3ZRDA

Oxidised thiol peroxidase (tpx) from yersinia pseudotuberculosis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
174
structure length
174
Chain Sequence
QGIDPFTMTQTVHFQGNPVSVAGKLPQIGDKAKDFTLVAKDLSDVALSSFAGKRKVLNIFPSIDTGVCAASVRKFNQLAGELENTVVLCISSDLPFAQSRFCGAEGLSNVITLSTLRGADFKQAYGVAITEGPLAGLTARAVVVLDGQDNVIYSELVNEITTEPNYDAALAALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOL PEROXIDASE
publication title Structural Characterisation of Tpx from Yersinia Pseudotuberculosis Reveals Insights Into the Binding of Salicylidene Acylhydrazide Compounds.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
total genus 55
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zrdA00
3UEMA 2HZFA 1U3AA 2NPBA 2QGVA 5B8BA 2B5XA 3LXTA 2EC4A 1F3AA 4F82A 3FR3A 4ZBAA 2OE1A 3KGKA 2PVOC 3GH9A 1HNAA 1TTZA 2MBSA 4KSMA 3W8SA 2AJQB 4IP6A 3RPNA 4ZL9A 2DJ1A 3GTUB 3KJYA 3VWXA 2ZCTA 1GTIA 2IWTA 4TR1A 5F0GA 1TI1A 1JZOA 2WRTA 1PGTA 1G7EA 4F03A 1SKSB 1WE0A 2ON7A 2GT6A 4HU9A 4OO4A 2V2GA 1GUKA 5KN3A 4IGJA 4O7HA 1M0UA 3EWLA 1SKWB 2XPEA 3H93A 5G1LA 2IPAA 2IL3A 5LCZA 4F2IA 4CW9A 2H6XA 3ZFBA 1XWBA 1T00A 2C8UA 2A2SA 3IXRA 5JCGA 5HFKA 1GRXA 2VCZA 3ZMLA 3F8UA 4JU5A 1URMA 2KP2A 2L59A 2J23A 2H1GA 2OE0A 1Z5YE 1JZWA 2GVPA 4HEA2 5IM9A 2IMIA 2X8CA 1V2AA 4I2TA 4PNGA 2B5EA 3NOFA 1HQOA 4EDZA 4OFTA 2A2RA 2XC2A 2GT5A 1K0DA 1FOVA 1B4PA 3ZMKA 2YV9A 3IC4A 2AHEA 2HXKA 2OBIA 5D9VA 2FA4A 5D9WA 5DDLA 1U6TA 1TRWA 2LNSA 5G1KA 1VRSD 3DRNA 2PWJA 3ZITA 3QFBC 3ERGA 1OC8A 4LL1B 2NDOA 3ME8A 1VF1A 1XCCA 1K0MA 1ON4A 3IR4A 4ML1A 4EUYA 16GSA 4GRFA 2O7KA 5GAND 5CRHA 5J41A 5ECOB 1ERTA 1T3BA 2CAIA 2O85A 1E2YA 4L0UA 1PKWA 1O73A 4WR4A 5F06A 4HU7A 2VL2A 5HR0A 3DXBA 3GIXA 1AC1A 3DEXA 1BX9A 4MJBA 2E2MA 5EPFA 2OJLA 4ZXGA 6GSSA 4KSOA 4WF5A 1AIUA 2P0GA 3VLNA 4GQFA 3L78A 2DSAA 2C1YA 3WGXA 1SU9A 2CX3A 2VL9A 2IIYA 3F4SA 1R5AA 4Q5FA 3FR9A 4YQVA 5IPHA 1PX7A 1FVJA 1TU7A 2BMXA 1OVNA 4K8MA 3TB2A 1TK8B 4OFMA 4BVYA 1GNWA 4QL9A 1FAAA 4CDOA 4FIWA 3LEFA 1FVKA 3UAPA 1GSFA 2OKAA 4MZCA 2KP1A 3FY7A 3G7YA 2VLTA 4GCIA 5IPGA 3TKSE 3O6TA 5DBQA 1PD21 4DSSB 3IE3A 3UVTA 1H75A 4K2DA 4LMVA 1ML6A 2PUKC 4WEYA 5GSTA 2GSRA 4HQZA 1V58A 2H8LA 3WYWA 5KN1A 4XTSA 2LV3A 3F6DA 3IBHA 4DVCA 1F3BA 1A0FA 5CNWA 3I9V2 3E0UA 4NPBA 3FHKA 1JHBA 1XW9A 3PR8A 1DBYA 4AF2A 1AUCA 1Y6EA 4IELA 2DJ0A 3ZFLA 2H75A 5F8BA 3RHCA 4ISDA 3M8NA 3HY2A 1K3OA 3VPTA 2L5LA 4IHUA 6GSXA 1SD9A 4BWQA 2EIQA 5A4VA 4G2EA 2LJKA 4ID0A 2YZUA 3V1WA 1V57A 1QUWA 1SL2B 3UL3A 1X5CA 4MJCA 4JRRA 1EGOA 2B7KA 2TIRA 1T1VA 1MTCA 2QSIA 5A4WA 1KBNA 4EKZA 3KM6A 2A4VA 1M7TA 2X64A 1A2JA 1GSSA 1YY7A 2GSSA 3MWHA 5LD0A 3A5WA 2PN8A 1V9WA 1TP9A 2GQMA 1SL0B 3C73A 1NHYA 4K0GA 1A8YA 4IW9A 3HJOA 3OR5A 1QGVA 4ZBDA 4N0VA 3IDVA 4TXOB 2M72A 2CZ2A 2VLVA 4NHZA 2JL4A 5IMZA 2IMDA 4JE1A 4EL1A 4OWYA 2GSQA 5H5SA 4D73B 1Q98A 2WZ9A 4MF6A 3M0FA 4AGSA 1WMJA 2LRNA 3KCMA 3KP8A 3VI7A 4MPGA 2RM5A 5CREA 4TR4A 4NHWA 1XOBA 3DYRA 2GLRA 4HJMA 3CBUA 4GTUA 5LNKe 5HFIA 2JZSA 2E7PA 2HSYA 3QCPA 2LEGA 3LXZA 2NVLA 5ECNB 1AW9A 5FWGA 3GHAA 2FWHA 1AQXA 1Z6NA 1T8EB 5JWQB 1FB0A 3KEBA 4ZB6A 2CQ9A 3M9KA 4IS0A 3IHQA 4Z7XA 1R7HA 2C3TA 3P90A 2YWIA 1S3AA 5ECIB 3P2AA 1CQHA 1ZYQB 2LS5A 2PU9C 3DVXA 3GKNA 3WT1A 3FR6A 3UVHA 1NM3A 3HVXA 4L5LA 5HR3A 2K18A 2VCTA 4IQAA 1OKTA 4MLYA 2BTOT 5DALB 3RPPA 1XOAA 3QAWA 1C72A 2I81A 4HQSA 2B3SA 4L5OA 3LJRA 4V1Ag 3EVIA 2WFCA 2FWEA 1SJ6A 4I5QA 4I97A 1XIYA 3KH9A 2JZRA 4G19A 3CXGA 3IK9A 4KE3A 3HD5A 3M9JA 2LJAA 4DSRA 4ML6A 3VK9A 4XS4B 22GSA 2HRFA 3TOTA 3CTFA 5B7CA 2F3MA 1FG4A 2F9SA 1GLQA 3TKRA 4GXZA 1XFLA 4YQMA 1GTAA 3GA4A 4DEJA 2MBTA 2DJ3A 4OFNA 3CMIA 1DE1A 4PQ1A 1M2BA 1HD2A 2B1LA 4KCEA 5D96A 2O89A 4L0WA 2GTUA 1SK1A 1XWAA 2PPTA 1A23A 4KDUA 4HZ2A 2L4CA 1GH2A 1DSBA 2HNLA 1TXXA 3F63A 4IQ1A 3A3TA 2YJHA 5GZZB 2LUSA 1S3CA 5G30A 3ED3A 2V6KA 1MEKA 1GP1A 3BOAA 4XHMA 2H01A 2H6ZA 5ELGA 2XBIA 4ACSA 2C0FA 2R5GA 3RDWA 5IMVA 3D4MA 5F07A 3BCKA 3ZRDA 3GYKA 1YZXA 2HT9A 1GL8A 2GGTA 1GSEA 4ULXA 3KTBA 4EVMA 3FEUA 5D93A 4K1FA 4MF5A 5GSSA 2QKEA 4MABA 2R37A 4ECBA 1W4VA 4WR5A 1T7PB 3F0IA 5ID2A 3A2VA 4V2NA 3GX0A 4EXJA 1WPIA 5JCUA 4K7OA 4MDCA 1XVWA 1SL1B 3F3QA 11GSA 2CT6A 4KW6A 2PBJA 3ERWA 1JLWA 1GWCA 4ECCA 2KOKA 1OC3A 2LTKA 4K9ZA 1O81A 5DVBA 3CTGA 5DQYA 2VCVA 3TKSC 1EP7A 4YQUA 1VF3A 4N11A 4TW5A 2IFQA 2OADA 5KEJA 3H8QA 4P3YB 1USBA 3IPZA 4D73A 8GSSA 5HQPA 2I1UA 1Q4JA 2ALBA 1NW2A 4AJ6A 2H30A 4HI7A 2YWOA 3GUSA 1BAYA 1GUMA 2FUG2 3FZ4A 4JEDA 4ZB8A 5HR2A 3C1SA 2GZZA 3APSA 4XRAA 4XCSA 4K7IA 4IBPA 4I6XA 2E0QA 2HE3A 2VCWA 3LYPA 5AN1A 1JFUA 3QR6A 1XW5A 2G0FA 2IN3A 5C00A 5C04A 2KUCA 13GSA 5G5EA 7GSSA 1B9YC 5G5FA 3IOSA 5DAKA 3A2WA 1TK0B 2VD1A 2RUFA 2YJ7A 2PGTA 1OKDA 4L8EA 4MH3A 2DJJA 2KHPA 2H76A 1K0CA 1OE7A 1YEXA 1RW1A 5B8AA 1NSWA 4POBA 3VPQA 2CAQA 9GSSA 2FD3A 4GLTA 1DUGA 1THOA 2N5FA 1J08A 4WETA 1A2LA 4RI7A 3Q18A 3IA1A 1TKDB 4LL4B 5G31A 1Z7PA 3TGZA 5ECPB 4EO3A 4FYBA 4AJ8A 2F51A 3WGEA 5IQYA 1ZCPA 2GZPA 1GLPA 1VF2A 2P5RA 4H86A 4CHSA 4OMVA 2JADA 2WS2A 2AB6A 3ZTLA 5CAXA 1UN2A 1SK0A 5IIZA 3TJJA 1O8WA 4AJ7A 1TRVA 3IK7A 3GMFA 1PMTA 3IAM2 2VUPA 3RHBA 3A2XA 1N8JA 1JZDA 3ERFA 3DKSA 3L4NA 1GSUA 1YF0A 2VCQA 4YAVA 4XS1A 2FHEA 3HXSA 2B6MA 1Z3EA 3QD9A 2V1MA 1EZKA 2H72A 3GRXA 4MCUA 2H74A 2YANA 3I43A 3GSSA 3ZL5A 3L9SA 3LSZA 1SYXA 1TI3A 3TKQA 2VOCA 3F4TA 3UOMA 4POMA 3F3RA 1B4QA 2RIIA 4PURA 1KTEA 4BVXA 1YDKA 2AV4A 4K0NA 3EMXA 3ME7A 2HI7A 4GSTA 1FB6A 2O8VB 1K0BA 3FZAA 2F8AA 2YV7A 5ECHB 1BEDA 5E59A 5IOWA 1OAZA 3HJPA 2VM1A 1GUHA 6GSTA 4QL7A 1R4WA 2LKUA 3I6AA 1EGRA 1X5EA 1PX6A 2LSTA 4KA0A 5B6NA 4J2FA 2DIZA 1NHOA 2L6CA 2WDUA 1MDIA 2V32A 3U6VA 2FWFA 2WGRA 2TRXA 3GTUA 1EP8A 1TJDA 2H70A 1XPVA 2FCHA 5HFGA 1J0FA 2MMOA 1SD8A 1LJRA 1MDKA 2V41A 3KIJA 5AGYA 3ZYWA 3RBTA 4ILFA 3LG6A 2I9HA 2C80A 1WOUA 4KNDA 5KN2A 1TOFA 4X1UA 3TKPA 4RUVA 4MP4A 3D4TA 3VURA 4ZBBA 3VFIA 1FO5A 3NIVA 1ZOFA 1WRYA 3HYPA 1GULA 3M1GA 2R2JA 3D5JA 1BQ7A 5DQSA 3TRPA 3UBKA 1TW9A 1UC7A 3VWUA 2MMAA 5J9BA 2WCIA 17GSA 2BJXA 1A8LA 2B1KA 3TRQA 1A24A 2H66A 5AIXA 1ERUA 1ZZYA 1O6JA 1TRSA 2I3YA 5L71A 5HR1A 3D0ZA 2C0DA 4MF7A 1AXDA 5CRDA 1IYHA 2HZEB 3WGDA 3C71A 3LFLA 3HCZA 2FNOA 2VCXA 1A2MA 1K0OA 1X9WB 1W89A 3CRTA 4IN0A 4LA1A 3TDGA 5CRGA 3TJFA 4ZL8A 5IOXA 1ERVA 1BJXA 4PX1A 2DIYA 4TXVA 4RQXA 3NZNA 4F0CA 1TU8A 5ECLB 1GSYA 5D8IA 1H4OA 2DMLA 1SJIA 14GSA 1MD3A 5ABRA 2CX4A 4EDYA 3EC3A 5A4UA 3KH7A 4JR4A 2RM6A 3H4KA 3N5OA 3ZVJD 4F9ZA 3G9BA 3L9UA 5G2ZA 1YKCA 4V1Ap 1EEMA 1XVQA 3HA9A 1SK2A 2RLIA 2TRCP 3HVVA 1XZOA 1EWXA 4MMMA 1YJ6A 1XWGA 3EU4A 3H79A 4IP1A 5DJLA 3TJBA 4G10A 2HFDA 2AYTA 3GL3A 5F05A 3J7Yk 2R6KA 2Z9SA 3E3EA 2C0EA 5DCHA 2IMKA 2DC5A 5IO2A 2CVBA 4KUNA 3F4RA 5D73A 3QFAC 6GSYA 4XRDA 1YKAA 2H1AA 1HNBA 2YOIA 2D2ZA 1XBSA 2C0GA 1X9SB 4JZQA 4MA9A 2OE3A 3BBYA 1AAZA 3P7XA 1R5PA 4PXOA 4DSSA 4V2MA 1FW1A 3F6FA 3GH6A 3APOA 2DLXA 1O85A 1V40A 2JACA 5EVOA 1EEJA 1XXUA 3GFKA 4OCFA 1Y25A 3CRUA 4FYCA 3GKKA 3W6GA 2CV4A 1YF1A 4X0XA 3DD3A 1UVZA 4NV2A 1WIKA 3VWVA 2H19A 4V2LA 4TOPA 3KD0A 1SYRA 2K8SA 1HNCA 1ILOA 3PGTA 3APQA 3BD2A 5ECMB 4HDEA 4XS6A 2LRTA 4PNFA 19GSA 3DWVA 4HJ2A 4PUAA 4YAPA 2DMMA 3EU3A 4Q5QA 1THXA 4NMUA 2H1BA 2LJRA 1VGLA 4IVFA 3MSZA 5ENUA 1QMVA 2GSTA 3TRXA 2K6VA 2YZHA 2P5QA 2WULA 2VAFA 5CRWA 1DE2A 2YP6A 4MZBA 2WJUA 1I9DA 3ZREA 1EV4A 1EOHA 4MK3A 2OBKA 5DJMA 4BPYA 4ZL7A 4N0ZA 1F9MA 4MPFA 1F37A 1F6MC 4J56E 2HYXA 2O87A 2L6DA 1E6BA 3P8WA 4RQRA 5B6MA 3BJ5A 2RUEA 2HZEA 4POLA 2EIRA 1SJZA 3QAGA 1O7UA 4TXOA 2V6OA 3KMNA 3O76A 1QQ2A 3RAZA 1PSQA 4E8HA 3ZZXA 3D6IA 4WBRD 4EE0A 4OO5A 4GQCA 4PQHA 2VL2C 3G7JA 4WXTA 3QMXA 1PN9A 4E8EA 2XHFA 4N30A 1KEBA 4I8BA 2CVKA 4WBJA 1X0RA 2AAWA 4G9HA 2GQLA 3K8NA 3VWWA 1S3DA 5EY6A 2MMZA 2DJ2A 2FY6A 1X5DA 3FZ5A 1XW6A 2L4QA 3IRAA 1K3LA 4TRXA 4BA7A 1GTUA 1JLVA 2FLSA 2H73A 3HKRA 3ISOA 4EC0A 4MJAA 1M2DA 2C3QA 4TR3A 3L0HA 2IMFA 3HDCA 1B48A 3IAS2 3GV1A 1ST9A 2YN1A 2ON5A 1T4YA 4TR0A 2GZYA 1T4ZA 3ZVJA 1YEPA 1TK5B 1VF4A 2LRCA 3LWAA 5JWRB 4NWYA 5INYA 3C7MA 3GURA 5IO0A 4PUFC 2VM2A 5DALA 4MZWA 1PL2A 1ERWA 3M3MA 2LQOA 1WJKA 2GS3A 3EYTA 2VLUA 5E4WA 3DIEA 2PERA 3GL5A 3LYKA 4ECJA 2H0IA 5ELAA 1QXHA 3J7Yb 3DVWA 2DJKA 2MYGA 2C4JA 2LQQA 3LORA 4NAXA 4XIHA 4K7NA 1U87A 4XS4A 3KMOA 4ECIA 6GSUA 2YWNA 1ABAA 5IMCA 2NBSA 5ECKB 4FYUA 5GAPD 3MAKA 2H6YA 1IYIA 1PA3A 2P31A 1MDJA 4KH7A 3TKSA 18GSA 1U3IA 3SWLA 4DSQA 2XBQA 4GSNA 2JU5A 4NXIA 2F8FA 4KDYA 2CA8A 4IJ3A 4MH2A 1X9MB 3F9UA 3KTLA 4GWRA 5IMFA 5AIVA 5IMAA 3D21A 3EINA 3E9JB 2OACA 3C1RA 5J4UA 1OC9B 3GSTA 3EMPA 3Q74A 3IV4A 2VO4A 1PL1A 1GTBA 1TDIA 4POKA 3DGQA 3GNJA 4KAEA 2IJYA 4GSSA 4JR6A 1ACVA 3QAVA 1CQGA 4WKWA 3GX8A 1K0AA 3Q19A 3MNGA 5ECRB 2ES7A 2YWMA 1HYUA 2ZUPA 2J9HA 1RQMA 1RK4A 3VI5A 3FYGA 1XWCA 5H5QA 10GSA 4I2UA 1V98A 1G6YA 2R3XA 2MMNA 4O32A 3HZ8A 3HHVA 4PQIA 3GN3A 1XWKA 4IJIA 5COHA 3TJGA 5FT3A 2L5OA 5AISA 3US3A 1R26A 5CP1A 1LU4A 1O8XA 3D22A 1B8XA 1OYJA 3L9VA 3UJ1A 2E2GA 4BWSA 1UA5A 2I4AA 5D9XA 1BYEA 2HRNA 1M9BA 4MJEA 4ZILA 1WP0A 2N5AA 3GKMA 4LLRA 3W8JA 5CYYA 3U5RE 1Z7RA 4KX4A 2FA8A 5H5RA 5J9CA 2JZTA 1F2EA 2H71A 1FHEA 1K3YA 2H1DA 2H0HA 3ZLPA 3GKXA 2C3NA 2GQKA 3UMAA 3FW2A 5KN0A 1WWJA 2M80A 1JZRA 4FO5A 3FRCA 3EURA 2EIOA 4FH8A 1ZL9A 5ID2B 20GSA 3AY8A 2XPDA 2FGXA 1M9AA 4HUAA 3UARA 2R4VA 5IMDA 4O5RA 1Z9HA 3I69A 1YQ1A 4NV5A 5CO3A 3QOUA 3TCOA 3FK8A 1PQNA 4TR1B 3MDKA 1J9BA 1U88A 4X43A 4Q5RA 5D9TA 1ZYEA 2B7JA 3JCML 2IFQB 2WB9A 4GF0A 1OE8A 2YPMA 2GDRA 2G2QA 3LGCA 2PMTA 3SBCA 3C8EA 5JWOB 6GSVA 4IKHA 2X99A 3QPMA 3KZQA 1AQWA 3CSHA 5ECSA 3ZIJA 4PGTA 2VL3A 5J5NA 1QFNA 3Q6OA 2VD0A 3PINA 3HVSA 4RI6A 4OCEA 3CYNA 4O92A 1MD4A 5A5KA 5JCWA 1EOGA 2ZNMA 3TOUA 1G0TA 3HZ4A 2HSHA 3H1NA 3N9JA 2IMEA 5EL8A 4KB3A 5J3RA 3DMLA 1SKRB 2PVQA 2L57A 4HOJA 1K0NA 2KLXA 1I5GA 1PKZA 3UIWA 2AUVA 3WD6A 1OC9A 5DAKB 1B9XC 1GSQA 1GSDA 2MZCA 2YCDA 3LQ7A 3BCIA 1TRUA 2NTOA 2LNTA 4TKYA 1QK8A 3FKFA 3HJMA 1G6WA 1LBKA 1ZGNA 2OA7A 1N2AA 3CSJA 4KCAA 2VIMA 4KGIA 3O3TA 2HLSA 4BL7A 2X8GA 2CVDA 3G7IA 3KXOA 3WT2A 3R2QA 4YH2A 2K8VA 1AQVA 4HZ4A 2H0GA 5DCGA 4K6XA 4ZB9A 3KP9A 1SENA 1KNGA 4LMWA 12GSA 1G7OA 4F0BA 3TJKA 1GNEA 4ZIJA 4EF0A 4OD7A 1M99A 1PRXA 3S9FA 1Z6MA 2FWGA 3TUEA 2REMA 1A0RP 3ZIVA 1ZMAA 2K9FA 4TN8A 4TVEA 2JSZA 2X8HA 3PH9A 3FZ9A 5ECQB 2DBCA 3CSIA 4WF4A 6GSWA 2B5YA 3UBLA 1BG5A 1M2AA 4KDXA 2N5BA 4QQ7A 4Q5NA 1EV9A 2CZ3A 5FHIA 2YNXA 4J57E 2QC7A 2JSYA 3EE2A 2M46A 4HS1A 4N10A 4JBBA 3QDNA
chains in the Genus database with same CATH superfamily
3UEMA 2HZFA 1U3AA 2NPBA 2QGVA 5B8BA 2B5XA 3LXTA 2EC4A 1F3AA 4F82A 3FR3A 4ZBAA 2OE1A 3KGKA 2PVOC 3GH9A 1HNAA 1TTZA 2MBSA 4KSMA 3W8SA 2AJQB 4IP6A 3RPNA 4ZL9A 2DJ1A 3GTUB 3KJYA 3VWXA 2ZCTA 1GTIA 2IWTA 4TR1A 5F0GA 1TI1A 1JZOA 2WRTA 1PGTA 1G7EA 4F03A 1SKSB 1WE0A 2ON7A 2GT6A 4HU9A 4OO4A 2V2GA 1GUKA 2HRAA 5KN3A 4IGJA 4O7HA 1M0UA 3EWLA 1SKWB 2XPEA 3H93A 5G1LA 2IPAA 2IL3A 5LCZA 4F2IA 4CW9A 2H6XA 3A5IA 3ZFBA 1XWBA 1T00A 2C8UA 2A2SA 3IXRA 5JCGA 5HFKA 1GRXA 2VCZA 3ZMLA 3F8UA 4JU5A 1URMA 2KP2A 2A2PA 4EIQA 2L59A 2J23A 2H1GA 2OE0A 1Z5YE 1JZWA 2GVPA 4HEA2 5IM9A 2IMIA 2X8CA 1V2AA 4I2TA 4PNGA 2B5EA 3NOFA 1HQOA 4EDZA 4OFTA 2A2RA 2XC2A 2GT5A 1K0DA 1FOVA 1B4PA 3ZMKA 2YV9A 3IC4A 2AHEA 2HXKA 2OBIA 5D9VA 2FA4A 5D9WA 5DDLA 1U6TA 1TRWA 2LNSA 1FOHA 5G1KA 1VRSD 3DRNA 2PWJA 3ZITA 3QFBC 3ERGA 2X4AA 2R0PA 1OC8A 4LL1B 2NDOA 3ME8A 1VF1A 1XCCA 1K0MA 1ON4A 3IR4A 4ML1A 4EUYA 16GSA 4GRFA 2O7KA 5GAND 5CRHA 5J41A 5ECOB 1ERTA 1T3BA 2CAIA 2O85A 1E2YA 4L0UA 1PKWA 1O73A 4WR4A 5F06A 4HU7A 2VL2A 5HR0A 3DXBA 3GIXA 1AC1A 3DEXA 1BX9A 4MJBA 2E2MA 5EPFA 2OJLA 4ZXGA 6GSSA 4KSOA 4WF5A 1AIUA 2P0GA 3VLNA 4BIKA 4GQFA 3L78A 2DSAA 2C1YA 3WGXA 1SU9A 2CX3A 2VL9A 2QA1A 2IIYA 3F4SA 1R5AA 4Q5FA 3FR9A 4YQVA 5IPHA 1PX7A 1FVJA 1TU7A 2BMXA 1OVNA 4K8MA 3TB2A 1TK8B 4OFMA 4BVYA 1GNWA 4QL9A 1FAAA 4CDOA 4FIWA 3LEFA 1FVKA 3UAPA 1GSFA 2OKAA 4MZCA 2KP1A 3FY7A 3G7YA 2VLTA 4GCIA 5IPGA 3TKSE 3O6TA 1ZYPA 5DBQA 1PD21 4DSSB 3IE3A 3UVTA 1H75A 4K2DA 4LMVA 1ML6A 2PUKC 4WEYA 5GSTA 2GSRA 4HQZA 1V58A 2H8LA 3WYWA 5KN1A 4XTSA 2LV3A 3F6DA 3IBHA 4DVCA 1F3BA 1A0FA 5CNWA 3I9V2 3E0UA 4NPBA 3FHKA 1JHBA 4G0LA 1XW9A 3PR8A 1DBYA 4AF2A 1AUCA 1Y6EA 1M3JA 4IELA 2DJ0A 3ZFLA 2HSMA 2H75A 5F8BA 3RHCA 3HVNA 4ISDA 3M8NA 3HY2A 1K3OA 3VPTA 2L5LA 4IHUA 6GSXA 1SD9A 4BWQA 2EIQA 5A4VA 4G2EA 2LJKA 4ID0A 2YZUA 4ICYA 3V1WA 1V57A 3PPUA 1QUWA 1SL2B 3UL3A 1X5CA 4MJCA 4JRRA 1EGOA 4EIPA 2B7KA 2TIRA 1T1VA 1MTCA 2QSIA 5A4WA 1KBNA 4EKZA 3KM6A 2A4VA 1M7TA 2X64A 1A2JA 1GSSA 1YY7A 2GSSA 3MWHA 5LD0A 3A5WA 2PN8A 1V9WA 1TP9A 4FQUA 2GQMA 1SL0B 3C73A 1NHYA 4K0GA 1A8YA 4IW9A 3HJOA 3OR5A 1QGVA 4ZBDA 4N0VA 1XG8A 3IDVA 4TXOB 2M72A 2CZ2A 2VLVA 4NHZA 2JL4A 5IMZA 2IMDA 4JE1A 4EL1A 4OWYA 2GSQA 5H5SA 4D73B 1Q98A 2WZ9A 5KOWA 4MF6A 3M0FA 4AGSA 1WMJA 2LRNA 3KCMA 3KP8A 3VI7A 4MPGA 2RM5A 5CREA 4TR4A 4NHWA 1XOBA 3DYRA 2GLRA 4HJMA 3CBUA 4GTUA 5LNKe 5HFIA 2JZSA 2E7PA 2HSYA 3QCPA 2LEGA 3LXZA 2NVLA 5ECNB 1AW9A 5FWGA 3GHAA 2FWHA 1AQXA 1Z6NA 1T8EB 5JWQB 1FB0A 3KEBA 4ZB6A 2CQ9A 3M9KA 4IS0A 3IHQA 4Z7XA 1R7HA 2C3TA 3P90A 2YWIA 1S3AA 5ECIB 3P2AA 1CQHA 1ZYQB 2LS5A 2PU9C 3DVXA 3GKNA 3WT1A 3FR6A 3UVHA 1NM3A 3HVXA 4L5LA 5HR3A 2K18A 2VCTA 4IQAA 1OKTA 4MLYA 2BTOT 5DALB 3RPPA 1XOAA 3QAWA 1C72A 2I81A 4HQSA 2B3SA 4L5OA 3LJRA 4V1Ag 3EVIA 2WFCA 2FWEA 1SJ6A 4I5QA 4I97A 1XIYA 3KH9A 2JZRA 4G19A 3CXGA 3IK9A 4KE3A 3MYDA 3HD5A 3M9JA 2LJAA 4DSRA 4ML6A 3VK9A 4XS4B 22GSA 2HRFA 3TOTA 3CTFA 5B7CA 2F3MA 1FG4A 2F9SA 1GLQA 2A4HA 3TKRA 4GXZA 1XFLA 4YQMA 1GTAA 3GA4A 4DEJA 2MBTA 2DJ3A 4OFNA 4HSCX 3CMIA 1DE1A 4PQ1A 1M2BA 1HD2A 2B1LA 4KCEA 3LW9A 5D96A 2O89A 4L0WA 2GTUA 1SK1A 1XWAA 2PPTA 1A23A 4KDUA 4HZ2A 2L4CA 1GH2A 1DSBA 2HNLA 1TXXA 3F63A 4IQ1A 3A3TA 2YJHA 5GZZB 2LUSA 1S3CA 5G30A 3ED3A 2V6KA 1MEKA 1GP1A 3BOAA 4XHMA 2H01A 2H6ZA 5ELGA 2XBIA 4ACSA 2C0FA 2R5GA 4Z2UA 3CQFA 3RDWA 5IMVA 3D4MA 5F07A 3BCKA 3ZRDA 3GYKA 1YZXA 2HT9A 1GL8A 3IHGA 2GGTA 1GSEA 4ULXA 3KTBA 4EVMA 3FEUA 5D93A 4K1FA 4MF5A 5GSSA 2QKEA 4MABA 2R37A 4ECBA 1W4VA 4WR5A 2QA2A 1T7PB 3F0IA 5ID2A 3A2VA 4V2NA 3GX0A 4EXJA 1WPIA 5JCUA 4K7OA 4MDCA 1XVWA 1SL1B 3F3QA 11GSA 2CT6A 4KW6A 2PBJA 3ERWA 1JLWA 1GWCA 4ECCA 2KOKA 1OC3A 2LTKA 4K9ZA 1O81A 5DVBA 3CTGA 5DQYA 2VCVA 3TKSC 1EP7A 4YQUA 1VF3A 4N11A 4TW5A 2IFQA 2OADA 5KEJA 3H8QA 4P3YB 1USBA 3IPZA 4D73A 8GSSA 5HQPA 2I1UA 1Q4JA 2ALBA 1NW2A 4AJ6A 2H30A 4HI7A 4O5UA 2YWOA 3GUSA 1BAYA 1GUMA 2FUG2 3FZ4A 4JEDA 4ZB8A 5HR2A 3C1SA 2GZZA 3APSA 4XRAA 4XCSA 4K7IA 4IBPA 4I6XA 2E0QA 2HE3A 2VCWA 3LYPA 5AN1A 1JFUA 3QR6A 1XW5A 2G0FA 2IN3A 4K5RA 5C00A 5C04A 2KUCA 13GSA 5G5EA 7GSSA 1B9YC 5G5FA 3IOSA 5DAKA 3A2WA 1TK0B 2VD1A 2RUFA 2YJ7A 2PGTA 1OKDA 4L8EA 4MH3A 2DJJA 2KHPA 2H76A 1K0CA 1OE7A 1YEXA 1RW1A 5B8AA 1NSWA 4POBA 3VPQA 2CAQA 9GSSA 2FD3A 4GLTA 1DUGA 1THOA 2N5FA 1J08A 4G0KA 4K2XA 4WETA 1A2LA 4RI7A 3Q18A 3IA1A 1TKDB 4LL4B 5G31A 1Z7PA 3TGZA 5ECPB 4EO3A 4FYBA 4AJ8A 2F51A 3WGEA 5IQYA 1ZCPA 2GZPA 1GLPA 1VF2A 2P5RA 4CY8A 4H86A 4CHSA 4OMVA 2JADA 2WS2A 2AB6A 3ZTLA 5CAXA 1UN2A 1SK0A 5IIZA 3TJJA 1O8WA 4AJ7A 1TRVA 3IK7A 3GMFA 1PMTA 3IAM2 2VUPA 3RHBA 3A2XA 1N8JA 1JZDA 3ERFA 3DKSA 3L4NA 1GSUA 1YF0A 2VCQA 4YAVA 4XS1A 5BRTA 2FHEA 3HXSA 2B6MA 1Z3EA 3QD9A 2V1MA 1EZKA 2H72A 3GRXA 4MCUA 2H74A 2YANA 3I43A 3GSSA 3ZL5A 3L9SA 3LSZA 1SYXA 1TI3A 3TKQA 2VOCA 3F4TA 3UOMA 4POMA 3F3RA 1B4QA 2RIIA 4PURA 1KTEA 4BVXA 1YDKA 2AV4A 4K0NA 4YKFA 3EMXA 3ME7A 2HI7A 4GSTA 1FB6A 2O8VB 1K0BA 3FZAA 2F8AA 2YV7A 4BL7B 5ECHB 1BEDA 5E59A 5IOWA 1OAZA 3HJPA 2VM1A 1GUHA 6GSTA 4QL7A 1R4WA 2LKUA 3I6AA 1EGRA 1X5EA 1PX6A 2LSTA 4KA0A 5B6NA 3MIXA 4J2FA 2DIZA 1NHOA 2L6CA 2WDUA 1MDIA 2V32A 3U6VA 2FWFA 2WGRA 2TRXA 3GTUA 1EP8A 1TJDA 2R0GA 2H70A 1XPVA 2FCHA 5HFGA 1J0FA 2MMOA 1SD8A 1LJRA 1MDKA 2V41A 3KIJA 5AGYA 3ZYWA 3RBTA 4ILFA 3LG6A 2I9HA 2C80A 1WOUA 4KNDA 5KN2A 1TOFA 4X1UA 3TKPA 4RUVA 4MP4A 3D4TA 3VURA 4ZBBA 3VFIA 1FO5A 3NIVA 1ZOFA 1WRYA 3HYPA 1GULA 3M1GA 2R2JA 3D5JA 1BQ7A 5DQSA 3TRPA 3UBKA 1TW9A 1UC7A 3VWUA 2MMAA 5J9BA 2WCIA 17GSA 2BJXA 1A8LA 2B1KA 3TRQA 1A24A 2H66A 5AIXA 1ERUA 1ZZYA 1O6JA 1TRSA 2I3YA 5L71A 5HR1A 3D0ZA 2C0DA 4MF7A 1AXDA 5CRDA 1IYHA 2HZEB 3WGDA 3C71A 3LFLA 2DKHA 3HCZA 2FNOA 2VCXA 1A2MA 1K0OA 1X9WB 1W89A 3CRTA 4IN0A 4LA1A 3TDGA 5CRGA 3TJFA 4ZL8A 5IOXA 1ERVA 1BJXA 4PX1A 2DIYA 4TXVA 4RQXA 3NZNA 4F0CA 1TU8A 5ECLB 1GSYA 5D8IA 1H4OA 2DMLA 1SJIA 14GSA 1MD3A 5ABRA 2CX4A 4EDYA 3EC3A 5A4UA 3KH7A 4JR4A 2RM6A 3H4KA 3N5OA 3ZVJD 4F9ZA 3G9BA 3L9UA 5G2ZA 1YKCA 4V1Ap 1EEMA 1XVQA 3HA9A 1SK2A 2RLIA 2TRCP 3HVVA 1XZOA 2DKIA 1EWXA 4MMMA 1YJ6A 1XWGA 3EU4A 3H79A 4IP1A 5DJLA 2UZ8A 3TJBA 4G10A 2HFDA 2AYTA 3GL3A 5F05A 4X4JA 3J7Yk 2R6KA 2Z9SA 3E3EA 2C0EA 5DCHA 2IMKA 2DC5A 5IO2A 2CVBA 4KUNA 3F4RA 4KF9A 5D73A 3QFAC 6GSYA 4XRDA 1YKAA 2H1AA 1HNBA 1PFOA 2YOIA 2D2ZA 1XBSA 2C0GA 1X9SB 4JZQA 4MA9A 2OE3A 3BBYA 1AAZA 3P7XA 1R5PA 4PXOA 4DSSA 4V2MA 1FW1A 3F6FA 3GH6A 3APOA 3IC8A 4USSA 2DLXA 1O85A 1V40A 2JACA 5EVOA 1EEJA 1XXUA 3GFKA 4OCFA 1Y25A 3CRUA 4FYCA 3GKKA 3W6GA 2CV4A 1YF1A 4X0XA 3DD3A 1UVZA 4NV2A 1WIKA 3VWVA 2H19A 4V2LA 4TOPA 3KD0A 1SYRA 2K8SA 1HNCA 1ILOA 3PGTA 3APQA 3BD2A 5ECMB 4HDEA 4XS6A 2LRTA 4PNFA 19GSA 3DWVA 4HJ2A 4PUAA 4YAPA 2DMMA 3EU3A 4Q5QA 1THXA 4NMUA 2H1BA 2LJRA 1VGLA 4IVFA 3MSZA 5ENUA 1QMVA 2GSTA 3TRXA 2K6VA 2YZHA 2P5QA 2WULA 2VAFA 5CRWA 1DE2A 2YP6A 4BVYB 4MZBA 2WJUA 1I9DA 3ZREA 1EV4A 1EOHA 4MK3A 2OBKA 5DJMA 4BPYA 4ZL7A 4N0ZA 1F9MA 4MPFA 1F37A 1F6MC 4J56E 2HYXA 2O87A 2L6DA 1E6BA 3P8WA 4RQRA 5B6MA 3BJ5A 2RUEA 2HZEA 4POLA 2EIRA 1SJZA 3QAGA 1O7UA 4TXOA 2V6OA 3KMNA 3O76A 1QQ2A 3RAZA 1PSQA 4E8HA 4MNNA 3ZZXA 3D6IA 4WBRD 4EE0A 4OO5A 4GQCA 4PQHA 2VL2C 3G7JA 4WXTA 3QMXA 1PN9A 4E8EA 2XHFA 4N30A 1KEBA 4I8BA 2CVKA 4WBJA 1X0RA 2AAWA 4G9HA 2GQLA 3K8NA 3VWWA 1S3DA 5EY6A 2MMZA 2DJ2A 2FY6A 3FMWA 1X5DA 3FZ5A 1XW6A 2L4QA 3IRAA 1K3LA 4TRXA 4BA7A 1GTUA 1JLVA 2FLSA 2H73A 3HKRA 3ISOA 4EC0A 4MJAA 1M2DA 2C3QA 4TR3A 3L0HA 2IMFA 3HDCA 1B48A 3IAS2 3GV1A 1ST9A 2YN1A 2ON5A 1T4YA 4TR0A 2GZYA 1T4ZA 3ZVJA 1YEPA 1TK5B 1VF4A 2LRCA 3LWAA 5JWRB 4NWYA 5INYA 3C7MA 3GURA 5IO0A 4PUFC 2VM2A 5DALA 4MZWA 1PL2A 1ERWA 3M3MA 2LQOA 1WJKA 2GS3A 3EYTA 2VLUA 5E4WA 3DIEA 2PERA 3GL5A 3LYKA 4ECJA 2H0IA 5ELAA 1QXHA 3J7Yb 3DVWA 2DJKA 2MYGA 2C4JA 2LQQA 3LORA 4NAXA 4XIHA 4K7NA 1U87A 5KOXA 4XS4A 3KMOA 4CY6A 4ECIA 6GSUA 2YWNA 1ABAA 5IMCA 2NBSA 5ECKB 4FYUA 5GAPD 3MAKA 2H6YA 1IYIA 1PA3A 2P31A 2HRKA 3EPTA 1MDJA 4KH7A 3TKSA 18GSA 1U3IA 3SWLA 4DSQA 2XBQA 4GSNA 2JU5A 4NXIA 2F8FA 4KDYA 2CA8A 4IJ3A 4MH2A 1X9MB 3F9UA 3KTLA 4GWRA 5IMFA 5AIVA 5IMAA 3D21A 3EINA 3E9JB 2OACA 3C1RA 1M3IA 5J4UA 1OC9B 3GSTA 3EMPA 3Q74A 3IV4A 2VO4A 1PL1A 1GTBA 1TDIA 4POKA 3DGQA 3GNJA 4KAEA 2IJYA 4GSSA 4JR6A 1ACVA 3QAVA 1CQGA 4WKWA 3GX8A 1K0AA 1PN0A 4YKGA 3Q19A 3MNGA 5ECRB 2ES7A 2YWMA 1HYUA 2ZUPA 2J9HA 1RQMA 1RK4A 3VI5A 3FYGA 1XWCA 5H5QA 10GSA 4I2UA 1V98A 1G6YA 2R3XA 2MMNA 4O32A 3HZ8A 2X49A 3HHVA 4PQIA 3GN3A 1XWKA 4IJIA 5COHA 3TJGA 5FT3A 2L5OA 5AISA 3US3A 1R26A 5CP1A 1LU4A 1O8XA 3D22A 1B8XA 1OYJA 3L9VA 3UJ1A 2E2GA 4BWSA 1UA5A 2I4AA 5D9XA 1BYEA 2HRNA 1M9BA 4MJEA 4ZILA 1WP0A 2N5AA 3GKMA 4LLRA 3W8JA 5CYYA 3U5RE 1Z7RA 4KX4A 2FA8A 5H5RA 5J9CA 2JZTA 1F2EA 2H71A 1FHEA 1K3YA 2H1DA 2H0HA 3ZLPA 3GKXA 2C3NA 2GQKA 3UMAA 3FW2A 5KN0A 1WWJA 2M80A 1JZRA 4FO5A 3FRCA 3EURA 2EIOA 4FH8A 1ZL9A 5ID2B 20GSA 3AY8A 2XPDA 4K5SA 2FGXA 1M9AA 4HUAA 3UARA 2R4VA 5IMDA 4G0IA 4O5RA 1Z9HA 3I69A 1YQ1A 4NV5A 5CO3A 4A5PA 3QOUA 3TCOA 3FK8A 1PQNA 4TR1B 3MDKA 1J9BA 1U88A 4X43A 4Q5RA 5D9TA 1ZYEA 2B7JA 3JCML 2IFQB 2WB9A 4GF0A 1OE8A 2YPMA 2GDRA 2G2QA 3LGCA 2PMTA 3SBCA 3C8EA 5JWOB 6GSVA 4IKHA 2X99A 3QPMA 3KZQA 1AQWA 1S3RA 3CSHA 5ECSA 3ZIJA 4PGTA 2VL3A 5J5NA 1QFNA 3Q6OA 2VD0A 3PINA 3HVSA 4RI6A 4OCEA 3CYNA 4O92A 1MD4A 2R0CA 5A5KA 5JCWA 5BMUA 4PTSA 1EOGA 2ZNMA 3TOUA 1G0TA 3HZ4A 2HSHA 3H1NA 3N9JA 2IMEA 5EL8A 4KB3A 5J3RA 3DMLA 1SKRB 2PVQA 2L57A 4HOJA 1K0NA 2KLXA 1I5GA 1PKZA 3UIWA 2AUVA 3WD6A 1OC9A 5DAKB 1B9XC 1GSQA 1GSDA 2MZCA 2YCDA 3LQ7A 3BCIA 1TRUA 2NTOA 2LNTA 3R3EA 4TKYA 1QK8A 3FKFA 3HJMA 1G6WA 1LBKA 1ZGNA 2OA7A 1N2AA 3CSJA 4KCAA 2VIMA 4KGIA 3O3TA 2HLSA 4BL7A 2X8GA 2CVDA 3G7IA 3KXOA 3WT2A 3R2QA 4YH2A 2K8VA 1AQVA 4HZ4A 2H0GA 5DCGA 4K6XA 1ZYNA 4ZB9A 3KP9A 1SENA 1KNGA 4LMWA 12GSA 4Z2TA 1G7OA 4F0BA 3TJKA 1GNEA 4ZIJA 4EF0A 4OD7A 1M99A 1PRXA 3S9FA 4O5QA 1Z6MA 2FWGA 3TUEA 2REMA 1A0RP 3ZIVA 1ZMAA 2K9FA 4TN8A 4Z2RA 4TVEA 2JSZA 2X8HA 3PH9A 3FZ9A 5ECQB 2DBCA 3CSIA 4WF4A 6GSWA 2B5YA 3UBLA 1BG5A 1M2AA 4KDXA 2N5BA 4QQ7A 4Q5NA 1EV9A 2CZ3A 5FHIA 2YNXA 4BVXB 4J57E 2QC7A 2JSYA 3EE2A 2M46A 4HS1A 4N10A 4JBBA 3QDNA
chains in the Genus database with same CATH topology
3UEMA 2HZFA 1U3AA 2NPBA 2QGVA 5B8BA 2B5XA 3LXTA 2EC4A 1F3AA 4F82A 3FR3A 4ZBAA 2OE1A 3KGKA 2PVOC 3GH9A 1HNAA 1TTZA 2MBSA 4KSMA 3W8SA 2AJQB 4IP6A 3RPNA 4ZL9A 2DJ1A 3GTUB 3KJYA 3VWXA 2ZCTA 1GTIA 2IWTA 4TR1A 5F0GA 1TI1A 1JZOA 2WRTA 1PGTA 1G7EA 4F03A 1SKSB 1WE0A 2ON7A 2GT6A 4HU9A 4OO4A 2V2GA 1GUKA 2HRAA 5KN3A 4IGJA 4O7HA 1M0UA 3EWLA 1SKWB 2XPEA 3H93A 5G1LA 2IPAA 2IL3A 5LCZA 4F2IA 4CW9A 2H6XA 3A5IA 3ZFBA 1XWBA 1T00A 2C8UA 2A2SA 3IXRA 5JCGA 5HFKA 1GRXA 2VCZA 3ZMLA 3F8UA 4JU5A 1URMA 2KP2A 2A2PA 4EIQA 2L59A 2J23A 2H1GA 2OE0A 1Z5YE 1JZWA 2GVPA 4HEA2 5IM9A 2IMIA 2X8CA 1V2AA 4I2TA 4PNGA 2B5EA 3NOFA 1HQOA 4EDZA 4OFTA 2A2RA 2XC2A 2GT5A 1K0DA 1FOVA 1B4PA 3ZMKA 2YV9A 3IC4A 2AHEA 2HXKA 2OBIA 5D9VA 2FA4A 5D9WA 5DDLA 1U6TA 1TRWA 2LNSA 1FOHA 5G1KA 1VRSD 3DRNA 2PWJA 3ZITA 3QFBC 3ERGA 2X4AA 2R0PA 1OC8A 4LL1B 2NDOA 3ME8A 1VF1A 1XCCA 1K0MA 1ON4A 3IR4A 4ML1A 4EUYA 16GSA 4GRFA 2O7KA 5GAND 5CRHA 5J41A 5ECOB 1ERTA 1T3BA 2CAIA 2O85A 1E2YA 4L0UA 1PKWA 1O73A 4WR4A 5F06A 4HU7A 2VL2A 5HR0A 3DXBA 3GIXA 1AC1A 3DEXA 1BX9A 4MJBA 2E2MA 5EPFA 2OJLA 4ZXGA 6GSSA 4KSOA 4WF5A 1AIUA 2P0GA 3VLNA 4GQFA 3L78A 2DSAA 2C1YA 3WGXA 1SU9A 2CX3A 2VL9A 2QA1A 2IIYA 3F4SA 1R5AA 4Q5FA 3FR9A 4YQVA 5IPHA 1PX7A 1FVJA 1TU7A 2BMXA 1OVNA 4K8MA 3TB2A 1TK8B 4OFMA 4BVYA 1GNWA 4QL9A 1FAAA 4CDOA 4FIWA 3LEFA 1FVKA 3UAPA 1GSFA 2OKAA 4MZCA 2KP1A 3FY7A 3G7YA 2VLTA 4GCIA 5IPGA 3TKSE 3O6TA 1ZYPA 5DBQA 1PD21 4DSSB 3IE3A 3UVTA 1H75A 4K2DA 4LMVA 1ML6A 2PUKC 4WEYA 5GSTA 2GSRA 4HQZA 1V58A 2H8LA 3WYWA 5KN1A 4XTSA 2LV3A 3F6DA 3IBHA 4DVCA 1F3BA 1A0FA 5CNWA 3I9V2 3E0UA 4NPBA 3FHKA 1JHBA 4G0LA 1XW9A 3PR8A 1DBYA 4AF2A 1AUCA 1Y6EA 4IELA 2DJ0A 3ZFLA 2HSMA 2H75A 5F8BA 3RHCA 4ISDA 3M8NA 3HY2A 1K3OA 3VPTA 2L5LA 4IHUA 6GSXA 1SD9A 4BWQA 2EIQA 5A4VA 4G2EA 2LJKA 4ID0A 2YZUA 4ICYA 3V1WA 1V57A 3PPUA 1QUWA 1SL2B 3UL3A 1X5CA 4MJCA 4JRRA 1EGOA 4EIPA 2B7KA 2TIRA 1T1VA 1MTCA 2QSIA 5A4WA 1KBNA 4EKZA 3KM6A 2A4VA 1M7TA 2X64A 1A2JA 1GSSA 1YY7A 2GSSA 3MWHA 5LD0A 3A5WA 2PN8A 1V9WA 1TP9A 4FQUA 2GQMA 1SL0B 3C73A 1NHYA 4K0GA 1A8YA 4IW9A 3HJOA 3OR5A 1QGVA 4ZBDA 4N0VA 3IDVA 4TXOB 2M72A 2CZ2A 2VLVA 4NHZA 2JL4A 5IMZA 2IMDA 4JE1A 4EL1A 4OWYA 2GSQA 5H5SA 4D73B 1Q98A 2WZ9A 5KOWA 4MF6A 3M0FA 4AGSA 1WMJA 2LRNA 3KCMA 3KP8A 3VI7A 4MPGA 2RM5A 5CREA 4TR4A 4NHWA 1XOBA 3DYRA 2GLRA 4HJMA 3CBUA 4GTUA 5LNKe 5HFIA 2JZSA 2E7PA 2HSYA 3QCPA 2LEGA 3LXZA 2NVLA 5ECNB 1AW9A 5FWGA 3GHAA 2FWHA 1AQXA 1Z6NA 1T8EB 5JWQB 1FB0A 3KEBA 4ZB6A 2CQ9A 3M9KA 4IS0A 3IHQA 4Z7XA 1R7HA 2C3TA 3P90A 2YWIA 1S3AA 5ECIB 3P2AA 1CQHA 1ZYQB 2LS5A 2PU9C 3DVXA 3GKNA 3WT1A 3FR6A 3UVHA 1NM3A 3HVXA 4L5LA 5HR3A 2K18A 2VCTA 4IQAA 1OKTA 4MLYA 2BTOT 5DALB 3RPPA 1XOAA 3QAWA 1C72A 2I81A 4HQSA 2B3SA 4L5OA 3LJRA 4V1Ag 3EVIA 2WFCA 2FWEA 1SJ6A 4I5QA 4I97A 1XIYA 3KH9A 2JZRA 4G19A 3CXGA 3IK9A 4KE3A 3MYDA 3HD5A 3M9JA 2LJAA 4DSRA 4ML6A 3VK9A 4XS4B 22GSA 2HRFA 3TOTA 3CTFA 5B7CA 2F3MA 1FG4A 2F9SA 1GLQA 2A4HA 3TKRA 4GXZA 1XFLA 4YQMA 1GTAA 3GA4A 4DEJA 2MBTA 2DJ3A 4OFNA 3CMIA 1DE1A 4PQ1A 1M2BA 1HD2A 2B1LA 4KCEA 3LW9A 5D96A 2O89A 4L0WA 2GTUA 1SK1A 1XWAA 2PPTA 1A23A 4KDUA 4HZ2A 2L4CA 1GH2A 1DSBA 2HNLA 1TXXA 3F63A 4IQ1A 3A3TA 2YJHA 5GZZB 2LUSA 1S3CA 5G30A 3ED3A 2V6KA 1MEKA 1GP1A 3BOAA 4XHMA 2H01A 2H6ZA 5ELGA 2XBIA 4ACSA 2C0FA 2R5GA 4Z2UA 3RDWA 5IMVA 3D4MA 5F07A 3BCKA 3ZRDA 3GYKA 1YZXA 2HT9A 1GL8A 3IHGA 2GGTA 1GSEA 4ULXA 3KTBA 4EVMA 3FEUA 5D93A 4K1FA 4MF5A 5GSSA 2QKEA 4MABA 2R37A 4ECBA 1W4VA 4WR5A 2QA2A 1T7PB 3F0IA 5ID2A 3A2VA 4V2NA 3GX0A 4EXJA 1WPIA 5JCUA 4K7OA 4MDCA 1XVWA 1SL1B 3F3QA 11GSA 2CT6A 4KW6A 2PBJA 3ERWA 1JLWA 1GWCA 4ECCA 2KOKA 1OC3A 2LTKA 4K9ZA 1O81A 5DVBA 3CTGA 5DQYA 2VCVA 3TKSC 1EP7A 4YQUA 1VF3A 4N11A 4TW5A 2IFQA 2OADA 5KEJA 3H8QA 4P3YB 1USBA 3IPZA 4D73A 8GSSA 5HQPA 2I1UA 1Q4JA 2ALBA 1NW2A 4AJ6A 2H30A 4HI7A 4O5UA 2YWOA 3GUSA 1BAYA 1GUMA 2FUG2 3FZ4A 4JEDA 4ZB8A 5HR2A 3C1SA 2GZZA 3APSA 4XRAA 4XCSA 4K7IA 4IBPA 4I6XA 2E0QA 2HE3A 2VCWA 3LYPA 5AN1A 1JFUA 3QR6A 1XW5A 2G0FA 2IN3A 4K5RA 5C00A 5C04A 2KUCA 13GSA 5G5EA 7GSSA 1B9YC 5G5FA 3IOSA 5DAKA 3A2WA 1TK0B 2VD1A 2RUFA 2YJ7A 2PGTA 1OKDA 4L8EA 4MH3A 2DJJA 2KHPA 2H76A 1K0CA 1OE7A 1YEXA 1RW1A 5B8AA 1NSWA 4POBA 3VPQA 2CAQA 9GSSA 2FD3A 4GLTA 1DUGA 1THOA 2N5FA 1J08A 4G0KA 4K2XA 4WETA 1A2LA 4RI7A 3Q18A 3IA1A 1TKDB 4LL4B 5G31A 1Z7PA 3TGZA 5ECPB 4EO3A 4FYBA 4AJ8A 2F51A 3WGEA 5IQYA 1ZCPA 2GZPA 1GLPA 1VF2A 2P5RA 4CY8A 4H86A 4CHSA 4OMVA 2JADA 2WS2A 2AB6A 3ZTLA 5CAXA 1UN2A 1SK0A 5IIZA 3TJJA 1O8WA 4AJ7A 1TRVA 3IK7A 3GMFA 1PMTA 3IAM2 2VUPA 3RHBA 3A2XA 1N8JA 1JZDA 3ERFA 3DKSA 3L4NA 1GSUA 1YF0A 2VCQA 4YAVA 4XS1A 5BRTA 2FHEA 3HXSA 2B6MA 1Z3EA 3QD9A 2V1MA 1EZKA 2H72A 3GRXA 4MCUA 2H74A 2YANA 3I43A 3GSSA 3ZL5A 3L9SA 3LSZA 1SYXA 1TI3A 3TKQA 2VOCA 3F4TA 3UOMA 4POMA 3F3RA 1B4QA 2RIIA 4PURA 1KTEA 4BVXA 1YDKA 2AV4A 4K0NA 4YKFA 3EMXA 3ME7A 2HI7A 4GSTA 1FB6A 2O8VB 1K0BA 3FZAA 2F8AA 2YV7A 4BL7B 5ECHB 1BEDA 5E59A 5IOWA 1OAZA 3HJPA 2VM1A 1GUHA 6GSTA 4QL7A 1R4WA 2LKUA 3I6AA 1EGRA 1X5EA 1PX6A 2LSTA 4KA0A 5B6NA 3MIXA 4J2FA 2DIZA 1NHOA 2L6CA 2WDUA 1MDIA 2V32A 3U6VA 2FWFA 2WGRA 2TRXA 3GTUA 1EP8A 1TJDA 2R0GA 2H70A 1XPVA 2FCHA 5HFGA 1J0FA 2MMOA 1SD8A 1LJRA 1MDKA 2V41A 3KIJA 5AGYA 3ZYWA 3RBTA 4ILFA 3LG6A 2I9HA 2C80A 1WOUA 4KNDA 5KN2A 1TOFA 4X1UA 3TKPA 4RUVA 4MP4A 3D4TA 3VURA 4ZBBA 3VFIA 1FO5A 3NIVA 1ZOFA 1WRYA 3HYPA 1GULA 3M1GA 2R2JA 3D5JA 1BQ7A 5DQSA 3TRPA 3UBKA 1TW9A 1UC7A 3VWUA 2MMAA 5J9BA 2WCIA 17GSA 2BJXA 1A8LA 2B1KA 3TRQA 1A24A 2H66A 5AIXA 1ERUA 1ZZYA 1O6JA 1TRSA 2I3YA 5L71A 5HR1A 3D0ZA 2C0DA 4MF7A 1AXDA 5CRDA 1IYHA 2HZEB 3WGDA 3C71A 3LFLA 2DKHA 3HCZA 2FNOA 2VCXA 1A2MA 1K0OA 1X9WB 1W89A 3CRTA 4IN0A 4LA1A 3TDGA 5CRGA 3TJFA 4ZL8A 5IOXA 1ERVA 1BJXA 4PX1A 2DIYA 4TXVA 4RQXA 3NZNA 4F0CA 1TU8A 5ECLB 1GSYA 5D8IA 1H4OA 2DMLA 1SJIA 14GSA 1MD3A 5ABRA 2CX4A 4EDYA 3EC3A 5A4UA 3KH7A 4JR4A 2RM6A 3H4KA 3N5OA 3ZVJD 4F9ZA 3G9BA 3L9UA 5G2ZA 1YKCA 4V1Ap 1EEMA 1XVQA 3HA9A 1SK2A 2RLIA 2TRCP 3HVVA 1XZOA 2DKIA 1EWXA 4MMMA 1YJ6A 1XWGA 3EU4A 3H79A 4IP1A 5DJLA 2UZ8A 3TJBA 4G10A 2HFDA 2AYTA 3GL3A 5F05A 4X4JA 3J7Yk 2R6KA 2Z9SA 3E3EA 2C0EA 5DCHA 2IMKA 2DC5A 5IO2A 2CVBA 4KUNA 3F4RA 4KF9A 5D73A 3QFAC 6GSYA 4XRDA 1YKAA 2H1AA 1HNBA 2YOIA 2D2ZA 1XBSA 2C0GA 1X9SB 4JZQA 4MA9A 2OE3A 3BBYA 1AAZA 3P7XA 1R5PA 4PXOA 4DSSA 4V2MA 1FW1A 3F6FA 3GH6A 3APOA 3IC8A 4USSA 2DLXA 1O85A 1V40A 2JACA 5EVOA 1EEJA 1XXUA 3GFKA 4OCFA 1Y25A 3CRUA 4FYCA 3GKKA 3W6GA 2CV4A 1YF1A 4X0XA 3DD3A 1UVZA 4NV2A 1WIKA 3VWVA 2H19A 4V2LA 4TOPA 3KD0A 1SYRA 2K8SA 1HNCA 1ILOA 3PGTA 3APQA 3BD2A 5ECMB 4HDEA 4XS6A 2LRTA 4PNFA 19GSA 3DWVA 4HJ2A 4PUAA 4YAPA 2DMMA 3EU3A 4Q5QA 1THXA 4NMUA 2H1BA 2LJRA 1VGLA 4IVFA 3MSZA 5ENUA 1QMVA 2GSTA 3TRXA 2K6VA 2YZHA 2P5QA 2WULA 2VAFA 5CRWA 1DE2A 2YP6A 4BVYB 4MZBA 2WJUA 1I9DA 3ZREA 1EV4A 1EOHA 4MK3A 2OBKA 5DJMA 4BPYA 4ZL7A 4N0ZA 1F9MA 4MPFA 1F37A 1F6MC 4J56E 2HYXA 2O87A 2L6DA 1E6BA 3P8WA 4RQRA 5B6MA 3BJ5A 2RUEA 2HZEA 4POLA 2EIRA 1SJZA 3QAGA 1O7UA 4TXOA 2V6OA 3KMNA 3O76A 1QQ2A 3RAZA 1PSQA 4E8HA 4MNNA 3ZZXA 3D6IA 4WBRD 4EE0A 4OO5A 4GQCA 4PQHA 2VL2C 3G7JA 4WXTA 3QMXA 1PN9A 4E8EA 2XHFA 4N30A 1KEBA 4I8BA 2CVKA 4WBJA 1X0RA 2AAWA 4G9HA 2GQLA 3K8NA 3VWWA 1S3DA 5EY6A 2MMZA 2DJ2A 2FY6A 3FMWA 1X5DA 3FZ5A 1XW6A 2L4QA 3IRAA 1K3LA 4TRXA 4BA7A 1GTUA 1JLVA 2FLSA 2H73A 3HKRA 3ISOA 4EC0A 4MJAA 1M2DA 2C3QA 4TR3A 3L0HA 2IMFA 3HDCA 1B48A 3IAS2 3GV1A 1ST9A 2YN1A 2ON5A 1T4YA 4TR0A 2GZYA 1T4ZA 3ZVJA 1YEPA 1TK5B 1VF4A 2LRCA 3LWAA 5JWRB 4NWYA 5INYA 3C7MA 3GURA 5IO0A 4PUFC 2VM2A 5DALA 4MZWA 1PL2A 1ERWA 3M3MA 2LQOA 1WJKA 2GS3A 3EYTA 2VLUA 5E4WA 3DIEA 2PERA 3GL5A 3LYKA 4ECJA 2H0IA 5ELAA 1QXHA 3J7Yb 3DVWA 2DJKA 2MYGA 2C4JA 2LQQA 3LORA 4NAXA 4XIHA 4K7NA 1U87A 5KOXA 4XS4A 3KMOA 4CY6A 4ECIA 6GSUA 2YWNA 1ABAA 5IMCA 2NBSA 5ECKB 4FYUA 5GAPD 3MAKA 2H6YA 1IYIA 1PA3A 2P31A 2HRKA 3EPTA 1MDJA 4KH7A 3TKSA 18GSA 1U3IA 3SWLA 4DSQA 2XBQA 4GSNA 2JU5A 4NXIA 2F8FA 4KDYA 2CA8A 4IJ3A 4MH2A 1X9MB 3F9UA 3KTLA 4GWRA 5IMFA 5AIVA 5IMAA 3D21A 3EINA 3E9JB 2OACA 3C1RA 5J4UA 1OC9B 3GSTA 3EMPA 3Q74A 3IV4A 2VO4A 1PL1A 1GTBA 1TDIA 4POKA 3DGQA 3GNJA 4KAEA 2IJYA 4GSSA 4JR6A 1ACVA 3QAVA 1CQGA 4WKWA 3GX8A 1K0AA 1PN0A 4YKGA 3Q19A 3MNGA 5ECRB 2ES7A 2YWMA 1HYUA 2ZUPA 2J9HA 1RQMA 1RK4A 3VI5A 3FYGA 1XWCA 5H5QA 10GSA 4I2UA 1V98A 1G6YA 2R3XA 2MMNA 4O32A 3HZ8A 2X49A 3HHVA 4PQIA 3GN3A 1XWKA 4IJIA 5COHA 3TJGA 5FT3A 2L5OA 5AISA 3US3A 1R26A 5CP1A 1LU4A 1O8XA 3D22A 1B8XA 1OYJA 3L9VA 3UJ1A 2E2GA 4BWSA 1UA5A 2I4AA 5D9XA 1BYEA 2HRNA 1M9BA 4MJEA 4ZILA 1WP0A 2N5AA 3GKMA 4LLRA 3W8JA 5CYYA 3U5RE 1Z7RA 4KX4A 2FA8A 5H5RA 5J9CA 2JZTA 1F2EA 2H71A 1FHEA 1K3YA 2H1DA 2H0HA 3ZLPA 3GKXA 2C3NA 2GQKA 3UMAA 3FW2A 5KN0A 1WWJA 2M80A 1JZRA 4FO5A 3FRCA 3EURA 2EIOA 4FH8A 1ZL9A 5ID2B 20GSA 3AY8A 2XPDA 4K5SA 2FGXA 1M9AA 4HUAA 3UARA 2R4VA 5IMDA 4G0IA 4O5RA 1Z9HA 3I69A 1YQ1A 4NV5A 5CO3A 4A5PA 3QOUA 3TCOA 3FK8A 1PQNA 4TR1B 3MDKA 1J9BA 1U88A 4X43A 4Q5RA 5D9TA 1ZYEA 2B7JA 3JCML 2IFQB 2WB9A 4GF0A 1OE8A 2YPMA 2GDRA 2G2QA 3LGCA 2PMTA 3SBCA 3C8EA 5JWOB 6GSVA 4IKHA 2X99A 3QPMA 3KZQA 1AQWA 3CSHA 5ECSA 3ZIJA 4PGTA 2VL3A 5J5NA 1QFNA 3Q6OA 2VD0A 3PINA 3HVSA 4RI6A 4OCEA 3CYNA 4O92A 1MD4A 2R0CA 5A5KA 5JCWA 5BMUA 4PTSA 1EOGA 2ZNMA 3TOUA 1G0TA 3HZ4A 2HSHA 3H1NA 3N9JA 2IMEA 5EL8A 4KB3A 5J3RA 3DMLA 1SKRB 2PVQA 2L57A 4HOJA 1K0NA 2KLXA 1I5GA 1PKZA 3UIWA 2AUVA 3WD6A 1OC9A 5DAKB 1B9XC 1GSQA 1GSDA 2MZCA 2YCDA 3LQ7A 3BCIA 1TRUA 2NTOA 2LNTA 3R3EA 4TKYA 1QK8A 3FKFA 3HJMA 1G6WA 1LBKA 1ZGNA 2OA7A 1N2AA 3CSJA 4KCAA 2VIMA 4KGIA 3O3TA 2HLSA 4BL7A 2X8GA 2CVDA 3G7IA 3KXOA 3WT2A 3R2QA 4YH2A 2K8VA 1AQVA 4HZ4A 2H0GA 5DCGA 4K6XA 1ZYNA 4ZB9A 3KP9A 1SENA 1KNGA 4LMWA 12GSA 4Z2TA 1G7OA 4F0BA 3TJKA 1GNEA 4ZIJA 4EF0A 4OD7A 1M99A 1PRXA 3S9FA 4O5QA 1Z6MA 2FWGA 3TUEA 2REMA 1A0RP 3ZIVA 1ZMAA 2K9FA 4TN8A 4Z2RA 4TVEA 2JSZA 2X8HA 3PH9A 3FZ9A 5ECQB 2DBCA 3CSIA 4WF4A 6GSWA 2B5YA 3UBLA 1BG5A 1M2AA 4KDXA 2N5BA 4QQ7A 4Q5NA 1EV9A 2CZ3A 5FHIA 2YNXA 4BVXB 4J57E 2QC7A 2JSYA 3EE2A 2M46A 4HS1A 4N10A 4JBBA 3QDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UEM A;  2HZF A;  1U3A A;  2NPB A;  2QGV A;  5B8B A;  2B5X A;  3LXT A;  2EC4 A;  1F3A A;  4F82 A;  3FR3 A;  4ZBA A;  2OE1 A;  3KGK A;  2PVO C;  3GH9 A;  1HNA A;  1TTZ A;  2MBS A;  4KSM A;  3W8S A;  2AJQ B;  4IP6 A;  3RPN A;  4ZL9 A;  2DJ1 A;  3GTU B;  3KJY A;  3VWX A;  2ZCT A;  1GTI A;  2IWT A;  4TR1 A;  5F0G A;  1TI1 A;  1JZO A;  2WRT A;  1PGT A;  1G7E A;  4F03 A;  1SKS B;  1WE0 A;  2ON7 A;  2GT6 A;  4HU9 A;  4OO4 A;  2V2G A;  1GUK A;  5KN3 A;  4IGJ A;  4O7H A;  1M0U A;  3EWL A;  1SKW B;  2XPE A;  3H93 A;  5G1L A;  2IPA A;  2IL3 A;  5LCZ A;  4F2I A;  4CW9 A;  2H6X A;  3ZFB A;  1XWB A;  1T00 A;  2C8U A;  2A2S A;  3IXR A;  5JCG A;  5HFK A;  1GRX A;  2VCZ A;  3ZML A;  3F8U A;  4JU5 A;  1URM A;  2KP2 A;  2L59 A;  2J23 A;  2H1G A;  2OE0 A;  1Z5Y E;  1JZW A;  2GVP A;  4HEA 2;  5IM9 A;  2IMI A;  2X8C A;  1V2A A;  4I2T A;  4PNG A;  2B5E A;  3NOF A;  1HQO A;  4EDZ A;  4OFT A;  2A2R A;  2XC2 A;  2GT5 A;  1K0D A;  1FOV A;  1B4P A;  3ZMK A;  2YV9 A;  3IC4 A;  2AHE A;  2HXK A;  2OBI A;  5D9V A;  2FA4 A;  5D9W A;  5DDL A;  1U6T A;  1TRW A;  2LNS A;  5G1K A;  1VRS D;  3DRN A;  2PWJ A;  3ZIT A;  3QFB C;  3ERG A;  1OC8 A;  4LL1 B;  2NDO A;  3ME8 A;  1VF1 A;  1XCC A;  1K0M A;  1ON4 A;  3IR4 A;  4ML1 A;  4EUY A;  16GS A;  4GRF A;  2O7K A;  5GAN D;  5CRH A;  5J41 A;  5ECO B;  1ERT A;  1T3B A;  2CAI A;  2O85 A;  1E2Y A;  4L0U A;  1PKW A;  1O73 A;  4WR4 A;  5F06 A;  4HU7 A;  2VL2 A;  5HR0 A;  3DXB A;  3GIX A;  1AC1 A;  3DEX A;  1BX9 A;  4MJB A;  2E2M A;  5EPF A;  2OJL A;  4ZXG A;  6GSS A;  4KSO A;  4WF5 A;  1AIU A;  2P0G A;  3VLN A;  4GQF A;  3L78 A;  2DSA A;  2C1Y A;  3WGX A;  1SU9 A;  2CX3 A;  2VL9 A;  2IIY A;  3F4S A;  1R5A A;  4Q5F A;  3FR9 A;  4YQV A;  5IPH A;  1PX7 A;  1FVJ A;  1TU7 A;  2BMX A;  1OVN A;  4K8M A;  3TB2 A;  1TK8 B;  4OFM A;  4BVY A;  1GNW A;  4QL9 A;  1FAA A;  4CDO A;  4FIW A;  3LEF A;  1FVK A;  3UAP A;  1GSF A;  2OKA A;  4MZC A;  2KP1 A;  3FY7 A;  3G7Y A;  2VLT A;  4GCI A;  5IPG A;  3TKS E;  3O6T A;  5DBQ A;  1PD2 1;  4DSS B;  3IE3 A;  3UVT A;  1H75 A;  4K2D A;  4LMV A;  1ML6 A;  2PUK C;  4WEY A;  5GST A;  2GSR A;  4HQZ A;  1V58 A;  2H8L A;  3WYW A;  5KN1 A;  4XTS A;  2LV3 A;  3F6D A;  3IBH A;  4DVC A;  1F3B A;  1A0F A;  5CNW A;  3I9V 2;  3E0U A;  4NPB A;  3FHK A;  1JHB A;  1XW9 A;  3PR8 A;  1DBY A;  4AF2 A;  1AUC A;  1Y6E A;  4IEL A;  2DJ0 A;  3ZFL A;  2H75 A;  5F8B A;  3RHC A;  4ISD A;  3M8N A;  3HY2 A;  1K3O A;  3VPT A;  2L5L A;  4IHU A;  6GSX A;  1SD9 A;  4BWQ A;  2EIQ A;  5A4V A;  4G2E A;  2LJK A;  4ID0 A;  2YZU A;  3V1W A;  1V57 A;  1QUW A;  1SL2 B;  3UL3 A;  1X5C A;  4MJC A;  4JRR A;  1EGO A;  2B7K A;  2TIR A;  1T1V A;  1MTC A;  2QSI A;  5A4W A;  1KBN A;  4EKZ A;  3KM6 A;  2A4V A;  1M7T A;  2X64 A;  1A2J A;  1GSS A;  1YY7 A;  2GSS A;  3MWH A;  5LD0 A;  3A5W A;  2PN8 A;  1V9W A;  1TP9 A;  2GQM A;  1SL0 B;  3C73 A;  1NHY A;  4K0G A;  1A8Y A;  4IW9 A;  3HJO A;  3OR5 A;  1QGV A;  4ZBD A;  4N0V A;  3IDV A;  4TXO B;  2M72 A;  2CZ2 A;  2VLV A;  4NHZ A;  2JL4 A;  5IMZ A;  2IMD A;  4JE1 A;  4EL1 A;  4OWY A;  2GSQ A;  5H5S A;  4D73 B;  1Q98 A;  2WZ9 A;  4MF6 A;  3M0F A;  4AGS A;  1WMJ A;  2LRN A;  3KCM A;  3KP8 A;  3VI7 A;  4MPG A;  2RM5 A;  5CRE A;  4TR4 A;  4NHW A;  1XOB A;  3DYR A;  2GLR A;  4HJM A;  3CBU A;  4GTU A;  5LNK e;  5HFI A;  2JZS A;  2E7P A;  2HSY A;  3QCP A;  2LEG A;  3LXZ A;  2NVL A;  5ECN B;  1AW9 A;  5FWG A;  3GHA A;  2FWH A;  1AQX A;  1Z6N A;  1T8E B;  5JWQ B;  1FB0 A;  3KEB A;  4ZB6 A;  2CQ9 A;  3M9K A;  4IS0 A;  3IHQ A;  4Z7X A;  1R7H A;  2C3T A;  3P90 A;  2YWI A;  1S3A A;  5ECI B;  3P2A A;  1CQH A;  1ZYQ B;  2LS5 A;  2PU9 C;  3DVX A;  3GKN A;  3WT1 A;  3FR6 A;  3UVH A;  1NM3 A;  3HVX A;  4L5L A;  5HR3 A;  2K18 A;  2VCT A;  4IQA A;  1OKT A;  4MLY A;  2BTO T;  5DAL B;  3RPP A;  1XOA A;  3QAW A;  1C72 A;  2I81 A;  4HQS A;  2B3S A;  4L5O A;  3LJR A;  4V1A g;  3EVI A;  2WFC A;  2FWE A;  1SJ6 A;  4I5Q A;  4I97 A;  1XIY A;  3KH9 A;  2JZR A;  4G19 A;  3CXG A;  3IK9 A;  4KE3 A;  3HD5 A;  3M9J A;  2LJA A;  4DSR A;  4ML6 A;  3VK9 A;  4XS4 B;  22GS A;  2HRF A;  3TOT A;  3CTF A;  5B7C A;  2F3M A;  1FG4 A;  2F9S A;  1GLQ A;  3TKR A;  4GXZ A;  1XFL A;  4YQM A;  1GTA A;  3GA4 A;  4DEJ A;  2MBT A;  2DJ3 A;  4OFN A;  3CMI A;  1DE1 A;  4PQ1 A;  1M2B A;  1HD2 A;  2B1L A;  4KCE A;  5D96 A;  2O89 A;  4L0W A;  2GTU A;  1SK1 A;  1XWA A;  2PPT A;  1A23 A;  4KDU A;  4HZ2 A;  2L4C A;  1GH2 A;  1DSB A;  2HNL A;  1TXX A;  3F63 A;  4IQ1 A;  3A3T A;  2YJH A;  5GZZ B;  2LUS A;  1S3C A;  5G30 A;  3ED3 A;  2V6K A;  1MEK A;  1GP1 A;  3BOA A;  4XHM A;  2H01 A;  2H6Z A;  5ELG A;  2XBI A;  4ACS A;  2C0F A;  2R5G A;  3RDW A;  5IMV A;  3D4M A;  5F07 A;  3BCK A;  3ZRD A;  3GYK A;  1YZX A;  2HT9 A;  1GL8 A;  2GGT A;  1GSE A;  4ULX A;  3KTB A;  4EVM A;  3FEU A;  5D93 A;  4K1F A;  4MF5 A;  5GSS A;  2QKE A;  4MAB A;  2R37 A;  4ECB A;  1W4V A;  4WR5 A;  1T7P B;  3F0I A;  5ID2 A;  3A2V A;  4V2N A;  3GX0 A;  4EXJ A;  1WPI A;  5JCU A;  4K7O A;  4MDC A;  1XVW A;  1SL1 B;  3F3Q A;  11GS A;  2CT6 A;  4KW6 A;  2PBJ A;  3ERW A;  1JLW A;  1GWC A;  4ECC A;  2KOK A;  1OC3 A;  2LTK A;  4K9Z A;  1O81 A;  5DVB A;  3CTG A;  5DQY A;  2VCV A;  3TKS C;  1EP7 A;  4YQU A;  1VF3 A;  4N11 A;  4TW5 A;  2IFQ A;  2OAD A;  5KEJ A;  3H8Q A;  4P3Y B;  1USB A;  3IPZ A;  4D73 A;  8GSS A;  5HQP A;  2I1U A;  1Q4J A;  2ALB A;  1NW2 A;  4AJ6 A;  2H30 A;  4HI7 A;  2YWO A;  3GUS A;  1BAY A;  1GUM A;  2FUG 2;  3FZ4 A;  4JED A;  4ZB8 A;  5HR2 A;  3C1S A;  2GZZ A;  3APS A;  4XRA A;  4XCS A;  4K7I A;  4IBP A;  4I6X A;  2E0Q A;  2HE3 A;  2VCW A;  3LYP A;  5AN1 A;  1JFU A;  3QR6 A;  1XW5 A;  2G0F A;  2IN3 A;  5C00 A;  5C04 A;  2KUC A;  13GS A;  5G5E A;  7GSS A;  1B9Y C;  5G5F A;  3IOS A;  5DAK A;  3A2W A;  1TK0 B;  2VD1 A;  2RUF A;  2YJ7 A;  2PGT A;  1OKD A;  4L8E A;  4MH3 A;  2DJJ A;  2KHP A;  2H76 A;  1K0C A;  1OE7 A;  1YEX A;  1RW1 A;  5B8A A;  1NSW A;  4POB A;  3VPQ A;  2CAQ A;  9GSS A;  2FD3 A;  4GLT A;  1DUG A;  1THO A;  2N5F A;  1J08 A;  4WET A;  1A2L A;  4RI7 A;  3Q18 A;  3IA1 A;  1TKD B;  4LL4 B;  5G31 A;  1Z7P A;  3TGZ A;  5ECP B;  4EO3 A;  4FYB A;  4AJ8 A;  2F51 A;  3WGE A;  5IQY A;  1ZCP A;  2GZP A;  1GLP A;  1VF2 A;  2P5R A;  4H86 A;  4CHS A;  4OMV A;  2JAD A;  2WS2 A;  2AB6 A;  3ZTL A;  5CAX A;  1UN2 A;  1SK0 A;  5IIZ A;  3TJJ A;  1O8W A;  4AJ7 A;  1TRV A;  3IK7 A;  3GMF A;  1PMT A;  3IAM 2;  2VUP A;  3RHB A;  3A2X A;  1N8J A;  1JZD A;  3ERF A;  3DKS A;  3L4N A;  1GSU A;  1YF0 A;  2VCQ A;  4YAV A;  4XS1 A;  2FHE A;  3HXS A;  2B6M A;  1Z3E A;  3QD9 A;  2V1M A;  1EZK A;  2H72 A;  3GRX A;  4MCU A;  2H74 A;  2YAN A;  3I43 A;  3GSS A;  3ZL5 A;  3L9S A;  3LSZ A;  1SYX A;  1TI3 A;  3TKQ A;  2VOC A;  3F4T A;  3UOM A;  4POM A;  3F3R A;  1B4Q A;  2RII A;  4PUR A;  1KTE A;  4BVX A;  1YDK A;  2AV4 A;  4K0N A;  3EMX A;  3ME7 A;  2HI7 A;  4GST A;  1FB6 A;  2O8V B;  1K0B A;  3FZA A;  2F8A A;  2YV7 A;  5ECH B;  1BED A;  5E59 A;  5IOW A;  1OAZ A;  3HJP A;  2VM1 A;  1GUH A;  6GST A;  4QL7 A;  1R4W A;  2LKU A;  3I6A A;  1EGR A;  1X5E A;  1PX6 A;  2LST A;  4KA0 A;  5B6N A;  4J2F A;  2DIZ A;  1NHO A;  2L6C A;  2WDU A;  1MDI A;  2V32 A;  3U6V A;  2FWF A;  2WGR A;  2TRX A;  3GTU A;  1EP8 A;  1TJD A;  2H70 A;  1XPV A;  2FCH A;  5HFG A;  1J0F A;  2MMO A;  1SD8 A;  1LJR A;  1MDK A;  2V41 A;  3KIJ A;  5AGY A;  3ZYW A;  3RBT A;  4ILF A;  3LG6 A;  2I9H A;  2C80 A;  1WOU A;  4KND A;  5KN2 A;  1TOF A;  4X1U A;  3TKP A;  4RUV A;  4MP4 A;  3D4T A;  3VUR A;  4ZBB A;  3VFI A;  1FO5 A;  3NIV A;  1ZOF A;  1WRY A;  3HYP A;  1GUL A;  3M1G A;  2R2J A;  3D5J A;  1BQ7 A;  5DQS A;  3TRP A;  3UBK A;  1TW9 A;  1UC7 A;  3VWU A;  2MMA A;  5J9B A;  2WCI A;  17GS A;  2BJX A;  1A8L A;  2B1K A;  3TRQ A;  1A24 A;  2H66 A;  5AIX A;  1ERU A;  1ZZY A;  1O6J A;  1TRS A;  2I3Y A;  5L71 A;  5HR1 A;  3D0Z A;  2C0D A;  4MF7 A;  1AXD A;  5CRD A;  1IYH A;  2HZE B;  3WGD A;  3C71 A;  3LFL A;  3HCZ A;  2FNO A;  2VCX A;  1A2M A;  1K0O A;  1X9W B;  1W89 A;  3CRT A;  4IN0 A;  4LA1 A;  3TDG A;  5CRG A;  3TJF A;  4ZL8 A;  5IOX A;  1ERV A;  1BJX A;  4PX1 A;  2DIY A;  4TXV A;  4RQX A;  3NZN A;  4F0C A;  1TU8 A;  5ECL B;  1GSY A;  5D8I A;  1H4O A;  2DML A;  1SJI A;  14GS A;  1MD3 A;  5ABR A;  2CX4 A;  4EDY A;  3EC3 A;  5A4U A;  3KH7 A;  4JR4 A;  2RM6 A;  3H4K A;  3N5O A;  3ZVJ D;  4F9Z A;  3G9B A;  3L9U A;  5G2Z A;  1YKC A;  4V1A p;  1EEM A;  1XVQ A;  3HA9 A;  1SK2 A;  2RLI A;  2TRC P;  3HVV A;  1XZO A;  1EWX A;  4MMM A;  1YJ6 A;  1XWG A;  3EU4 A;  3H79 A;  4IP1 A;  5DJL A;  3TJB A;  4G10 A;  2HFD A;  2AYT A;  3GL3 A;  5F05 A;  3J7Y k;  2R6K A;  2Z9S A;  3E3E A;  2C0E A;  5DCH A;  2IMK A;  2DC5 A;  5IO2 A;  2CVB A;  4KUN A;  3F4R A;  5D73 A;  3QFA C;  6GSY A;  4XRD A;  1YKA A;  2H1A A;  1HNB A;  2YOI A;  2D2Z A;  1XBS A;  2C0G A;  1X9S B;  4JZQ A;  4MA9 A;  2OE3 A;  3BBY A;  1AAZ A;  3P7X A;  1R5P A;  4PXO A;  4DSS A;  4V2M A;  1FW1 A;  3F6F A;  3GH6 A;  3APO A;  2DLX A;  1O85 A;  1V40 A;  2JAC A;  5EVO A;  1EEJ A;  1XXU A;  3GFK A;  4OCF A;  1Y25 A;  3CRU A;  4FYC A;  3GKK A;  3W6G A;  2CV4 A;  1YF1 A;  4X0X A;  3DD3 A;  1UVZ A;  4NV2 A;  1WIK A;  3VWV A;  2H19 A;  4V2L A;  4TOP A;  3KD0 A;  1SYR A;  2K8S A;  1HNC A;  1ILO A;  3PGT A;  3APQ A;  3BD2 A;  5ECM B;  4HDE A;  4XS6 A;  2LRT A;  4PNF A;  19GS A;  3DWV A;  4HJ2 A;  4PUA A;  4YAP A;  2DMM A;  3EU3 A;  4Q5Q A;  1THX A;  4NMU A;  2H1B A;  2LJR A;  1VGL A;  4IVF A;  3MSZ A;  5ENU A;  1QMV A;  2GST A;  3TRX A;  2K6V A;  2YZH A;  2P5Q A;  2WUL A;  2VAF A;  5CRW A;  1DE2 A;  2YP6 A;  4MZB A;  2WJU A;  1I9D A;  3ZRE A;  1EV4 A;  1EOH A;  4MK3 A;  2OBK A;  5DJM A;  4BPY A;  4ZL7 A;  4N0Z A;  1F9M A;  4MPF A;  1F37 A;  1F6M C;  4J56 E;  2HYX A;  2O87 A;  2L6D A;  1E6B A;  3P8W A;  4RQR A;  5B6M A;  3BJ5 A;  2RUE A;  2HZE A;  4POL A;  2EIR A;  1SJZ A;  3QAG A;  1O7U A;  4TXO A;  2V6O A;  3KMN A;  3O76 A;  1QQ2 A;  3RAZ A;  1PSQ A;  4E8H A;  3ZZX A;  3D6I A;  4WBR D;  4EE0 A;  4OO5 A;  4GQC A;  4PQH A;  2VL2 C;  3G7J A;  4WXT A;  3QMX A;  1PN9 A;  4E8E A;  2XHF A;  4N30 A;  1KEB A;  4I8B A;  2CVK A;  4WBJ A;  1X0R A;  2AAW A;  4G9H A;  2GQL A;  3K8N A;  3VWW A;  1S3D A;  5EY6 A;  2MMZ A;  2DJ2 A;  2FY6 A;  1X5D A;  3FZ5 A;  1XW6 A;  2L4Q A;  3IRA A;  1K3L A;  4TRX A;  4BA7 A;  1GTU A;  1JLV A;  2FLS A;  2H73 A;  3HKR A;  3ISO A;  4EC0 A;  4MJA A;  1M2D A;  2C3Q A;  4TR3 A;  3L0H A;  2IMF A;  3HDC A;  1B48 A;  3IAS 2;  3GV1 A;  1ST9 A;  2YN1 A;  2ON5 A;  1T4Y A;  4TR0 A;  2GZY A;  1T4Z A;  3ZVJ A;  1YEP A;  1TK5 B;  1VF4 A;  2LRC A;  3LWA A;  5JWR B;  4NWY A;  5INY A;  3C7M A;  3GUR A;  5IO0 A;  4PUF C;  2VM2 A;  5DAL A;  4MZW A;  1PL2 A;  1ERW A;  3M3M A;  2LQO A;  1WJK A;  2GS3 A;  3EYT A;  2VLU A;  5E4W A;  3DIE A;  2PER A;  3GL5 A;  3LYK A;  4ECJ A;  2H0I A;  5ELA A;  1QXH A;  3J7Y b;  3DVW A;  2DJK A;  2MYG A;  2C4J A;  2LQQ A;  3LOR A;  4NAX A;  4XIH A;  4K7N A;  1U87 A;  4XS4 A;  3KMO A;  4ECI A;  6GSU A;  2YWN A;  1ABA A;  5IMC A;  2NBS A;  5ECK B;  4FYU A;  5GAP D;  3MAK A;  2H6Y A;  1IYI A;  1PA3 A;  2P31 A;  1MDJ A;  4KH7 A;  3TKS A;  18GS A;  1U3I A;  3SWL A;  4DSQ A;  2XBQ A;  4GSN A;  2JU5 A;  4NXI A;  2F8F A;  4KDY A;  2CA8 A;  4IJ3 A;  4MH2 A;  1X9M B;  3F9U A;  3KTL A;  4GWR A;  5IMF A;  5AIV A;  5IMA A;  3D21 A;  3EIN A;  3E9J B;  2OAC A;  3C1R A;  5J4U A;  1OC9 B;  3GST A;  3EMP A;  3Q74 A;  3IV4 A;  2VO4 A;  1PL1 A;  1GTB A;  1TDI A;  4POK A;  3DGQ A;  3GNJ A;  4KAE A;  2IJY A;  4GSS A;  4JR6 A;  1ACV A;  3QAV A;  1CQG A;  4WKW A;  3GX8 A;  1K0A A;  3Q19 A;  3MNG A;  5ECR B;  2ES7 A;  2YWM A;  1HYU A;  2ZUP A;  2J9H A;  1RQM A;  1RK4 A;  3VI5 A;  3FYG A;  1XWC A;  5H5Q A;  10GS A;  4I2U A;  1V98 A;  1G6Y A;  2R3X A;  2MMN A;  4O32 A;  3HZ8 A;  3HHV A;  4PQI A;  3GN3 A;  1XWK A;  4IJI A;  5COH A;  3TJG A;  5FT3 A;  2L5O A;  5AIS A;  3US3 A;  1R26 A;  5CP1 A;  1LU4 A;  1O8X A;  3D22 A;  1B8X A;  1OYJ A;  3L9V A;  3UJ1 A;  2E2G A;  4BWS A;  1UA5 A;  2I4A A;  5D9X A;  1BYE A;  2HRN A;  1M9B A;  4MJE A;  4ZIL A;  1WP0 A;  2N5A A;  3GKM A;  4LLR A;  3W8J A;  5CYY A;  3U5R E;  1Z7R A;  4KX4 A;  2FA8 A;  5H5R A;  5J9C A;  2JZT A;  1F2E A;  2H71 A;  1FHE A;  1K3Y A;  2H1D A;  2H0H A;  3ZLP A;  3GKX A;  2C3N A;  2GQK A;  3UMA A;  3FW2 A;  5KN0 A;  1WWJ A;  2M80 A;  1JZR A;  4FO5 A;  3FRC A;  3EUR A;  2EIO A;  4FH8 A;  1ZL9 A;  5ID2 B;  20GS A;  3AY8 A;  2XPD A;  2FGX A;  1M9A A;  4HUA A;  3UAR A;  2R4V A;  5IMD A;  4O5R A;  1Z9H A;  3I69 A;  1YQ1 A;  4NV5 A;  5CO3 A;  3QOU A;  3TCO A;  3FK8 A;  1PQN A;  4TR1 B;  3MDK A;  1J9B A;  1U88 A;  4X43 A;  4Q5R A;  5D9T A;  1ZYE A;  2B7J A;  3JCM L;  2IFQ B;  2WB9 A;  4GF0 A;  1OE8 A;  2YPM A;  2GDR A;  2G2Q A;  3LGC A;  2PMT A;  3SBC A;  3C8E A;  5JWO B;  6GSV A;  4IKH A;  2X99 A;  3QPM A;  3KZQ A;  1AQW A;  3CSH A;  5ECS A;  3ZIJ A;  4PGT A;  2VL3 A;  5J5N A;  1QFN A;  3Q6O A;  2VD0 A;  3PIN A;  3HVS A;  4RI6 A;  4OCE A;  3CYN A;  4O92 A;  1MD4 A;  5A5K A;  5JCW A;  1EOG A;  2ZNM A;  3TOU A;  1G0T A;  3HZ4 A;  2HSH A;  3H1N A;  3N9J A;  2IME A;  5EL8 A;  4KB3 A;  5J3R A;  3DML A;  1SKR B;  2PVQ A;  2L57 A;  4HOJ A;  1K0N A;  2KLX A;  1I5G A;  1PKZ A;  3UIW A;  2AUV A;  3WD6 A;  1OC9 A;  5DAK B;  1B9X C;  1GSQ A;  1GSD A;  2MZC A;  2YCD A;  3LQ7 A;  3BCI A;  1TRU A;  2NTO A;  2LNT A;  4TKY A;  1QK8 A;  3FKF A;  3HJM A;  1G6W A;  1LBK A;  1ZGN A;  2OA7 A;  1N2A A;  3CSJ A;  4KCA A;  2VIM A;  4KGI A;  3O3T A;  2HLS A;  4BL7 A;  2X8G A;  2CVD A;  3G7I A;  3KXO A;  3WT2 A;  3R2Q A;  4YH2 A;  2K8V A;  1AQV A;  4HZ4 A;  2H0G A;  5DCG A;  4K6X A;  4ZB9 A;  3KP9 A;  1SEN A;  1KNG A;  4LMW A;  12GS A;  1G7O A;  4F0B A;  3TJK A;  1GNE A;  4ZIJ A;  4EF0 A;  4OD7 A;  1M99 A;  1PRX A;  3S9F A;  1Z6M A;  2FWG A;  3TUE A;  2REM A;  1A0R P;  3ZIV A;  1ZMA A;  2K9F A;  4TN8 A;  4TVE A;  2JSZ A;  2X8H A;  3PH9 A;  3FZ9 A;  5ECQ B;  2DBC A;  3CSI A;  4WF4 A;  6GSW A;  2B5Y A;  3UBL A;  1BG5 A;  1M2A A;  4KDX A;  2N5B A;  4QQ7 A;  4Q5N A;  1EV9 A;  2CZ3 A;  5FHI A;  2YNX A;  4J57 E;  2QC7 A;  2JSY A;  3EE2 A;  2M46 A;  4HS1 A;  4N10 A;  4JBB A;  3QDN A; 
#chains in the Genus database with same CATH topology
 3UEM A;  2HZF A;  1U3A A;  2NPB A;  2QGV A;  5B8B A;  2B5X A;  3LXT A;  2EC4 A;  1F3A A;  4F82 A;  3FR3 A;  4ZBA A;  2OE1 A;  3KGK A;  2PVO C;  3GH9 A;  1HNA A;  1TTZ A;  2MBS A;  4KSM A;  3W8S A;  2AJQ B;  4IP6 A;  3RPN A;  4ZL9 A;  2DJ1 A;  3GTU B;  3KJY A;  3VWX A;  2ZCT A;  1GTI A;  2IWT A;  4TR1 A;  5F0G A;  1TI1 A;  1JZO A;  2WRT A;  1PGT A;  1G7E A;  4F03 A;  1SKS B;  1WE0 A;  2ON7 A;  2GT6 A;  4HU9 A;  4OO4 A;  2V2G A;  1GUK A;  2HRA A;  5KN3 A;  4IGJ A;  4O7H A;  1M0U A;  3EWL A;  1SKW B;  2XPE A;  3H93 A;  5G1L A;  2IPA A;  2IL3 A;  5LCZ A;  4F2I A;  4CW9 A;  2H6X A;  3A5I A;  3ZFB A;  1XWB A;  1T00 A;  2C8U A;  2A2S A;  3IXR A;  5JCG A;  5HFK A;  1GRX A;  2VCZ A;  3ZML A;  3F8U A;  4JU5 A;  1URM A;  2KP2 A;  2A2P A;  4EIQ A;  2L59 A;  2J23 A;  2H1G A;  2OE0 A;  1Z5Y E;  1JZW A;  2GVP A;  4HEA 2;  5IM9 A;  2IMI A;  2X8C A;  1V2A A;  4I2T A;  4PNG A;  2B5E A;  3NOF A;  1HQO A;  4EDZ A;  4OFT A;  2A2R A;  2XC2 A;  2GT5 A;  1K0D A;  1FOV A;  1B4P A;  3ZMK A;  2YV9 A;  3IC4 A;  2AHE A;  2HXK A;  2OBI A;  5D9V A;  2FA4 A;  5D9W A;  5DDL A;  1U6T A;  1TRW A;  2LNS A;  1FOH A;  5G1K A;  1VRS D;  3DRN A;  2PWJ A;  3ZIT A;  3QFB C;  3ERG A;  2X4A A;  2R0P A;  1OC8 A;  4LL1 B;  2NDO A;  3ME8 A;  1VF1 A;  1XCC A;  1K0M A;  1ON4 A;  3IR4 A;  4ML1 A;  4EUY A;  16GS A;  4GRF A;  2O7K A;  5GAN D;  5CRH A;  5J41 A;  5ECO B;  1ERT A;  1T3B A;  2CAI A;  2O85 A;  1E2Y A;  4L0U A;  1PKW A;  1O73 A;  4WR4 A;  5F06 A;  4HU7 A;  2VL2 A;  5HR0 A;  3DXB A;  3GIX A;  1AC1 A;  3DEX A;  1BX9 A;  4MJB A;  2E2M A;  5EPF A;  2OJL A;  4ZXG A;  6GSS A;  4KSO A;  4WF5 A;  1AIU A;  2P0G A;  3VLN A;  4BIK A;  4GQF A;  3L78 A;  2DSA A;  2C1Y A;  3WGX A;  1SU9 A;  2CX3 A;  2VL9 A;  2QA1 A;  2IIY A;  3F4S A;  1R5A A;  4Q5F A;  3FR9 A;  4YQV A;  5IPH A;  1PX7 A;  1FVJ A;  1TU7 A;  2BMX A;  1OVN A;  4K8M A;  3TB2 A;  1TK8 B;  4OFM A;  4BVY A;  1GNW A;  4QL9 A;  1FAA A;  4CDO A;  4FIW A;  3LEF A;  1FVK A;  3UAP A;  1GSF A;  2OKA A;  4MZC A;  2KP1 A;  3FY7 A;  3G7Y A;  2VLT A;  4GCI A;  5IPG A;  3TKS E;  3O6T A;  1ZYP A;  5DBQ A;  1PD2 1;  4DSS B;  3IE3 A;  3UVT A;  1H75 A;  4K2D A;  4LMV A;  1ML6 A;  2PUK C;  4WEY A;  5GST A;  2GSR A;  4HQZ A;  1V58 A;  2H8L A;  3WYW A;  5KN1 A;  4XTS A;  2LV3 A;  3F6D A;  3IBH A;  4DVC A;  1F3B A;  1A0F A;  5CNW A;  3I9V 2;  3E0U A;  4NPB A;  3FHK A;  1JHB A;  4G0L A;  1XW9 A;  3PR8 A;  1DBY A;  4AF2 A;  1AUC A;  1Y6E A;  1M3J A;  4IEL A;  2DJ0 A;  3ZFL A;  2HSM A;  2H75 A;  5F8B A;  3RHC A;  3HVN A;  4ISD A;  3M8N A;  3HY2 A;  1K3O A;  3VPT A;  2L5L A;  4IHU A;  6GSX A;  1SD9 A;  4BWQ A;  2EIQ A;  5A4V A;  4G2E A;  2LJK A;  4ID0 A;  2YZU A;  4ICY A;  3V1W A;  1V57 A;  3PPU A;  1QUW A;  1SL2 B;  3UL3 A;  1X5C A;  4MJC A;  4JRR A;  1EGO A;  4EIP A;  2B7K A;  2TIR A;  1T1V A;  1MTC A;  2QSI A;  5A4W A;  1KBN A;  4EKZ A;  3KM6 A;  2A4V A;  1M7T A;  2X64 A;  1A2J A;  1GSS A;  1YY7 A;  2GSS A;  3MWH A;  5LD0 A;  3A5W A;  2PN8 A;  1V9W A;  1TP9 A;  4FQU A;  2GQM A;  1SL0 B;  3C73 A;  1NHY A;  4K0G A;  1A8Y A;  4IW9 A;  3HJO A;  3OR5 A;  1QGV A;  4ZBD A;  4N0V A;  1XG8 A;  3IDV A;  4TXO B;  2M72 A;  2CZ2 A;  2VLV A;  4NHZ A;  2JL4 A;  5IMZ A;  2IMD A;  4JE1 A;  4EL1 A;  4OWY A;  2GSQ A;  5H5S A;  4D73 B;  1Q98 A;  2WZ9 A;  5KOW A;  4MF6 A;  3M0F A;  4AGS A;  1WMJ A;  2LRN A;  3KCM A;  3KP8 A;  3VI7 A;  4MPG A;  2RM5 A;  5CRE A;  4TR4 A;  4NHW A;  1XOB A;  3DYR A;  2GLR A;  4HJM A;  3CBU A;  4GTU A;  5LNK e;  5HFI A;  2JZS A;  2E7P A;  2HSY A;  3QCP A;  2LEG A;  3LXZ A;  2NVL A;  5ECN B;  1AW9 A;  5FWG A;  3GHA A;  2FWH A;  1AQX A;  1Z6N A;  1T8E B;  5JWQ B;  1FB0 A;  3KEB A;  4ZB6 A;  2CQ9 A;  3M9K A;  4IS0 A;  3IHQ A;  4Z7X A;  1R7H A;  2C3T A;  3P90 A;  2YWI A;  1S3A A;  5ECI B;  3P2A A;  1CQH A;  1ZYQ B;  2LS5 A;  2PU9 C;  3DVX A;  3GKN A;  3WT1 A;  3FR6 A;  3UVH A;  1NM3 A;  3HVX A;  4L5L A;  5HR3 A;  2K18 A;  2VCT A;  4IQA A;  1OKT A;  4MLY A;  2BTO T;  5DAL B;  3RPP A;  1XOA A;  3QAW A;  1C72 A;  2I81 A;  4HQS A;  2B3S A;  4L5O A;  3LJR A;  4V1A g;  3EVI A;  2WFC A;  2FWE A;  1SJ6 A;  4I5Q A;  4I97 A;  1XIY A;  3KH9 A;  2JZR A;  4G19 A;  3CXG A;  3IK9 A;  4KE3 A;  3MYD A;  3HD5 A;  3M9J A;  2LJA A;  4DSR A;  4ML6 A;  3VK9 A;  4XS4 B;  22GS A;  2HRF A;  3TOT A;  3CTF A;  5B7C A;  2F3M A;  1FG4 A;  2F9S A;  1GLQ A;  2A4H A;  3TKR A;  4GXZ A;  1XFL A;  4YQM A;  1GTA A;  3GA4 A;  4DEJ A;  2MBT A;  2DJ3 A;  4OFN A;  4HSC X;  3CMI A;  1DE1 A;  4PQ1 A;  1M2B A;  1HD2 A;  2B1L A;  4KCE A;  3LW9 A;  5D96 A;  2O89 A;  4L0W A;  2GTU A;  1SK1 A;  1XWA A;  2PPT A;  1A23 A;  4KDU A;  4HZ2 A;  2L4C A;  1GH2 A;  1DSB A;  2HNL A;  1TXX A;  3F63 A;  4IQ1 A;  3A3T A;  2YJH A;  5GZZ B;  2LUS A;  1S3C A;  5G30 A;  3ED3 A;  2V6K A;  1MEK A;  1GP1 A;  3BOA A;  4XHM A;  2H01 A;  2H6Z A;  5ELG A;  2XBI A;  4ACS A;  2C0F A;  2R5G A;  4Z2U A;  3CQF A;  3RDW A;  5IMV A;  3D4M A;  5F07 A;  3BCK A;  3ZRD A;  3GYK A;  1YZX A;  2HT9 A;  1GL8 A;  3IHG A;  2GGT A;  1GSE A;  4ULX A;  3KTB A;  4EVM A;  3FEU A;  5D93 A;  4K1F A;  4MF5 A;  5GSS A;  2QKE A;  4MAB A;  2R37 A;  4ECB A;  1W4V A;  4WR5 A;  2QA2 A;  1T7P B;  3F0I A;  5ID2 A;  3A2V A;  4V2N A;  3GX0 A;  4EXJ A;  1WPI A;  5JCU A;  4K7O A;  4MDC A;  1XVW A;  1SL1 B;  3F3Q A;  11GS A;  2CT6 A;  4KW6 A;  2PBJ A;  3ERW A;  1JLW A;  1GWC A;  4ECC A;  2KOK A;  1OC3 A;  2LTK A;  4K9Z A;  1O81 A;  5DVB A;  3CTG A;  5DQY A;  2VCV A;  3TKS C;  1EP7 A;  4YQU A;  1VF3 A;  4N11 A;  4TW5 A;  2IFQ A;  2OAD A;  5KEJ A;  3H8Q A;  4P3Y B;  1USB A;  3IPZ A;  4D73 A;  8GSS A;  5HQP A;  2I1U A;  1Q4J A;  2ALB A;  1NW2 A;  4AJ6 A;  2H30 A;  4HI7 A;  4O5U A;  2YWO A;  3GUS A;  1BAY A;  1GUM A;  2FUG 2;  3FZ4 A;  4JED A;  4ZB8 A;  5HR2 A;  3C1S A;  2GZZ A;  3APS A;  4XRA A;  4XCS A;  4K7I A;  4IBP A;  4I6X A;  2E0Q A;  2HE3 A;  2VCW A;  3LYP A;  5AN1 A;  1JFU A;  3QR6 A;  1XW5 A;  2G0F A;  2IN3 A;  4K5R A;  5C00 A;  5C04 A;  2KUC A;  13GS A;  5G5E A;  7GSS A;  1B9Y C;  5G5F A;  3IOS A;  5DAK A;  3A2W A;  1TK0 B;  2VD1 A;  2RUF A;  2YJ7 A;  2PGT A;  1OKD A;  4L8E A;  4MH3 A;  2DJJ A;  2KHP A;  2H76 A;  1K0C A;  1OE7 A;  1YEX A;  1RW1 A;  5B8A A;  1NSW A;  4POB A;  3VPQ A;  2CAQ A;  9GSS A;  2FD3 A;  4GLT A;  1DUG A;  1THO A;  2N5F A;  1J08 A;  4G0K A;  4K2X A;  4WET A;  1A2L A;  4RI7 A;  3Q18 A;  3IA1 A;  1TKD B;  4LL4 B;  5G31 A;  1Z7P A;  3TGZ A;  5ECP B;  4EO3 A;  4FYB A;  4AJ8 A;  2F51 A;  3WGE A;  5IQY A;  1ZCP A;  2GZP A;  1GLP A;  1VF2 A;  2P5R A;  4CY8 A;  4H86 A;  4CHS A;  4OMV A;  2JAD A;  2WS2 A;  2AB6 A;  3ZTL A;  5CAX A;  1UN2 A;  1SK0 A;  5IIZ A;  3TJJ A;  1O8W A;  4AJ7 A;  1TRV A;  3IK7 A;  3GMF A;  1PMT A;  3IAM 2;  2VUP A;  3RHB A;  3A2X A;  1N8J A;  1JZD A;  3ERF A;  3DKS A;  3L4N A;  1GSU A;  1YF0 A;  2VCQ A;  4YAV A;  4XS1 A;  5BRT A;  2FHE A;  3HXS A;  2B6M A;  1Z3E A;  3QD9 A;  2V1M A;  1EZK A;  2H72 A;  3GRX A;  4MCU A;  2H74 A;  2YAN A;  3I43 A;  3GSS A;  3ZL5 A;  3L9S A;  3LSZ A;  1SYX A;  1TI3 A;  3TKQ A;  2VOC A;  3F4T A;  3UOM A;  4POM A;  3F3R A;  1B4Q A;  2RII A;  4PUR A;  1KTE A;  4BVX A;  1YDK A;  2AV4 A;  4K0N A;  4YKF A;  3EMX A;  3ME7 A;  2HI7 A;  4GST A;  1FB6 A;  2O8V B;  1K0B A;  3FZA A;  2F8A A;  2YV7 A;  4BL7 B;  5ECH B;  1BED A;  5E59 A;  5IOW A;  1OAZ A;  3HJP A;  2VM1 A;  1GUH A;  6GST A;  4QL7 A;  1R4W A;  2LKU A;  3I6A A;  1EGR A;  1X5E A;  1PX6 A;  2LST A;  4KA0 A;  5B6N A;  3MIX A;  4J2F A;  2DIZ A;  1NHO A;  2L6C A;  2WDU A;  1MDI A;  2V32 A;  3U6V A;  2FWF A;  2WGR A;  2TRX A;  3GTU A;  1EP8 A;  1TJD A;  2R0G A;  2H70 A;  1XPV A;  2FCH A;  5HFG A;  1J0F A;  2MMO A;  1SD8 A;  1LJR A;  1MDK A;  2V41 A;  3KIJ A;  5AGY A;  3ZYW A;  3RBT A;  4ILF A;  3LG6 A;  2I9H A;  2C80 A;  1WOU A;  4KND A;  5KN2 A;  1TOF A;  4X1U A;  3TKP A;  4RUV A;  4MP4 A;  3D4T A;  3VUR A;  4ZBB A;  3VFI A;  1FO5 A;  3NIV A;  1ZOF A;  1WRY A;  3HYP A;  1GUL A;  3M1G A;  2R2J A;  3D5J A;  1BQ7 A;  5DQS A;  3TRP A;  3UBK A;  1TW9 A;  1UC7 A;  3VWU A;  2MMA A;  5J9B A;  2WCI A;  17GS A;  2BJX A;  1A8L A;  2B1K A;  3TRQ A;  1A24 A;  2H66 A;  5AIX A;  1ERU A;  1ZZY A;  1O6J A;  1TRS A;  2I3Y A;  5L71 A;  5HR1 A;  3D0Z A;  2C0D A;  4MF7 A;  1AXD A;  5CRD A;  1IYH A;  2HZE B;  3WGD A;  3C71 A;  3LFL A;  2DKH A;  3HCZ A;  2FNO A;  2VCX A;  1A2M A;  1K0O A;  1X9W B;  1W89 A;  3CRT A;  4IN0 A;  4LA1 A;  3TDG A;  5CRG A;  3TJF A;  4ZL8 A;  5IOX A;  1ERV A;  1BJX A;  4PX1 A;  2DIY A;  4TXV A;  4RQX A;  3NZN A;  4F0C A;  1TU8 A;  5ECL B;  1GSY A;  5D8I A;  1H4O A;  2DML A;  1SJI A;  14GS A;  1MD3 A;  5ABR A;  2CX4 A;  4EDY A;  3EC3 A;  5A4U A;  3KH7 A;  4JR4 A;  2RM6 A;  3H4K A;  3N5O A;  3ZVJ D;  4F9Z A;  3G9B A;  3L9U A;  5G2Z A;  1YKC A;  4V1A p;  1EEM A;  1XVQ A;  3HA9 A;  1SK2 A;  2RLI A;  2TRC P;  3HVV A;  1XZO A;  2DKI A;  1EWX A;  4MMM A;  1YJ6 A;  1XWG A;  3EU4 A;  3H79 A;  4IP1 A;  5DJL A;  2UZ8 A;  3TJB A;  4G10 A;  2HFD A;  2AYT A;  3GL3 A;  5F05 A;  4X4J A;  3J7Y k;  2R6K A;  2Z9S A;  3E3E A;  2C0E A;  5DCH A;  2IMK A;  2DC5 A;  5IO2 A;  2CVB A;  4KUN A;  3F4R A;  4KF9 A;  5D73 A;  3QFA C;  6GSY A;  4XRD A;  1YKA A;  2H1A A;  1HNB A;  1PFO A;  2YOI A;  2D2Z A;  1XBS A;  2C0G A;  1X9S B;  4JZQ A;  4MA9 A;  2OE3 A;  3BBY A;  1AAZ A;  3P7X A;  1R5P A;  4PXO A;  4DSS A;  4V2M A;  1FW1 A;  3F6F A;  3GH6 A;  3APO A;  3IC8 A;  4USS A;  2DLX A;  1O85 A;  1V40 A;  2JAC A;  5EVO A;  1EEJ A;  1XXU A;  3GFK A;  4OCF A;  1Y25 A;  3CRU A;  4FYC A;  3GKK A;  3W6G A;  2CV4 A;  1YF1 A;  4X0X A;  3DD3 A;  1UVZ A;  4NV2 A;  1WIK A;  3VWV A;  2H19 A;  4V2L A;  4TOP A;  3KD0 A;  1SYR A;  2K8S A;  1HNC A;  1ILO A;  3PGT A;  3APQ A;  3BD2 A;  5ECM B;  4HDE A;  4XS6 A;  2LRT A;  4PNF A;  19GS A;  3DWV A;  4HJ2 A;  4PUA A;  4YAP A;  2DMM A;  3EU3 A;  4Q5Q A;  1THX A;  4NMU A;  2H1B A;  2LJR A;  1VGL A;  4IVF A;  3MSZ A;  5ENU A;  1QMV A;  2GST A;  3TRX A;  2K6V A;  2YZH A;  2P5Q A;  2WUL A;  2VAF A;  5CRW A;  1DE2 A;  2YP6 A;  4BVY B;  4MZB A;  2WJU A;  1I9D A;  3ZRE A;  1EV4 A;  1EOH A;  4MK3 A;  2OBK A;  5DJM A;  4BPY A;  4ZL7 A;  4N0Z A;  1F9M A;  4MPF A;  1F37 A;  1F6M C;  4J56 E;  2HYX A;  2O87 A;  2L6D A;  1E6B A;  3P8W A;  4RQR A;  5B6M A;  3BJ5 A;  2RUE A;  2HZE A;  4POL A;  2EIR A;  1SJZ A;  3QAG A;  1O7U A;  4TXO A;  2V6O A;  3KMN A;  3O76 A;  1QQ2 A;  3RAZ A;  1PSQ A;  4E8H A;  4MNN A;  3ZZX A;  3D6I A;  4WBR D;  4EE0 A;  4OO5 A;  4GQC A;  4PQH A;  2VL2 C;  3G7J A;  4WXT A;  3QMX A;  1PN9 A;  4E8E A;  2XHF A;  4N30 A;  1KEB A;  4I8B A;  2CVK A;  4WBJ A;  1X0R A;  2AAW A;  4G9H A;  2GQL A;  3K8N A;  3VWW A;  1S3D A;  5EY6 A;  2MMZ A;  2DJ2 A;  2FY6 A;  3FMW A;  1X5D A;  3FZ5 A;  1XW6 A;  2L4Q A;  3IRA A;  1K3L A;  4TRX A;  4BA7 A;  1GTU A;  1JLV A;  2FLS A;  2H73 A;  3HKR A;  3ISO A;  4EC0 A;  4MJA A;  1M2D A;  2C3Q A;  4TR3 A;  3L0H A;  2IMF A;  3HDC A;  1B48 A;  3IAS 2;  3GV1 A;  1ST9 A;  2YN1 A;  2ON5 A;  1T4Y A;  4TR0 A;  2GZY A;  1T4Z A;  3ZVJ A;  1YEP A;  1TK5 B;  1VF4 A;  2LRC A;  3LWA A;  5JWR B;  4NWY A;  5INY A;  3C7M A;  3GUR A;  5IO0 A;  4PUF C;  2VM2 A;  5DAL A;  4MZW A;  1PL2 A;  1ERW A;  3M3M A;  2LQO A;  1WJK A;  2GS3 A;  3EYT A;  2VLU A;  5E4W A;  3DIE A;  2PER A;  3GL5 A;  3LYK A;  4ECJ A;  2H0I A;  5ELA A;  1QXH A;  3J7Y b;  3DVW A;  2DJK A;  2MYG A;  2C4J A;  2LQQ A;  3LOR A;  4NAX A;  4XIH A;  4K7N A;  1U87 A;  5KOX A;  4XS4 A;  3KMO A;  4CY6 A;  4ECI A;  6GSU A;  2YWN A;  1ABA A;  5IMC A;  2NBS A;  5ECK B;  4FYU A;  5GAP D;  3MAK A;  2H6Y A;  1IYI A;  1PA3 A;  2P31 A;  2HRK A;  3EPT A;  1MDJ A;  4KH7 A;  3TKS A;  18GS A;  1U3I A;  3SWL A;  4DSQ A;  2XBQ A;  4GSN A;  2JU5 A;  4NXI A;  2F8F A;  4KDY A;  2CA8 A;  4IJ3 A;  4MH2 A;  1X9M B;  3F9U A;  3KTL A;  4GWR A;  5IMF A;  5AIV A;  5IMA A;  3D21 A;  3EIN A;  3E9J B;  2OAC A;  3C1R A;  1M3I A;  5J4U A;  1OC9 B;  3GST A;  3EMP A;  3Q74 A;  3IV4 A;  2VO4 A;  1PL1 A;  1GTB A;  1TDI A;  4POK A;  3DGQ A;  3GNJ A;  4KAE A;  2IJY A;  4GSS A;  4JR6 A;  1ACV A;  3QAV A;  1CQG A;  4WKW A;  3GX8 A;  1K0A A;  1PN0 A;  4YKG A;  3Q19 A;  3MNG A;  5ECR B;  2ES7 A;  2YWM A;  1HYU A;  2ZUP A;  2J9H A;  1RQM A;  1RK4 A;  3VI5 A;  3FYG A;  1XWC A;  5H5Q A;  10GS A;  4I2U A;  1V98 A;  1G6Y A;  2R3X A;  2MMN A;  4O32 A;  3HZ8 A;  2X49 A;  3HHV A;  4PQI A;  3GN3 A;  1XWK A;  4IJI A;  5COH A;  3TJG A;  5FT3 A;  2L5O A;  5AIS A;  3US3 A;  1R26 A;  5CP1 A;  1LU4 A;  1O8X A;  3D22 A;  1B8X A;  1OYJ A;  3L9V A;  3UJ1 A;  2E2G A;  4BWS A;  1UA5 A;  2I4A A;  5D9X A;  1BYE A;  2HRN A;  1M9B A;  4MJE A;  4ZIL A;  1WP0 A;  2N5A A;  3GKM A;  4LLR A;  3W8J A;  5CYY A;  3U5R E;  1Z7R A;  4KX4 A;  2FA8 A;  5H5R A;  5J9C A;  2JZT A;  1F2E A;  2H71 A;  1FHE A;  1K3Y A;  2H1D A;  2H0H A;  3ZLP A;  3GKX A;  2C3N A;  2GQK A;  3UMA A;  3FW2 A;  5KN0 A;  1WWJ A;  2M80 A;  1JZR A;  4FO5 A;  3FRC A;  3EUR A;  2EIO A;  4FH8 A;  1ZL9 A;  5ID2 B;  20GS A;  3AY8 A;  2XPD A;  4K5S A;  2FGX A;  1M9A A;  4HUA A;  3UAR A;  2R4V A;  5IMD A;  4G0I A;  4O5R A;  1Z9H A;  3I69 A;  1YQ1 A;  4NV5 A;  5CO3 A;  4A5P A;  3QOU A;  3TCO A;  3FK8 A;  1PQN A;  4TR1 B;  3MDK A;  1J9B A;  1U88 A;  4X43 A;  4Q5R A;  5D9T A;  1ZYE A;  2B7J A;  3JCM L;  2IFQ B;  2WB9 A;  4GF0 A;  1OE8 A;  2YPM A;  2GDR A;  2G2Q A;  3LGC A;  2PMT A;  3SBC A;  3C8E A;  5JWO B;  6GSV A;  4IKH A;  2X99 A;  3QPM A;  3KZQ A;  1AQW A;  1S3R A;  3CSH A;  5ECS A;  3ZIJ A;  4PGT A;  2VL3 A;  5J5N A;  1QFN A;  3Q6O A;  2VD0 A;  3PIN A;  3HVS A;  4RI6 A;  4OCE A;  3CYN A;  4O92 A;  1MD4 A;  2R0C A;  5A5K A;  5JCW A;  5BMU A;  4PTS A;  1EOG A;  2ZNM A;  3TOU A;  1G0T A;  3HZ4 A;  2HSH A;  3H1N A;  3N9J A;  2IME A;  5EL8 A;  4KB3 A;  5J3R A;  3DML A;  1SKR B;  2PVQ A;  2L57 A;  4HOJ A;  1K0N A;  2KLX A;  1I5G A;  1PKZ A;  3UIW A;  2AUV A;  3WD6 A;  1OC9 A;  5DAK B;  1B9X C;  1GSQ A;  1GSD A;  2MZC A;  2YCD A;  3LQ7 A;  3BCI A;  1TRU A;  2NTO A;  2LNT A;  3R3E A;  4TKY A;  1QK8 A;  3FKF A;  3HJM A;  1G6W A;  1LBK A;  1ZGN A;  2OA7 A;  1N2A A;  3CSJ A;  4KCA A;  2VIM A;  4KGI A;  3O3T A;  2HLS A;  4BL7 A;  2X8G A;  2CVD A;  3G7I A;  3KXO A;  3WT2 A;  3R2Q A;  4YH2 A;  2K8V A;  1AQV A;  4HZ4 A;  2H0G A;  5DCG A;  4K6X A;  1ZYN A;  4ZB9 A;  3KP9 A;  1SEN A;  1KNG A;  4LMW A;  12GS A;  4Z2T A;  1G7O A;  4F0B A;  3TJK A;  1GNE A;  4ZIJ A;  4EF0 A;  4OD7 A;  1M99 A;  1PRX A;  3S9F A;  4O5Q A;  1Z6M A;  2FWG A;  3TUE A;  2REM A;  1A0R P;  3ZIV A;  1ZMA A;  2K9F A;  4TN8 A;  4Z2R A;  4TVE A;  2JSZ A;  2X8H A;  3PH9 A;  3FZ9 A;  5ECQ B;  2DBC A;  3CSI A;  4WF4 A;  6GSW A;  2B5Y A;  3UBL A;  1BG5 A;  1M2A A;  4KDX A;  2N5B A;  4QQ7 A;  4Q5N A;  1EV9 A;  2CZ3 A;  5FHI A;  2YNX A;  4BVX B;  4J57 E;  2QC7 A;  2JSY A;  3EE2 A;  2M46 A;  4HS1 A;  4N10 A;  4JBB A;  3QDN A; 
#chains in the Genus database with same CATH homology
 3UEM A;  2HZF A;  1U3A A;  2NPB A;  2QGV A;  5B8B A;  2B5X A;  3LXT A;  2EC4 A;  1F3A A;  4F82 A;  3FR3 A;  4ZBA A;  2OE1 A;  3KGK A;  2PVO C;  3GH9 A;  1HNA A;  1TTZ A;  2MBS A;  4KSM A;  3W8S A;  2AJQ B;  4IP6 A;  3RPN A;  4ZL9 A;  2DJ1 A;  3GTU B;  3KJY A;  3VWX A;  2ZCT A;  1GTI A;  2IWT A;  4TR1 A;  5F0G A;  1TI1 A;  1JZO A;  2WRT A;  1PGT A;  1G7E A;  4F03 A;  1SKS B;  1WE0 A;  2ON7 A;  2GT6 A;  4HU9 A;  4OO4 A;  2V2G A;  1GUK A;  2HRA A;  5KN3 A;  4IGJ A;  4O7H A;  1M0U A;  3EWL A;  1SKW B;  2XPE A;  3H93 A;  5G1L A;  2IPA A;  2IL3 A;  5LCZ A;  4F2I A;  4CW9 A;  2H6X A;  3A5I A;  3ZFB A;  1XWB A;  1T00 A;  2C8U A;  2A2S A;  3IXR A;  5JCG A;  5HFK A;  1GRX A;  2VCZ A;  3ZML A;  3F8U A;  4JU5 A;  1URM A;  2KP2 A;  2A2P A;  4EIQ A;  2L59 A;  2J23 A;  2H1G A;  2OE0 A;  1Z5Y E;  1JZW A;  2GVP A;  4HEA 2;  5IM9 A;  2IMI A;  2X8C A;  1V2A A;  4I2T A;  4PNG A;  2B5E A;  3NOF A;  1HQO A;  4EDZ A;  4OFT A;  2A2R A;  2XC2 A;  2GT5 A;  1K0D A;  1FOV A;  1B4P A;  3ZMK A;  2YV9 A;  3IC4 A;  2AHE A;  2HXK A;  2OBI A;  5D9V A;  2FA4 A;  5D9W A;  5DDL A;  1U6T A;  1TRW A;  2LNS A;  1FOH A;  5G1K A;  1VRS D;  3DRN A;  2PWJ A;  3ZIT A;  3QFB C;  3ERG A;  2X4A A;  2R0P A;  1OC8 A;  4LL1 B;  2NDO A;  3ME8 A;  1VF1 A;  1XCC A;  1K0M A;  1ON4 A;  3IR4 A;  4ML1 A;  4EUY A;  16GS A;  4GRF A;  2O7K A;  5GAN D;  5CRH A;  5J41 A;  5ECO B;  1ERT A;  1T3B A;  2CAI A;  2O85 A;  1E2Y A;  4L0U A;  1PKW A;  1O73 A;  4WR4 A;  5F06 A;  4HU7 A;  2VL2 A;  5HR0 A;  3DXB A;  3GIX A;  1AC1 A;  3DEX A;  1BX9 A;  4MJB A;  2E2M A;  5EPF A;  2OJL A;  4ZXG A;  6GSS A;  4KSO A;  4WF5 A;  1AIU A;  2P0G A;  3VLN A;  4GQF A;  3L78 A;  2DSA A;  2C1Y A;  3WGX A;  1SU9 A;  2CX3 A;  2VL9 A;  2QA1 A;  2IIY A;  3F4S A;  1R5A A;  4Q5F A;  3FR9 A;  4YQV A;  5IPH A;  1PX7 A;  1FVJ A;  1TU7 A;  2BMX A;  1OVN A;  4K8M A;  3TB2 A;  1TK8 B;  4OFM A;  4BVY A;  1GNW A;  4QL9 A;  1FAA A;  4CDO A;  4FIW A;  3LEF A;  1FVK A;  3UAP A;  1GSF A;  2OKA A;  4MZC A;  2KP1 A;  3FY7 A;  3G7Y A;  2VLT A;  4GCI A;  5IPG A;  3TKS E;  3O6T A;  1ZYP A;  5DBQ A;  1PD2 1;  4DSS B;  3IE3 A;  3UVT A;  1H75 A;  4K2D A;  4LMV A;  1ML6 A;  2PUK C;  4WEY A;  5GST A;  2GSR A;  4HQZ A;  1V58 A;  2H8L A;  3WYW A;  5KN1 A;  4XTS A;  2LV3 A;  3F6D A;  3IBH A;  4DVC A;  1F3B A;  1A0F A;  5CNW A;  3I9V 2;  3E0U A;  4NPB A;  3FHK A;  1JHB A;  4G0L A;  1XW9 A;  3PR8 A;  1DBY A;  4AF2 A;  1AUC A;  1Y6E A;  4IEL A;  2DJ0 A;  3ZFL A;  2HSM A;  2H75 A;  5F8B A;  3RHC A;  4ISD A;  3M8N A;  3HY2 A;  1K3O A;  3VPT A;  2L5L A;  4IHU A;  6GSX A;  1SD9 A;  4BWQ A;  2EIQ A;  5A4V A;  4G2E A;  2LJK A;  4ID0 A;  2YZU A;  4ICY A;  3V1W A;  1V57 A;  3PPU A;  1QUW A;  1SL2 B;  3UL3 A;  1X5C A;  4MJC A;  4JRR A;  1EGO A;  4EIP A;  2B7K A;  2TIR A;  1T1V A;  1MTC A;  2QSI A;  5A4W A;  1KBN A;  4EKZ A;  3KM6 A;  2A4V A;  1M7T A;  2X64 A;  1A2J A;  1GSS A;  1YY7 A;  2GSS A;  3MWH A;  5LD0 A;  3A5W A;  2PN8 A;  1V9W A;  1TP9 A;  4FQU A;  2GQM A;  1SL0 B;  3C73 A;  1NHY A;  4K0G A;  1A8Y A;  4IW9 A;  3HJO A;  3OR5 A;  1QGV A;  4ZBD A;  4N0V A;  3IDV A;  4TXO B;  2M72 A;  2CZ2 A;  2VLV A;  4NHZ A;  2JL4 A;  5IMZ A;  2IMD A;  4JE1 A;  4EL1 A;  4OWY A;  2GSQ A;  5H5S A;  4D73 B;  1Q98 A;  2WZ9 A;  5KOW A;  4MF6 A;  3M0F A;  4AGS A;  1WMJ A;  2LRN A;  3KCM A;  3KP8 A;  3VI7 A;  4MPG A;  2RM5 A;  5CRE A;  4TR4 A;  4NHW A;  1XOB A;  3DYR A;  2GLR A;  4HJM A;  3CBU A;  4GTU A;  5LNK e;  5HFI A;  2JZS A;  2E7P A;  2HSY A;  3QCP A;  2LEG A;  3LXZ A;  2NVL A;  5ECN B;  1AW9 A;  5FWG A;  3GHA A;  2FWH A;  1AQX A;  1Z6N A;  1T8E B;  5JWQ B;  1FB0 A;  3KEB A;  4ZB6 A;  2CQ9 A;  3M9K A;  4IS0 A;  3IHQ A;  4Z7X A;  1R7H A;  2C3T A;  3P90 A;  2YWI A;  1S3A A;  5ECI B;  3P2A A;  1CQH A;  1ZYQ B;  2LS5 A;  2PU9 C;  3DVX A;  3GKN A;  3WT1 A;  3FR6 A;  3UVH A;  1NM3 A;  3HVX A;  4L5L A;  5HR3 A;  2K18 A;  2VCT A;  4IQA A;  1OKT A;  4MLY A;  2BTO T;  5DAL B;  3RPP A;  1XOA A;  3QAW A;  1C72 A;  2I81 A;  4HQS A;  2B3S A;  4L5O A;  3LJR A;  4V1A g;  3EVI A;  2WFC A;  2FWE A;  1SJ6 A;  4I5Q A;  4I97 A;  1XIY A;  3KH9 A;  2JZR A;  4G19 A;  3CXG A;  3IK9 A;  4KE3 A;  3MYD A;  3HD5 A;  3M9J A;  2LJA A;  4DSR A;  4ML6 A;  3VK9 A;  4XS4 B;  22GS A;  2HRF A;  3TOT A;  3CTF A;  5B7C A;  2F3M A;  1FG4 A;  2F9S A;  1GLQ A;  2A4H A;  3TKR A;  4GXZ A;  1XFL A;  4YQM A;  1GTA A;  3GA4 A;  4DEJ A;  2MBT A;  2DJ3 A;  4OFN A;  3CMI A;  1DE1 A;  4PQ1 A;  1M2B A;  1HD2 A;  2B1L A;  4KCE A;  3LW9 A;  5D96 A;  2O89 A;  4L0W A;  2GTU A;  1SK1 A;  1XWA A;  2PPT A;  1A23 A;  4KDU A;  4HZ2 A;  2L4C A;  1GH2 A;  1DSB A;  2HNL A;  1TXX A;  3F63 A;  4IQ1 A;  3A3T A;  2YJH A;  5GZZ B;  2LUS A;  1S3C A;  5G30 A;  3ED3 A;  2V6K A;  1MEK A;  1GP1 A;  3BOA A;  4XHM A;  2H01 A;  2H6Z A;  5ELG A;  2XBI A;  4ACS A;  2C0F A;  2R5G A;  4Z2U A;  3RDW A;  5IMV A;  3D4M A;  5F07 A;  3BCK A;  3ZRD A;  3GYK A;  1YZX A;  2HT9 A;  1GL8 A;  3IHG A;  2GGT A;  1GSE A;  4ULX A;  3KTB A;  4EVM A;  3FEU A;  5D93 A;  4K1F A;  4MF5 A;  5GSS A;  2QKE A;  4MAB A;  2R37 A;  4ECB A;  1W4V A;  4WR5 A;  2QA2 A;  1T7P B;  3F0I A;  5ID2 A;  3A2V A;  4V2N A;  3GX0 A;  4EXJ A;  1WPI A;  5JCU A;  4K7O A;  4MDC A;  1XVW A;  1SL1 B;  3F3Q A;  11GS A;  2CT6 A;  4KW6 A;  2PBJ A;  3ERW A;  1JLW A;  1GWC A;  4ECC A;  2KOK A;  1OC3 A;  2LTK A;  4K9Z A;  1O81 A;  5DVB A;  3CTG A;  5DQY A;  2VCV A;  3TKS C;  1EP7 A;  4YQU A;  1VF3 A;  4N11 A;  4TW5 A;  2IFQ A;  2OAD A;  5KEJ A;  3H8Q A;  4P3Y B;  1USB A;  3IPZ A;  4D73 A;  8GSS A;  5HQP A;  2I1U A;  1Q4J A;  2ALB A;  1NW2 A;  4AJ6 A;  2H30 A;  4HI7 A;  4O5U A;  2YWO A;  3GUS A;  1BAY A;  1GUM A;  2FUG 2;  3FZ4 A;  4JED A;  4ZB8 A;  5HR2 A;  3C1S A;  2GZZ A;  3APS A;  4XRA A;  4XCS A;  4K7I A;  4IBP A;  4I6X A;  2E0Q A;  2HE3 A;  2VCW A;  3LYP A;  5AN1 A;  1JFU A;  3QR6 A;  1XW5 A;  2G0F A;  2IN3 A;  4K5R A;  5C00 A;  5C04 A;  2KUC A;  13GS A;  5G5E A;  7GSS A;  1B9Y C;  5G5F A;  3IOS A;  5DAK A;  3A2W A;  1TK0 B;  2VD1 A;  2RUF A;  2YJ7 A;  2PGT A;  1OKD A;  4L8E A;  4MH3 A;  2DJJ A;  2KHP A;  2H76 A;  1K0C A;  1OE7 A;  1YEX A;  1RW1 A;  5B8A A;  1NSW A;  4POB A;  3VPQ A;  2CAQ A;  9GSS A;  2FD3 A;  4GLT A;  1DUG A;  1THO A;  2N5F A;  1J08 A;  4G0K A;  4K2X A;  4WET A;  1A2L A;  4RI7 A;  3Q18 A;  3IA1 A;  1TKD B;  4LL4 B;  5G31 A;  1Z7P A;  3TGZ A;  5ECP B;  4EO3 A;  4FYB A;  4AJ8 A;  2F51 A;  3WGE A;  5IQY A;  1ZCP A;  2GZP A;  1GLP A;  1VF2 A;  2P5R A;  4CY8 A;  4H86 A;  4CHS A;  4OMV A;  2JAD A;  2WS2 A;  2AB6 A;  3ZTL A;  5CAX A;  1UN2 A;  1SK0 A;  5IIZ A;  3TJJ A;  1O8W A;  4AJ7 A;  1TRV A;  3IK7 A;  3GMF A;  1PMT A;  3IAM 2;  2VUP A;  3RHB A;  3A2X A;  1N8J A;  1JZD A;  3ERF A;  3DKS A;  3L4N A;  1GSU A;  1YF0 A;  2VCQ A;  4YAV A;  4XS1 A;  5BRT A;  2FHE A;  3HXS A;  2B6M A;  1Z3E A;  3QD9 A;  2V1M A;  1EZK A;  2H72 A;  3GRX A;  4MCU A;  2H74 A;  2YAN A;  3I43 A;  3GSS A;  3ZL5 A;  3L9S A;  3LSZ A;  1SYX A;  1TI3 A;  3TKQ A;  2VOC A;  3F4T A;  3UOM A;  4POM A;  3F3R A;  1B4Q A;  2RII A;  4PUR A;  1KTE A;  4BVX A;  1YDK A;  2AV4 A;  4K0N A;  4YKF A;  3EMX A;  3ME7 A;  2HI7 A;  4GST A;  1FB6 A;  2O8V B;  1K0B A;  3FZA A;  2F8A A;  2YV7 A;  4BL7 B;  5ECH B;  1BED A;  5E59 A;  5IOW A;  1OAZ A;  3HJP A;  2VM1 A;  1GUH A;  6GST A;  4QL7 A;  1R4W A;  2LKU A;  3I6A A;  1EGR A;  1X5E A;  1PX6 A;  2LST A;  4KA0 A;  5B6N A;  3MIX A;  4J2F A;  2DIZ A;  1NHO A;  2L6C A;  2WDU A;  1MDI A;  2V32 A;  3U6V A;  2FWF A;  2WGR A;  2TRX A;  3GTU A;  1EP8 A;  1TJD A;  2R0G A;  2H70 A;  1XPV A;  2FCH A;  5HFG A;  1J0F A;  2MMO A;  1SD8 A;  1LJR A;  1MDK A;  2V41 A;  3KIJ A;  5AGY A;  3ZYW A;  3RBT A;  4ILF A;  3LG6 A;  2I9H A;  2C80 A;  1WOU A;  4KND A;  5KN2 A;  1TOF A;  4X1U A;  3TKP A;  4RUV A;  4MP4 A;  3D4T A;  3VUR A;  4ZBB A;  3VFI A;  1FO5 A;  3NIV A;  1ZOF A;  1WRY A;  3HYP A;  1GUL A;  3M1G A;  2R2J A;  3D5J A;  1BQ7 A;  5DQS A;  3TRP A;  3UBK A;  1TW9 A;  1UC7 A;  3VWU A;  2MMA A;  5J9B A;  2WCI A;  17GS A;  2BJX A;  1A8L A;  2B1K A;  3TRQ A;  1A24 A;  2H66 A;  5AIX A;  1ERU A;  1ZZY A;  1O6J A;  1TRS A;  2I3Y A;  5L71 A;  5HR1 A;  3D0Z A;  2C0D A;  4MF7 A;  1AXD A;  5CRD A;  1IYH A;  2HZE B;  3WGD A;  3C71 A;  3LFL A;  2DKH A;  3HCZ A;  2FNO A;  2VCX A;  1A2M A;  1K0O A;  1X9W B;  1W89 A;  3CRT A;  4IN0 A;  4LA1 A;  3TDG A;  5CRG A;  3TJF A;  4ZL8 A;  5IOX A;  1ERV A;  1BJX A;  4PX1 A;  2DIY A;  4TXV A;  4RQX A;  3NZN A;  4F0C A;  1TU8 A;  5ECL B;  1GSY A;  5D8I A;  1H4O A;  2DML A;  1SJI A;  14GS A;  1MD3 A;  5ABR A;  2CX4 A;  4EDY A;  3EC3 A;  5A4U A;  3KH7 A;  4JR4 A;  2RM6 A;  3H4K A;  3N5O A;  3ZVJ D;  4F9Z A;  3G9B A;  3L9U A;  5G2Z A;  1YKC A;  4V1A p;  1EEM A;  1XVQ A;  3HA9 A;  1SK2 A;  2RLI A;  2TRC P;  3HVV A;  1XZO A;  2DKI A;  1EWX A;  4MMM A;  1YJ6 A;  1XWG A;  3EU4 A;  3H79 A;  4IP1 A;  5DJL A;  2UZ8 A;  3TJB A;  4G10 A;  2HFD A;  2AYT A;  3GL3 A;  5F05 A;  4X4J A;  3J7Y k;  2R6K A;  2Z9S A;  3E3E A;  2C0E A;  5DCH A;  2IMK A;  2DC5 A;  5IO2 A;  2CVB A;  4KUN A;  3F4R A;  4KF9 A;  5D73 A;  3QFA C;  6GSY A;  4XRD A;  1YKA A;  2H1A A;  1HNB A;  2YOI A;  2D2Z A;  1XBS A;  2C0G A;  1X9S B;  4JZQ A;  4MA9 A;  2OE3 A;  3BBY A;  1AAZ A;  3P7X A;  1R5P A;  4PXO A;  4DSS A;  4V2M A;  1FW1 A;  3F6F A;  3GH6 A;  3APO A;  3IC8 A;  4USS A;  2DLX A;  1O85 A;  1V40 A;  2JAC A;  5EVO A;  1EEJ A;  1XXU A;  3GFK A;  4OCF A;  1Y25 A;  3CRU A;  4FYC A;  3GKK A;  3W6G A;  2CV4 A;  1YF1 A;  4X0X A;  3DD3 A;  1UVZ A;  4NV2 A;  1WIK A;  3VWV A;  2H19 A;  4V2L A;  4TOP A;  3KD0 A;  1SYR A;  2K8S A;  1HNC A;  1ILO A;  3PGT A;  3APQ A;  3BD2 A;  5ECM B;  4HDE A;  4XS6 A;  2LRT A;  4PNF A;  19GS A;  3DWV A;  4HJ2 A;  4PUA A;  4YAP A;  2DMM A;  3EU3 A;  4Q5Q A;  1THX A;  4NMU A;  2H1B A;  2LJR A;  1VGL A;  4IVF A;  3MSZ A;  5ENU A;  1QMV A;  2GST A;  3TRX A;  2K6V A;  2YZH A;  2P5Q A;  2WUL A;  2VAF A;  5CRW A;  1DE2 A;  2YP6 A;  4BVY B;  4MZB A;  2WJU A;  1I9D A;  3ZRE A;  1EV4 A;  1EOH A;  4MK3 A;  2OBK A;  5DJM A;  4BPY A;  4ZL7 A;  4N0Z A;  1F9M A;  4MPF A;  1F37 A;  1F6M C;  4J56 E;  2HYX A;  2O87 A;  2L6D A;  1E6B A;  3P8W A;  4RQR A;  5B6M A;  3BJ5 A;  2RUE A;  2HZE A;  4POL A;  2EIR A;  1SJZ A;  3QAG A;  1O7U A;  4TXO A;  2V6O A;  3KMN A;  3O76 A;  1QQ2 A;  3RAZ A;  1PSQ A;  4E8H A;  4MNN A;  3ZZX A;  3D6I A;  4WBR D;  4EE0 A;  4OO5 A;  4GQC A;  4PQH A;  2VL2 C;  3G7J A;  4WXT A;  3QMX A;  1PN9 A;  4E8E A;  2XHF A;  4N30 A;  1KEB A;  4I8B A;  2CVK A;  4WBJ A;  1X0R A;  2AAW A;  4G9H A;  2GQL A;  3K8N A;  3VWW A;  1S3D A;  5EY6 A;  2MMZ A;  2DJ2 A;  2FY6 A;  3FMW A;  1X5D A;  3FZ5 A;  1XW6 A;  2L4Q A;  3IRA A;  1K3L A;  4TRX A;  4BA7 A;  1GTU A;  1JLV A;  2FLS A;  2H73 A;  3HKR A;  3ISO A;  4EC0 A;  4MJA A;  1M2D A;  2C3Q A;  4TR3 A;  3L0H A;  2IMF A;  3HDC A;  1B48 A;  3IAS 2;  3GV1 A;  1ST9 A;  2YN1 A;  2ON5 A;  1T4Y A;  4TR0 A;  2GZY A;  1T4Z A;  3ZVJ A;  1YEP A;  1TK5 B;  1VF4 A;  2LRC A;  3LWA A;  5JWR B;  4NWY A;  5INY A;  3C7M A;  3GUR A;  5IO0 A;  4PUF C;  2VM2 A;  5DAL A;  4MZW A;  1PL2 A;  1ERW A;  3M3M A;  2LQO A;  1WJK A;  2GS3 A;  3EYT A;  2VLU A;  5E4W A;  3DIE A;  2PER A;  3GL5 A;  3LYK A;  4ECJ A;  2H0I A;  5ELA A;  1QXH A;  3J7Y b;  3DVW A;  2DJK A;  2MYG A;  2C4J A;  2LQQ A;  3LOR A;  4NAX A;  4XIH A;  4K7N A;  1U87 A;  5KOX A;  4XS4 A;  3KMO A;  4CY6 A;  4ECI A;  6GSU A;  2YWN A;  1ABA A;  5IMC A;  2NBS A;  5ECK B;  4FYU A;  5GAP D;  3MAK A;  2H6Y A;  1IYI A;  1PA3 A;  2P31 A;  2HRK A;  3EPT A;  1MDJ A;  4KH7 A;  3TKS A;  18GS A;  1U3I A;  3SWL A;  4DSQ A;  2XBQ A;  4GSN A;  2JU5 A;  4NXI A;  2F8F A;  4KDY A;  2CA8 A;  4IJ3 A;  4MH2 A;  1X9M B;  3F9U A;  3KTL A;  4GWR A;  5IMF A;  5AIV A;  5IMA A;  3D21 A;  3EIN A;  3E9J B;  2OAC A;  3C1R A;  5J4U A;  1OC9 B;  3GST A;  3EMP A;  3Q74 A;  3IV4 A;  2VO4 A;  1PL1 A;  1GTB A;  1TDI A;  4POK A;  3DGQ A;  3GNJ A;  4KAE A;  2IJY A;  4GSS A;  4JR6 A;  1ACV A;  3QAV A;  1CQG A;  4WKW A;  3GX8 A;  1K0A A;  1PN0 A;  4YKG A;  3Q19 A;  3MNG A;  5ECR B;  2ES7 A;  2YWM A;  1HYU A;  2ZUP A;  2J9H A;  1RQM A;  1RK4 A;  3VI5 A;  3FYG A;  1XWC A;  5H5Q A;  10GS A;  4I2U A;  1V98 A;  1G6Y A;  2R3X A;  2MMN A;  4O32 A;  3HZ8 A;  2X49 A;  3HHV A;  4PQI A;  3GN3 A;  1XWK A;  4IJI A;  5COH A;  3TJG A;  5FT3 A;  2L5O A;  5AIS A;  3US3 A;  1R26 A;  5CP1 A;  1LU4 A;  1O8X A;  3D22 A;  1B8X A;  1OYJ A;  3L9V A;  3UJ1 A;  2E2G A;  4BWS A;  1UA5 A;  2I4A A;  5D9X A;  1BYE A;  2HRN A;  1M9B A;  4MJE A;  4ZIL A;  1WP0 A;  2N5A A;  3GKM A;  4LLR A;  3W8J A;  5CYY A;  3U5R E;  1Z7R A;  4KX4 A;  2FA8 A;  5H5R A;  5J9C A;  2JZT A;  1F2E A;  2H71 A;  1FHE A;  1K3Y A;  2H1D A;  2H0H A;  3ZLP A;  3GKX A;  2C3N A;  2GQK A;  3UMA A;  3FW2 A;  5KN0 A;  1WWJ A;  2M80 A;  1JZR A;  4FO5 A;  3FRC A;  3EUR A;  2EIO A;  4FH8 A;  1ZL9 A;  5ID2 B;  20GS A;  3AY8 A;  2XPD A;  4K5S A;  2FGX A;  1M9A A;  4HUA A;  3UAR A;  2R4V A;  5IMD A;  4G0I A;  4O5R A;  1Z9H A;  3I69 A;  1YQ1 A;  4NV5 A;  5CO3 A;  4A5P A;  3QOU A;  3TCO A;  3FK8 A;  1PQN A;  4TR1 B;  3MDK A;  1J9B A;  1U88 A;  4X43 A;  4Q5R A;  5D9T A;  1ZYE A;  2B7J A;  3JCM L;  2IFQ B;  2WB9 A;  4GF0 A;  1OE8 A;  2YPM A;  2GDR A;  2G2Q A;  3LGC A;  2PMT A;  3SBC A;  3C8E A;  5JWO B;  6GSV A;  4IKH A;  2X99 A;  3QPM A;  3KZQ A;  1AQW A;  3CSH A;  5ECS A;  3ZIJ A;  4PGT A;  2VL3 A;  5J5N A;  1QFN A;  3Q6O A;  2VD0 A;  3PIN A;  3HVS A;  4RI6 A;  4OCE A;  3CYN A;  4O92 A;  1MD4 A;  2R0C A;  5A5K A;  5JCW A;  5BMU A;  4PTS A;  1EOG A;  2ZNM A;  3TOU A;  1G0T A;  3HZ4 A;  2HSH A;  3H1N A;  3N9J A;  2IME A;  5EL8 A;  4KB3 A;  5J3R A;  3DML A;  1SKR B;  2PVQ A;  2L57 A;  4HOJ A;  1K0N A;  2KLX A;  1I5G A;  1PKZ A;  3UIW A;  2AUV A;  3WD6 A;  1OC9 A;  5DAK B;  1B9X C;  1GSQ A;  1GSD A;  2MZC A;  2YCD A;  3LQ7 A;  3BCI A;  1TRU A;  2NTO A;  2LNT A;  3R3E A;  4TKY A;  1QK8 A;  3FKF A;  3HJM A;  1G6W A;  1LBK A;  1ZGN A;  2OA7 A;  1N2A A;  3CSJ A;  4KCA A;  2VIM A;  4KGI A;  3O3T A;  2HLS A;  4BL7 A;  2X8G A;  2CVD A;  3G7I A;  3KXO A;  3WT2 A;  3R2Q A;  4YH2 A;  2K8V A;  1AQV A;  4HZ4 A;  2H0G A;  5DCG A;  4K6X A;  1ZYN A;  4ZB9 A;  3KP9 A;  1SEN A;  1KNG A;  4LMW A;  12GS A;  4Z2T A;  1G7O A;  4F0B A;  3TJK A;  1GNE A;  4ZIJ A;  4EF0 A;  4OD7 A;  1M99 A;  1PRX A;  3S9F A;  4O5Q A;  1Z6M A;  2FWG A;  3TUE A;  2REM A;  1A0R P;  3ZIV A;  1ZMA A;  2K9F A;  4TN8 A;  4Z2R A;  4TVE A;  2JSZ A;  2X8H A;  3PH9 A;  3FZ9 A;  5ECQ B;  2DBC A;  3CSI A;  4WF4 A;  6GSW A;  2B5Y A;  3UBL A;  1BG5 A;  1M2A A;  4KDX A;  2N5B A;  4QQ7 A;  4Q5N A;  1EV9 A;  2CZ3 A;  5FHI A;  2YNX A;  4BVX B;  4J57 E;  2QC7 A;  2JSY A;  3EE2 A;  2M46 A;  4HS1 A;  4N10 A;  4JBB A;  3QDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...