A 4KGIA 4FYCA 3I69A 3C1RA 3VK9A 1B4PA 2OADA 3HCZA 4JZQA 4GTUA 3UIWA 3CSJA 5AIVA 3ZVJD 4K6XA 1ACVA 2RIIA 2KP1A 1CQHA 1M99A 4QQ7A 4RI7A 4MF5A 4Q5RA 2A2RA 2B7JA 4DSRA 4BL7A 3U6VA 3TOTA 2WCIA 1V57A 3KGKA 3C8EA 2AUVA 4KX4A 2HRNA 3QMXA 6GSWA 2CVKA 3A2XA 4KNDA 1XOAA 3FYGA 4I2UA 4POKA 4EC0A 4XS6A 4NWYA 4AJ7A 5CAXA 2QSIA 3KXOA 2YNXA 4OD7A 5G5EA 4MDCA 2H75A 3L9SA 4I97A 3CRTA 2C0GA 2M80A 2EC4A 1VF4A 4YKFA 3M1GA 2LJAA 3JCML 1K0BA 5D93A 4JU5A 3O3TA 3PPUA 4NPBA 5IMCA 1RW1A 3F63A 1R5PA 3IHQA 1SK0A 4KE3A 1ZYPA 1B9XC 3MYDA 4K7IA 2L57A 3TB2A 1O6JA 3KJYA 5H5RA 1M2DA 1GSQA 2K8VA 1A2JA 1CQGA 3G9BA 1TU7A 14GSA 3LEFA 5DBQA 5F05A 2L59A 1ABAA 5GSTA 4YQVA 3QAWA 4NXIA 4FQUA 4ECIA 3TUEA 4BVXB 2L4QA 1EOHA 3TKSC 1XOBA 2YANA 1ERWA 2E7PA 4WR5A 2O7KA 3WGXA 1O8WA 1QMVA 4K9ZA 2F3MA 1Z3EA 1ZYQB 2B6MA 3TRXA 5GSSA 1XBSA 5ELAA 3Q6OA 4OFMA 4F2IA 2P5RA 3L9VA 1ILOA 3EU4A 4GWRA 5EL8A 3APOA 2H74A 2R3XA 1EEMA 3FZAA 3UMAA 4OCFA 1ZZYA 3ZMKA 3ZIJA 4POMA 3F3QA 1R7HA 5ECRB 1ZOFA 1NHOA 1W4VA 5KN2A 3HY2A 4QL9A 4GSNA 1VF2A 2HLSA 2YJHA 4I8BA 3G7JA 1HYUA 5IOWA 4J57E 1XWGA 1HQOA 2C3NA 3IK9A 1FG4A 5ECKB 3MAKA 3IRAA 2FLSA 2PVQA 3IDVA 1SKWB 3J7Yb 3LYPA 1SKRB 4JEDA 2F8AA 4LL1B 4ZL9A 3A5WA 1A0FA 1XVQA 5ID2A 3E9JB 4MLYA 5B8AA 4BVYB 2IL3A 1FVKA 2YZHA 4P3YB 4L5LA 1K0OA 4K2DA 5ELGA 3D5JA 2LRNA 1Y25A 3H1NA 5B8BA 2JSZA 1M9AA 3ISOA 2DJ0A 3F4TA 1ZCPA 4FH8A 3PINA 5J41A 2L4CA 1HNAA 1TXXA 3C71A 4MZBA 3Q18A 3FW2A 3CRUA 1A8LA 1TRUA 4IBPA 4L0UA 1PL1A 5CRGA 2F9SA 3TKRA 5G31A 2PMTA 3FRCA 1KEBA 3BBYA 2PERA 1X9SB 3DMLA 4G9HA 5FHIA 1RK4A 2DJ2A 2AHEA 5A4VA 2GT5A 4JE1A 1EGOA 3ZL5A 1SJIA 1MTCA 4K7NA 1PD21 1GLPA 2VD1A 3A2WA 4PGTA 6GSVA 2PGTA 2K6VA 2M46A 2IJYA 5IIZA 5D9TA 3DVWA 2E2GA 1WWJA 1EV4A 2CX4A 3WGDA 3EMPA 3R3EA 1YKAA 4CY8A 2QA2A 1DE2A 3GKNA 3FR6A 5A4WA 1A8YA 2X4AA 4ZBAA 1JZRA 4PQ1A 4X1UA 4F03A 4MPFA 2IN3A 5KOWA 1YF1A 2KHPA 3TJBA 1UVZA 3GUSA 5J9CA 1GSFA 12GSA 4MZWA 2CZ2A 3F4SA 4FYBA 4EO3A 2HXKA 4K2XA 3QAGA 1E6BA 2A4VA 5BRTA 2VM2A 1N2AA 1EZKA 1UN2A 5HR1A 3RAZA 4EUYA 2V32A 3GX0A 3VWWA 2N5AA 1PRXA 1GUMA 1GP1A 2H8LA 4MA9A 2B7KA 3VWUA 5A4UA 2ES7A 2FNOA 3TRQA 4ECBA 4OFTA 2VL9A 1M9BA 2YV9A 1FOHA 2F51A 4V2NA 1F6MC 6GSUA 3LYKA 3ERGA 2OA7A 1K0AA 3EURA 1O73A 4HJMA 2ZUPA 4BPYA 1O7UA 5A5KA 2OJLA 4JR6A 4N0VA 3HJOA 2IIYA 1AC1A 4O7HA 3H4KA 22GSA 3ME7A 2FWFA 4HUAA 1GTUA 1TK8B 2QC7A 1S3AA 2LEGA 3ZFBA 2DMMA 3G7YA 1UA5A 4MH3A 1R26A 2YP6A 3DWVA 6GSYA 3I9V2 3DKSA 4TVEA 2MBSA 4IN0A 1MD3A 5CNWA 2JZSA 3FZ5A 4EF0A 3GTUA 5ECQB 2QA1A 1WIKA 2OBKA 1M0UA 2HT9A 1BX9A 4XS4A 5D9VA 4K7OA 3E0UA 4E8HA 5HR3A 4NV2A 2L6CA 2JZRA 4ML1A 3CMIA 2VLVA 4JBBA 3LWAA 5D8IA 4AJ6A 4HZ2A 2I9HA 2AJQB 4V1Ap 4D73A 1TW9A 4MCUA 3VI7A 2DMLA 4MJBA 4OCEA 1C72A 2L6DA 3QOUA 1U3AA 3LXZA 2GSRA 5BMUA 3FR9A 4PNFA 2GGTA 5DQYA 1SL1B 4RQRA 3TKSE 3AY8A 1PL2A 3C7MA 4XTSA 5F07A 3M8NA 5C00A 4X43A 4GXZA 3FZ4A 2UZ8A 3HHVA 2MMAA 3F3RA 3EMXA 1SL0B 2FWGA 2R4VA 3DD3A 1FVJA 2I3YA 2VL3A 2HRAA 1Z9HA 1QQ2A 2HRKA 4NMUA 1WOUA 5KN0A 3ED3A 3CSIA 1U3IA 3SBCA 1Z7RA 1RQMA 2XBIA 4G0IA 5KOXA 2FD3A 5ID2B 2JL4A 2IMDA 2MYGA 2H19A 1BG5A 1MDIA 5D96A 4J56E 4PQHA 2JADA 1QK8A 1IYHA 1EP7A 3LXTA 2VCTA 3HXSA 19GSA 3W8SA 2GQKA 4JRRA 1YF0A 2WGRA 9GSSA 1WMJA 2H01A 4KB3A 2YN1A 2P5QA 1GLQA 4K5RA 1VGLA 4E8EA 6GSXA 3R2QA 2NBSA 3RDWA 2WULA 1DBYA 3GURA 4OO5A 4MF6A 1XIYA 16GSA 2RM6A 1T4YA 2WB9A 1PN0A 3CYNA 2R2JA 3EVIA 1TRWA 1URMA 2OE0A 1BJXA 1OC9B 2C3TA 1T1VA 1A2MA 1YJ6A 4PURA 3LW9A 5IMAA 3DGQA 2R6KA 2FY6A 3VI5A 2FUG2 1PMTA 5ABRA 2LRCA 4WF4A 1AUCA 4GLTA 1JFUA 4MF7A 5KEJA 3GN3A 1X9WB 5DVBA 4PQIA 2AAWA 1MEKA 1KTEA 2OE3A 1SJ6A 4KAEA 4WR4A 1XZOA 2GZPA 2R0GA 1YEPA 2RUEA 4AGSA 1OAZA 3FHKA 1GUHA 1A2LA 4POLA 2R5GA 4ECCA 1TI3A 1WRYA 2PWJA 5DAKB 2LNTA 1QGVA 3TOUA 3DVXA 1F9MA 2YPMA 3MDKA 1ZYEA 1WE0A 4CDOA 4N0ZA 4HI7A 1AQVA 8GSSA 4WETA 3IOSA 1EGRA 1XWBA 2FCHA 4PUFC 1G7EA 3H79A 4TOPA 4G0KA 1VRSD 1PX6A 4IW9A 1WJKA 4K5SA 5DJLA 1ERVA 3QD9A 3TJGA 4YQMA 1DE1A 5IOXA 3UL3A 2V1MA 3FK8A 4IS0A 4V1Ag 3Q74A 4HQZA 2REMA 5L71A 1GH2A 2MZCA 5E4WA 2IWTA 1KBNA 1X5EA 1AIUA 4TRXA 2QGVA 2WFCA 1PA3A 13GSA 2E0QA 3U5RE 4OMVA 3ZITA 1THOA 1SYRA 2ZNMA 4EDZA 2K8SA 4TR1A 5AGYA 1AQXA 2K18A 2YCDA 5ECOB 2TRCP 3EINA 1OC3A 2HRFA 2VIMA 4TXOB 4XS4B 2PBJA 5IO2A 2CX3A 4ZL8A 2CT6A 4WBJA 4ILFA 5KN1A 3GL3A 2DC5A 3M3MA 2JZTA 4RI6A 4IGJA 2R37A 3HVSA 2GQLA 2XBQA 4F9ZA 2H6YA 3KP8A 5IMDA 2V2GA 2VLUA 3ZYWA 5AIXA 1H75A 5E59A 1FO5A 2LTKA 4HU7A 2GVPA 3PH9A 5GAND 1SK2A 1Y6EA 4F0BA 2WZ9A 1GNEA 1DUGA 4MABA 1TOFA 1EWXA 1OYJA 2LQOA 3V1WA 1MD4A 1F3AA 3ZVJA 3DYRA 1M2AA 1A24A 2RLIA 5IMZA 1SU9A 4K1FA 1SENA 2I4AA 1T00A 3ME8A 4CHSA 4LA1A 4LMVA 2E2MA 3HZ4A 3GKKA 3UJ1A 1PN9A 1T3BA 3PR8A 3I43A 2D2ZA 4DSSA 2LJRA 1XWAA 4ZB6A 4O5RA 3LGCA 5ECLB 2I1UA 3BD2A 2O87A 1AAZA 2ALBA 4NHWA 2P0GA 4EIQA 3IXRA 2VOCA 2KOKA 3M9JA 5H5QA 4FO5A 2LRTA 3EPTA 3FZ9A 3ZIVA 2H70A 2TRXA 2C3QA 4MNNA 4KF9A 5CYYA 4AF2A 3WYWA 2AYTA 2GS3A 2J23A 2LUSA 1SD9A 4LMWA 4MJCA 2K9FA 1XFLA 1FOVA 4TR3A 1ZYNA 3CBUA 2A4HA 2H6ZA 4O32A 2N5BA 3N9JA 2O85A 3KP9A 3CTGA 1F3BA 2CVDA 1FB6A 2IMEA 1SYXA 4PNGA 4BL7B 2DJ3A 3UBKA 2BTOT 2KP2A 2HI7A 1H4OA 1OC8A 3APQA 3P2AA 5G5FA 5DJMA 2H76A 3GX8A 4Q5FA 2V6OA 4TR0A 3DIEA 3P7XA 5CO3A 4GQCA 5JCGA 1PX7A 4MMMA 1VF1A 4NAXA 4HZ4A 1K3OA 4QL7A 1R4WA 3GHAA 4IHUA 3IAM2 4V2MA 4KW6A 2BJXA 4WF5A 3KTLA 2PVOC 1M7TA 3F6FA 3VPTA 1MDJA 5ECSA 1Z6NA 3WT2A 2GTUA 4ZBDA 4KA0A 3DEXA 1PQNA 3HJMA 4IP1A 2NVLA 2YZUA 3FMWA 5DALA 3C1SA 1PSQA 1X5DA 5DDLA 1GULA 5KN3A 3H8QA 1O81A 3BCIA 2H1AA 2DJJA 1UC7A 2DIYA 1T4ZA 2PUKC 2JSYA 3GKMA 1K0CA 2GSQA 1YZXA 3IC8A 3TCOA 2PU9C 3HD5A 2EIOA 4WEYA 4EE0A 1FB0A 2IMFA 5DCHA 2HFDA 5G2ZA 3O76A 2L5OA 3Q19A 2C8UA 4EL1A 3K8NA 2C0EA 1U6TA 2MMZA 2HYXA 4L5OA 4V2LA 1YEXA 1Q98A 1DSBA 1BEDA 1LBKA 5HR0A 1IYIA 4N11A 3HYPA 1K0NA 4FIWA 2HZEA 3ZMLA 4USSA 4GF0A 3NIVA 2H6XA 5DQSA 3KTBA 1K0DA 3IC4A 2R0PA 5ECMB 3IHGA 4LL4B 4BWSA 4PX1A 3KMOA 2GSTA 2B1LA 2ON7A 2V41A 1XPVA 2B5YA 3QR6A 4POBA 2YJ7A 2ZCTA 1SJZA 3EC3A 4H86A 5INYA 1FW1A 2I81A 4YAVA 1ZMAA 1OVNA 4IQ1A 4ZB8A 2JACA 3IPZA 4TN8A 2GZYA 3RPPA 2HZFA 1BQ7A 11GSA 3LORA 4KUNA 3US3A 2Z9SA 5ENUA 4O5QA 5CRHA 3FEUA 3P90A 4IVFA 2VL2A 3EYTA 2XC2A 5JWRB 4ACSA 3IBHA 1GTBA 1XW9A 1N8JA 1WP0A 5JWOB 4PXOA 5B6NA 3WT1A 2LNSA 2VLTA 3TKQA 2ON5A 4IKHA 2F8FA 5EPFA 3IA1A 3KIJA 3A2VA 3UAPA 4CW9A 5HR2A 2FWEA 1EP8A 4HEA2 1GWCA 1I9DA 2H1GA 4MZCA 4KDUA 1ML6A 1GTIA 3QPMA 1TRVA 2TIRA 1J9BA 4GSSA 1OKTA 3FR3A 3KCMA 5F0GA 4Z7XA 4J2FA 1AXDA 3KD0A 3LFLA 1WPIA 1EEJA 2O89A 1B48A 3SWLA 4EXJA 2C0DA 3QFAC 2GZZA 1ERTA 2FA4A 6GSTA 3P8WA 2X8HA 2RM5A 1GSDA 4MPGA 1TDIA 2B5XA 3UBLA 3FKFA 3TJJA 4KSOA 5HFIA 4MK3A 3RHBA 4YKGA 3GV1A 2GQMA 1T7PB 4MH2A 4ZBBA 5HQPA 3A5IA 2HNLA 3KM6A 2NDOA 3ZREA 1V58A 4TXVA 1O8XA 2EIRA 2CV4A 1G6WA 4GSTA 1TI1A 2YWIA 1O85A 2CVBA 4RUVA 1SKSB 4X0XA 4ML6A 3VPQA 1XW5A 2A2SA 3CTFA 3S9FA 4Q5QA 3F9UA 3LG6A 2FHEA 3FY7A 5IMFA 5CRDA 3D22A 2YOIA 2V6KA 2DKHA 3A3TA 2KUCA 2H30A 3QFBC 2B1KA 2HSHA 5IMVA 1Q4JA 4HDEA 2H72A 5J9BA 4EIPA 1XXUA 5EY6A 2FGXA 2GSSA 3G7IA 4EKZA 2O8VB 5CP1A 4XRAA 1B4QA 4HS1A 4FYUA 3TRPA 3M0FA 2R0CA 3GYKA 3F6DA 2EIQA 4XIHA 4ID0A 4KH7A 1G0TA 5CREA 4ZXGA 3GSSA 1TU8A 1QFNA 3QAVA 1GNWA 3BOAA 4L0WA 2FA8A 3BCKA 1HD2A 2X8CA 1V2AA 5DALB 1G7OA 4XS1A 1OE8A 5ECIB 5G1LA 1EV9A 4ZB9A 1BAYA 3UVHA 3D21A 2HSYA 2H66A 6GSSA 3WGEA 4MJAA 1FHEA 3C73A 4F82A 1XW6A 3TJKA 1AQWA 3VFIA 3ERFA 3WD6A 3IE3A 1X5CA 4GRFA 5ECPB 3D0ZA 4ULXA 1A0RP 2N5FA 2WS2A 4BA7A 5FWGA 3GSTA 1BYEA 2VL2C 4HJ2A 2JU5A 1ERUA 1GUKA 2OE1A 3TGZA 2IMKA 3KH9A 3UEMA 4KSMA 1SK1A 3KMNA 1NW2A 4DSQA 3GTUB 4L8EA 3O6TA 1LU4A 4O92A 3NZNA 2P31A 4G0LA 1OE7A 1TJDA 4EVMA 1B8XA 10GSA 4MJEA 2AV4A 2HZEB 4ICYA 5EVOA 1GL8A 4XCSA 1J08A 2OACA 5GAPD 2LJKA 4MP4A 3LSZA 4F0CA 1SL2B 1XWKA 3TKPA 5J5NA 1U87A 2VCZA 4N10A 3EE2A 1NM3A 2AB6A 4D73B 2CQ9A 3MIXA 2VD0A 5ECHB 3F8UA 1ST9A 1GSEA 1JLVA 4HQSA 4OWYA 3VURA 2BMXA 2XPEA 2KLXA 1ON4A 4GQFA 2LKUA 5DCGA 3D6IA 4TW5A 4PUAA 1R5AA 3GRXA 1F2EA 3J7Yk 1JHBA 1THXA 4PTSA 3DXBA 4WBRD 3L0HA 3RBTA 2IFQA 1Z6MA 1GSSA 1MDKA 3MNGA 3GA4A 4YQUA 1M2BA 1PGTA 4HU9A 2DLXA 3KEBA 3M9KA 2B3SA 2LSTA 5IO0A 1S3CA 4GCIA 4A5PA 2VAFA 4XRDA 3VWXA 1HNCA 3GIXA 5ECNB 5HFGA 3HKRA 2VCWA 1V98A 2J9HA 3TJFA 4IP6A 4XHMA 3ZZXA 3VLNA 1V9WA 1GRXA 1XCCA 5D9XA 1JLWA 2LV3A 2MBTA 2MMOA 1PKWA 4OFNA 3EU3A 2DJ1A 3MSZA 1EOGA 5CRWA 1V40A 4ZL7A 3ERWA 1J0FA 4KCAA 5COHA 3D4MA 1XVWA 1I5GA 5JCWA 3BJ5A 5D9WA 1HNBA 1TP9A 17GSA 2M72A 1JZOA 4ECJA 2CA8A 5JCUA 3I6AA 4N30A 2NPBA 1K0MA 4X4JA 2YWMA 2C0FA 3NOFA 2X49A 1SD8A 3VWVA 1PKZA 4Q5NA 5FT3A 1Z5YE 1X0RA 2HE3A 3KZQA 2DSAA 5IPGA 2IMIA 5IPHA 4WKWA 3HVVA 5H5SA 2H71A 4IQAA 5F8BA 2X64A 4IELA 1G6YA 5LD0A 2HSMA 1OC9A 2LQQA 1GSYA 4G10A 3IK7A 3UARA 1YKCA 4KDYA 3N5OA 3QCPA 3UOMA 2GDRA 4K0GA 1QUWA 2QKEA 4I2TA 5HFKA 1JZWA 1F37A 2YWOA 3GNJA 2C4JA 4Z2UA 2H0HA 3IR4A 3ZFLA 2VUPA 3L9UA 3CSHA 3ZRDA 4CY6A 3CXGA 2G2QA 2OBIA 2YV7A 1YY7A 2C80A 1YQ1A 2LS5A 3DRNA 3GL5A 4IJ3A 3W8JA 3LQ7A 4G2EA 4Z2RA 5J4UA 1S3DA 4ISDA 4IJIA 3W6GA 2GT6A 7GSSA 1YDKA 4ZIJA 4K0NA 3GKXA 5DAKA 5F06A 1E2YA 1LJRA 4JR4A 3IAS2 3QDNA 2XPDA 3GMFA 1K3YA 2DKIA 4I6XA 3L78A 1T8EB 5LCZA 3RPNA 1AW9A 2VCQA 3HVXA 1VF3A 4RQXA 3HJPA 1FAAA 18GSA 2A2PA 5IM9A 2GLRA 2X99A 4BWQA 3ZTLA 3H93A 3LJRA 4BVXA 2G0FA 20GSA 4KCEA 4DVCA 3TDGA 4TR1B 3F4RA 2YWNA 1NSWA 1B9YC 4ZILA 3OR5A 2RUFA 4WXTA 4HOJA 2H73A 5B6MA 4YH2A 3MWHA 1JZDA 2L5LA 3ZLPA 2OKAA 1Z7PA 2H0IA 5IQYA 5LNKe 5D73A 3RHCA 4TKYA 4TXOA 1TKDB 2NTOA 5B7CA 5JWQB 4NV5A 5G1KA 1TK0B 5AISA 2DIZA 3UVTA 2CZ3A 4KDXA 2PPTA 2WJUA 1USBA 3PGTA 3HDCA 4NHZA 5GZZB 3GH9A 3GFKA 2H1DA 2IFQB 1K3LA 2PN8A 4DEJA 1GTAA 2XHFA 5AN1A 2WDUA 3EWLA 3TKSA 1TK5B 3GH6A 4EDYA 2H0GA 1TRSA 3L4NA 1KNGA 2FWHA 2MMNA 2C1YA 2X8GA 3F0IA 1GSUA 4DSSB 4TR4A 5G30A 1ZL9A 1NHYA 4BVYA 1A23A 4AJ8A 1W89A 2VCXA 1ZGNA 2VM1A 2CAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IV4 A;  2VCV A;  2IPA A;  5J3R A;  2DJK A;  1QXH A;  2CAI A;  4K8M A;  4LLR A;  1U88 A;  1X9M B;  1XWC A;  3KH7 A;  1TTZ A;  3D4T A;  5C04 A;  2WRT A;  3HZ8 A;  1OKD A;  4G19 A;  2H1B A;  4I5Q A;  2B5E A;  3HA9 A;  2DBC A;  4YAP A;  4OO4 A;  3APS A;  3E3E A;  2VO4 A;  4KGI A;  4FYC A;  3I69 A;  3C1R A;  3VK9 A;  1B4P A;  2OAD A;  3HCZ A;  4JZQ A;  4GTU A;  3UIW A;  3CSJ A;  5AIV A;  3ZVJ D;  4K6X A;  1ACV A;  2RII A;  2KP1 A;  1CQH A;  1M99 A;  4QQ7 A;  4RI7 A;  4MF5 A;  4Q5R A;  2A2R A;  2B7J A;  4DSR A;  4BL7 A;  3U6V A;  3TOT A;  2WCI A;  1V57 A;  3KGK A;  3C8E A;  2AUV A;  4KX4 A;  2HRN A;  3QMX A;  6GSW A;  2CVK A;  3A2X A;  4KND A;  1XOA A;  3FYG A;  4I2U A;  4POK A;  4EC0 A;  4XS6 A;  4NWY A;  4AJ7 A;  5CAX A;  2QSI A;  3KXO A;  2YNX A;  4OD7 A;  5G5E A;  4MDC A;  2H75 A;  3L9S A;  4I97 A;  3CRT A;  2C0G A;  2M80 A;  2EC4 A;  1VF4 A;  3M1G A;  2LJA A;  3JCM L;  1K0B A;  5D93 A;  4JU5 A;  3O3T A;  4NPB A;  5IMC A;  1RW1 A;  3F63 A;  1R5P A;  3IHQ A;  1SK0 A;  4KE3 A;  1B9X C;  4K7I A;  2L57 A;  3TB2 A;  1O6J A;  3KJY A;  5H5R A;  1M2D A;  1GSQ A;  2K8V A;  1A2J A;  1CQG A;  3G9B A;  1TU7 A;  14GS A;  3LEF A;  5DBQ A;  5F05 A;  2L59 A;  1ABA A;  5GST A;  4YQV A;  3QAW A;  4NXI A;  4ECI A;  3TUE A;  2L4Q A;  1EOH A;  3TKS C;  1XOB A;  2YAN A;  1ERW A;  2E7P A;  4WR5 A;  2O7K A;  3WGX A;  1O8W A;  1QMV A;  4K9Z A;  2F3M A;  1Z3E A;  1ZYQ B;  2B6M A;  3TRX A;  5GSS A;  1XBS A;  5ELA A;  3Q6O A;  4OFM A;  4F2I A;  2P5R A;  3L9V A;  1ILO A;  3EU4 A;  4GWR A;  5EL8 A;  3APO A;  2H74 A;  2R3X A;  1EEM A;  3FZA A;  3UMA A;  4OCF A;  1ZZY A;  3ZMK A;  3ZIJ A;  4POM A;  3F3Q A;  1R7H A;  5ECR B;  1ZOF A;  1NHO A;  1W4V A;  5KN2 A;  3HY2 A;  4QL9 A;  4GSN A;  1VF2 A;  2HLS A;  2YJH A;  4I8B A;  3G7J A;  1HYU A;  5IOW A;  4J57 E;  1XWG A;  1HQO A;  2C3N A;  3IK9 A;  1FG4 A;  5ECK B;  3MAK A;  3IRA A;  2FLS A;  2PVQ A;  3IDV A;  1SKW B;  3J7Y b;  3LYP A;  1SKR B;  4JED A;  2F8A A;  4LL1 B;  4ZL9 A;  3A5W A;  1A0F A;  1XVQ A;  5ID2 A;  3E9J B;  4MLY A;  5B8A A;  2IL3 A;  1FVK A;  2YZH A;  4P3Y B;  4L5L A;  1K0O A;  4K2D A;  5ELG A;  3D5J A;  2LRN A;  1Y25 A;  3H1N A;  5B8B A;  2JSZ A;  1M9A A;  3ISO A;  2DJ0 A;  3F4T A;  1ZCP A;  4FH8 A;  3PIN A;  5J41 A;  2L4C A;  1HNA A;  1TXX A;  3C71 A;  4MZB A;  3Q18 A;  3FW2 A;  3CRU A;  1A8L A;  1TRU A;  4IBP A;  4L0U A;  1PL1 A;  5CRG A;  2F9S A;  3TKR A;  5G31 A;  2PMT A;  3FRC A;  1KEB A;  3BBY A;  2PER A;  1X9S B;  3DML A;  4G9H A;  5FHI A;  1RK4 A;  2DJ2 A;  2AHE A;  5A4V A;  2GT5 A;  4JE1 A;  1EGO A;  3ZL5 A;  1SJI A;  1MTC A;  4K7N A;  1PD2 1;  1GLP A;  2VD1 A;  3A2W A;  4PGT A;  6GSV A;  2PGT A;  2K6V A;  2M46 A;  2IJY A;  5IIZ A;  5D9T A;  3DVW A;  2E2G A;  1WWJ A;  1EV4 A;  2CX4 A;  3WGD A;  3EMP A;  1YKA A;  1DE2 A;  3GKN A;  3FR6 A;  5A4W A;  1A8Y A;  4ZBA A;  1JZR A;  4PQ1 A;  4X1U A;  4F03 A;  4MPF A;  2IN3 A;  1YF1 A;  2KHP A;  3TJB A;  1UVZ A;  3GUS A;  5J9C A;  1GSF A;  12GS A;  4MZW A;  2CZ2 A;  3F4S A;  4FYB A;  4EO3 A;  2HXK A;  3QAG A;  1E6B A;  2A4V A;  2VM2 A;  1N2A A;  1EZK A;  1UN2 A;  5HR1 A;  3RAZ A;  4EUY A;  2V32 A;  3GX0 A;  3VWW A;  2N5A A;  1PRX A;  1GUM A;  1GP1 A;  2H8L A;  4MA9 A;  2B7K A;  3VWU A;  5A4U A;  2ES7 A;  2FNO A;  3TRQ A;  4ECB A;  4OFT A;  2VL9 A;  1M9B A;  2YV9 A;  2F51 A;  4V2N A;  1F6M C;  6GSU A;  3LYK A;  3ERG A;  2OA7 A;  1K0A A;  3EUR A;  1O73 A;  4HJM A;  2ZUP A;  4BPY A;  1O7U A;  5A5K A;  2OJL A;  4JR6 A;  4N0V A;  3HJO A;  2IIY A;  1AC1 A;  4O7H A;  3H4K A;  22GS A;  3ME7 A;  2FWF A;  4HUA A;  1GTU A;  1TK8 B;  2QC7 A;  1S3A A;  2LEG A;  3ZFB A;  2DMM A;  3G7Y A;  1UA5 A;  4MH3 A;  1R26 A;  2YP6 A;  3DWV A;  6GSY A;  3I9V 2;  3DKS A;  4TVE A;  2MBS A;  4IN0 A;  1MD3 A;  5CNW A;  2JZS A;  3FZ5 A;  4EF0 A;  3GTU A;  5ECQ B;  1WIK A;  2OBK A;  1M0U A;  2HT9 A;  1BX9 A;  4XS4 A;  5D9V A;  4K7O A;  3E0U A;  4E8H A;  5HR3 A;  4NV2 A;  2L6C A;  2JZR A;  4ML1 A;  3CMI A;  2VLV A;  4JBB A;  3LWA A;  5D8I A;  4AJ6 A;  4HZ2 A;  2I9H A;  2AJQ B;  4V1A p;  4D73 A;  1TW9 A;  4MCU A;  3VI7 A;  2DML A;  4MJB A;  4OCE A;  1C72 A;  2L6D A;  3QOU A;  1U3A A;  3LXZ A;  2GSR A;  3FR9 A;  4PNF A;  2GGT A;  5DQY A;  1SL1 B;  4RQR A;  3TKS E;  3AY8 A;  1PL2 A;  3C7M A;  4XTS A;  5F07 A;  3M8N A;  5C00 A;  4X43 A;  4GXZ A;  3FZ4 A;  3HHV A;  2MMA A;  3F3R A;  3EMX A;  1SL0 B;  2FWG A;  2R4V A;  3DD3 A;  1FVJ A;  2I3Y A;  2VL3 A;  1Z9H A;  1QQ2 A;  4NMU A;  1WOU A;  5KN0 A;  3ED3 A;  3CSI A;  1U3I A;  3SBC A;  1Z7R A;  1RQM A;  2XBI A;  2FD3 A;  5ID2 B;  2JL4 A;  2IMD A;  2MYG A;  2H19 A;  1BG5 A;  1MDI A;  5D96 A;  4J56 E;  4PQH A;  2JAD A;  1QK8 A;  1IYH A;  1EP7 A;  3LXT A;  2VCT A;  3HXS A;  19GS A;  3W8S A;  2GQK A;  4JRR A;  1YF0 A;  2WGR A;  9GSS A;  1WMJ A;  2H01 A;  4KB3 A;  2YN1 A;  2P5Q A;  1GLQ A;  1VGL A;  4E8E A;  6GSX A;  3R2Q A;  2NBS A;  3RDW A;  2WUL A;  1DBY A;  3GUR A;  4OO5 A;  4MF6 A;  1XIY A;  16GS A;  2RM6 A;  1T4Y A;  2WB9 A;  3CYN A;  2R2J A;  3EVI A;  1TRW A;  1URM A;  2OE0 A;  1BJX A;  1OC9 B;  2C3T A;  1T1V A;  1A2M A;  1YJ6 A;  4PUR A;  5IMA A;  3DGQ A;  2R6K A;  2FY6 A;  3VI5 A;  2FUG 2;  1PMT A;  5ABR A;  2LRC A;  4WF4 A;  1AUC A;  4GLT A;  1JFU A;  4MF7 A;  5KEJ A;  3GN3 A;  1X9W B;  5DVB A;  4PQI A;  2AAW A;  1MEK A;  1KTE A;  2OE3 A;  1SJ6 A;  4KAE A;  4WR4 A;  1XZO A;  2GZP A;  1YEP A;  2RUE A;  4AGS A;  1OAZ A;  3FHK A;  1GUH A;  1A2L A;  4POL A;  2R5G A;  4ECC A;  1TI3 A;  1WRY A;  2PWJ A;  5DAK B;  2LNT A;  1QGV A;  3TOU A;  3DVX A;  1F9M A;  2YPM A;  3MDK A;  1ZYE A;  1WE0 A;  4CDO A;  4N0Z A;  4HI7 A;  1AQV A;  8GSS A;  4WET A;  3IOS A;  1EGR A;  1XWB A;  2FCH A;  4PUF C;  1G7E A;  3H79 A;  4TOP A;  1VRS D;  1PX6 A;  4IW9 A;  1WJK A;  5DJL A;  1ERV A;  3QD9 A;  3TJG A;  4YQM A;  1DE1 A;  5IOX A;  3UL3 A;  2V1M A;  3FK8 A;  4IS0 A;  4V1A g;  3Q74 A;  4HQZ A;  2REM A;  5L71 A;  1GH2 A;  2MZC A;  5E4W A;  2IWT A;  1KBN A;  1X5E A;  1AIU A;  4TRX A;  2QGV A;  2WFC A;  1PA3 A;  13GS A;  2E0Q A;  3U5R E;  4OMV A;  3ZIT A;  1THO A;  1SYR A;  2ZNM A;  4EDZ A;  2K8S A;  4TR1 A;  5AGY A;  1AQX A;  2K18 A;  2YCD A;  5ECO B;  2TRC P;  3EIN A;  1OC3 A;  2HRF A;  2VIM A;  4TXO B;  4XS4 B;  2PBJ A;  5IO2 A;  2CX3 A;  4ZL8 A;  2CT6 A;  4WBJ A;  4ILF A;  5KN1 A;  3GL3 A;  2DC5 A;  3M3M A;  2JZT A;  4RI6 A;  4IGJ A;  2R37 A;  3HVS A;  2GQL A;  2XBQ A;  4F9Z A;  2H6Y A;  3KP8 A;  5IMD A;  2V2G A;  2VLU A;  3ZYW A;  5AIX A;  1H75 A;  5E59 A;  1FO5 A;  2LTK A;  4HU7 A;  2GVP A;  3PH9 A;  5GAN D;  1SK2 A;  1Y6E A;  4F0B A;  2WZ9 A;  1GNE A;  1DUG A;  4MAB A;  1TOF A;  1EWX A;  1OYJ A;  2LQO A;  3V1W A;  1MD4 A;  1F3A A;  3ZVJ A;  3DYR A;  1M2A A;  1A24 A;  2RLI A;  5IMZ A;  1SU9 A;  4K1F A;  1SEN A;  2I4A A;  1T00 A;  3ME8 A;  4CHS A;  4LA1 A;  4LMV A;  2E2M A;  3HZ4 A;  3GKK A;  3UJ1 A;  1PN9 A;  1T3B A;  3PR8 A;  3I43 A;  2D2Z A;  4DSS A;  2LJR A;  1XWA A;  4ZB6 A;  4O5R A;  3LGC A;  5ECL B;  2I1U A;  3BD2 A;  2O87 A;  1AAZ A;  2ALB A;  4NHW A;  2P0G A;  3IXR A;  2VOC A;  2KOK A;  3M9J A;  5H5Q A;  4FO5 A;  2LRT A;  3FZ9 A;  3ZIV A;  2H70 A;  2TRX A;  2C3Q A;  5CYY A;  4AF2 A;  3WYW A;  2AYT A;  2GS3 A;  2J23 A;  2LUS A;  1SD9 A;  4LMW A;  4MJC A;  2K9F A;  1XFL A;  1FOV A;  4TR3 A;  3CBU A;  2H6Z A;  4O32 A;  2N5B A;  3N9J A;  2O85 A;  3KP9 A;  3CTG A;  1F3B A;  2CVD A;  1FB6 A;  2IME A;  1SYX A;  4PNG A;  2DJ3 A;  3UBK A;  2BTO T;  2KP2 A;  2HI7 A;  1H4O A;  1OC8 A;  3APQ A;  3P2A A;  5G5F A;  5DJM A;  2H76 A;  3GX8 A;  4Q5F A;  2V6O A;  4TR0 A;  3DIE A;  3P7X A;  5CO3 A;  4GQC A;  5JCG A;  1PX7 A;  4MMM A;  1VF1 A;  4NAX A;  4HZ4 A;  1K3O A;  4QL7 A;  1R4W A;  3GHA A;  4IHU A;  3IAM 2;  4V2M A;  4KW6 A;  2BJX A;  4WF5 A;  3KTL A;  2PVO C;  1M7T A;  3F6F A;  3VPT A;  1MDJ A;  5ECS A;  1Z6N A;  3WT2 A;  2GTU A;  4ZBD A;  4KA0 A;  3DEX A;  1PQN A;  3HJM A;  4IP1 A;  2NVL A;  2YZU A;  5DAL A;  3C1S A;  1PSQ A;  1X5D A;  5DDL A;  1GUL A;  5KN3 A;  3H8Q A;  1O81 A;  3BCI A;  2H1A A;  2DJJ A;  1UC7 A;  2DIY A;  1T4Z A;  2PUK C;  2JSY A;  3GKM A;  1K0C A;  2GSQ A;  1YZX A;  3TCO A;  2PU9 C;  3HD5 A;  2EIO A;  4WEY A;  4EE0 A;  1FB0 A;  2IMF A;  5DCH A;  2HFD A;  5G2Z A;  3O76 A;  2L5O A;  3Q19 A;  2C8U A;  4EL1 A;  3K8N A;  2C0E A;  1U6T A;  2MMZ A;  2HYX A;  4L5O A;  4V2L A;  1YEX A;  1Q98 A;  1DSB A;  1BED A;  1LBK A;  5HR0 A;  1IYI A;  4N11 A;  3HYP A;  1K0N A;  4FIW A;  2HZE A;  3ZML A;  4GF0 A;  3NIV A;  2H6X A;  5DQS A;  3KTB A;  1K0D A;  3IC4 A;  5ECM B;  4LL4 B;  4BWS A;  4PX1 A;  3KMO A;  2GST A;  2B1L A;  2ON7 A;  2V41 A;  1XPV A;  2B5Y A;  3QR6 A;  4POB A;  2YJ7 A;  2ZCT A;  1SJZ A;  3EC3 A;  4H86 A;  5INY A;  1FW1 A;  2I81 A;  4YAV A;  1ZMA A;  1OVN A;  4IQ1 A;  4ZB8 A;  2JAC A;  3IPZ A;  4TN8 A;  2GZY A;  3RPP A;  2HZF A;  1BQ7 A;  11GS A;  3LOR A;  4KUN A;  3US3 A;  2Z9S A;  5ENU A;  5CRH A;  3FEU A;  3P90 A;  4IVF A;  2VL2 A;  3EYT A;  2XC2 A;  5JWR B;  4ACS A;  3IBH A;  1GTB A;  1XW9 A;  1N8J A;  1WP0 A;  5JWO B;  4PXO A;  5B6N A;  3WT1 A;  2LNS A;  2VLT A;  3TKQ A;  2ON5 A;  4IKH A;  2F8F A;  5EPF A;  3IA1 A;  3KIJ A;  3A2V A;  3UAP A;  4CW9 A;  5HR2 A;  2FWE A;  1EP8 A;  4HEA 2;  1GWC A;  1I9D A;  2H1G A;  4MZC A;  4KDU A;  1ML6 A;  1GTI A;  3QPM A;  1TRV A;  2TIR A;  1J9B A;  4GSS A;  1OKT A;  3FR3 A;  3KCM A;  5F0G A;  4Z7X A;  4J2F A;  1AXD A;  3KD0 A;  3LFL A;  1WPI A;  1EEJ A;  2O89 A;  1B48 A;  3SWL A;  4EXJ A;  2C0D A;  3QFA C;  2GZZ A;  1ERT A;  2FA4 A;  6GST A;  3P8W A;  2X8H A;  2RM5 A;  1GSD A;  4MPG A;  1TDI A;  2B5X A;  3UBL A;  3FKF A;  3TJJ A;  4KSO A;  5HFI A;  4MK3 A;  3RHB A;  3GV1 A;  2GQM A;  1T7P B;  4MH2 A;  4ZBB A;  5HQP A;  2HNL A;  3KM6 A;  2NDO A;  3ZRE A;  1V58 A;  4TXV A;  1O8X A;  2EIR A;  2CV4 A;  1G6W A;  4GST A;  1TI1 A;  2YWI A;  1O85 A;  2CVB A;  4RUV A;  1SKS B;  4X0X A;  4ML6 A;  3VPQ A;  1XW5 A;  2A2S A;  3CTF A;  3S9F A;  4Q5Q A;  3F9U A;  3LG6 A;  2FHE A;  3FY7 A;  5IMF A;  5CRD A;  3D22 A;  2YOI A;  2V6K A;  3A3T A;  2KUC A;  2H30 A;  3QFB C;  2B1K A;  2HSH A;  5IMV A;  1Q4J A;  4HDE A;  2H72 A;  5J9B A;  1XXU A;  5EY6 A;  2FGX A;  2GSS A;  3G7I A;  4EKZ A;  2O8V B;  5CP1 A;  4XRA A;  1B4Q A;  4HS1 A;  4FYU A;  3TRP A;  3M0F A;  3GYK A;  3F6D A;  2EIQ A;  4XIH A;  4ID0 A;  4KH7 A;  1G0T A;  5CRE A;  4ZXG A;  3GSS A;  1TU8 A;  1QFN A;  3QAV A;  1GNW A;  3BOA A;  4L0W A;  2FA8 A;  3BCK A;  1HD2 A;  2X8C A;  1V2A A;  5DAL B;  1G7O A;  4XS1 A;  1OE8 A;  5ECI B;  5G1L A;  1EV9 A;  4ZB9 A;  1BAY A;  3UVH A;  3D21 A;  2HSY A;  2H66 A;  6GSS A;  3WGE A;  4MJA A;  1FHE A;  3C73 A;  4F82 A;  1XW6 A;  3TJK A;  1AQW A;  3VFI A;  3ERF A;  3WD6 A;  3IE3 A;  1X5C A;  4GRF A;  5ECP B;  3D0Z A;  4ULX A;  1A0R P;  2N5F A;  2WS2 A;  4BA7 A;  5FWG A;  3GST A;  1BYE A;  2VL2 C;  4HJ2 A;  2JU5 A;  1ERU A;  1GUK A;  2OE1 A;  3TGZ A;  2IMK A;  3KH9 A;  3UEM A;  4KSM A;  1SK1 A;  3KMN A;  1NW2 A;  4DSQ A;  3GTU B;  4L8E A;  3O6T A;  1LU4 A;  4O92 A;  3NZN A;  2P31 A;  1OE7 A;  1TJD A;  4EVM A;  1B8X A;  10GS A;  4MJE A;  2AV4 A;  2HZE B;  5EVO A;  1GL8 A;  4XCS A;  1J08 A;  2OAC A;  5GAP D;  2LJK A;  4MP4 A;  3LSZ A;  4F0C A;  1SL2 B;  1XWK A;  3TKP A;  5J5N A;  1U87 A;  2VCZ A;  4N10 A;  3EE2 A;  1NM3 A;  2AB6 A;  4D73 B;  2CQ9 A;  2VD0 A;  5ECH B;  3F8U A;  1ST9 A;  1GSE A;  1JLV A;  4HQS A;  4OWY A;  3VUR A;  2BMX A;  2XPE A;  2KLX A;  1ON4 A;  4GQF A;  2LKU A;  5DCG A;  3D6I A;  4TW5 A;  4PUA A;  1R5A A;  3GRX A;  1F2E A;  3J7Y k;  1JHB A;  1THX A;  3DXB A;  4WBR D;  3L0H A;  3RBT A;  2IFQ A;  1Z6M A;  1GSS A;  1MDK A;  3MNG A;  3GA4 A;  4YQU A;  1M2B A;  1PGT A;  4HU9 A;  2DLX A;  3KEB A;  3M9K A;  2B3S A;  2LST A;  5IO0 A;  1S3C A;  4GCI A;  2VAF A;  4XRD A;  3VWX A;  1HNC A;  5ECN B;  3GIX A;  5HFG A;  3HKR A;  2VCW A;  1V98 A;  2J9H A;  3TJF A;  4IP6 A;  4XHM A;  3ZZX A;  3VLN A;  1V9W A;  1GRX A;  1XCC A;  5D9X A;  1JLW A;  2LV3 A;  2MBT A;  2MMO A;  1PKW A;  4OFN A;  3EU3 A;  2DJ1 A;  3MSZ A;  1EOG A;  5CRW A;  1V40 A;  4ZL7 A;  3ERW A;  1J0F A;  4KCA A;  5COH A;  3D4M A;  1XVW A;  1I5G A;  5JCW A;  3BJ5 A;  5D9W A;  1HNB A;  1TP9 A;  17GS A;  2M72 A;  1JZO A;  4ECJ A;  2CA8 A;  5JCU A;  3I6A A;  4N30 A;  2NPB A;  1K0M A;  2YWM A;  2C0F A;  3NOF A;  1SD8 A;  3VWV A;  1PKZ A;  4Q5N A;  5FT3 A;  1Z5Y E;  1X0R A;  2HE3 A;  3KZQ A;  2DSA A;  5IPG A;  2IMI A;  5IPH A;  4WKW A;  3HVV A;  5H5S A;  2H71 A;  4IQA A;  5F8B A;  2X64 A;  4IEL A;  1G6Y A;  5LD0 A;  1OC9 A;  2LQQ A;  1GSY A;  4G10 A;  3IK7 A;  3UAR A;  1YKC A;  4KDY A;  3N5O A;  3QCP A;  3UOM A;  2GDR A;  4K0G A;  1QUW A;  2QKE A;  4I2T A;  5HFK A;  1JZW A;  1F37 A;  2YWO A;  3GNJ A;  2C4J A;  2H0H A;  3IR4 A;  3ZFL A;  2VUP A;  3L9U A;  3CSH A;  3ZRD A;  3CXG A;  2G2Q A;  2OBI A;  2YV7 A;  1YY7 A;  2C80 A;  1YQ1 A;  2LS5 A;  3DRN A;  3GL5 A;  4IJ3 A;  3W8J A;  3LQ7 A;  4G2E A;  5J4U A;  1S3D A;  4ISD A;  4IJI A;  3W6G A;  2GT6 A;  7GSS A;  1YDK A;  4ZIJ A;  4K0N A;  3GKX A;  5DAK A;  5F06 A;  1E2Y A;  1LJR A;  4JR4 A;  3IAS 2;  3QDN A;  2XPD A;  3GMF A;  1K3Y A;  4I6X A;  3L78 A;  1T8E B;  5LCZ A;  3RPN A;  1AW9 A;  2VCQ A;  3HVX A;  1VF3 A;  4RQX A;  3HJP A;  1FAA A;  18GS A;  5IM9 A;  2GLR A;  2X99 A;  4BWQ A;  3ZTL A;  3H93 A;  3LJR A;  4BVX A;  2G0F A;  20GS A;  4KCE A;  4DVC A;  3TDG A;  4TR1 B;  3F4R A;  2YWN A;  1NSW A;  1B9Y C;  4ZIL A;  3OR5 A;  2RUF A;  4WXT A;  4HOJ A;  2H73 A;  5B6M A;  4YH2 A;  3MWH A;  1JZD A;  2L5L A;  3ZLP A;  2OKA A;  1Z7P A;  2H0I A;  5IQY A;  5LNK e;  5D73 A;  3RHC A;  4TKY A;  4TXO A;  1TKD B;  2NTO A;  5B7C A;  5JWQ B;  4NV5 A;  5G1K A;  1TK0 B;  5AIS A;  2DIZ A;  3UVT A;  2CZ3 A;  4KDX A;  2PPT A;  2WJU A;  1USB A;  3PGT A;  3HDC A;  4NHZ A;  5GZZ B;  3GH9 A;  3GFK A;  2H1D A;  2IFQ B;  1K3L A;  2PN8 A;  4DEJ A;  1GTA A;  2XHF A;  5AN1 A;  2WDU A;  3EWL A;  3TKS A;  1TK5 B;  3GH6 A;  4EDY A;  2H0G A;  1TRS A;  3L4N A;  1KNG A;  2FWH A;  2MMN A;  2C1Y A;  2X8G A;  3F0I A;  1GSU A;  4DSS B;  4TR4 A;  5G30 A;  1ZL9 A;  1NHY A;  4BVY A;  1A23 A;  4AJ8 A;  1W89 A;  2VCX A;  1ZGN A;  2VM1 A;  2CAQ A; 
#chains in the Genus database with same CATH topology
 3IV4 A;  2VCV A;  2IPA A;  5J3R A;  2DJK A;  1QXH A;  2CAI A;  4K8M A;  4LLR A;  1U88 A;  1X9M B;  1XWC A;  3KH7 A;  1TTZ A;  3D4T A;  5C04 A;  4O5U A;  2WRT A;  3HZ8 A;  1OKD A;  4G19 A;  2H1B A;  4I5Q A;  2B5E A;  3HA9 A;  2DBC A;  4YAP A;  4Z2T A;  4OO4 A;  3APS A;  3E3E A;  2VO4 A;  4KGI A;  4FYC A;  3I69 A;  3C1R A;  3VK9 A;  1B4P A;  1M3J A;  2OAD A;  3HCZ A;  4JZQ A;  4GTU A;  3UIW A;  3CSJ A;  5AIV A;  3ZVJ D;  4K6X A;  1ACV A;  2RII A;  2KP1 A;  1CQH A;  1M99 A;  4QQ7 A;  4RI7 A;  4MF5 A;  4Q5R A;  2A2R A;  2B7J A;  4DSR A;  4BL7 A;  3U6V A;  3TOT A;  2WCI A;  1V57 A;  3KGK A;  3CQF A;  3C8E A;  2AUV A;  4KX4 A;  2HRN A;  3QMX A;  6GSW A;  2CVK A;  3A2X A;  4KND A;  1XOA A;  3FYG A;  4I2U A;  4POK A;  4EC0 A;  4XS6 A;  4NWY A;  4AJ7 A;  5CAX A;  2QSI A;  3KXO A;  2YNX A;  4OD7 A;  5G5E A;  4MDC A;  2H75 A;  3L9S A;  4I97 A;  3CRT A;  2C0G A;  2M80 A;  2EC4 A;  1VF4 A;  4YKF A;  3M1G A;  2LJA A;  3JCM L;  1K0B A;  5D93 A;  4JU5 A;  3O3T A;  3PPU A;  4NPB A;  5IMC A;  1RW1 A;  3F63 A;  1R5P A;  3IHQ A;  1SK0 A;  4KE3 A;  1ZYP A;  1B9X C;  3MYD A;  4K7I A;  2L57 A;  3TB2 A;  1O6J A;  3KJY A;  5H5R A;  1M2D A;  1GSQ A;  2K8V A;  1A2J A;  1CQG A;  3G9B A;  1TU7 A;  14GS A;  3LEF A;  5DBQ A;  5F05 A;  2L59 A;  1ABA A;  5GST A;  4YQV A;  3QAW A;  4NXI A;  4FQU A;  4ECI A;  3TUE A;  4BVX B;  2L4Q A;  1EOH A;  3TKS C;  1XOB A;  2YAN A;  1ERW A;  2E7P A;  4WR5 A;  2O7K A;  3WGX A;  1O8W A;  1QMV A;  4K9Z A;  2F3M A;  1Z3E A;  1ZYQ B;  2B6M A;  3TRX A;  5GSS A;  1XBS A;  5ELA A;  3Q6O A;  4OFM A;  4F2I A;  2P5R A;  3L9V A;  1ILO A;  3EU4 A;  4GWR A;  5EL8 A;  3APO A;  2H74 A;  2R3X A;  1EEM A;  3FZA A;  3UMA A;  4OCF A;  1ZZY A;  3ZMK A;  3ZIJ A;  4POM A;  3F3Q A;  1R7H A;  5ECR B;  1ZOF A;  1NHO A;  1W4V A;  5KN2 A;  3HY2 A;  4QL9 A;  4GSN A;  1VF2 A;  2HLS A;  2YJH A;  4I8B A;  3G7J A;  1HYU A;  5IOW A;  4J57 E;  1XWG A;  1HQO A;  2C3N A;  3IK9 A;  1FG4 A;  5ECK B;  3MAK A;  3IRA A;  2FLS A;  2PVQ A;  3IDV A;  1SKW B;  3J7Y b;  3LYP A;  1SKR B;  4JED A;  2F8A A;  4LL1 B;  4ZL9 A;  3A5W A;  1A0F A;  1XVQ A;  5ID2 A;  3E9J B;  4MLY A;  5B8A A;  4BVY B;  2IL3 A;  1FVK A;  2YZH A;  4P3Y B;  4L5L A;  1K0O A;  4K2D A;  5ELG A;  3D5J A;  2LRN A;  1Y25 A;  3H1N A;  5B8B A;  2JSZ A;  1M9A A;  3ISO A;  2DJ0 A;  3F4T A;  1ZCP A;  4FH8 A;  3PIN A;  5J41 A;  2L4C A;  1HNA A;  1TXX A;  3C71 A;  4MZB A;  3Q18 A;  3FW2 A;  3CRU A;  1A8L A;  1TRU A;  4IBP A;  4L0U A;  1PL1 A;  5CRG A;  2F9S A;  3TKR A;  5G31 A;  2PMT A;  3FRC A;  1KEB A;  3BBY A;  2PER A;  1X9S B;  3DML A;  4G9H A;  5FHI A;  1RK4 A;  2DJ2 A;  2AHE A;  5A4V A;  2GT5 A;  4JE1 A;  1EGO A;  3ZL5 A;  1SJI A;  1MTC A;  4K7N A;  1PD2 1;  1GLP A;  2VD1 A;  3A2W A;  4PGT A;  6GSV A;  2PGT A;  2K6V A;  2M46 A;  2IJY A;  5IIZ A;  5D9T A;  3DVW A;  2E2G A;  1WWJ A;  1EV4 A;  2CX4 A;  3WGD A;  3EMP A;  3R3E A;  1YKA A;  4CY8 A;  2QA2 A;  1DE2 A;  3GKN A;  3FR6 A;  5A4W A;  1A8Y A;  2X4A A;  4ZBA A;  1JZR A;  4PQ1 A;  4X1U A;  4F03 A;  4MPF A;  2IN3 A;  5KOW A;  1YF1 A;  2KHP A;  3TJB A;  1UVZ A;  3GUS A;  5J9C A;  1GSF A;  12GS A;  4MZW A;  2CZ2 A;  3F4S A;  4FYB A;  4EO3 A;  2HXK A;  4K2X A;  3QAG A;  1E6B A;  2A4V A;  5BRT A;  2VM2 A;  1N2A A;  1EZK A;  1UN2 A;  5HR1 A;  3RAZ A;  4EUY A;  2V32 A;  3GX0 A;  3VWW A;  2N5A A;  1PRX A;  1GUM A;  1GP1 A;  2H8L A;  4MA9 A;  2B7K A;  3VWU A;  5A4U A;  2ES7 A;  2FNO A;  3TRQ A;  4ECB A;  4OFT A;  1S3R A;  1M9B A;  2VL9 A;  1FOH A;  2YV9 A;  2F51 A;  4V2N A;  1F6M C;  6GSU A;  3LYK A;  3ERG A;  2OA7 A;  1K0A A;  3EUR A;  1O73 A;  4HJM A;  2ZUP A;  4BPY A;  1O7U A;  5A5K A;  2OJL A;  4JR6 A;  4N0V A;  3HJO A;  2IIY A;  1AC1 A;  4O7H A;  3H4K A;  22GS A;  3ME7 A;  2FWF A;  4HUA A;  1GTU A;  1TK8 B;  2QC7 A;  1S3A A;  2LEG A;  3ZFB A;  2DMM A;  3G7Y A;  1UA5 A;  4MH3 A;  1R26 A;  2YP6 A;  3DWV A;  6GSY A;  3I9V 2;  3DKS A;  4TVE A;  2MBS A;  4IN0 A;  1MD3 A;  5CNW A;  2JZS A;  3FZ5 A;  4EF0 A;  3GTU A;  5ECQ B;  2QA1 A;  1WIK A;  2OBK A;  1M0U A;  2HT9 A;  1BX9 A;  4XS4 A;  5D9V A;  4K7O A;  3E0U A;  4E8H A;  5HR3 A;  4NV2 A;  2L6C A;  2JZR A;  4ML1 A;  3CMI A;  2VLV A;  4JBB A;  3LWA A;  5D8I A;  4AJ6 A;  4HZ2 A;  2I9H A;  2AJQ B;  4V1A p;  4D73 A;  1TW9 A;  4MCU A;  3VI7 A;  2DML A;  4MJB A;  4OCE A;  1C72 A;  2L6D A;  3QOU A;  1U3A A;  3LXZ A;  2GSR A;  5BMU A;  3FR9 A;  4PNF A;  2GGT A;  5DQY A;  1SL1 B;  4RQR A;  3TKS E;  3AY8 A;  1PL2 A;  3C7M A;  4XTS A;  5F07 A;  3M8N A;  5C00 A;  4X43 A;  4GXZ A;  3FZ4 A;  2UZ8 A;  3HHV A;  2MMA A;  3F3R A;  3EMX A;  1SL0 B;  2FWG A;  2R4V A;  3DD3 A;  1FVJ A;  2I3Y A;  2VL3 A;  2HRA A;  1Z9H A;  1QQ2 A;  2HRK A;  4NMU A;  1WOU A;  5KN0 A;  3ED3 A;  3CSI A;  1U3I A;  3SBC A;  1Z7R A;  1RQM A;  2XBI A;  4G0I A;  5KOX A;  2FD3 A;  5ID2 B;  2JL4 A;  2IMD A;  2MYG A;  2H19 A;  1BG5 A;  1MDI A;  5D96 A;  4J56 E;  4PQH A;  2JAD A;  1QK8 A;  1IYH A;  1EP7 A;  3LXT A;  2VCT A;  3HXS A;  19GS A;  3W8S A;  2GQK A;  4JRR A;  1YF0 A;  2WGR A;  9GSS A;  1WMJ A;  2H01 A;  4KB3 A;  2YN1 A;  2P5Q A;  1GLQ A;  4K5R A;  1VGL A;  4E8E A;  6GSX A;  3R2Q A;  2NBS A;  3RDW A;  2WUL A;  1DBY A;  3GUR A;  4OO5 A;  4MF6 A;  1XIY A;  16GS A;  2RM6 A;  1T4Y A;  2WB9 A;  1PN0 A;  3CYN A;  2R2J A;  3EVI A;  1TRW A;  1URM A;  2OE0 A;  1BJX A;  1OC9 B;  2C3T A;  1T1V A;  1A2M A;  1YJ6 A;  4PUR A;  3LW9 A;  5IMA A;  3DGQ A;  2R6K A;  2FY6 A;  3VI5 A;  2FUG 2;  1PMT A;  5ABR A;  2LRC A;  4WF4 A;  1AUC A;  4GLT A;  1JFU A;  4MF7 A;  5KEJ A;  3GN3 A;  1X9W B;  5DVB A;  4PQI A;  2AAW A;  1MEK A;  1KTE A;  2OE3 A;  1SJ6 A;  4KAE A;  4WR4 A;  1XZO A;  2GZP A;  2R0G A;  1YEP A;  2RUE A;  4AGS A;  1OAZ A;  3FHK A;  1GUH A;  1A2L A;  4POL A;  2R5G A;  4ECC A;  1TI3 A;  1WRY A;  2PWJ A;  5DAK B;  2LNT A;  1QGV A;  3TOU A;  3DVX A;  1F9M A;  2YPM A;  3MDK A;  1ZYE A;  1WE0 A;  4CDO A;  4N0Z A;  4HI7 A;  1AQV A;  8GSS A;  4WET A;  3IOS A;  1EGR A;  1XWB A;  2FCH A;  4PUF C;  1G7E A;  3H79 A;  4TOP A;  4G0K A;  1VRS D;  1PX6 A;  4IW9 A;  1WJK A;  4K5S A;  5DJL A;  1ERV A;  3QD9 A;  3TJG A;  4YQM A;  1DE1 A;  5IOX A;  3UL3 A;  2V1M A;  3FK8 A;  4IS0 A;  4V1A g;  3Q74 A;  4HQZ A;  2REM A;  5L71 A;  1GH2 A;  2MZC A;  5E4W A;  2IWT A;  1KBN A;  1X5E A;  1AIU A;  4TRX A;  2QGV A;  2WFC A;  1PA3 A;  13GS A;  2E0Q A;  3U5R E;  4OMV A;  3ZIT A;  1THO A;  1SYR A;  2ZNM A;  4EDZ A;  2K8S A;  4TR1 A;  5AGY A;  1AQX A;  2K18 A;  2YCD A;  5ECO B;  2TRC P;  3EIN A;  1OC3 A;  2HRF A;  2VIM A;  4TXO B;  4XS4 B;  2PBJ A;  5IO2 A;  2CX3 A;  4ZL8 A;  2CT6 A;  4WBJ A;  4ILF A;  5KN1 A;  3GL3 A;  2DC5 A;  3M3M A;  2JZT A;  4RI6 A;  4IGJ A;  2R37 A;  3HVS A;  2GQL A;  2XBQ A;  4F9Z A;  2H6Y A;  3KP8 A;  5IMD A;  2V2G A;  2VLU A;  3ZYW A;  5AIX A;  1H75 A;  5E59 A;  1FO5 A;  2LTK A;  4HU7 A;  2GVP A;  3PH9 A;  5GAN D;  1SK2 A;  1Y6E A;  4F0B A;  2WZ9 A;  1GNE A;  1DUG A;  4MAB A;  1TOF A;  1EWX A;  1OYJ A;  2LQO A;  3V1W A;  1MD4 A;  1F3A A;  3ZVJ A;  3DYR A;  1M2A A;  1A24 A;  2RLI A;  5IMZ A;  1SU9 A;  4K1F A;  1SEN A;  2I4A A;  1T00 A;  3ME8 A;  4CHS A;  4LA1 A;  4LMV A;  2E2M A;  3HZ4 A;  3GKK A;  3UJ1 A;  1PN9 A;  1T3B A;  3PR8 A;  3I43 A;  2D2Z A;  4DSS A;  2LJR A;  1XWA A;  4ZB6 A;  4O5R A;  3LGC A;  5ECL B;  2I1U A;  3BD2 A;  2O87 A;  1AAZ A;  2ALB A;  4NHW A;  2P0G A;  4EIQ A;  3IXR A;  2VOC A;  2KOK A;  3M9J A;  5H5Q A;  4FO5 A;  2LRT A;  3EPT A;  3FZ9 A;  3ZIV A;  2H70 A;  2TRX A;  2C3Q A;  4MNN A;  4KF9 A;  5CYY A;  4AF2 A;  3WYW A;  2AYT A;  2GS3 A;  2J23 A;  2LUS A;  1SD9 A;  4LMW A;  4MJC A;  2K9F A;  1XFL A;  1FOV A;  4TR3 A;  1ZYN A;  3CBU A;  2A4H A;  2H6Z A;  4O32 A;  2N5B A;  3N9J A;  2O85 A;  3KP9 A;  3CTG A;  1F3B A;  2CVD A;  1FB6 A;  2IME A;  1SYX A;  4PNG A;  4BL7 B;  2DJ3 A;  3UBK A;  2BTO T;  2KP2 A;  2HI7 A;  1H4O A;  1OC8 A;  3APQ A;  3P2A A;  5G5F A;  5DJM A;  2H76 A;  3GX8 A;  4Q5F A;  2V6O A;  4TR0 A;  3DIE A;  3P7X A;  5CO3 A;  4GQC A;  5JCG A;  1PX7 A;  4MMM A;  1VF1 A;  4NAX A;  4HZ4 A;  1K3O A;  4QL7 A;  1R4W A;  3GHA A;  4IHU A;  3IAM 2;  4V2M A;  4KW6 A;  2BJX A;  4WF5 A;  3KTL A;  2PVO C;  1M7T A;  3F6F A;  3VPT A;  1MDJ A;  5ECS A;  1Z6N A;  3WT2 A;  2GTU A;  4ZBD A;  4KA0 A;  3DEX A;  1PQN A;  3HJM A;  4IP1 A;  2NVL A;  2YZU A;  3FMW A;  5DAL A;  3C1S A;  1PSQ A;  1X5D A;  5DDL A;  1GUL A;  5KN3 A;  3H8Q A;  1O81 A;  3BCI A;  2H1A A;  2DJJ A;  1UC7 A;  2DIY A;  1T4Z A;  2PUK C;  2JSY A;  3GKM A;  1K0C A;  2GSQ A;  1YZX A;  3IC8 A;  3TCO A;  2PU9 C;  3HD5 A;  2EIO A;  4WEY A;  4EE0 A;  1FB0 A;  2IMF A;  5DCH A;  2HFD A;  5G2Z A;  3O76 A;  2L5O A;  3Q19 A;  2C8U A;  4EL1 A;  3K8N A;  2C0E A;  1U6T A;  2MMZ A;  2HYX A;  4L5O A;  4V2L A;  1YEX A;  1Q98 A;  1DSB A;  1BED A;  1LBK A;  5HR0 A;  1IYI A;  4N11 A;  3HYP A;  1K0N A;  4FIW A;  2HZE A;  3ZML A;  4USS A;  4GF0 A;  3NIV A;  2H6X A;  5DQS A;  3KTB A;  1K0D A;  3IC4 A;  2R0P A;  5ECM B;  3IHG A;  4LL4 B;  4BWS A;  4PX1 A;  3KMO A;  2GST A;  2B1L A;  4BIK A;  2ON7 A;  2V41 A;  1XPV A;  2B5Y A;  3QR6 A;  4POB A;  2YJ7 A;  2ZCT A;  1SJZ A;  3EC3 A;  4H86 A;  5INY A;  1FW1 A;  2I81 A;  4YAV A;  1ZMA A;  1OVN A;  4IQ1 A;  4ZB8 A;  2JAC A;  3IPZ A;  4TN8 A;  2GZY A;  3RPP A;  2HZF A;  1BQ7 A;  11GS A;  3LOR A;  4KUN A;  3US3 A;  2Z9S A;  5ENU A;  4O5Q A;  5CRH A;  3FEU A;  3P90 A;  4IVF A;  2VL2 A;  3EYT A;  2XC2 A;  5JWR B;  4ACS A;  3IBH A;  1GTB A;  1XW9 A;  1N8J A;  1WP0 A;  5JWO B;  4PXO A;  5B6N A;  3WT1 A;  2LNS A;  2VLT A;  3TKQ A;  2ON5 A;  4IKH A;  2F8F A;  5EPF A;  3IA1 A;  3KIJ A;  3A2V A;  3UAP A;  4CW9 A;  5HR2 A;  2FWE A;  1EP8 A;  4HEA 2;  1GWC A;  1I9D A;  2H1G A;  4MZC A;  4KDU A;  1ML6 A;  1GTI A;  3QPM A;  1TRV A;  2TIR A;  1J9B A;  4GSS A;  1OKT A;  3FR3 A;  3KCM A;  5F0G A;  4Z7X A;  4J2F A;  1PFO A;  1AXD A;  3KD0 A;  3LFL A;  1WPI A;  1EEJ A;  2O89 A;  1B48 A;  3SWL A;  4EXJ A;  2C0D A;  3QFA C;  2GZZ A;  1ERT A;  2FA4 A;  6GST A;  3P8W A;  2X8H A;  2RM5 A;  1GSD A;  4MPG A;  1TDI A;  2B5X A;  3UBL A;  3FKF A;  3TJJ A;  4KSO A;  5HFI A;  4MK3 A;  3RHB A;  4YKG A;  3GV1 A;  2GQM A;  1T7P B;  4MH2 A;  4ZBB A;  5HQP A;  3A5I A;  2HNL A;  3KM6 A;  2NDO A;  3ZRE A;  1V58 A;  4TXV A;  1O8X A;  2EIR A;  2CV4 A;  1G6W A;  4GST A;  1TI1 A;  2YWI A;  1O85 A;  2CVB A;  4RUV A;  1SKS B;  4X0X A;  4ML6 A;  3VPQ A;  1XW5 A;  2A2S A;  3CTF A;  3S9F A;  4Q5Q A;  3F9U A;  3LG6 A;  2FHE A;  3FY7 A;  5IMF A;  5CRD A;  3D22 A;  2YOI A;  2V6K A;  2DKH A;  3A3T A;  2KUC A;  2H30 A;  3QFB C;  2B1K A;  2HSH A;  5IMV A;  1Q4J A;  4HDE A;  2H72 A;  5J9B A;  4EIP A;  1XXU A;  5EY6 A;  2FGX A;  2GSS A;  3G7I A;  4EKZ A;  2O8V B;  5CP1 A;  4XRA A;  1B4Q A;  4HS1 A;  4FYU A;  3TRP A;  3M0F A;  2R0C A;  3GYK A;  3F6D A;  2EIQ A;  4XIH A;  4ID0 A;  4KH7 A;  1G0T A;  5CRE A;  4ZXG A;  3GSS A;  1TU8 A;  1QFN A;  3QAV A;  1GNW A;  3BOA A;  4L0W A;  2FA8 A;  3BCK A;  1HD2 A;  2X8C A;  1V2A A;  5DAL B;  1G7O A;  4XS1 A;  1OE8 A;  5ECI B;  5G1L A;  1EV9 A;  4ZB9 A;  1BAY A;  3UVH A;  3D21 A;  2HSY A;  2H66 A;  6GSS A;  3WGE A;  4MJA A;  1FHE A;  3C73 A;  4F82 A;  1XW6 A;  3TJK A;  1AQW A;  3VFI A;  3ERF A;  3WD6 A;  3IE3 A;  1X5C A;  4GRF A;  5ECP B;  3D0Z A;  4ULX A;  1A0R P;  2N5F A;  2WS2 A;  4BA7 A;  5FWG A;  3GST A;  1BYE A;  2VL2 C;  4HJ2 A;  2JU5 A;  1ERU A;  1GUK A;  2OE1 A;  3TGZ A;  2IMK A;  3KH9 A;  3UEM A;  4KSM A;  1SK1 A;  3KMN A;  1NW2 A;  4DSQ A;  3GTU B;  4L8E A;  3O6T A;  1LU4 A;  4O92 A;  3NZN A;  2P31 A;  4G0L A;  1OE7 A;  1TJD A;  4EVM A;  1B8X A;  10GS A;  4MJE A;  2AV4 A;  2HZE B;  4ICY A;  5EVO A;  1GL8 A;  4XCS A;  1J08 A;  2OAC A;  5GAP D;  2LJK A;  4MP4 A;  3LSZ A;  4F0C A;  1SL2 B;  1XWK A;  3TKP A;  5J5N A;  1U87 A;  2VCZ A;  4N10 A;  3EE2 A;  1NM3 A;  2AB6 A;  4D73 B;  2CQ9 A;  3MIX A;  2VD0 A;  5ECH B;  3F8U A;  1ST9 A;  1GSE A;  1JLV A;  4HQS A;  4OWY A;  3VUR A;  2BMX A;  2XPE A;  2KLX A;  1ON4 A;  4GQF A;  2LKU A;  5DCG A;  3D6I A;  4TW5 A;  4PUA A;  1R5A A;  3GRX A;  1F2E A;  3J7Y k;  1JHB A;  1THX A;  4PTS A;  3DXB A;  4WBR D;  3L0H A;  3RBT A;  2IFQ A;  1Z6M A;  1GSS A;  1MDK A;  3MNG A;  3GA4 A;  4YQU A;  1M2B A;  1PGT A;  4HU9 A;  2DLX A;  3KEB A;  3M9K A;  2B3S A;  2LST A;  5IO0 A;  1S3C A;  4GCI A;  4A5P A;  2VAF A;  4XRD A;  3VWX A;  1HNC A;  3GIX A;  5ECN B;  5HFG A;  3HKR A;  2VCW A;  1V98 A;  2J9H A;  3TJF A;  4IP6 A;  4XHM A;  3ZZX A;  3VLN A;  1V9W A;  1GRX A;  1XCC A;  5D9X A;  1JLW A;  2LV3 A;  2MBT A;  2MMO A;  1PKW A;  4OFN A;  3EU3 A;  2DJ1 A;  3MSZ A;  1EOG A;  5CRW A;  1V40 A;  4ZL7 A;  3ERW A;  1XG8 A;  1J0F A;  4KCA A;  5COH A;  3D4M A;  1XVW A;  1I5G A;  5JCW A;  3BJ5 A;  5D9W A;  1HNB A;  1TP9 A;  17GS A;  2M72 A;  1JZO A;  4ECJ A;  2CA8 A;  5JCU A;  3I6A A;  4N30 A;  2NPB A;  1K0M A;  4X4J A;  2YWM A;  2C0F A;  3NOF A;  2X49 A;  1SD8 A;  3VWV A;  1PKZ A;  4Q5N A;  5FT3 A;  1Z5Y E;  1X0R A;  2HE3 A;  3KZQ A;  2DSA A;  5IPG A;  2IMI A;  5IPH A;  4WKW A;  3HVV A;  5H5S A;  2H71 A;  4IQA A;  5F8B A;  2X64 A;  4IEL A;  1G6Y A;  5LD0 A;  2HSM A;  1OC9 A;  2LQQ A;  1GSY A;  4G10 A;  3IK7 A;  3UAR A;  1YKC A;  4KDY A;  3N5O A;  3QCP A;  3UOM A;  2GDR A;  4K0G A;  1QUW A;  2QKE A;  4I2T A;  5HFK A;  1JZW A;  1F37 A;  2YWO A;  3GNJ A;  2C4J A;  4Z2U A;  2H0H A;  3IR4 A;  3ZFL A;  2VUP A;  3L9U A;  3CSH A;  3ZRD A;  4CY6 A;  3CXG A;  2G2Q A;  2OBI A;  2YV7 A;  1YY7 A;  2C80 A;  1YQ1 A;  2LS5 A;  3DRN A;  3GL5 A;  4IJ3 A;  3W8J A;  3LQ7 A;  4G2E A;  4Z2R A;  5J4U A;  1S3D A;  4ISD A;  4IJI A;  3W6G A;  2GT6 A;  7GSS A;  1YDK A;  4ZIJ A;  4K0N A;  3GKX A;  5DAK A;  5F06 A;  1E2Y A;  1LJR A;  4JR4 A;  3IAS 2;  3QDN A;  2XPD A;  3GMF A;  1K3Y A;  2DKI A;  4I6X A;  3L78 A;  1T8E B;  5LCZ A;  3RPN A;  1AW9 A;  2VCQ A;  3HVX A;  1VF3 A;  4RQX A;  3HJP A;  1FAA A;  18GS A;  4HSC X;  2A2P A;  5IM9 A;  2GLR A;  2X99 A;  4BWQ A;  3ZTL A;  3H93 A;  3LJR A;  4BVX A;  2G0F A;  20GS A;  4KCE A;  4DVC A;  3TDG A;  4TR1 B;  3F4R A;  2YWN A;  1NSW A;  1B9Y C;  4ZIL A;  3OR5 A;  2RUF A;  4WXT A;  4HOJ A;  2H73 A;  5B6M A;  4YH2 A;  3MWH A;  1JZD A;  2L5L A;  3ZLP A;  2OKA A;  1Z7P A;  2H0I A;  5IQY A;  5LNK e;  5D73 A;  3RHC A;  4TKY A;  4TXO A;  1TKD B;  2NTO A;  5B7C A;  5JWQ B;  4NV5 A;  5G1K A;  1TK0 B;  5AIS A;  2DIZ A;  3UVT A;  2CZ3 A;  4KDX A;  2PPT A;  2WJU A;  1USB A;  3PGT A;  3HDC A;  4NHZ A;  5GZZ B;  3GH9 A;  3GFK A;  1M3I A;  2H1D A;  2IFQ B;  1K3L A;  2PN8 A;  4DEJ A;  1GTA A;  3HVN A;  2XHF A;  5AN1 A;  2WDU A;  3EWL A;  3TKS A;  1TK5 B;  3GH6 A;  4EDY A;  2H0G A;  1TRS A;  3L4N A;  1KNG A;  2FWH A;  2MMN A;  2C1Y A;  2X8G A;  3F0I A;  1GSU A;  4DSS B;  4TR4 A;  5G30 A;  1ZL9 A;  1NHY A;  4BVY A;  1A23 A;  4AJ8 A;  1W89 A;  2VCX A;  1ZGN A;  2VM1 A;  2CAQ A; 
#chains in the Genus database with same CATH homology
 3IV4 A;  2VCV A;  2IPA A;  5J3R A;  2DJK A;  1QXH A;  2CAI A;  4K8M A;  4LLR A;  1U88 A;  1X9M B;  1XWC A;  3KH7 A;  1TTZ A;  3D4T A;  5C04 A;  4O5U A;  2WRT A;  3HZ8 A;  1OKD A;  4G19 A;  2H1B A;  4I5Q A;  2B5E A;  3HA9 A;  2DBC A;  4YAP A;  4Z2T A;  4OO4 A;  3APS A;  3E3E A;  2VO4 A;  4KGI A;  4FYC A;  3I69 A;  3C1R A;  3VK9 A;  1B4P A;  2OAD A;  3HCZ A;  4JZQ A;  4GTU A;  3UIW A;  3CSJ A;  5AIV A;  3ZVJ D;  4K6X A;  1ACV A;  2RII A;  2KP1 A;  1CQH A;  1M99 A;  4QQ7 A;  4RI7 A;  4MF5 A;  4Q5R A;  2A2R A;  2B7J A;  4DSR A;  4BL7 A;  3U6V A;  3TOT A;  2WCI A;  1V57 A;  3KGK A;  3C8E A;  2AUV A;  4KX4 A;  2HRN A;  3QMX A;  6GSW A;  2CVK A;  3A2X A;  4KND A;  1XOA A;  3FYG A;  4I2U A;  4POK A;  4EC0 A;  4XS6 A;  4NWY A;  4AJ7 A;  5CAX A;  2QSI A;  3KXO A;  2YNX A;  4OD7 A;  5G5E A;  4MDC A;  2H75 A;  3L9S A;  4I97 A;  3CRT A;  2C0G A;  2M80 A;  2EC4 A;  1VF4 A;  4YKF A;  3M1G A;  2LJA A;  3JCM L;  1K0B A;  5D93 A;  4JU5 A;  3O3T A;  3PPU A;  4NPB A;  5IMC A;  1RW1 A;  3F63 A;  1R5P A;  3IHQ A;  1SK0 A;  4KE3 A;  1ZYP A;  1B9X C;  3MYD A;  4K7I A;  2L57 A;  3TB2 A;  1O6J A;  3KJY A;  5H5R A;  1M2D A;  1GSQ A;  2K8V A;  1A2J A;  1CQG A;  3G9B A;  1TU7 A;  14GS A;  3LEF A;  5DBQ A;  5F05 A;  2L59 A;  1ABA A;  5GST A;  4YQV A;  3QAW A;  4NXI A;  4FQU A;  4ECI A;  3TUE A;  4BVX B;  2L4Q A;  1EOH A;  3TKS C;  1XOB A;  2YAN A;  1ERW A;  2E7P A;  4WR5 A;  2O7K A;  3WGX A;  1O8W A;  1QMV A;  4K9Z A;  2F3M A;  1Z3E A;  1ZYQ B;  2B6M A;  3TRX A;  5GSS A;  1XBS A;  5ELA A;  3Q6O A;  4OFM A;  4F2I A;  2P5R A;  3L9V A;  1ILO A;  3EU4 A;  4GWR A;  5EL8 A;  3APO A;  2H74 A;  2R3X A;  1EEM A;  3FZA A;  3UMA A;  4OCF A;  1ZZY A;  3ZMK A;  3ZIJ A;  4POM A;  3F3Q A;  1R7H A;  5ECR B;  1ZOF A;  1NHO A;  1W4V A;  5KN2 A;  3HY2 A;  4QL9 A;  4GSN A;  1VF2 A;  2HLS A;  2YJH A;  4I8B A;  3G7J A;  1HYU A;  5IOW A;  4J57 E;  1XWG A;  1HQO A;  2C3N A;  3IK9 A;  1FG4 A;  5ECK B;  3MAK A;  3IRA A;  2FLS A;  2PVQ A;  3IDV A;  1SKW B;  3J7Y b;  3LYP A;  1SKR B;  4JED A;  2F8A A;  4LL1 B;  4ZL9 A;  3A5W A;  1A0F A;  1XVQ A;  5ID2 A;  3E9J B;  4MLY A;  5B8A A;  4BVY B;  2IL3 A;  1FVK A;  2YZH A;  4P3Y B;  4L5L A;  1K0O A;  4K2D A;  5ELG A;  3D5J A;  2LRN A;  1Y25 A;  3H1N A;  5B8B A;  2JSZ A;  1M9A A;  3ISO A;  2DJ0 A;  3F4T A;  1ZCP A;  4FH8 A;  3PIN A;  5J41 A;  2L4C A;  1HNA A;  1TXX A;  3C71 A;  4MZB A;  3Q18 A;  3FW2 A;  3CRU A;  1A8L A;  1TRU A;  4IBP A;  4L0U A;  1PL1 A;  5CRG A;  2F9S A;  3TKR A;  5G31 A;  2PMT A;  3FRC A;  1KEB A;  3BBY A;  2PER A;  1X9S B;  3DML A;  4G9H A;  5FHI A;  1RK4 A;  2DJ2 A;  2AHE A;  5A4V A;  2GT5 A;  4JE1 A;  1EGO A;  3ZL5 A;  1SJI A;  1MTC A;  4K7N A;  1PD2 1;  1GLP A;  2VD1 A;  3A2W A;  4PGT A;  6GSV A;  2PGT A;  2K6V A;  2M46 A;  2IJY A;  5IIZ A;  5D9T A;  3DVW A;  2E2G A;  1WWJ A;  1EV4 A;  2CX4 A;  3WGD A;  3EMP A;  3R3E A;  1YKA A;  4CY8 A;  2QA2 A;  1DE2 A;  3GKN A;  3FR6 A;  5A4W A;  1A8Y A;  2X4A A;  4ZBA A;  1JZR A;  4PQ1 A;  4X1U A;  4F03 A;  4MPF A;  2IN3 A;  5KOW A;  1YF1 A;  2KHP A;  3TJB A;  1UVZ A;  3GUS A;  5J9C A;  1GSF A;  12GS A;  4MZW A;  2CZ2 A;  3F4S A;  4FYB A;  4EO3 A;  2HXK A;  4K2X A;  3QAG A;  1E6B A;  2A4V A;  5BRT A;  2VM2 A;  1N2A A;  1EZK A;  1UN2 A;  5HR1 A;  3RAZ A;  4EUY A;  2V32 A;  3GX0 A;  3VWW A;  2N5A A;  1PRX A;  1GUM A;  1GP1 A;  2H8L A;  4MA9 A;  2B7K A;  3VWU A;  5A4U A;  2ES7 A;  2FNO A;  3TRQ A;  4ECB A;  4OFT A;  2VL9 A;  1M9B A;  2YV9 A;  1FOH A;  2F51 A;  4V2N A;  1F6M C;  6GSU A;  3LYK A;  3ERG A;  2OA7 A;  1K0A A;  3EUR A;  1O73 A;  4HJM A;  2ZUP A;  4BPY A;  1O7U A;  5A5K A;  2OJL A;  4JR6 A;  4N0V A;  3HJO A;  2IIY A;  1AC1 A;  4O7H A;  3H4K A;  22GS A;  3ME7 A;  2FWF A;  4HUA A;  1GTU A;  1TK8 B;  2QC7 A;  1S3A A;  2LEG A;  3ZFB A;  2DMM A;  3G7Y A;  1UA5 A;  4MH3 A;  1R26 A;  2YP6 A;  3DWV A;  6GSY A;  3I9V 2;  3DKS A;  4TVE A;  2MBS A;  4IN0 A;  1MD3 A;  5CNW A;  2JZS A;  3FZ5 A;  4EF0 A;  3GTU A;  5ECQ B;  2QA1 A;  1WIK A;  2OBK A;  1M0U A;  2HT9 A;  1BX9 A;  4XS4 A;  5D9V A;  4K7O A;  3E0U A;  4E8H A;  5HR3 A;  4NV2 A;  2L6C A;  2JZR A;  4ML1 A;  3CMI A;  2VLV A;  4JBB A;  3LWA A;  5D8I A;  4AJ6 A;  4HZ2 A;  2I9H A;  2AJQ B;  4V1A p;  4D73 A;  1TW9 A;  4MCU A;  3VI7 A;  2DML A;  4MJB A;  4OCE A;  1C72 A;  2L6D A;  3QOU A;  1U3A A;  3LXZ A;  2GSR A;  5BMU A;  3FR9 A;  4PNF A;  2GGT A;  5DQY A;  1SL1 B;  4RQR A;  3TKS E;  3AY8 A;  1PL2 A;  3C7M A;  4XTS A;  5F07 A;  3M8N A;  5C00 A;  4X43 A;  4GXZ A;  3FZ4 A;  2UZ8 A;  3HHV A;  2MMA A;  3F3R A;  3EMX A;  1SL0 B;  2FWG A;  2R4V A;  3DD3 A;  1FVJ A;  2I3Y A;  2VL3 A;  2HRA A;  1Z9H A;  1QQ2 A;  2HRK A;  4NMU A;  1WOU A;  5KN0 A;  3ED3 A;  3CSI A;  1U3I A;  3SBC A;  1Z7R A;  1RQM A;  2XBI A;  4G0I A;  5KOX A;  2FD3 A;  5ID2 B;  2JL4 A;  2IMD A;  2MYG A;  2H19 A;  1BG5 A;  1MDI A;  5D96 A;  4J56 E;  4PQH A;  2JAD A;  1QK8 A;  1IYH A;  1EP7 A;  3LXT A;  2VCT A;  3HXS A;  19GS A;  3W8S A;  2GQK A;  4JRR A;  1YF0 A;  2WGR A;  9GSS A;  1WMJ A;  2H01 A;  4KB3 A;  2YN1 A;  2P5Q A;  1GLQ A;  4K5R A;  1VGL A;  4E8E A;  6GSX A;  3R2Q A;  2NBS A;  3RDW A;  2WUL A;  1DBY A;  3GUR A;  4OO5 A;  4MF6 A;  1XIY A;  16GS A;  2RM6 A;  1T4Y A;  2WB9 A;  1PN0 A;  3CYN A;  2R2J A;  3EVI A;  1TRW A;  1URM A;  2OE0 A;  1BJX A;  1OC9 B;  2C3T A;  1T1V A;  1A2M A;  1YJ6 A;  4PUR A;  3LW9 A;  5IMA A;  3DGQ A;  2R6K A;  2FY6 A;  3VI5 A;  2FUG 2;  1PMT A;  5ABR A;  2LRC A;  4WF4 A;  1AUC A;  4GLT A;  1JFU A;  4MF7 A;  5KEJ A;  3GN3 A;  1X9W B;  5DVB A;  4PQI A;  2AAW A;  1MEK A;  1KTE A;  2OE3 A;  1SJ6 A;  4KAE A;  4WR4 A;  1XZO A;  2GZP A;  2R0G A;  1YEP A;  2RUE A;  4AGS A;  1OAZ A;  3FHK A;  1GUH A;  1A2L A;  4POL A;  2R5G A;  4ECC A;  1TI3 A;  1WRY A;  2PWJ A;  5DAK B;  2LNT A;  1QGV A;  3TOU A;  3DVX A;  1F9M A;  2YPM A;  3MDK A;  1ZYE A;  1WE0 A;  4CDO A;  4N0Z A;  4HI7 A;  1AQV A;  8GSS A;  4WET A;  3IOS A;  1EGR A;  1XWB A;  2FCH A;  4PUF C;  1G7E A;  3H79 A;  4TOP A;  4G0K A;  1VRS D;  1PX6 A;  4IW9 A;  1WJK A;  4K5S A;  5DJL A;  1ERV A;  3QD9 A;  3TJG A;  4YQM A;  1DE1 A;  5IOX A;  3UL3 A;  2V1M A;  3FK8 A;  4IS0 A;  4V1A g;  3Q74 A;  4HQZ A;  2REM A;  5L71 A;  1GH2 A;  2MZC A;  5E4W A;  2IWT A;  1KBN A;  1X5E A;  1AIU A;  4TRX A;  2QGV A;  2WFC A;  1PA3 A;  13GS A;  2E0Q A;  3U5R E;  4OMV A;  3ZIT A;  1THO A;  1SYR A;  2ZNM A;  4EDZ A;  2K8S A;  4TR1 A;  5AGY A;  1AQX A;  2K18 A;  2YCD A;  5ECO B;  2TRC P;  3EIN A;  1OC3 A;  2HRF A;  2VIM A;  4TXO B;  4XS4 B;  2PBJ A;  5IO2 A;  2CX3 A;  4ZL8 A;  2CT6 A;  4WBJ A;  4ILF A;  5KN1 A;  3GL3 A;  2DC5 A;  3M3M A;  2JZT A;  4RI6 A;  4IGJ A;  2R37 A;  3HVS A;  2GQL A;  2XBQ A;  4F9Z A;  2H6Y A;  3KP8 A;  5IMD A;  2V2G A;  2VLU A;  3ZYW A;  5AIX A;  1H75 A;  5E59 A;  1FO5 A;  2LTK A;  4HU7 A;  2GVP A;  3PH9 A;  5GAN D;  1SK2 A;  1Y6E A;  4F0B A;  2WZ9 A;  1GNE A;  1DUG A;  4MAB A;  1TOF A;  1EWX A;  1OYJ A;  2LQO A;  3V1W A;  1MD4 A;  1F3A A;  3ZVJ A;  3DYR A;  1M2A A;  1A24 A;  2RLI A;  5IMZ A;  1SU9 A;  4K1F A;  1SEN A;  2I4A A;  1T00 A;  3ME8 A;  4CHS A;  4LA1 A;  4LMV A;  2E2M A;  3HZ4 A;  3GKK A;  3UJ1 A;  1PN9 A;  1T3B A;  3PR8 A;  3I43 A;  2D2Z A;  4DSS A;  2LJR A;  1XWA A;  4ZB6 A;  4O5R A;  3LGC A;  5ECL B;  2I1U A;  3BD2 A;  2O87 A;  1AAZ A;  2ALB A;  4NHW A;  2P0G A;  4EIQ A;  3IXR A;  2VOC A;  2KOK A;  3M9J A;  5H5Q A;  4FO5 A;  2LRT A;  3EPT A;  3FZ9 A;  3ZIV A;  2H70 A;  2TRX A;  2C3Q A;  4MNN A;  4KF9 A;  5CYY A;  4AF2 A;  3WYW A;  2AYT A;  2GS3 A;  2J23 A;  2LUS A;  1SD9 A;  4LMW A;  4MJC A;  2K9F A;  1XFL A;  1FOV A;  4TR3 A;  1ZYN A;  3CBU A;  2A4H A;  2H6Z A;  4O32 A;  2N5B A;  3N9J A;  2O85 A;  3KP9 A;  3CTG A;  1F3B A;  2CVD A;  1FB6 A;  2IME A;  1SYX A;  4PNG A;  4BL7 B;  2DJ3 A;  3UBK A;  2BTO T;  2KP2 A;  2HI7 A;  1H4O A;  1OC8 A;  3APQ A;  3P2A A;  5G5F A;  5DJM A;  2H76 A;  3GX8 A;  4Q5F A;  2V6O A;  4TR0 A;  3DIE A;  3P7X A;  5CO3 A;  4GQC A;  5JCG A;  1PX7 A;  4MMM A;  1VF1 A;  4NAX A;  4HZ4 A;  1K3O A;  4QL7 A;  1R4W A;  3GHA A;  4IHU A;  3IAM 2;  4V2M A;  4KW6 A;  2BJX A;  4WF5 A;  3KTL A;  2PVO C;  1M7T A;  3F6F A;  3VPT A;  1MDJ A;  5ECS A;  1Z6N A;  3WT2 A;  2GTU A;  4ZBD A;  4KA0 A;  3DEX A;  1PQN A;  3HJM A;  4IP1 A;  2NVL A;  2YZU A;  3FMW A;  5DAL A;  3C1S A;  1PSQ A;  1X5D A;  5DDL A;  1GUL A;  5KN3 A;  3H8Q A;  1O81 A;  3BCI A;  2H1A A;  2DJJ A;  1UC7 A;  2DIY A;  1T4Z A;  2PUK C;  2JSY A;  3GKM A;  1K0C A;  2GSQ A;  1YZX A;  3IC8 A;  3TCO A;  2PU9 C;  3HD5 A;  2EIO A;  4WEY A;  4EE0 A;  1FB0 A;  2IMF A;  5DCH A;  2HFD A;  5G2Z A;  3O76 A;  2L5O A;  3Q19 A;  2C8U A;  4EL1 A;  3K8N A;  2C0E A;  1U6T A;  2MMZ A;  2HYX A;  4L5O A;  4V2L A;  1YEX A;  1Q98 A;  1DSB A;  1BED A;  1LBK A;  5HR0 A;  1IYI A;  4N11 A;  3HYP A;  1K0N A;  4FIW A;  2HZE A;  3ZML A;  4USS A;  4GF0 A;  3NIV A;  2H6X A;  5DQS A;  3KTB A;  1K0D A;  3IC4 A;  2R0P A;  5ECM B;  3IHG A;  4LL4 B;  4BWS A;  4PX1 A;  3KMO A;  2GST A;  2B1L A;  2ON7 A;  2V41 A;  1XPV A;  2B5Y A;  3QR6 A;  4POB A;  2YJ7 A;  2ZCT A;  1SJZ A;  3EC3 A;  4H86 A;  5INY A;  1FW1 A;  2I81 A;  4YAV A;  1ZMA A;  1OVN A;  4IQ1 A;  4ZB8 A;  2JAC A;  3IPZ A;  4TN8 A;  2GZY A;  3RPP A;  2HZF A;  1BQ7 A;  11GS A;  3LOR A;  4KUN A;  3US3 A;  2Z9S A;  5ENU A;  4O5Q A;  5CRH A;  3FEU A;  3P90 A;  4IVF A;  2VL2 A;  3EYT A;  2XC2 A;  5JWR B;  4ACS A;  3IBH A;  1GTB A;  1XW9 A;  1N8J A;  1WP0 A;  5JWO B;  4PXO A;  5B6N A;  3WT1 A;  2LNS A;  2VLT A;  3TKQ A;  2ON5 A;  4IKH A;  2F8F A;  5EPF A;  3IA1 A;  3KIJ A;  3A2V A;  3UAP A;  4CW9 A;  5HR2 A;  2FWE A;  1EP8 A;  4HEA 2;  1GWC A;  1I9D A;  2H1G A;  4MZC A;  4KDU A;  1ML6 A;  1GTI A;  3QPM A;  1TRV A;  2TIR A;  1J9B A;  4GSS A;  1OKT A;  3FR3 A;  3KCM A;  5F0G A;  4Z7X A;  4J2F A;  1AXD A;  3KD0 A;  3LFL A;  1WPI A;  1EEJ A;  2O89 A;  1B48 A;  3SWL A;  4EXJ A;  2C0D A;  3QFA C;  2GZZ A;  1ERT A;  2FA4 A;  6GST A;  3P8W A;  2X8H A;  2RM5 A;  1GSD A;  4MPG A;  1TDI A;  2B5X A;  3UBL A;  3FKF A;  3TJJ A;  4KSO A;  5HFI A;  4MK3 A;  3RHB A;  4YKG A;  3GV1 A;  2GQM A;  1T7P B;  4MH2 A;  4ZBB A;  5HQP A;  3A5I A;  2HNL A;  3KM6 A;  2NDO A;  3ZRE A;  1V58 A;  4TXV A;  1O8X A;  2EIR A;  2CV4 A;  1G6W A;  4GST A;  1TI1 A;  2YWI A;  1O85 A;  2CVB A;  4RUV A;  1SKS B;  4X0X A;  4ML6 A;  3VPQ A;  1XW5 A;  2A2S A;  3CTF A;  3S9F A;  4Q5Q A;  3F9U A;  3LG6 A;  2FHE A;  3FY7 A;  5IMF A;  5CRD A;  3D22 A;  2YOI A;  2V6K A;  2DKH A;  3A3T A;  2KUC A;  2H30 A;  3QFB C;  2B1K A;  2HSH A;  5IMV A;  1Q4J A;  4HDE A;  2H72 A;  5J9B A;  4EIP A;  1XXU A;  5EY6 A;  2FGX A;  2GSS A;  3G7I A;  4EKZ A;  2O8V B;  5CP1 A;  4XRA A;  1B4Q A;  4HS1 A;  4FYU A;  3TRP A;  3M0F A;  2R0C A;  3GYK A;  3F6D A;  2EIQ A;  4XIH A;  4ID0 A;  4KH7 A;  1G0T A;  5CRE A;  4ZXG A;  3GSS A;  1TU8 A;  1QFN A;  3QAV A;  1GNW A;  3BOA A;  4L0W A;  2FA8 A;  3BCK A;  1HD2 A;  2X8C A;  1V2A A;  5DAL B;  1G7O A;  4XS1 A;  1OE8 A;  5ECI B;  5G1L A;  1EV9 A;  4ZB9 A;  1BAY A;  3UVH A;  3D21 A;  2HSY A;  2H66 A;  6GSS A;  3WGE A;  4MJA A;  1FHE A;  3C73 A;  4F82 A;  1XW6 A;  3TJK A;  1AQW A;  3VFI A;  3ERF A;  3WD6 A;  3IE3 A;  1X5C A;  4GRF A;  5ECP B;  3D0Z A;  4ULX A;  1A0R P;  2N5F A;  2WS2 A;  4BA7 A;  5FWG A;  3GST A;  1BYE A;  2VL2 C;  4HJ2 A;  2JU5 A;  1ERU A;  1GUK A;  2OE1 A;  3TGZ A;  2IMK A;  3KH9 A;  3UEM A;  4KSM A;  1SK1 A;  3KMN A;  1NW2 A;  4DSQ A;  3GTU B;  4L8E A;  3O6T A;  1LU4 A;  4O92 A;  3NZN A;  2P31 A;  4G0L A;  1OE7 A;  1TJD A;  4EVM A;  1B8X A;  10GS A;  4MJE A;  2AV4 A;  2HZE B;  4ICY A;  5EVO A;  1GL8 A;  4XCS A;  1J08 A;  2OAC A;  5GAP D;  2LJK A;  4MP4 A;  3LSZ A;  4F0C A;  1SL2 B;  1XWK A;  3TKP A;  5J5N A;  1U87 A;  2VCZ A;  4N10 A;  3EE2 A;  1NM3 A;  2AB6 A;  4D73 B;  2CQ9 A;  3MIX A;  2VD0 A;  5ECH B;  3F8U A;  1ST9 A;  1GSE A;  1JLV A;  4HQS A;  4OWY A;  3VUR A;  2BMX A;  2XPE A;  2KLX A;  1ON4 A;  4GQF A;  2LKU A;  5DCG A;  3D6I A;  4TW5 A;  4PUA A;  1R5A A;  3GRX A;  1F2E A;  3J7Y k;  1JHB A;  1THX A;  4PTS A;  3DXB A;  4WBR D;  3L0H A;  3RBT A;  2IFQ A;  1Z6M A;  1GSS A;  1MDK A;  3MNG A;  3GA4 A;  4YQU A;  1M2B A;  1PGT A;  4HU9 A;  2DLX A;  3KEB A;  3M9K A;  2B3S A;  2LST A;  5IO0 A;  1S3C A;  4GCI A;  4A5P A;  2VAF A;  4XRD A;  3VWX A;  1HNC A;  3GIX A;  5ECN B;  5HFG A;  3HKR A;  2VCW A;  1V98 A;  2J9H A;  3TJF A;  4IP6 A;  4XHM A;  3ZZX A;  3VLN A;  1V9W A;  1GRX A;  1XCC A;  5D9X A;  1JLW A;  2LV3 A;  2MBT A;  2MMO A;  1PKW A;  4OFN A;  3EU3 A;  2DJ1 A;  3MSZ A;  1EOG A;  5CRW A;  1V40 A;  4ZL7 A;  3ERW A;  1J0F A;  4KCA A;  5COH A;  3D4M A;  1XVW A;  1I5G A;  5JCW A;  3BJ5 A;  5D9W A;  1HNB A;  1TP9 A;  17GS A;  2M72 A;  1JZO A;  4ECJ A;  2CA8 A;  5JCU A;  3I6A A;  4N30 A;  2NPB A;  1K0M A;  4X4J A;  2YWM A;  2C0F A;  3NOF A;  2X49 A;  1SD8 A;  3VWV A;  1PKZ A;  4Q5N A;  5FT3 A;  1Z5Y E;  1X0R A;  2HE3 A;  3KZQ A;  2DSA A;  5IPG A;  2IMI A;  5IPH A;  4WKW A;  3HVV A;  5H5S A;  2H71 A;  4IQA A;  5F8B A;  2X64 A;  4IEL A;  1G6Y A;  5LD0 A;  2HSM A;  1OC9 A;  2LQQ A;  1GSY A;  4G10 A;  3IK7 A;  3UAR A;  1YKC A;  4KDY A;  3N5O A;  3QCP A;  3UOM A;  2GDR A;  4K0G A;  1QUW A;  2QKE A;  4I2T A;  5HFK A;  1JZW A;  1F37 A;  2YWO A;  3GNJ A;  2C4J A;  4Z2U A;  2H0H A;  3IR4 A;  3ZFL A;  2VUP A;  3L9U A;  3CSH A;  3ZRD A;  4CY6 A;  3CXG A;  2G2Q A;  2OBI A;  2YV7 A;  1YY7 A;  2C80 A;  1YQ1 A;  2LS5 A;  3DRN A;  3GL5 A;  4IJ3 A;  3W8J A;  3LQ7 A;  4G2E A;  4Z2R A;  5J4U A;  1S3D A;  4ISD A;  4IJI A;  3W6G A;  2GT6 A;  7GSS A;  1YDK A;  4ZIJ A;  4K0N A;  3GKX A;  5DAK A;  5F06 A;  1E2Y A;  1LJR A;  4JR4 A;  3IAS 2;  3QDN A;  2XPD A;  3GMF A;  1K3Y A;  2DKI A;  4I6X A;  3L78 A;  1T8E B;  5LCZ A;  3RPN A;  1AW9 A;  2VCQ A;  3HVX A;  1VF3 A;  4RQX A;  3HJP A;  1FAA A;  18GS A;  2A2P A;  5IM9 A;  2GLR A;  2X99 A;  4BWQ A;  3ZTL A;  3H93 A;  3LJR A;  4BVX A;  2G0F A;  20GS A;  4KCE A;  4DVC A;  3TDG A;  4TR1 B;  3F4R A;  2YWN A;  1NSW A;  1B9Y C;  4ZIL A;  3OR5 A;  2RUF A;  4WXT A;  4HOJ A;  2H73 A;  5B6M A;  4YH2 A;  3MWH A;  1JZD A;  2L5L A;  3ZLP A;  2OKA A;  1Z7P A;  2H0I A;  5IQY A;  5LNK e;  5D73 A;  3RHC A;  4TKY A;  4TXO A;  1TKD B;  2NTO A;  5B7C A;  5JWQ B;  4NV5 A;  5G1K A;  1TK0 B;  5AIS A;  2DIZ A;  3UVT A;  2CZ3 A;  4KDX A;  2PPT A;  2WJU A;  1USB A;  3PGT A;  3HDC A;  4NHZ A;  5GZZ B;  3GH9 A;  3GFK A;  2H1D A;  2IFQ B;  1K3L A;  2PN8 A;  4DEJ A;  1GTA A;  2XHF A;  5AN1 A;  2WDU A;  3EWL A;  3TKS A;  1TK5 B;  3GH6 A;  4EDY A;  2H0G A;  1TRS A;  3L4N A;  1KNG A;  2FWH A;  2MMN A;  2C1Y A;  2X8G A;  3F0I A;  1GSU A;  4DSS B;  4TR4 A;  5G30 A;  1ZL9 A;  1NHY A;  4BVY A;  1A23 A;  4AJ8 A;  1W89 A;  2VCX A;  1ZGN A;  2VM1 A;  2CAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...