3ZRDA

Oxidised thiol peroxidase (tpx) from yersinia pseudotuberculosis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
174
structure length
174
Chain Sequence
QGIDPFTMTQTVHFQGNPVSVAGKLPQIGDKAKDFTLVAKDLSDVALSSFAGKRKVLNIFPSIDTGVCAASVRKFNQLAGELENTVVLCISSDLPFAQSRFCGAEGLSNVITLSTLRGADFKQAYGVAITEGPLAGLTARAVVVLDGQDNVIYSELVNEITTEPNYDAALAALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL PEROXIDASE
publication title Structural Characterisation of Tpx from Yersinia Pseudotuberculosis Reveals Insights Into the Binding of Salicylidene Acylhydrazide Compounds.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Oxidoreductase
total genus 55
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zrdA00
1HD2A 1GWCA 3GMFA 2VOCA 1F3AA 1AQXA 5KN3A 4G9HA 1J9BA 3HVVA 3IR4A 3DVWA 1WRYA 4K1FA 1GP1A 1T1VA 4HQZA 5HFKA 2MBSA 2YNXA 4I97A 1JZDA 4ECCA 1A8LA 1YZXA 1S3AA 1KTEA 1SD8A 4KGIA 3G7YA 3Q6OA 1OC3A 2WRTA 2FNOA 3EU4A 2YANA 5HFIA 2DMLA 4TR4A 4BVYA 1YDKA 2L6CA 2BMXA 5AN1A 3L4NA 2O89A 1E6BA 3ZIVA 3CSHA 1XXUA 1PL1A 5J4UA 1THXA 5JCUA 1FB6A 4ZB6A 1G6YA 4ULXA 4G2EA 1ML6A 1Z9HA 4MJEA 1SJIA 2KLXA 4EO3A 3H8QA 1RK4A 3HJPA 4F03A 3DIEA 2DC5A 2M80A 3GL3A 2HT9A 3NZNA 1Y25A 4MCUA 5CRGA 3P90A 1FHEA 4MMMA 2MZCA 3L9UA 2YZUA 3SWLA 3HD5A 4DSQA 2QKEA 4IVFA 2A4VA 2RUFA 1U87A 3SBCA 2H70A 4GSNA 4EXJA 4XS6A 2FY6A 1LJRA 4HOJA 1O8XA 3GRXA 1R5PA 3FR6A 2H66A 3L9SA 3IHQA 1WPIA 3LJRA 3ZRDA 4FH8A 1F3BA 2MMNA 1SKWB 2YWOA 3F9UA 20GSA 1FVKA 2JSYA 3FKFA 2GZYA 5G1KA 1X5EA 4IJ3A 3IK7A 3CYNA 5JCWA 2V6KA 1AUCA 2HZEB 3R2QA 1MDJA 1K3YA 3KTLA 4CW9A 4IS0A 6GSYA 2FWHA 5JCGA 1XWKA 4TXVA 1AXDA 4PGTA 1PX6A 2DJKA 4IP1A 2FCHA 3LGCA 5GZZB 2H74A 3ZYWA 2GVPA 5D9WA 3UJ1A 1EWXA 1NSWA 2DLXA 1BJXA 2K6VA 5DAKA 3TJBA 1GSEA 3D21A 4HEA2 3TCOA 3US3A 3TOUA 2P31A 3WGEA 3IRAA 1ZL9A 1F37A 2YCDA 2D2ZA 3KM6A 4EF0A 5ID2B 2VAFA 4LMWA 4L0WA 5ECMB 3ZITA 3GSSA 5ECLB 1Z7PA 3GKMA 1V40A 3TUEA 4PQHA 3MDKA 2R6KA 4PURA 5D9VA 1GUMA 1DSBA 3TKSE 3GKNA 2IMFA 2H0GA 4KDXA 1ERVA 2AV4A 4WETA 3VLNA 2R4VA 3BJ5A 4MZBA 4ZL7A 7GSSA 2AJQB 2XBQA 5IO2A 2ZUPA 1TRVA 4KW6A 4TN8A 5F05A 3IXRA 2GQLA 2H30A 1YEXA 4XHMA 3VPQA 4JE1A 3MSZA 2GSRA 3W8JA 2FGXA 2TRCP 2VM2A 4KUNA 1X0RA 3EC3A 1E2YA 1JHBA 5C00A 2X99A 2PMTA 3QDNA 1GUHA 2IIYA 4Z7XA 3C1RA 4IQ1A 2NPBA 3GKKA 4GCIA 2OE0A 3GH6A 1B4QA 1ZYQB 3PINA 4Q5QA 3RDWA 1EEMA 5IMCA 5GAND 4EC0A 3CTGA 4HZ2A 2FD3A 2CQ9A 3IOSA 2OE1A 3EURA 1FO5A 1MDKA 5DALB 5FHIA 1BX9A 3L9VA 3FEUA 2A2SA 1TK8B 2GZZA 4FYCA 6GSTA 2DMMA 2VLUA 4IN0A 1XIYA 3UMAA 3F4RA 5ID2A 2PWJA 1NM3A 4MP4A 1WIKA 1XBSA 2IN3A 5J9BA 1XFLA 3TDGA 1W89A 1YKCA 1N2AA 1K0OA 2I3YA 1A0FA 4LMVA 1XW6A 2R2JA 5G2ZA 4FYUA 3MNGA 5DVBA 17GSA 5CRHA 3W6GA 1AIUA 4TR1B 1TRUA 3A2XA 4MF7A 3QFAC 4QL7A 1M7TA 1EV9A 1B9XC 2M46A 4GWRA 1J0FA 3H1NA 2WJUA 3GYKA 4F9ZA 4NXIA 3M1GA 1W4VA 2AB6A 2IMEA 1IYHA 1MD3A 4I6XA 3DWVA 5ECPB 4YH2A 1VF3A 3QAGA 2HXKA 2KP2A 3F3RA 1HNBA 2KUCA 4G19A 3VURA 3ZL5A 2HLSA 2VCZA 1XWAA 5AIXA 2KP1A 4HQSA 4IKHA 3IK9A 3BBYA 3FZ9A 1GSQA 4XIHA 4AJ8A 1X9WB 1GLPA 3GUSA 2WCIA 4X1UA 3HJMA 2OBKA 4BPYA 1USBA 5GAPD 3TGZA 2JADA 5ECHB 5IMFA 3EU3A 1RW1A 1B48A 1Z7RA 3UOMA 6GSVA 2H71A 3D5JA 2GQKA 4KCAA 1KEBA 3KH9A 1JZOA 2CX4A 18GSA 4NV5A 5HFGA 1QUWA 2PGTA 3M9JA 1YQ1A 4ZBBA 4I2UA 1EGOA 1O8WA 2O7KA 5E4WA 5IMDA 4XS4A 5CYYA 3ZVJA 1Z5YE 1PQNA 3TJKA 3VI5A 4TOPA 2YV7A 1JZWA 22GSA 1TP9A 3TKSC 1SD9A 1UA5A 2LNTA 3FYGA 3EVIA 1QFNA 1XZOA 3EE2A 2IL3A 1GSFA 1J08A 3Q19A 1M9BA 1M99A 5L71A 1GL8A 1EZKA 3UEMA 2B1KA 1WE0A 2CV4A 2MMAA 1V98A 5B8BA 12GSA 2GDRA 3TRPA 3HZ4A 3C1SA 1PD21 1XW5A 1F6MC 3I9V2 1ZCPA 2DBCA 5DJLA 2JU5A 3I6AA 3J7Yk 4KA0A 4POKA 1OC8A 1R5AA 3GH9A 3CBUA 1OVNA 1A2MA 4TR0A 2TIRA 3I69A 1OKDA 4GSTA 1EP7A 2XBIA 2FA4A 4LA1A 4OO4A 2YWMA 3U6VA 2YWIA 2FHEA 5ECRB 1M2AA 4POBA 5HR3A 1TK0B 1THOA 2WZ9A 4MPGA 3U5RE 4BWQA 4PUAA 2X8GA 4XCSA 3KZQA 3P2AA 3TB2A 1GH2A 4MF5A 1PN9A 3LFLA 2FUG2 3V1WA 3ZFLA 4K8MA 1V57A 3GTUA 5INYA 5KEJA 1T7PB 1WJKA 5HR0A 1QK8A 4YQUA 3UBLA 2RM6A 1SK1A 2HE3A 1JLWA 3ERGA 1VF4A 2WULA 3DVXA 2YP6A 2G2QA 1DBYA 5IO0A 2H75A 1YF0A 1PKZA 2H1BA 3GX0A 2CVKA 1H4OA 5H5QA 2VLTA 2B5YA 1JZRA 2KOKA 1FVJA 4JRRA 5COHA 3LXTA 4F82A 3HVXA 2IWTA 4NWYA 3UIWA 2MYGA 3AY8A 5DQYA 1XCCA 2LJKA 3ZMLA 4MK3A 4YQMA 1O6JA 2YOIA 1ABAA 5J5NA 4NHZA 2GSSA 2C0DA 3EMPA 4DEJA 3KMNA 2F51A 3FZ4A 4JR4A 3GIXA 5B6MA 4DSRA 3HCZA 4ZIJA 3RHBA 5DAKB 1SYXA 2VIMA 3O6TA 4PQ1A 1GNEA 3VPTA 5EVOA 1M2DA 5G5EA 1K3OA 5D8IA 4TXOB 1ST9A 1SJZA 2EC4A 3WYWA 2BTOT 4IJIA 4POMA 2O85A 2E7PA 4KDYA 3QD9A 4KAEA 4X43A 3FZAA 3GHAA 2EIQA 2CA8A 1XVWA 1AC1A 2PERA 1WMJA 3N9JA 3HKRA 4TR3A 4PNGA 2JZTA 3FW2A 1X5DA 3CRTA 2K18A 1OKTA 2XHFA 4Q5NA 2FWGA 4N11A 3KH7A 1ILOA 1AAZA 5F07A 5B8AA 1FB0A 5KN0A 1BEDA 4N0VA 3CSIA 4YAPA 4IW9A 2IFQA 1JFUA 4MJCA 4ZL8A 1DE1A 2N5AA 1AQWA 2FLSA 2GT6A 3VWVA 1UVZA 1EEJA 1TJDA 4K0GA 2HFDA 1GSYA 2L6DA 5J9CA 3DRNA 4D73A 1BAYA 4FIWA 2LTKA 5DDLA 1V2AA 2K8SA 3VK9A 2C3QA 3F63A 4MDCA 2VCXA 13GSA 3DD3A 2XPEA 1C72A 2N5BA 1PMTA 3FZ5A 1QQ2A 1U88A 2DJ1A 3E3EA 2E2MA 2O8VB 2OBIA 1PGTA 3DXBA 3P7XA 4O92A 4CHSA 1TI3A 1EGRA 5J3RA 4TXOA 3PGTA 2LJAA 1N8JA 1AW9A 1DUGA 2HI7A 4O7HA 2HSYA 1TU7A 4J2FA 1NHYA 5D96A 1BG5A 3IBHA 5ELGA 4ISDA 3M9KA 3EMXA 3ZTLA 1G7EA 3LQ7A 1A8YA 4ZILA 2TRXA 3ZIJA 2F8FA 4ID0A 4RUVA 5J41A 1NW2A 1VF1A 1SL0B 1Q4JA 3D0ZA 2NVLA 2PN8A 1SKSB 19GSA 3F8UA 4WF5A 1OE8A 4N10A 3F0IA 3DGQA 4ILFA 2AHEA 2FA8A 4F0BA 3CXGA 1MEKA 1GRXA 1XPVA 4WR4A 2B5XA 5F0GA 4IQAA 4OWYA 1XOAA 2GSTA 1ZYEA 1TRSA 1PX7A 2DJ0A 4ECBA 2L4QA 1GULA 2I1UA 1QXHA 2VL3A 2C3NA 2C3TA 4ZB8A 2P5RA 2YPMA 2CZ3A 2E0QA 5GSSA 3LORA 3UVTA 2JZSA 2MBTA 1O81A 5LNKe 1OE7A 1PSQA 3FR9A 4L5OA 5A4WA 3ZREA 4P3YB 3A2VA 5CRWA 1GSDA 6GSSA 4V1Ap 4K7OA 3KCMA 4XS4B 3O3TA 1A23A 2B1LA 3FRCA 1K3LA 3RHCA 2FWFA 3CRUA 4HZ4A 3APSA 1M2BA 3LYPA 3D4MA 3EYTA 3ERWA 4V1Ag 1OYJA 5G30A 14GSA 1EOHA 5IMZA 3HY2A 2QC7A 3PR8A 4OFTA 4FO5A 5D9TA 4WF4A 1IYIA 3RPPA 3HZ8A 1DE2A 3TOTA 3LSZA 2OACA 3GV1A 4ZB9A 3GSTA 2GTUA 1U3IA 4OFNA 3C71A 3F4SA 1K0AA 5AGYA 4HS1A 5E59A 4WKWA 6GSUA 3O76A 3GNJA 4TVEA 5JWRB 5DBQA 3GL5A 1GSUA 1QMVA 1FAAA 1HNAA 1SK2A 3NOFA 2VL2A 5CREA 4KSMA 1TW9A 1NHOA 2CX3A 2C0GA 3C7MA 3ZZXA 2YZHA 4E8HA 4MF6A 5IIZA 5LCZA 4MLYA 2EIOA 1TK5B 1TXXA 2WFCA 3M3MA 1T00A 3KEBA 5ABRA 1WP0A 4EUYA 1VRSD 2X8CA 4EL1A 2REMA 2K8VA 2NDOA 2LUSA 1PRXA 4MABA 1A2LA 2PUKC 5DCGA 4RI6A 5AISA 3HYPA 3GTUB 4PX1A 1B9YC 4G10A 3A5WA 4KCEA 5IMVA 3G7JA 3F3QA 2GS3A 4MH2A 4WBJA 2H76A 4HU7A 3MWHA 1SU9A 2PU9C 2OE3A 2LNSA 3NIVA 5KN2A 1MD4A 2YJHA 1FOVA 1K0BA 3HA9A 2WGRA 2IMDA 2I81A 3GA4A 3P8WA 2C8UA 2HSHA 3F4TA 5LD0A 4EDZA 9GSSA 1WWJA 2VCVA 3RPNA 3QAWA 5B6NA 1G6WA 1TU8A 4O5RA 3ZMKA 2AUVA 4GXZA 2DIZA 2L5LA 2YV9A 3KMOA 4IHUA 4EKZA 4IGJA 2PPTA 2E2GA 3N5OA 2CVDA 3TJJA 1OAZA 2DJ3A 5KN1A 1KNGA 3FR3A 5EPFA 3BCIA 1SYRA 2VCTA 1G0TA 4HI7A 2DJJA 4ZL9A 3EWLA 4PXOA 3TKRA 2C80A 3F6DA 2VCQA 1M0UA 2LS5A 1ERTA 4BL7A 1SK0A 1XWGA 1WOUA 2CZ2A 2L57A 1LBKA 1HNCA 4MJBA 2H73A 2B3SA 3S9FA 3UAPA 1A24A 3C73A 2C4JA 1O73A 5G1LA 2EIRA 3WT1A 3QPMA 1PA3A 5JWOB 4AF2A 3IA1A 3L0HA 2VO4A 4K9ZA 2I9HA 2LRCA 3KP9A 4EE0A 4MJAA 1R4WA 2H72A 1SJ6A 3HHVA 2GSQA 2R3XA 4GF0A 2B5EA 2RLIA 6GSXA 3BCKA 4WXTA 3ZFBA 1EOGA 5AIVA 1OC9B 1K0DA 1VGLA 1K0CA 3H4KA 4HDEA 4PUFC 2IFQB 4N30A 5IPHA 5GSTA 2CAQA 3LEFA 4IBPA 1X9MB 1GTIA 1R26A 4ZBDA 2WS2A 3DEXA 1KBNA 4XRDA 3I43A 5HQPA 3ERFA 2CT6A 2VD1A 3LG6A 3CTFA 1RQMA 2OJLA 4D73B 1V58A 16GSA 2LRNA 1T4YA 5CP1A 3WD6A 2WB9A 1O85A 3DYRA 4DVCA 4WEYA 4E8EA 3M0FA 4JU5A 4OO5A 4CDOA 1F2EA 3LWAA 2H6ZA 3ME8A 1ACVA 1GUKA 1FG4A 4I2TA 5D93A 4Q5RA 4I8BA 4HUAA 2V32A 3ED3A 4IP6A 1B8XA 4POLA 4NPBA 3KD0A 2CAIA 5G31A 2VUPA 1HQOA 4J57E 4MZWA 4DSSB 2MMOA 4V2NA 4N0ZA 2N5FA 4NAXA 4PNFA 5IMAA 3UVHA 2JL4A 4QQ7A 2OADA 3H93A 1BYEA 4WBRD 3TKPA 3VFIA 2BJXA 1OC9A 4ML1A 2VL9A 1SENA 4EVMA 2Z9SA 3EINA 2AYTA 3QAVA 5FWGA 4YAVA 5IQYA 5G5FA 4XS1A 4O32A 1G7OA 3KP8A 3CMIA 3ME7A 4NMUA 2ZNMA 2LEGA 5ECNB 3MAKA 4H86A 1EV4A 4AGSA 1U6TA 5IOXA 4RQXA 2VM1A 3HXSA 5DCHA 3QFBC 2H01A 1Z6MA 1F9MA 2P0GA 1TDIA 5IOWA 4TKYA 1XWCA 3GN3A 5EY6A 3VWWA 1X9SB 3KGKA 2GT5A 1GLQA 5ECSA 4JBBA 2H8LA 5FT3A 3FY7A 3IPZA 5A4UA 1PL2A 1UC7A 1YF1A 4OCEA 4XRAA 5ENUA 4HJMA 2P5QA 2O87A 2VD0A 1H75A 2C0FA 2DSAA 1ERUA 2X64A 3HVSA 4MH3A 1I9DA 5ECOB 2JSZA 5IM9A 2H0IA 2KHPA 4DSSA 3E9JB 4JZQA 1BQ7A 2ON5A 1XVQA 3CSJA 1CQHA 2IJYA 4ZBAA 3QOUA 2OA7A 4GTUA 1K0MA 3TRQA 10GSA 4JR6A 1I5GA 2LQOA 1ZOFA 4IELA 1R7HA 4K6XA 1YKAA 2GLRA 2C0EA 2JACA 3ISOA 1MDIA 3APQA 4WR5A 4OMVA 4NHWA 4K2DA 3G7IA 4ZXGA 3BD2A 3OR5A 4ECJA 3IE3A 2H19A 5DQSA 4ECIA 2YWNA 4GQCA 2HNLA 5F8BA 2F9SA 3KIJA 4F2IA 4TRXA 1YJ6A 4EDYA 1LU4A 1A2JA 1TTZA 4TW5A 3IDVA 5A4VA 1S3CA 4BVXA 4BA7A 3D22A 2HZEA 3TJFA 3LXZA 2R5GA 3D6IA 3Q18A 2IMIA 4YQVA 1ZMAA 3C8EA 11GSA 3A2WA 2AAWA 2LSTA 3VWUA 4GRFA 3QCPA 1B4PA 4OD7A 2YJ7A 4KDUA 4HJ2A 1X5CA 2ES7A 4KSOA 2G0FA 5A5KA 3M8NA 3VI7A 5DJMA 3GX8A 3HDCA 2F8AA 5JWQB 5ECIB 3TKSA 2L5OA 4V2MA 4L8EA 3KXOA 2C1YA 4GSSA 5F06A 2LKUA 2L4CA 1PKWA 5ECKB 3QMXA 1T8EB 1T4ZA 4K7IA 4OFMA 5CNWA 3TRXA 2H0HA 3A3TA 4I5QA 3ZVJD 2B7JA 4FYBA 3GKXA 4GQFA 3F6FA 1XWBA 2K9FA 2CVBA 5ECQB 2ON7A 4K7NA 3IV4A 4HU9A 5HR1A 3IC4A 4F0CA 3GURA 1K0NA 2V6OA 2GZPA 3E0UA 2PVQA 3UARA 2VLVA 2X8HA 3ZLPA 1ZGNA 1URMA 5D9XA 4QL9A 5HR2A 2FWEA 4LL1B 3D4TA 2GGTA 4OCFA 2B7KA 3RAZA 2DIYA 2J23A 3FK8A 3JCML 6GSWA 2V41A 4KB3A 2H6YA 1TRWA 2PVOC 1O7UA 1T3BA 2HZFA 3DKSA 2HRFA 1JLVA 1TI1A 4XTSA 2VCWA 4MZCA 1Y6EA 5CAXA 3L78A 2ALBA 5CRDA 4L5LA 5D73A 1ERWA 3DMLA 1HYUA 1M9AA 4LLRA 4BWSA 2NBSA 1QGVA 3UL3A 3IAS2 4V2LA 2IMKA 1SL1B 1TOFA 3W8SA 4LL4B 3PH9A 4JEDA 3TKQA 5DALA 5B7CA 1U3AA 1GSSA 4NV2A 3J7Yb 3G9BA 3KTBA 1EP8A 4ACSA 2L59A 2WDUA 3KJYA 3APOA 4KH7A 4K0NA 1TKDB 1ON4A 4MPFA 1XOBA 1FW1A 2V1MA 2QSIA 2RM5A 1MTCA 3TJGA 2LV3A 2H1AA 2M72A 2RUEA 5H5SA 1XW9A 4J56E 8GSSA 2HRNA 3WGDA 4TR1A 2HYXA 2PBJA 2JZRA 3FHKA 4KX4A 5IPGA 4L0UA 1CQGA 3WT2A 2NTOA 1Q98A 1YY7A 3IAM2 2LRTA 4Q5FA 1ZZYA 4RI7A 3QR6A 5ELAA 2I4AA 4ML6A 1AQVA 1S3DA 2H6XA 1Z6NA 1GTAA 1Z3EA 1GTUA 5H5RA 1GNWA 2LJRA 1SL2B 1A0RP 2ZCTA 2XPDA 4AJ6A 4X0XA 4AJ7A 1GTBA 2MMZA 4KNDA 2XC2A 3H79A 2V2GA 2R37A 2DJ2A 2A2RA 2J9HA 2F3MA 4MA9A 2H1GA 3GFKA 4GLTA 1YEPA 2YN1A 3HJOA 5CO3A 2QGVA 2LQQA 5EL8A 1VF2A 2IPAA 4PQIA 2GQMA 3BOAA 4RQRA 5C04A 1SKRB 3UBKA 2VL2C 3WGXA 3Q74A 3VWXA 2B6MA 3K8NA 3RBTA 2RIIA 1UN2A 1V9WA 2OKAA 4KE3A 3LYKA 2H1DA
chains in the Genus database with same CATH superfamily
1HD2A 1GWCA 3GMFA 2VOCA 1F3AA 1AQXA 5KN3A 4G9HA 1J9BA 3HVVA 3IR4A 3DVWA 1WRYA 4K1FA 1GP1A 1T1VA 4HQZA 5HFKA 2MBSA 2YNXA 4I97A 1JZDA 4ECCA 1A8LA 1YZXA 1S3AA 1S3RA 1KTEA 1SD8A 4KGIA 3G7YA 3Q6OA 1OC3A 2WRTA 2FNOA 3EU4A 2YANA 5HFIA 2DMLA 4TR4A 4BVYA 1YDKA 2L6CA 2BMXA 5AN1A 3L4NA 2O89A 1E6BA 3ZIVA 3CSHA 1XXUA 1PL1A 5J4UA 1THXA 5JCUA 1FB6A 4ZB6A 1G6YA 4ULXA 4G2EA 1ML6A 1Z9HA 4MJEA 1SJIA 2KLXA 4EO3A 3H8QA 1RK4A 3HJPA 4F03A 3DIEA 2DC5A 2M80A 3GL3A 2HT9A 4CY8A 3NZNA 1Y25A 4MCUA 5CRGA 3P90A 1FHEA 4MMMA 2HRKA 2MZCA 5BMUA 3L9UA 2YZUA 3SWLA 3HD5A 4DSQA 2QKEA 4IVFA 2A4VA 2RUFA 1U87A 3SBCA 2H70A 4GSNA 4EXJA 4XS6A 2FY6A 1LJRA 4HOJA 1O8XA 3GRXA 1R5PA 3FR6A 2H66A 3L9SA 3IHQA 1WPIA 3LJRA 3ZRDA 4FH8A 1F3BA 2MMNA 1SKWB 4YKGA 2YWOA 3F9UA 20GSA 1FVKA 2JSYA 3FKFA 2GZYA 5G1KA 3R3EA 1X5EA 4IJ3A 3IK7A 4BVXB 3CYNA 5JCWA 2V6KA 1AUCA 2HZEB 1ZYNA 3R2QA 1MDJA 1K3YA 3KTLA 4CW9A 4IS0A 6GSYA 2FWHA 5JCGA 1XWKA 4TXVA 1AXDA 5KOXA 4PGTA 1PX6A 2DJKA 1M3IA 4IP1A 2FCHA 3LGCA 5GZZB 2H74A 3ZYWA 2GVPA 5D9WA 3UJ1A 1EWXA 1NSWA 2DLXA 1BJXA 2K6VA 5DAKA 3TJBA 1GSEA 3D21A 4HEA2 3TCOA 5BRTA 3US3A 3TOUA 2P31A 3WGEA 3IRAA 1ZL9A 1F37A 2YCDA 2D2ZA 3KM6A 4EF0A 5ID2B 2VAFA 4LMWA 4L0WA 5ECMB 3ZITA 3GSSA 5ECLB 1Z7PA 3GKMA 1V40A 3TUEA 4PQHA 3MDKA 2R6KA 4PURA 5D9VA 1GUMA 1DSBA 3TKSE 3GKNA 2IMFA 2H0GA 4KDXA 1ERVA 2AV4A 4WETA 3VLNA 2R4VA 3BJ5A 4MZBA 4ZL7A 7GSSA 2X4AA 2AJQB 2XBQA 5IO2A 2ZUPA 1TRVA 4KW6A 4TN8A 5F05A 3IXRA 2GQLA 2H30A 1YEXA 4XHMA 3VPQA 4JE1A 3MSZA 2GSRA 3W8JA 2FGXA 2TRCP 2VM2A 4KUNA 1X0RA 3EC3A 1E2YA 1JHBA 5C00A 2X99A 2PMTA 3QDNA 1GUHA 2IIYA 4Z7XA 3C1RA 4IQ1A 2NPBA 3GKKA 4GCIA 2OE0A 3GH6A 1B4QA 1ZYQB 3PINA 4Q5QA 3RDWA 1EEMA 5IMCA 5GAND 4EC0A 3CTGA 4HZ2A 2FD3A 2CQ9A 3IOSA 2OE1A 3EURA 1FO5A 1MDKA 5DALB 5FHIA 1BX9A 3L9VA 3FEUA 2A2SA 1TK8B 2GZZA 4FYCA 6GSTA 2DMMA 2VLUA 4IN0A 1XIYA 3UMAA 3F4RA 5ID2A 2PWJA 1NM3A 4MP4A 1WIKA 1XBSA 2IN3A 5J9BA 1XFLA 3TDGA 1W89A 1YKCA 1N2AA 1K0OA 2I3YA 1A0FA 4LMVA 1XW6A 2R2JA 5G2ZA 4O5UA 4FYUA 3MNGA 5DVBA 17GSA 5CRHA 3W6GA 1AIUA 4TR1B 1TRUA 3A2XA 4MF7A 3QFAC 4QL7A 1M7TA 1EV9A 1B9XC 2M46A 4GWRA 1J0FA 3H1NA 2WJUA 3GYKA 4F9ZA 4NXIA 3M1GA 1W4VA 2AB6A 2IMEA 1IYHA 1MD3A 4I6XA 3DWVA 5ECPB 4YH2A 1VF3A 3QAGA 2HXKA 2KP2A 3F3RA 1HNBA 2KUCA 4G19A 3VURA 3ZL5A 2HLSA 2VCZA 1XWAA 3MIXA 5AIXA 2KP1A 4HQSA 4IKHA 3IK9A 3BBYA 3FZ9A 1GSQA 4XIHA 4AJ8A 1X9WB 1GLPA 3GUSA 2WCIA 4X1UA 3HJMA 2OBKA 4BPYA 1USBA 5GAPD 3TGZA 2JADA 5ECHB 5IMFA 3EU3A 1RW1A 1B48A 1Z7RA 3UOMA 6GSVA 2H71A 3D5JA 2GQKA 4G0LA 4KCAA 1KEBA 3KH9A 1JZOA 2CX4A 18GSA 4NV5A 5HFGA 1QUWA 2PGTA 3M9JA 1YQ1A 4ZBBA 4I2UA 1EGOA 1O8WA 2O7KA 5E4WA 5IMDA 4XS4A 5CYYA 3ZVJA 2UZ8A 1Z5YE 1PQNA 3TJKA 3VI5A 4TOPA 2YV7A 1JZWA 22GSA 1TP9A 3TKSC 1SD9A 1UA5A 2LNTA 3FYGA 3EVIA 1QFNA 1XZOA 3EE2A 2IL3A 1GSFA 1J08A 3Q19A 1M9BA 1M99A 5L71A 1GL8A 1EZKA 3UEMA 2B1KA 1WE0A 2CV4A 2MMAA 1V98A 5B8BA 12GSA 2GDRA 3TRPA 3HZ4A 3C1SA 1PD21 1XW5A 1F6MC 3I9V2 1ZCPA 2DBCA 5DJLA 2JU5A 3I6AA 3J7Yk 4KA0A 4POKA 4BVYB 1OC8A 1R5AA 3GH9A 4USSA 3CBUA 1OVNA 1A2MA 4TR0A 2TIRA 3I69A 1OKDA 4GSTA 1EP7A 2XBIA 2FA4A 4LA1A 4OO4A 2YWMA 3U6VA 2YWIA 2FHEA 5ECRB 1M2AA 4POBA 5HR3A 1TK0B 1THOA 2WZ9A 4MPGA 3U5RE 4BWQA 4PUAA 2X8GA 4XCSA 3KZQA 3P2AA 3TB2A 1GH2A 4MF5A 1PN9A 3LFLA 2FUG2 3V1WA 3ZFLA 4K8MA 1V57A 3GTUA 5INYA 5KEJA 1T7PB 1WJKA 5HR0A 1QK8A 4YQUA 3UBLA 2RM6A 1SK1A 2HE3A 3ERGA 1JLWA 1VF4A 2WULA 3DVXA 2YP6A 2G2QA 1DBYA 5IO0A 2H75A 1YF0A 1PKZA 2H1BA 3GX0A 2CVKA 1H4OA 2HSMA 5H5QA 2VLTA 2B5YA 1JZRA 2KOKA 1FVJA 4JRRA 5COHA 3LXTA 4F82A 3HVXA 2IWTA 4NWYA 3UIWA 2MYGA 3AY8A 5DQYA 1XCCA 2LJKA 3MYDA 3ZMLA 4MK3A 4YQMA 1O6JA 2YOIA 1ABAA 5J5NA 4NHZA 2GSSA 2C0DA 3EMPA 4DEJA 3KMNA 2F51A 3FZ4A 4JR4A 3GIXA 5B6MA 4DSRA 3HCZA 4ZIJA 3RHBA 5DAKB 1SYXA 2VIMA 3O6TA 4PQ1A 1GNEA 3VPTA 5EVOA 1M2DA 5G5EA 1K3OA 4TXOB 5D8IA 1ST9A 1SJZA 2EC4A 3WYWA 2BTOT 4IJIA 4POMA 2DKHA 2O85A 2E7PA 4KDYA 3QD9A 4KAEA 4X43A 3FZAA 3GHAA 2EIQA 2CA8A 1XVWA 1AC1A 2PERA 1WMJA 3N9JA 3HKRA 4TR3A 4PNGA 2JZTA 3FW2A 1X5DA 3CRTA 2K18A 1OKTA 2XHFA 4Q5NA 2FWGA 4N11A 3KH7A 1ILOA 1AAZA 5F07A 4Z2UA 1FB0A 5B8AA 5KN0A 1BEDA 4N0VA 3CSIA 4YAPA 4IW9A 2IFQA 1JFUA 4MJCA 4ZL8A 1DE1A 2N5AA 1AQWA 2FLSA 2GT6A 3VWVA 1UVZA 1EEJA 1TJDA 4K0GA 2HFDA 1GSYA 2L6DA 5J9CA 3DRNA 3PPUA 4D73A 1BAYA 4FIWA 2LTKA 5DDLA 1V2AA 2K8SA 3VK9A 2C3QA 3F63A 4MDCA 2VCXA 13GSA 3DD3A 2XPEA 1C72A 2N5BA 1PMTA 3FZ5A 1QQ2A 1U88A 2DJ1A 3E3EA 3IHGA 2E2MA 2O8VB 2OBIA 1PGTA 3DXBA 3P7XA 4G0IA 4O92A 4CHSA 1TI3A 1EGRA 5J3RA 4TXOA 4ICYA 3PGTA 2LJAA 2HRAA 1N8JA 1AW9A 1DUGA 2HI7A 4O7HA 2HSYA 1TU7A 4J2FA 1NHYA 5D96A 1BG5A 3IBHA 5ELGA 4ISDA 3M9KA 3EMXA 3ZTLA 1G7EA 4BIKA 3LQ7A 1A8YA 4ZILA 2TRXA 3ZIJA 2F8FA 4ID0A 4RUVA 5J41A 1NW2A 1VF1A 1SL0B 1Q4JA 3D0ZA 2NVLA 2PN8A 1SKSB 19GSA 3F8UA 4WF5A 1OE8A 4N10A 3F0IA 3DGQA 4ILFA 2AHEA 2FA8A 4F0BA 3CXGA 1MEKA 1GRXA 1XPVA 4WR4A 2B5XA 5F0GA 4IQAA 4OWYA 1XOAA 2GSTA 1ZYEA 1TRSA 1PX7A 2DJ0A 4ECBA 2L4QA 1GULA 2I1UA 1QXHA 2VL3A 2C3NA 2C3TA 4ZB8A 2P5RA 2YPMA 2CZ3A 2E0QA 5GSSA 3LORA 3UVTA 2JZSA 2MBTA 1O81A 5LNKe 1OE7A 1PSQA 3FR9A 4L5OA 5A4WA 3ZREA 4P3YB 3A2VA 5CRWA 1GSDA 6GSSA 4V1Ap 4K7OA 3KCMA 4Z2TA 4XS4B 3O3TA 1A23A 2B1LA 3FRCA 1K3LA 3RHCA 2FWFA 3CRUA 4HZ4A 3APSA 1M2BA 4FQUA 3LYPA 3D4MA 3EYTA 3ERWA 4V1Ag 1OYJA 5G30A 14GSA 1EOHA 5IMZA 4HSCX 3HY2A 2QC7A 3PR8A 4OFTA 4FO5A 5D9TA 4WF4A 1IYIA 3RPPA 3HZ8A 1DE2A 3TOTA 3LSZA 2OACA 3GV1A 4ZB9A 3GSTA 2GTUA 1U3IA 4OFNA 3C71A 3F4SA 1K0AA 5AGYA 4HS1A 5E59A 4WKWA 6GSUA 3O76A 3GNJA 4TVEA 5JWRB 5DBQA 3GL5A 1GSUA 1QMVA 1FAAA 1HNAA 2DKIA 1SK2A 3NOFA 2VL2A 5CREA 4KSMA 1TW9A 1NHOA 2CX3A 2C0GA 3C7MA 3ZZXA 2YZHA 4E8HA 4MF6A 4K2XA 5IIZA 5LCZA 4MLYA 4BL7B 2EIOA 1TK5B 1TXXA 4X4JA 2WFCA 3M3MA 1T00A 3KEBA 5ABRA 1WP0A 4EUYA 1VRSD 2X8CA 3A5IA 4EL1A 2REMA 2K8VA 2NDOA 2LUSA 1PRXA 4MABA 1A2LA 4G0KA 2PUKC 5DCGA 4RI6A 5AISA 3HYPA 3GTUB 4PX1A 1B9YC 4G10A 3A5WA 4KCEA 5IMVA 3G7JA 3F3QA 2GS3A 4MH2A 4WBJA 2H76A 4HU7A 3MWHA 1SU9A 2PU9C 2OE3A 2LNSA 3NIVA 5KN2A 1MD4A 2YJHA 1FOVA 1K0BA 3HA9A 2WGRA 2IMDA 1FOHA 2I81A 3GA4A 3P8WA 2C8UA 1XG8A 2HSHA 3F4TA 5LD0A 4EDZA 9GSSA 1WWJA 2VCVA 3RPNA 3QAWA 5B6NA 1G6WA 1TU8A 4O5RA 3ZMKA 2AUVA 4GXZA 2DIZA 2L5LA 2YV9A 3KMOA 4IHUA 4EKZA 4IGJA 2PPTA 2E2GA 3N5OA 2CVDA 3LW9A 3TJJA 1OAZA 2DJ3A 5KN1A 1KNGA 3FR3A 5EPFA 3BCIA 1SYRA 2VCTA 1G0TA 4HI7A 2DJJA 4ZL9A 3EWLA 4PXOA 3TKRA 2C80A 3F6DA 2VCQA 1M0UA 2LS5A 1ERTA 4BL7A 1SK0A 1XWGA 1WOUA 2CZ2A 2L57A 1LBKA 1HNCA 4MJBA 2H73A 2B3SA 1PN0A 3UAPA 3S9FA 1A24A 3C73A 2C4JA 2X49A 1O73A 5G1LA 2EIRA 3WT1A 3QPMA 1PA3A 5JWOB 4AF2A 3IA1A 3L0HA 2VO4A 4K9ZA 2I9HA 2LRCA 3KP9A 4EE0A 4MJAA 1R4WA 2H72A 1SJ6A 3HHVA 2GSQA 2R3XA 4GF0A 2B5EA 2RLIA 6GSXA 3BCKA 4WXTA 1PFOA 3ZFBA 1EOGA 5AIVA 4MNNA 1OC9B 1K0DA 1VGLA 1K0CA 3H4KA 4HDEA 4PUFC 2IFQB 4N30A 5IPHA 5GSTA 2CAQA 3LEFA 4IBPA 1X9MB 1GTIA 1R26A 4ZBDA 2WS2A 3DEXA 1KBNA 4XRDA 3I43A 5HQPA 3ERFA 2CT6A 2VD1A 3LG6A 3CTFA 1RQMA 2OJLA 4D73B 1V58A 16GSA 2LRNA 1T4YA 5CP1A 3WD6A 2WB9A 1O85A 3DYRA 4DVCA 4WEYA 4E8EA 3M0FA 4JU5A 4OO5A 4CDOA 1F2EA 3LWAA 2H6ZA 3ME8A 1ACVA 1GUKA 1FG4A 4I2TA 5D93A 4Q5RA 4I8BA 4HUAA 2V32A 3ED3A 4IP6A 1B8XA 4POLA 4NPBA 3KD0A 2CAIA 5G31A 2VUPA 1HQOA 4J57E 4MZWA 4DSSB 2MMOA 4Z2RA 4V2NA 4N0ZA 2N5FA 4NAXA 4PNFA 5IMAA 3UVHA 2JL4A 4QQ7A 2OADA 4O5QA 3H93A 1BYEA 4WBRD 3TKPA 3VFIA 2BJXA 1OC9A 4ML1A 2VL9A 1SENA 4EVMA 2Z9SA 3EINA 2AYTA 3QAVA 5FWGA 4YAVA 5IQYA 5G5FA 4EIPA 4XS1A 4O32A 1G7OA 3KP8A 3CMIA 3ME7A 4NMUA 2ZNMA 2LEGA 5ECNB 3MAKA 4H86A 1EV4A 4AGSA 1U6TA 5IOXA 4RQXA 2VM1A 3HXSA 5DCHA 3QFBC 2H01A 1Z6MA 3HVNA 1F9MA 2P0GA 1TDIA 5IOWA 4TKYA 1XWCA 3GN3A 3FMWA 5EY6A 3VWWA 1X9SB 3IC8A 3KGKA 2GT5A 1GLQA 5ECSA 4JBBA 2H8LA 5FT3A 3FY7A 3IPZA 5A4UA 1PL2A 1UC7A 1YF1A 4OCEA 4XRAA 5ENUA 4HJMA 2P5QA 2R0PA 2O87A 2VD0A 1H75A 2C0FA 2DSAA 1ERUA 2X64A 3HVSA 4MH3A 1I9DA 5ECOB 2JSZA 5IM9A 2H0IA 2KHPA 4DSSA 3E9JB 4JZQA 1BQ7A 2ON5A 1XVQA 3CSJA 1CQHA 2IJYA 5KOWA 4ZBAA 3QOUA 2OA7A 4GTUA 1K0MA 3TRQA 10GSA 4JR6A 1I5GA 2LQOA 1ZOFA 4IELA 1R7HA 4K6XA 1YKAA 2GLRA 4A5PA 2C0EA 2JACA 3ISOA 1MDIA 3APQA 4WR5A 2QA2A 4OMVA 4NHWA 4K2DA 3G7IA 4ZXGA 3BD2A 3OR5A 4ECJA 2QA1A 3IE3A 2H19A 5DQSA 4ECIA 2YWNA 4GQCA 2HNLA 5F8BA 2F9SA 3KIJA 4F2IA 2A2PA 4TRXA 1YJ6A 4EDYA 1LU4A 4CY6A 1A2JA 1TTZA 4TW5A 3IDVA 5A4VA 1S3CA 4BVXA 4BA7A 3D22A 2HZEA 3TJFA 3LXZA 2R5GA 3D6IA 3Q18A 2IMIA 4YQVA 1ZMAA 3C8EA 11GSA 3A2WA 2AAWA 2LSTA 3VWUA 4GRFA 3QCPA 2A4HA 1B4PA 4OD7A 2YJ7A 4KDUA 4HJ2A 1X5CA 2ES7A 4KSOA 2G0FA 5A5KA 3M8NA 3VI7A 5DJMA 3GX8A 3HDCA 2F8AA 5JWQB 5ECIB 3TKSA 2L5OA 4V2MA 4L8EA 3KXOA 2C1YA 4GSSA 5F06A 2LKUA 2L4CA 1PKWA 5ECKB 3QMXA 1T8EB 3CQFA 1T4ZA 4K7IA 4OFMA 5CNWA 3TRXA 2H0HA 3A3TA 4I5QA 3ZVJD 2R0CA 2B7JA 4FYBA 3GKXA 4GQFA 3F6FA 1XWBA 2K9FA 2CVBA 5ECQB 2ON7A 4K7NA 3IV4A 4HU9A 5HR1A 3IC4A 4F0CA 3GURA 1K0NA 2V6OA 2GZPA 3E0UA 2PVQA 3UARA 4PTSA 2VLVA 2X8HA 3ZLPA 1ZGNA 1URMA 5D9XA 4QL9A 5HR2A 2FWEA 4LL1B 3D4TA 2GGTA 4OCFA 2B7KA 3RAZA 2DIYA 2J23A 3FK8A 3JCML 6GSWA 2V41A 4KB3A 2H6YA 1TRWA 2PVOC 1O7UA 1T3BA 2HZFA 2R0GA 3DKSA 2HRFA 1JLVA 1TI1A 4XTSA 2VCWA 4MZCA 1Y6EA 5CAXA 3L78A 2ALBA 5CRDA 4L5LA 4EIQA 5D73A 1ERWA 3DMLA 1HYUA 1M9AA 4LLRA 4BWSA 2NBSA 1QGVA 3UL3A 4K5RA 3IAS2 4V2LA 2IMKA 1SL1B 1TOFA 3W8SA 4LL4B 3PH9A 4JEDA 3TKQA 5DALA 5B7CA 1U3AA 1GSSA 4NV2A 3J7Yb 3G9BA 3KTBA 1EP8A 4ACSA 2L59A 2WDUA 3KJYA 3APOA 4KH7A 4K0NA 1TKDB 1ON4A 4MPFA 1XOBA 1FW1A 2V1MA 2QSIA 2RM5A 1MTCA 3TJGA 2LV3A 2H1AA 2M72A 2RUEA 5H5SA 1XW9A 4J56E 8GSSA 2HRNA 1M3JA 3WGDA 4TR1A 2HYXA 2PBJA 2JZRA 3FHKA 4KX4A 5IPGA 4L0UA 1CQGA 3WT2A 2NTOA 1Q98A 1YY7A 3IAM2 2LRTA 4Q5FA 1ZZYA 4RI7A 3QR6A 5ELAA 2I4AA 4ML6A 1AQVA 1S3DA 2H6XA 1Z6NA 1GTAA 1Z3EA 1GTUA 5H5RA 1GNWA 2LJRA 1SL2B 1A0RP 2ZCTA 2XPDA 4AJ6A 4X0XA 4AJ7A 1GTBA 2MMZA 4KNDA 2XC2A 3H79A 2V2GA 2R37A 2DJ2A 4K5SA 2A2RA 4KF9A 2J9HA 2F3MA 4MA9A 2H1GA 3GFKA 4GLTA 1YEPA 2YN1A 3HJOA 5CO3A 2QGVA 2LQQA 5EL8A 1VF2A 2IPAA 4PQIA 3EPTA 4YKFA 2GQMA 3BOAA 4RQRA 5C04A 1ZYPA 1SKRB 3UBKA 2VL2C 3WGXA 3Q74A 3VWXA 2B6MA 3K8NA 3RBTA 2RIIA 1UN2A 1V9WA 2OKAA 4KE3A 3LYKA 2H1DA
chains in the Genus database with same CATH topology
1HD2A 1GWCA 3GMFA 2VOCA 1F3AA 1AQXA 5KN3A 4G9HA 1J9BA 3HVVA 3IR4A 3DVWA 1WRYA 4K1FA 1GP1A 1T1VA 4HQZA 5HFKA 2MBSA 2YNXA 4I97A 1JZDA 4ECCA 1A8LA 1YZXA 1S3AA 1KTEA 1SD8A 4KGIA 3G7YA 3Q6OA 1OC3A 2WRTA 2FNOA 3EU4A 2YANA 5HFIA 2DMLA 4TR4A 4BVYA 1YDKA 2L6CA 2BMXA 5AN1A 3L4NA 2O89A 1E6BA 3ZIVA 3CSHA 1XXUA 1PL1A 5J4UA 1THXA 5JCUA 1FB6A 4ZB6A 1G6YA 4ULXA 4G2EA 1ML6A 1Z9HA 4MJEA 1SJIA 2KLXA 4EO3A 3H8QA 1RK4A 3HJPA 4F03A 3DIEA 2DC5A 2M80A 3GL3A 2HT9A 4CY8A 3NZNA 1Y25A 4MCUA 5CRGA 3P90A 1FHEA 4MMMA 2HRKA 2MZCA 5BMUA 3L9UA 2YZUA 3SWLA 3HD5A 4DSQA 2QKEA 4IVFA 2A4VA 2RUFA 1U87A 3SBCA 2H70A 4GSNA 4EXJA 4XS6A 2FY6A 1LJRA 4HOJA 1O8XA 3GRXA 1R5PA 3FR6A 2H66A 3L9SA 3IHQA 1WPIA 3LJRA 3ZRDA 4FH8A 1F3BA 2MMNA 1SKWB 4YKGA 2YWOA 3F9UA 20GSA 1FVKA 2JSYA 3FKFA 2GZYA 5G1KA 3R3EA 1X5EA 4IJ3A 3IK7A 4BVXB 3CYNA 5JCWA 2V6KA 1AUCA 2HZEB 1ZYNA 3R2QA 1MDJA 1K3YA 3KTLA 4CW9A 4IS0A 6GSYA 2FWHA 5JCGA 1XWKA 4TXVA 1AXDA 5KOXA 4PGTA 1PX6A 2DJKA 4IP1A 2FCHA 3LGCA 5GZZB 2H74A 3ZYWA 2GVPA 5D9WA 3UJ1A 1EWXA 1NSWA 2DLXA 1BJXA 2K6VA 5DAKA 3TJBA 1GSEA 3D21A 4HEA2 3TCOA 5BRTA 3US3A 3TOUA 2P31A 3WGEA 3IRAA 1ZL9A 1F37A 2YCDA 2D2ZA 3KM6A 4EF0A 5ID2B 2VAFA 4LMWA 4L0WA 5ECMB 3ZITA 3GSSA 5ECLB 1Z7PA 3GKMA 1V40A 3TUEA 4PQHA 3MDKA 2R6KA 4PURA 5D9VA 1GUMA 1DSBA 3TKSE 3GKNA 2IMFA 2H0GA 4KDXA 1ERVA 2AV4A 4WETA 3VLNA 2R4VA 3BJ5A 4MZBA 4ZL7A 7GSSA 2X4AA 2AJQB 2XBQA 5IO2A 2ZUPA 1TRVA 4KW6A 4TN8A 5F05A 3IXRA 2GQLA 2H30A 1YEXA 4XHMA 3VPQA 4JE1A 3MSZA 2GSRA 3W8JA 2FGXA 2TRCP 2VM2A 4KUNA 1X0RA 3EC3A 1E2YA 1JHBA 5C00A 2X99A 2PMTA 3QDNA 1GUHA 2IIYA 4Z7XA 3C1RA 4IQ1A 2NPBA 3GKKA 4GCIA 2OE0A 3GH6A 1B4QA 1ZYQB 3PINA 4Q5QA 3RDWA 1EEMA 5IMCA 5GAND 4EC0A 3CTGA 4HZ2A 2FD3A 2CQ9A 3IOSA 2OE1A 3EURA 1FO5A 1MDKA 5DALB 5FHIA 1BX9A 3L9VA 3FEUA 2A2SA 1TK8B 2GZZA 4FYCA 6GSTA 2DMMA 2VLUA 4IN0A 1XIYA 3UMAA 3F4RA 5ID2A 2PWJA 1NM3A 4MP4A 1WIKA 1XBSA 2IN3A 5J9BA 1XFLA 3TDGA 1W89A 1YKCA 1N2AA 1K0OA 2I3YA 1A0FA 4LMVA 1XW6A 2R2JA 5G2ZA 4O5UA 4FYUA 3MNGA 5DVBA 17GSA 5CRHA 3W6GA 1AIUA 4TR1B 1TRUA 3A2XA 4MF7A 3QFAC 4QL7A 1M7TA 1EV9A 1B9XC 2M46A 4GWRA 1J0FA 3H1NA 2WJUA 3GYKA 4F9ZA 4NXIA 3M1GA 1W4VA 2AB6A 2IMEA 1IYHA 1MD3A 4I6XA 3DWVA 5ECPB 4YH2A 1VF3A 3QAGA 2HXKA 2KP2A 3F3RA 1HNBA 2KUCA 4G19A 3VURA 3ZL5A 2HLSA 2VCZA 1XWAA 3MIXA 5AIXA 2KP1A 4HQSA 4IKHA 3IK9A 3BBYA 3FZ9A 1GSQA 4XIHA 4AJ8A 1X9WB 1GLPA 3GUSA 2WCIA 4X1UA 3HJMA 2OBKA 4BPYA 1USBA 5GAPD 3TGZA 2JADA 5ECHB 5IMFA 3EU3A 1RW1A 1B48A 1Z7RA 3UOMA 6GSVA 2H71A 3D5JA 2GQKA 4G0LA 4KCAA 1KEBA 3KH9A 1JZOA 2CX4A 18GSA 4NV5A 5HFGA 1QUWA 2PGTA 3M9JA 1YQ1A 4ZBBA 4I2UA 1EGOA 1O8WA 2O7KA 5E4WA 5IMDA 4XS4A 5CYYA 3ZVJA 2UZ8A 1Z5YE 1PQNA 3TJKA 3VI5A 4TOPA 2YV7A 1JZWA 22GSA 1TP9A 3TKSC 1SD9A 1UA5A 2LNTA 3FYGA 3EVIA 1QFNA 1XZOA 3EE2A 2IL3A 1GSFA 1J08A 3Q19A 1M9BA 1M99A 5L71A 1GL8A 1EZKA 3UEMA 2B1KA 1WE0A 2CV4A 2MMAA 1V98A 5B8BA 12GSA 2GDRA 3TRPA 3HZ4A 3C1SA 1PD21 1XW5A 1F6MC 3I9V2 1ZCPA 2DBCA 5DJLA 2JU5A 3I6AA 3J7Yk 4KA0A 4POKA 4BVYB 1OC8A 1R5AA 3GH9A 4USSA 3CBUA 1OVNA 1A2MA 4TR0A 2TIRA 3I69A 1OKDA 4GSTA 1EP7A 2XBIA 2FA4A 4LA1A 4OO4A 2YWMA 3U6VA 2YWIA 2FHEA 5ECRB 1M2AA 4POBA 5HR3A 1TK0B 1THOA 2WZ9A 4MPGA 3U5RE 4BWQA 4PUAA 2X8GA 4XCSA 3KZQA 3P2AA 3TB2A 1GH2A 4MF5A 1PN9A 3LFLA 2FUG2 3V1WA 3ZFLA 4K8MA 1V57A 3GTUA 5INYA 5KEJA 1T7PB 1WJKA 5HR0A 1QK8A 4YQUA 3UBLA 2RM6A 1SK1A 2HE3A 3ERGA 1JLWA 1VF4A 2WULA 3DVXA 2YP6A 2G2QA 1DBYA 5IO0A 2H75A 1YF0A 1PKZA 2H1BA 3GX0A 2CVKA 1H4OA 2HSMA 5H5QA 2VLTA 2B5YA 1JZRA 2KOKA 1FVJA 4JRRA 5COHA 3LXTA 4F82A 3HVXA 2IWTA 4NWYA 3UIWA 2MYGA 3AY8A 5DQYA 1XCCA 2LJKA 3MYDA 3ZMLA 4MK3A 4YQMA 1O6JA 2YOIA 1ABAA 5J5NA 4NHZA 2GSSA 2C0DA 3EMPA 4DEJA 3KMNA 2F51A 3FZ4A 4JR4A 3GIXA 5B6MA 4DSRA 3HCZA 4ZIJA 3RHBA 5DAKB 1SYXA 2VIMA 3O6TA 4PQ1A 1GNEA 3VPTA 5EVOA 1M2DA 5G5EA 1K3OA 4TXOB 5D8IA 1ST9A 1SJZA 2EC4A 3WYWA 2BTOT 4IJIA 4POMA 2DKHA 2O85A 2E7PA 4KDYA 3QD9A 4KAEA 4X43A 3FZAA 3GHAA 2EIQA 2CA8A 1XVWA 1AC1A 2PERA 1WMJA 3N9JA 3HKRA 4TR3A 4PNGA 2JZTA 3FW2A 1X5DA 3CRTA 2K18A 1OKTA 2XHFA 4Q5NA 2FWGA 4N11A 3KH7A 1ILOA 1AAZA 5F07A 4Z2UA 1FB0A 5B8AA 5KN0A 1BEDA 4N0VA 3CSIA 4YAPA 4IW9A 2IFQA 1JFUA 4MJCA 4ZL8A 1DE1A 2N5AA 1AQWA 2FLSA 2GT6A 3VWVA 1UVZA 1EEJA 1TJDA 4K0GA 2HFDA 1GSYA 2L6DA 5J9CA 3DRNA 3PPUA 4D73A 1BAYA 4FIWA 2LTKA 5DDLA 1V2AA 2K8SA 3VK9A 2C3QA 3F63A 4MDCA 2VCXA 13GSA 3DD3A 2XPEA 1C72A 2N5BA 1PMTA 3FZ5A 1QQ2A 1U88A 2DJ1A 3E3EA 3IHGA 2E2MA 2O8VB 2OBIA 1PGTA 3DXBA 3P7XA 4G0IA 4O92A 4CHSA 1TI3A 1EGRA 5J3RA 4TXOA 4ICYA 3PGTA 2LJAA 2HRAA 1N8JA 1AW9A 1DUGA 2HI7A 4O7HA 2HSYA 1TU7A 4J2FA 1NHYA 5D96A 1BG5A 3IBHA 5ELGA 4ISDA 3M9KA 3EMXA 3ZTLA 1G7EA 3LQ7A 1A8YA 4ZILA 2TRXA 3ZIJA 2F8FA 4ID0A 4RUVA 5J41A 1NW2A 1VF1A 1SL0B 1Q4JA 3D0ZA 2NVLA 2PN8A 1SKSB 19GSA 3F8UA 4WF5A 1OE8A 4N10A 3F0IA 3DGQA 4ILFA 2AHEA 2FA8A 4F0BA 3CXGA 1MEKA 1GRXA 1XPVA 4WR4A 2B5XA 5F0GA 4IQAA 4OWYA 1XOAA 2GSTA 1ZYEA 1TRSA 1PX7A 2DJ0A 4ECBA 2L4QA 1GULA 2I1UA 1QXHA 2VL3A 2C3NA 2C3TA 4ZB8A 2P5RA 2YPMA 2CZ3A 2E0QA 5GSSA 3LORA 3UVTA 2JZSA 2MBTA 1O81A 5LNKe 1OE7A 1PSQA 3FR9A 4L5OA 5A4WA 3ZREA 4P3YB 3A2VA 5CRWA 1GSDA 6GSSA 4V1Ap 4K7OA 3KCMA 4Z2TA 4XS4B 3O3TA 1A23A 2B1LA 3FRCA 1K3LA 3RHCA 2FWFA 3CRUA 4HZ4A 3APSA 1M2BA 4FQUA 3LYPA 3D4MA 3EYTA 3ERWA 4V1Ag 1OYJA 5G30A 14GSA 1EOHA 5IMZA 3HY2A 2QC7A 3PR8A 4OFTA 4FO5A 5D9TA 4WF4A 1IYIA 3RPPA 3HZ8A 1DE2A 3TOTA 3LSZA 2OACA 3GV1A 4ZB9A 3GSTA 2GTUA 1U3IA 4OFNA 3C71A 3F4SA 1K0AA 5AGYA 4HS1A 5E59A 4WKWA 6GSUA 3O76A 3GNJA 4TVEA 5JWRB 5DBQA 3GL5A 1GSUA 1QMVA 1FAAA 1HNAA 2DKIA 1SK2A 3NOFA 2VL2A 5CREA 4KSMA 1TW9A 1NHOA 2CX3A 2C0GA 3C7MA 3ZZXA 2YZHA 4E8HA 4MF6A 4K2XA 5IIZA 5LCZA 4MLYA 4BL7B 2EIOA 1TK5B 1TXXA 4X4JA 2WFCA 3M3MA 1T00A 3KEBA 5ABRA 1WP0A 4EUYA 1VRSD 2X8CA 3A5IA 4EL1A 2REMA 2K8VA 2NDOA 2LUSA 1PRXA 4MABA 1A2LA 4G0KA 2PUKC 5DCGA 4RI6A 5AISA 3HYPA 3GTUB 4PX1A 1B9YC 4G10A 3A5WA 4KCEA 5IMVA 3G7JA 3F3QA 2GS3A 4MH2A 4WBJA 2H76A 4HU7A 3MWHA 1SU9A 2PU9C 2OE3A 2LNSA 3NIVA 5KN2A 1MD4A 2YJHA 1FOVA 1K0BA 3HA9A 2WGRA 2IMDA 1FOHA 2I81A 3GA4A 3P8WA 2C8UA 2HSHA 3F4TA 5LD0A 4EDZA 9GSSA 1WWJA 2VCVA 3RPNA 3QAWA 5B6NA 1G6WA 1TU8A 4O5RA 3ZMKA 2AUVA 4GXZA 2DIZA 2L5LA 2YV9A 3KMOA 4IHUA 4EKZA 4IGJA 2PPTA 2E2GA 3N5OA 2CVDA 3LW9A 3TJJA 1OAZA 2DJ3A 5KN1A 1KNGA 3FR3A 5EPFA 3BCIA 1SYRA 2VCTA 1G0TA 4HI7A 2DJJA 4ZL9A 3EWLA 4PXOA 3TKRA 2C80A 3F6DA 2VCQA 1M0UA 2LS5A 1ERTA 4BL7A 1SK0A 1XWGA 1WOUA 2CZ2A 2L57A 1LBKA 1HNCA 4MJBA 2H73A 2B3SA 1PN0A 3UAPA 3S9FA 1A24A 3C73A 2C4JA 2X49A 1O73A 5G1LA 2EIRA 3WT1A 3QPMA 1PA3A 5JWOB 4AF2A 3IA1A 3L0HA 2VO4A 4K9ZA 2I9HA 2LRCA 3KP9A 4EE0A 4MJAA 1R4WA 2H72A 1SJ6A 3HHVA 2GSQA 2R3XA 4GF0A 2B5EA 2RLIA 6GSXA 3BCKA 4WXTA 3ZFBA 1EOGA 5AIVA 4MNNA 1OC9B 1K0DA 1VGLA 1K0CA 3H4KA 4HDEA 4PUFC 2IFQB 4N30A 5IPHA 5GSTA 2CAQA 3LEFA 4IBPA 1X9MB 1GTIA 1R26A 4ZBDA 2WS2A 3DEXA 1KBNA 4XRDA 3I43A 5HQPA 3ERFA 2CT6A 2VD1A 3LG6A 3CTFA 1RQMA 2OJLA 4D73B 1V58A 16GSA 2LRNA 1T4YA 5CP1A 3WD6A 2WB9A 1O85A 3DYRA 4DVCA 4WEYA 4E8EA 3M0FA 4JU5A 4OO5A 4CDOA 1F2EA 3LWAA 2H6ZA 3ME8A 1ACVA 1GUKA 1FG4A 4I2TA 5D93A 4Q5RA 4I8BA 4HUAA 2V32A 3ED3A 4IP6A 1B8XA 4POLA 4NPBA 3KD0A 2CAIA 5G31A 2VUPA 1HQOA 4J57E 4MZWA 4DSSB 2MMOA 4Z2RA 4V2NA 4N0ZA 2N5FA 4NAXA 4PNFA 5IMAA 3UVHA 2JL4A 4QQ7A 2OADA 4O5QA 3H93A 1BYEA 4WBRD 3TKPA 3VFIA 2BJXA 1OC9A 4ML1A 2VL9A 1SENA 4EVMA 2Z9SA 3EINA 2AYTA 3QAVA 5FWGA 4YAVA 5IQYA 5G5FA 4EIPA 4XS1A 4O32A 1G7OA 3KP8A 3CMIA 3ME7A 4NMUA 2ZNMA 2LEGA 5ECNB 3MAKA 4H86A 1EV4A 4AGSA 1U6TA 5IOXA 4RQXA 2VM1A 3HXSA 5DCHA 3QFBC 2H01A 1Z6MA 1F9MA 2P0GA 1TDIA 5IOWA 4TKYA 1XWCA 3GN3A 3FMWA 5EY6A 3VWWA 1X9SB 3IC8A 3KGKA 2GT5A 1GLQA 5ECSA 4JBBA 2H8LA 5FT3A 3FY7A 3IPZA 5A4UA 1PL2A 1UC7A 1YF1A 4OCEA 4XRAA 5ENUA 4HJMA 2P5QA 2R0PA 2O87A 2VD0A 1H75A 2C0FA 2DSAA 1ERUA 2X64A 3HVSA 4MH3A 1I9DA 5ECOB 2JSZA 5IM9A 2H0IA 2KHPA 4DSSA 3E9JB 4JZQA 1BQ7A 2ON5A 1XVQA 3CSJA 1CQHA 2IJYA 5KOWA 4ZBAA 3QOUA 2OA7A 4GTUA 1K0MA 3TRQA 10GSA 4JR6A 1I5GA 2LQOA 1ZOFA 4IELA 1R7HA 4K6XA 1YKAA 2GLRA 4A5PA 2C0EA 2JACA 3ISOA 1MDIA 3APQA 4WR5A 2QA2A 4OMVA 4NHWA 4K2DA 3G7IA 4ZXGA 3BD2A 3OR5A 4ECJA 2QA1A 3IE3A 2H19A 5DQSA 4ECIA 2YWNA 4GQCA 2HNLA 5F8BA 2F9SA 3KIJA 4F2IA 2A2PA 4TRXA 1YJ6A 4EDYA 1LU4A 4CY6A 1A2JA 1TTZA 4TW5A 3IDVA 5A4VA 1S3CA 4BVXA 4BA7A 3D22A 2HZEA 3TJFA 3LXZA 2R5GA 3D6IA 3Q18A 2IMIA 4YQVA 1ZMAA 3C8EA 11GSA 3A2WA 2AAWA 2LSTA 3VWUA 4GRFA 3QCPA 2A4HA 1B4PA 4OD7A 2YJ7A 4KDUA 4HJ2A 1X5CA 2ES7A 4KSOA 2G0FA 5A5KA 3M8NA 3VI7A 5DJMA 3GX8A 3HDCA 2F8AA 5JWQB 5ECIB 3TKSA 2L5OA 4V2MA 4L8EA 3KXOA 2C1YA 4GSSA 5F06A 2LKUA 2L4CA 1PKWA 5ECKB 3QMXA 1T8EB 1T4ZA 4K7IA 4OFMA 5CNWA 3TRXA 2H0HA 3A3TA 4I5QA 3ZVJD 2R0CA 2B7JA 4FYBA 3GKXA 4GQFA 3F6FA 1XWBA 2K9FA 2CVBA 5ECQB 2ON7A 4K7NA 3IV4A 4HU9A 5HR1A 3IC4A 4F0CA 3GURA 1K0NA 2V6OA 2GZPA 3E0UA 2PVQA 3UARA 4PTSA 2VLVA 2X8HA 3ZLPA 1ZGNA 1URMA 5D9XA 4QL9A 5HR2A 2FWEA 4LL1B 3D4TA 2GGTA 4OCFA 2B7KA 3RAZA 2DIYA 2J23A 3FK8A 3JCML 6GSWA 2V41A 4KB3A 2H6YA 1TRWA 2PVOC 1O7UA 1T3BA 2HZFA 2R0GA 3DKSA 2HRFA 1JLVA 1TI1A 4XTSA 2VCWA 4MZCA 1Y6EA 5CAXA 3L78A 2ALBA 5CRDA 4L5LA 4EIQA 5D73A 1ERWA 3DMLA 1HYUA 1M9AA 4LLRA 4BWSA 2NBSA 1QGVA 3UL3A 4K5RA 3IAS2 4V2LA 2IMKA 1SL1B 1TOFA 3W8SA 4LL4B 3PH9A 4JEDA 3TKQA 5DALA 5B7CA 1U3AA 1GSSA 4NV2A 3J7Yb 3G9BA 3KTBA 1EP8A 4ACSA 2L59A 2WDUA 3KJYA 3APOA 4KH7A 4K0NA 1TKDB 1ON4A 4MPFA 1XOBA 1FW1A 2V1MA 2QSIA 2RM5A 1MTCA 3TJGA 2LV3A 2H1AA 2M72A 2RUEA 5H5SA 1XW9A 4J56E 8GSSA 2HRNA 3WGDA 4TR1A 2HYXA 2PBJA 2JZRA 3FHKA 4KX4A 5IPGA 4L0UA 1CQGA 3WT2A 2NTOA 1Q98A 1YY7A 3IAM2 2LRTA 4Q5FA 1ZZYA 4RI7A 3QR6A 5ELAA 2I4AA 4ML6A 1AQVA 1S3DA 2H6XA 1Z6NA 1GTAA 1Z3EA 1GTUA 5H5RA 1GNWA 2LJRA 1SL2B 1A0RP 2ZCTA 2XPDA 4AJ6A 4X0XA 4AJ7A 1GTBA 2MMZA 4KNDA 2XC2A 3H79A 2V2GA 2R37A 2DJ2A 4K5SA 2A2RA 4KF9A 2J9HA 2F3MA 4MA9A 2H1GA 3GFKA 4GLTA 1YEPA 2YN1A 3HJOA 5CO3A 2QGVA 2LQQA 5EL8A 1VF2A 2IPAA 4PQIA 3EPTA 4YKFA 2GQMA 3BOAA 4RQRA 5C04A 1ZYPA 1SKRB 3UBKA 2VL2C 3WGXA 3Q74A 3VWXA 2B6MA 3K8NA 3RBTA 2RIIA 1UN2A 1V9WA 2OKAA 4KE3A 3LYKA 2H1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HD2 A;  1GWC A;  3GMF A;  2VOC A;  1F3A A;  1AQX A;  5KN3 A;  4G9H A;  1J9B A;  3HVV A;  3IR4 A;  3DVW A;  1WRY A;  4K1F A;  1GP1 A;  1T1V A;  4HQZ A;  5HFK A;  2MBS A;  2YNX A;  4I97 A;  1JZD A;  4ECC A;  1A8L A;  1YZX A;  1S3A A;  1KTE A;  1SD8 A;  4KGI A;  3G7Y A;  3Q6O A;  1OC3 A;  2WRT A;  2FNO A;  3EU4 A;  2YAN A;  5HFI A;  2DML A;  4TR4 A;  4BVY A;  1YDK A;  2L6C A;  2BMX A;  5AN1 A;  3L4N A;  2O89 A;  1E6B A;  3ZIV A;  3CSH A;  1XXU A;  1PL1 A;  5J4U A;  1THX A;  5JCU A;  1FB6 A;  4ZB6 A;  1G6Y A;  4ULX A;  4G2E A;  1ML6 A;  1Z9H A;  4MJE A;  1SJI A;  2KLX A;  4EO3 A;  3H8Q A;  1RK4 A;  3HJP A;  4F03 A;  3DIE A;  2DC5 A;  2M80 A;  3GL3 A;  2HT9 A;  3NZN A;  1Y25 A;  4MCU A;  5CRG A;  3P90 A;  1FHE A;  4MMM A;  2MZC A;  3L9U A;  2YZU A;  3SWL A;  3HD5 A;  4DSQ A;  2QKE A;  4IVF A;  2A4V A;  2RUF A;  1U87 A;  3SBC A;  2H70 A;  4GSN A;  4EXJ A;  4XS6 A;  2FY6 A;  1LJR A;  4HOJ A;  1O8X A;  3GRX A;  1R5P A;  3FR6 A;  2H66 A;  3L9S A;  3IHQ A;  1WPI A;  3LJR A;  3ZRD A;  4FH8 A;  1F3B A;  2MMN A;  1SKW B;  2YWO A;  3F9U A;  20GS A;  1FVK A;  2JSY A;  3FKF A;  2GZY A;  5G1K A;  1X5E A;  4IJ3 A;  3IK7 A;  3CYN A;  5JCW A;  2V6K A;  1AUC A;  2HZE B;  3R2Q A;  1MDJ A;  1K3Y A;  3KTL A;  4CW9 A;  4IS0 A;  6GSY A;  2FWH A;  5JCG A;  1XWK A;  4TXV A;  1AXD A;  4PGT A;  1PX6 A;  2DJK A;  4IP1 A;  2FCH A;  3LGC A;  5GZZ B;  2H74 A;  3ZYW A;  2GVP A;  5D9W A;  3UJ1 A;  1EWX A;  1NSW A;  2DLX A;  1BJX A;  2K6V A;  5DAK A;  3TJB A;  1GSE A;  3D21 A;  4HEA 2;  3TCO A;  3US3 A;  3TOU A;  2P31 A;  3WGE A;  3IRA A;  1ZL9 A;  1F37 A;  2YCD A;  2D2Z A;  3KM6 A;  4EF0 A;  5ID2 B;  2VAF A;  4LMW A;  4L0W A;  5ECM B;  3ZIT A;  3GSS A;  5ECL B;  1Z7P A;  3GKM A;  1V40 A;  3TUE A;  4PQH A;  3MDK A;  2R6K A;  4PUR A;  5D9V A;  1GUM A;  1DSB A;  3TKS E;  3GKN A;  2IMF A;  2H0G A;  4KDX A;  1ERV A;  2AV4 A;  4WET A;  3VLN A;  2R4V A;  3BJ5 A;  4MZB A;  4ZL7 A;  7GSS A;  2AJQ B;  2XBQ A;  5IO2 A;  2ZUP A;  1TRV A;  4KW6 A;  4TN8 A;  5F05 A;  3IXR A;  2GQL A;  2H30 A;  1YEX A;  4XHM A;  3VPQ A;  4JE1 A;  3MSZ A;  2GSR A;  3W8J A;  2FGX A;  2TRC P;  2VM2 A;  4KUN A;  1X0R A;  3EC3 A;  1E2Y A;  1JHB A;  5C00 A;  2X99 A;  2PMT A;  3QDN A;  1GUH A;  2IIY A;  4Z7X A;  3C1R A;  4IQ1 A;  2NPB A;  3GKK A;  4GCI A;  2OE0 A;  3GH6 A;  1B4Q A;  1ZYQ B;  3PIN A;  4Q5Q A;  3RDW A;  1EEM A;  5IMC A;  5GAN D;  4EC0 A;  3CTG A;  4HZ2 A;  2FD3 A;  2CQ9 A;  3IOS A;  2OE1 A;  3EUR A;  1FO5 A;  1MDK A;  5DAL B;  5FHI A;  1BX9 A;  3L9V A;  3FEU A;  2A2S A;  1TK8 B;  2GZZ A;  4FYC A;  6GST A;  2DMM A;  2VLU A;  4IN0 A;  1XIY A;  3UMA A;  3F4R A;  5ID2 A;  2PWJ A;  1NM3 A;  4MP4 A;  1WIK A;  1XBS A;  2IN3 A;  5J9B A;  1XFL A;  3TDG A;  1W89 A;  1YKC A;  1N2A A;  1K0O A;  2I3Y A;  1A0F A;  4LMV A;  1XW6 A;  2R2J A;  5G2Z A;  4FYU A;  3MNG A;  5DVB A;  17GS A;  5CRH A;  3W6G A;  1AIU A;  4TR1 B;  1TRU A;  3A2X A;  4MF7 A;  3QFA C;  4QL7 A;  1M7T A;  1EV9 A;  1B9X C;  2M46 A;  4GWR A;  1J0F A;  3H1N A;  2WJU A;  3GYK A;  4F9Z A;  4NXI A;  3M1G A;  1W4V A;  2AB6 A;  2IME A;  1IYH A;  1MD3 A;  4I6X A;  3DWV A;  5ECP B;  4YH2 A;  1VF3 A;  3QAG A;  2HXK A;  2KP2 A;  3F3R A;  1HNB A;  2KUC A;  4G19 A;  3VUR A;  3ZL5 A;  2HLS A;  2VCZ A;  1XWA A;  5AIX A;  2KP1 A;  4HQS A;  4IKH A;  3IK9 A;  3BBY A;  3FZ9 A;  1GSQ A;  4XIH A;  4AJ8 A;  1X9W B;  1GLP A;  3GUS A;  2WCI A;  4X1U A;  3HJM A;  2OBK A;  4BPY A;  1USB A;  5GAP D;  3TGZ A;  2JAD A;  5ECH B;  5IMF A;  3EU3 A;  1RW1 A;  1B48 A;  1Z7R A;  3UOM A;  6GSV A;  2H71 A;  3D5J A;  2GQK A;  4KCA A;  1KEB A;  3KH9 A;  1JZO A;  2CX4 A;  18GS A;  4NV5 A;  5HFG A;  1QUW A;  2PGT A;  3M9J A;  1YQ1 A;  4ZBB A;  4I2U A;  1EGO A;  1O8W A;  2O7K A;  5E4W A;  5IMD A;  4XS4 A;  5CYY A;  3ZVJ A;  1Z5Y E;  1PQN A;  3TJK A;  3VI5 A;  4TOP A;  2YV7 A;  1JZW A;  22GS A;  1TP9 A;  3TKS C;  1SD9 A;  1UA5 A;  2LNT A;  3FYG A;  3EVI A;  1QFN A;  1XZO A;  3EE2 A;  2IL3 A;  1GSF A;  1J08 A;  3Q19 A;  1M9B A;  1M99 A;  5L71 A;  1GL8 A;  1EZK A;  3UEM A;  2B1K A;  1WE0 A;  2CV4 A;  2MMA A;  1V98 A;  5B8B A;  12GS A;  2GDR A;  3TRP A;  3HZ4 A;  3C1S A;  1PD2 1;  1XW5 A;  1F6M C;  3I9V 2;  1ZCP A;  2DBC A;  5DJL A;  2JU5 A;  3I6A A;  3J7Y k;  4KA0 A;  4POK A;  1OC8 A;  1R5A A;  3GH9 A;  3CBU A;  1OVN A;  1A2M A;  4TR0 A;  2TIR A;  3I69 A;  1OKD A;  4GST A;  1EP7 A;  2XBI A;  2FA4 A;  4LA1 A;  4OO4 A;  2YWM A;  3U6V A;  2YWI A;  2FHE A;  5ECR B;  1M2A A;  4POB A;  5HR3 A;  1TK0 B;  1THO A;  2WZ9 A;  4MPG A;  3U5R E;  4BWQ A;  4PUA A;  2X8G A;  4XCS A;  3KZQ A;  3P2A A;  3TB2 A;  1GH2 A;  4MF5 A;  1PN9 A;  3LFL A;  2FUG 2;  3V1W A;  3ZFL A;  4K8M A;  1V57 A;  3GTU A;  5INY A;  5KEJ A;  1T7P B;  1WJK A;  5HR0 A;  1QK8 A;  4YQU A;  3UBL A;  2RM6 A;  1SK1 A;  2HE3 A;  1JLW A;  3ERG A;  1VF4 A;  2WUL A;  3DVX A;  2YP6 A;  2G2Q A;  1DBY A;  5IO0 A;  2H75 A;  1YF0 A;  1PKZ A;  2H1B A;  3GX0 A;  2CVK A;  1H4O A;  5H5Q A;  2VLT A;  2B5Y A;  1JZR A;  2KOK A;  1FVJ A;  4JRR A;  5COH A;  3LXT A;  4F82 A;  3HVX A;  2IWT A;  4NWY A;  3UIW A;  2MYG A;  3AY8 A;  5DQY A;  1XCC A;  2LJK A;  3ZML A;  4MK3 A;  4YQM A;  1O6J A;  2YOI A;  1ABA A;  5J5N A;  4NHZ A;  2GSS A;  2C0D A;  3EMP A;  4DEJ A;  3KMN A;  2F51 A;  3FZ4 A;  4JR4 A;  3GIX A;  5B6M A;  4DSR A;  3HCZ A;  4ZIJ A;  3RHB A;  5DAK B;  1SYX A;  2VIM A;  3O6T A;  4PQ1 A;  1GNE A;  3VPT A;  5EVO A;  1M2D A;  5G5E A;  1K3O A;  5D8I A;  4TXO B;  1ST9 A;  1SJZ A;  2EC4 A;  3WYW A;  2BTO T;  4IJI A;  4POM A;  2O85 A;  2E7P A;  4KDY A;  3QD9 A;  4KAE A;  4X43 A;  3FZA A;  3GHA A;  2EIQ A;  2CA8 A;  1XVW A;  1AC1 A;  2PER A;  1WMJ A;  3N9J A;  3HKR A;  4TR3 A;  4PNG A;  2JZT A;  3FW2 A;  1X5D A;  3CRT A;  2K18 A;  1OKT A;  2XHF A;  4Q5N A;  2FWG A;  4N11 A;  3KH7 A;  1ILO A;  1AAZ A;  5F07 A;  5B8A A;  1FB0 A;  5KN0 A;  1BED A;  4N0V A;  3CSI A;  4YAP A;  4IW9 A;  2IFQ A;  1JFU A;  4MJC A;  4ZL8 A;  1DE1 A;  2N5A A;  1AQW A;  2FLS A;  2GT6 A;  3VWV A;  1UVZ A;  1EEJ A;  1TJD A;  4K0G A;  2HFD A;  1GSY A;  2L6D A;  5J9C A;  3DRN A;  4D73 A;  1BAY A;  4FIW A;  2LTK A;  5DDL A;  1V2A A;  2K8S A;  3VK9 A;  2C3Q A;  3F63 A;  4MDC A;  2VCX A;  13GS A;  3DD3 A;  2XPE A;  1C72 A;  2N5B A;  1PMT A;  3FZ5 A;  1QQ2 A;  1U88 A;  2DJ1 A;  3E3E A;  2E2M A;  2O8V B;  2OBI A;  1PGT A;  3DXB A;  3P7X A;  4O92 A;  4CHS A;  1TI3 A;  1EGR A;  5J3R A;  4TXO A;  3PGT A;  2LJA A;  1N8J A;  1AW9 A;  1DUG A;  2HI7 A;  4O7H A;  2HSY A;  1TU7 A;  4J2F A;  1NHY A;  5D96 A;  1BG5 A;  3IBH A;  5ELG A;  4ISD A;  3M9K A;  3EMX A;  3ZTL A;  1G7E A;  3LQ7 A;  1A8Y A;  4ZIL A;  2TRX A;  3ZIJ A;  2F8F A;  4ID0 A;  4RUV A;  5J41 A;  1NW2 A;  1VF1 A;  1SL0 B;  1Q4J A;  3D0Z A;  2NVL A;  2PN8 A;  1SKS B;  19GS A;  3F8U A;  4WF5 A;  1OE8 A;  4N10 A;  3F0I A;  3DGQ A;  4ILF A;  2AHE A;  2FA8 A;  4F0B A;  3CXG A;  1MEK A;  1GRX A;  1XPV A;  4WR4 A;  2B5X A;  5F0G A;  4IQA A;  4OWY A;  1XOA A;  2GST A;  1ZYE A;  1TRS A;  1PX7 A;  2DJ0 A;  4ECB A;  2L4Q A;  1GUL A;  2I1U A;  1QXH A;  2VL3 A;  2C3N A;  2C3T A;  4ZB8 A;  2P5R A;  2YPM A;  2CZ3 A;  2E0Q A;  5GSS A;  3LOR A;  3UVT A;  2JZS A;  2MBT A;  1O81 A;  5LNK e;  1OE7 A;  1PSQ A;  3FR9 A;  4L5O A;  5A4W A;  3ZRE A;  4P3Y B;  3A2V A;  5CRW A;  1GSD A;  6GSS A;  4V1A p;  4K7O A;  3KCM A;  4XS4 B;  3O3T A;  1A23 A;  2B1L A;  3FRC A;  1K3L A;  3RHC A;  2FWF A;  3CRU A;  4HZ4 A;  3APS A;  1M2B A;  3LYP A;  3D4M A;  3EYT A;  3ERW A;  4V1A g;  1OYJ A;  5G30 A;  14GS A;  1EOH A;  5IMZ A;  3HY2 A;  2QC7 A;  3PR8 A;  4OFT A;  4FO5 A;  5D9T A;  4WF4 A;  1IYI A;  3RPP A;  3HZ8 A;  1DE2 A;  3TOT A;  3LSZ A;  2OAC A;  3GV1 A;  4ZB9 A;  3GST A;  2GTU A;  1U3I A;  4OFN A;  3C71 A;  3F4S A;  1K0A A;  5AGY A;  4HS1 A;  5E59 A;  4WKW A;  6GSU A;  3O76 A;  3GNJ A;  4TVE A;  5JWR B;  5DBQ A;  3GL5 A;  1GSU A;  1QMV A;  1FAA A;  1HNA A;  1SK2 A;  3NOF A;  2VL2 A;  5CRE A;  4KSM A;  1TW9 A;  1NHO A;  2CX3 A;  2C0G A;  3C7M A;  3ZZX A;  2YZH A;  4E8H A;  4MF6 A;  5IIZ A;  5LCZ A;  4MLY A;  2EIO A;  1TK5 B;  1TXX A;  2WFC A;  3M3M A;  1T00 A;  3KEB A;  5ABR A;  1WP0 A;  4EUY A;  1VRS D;  2X8C A;  4EL1 A;  2REM A;  2K8V A;  2NDO A;  2LUS A;  1PRX A;  4MAB A;  1A2L A;  2PUK C;  5DCG A;  4RI6 A;  5AIS A;  3HYP A;  3GTU B;  4PX1 A;  1B9Y C;  4G10 A;  3A5W A;  4KCE A;  5IMV A;  3G7J A;  3F3Q A;  2GS3 A;  4MH2 A;  4WBJ A;  2H76 A;  4HU7 A;  3MWH A;  1SU9 A;  2PU9 C;  2OE3 A;  2LNS A;  3NIV A;  5KN2 A;  1MD4 A;  2YJH A;  1FOV A;  1K0B A;  3HA9 A;  2WGR A;  2IMD A;  2I81 A;  3GA4 A;  3P8W A;  2C8U A;  2HSH A;  3F4T A;  5LD0 A;  4EDZ A;  9GSS A;  1WWJ A;  2VCV A;  3RPN A;  3QAW A;  5B6N A;  1G6W A;  1TU8 A;  4O5R A;  3ZMK A;  2AUV A;  4GXZ A;  2DIZ A;  2L5L A;  2YV9 A;  3KMO A;  4IHU A;  4EKZ A;  4IGJ A;  2PPT A;  2E2G A;  3N5O A;  2CVD A;  3TJJ A;  1OAZ A;  2DJ3 A;  5KN1 A;  1KNG A;  3FR3 A;  5EPF A;  3BCI A;  1SYR A;  2VCT A;  1G0T A;  4HI7 A;  2DJJ A;  4ZL9 A;  3EWL A;  4PXO A;  3TKR A;  2C80 A;  3F6D A;  2VCQ A;  1M0U A;  2LS5 A;  1ERT A;  4BL7 A;  1SK0 A;  1XWG A;  1WOU A;  2CZ2 A;  2L57 A;  1LBK A;  1HNC A;  4MJB A;  2H73 A;  2B3S A;  3S9F A;  3UAP A;  1A24 A;  3C73 A;  2C4J A;  1O73 A;  5G1L A;  2EIR A;  3WT1 A;  3QPM A;  1PA3 A;  5JWO B;  4AF2 A;  3IA1 A;  3L0H A;  2VO4 A;  4K9Z A;  2I9H A;  2LRC A;  3KP9 A;  4EE0 A;  4MJA A;  1R4W A;  2H72 A;  1SJ6 A;  3HHV A;  2GSQ A;  2R3X A;  4GF0 A;  2B5E A;  2RLI A;  6GSX A;  3BCK A;  4WXT A;  3ZFB A;  1EOG A;  5AIV A;  1OC9 B;  1K0D A;  1VGL A;  1K0C A;  3H4K A;  4HDE A;  4PUF C;  2IFQ B;  4N30 A;  5IPH A;  5GST A;  2CAQ A;  3LEF A;  4IBP A;  1X9M B;  1GTI A;  1R26 A;  4ZBD A;  2WS2 A;  3DEX A;  1KBN A;  4XRD A;  3I43 A;  5HQP A;  3ERF A;  2CT6 A;  2VD1 A;  3LG6 A;  3CTF A;  1RQM A;  2OJL A;  4D73 B;  1V58 A;  16GS A;  2LRN A;  1T4Y A;  5CP1 A;  3WD6 A;  2WB9 A;  1O85 A;  3DYR A;  4DVC A;  4WEY A;  4E8E A;  3M0F A;  4JU5 A;  4OO5 A;  4CDO A;  1F2E A;  3LWA A;  2H6Z A;  3ME8 A;  1ACV A;  1GUK A;  1FG4 A;  4I2T A;  5D93 A;  4Q5R A;  4I8B A;  4HUA A;  2V32 A;  3ED3 A;  4IP6 A;  1B8X A;  4POL A;  4NPB A;  3KD0 A;  2CAI A;  5G31 A;  2VUP A;  1HQO A;  4J57 E;  4MZW A;  4DSS B;  2MMO A;  4V2N A;  4N0Z A;  2N5F A;  4NAX A;  4PNF A;  5IMA A;  3UVH A;  2JL4 A;  4QQ7 A;  2OAD A;  3H93 A;  1BYE A;  4WBR D;  3TKP A;  3VFI A;  2BJX A;  1OC9 A;  4ML1 A;  2VL9 A;  1SEN A;  4EVM A;  2Z9S A;  3EIN A;  2AYT A;  3QAV A;  5FWG A;  4YAV A;  5IQY A;  5G5F A;  4XS1 A;  4O32 A;  1G7O A;  3KP8 A;  3CMI A;  3ME7 A;  4NMU A;  2ZNM A;  2LEG A;  5ECN B;  3MAK A;  4H86 A;  1EV4 A;  4AGS A;  1U6T A;  5IOX A;  4RQX A;  2VM1 A;  3HXS A;  5DCH A;  3QFB C;  2H01 A;  1Z6M A;  1F9M A;  2P0G A;  1TDI A;  5IOW A;  4TKY A;  1XWC A;  3GN3 A;  5EY6 A;  3VWW A;  1X9S B;  3KGK A;  2GT5 A;  1GLQ A;  5ECS A;  4JBB A;  2H8L A;  5FT3 A;  3FY7 A;  3IPZ A;  5A4U A;  1PL2 A;  1UC7 A;  1YF1 A;  4OCE A;  4XRA A;  5ENU A;  4HJM A;  2P5Q A;  2O87 A;  2VD0 A;  1H75 A;  2C0F A;  2DSA A;  1ERU A;  2X64 A;  3HVS A;  4MH3 A;  1I9D A;  5ECO B;  2JSZ A;  5IM9 A;  2H0I A;  2KHP A;  4DSS A;  3E9J B;  4JZQ A;  1BQ7 A;  2ON5 A;  1XVQ A;  3CSJ A;  1CQH A;  2IJY A;  4ZBA A;  3QOU A;  2OA7 A;  4GTU A;  1K0M A;  3TRQ A;  10GS A;  4JR6 A;  1I5G A;  2LQO A;  1ZOF A;  4IEL A;  1R7H A;  4K6X A;  1YKA A;  2GLR A;  2C0E A;  2JAC A;  3ISO A;  1MDI A;  3APQ A;  4WR5 A;  4OMV A;  4NHW A;  4K2D A;  3G7I A;  4ZXG A;  3BD2 A;  3OR5 A;  4ECJ A;  3IE3 A;  2H19 A;  5DQS A;  4ECI A;  2YWN A;  4GQC A;  2HNL A;  5F8B A;  2F9S A;  3KIJ A;  4F2I A;  4TRX A;  1YJ6 A;  4EDY A;  1LU4 A;  1A2J A;  1TTZ A;  4TW5 A;  3IDV A;  5A4V A;  1S3C A;  4BVX A;  4BA7 A;  3D22 A;  2HZE A;  3TJF A;  3LXZ A;  2R5G A;  3D6I A;  3Q18 A;  2IMI A;  4YQV A;  1ZMA A;  3C8E A;  11GS A;  3A2W A;  2AAW A;  2LST A;  3VWU A;  4GRF A;  3QCP A;  1B4P A;  4OD7 A;  2YJ7 A;  4KDU A;  4HJ2 A;  1X5C A;  2ES7 A;  4KSO A;  2G0F A;  5A5K A;  3M8N A;  3VI7 A;  5DJM A;  3GX8 A;  3HDC A;  2F8A A;  5JWQ B;  5ECI B;  3TKS A;  2L5O A;  4V2M A;  4L8E A;  3KXO A;  2C1Y A;  4GSS A;  5F06 A;  2LKU A;  2L4C A;  1PKW A;  5ECK B;  3QMX A;  1T8E B;  1T4Z A;  4K7I A;  4OFM A;  5CNW A;  3TRX A;  2H0H A;  3A3T A;  4I5Q A;  3ZVJ D;  2B7J A;  4FYB A;  3GKX A;  4GQF A;  3F6F A;  1XWB A;  2K9F A;  2CVB A;  5ECQ B;  2ON7 A;  4K7N A;  3IV4 A;  4HU9 A;  5HR1 A;  3IC4 A;  4F0C A;  3GUR A;  1K0N A;  2V6O A;  2GZP A;  3E0U A;  2PVQ A;  3UAR A;  2VLV A;  2X8H A;  3ZLP A;  1ZGN A;  1URM A;  5D9X A;  4QL9 A;  5HR2 A;  2FWE A;  4LL1 B;  3D4T A;  2GGT A;  4OCF A;  2B7K A;  3RAZ A;  2DIY A;  2J23 A;  3FK8 A;  3JCM L;  6GSW A;  2V41 A;  4KB3 A;  2H6Y A;  1TRW A;  2PVO C;  1O7U A;  1T3B A;  2HZF A;  3DKS A;  2HRF A;  1JLV A;  1TI1 A;  4XTS A;  2VCW A;  4MZC A;  1Y6E A;  5CAX A;  3L78 A;  2ALB A;  5CRD A;  4L5L A;  5D73 A;  1ERW A;  3DML A;  1HYU A;  1M9A A;  4LLR A;  4BWS A;  2NBS A;  1QGV A;  3UL3 A;  3IAS 2;  4V2L A;  2IMK A;  1SL1 B;  1TOF A;  3W8S A;  4LL4 B;  3PH9 A;  4JED A;  3TKQ A;  5DAL A;  5B7C A;  1U3A A;  1GSS A;  4NV2 A;  3J7Y b;  3G9B A;  3KTB A;  1EP8 A;  4ACS A;  2L59 A;  2WDU A;  3KJY A;  3APO A;  4KH7 A;  4K0N A;  1TKD B;  1ON4 A;  4MPF A;  1XOB A;  1FW1 A;  2V1M A;  2QSI A;  2RM5 A;  1MTC A;  3TJG A;  2LV3 A;  2H1A A;  2M72 A;  2RUE A;  5H5S A;  1XW9 A;  4J56 E;  8GSS A;  2HRN A;  3WGD A;  4TR1 A;  2HYX A;  2PBJ A;  2JZR A;  3FHK A;  4KX4 A;  5IPG A;  4L0U A;  1CQG A;  3WT2 A;  2NTO A;  1Q98 A;  1YY7 A;  3IAM 2;  2LRT A;  4Q5F A;  1ZZY A;  4RI7 A;  3QR6 A;  5ELA A;  2I4A A;  4ML6 A;  1AQV A;  1S3D A;  2H6X A;  1Z6N A;  1GTA A;  1Z3E A;  1GTU A;  5H5R A;  1GNW A;  2LJR A;  1SL2 B;  1A0R P;  2ZCT A;  2XPD A;  4AJ6 A;  4X0X A;  4AJ7 A;  1GTB A;  2MMZ A;  4KND A;  2XC2 A;  3H79 A;  2V2G A;  2R37 A;  2DJ2 A;  2A2R A;  2J9H A;  2F3M A;  4MA9 A;  2H1G A;  3GFK A;  4GLT A;  1YEP A;  2YN1 A;  3HJO A;  5CO3 A;  2QGV A;  2LQQ A;  5EL8 A;  1VF2 A;  2IPA A;  4PQI A;  2GQM A;  3BOA A;  4RQR A;  5C04 A;  1SKR B;  3UBK A;  2VL2 C;  3WGX A;  3Q74 A;  3VWX A;  2B6M A;  3K8N A;  3RBT A;  2RII A;  1UN2 A;  1V9W A;  2OKA A;  4KE3 A;  3LYK A;  2H1D A; 
#chains in the Genus database with same CATH topology
 1HD2 A;  1GWC A;  3GMF A;  2VOC A;  1F3A A;  1AQX A;  5KN3 A;  4G9H A;  1J9B A;  3HVV A;  3IR4 A;  3DVW A;  1WRY A;  4K1F A;  1GP1 A;  1T1V A;  4HQZ A;  5HFK A;  2MBS A;  2YNX A;  4I97 A;  1JZD A;  4ECC A;  1A8L A;  1YZX A;  1S3A A;  1S3R A;  1KTE A;  1SD8 A;  4KGI A;  3G7Y A;  3Q6O A;  1OC3 A;  2WRT A;  2FNO A;  3EU4 A;  2YAN A;  5HFI A;  2DML A;  4TR4 A;  4BVY A;  1YDK A;  2L6C A;  2BMX A;  5AN1 A;  3L4N A;  2O89 A;  1E6B A;  3ZIV A;  3CSH A;  1XXU A;  1PL1 A;  5J4U A;  1THX A;  5JCU A;  1FB6 A;  4ZB6 A;  1G6Y A;  4ULX A;  4G2E A;  1ML6 A;  1Z9H A;  4MJE A;  1SJI A;  2KLX A;  4EO3 A;  3H8Q A;  1RK4 A;  3HJP A;  4F03 A;  3DIE A;  2DC5 A;  2M80 A;  3GL3 A;  2HT9 A;  4CY8 A;  3NZN A;  1Y25 A;  4MCU A;  5CRG A;  3P90 A;  1FHE A;  4MMM A;  2HRK A;  2MZC A;  5BMU A;  3L9U A;  2YZU A;  3SWL A;  3HD5 A;  4DSQ A;  2QKE A;  4IVF A;  2A4V A;  2RUF A;  1U87 A;  3SBC A;  2H70 A;  4GSN A;  4EXJ A;  4XS6 A;  2FY6 A;  1LJR A;  4HOJ A;  1O8X A;  3GRX A;  1R5P A;  3FR6 A;  2H66 A;  3L9S A;  3IHQ A;  1WPI A;  3LJR A;  3ZRD A;  4FH8 A;  1F3B A;  2MMN A;  1SKW B;  4YKG A;  2YWO A;  3F9U A;  20GS A;  1FVK A;  2JSY A;  3FKF A;  2GZY A;  5G1K A;  3R3E A;  1X5E A;  4IJ3 A;  3IK7 A;  4BVX B;  3CYN A;  5JCW A;  2V6K A;  1AUC A;  2HZE B;  1ZYN A;  3R2Q A;  1MDJ A;  1K3Y A;  3KTL A;  4CW9 A;  4IS0 A;  6GSY A;  2FWH A;  5JCG A;  1XWK A;  4TXV A;  1AXD A;  5KOX A;  4PGT A;  1PX6 A;  2DJK A;  1M3I A;  4IP1 A;  2FCH A;  3LGC A;  5GZZ B;  2H74 A;  3ZYW A;  2GVP A;  5D9W A;  3UJ1 A;  1EWX A;  1NSW A;  2DLX A;  1BJX A;  2K6V A;  5DAK A;  3TJB A;  1GSE A;  3D21 A;  4HEA 2;  3TCO A;  5BRT A;  3US3 A;  3TOU A;  2P31 A;  3WGE A;  3IRA A;  1ZL9 A;  1F37 A;  2YCD A;  2D2Z A;  3KM6 A;  4EF0 A;  5ID2 B;  2VAF A;  4LMW A;  4L0W A;  5ECM B;  3ZIT A;  3GSS A;  5ECL B;  1Z7P A;  3GKM A;  1V40 A;  3TUE A;  4PQH A;  3MDK A;  2R6K A;  4PUR A;  5D9V A;  1GUM A;  1DSB A;  3TKS E;  3GKN A;  2IMF A;  2H0G A;  4KDX A;  1ERV A;  2AV4 A;  4WET A;  3VLN A;  2R4V A;  3BJ5 A;  4MZB A;  4ZL7 A;  7GSS A;  2X4A A;  2AJQ B;  2XBQ A;  5IO2 A;  2ZUP A;  1TRV A;  4KW6 A;  4TN8 A;  5F05 A;  3IXR A;  2GQL A;  2H30 A;  1YEX A;  4XHM A;  3VPQ A;  4JE1 A;  3MSZ A;  2GSR A;  3W8J A;  2FGX A;  2TRC P;  2VM2 A;  4KUN A;  1X0R A;  3EC3 A;  1E2Y A;  1JHB A;  5C00 A;  2X99 A;  2PMT A;  3QDN A;  1GUH A;  2IIY A;  4Z7X A;  3C1R A;  4IQ1 A;  2NPB A;  3GKK A;  4GCI A;  2OE0 A;  3GH6 A;  1B4Q A;  1ZYQ B;  3PIN A;  4Q5Q A;  3RDW A;  1EEM A;  5IMC A;  5GAN D;  4EC0 A;  3CTG A;  4HZ2 A;  2FD3 A;  2CQ9 A;  3IOS A;  2OE1 A;  3EUR A;  1FO5 A;  1MDK A;  5DAL B;  5FHI A;  1BX9 A;  3L9V A;  3FEU A;  2A2S A;  1TK8 B;  2GZZ A;  4FYC A;  6GST A;  2DMM A;  2VLU A;  4IN0 A;  1XIY A;  3UMA A;  3F4R A;  5ID2 A;  2PWJ A;  1NM3 A;  4MP4 A;  1WIK A;  1XBS A;  2IN3 A;  5J9B A;  1XFL A;  3TDG A;  1W89 A;  1YKC A;  1N2A A;  1K0O A;  2I3Y A;  1A0F A;  4LMV A;  1XW6 A;  2R2J A;  5G2Z A;  4O5U A;  4FYU A;  3MNG A;  5DVB A;  17GS A;  5CRH A;  3W6G A;  1AIU A;  4TR1 B;  1TRU A;  3A2X A;  4MF7 A;  3QFA C;  4QL7 A;  1M7T A;  1EV9 A;  1B9X C;  2M46 A;  4GWR A;  1J0F A;  3H1N A;  2WJU A;  3GYK A;  4F9Z A;  4NXI A;  3M1G A;  1W4V A;  2AB6 A;  2IME A;  1IYH A;  1MD3 A;  4I6X A;  3DWV A;  5ECP B;  4YH2 A;  1VF3 A;  3QAG A;  2HXK A;  2KP2 A;  3F3R A;  1HNB A;  2KUC A;  4G19 A;  3VUR A;  3ZL5 A;  2HLS A;  2VCZ A;  1XWA A;  3MIX A;  5AIX A;  2KP1 A;  4HQS A;  4IKH A;  3IK9 A;  3BBY A;  3FZ9 A;  1GSQ A;  4XIH A;  4AJ8 A;  1X9W B;  1GLP A;  3GUS A;  2WCI A;  4X1U A;  3HJM A;  2OBK A;  4BPY A;  1USB A;  5GAP D;  3TGZ A;  2JAD A;  5ECH B;  5IMF A;  3EU3 A;  1RW1 A;  1B48 A;  1Z7R A;  3UOM A;  6GSV A;  2H71 A;  3D5J A;  2GQK A;  4G0L A;  4KCA A;  1KEB A;  3KH9 A;  1JZO A;  2CX4 A;  18GS A;  4NV5 A;  5HFG A;  1QUW A;  2PGT A;  3M9J A;  1YQ1 A;  4ZBB A;  4I2U A;  1EGO A;  1O8W A;  2O7K A;  5E4W A;  5IMD A;  4XS4 A;  5CYY A;  3ZVJ A;  2UZ8 A;  1Z5Y E;  1PQN A;  3TJK A;  3VI5 A;  4TOP A;  2YV7 A;  1JZW A;  22GS A;  1TP9 A;  3TKS C;  1SD9 A;  1UA5 A;  2LNT A;  3FYG A;  3EVI A;  1QFN A;  1XZO A;  3EE2 A;  2IL3 A;  1GSF A;  1J08 A;  3Q19 A;  1M9B A;  1M99 A;  5L71 A;  1GL8 A;  1EZK A;  3UEM A;  2B1K A;  1WE0 A;  2CV4 A;  2MMA A;  1V98 A;  5B8B A;  12GS A;  2GDR A;  3TRP A;  3HZ4 A;  3C1S A;  1PD2 1;  1XW5 A;  1F6M C;  3I9V 2;  1ZCP A;  2DBC A;  5DJL A;  2JU5 A;  3I6A A;  3J7Y k;  4KA0 A;  4POK A;  4BVY B;  1OC8 A;  1R5A A;  3GH9 A;  4USS A;  3CBU A;  1OVN A;  1A2M A;  4TR0 A;  2TIR A;  3I69 A;  1OKD A;  4GST A;  1EP7 A;  2XBI A;  2FA4 A;  4LA1 A;  4OO4 A;  2YWM A;  3U6V A;  2YWI A;  2FHE A;  5ECR B;  1M2A A;  4POB A;  5HR3 A;  1TK0 B;  1THO A;  2WZ9 A;  4MPG A;  3U5R E;  4BWQ A;  4PUA A;  2X8G A;  4XCS A;  3KZQ A;  3P2A A;  3TB2 A;  1GH2 A;  4MF5 A;  1PN9 A;  3LFL A;  2FUG 2;  3V1W A;  3ZFL A;  4K8M A;  1V57 A;  3GTU A;  5INY A;  5KEJ A;  1T7P B;  1WJK A;  5HR0 A;  1QK8 A;  4YQU A;  3UBL A;  2RM6 A;  1SK1 A;  2HE3 A;  3ERG A;  1JLW A;  1VF4 A;  2WUL A;  3DVX A;  2YP6 A;  2G2Q A;  1DBY A;  5IO0 A;  2H75 A;  1YF0 A;  1PKZ A;  2H1B A;  3GX0 A;  2CVK A;  1H4O A;  2HSM A;  5H5Q A;  2VLT A;  2B5Y A;  1JZR A;  2KOK A;  1FVJ A;  4JRR A;  5COH A;  3LXT A;  4F82 A;  3HVX A;  2IWT A;  4NWY A;  3UIW A;  2MYG A;  3AY8 A;  5DQY A;  1XCC A;  2LJK A;  3MYD A;  3ZML A;  4MK3 A;  4YQM A;  1O6J A;  2YOI A;  1ABA A;  5J5N A;  4NHZ A;  2GSS A;  2C0D A;  3EMP A;  4DEJ A;  3KMN A;  2F51 A;  3FZ4 A;  4JR4 A;  3GIX A;  5B6M A;  4DSR A;  3HCZ A;  4ZIJ A;  3RHB A;  5DAK B;  1SYX A;  2VIM A;  3O6T A;  4PQ1 A;  1GNE A;  3VPT A;  5EVO A;  1M2D A;  5G5E A;  1K3O A;  4TXO B;  5D8I A;  1ST9 A;  1SJZ A;  2EC4 A;  3WYW A;  2BTO T;  4IJI A;  4POM A;  2DKH A;  2O85 A;  2E7P A;  4KDY A;  3QD9 A;  4KAE A;  4X43 A;  3FZA A;  3GHA A;  2EIQ A;  2CA8 A;  1XVW A;  1AC1 A;  2PER A;  1WMJ A;  3N9J A;  3HKR A;  4TR3 A;  4PNG A;  2JZT A;  3FW2 A;  1X5D A;  3CRT A;  2K18 A;  1OKT A;  2XHF A;  4Q5N A;  2FWG A;  4N11 A;  3KH7 A;  1ILO A;  1AAZ A;  5F07 A;  4Z2U A;  1FB0 A;  5B8A A;  5KN0 A;  1BED A;  4N0V A;  3CSI A;  4YAP A;  4IW9 A;  2IFQ A;  1JFU A;  4MJC A;  4ZL8 A;  1DE1 A;  2N5A A;  1AQW A;  2FLS A;  2GT6 A;  3VWV A;  1UVZ A;  1EEJ A;  1TJD A;  4K0G A;  2HFD A;  1GSY A;  2L6D A;  5J9C A;  3DRN A;  3PPU A;  4D73 A;  1BAY A;  4FIW A;  2LTK A;  5DDL A;  1V2A A;  2K8S A;  3VK9 A;  2C3Q A;  3F63 A;  4MDC A;  2VCX A;  13GS A;  3DD3 A;  2XPE A;  1C72 A;  2N5B A;  1PMT A;  3FZ5 A;  1QQ2 A;  1U88 A;  2DJ1 A;  3E3E A;  3IHG A;  2E2M A;  2O8V B;  2OBI A;  1PGT A;  3DXB A;  3P7X A;  4G0I A;  4O92 A;  4CHS A;  1TI3 A;  1EGR A;  5J3R A;  4TXO A;  4ICY A;  3PGT A;  2LJA A;  2HRA A;  1N8J A;  1AW9 A;  1DUG A;  2HI7 A;  4O7H A;  2HSY A;  1TU7 A;  4J2F A;  1NHY A;  5D96 A;  1BG5 A;  3IBH A;  5ELG A;  4ISD A;  3M9K A;  3EMX A;  3ZTL A;  1G7E A;  4BIK A;  3LQ7 A;  1A8Y A;  4ZIL A;  2TRX A;  3ZIJ A;  2F8F A;  4ID0 A;  4RUV A;  5J41 A;  1NW2 A;  1VF1 A;  1SL0 B;  1Q4J A;  3D0Z A;  2NVL A;  2PN8 A;  1SKS B;  19GS A;  3F8U A;  4WF5 A;  1OE8 A;  4N10 A;  3F0I A;  3DGQ A;  4ILF A;  2AHE A;  2FA8 A;  4F0B A;  3CXG A;  1MEK A;  1GRX A;  1XPV A;  4WR4 A;  2B5X A;  5F0G A;  4IQA A;  4OWY A;  1XOA A;  2GST A;  1ZYE A;  1TRS A;  1PX7 A;  2DJ0 A;  4ECB A;  2L4Q A;  1GUL A;  2I1U A;  1QXH A;  2VL3 A;  2C3N A;  2C3T A;  4ZB8 A;  2P5R A;  2YPM A;  2CZ3 A;  2E0Q A;  5GSS A;  3LOR A;  3UVT A;  2JZS A;  2MBT A;  1O81 A;  5LNK e;  1OE7 A;  1PSQ A;  3FR9 A;  4L5O A;  5A4W A;  3ZRE A;  4P3Y B;  3A2V A;  5CRW A;  1GSD A;  6GSS A;  4V1A p;  4K7O A;  3KCM A;  4Z2T A;  4XS4 B;  3O3T A;  1A23 A;  2B1L A;  3FRC A;  1K3L A;  3RHC A;  2FWF A;  3CRU A;  4HZ4 A;  3APS A;  1M2B A;  4FQU A;  3LYP A;  3D4M A;  3EYT A;  3ERW A;  4V1A g;  1OYJ A;  5G30 A;  14GS A;  1EOH A;  5IMZ A;  4HSC X;  3HY2 A;  2QC7 A;  3PR8 A;  4OFT A;  4FO5 A;  5D9T A;  4WF4 A;  1IYI A;  3RPP A;  3HZ8 A;  1DE2 A;  3TOT A;  3LSZ A;  2OAC A;  3GV1 A;  4ZB9 A;  3GST A;  2GTU A;  1U3I A;  4OFN A;  3C71 A;  3F4S A;  1K0A A;  5AGY A;  4HS1 A;  5E59 A;  4WKW A;  6GSU A;  3O76 A;  3GNJ A;  4TVE A;  5JWR B;  5DBQ A;  3GL5 A;  1GSU A;  1QMV A;  1FAA A;  1HNA A;  2DKI A;  1SK2 A;  3NOF A;  2VL2 A;  5CRE A;  4KSM A;  1TW9 A;  1NHO A;  2CX3 A;  2C0G A;  3C7M A;  3ZZX A;  2YZH A;  4E8H A;  4MF6 A;  4K2X A;  5IIZ A;  5LCZ A;  4MLY A;  4BL7 B;  2EIO A;  1TK5 B;  1TXX A;  4X4J A;  2WFC A;  3M3M A;  1T00 A;  3KEB A;  5ABR A;  1WP0 A;  4EUY A;  1VRS D;  2X8C A;  3A5I A;  4EL1 A;  2REM A;  2K8V A;  2NDO A;  2LUS A;  1PRX A;  4MAB A;  1A2L A;  4G0K A;  2PUK C;  5DCG A;  4RI6 A;  5AIS A;  3HYP A;  3GTU B;  4PX1 A;  1B9Y C;  4G10 A;  3A5W A;  4KCE A;  5IMV A;  3G7J A;  3F3Q A;  2GS3 A;  4MH2 A;  4WBJ A;  2H76 A;  4HU7 A;  3MWH A;  1SU9 A;  2PU9 C;  2OE3 A;  2LNS A;  3NIV A;  5KN2 A;  1MD4 A;  2YJH A;  1FOV A;  1K0B A;  3HA9 A;  2WGR A;  2IMD A;  1FOH A;  2I81 A;  3GA4 A;  3P8W A;  2C8U A;  1XG8 A;  2HSH A;  3F4T A;  5LD0 A;  4EDZ A;  9GSS A;  1WWJ A;  2VCV A;  3RPN A;  3QAW A;  5B6N A;  1G6W A;  1TU8 A;  4O5R A;  3ZMK A;  2AUV A;  4GXZ A;  2DIZ A;  2L5L A;  2YV9 A;  3KMO A;  4IHU A;  4EKZ A;  4IGJ A;  2PPT A;  2E2G A;  3N5O A;  2CVD A;  3LW9 A;  3TJJ A;  1OAZ A;  2DJ3 A;  5KN1 A;  1KNG A;  3FR3 A;  5EPF A;  3BCI A;  1SYR A;  2VCT A;  1G0T A;  4HI7 A;  2DJJ A;  4ZL9 A;  3EWL A;  4PXO A;  3TKR A;  2C80 A;  3F6D A;  2VCQ A;  1M0U A;  2LS5 A;  1ERT A;  4BL7 A;  1SK0 A;  1XWG A;  1WOU A;  2CZ2 A;  2L57 A;  1LBK A;  1HNC A;  4MJB A;  2H73 A;  2B3S A;  1PN0 A;  3UAP A;  3S9F A;  1A24 A;  3C73 A;  2C4J A;  2X49 A;  1O73 A;  5G1L A;  2EIR A;  3WT1 A;  3QPM A;  1PA3 A;  5JWO B;  4AF2 A;  3IA1 A;  3L0H A;  2VO4 A;  4K9Z A;  2I9H A;  2LRC A;  3KP9 A;  4EE0 A;  4MJA A;  1R4W A;  2H72 A;  1SJ6 A;  3HHV A;  2GSQ A;  2R3X A;  4GF0 A;  2B5E A;  2RLI A;  6GSX A;  3BCK A;  4WXT A;  1PFO A;  3ZFB A;  1EOG A;  5AIV A;  4MNN A;  1OC9 B;  1K0D A;  1VGL A;  1K0C A;  3H4K A;  4HDE A;  4PUF C;  2IFQ B;  4N30 A;  5IPH A;  5GST A;  2CAQ A;  3LEF A;  4IBP A;  1X9M B;  1GTI A;  1R26 A;  4ZBD A;  2WS2 A;  3DEX A;  1KBN A;  4XRD A;  3I43 A;  5HQP A;  3ERF A;  2CT6 A;  2VD1 A;  3LG6 A;  3CTF A;  1RQM A;  2OJL A;  4D73 B;  1V58 A;  16GS A;  2LRN A;  1T4Y A;  5CP1 A;  3WD6 A;  2WB9 A;  1O85 A;  3DYR A;  4DVC A;  4WEY A;  4E8E A;  3M0F A;  4JU5 A;  4OO5 A;  4CDO A;  1F2E A;  3LWA A;  2H6Z A;  3ME8 A;  1ACV A;  1GUK A;  1FG4 A;  4I2T A;  5D93 A;  4Q5R A;  4I8B A;  4HUA A;  2V32 A;  3ED3 A;  4IP6 A;  1B8X A;  4POL A;  4NPB A;  3KD0 A;  2CAI A;  5G31 A;  2VUP A;  1HQO A;  4J57 E;  4MZW A;  4DSS B;  2MMO A;  4Z2R A;  4V2N A;  4N0Z A;  2N5F A;  4NAX A;  4PNF A;  5IMA A;  3UVH A;  2JL4 A;  4QQ7 A;  2OAD A;  4O5Q A;  3H93 A;  1BYE A;  4WBR D;  3TKP A;  3VFI A;  2BJX A;  1OC9 A;  4ML1 A;  2VL9 A;  1SEN A;  4EVM A;  2Z9S A;  3EIN A;  2AYT A;  3QAV A;  5FWG A;  4YAV A;  5IQY A;  5G5F A;  4EIP A;  4XS1 A;  4O32 A;  1G7O A;  3KP8 A;  3CMI A;  3ME7 A;  4NMU A;  2ZNM A;  2LEG A;  5ECN B;  3MAK A;  4H86 A;  1EV4 A;  4AGS A;  1U6T A;  5IOX A;  4RQX A;  2VM1 A;  3HXS A;  5DCH A;  3QFB C;  2H01 A;  1Z6M A;  3HVN A;  1F9M A;  2P0G A;  1TDI A;  5IOW A;  4TKY A;  1XWC A;  3GN3 A;  3FMW A;  5EY6 A;  3VWW A;  1X9S B;  3IC8 A;  3KGK A;  2GT5 A;  1GLQ A;  5ECS A;  4JBB A;  2H8L A;  5FT3 A;  3FY7 A;  3IPZ A;  5A4U A;  1PL2 A;  1UC7 A;  1YF1 A;  4OCE A;  4XRA A;  5ENU A;  4HJM A;  2P5Q A;  2R0P A;  2O87 A;  2VD0 A;  1H75 A;  2C0F A;  2DSA A;  1ERU A;  2X64 A;  3HVS A;  4MH3 A;  1I9D A;  5ECO B;  2JSZ A;  5IM9 A;  2H0I A;  2KHP A;  4DSS A;  3E9J B;  4JZQ A;  1BQ7 A;  2ON5 A;  1XVQ A;  3CSJ A;  1CQH A;  2IJY A;  5KOW A;  4ZBA A;  3QOU A;  2OA7 A;  4GTU A;  1K0M A;  3TRQ A;  10GS A;  4JR6 A;  1I5G A;  2LQO A;  1ZOF A;  4IEL A;  1R7H A;  4K6X A;  1YKA A;  2GLR A;  4A5P A;  2C0E A;  2JAC A;  3ISO A;  1MDI A;  3APQ A;  4WR5 A;  2QA2 A;  4OMV A;  4NHW A;  4K2D A;  3G7I A;  4ZXG A;  3BD2 A;  3OR5 A;  4ECJ A;  2QA1 A;  3IE3 A;  2H19 A;  5DQS A;  4ECI A;  2YWN A;  4GQC A;  2HNL A;  5F8B A;  2F9S A;  3KIJ A;  4F2I A;  2A2P A;  4TRX A;  1YJ6 A;  4EDY A;  1LU4 A;  4CY6 A;  1A2J A;  1TTZ A;  4TW5 A;  3IDV A;  5A4V A;  1S3C A;  4BVX A;  4BA7 A;  3D22 A;  2HZE A;  3TJF A;  3LXZ A;  2R5G A;  3D6I A;  3Q18 A;  2IMI A;  4YQV A;  1ZMA A;  3C8E A;  11GS A;  3A2W A;  2AAW A;  2LST A;  3VWU A;  4GRF A;  3QCP A;  2A4H A;  1B4P A;  4OD7 A;  2YJ7 A;  4KDU A;  4HJ2 A;  1X5C A;  2ES7 A;  4KSO A;  2G0F A;  5A5K A;  3M8N A;  3VI7 A;  5DJM A;  3GX8 A;  3HDC A;  2F8A A;  5JWQ B;  5ECI B;  3TKS A;  2L5O A;  4V2M A;  4L8E A;  3KXO A;  2C1Y A;  4GSS A;  5F06 A;  2LKU A;  2L4C A;  1PKW A;  5ECK B;  3QMX A;  1T8E B;  3CQF A;  1T4Z A;  4K7I A;  4OFM A;  5CNW A;  3TRX A;  2H0H A;  3A3T A;  4I5Q A;  3ZVJ D;  2R0C A;  2B7J A;  4FYB A;  3GKX A;  4GQF A;  3F6F A;  1XWB A;  2K9F A;  2CVB A;  5ECQ B;  2ON7 A;  4K7N A;  3IV4 A;  4HU9 A;  5HR1 A;  3IC4 A;  4F0C A;  3GUR A;  1K0N A;  2V6O A;  2GZP A;  3E0U A;  2PVQ A;  3UAR A;  4PTS A;  2VLV A;  2X8H A;  3ZLP A;  1ZGN A;  1URM A;  5D9X A;  4QL9 A;  5HR2 A;  2FWE A;  4LL1 B;  3D4T A;  2GGT A;  4OCF A;  2B7K A;  3RAZ A;  2DIY A;  2J23 A;  3FK8 A;  3JCM L;  6GSW A;  2V41 A;  4KB3 A;  2H6Y A;  1TRW A;  2PVO C;  1O7U A;  1T3B A;  2HZF A;  2R0G A;  3DKS A;  2HRF A;  1JLV A;  1TI1 A;  4XTS A;  2VCW A;  4MZC A;  1Y6E A;  5CAX A;  3L78 A;  2ALB A;  5CRD A;  4L5L A;  4EIQ A;  5D73 A;  1ERW A;  3DML A;  1HYU A;  1M9A A;  4LLR A;  4BWS A;  2NBS A;  1QGV A;  3UL3 A;  4K5R A;  3IAS 2;  4V2L A;  2IMK A;  1SL1 B;  1TOF A;  3W8S A;  4LL4 B;  3PH9 A;  4JED A;  3TKQ A;  5DAL A;  5B7C A;  1U3A A;  1GSS A;  4NV2 A;  3J7Y b;  3G9B A;  3KTB A;  1EP8 A;  4ACS A;  2L59 A;  2WDU A;  3KJY A;  3APO A;  4KH7 A;  4K0N A;  1TKD B;  1ON4 A;  4MPF A;  1XOB A;  1FW1 A;  2V1M A;  2QSI A;  2RM5 A;  1MTC A;  3TJG A;  2LV3 A;  2H1A A;  2M72 A;  2RUE A;  5H5S A;  1XW9 A;  4J56 E;  8GSS A;  2HRN A;  1M3J A;  3WGD A;  4TR1 A;  2HYX A;  2PBJ A;  2JZR A;  3FHK A;  4KX4 A;  5IPG A;  4L0U A;  1CQG A;  3WT2 A;  2NTO A;  1Q98 A;  1YY7 A;  3IAM 2;  2LRT A;  4Q5F A;  1ZZY A;  4RI7 A;  3QR6 A;  5ELA A;  2I4A A;  4ML6 A;  1AQV A;  1S3D A;  2H6X A;  1Z6N A;  1GTA A;  1Z3E A;  1GTU A;  5H5R A;  1GNW A;  2LJR A;  1SL2 B;  1A0R P;  2ZCT A;  2XPD A;  4AJ6 A;  4X0X A;  4AJ7 A;  1GTB A;  2MMZ A;  4KND A;  2XC2 A;  3H79 A;  2V2G A;  2R37 A;  2DJ2 A;  4K5S A;  2A2R A;  4KF9 A;  2J9H A;  2F3M A;  4MA9 A;  2H1G A;  3GFK A;  4GLT A;  1YEP A;  2YN1 A;  3HJO A;  5CO3 A;  2QGV A;  2LQQ A;  5EL8 A;  1VF2 A;  2IPA A;  4PQI A;  3EPT A;  4YKF A;  2GQM A;  3BOA A;  4RQR A;  5C04 A;  1ZYP A;  1SKR B;  3UBK A;  2VL2 C;  3WGX A;  3Q74 A;  3VWX A;  2B6M A;  3K8N A;  3RBT A;  2RII A;  1UN2 A;  1V9W A;  2OKA A;  4KE3 A;  3LYK A;  2H1D A; 
#chains in the Genus database with same CATH homology
 1HD2 A;  1GWC A;  3GMF A;  2VOC A;  1F3A A;  1AQX A;  5KN3 A;  4G9H A;  1J9B A;  3HVV A;  3IR4 A;  3DVW A;  1WRY A;  4K1F A;  1GP1 A;  1T1V A;  4HQZ A;  5HFK A;  2MBS A;  2YNX A;  4I97 A;  1JZD A;  4ECC A;  1A8L A;  1YZX A;  1S3A A;  1KTE A;  1SD8 A;  4KGI A;  3G7Y A;  3Q6O A;  1OC3 A;  2WRT A;  2FNO A;  3EU4 A;  2YAN A;  5HFI A;  2DML A;  4TR4 A;  4BVY A;  1YDK A;  2L6C A;  2BMX A;  5AN1 A;  3L4N A;  2O89 A;  1E6B A;  3ZIV A;  3CSH A;  1XXU A;  1PL1 A;  5J4U A;  1THX A;  5JCU A;  1FB6 A;  4ZB6 A;  1G6Y A;  4ULX A;  4G2E A;  1ML6 A;  1Z9H A;  4MJE A;  1SJI A;  2KLX A;  4EO3 A;  3H8Q A;  1RK4 A;  3HJP A;  4F03 A;  3DIE A;  2DC5 A;  2M80 A;  3GL3 A;  2HT9 A;  4CY8 A;  3NZN A;  1Y25 A;  4MCU A;  5CRG A;  3P90 A;  1FHE A;  4MMM A;  2HRK A;  2MZC A;  5BMU A;  3L9U A;  2YZU A;  3SWL A;  3HD5 A;  4DSQ A;  2QKE A;  4IVF A;  2A4V A;  2RUF A;  1U87 A;  3SBC A;  2H70 A;  4GSN A;  4EXJ A;  4XS6 A;  2FY6 A;  1LJR A;  4HOJ A;  1O8X A;  3GRX A;  1R5P A;  3FR6 A;  2H66 A;  3L9S A;  3IHQ A;  1WPI A;  3LJR A;  3ZRD A;  4FH8 A;  1F3B A;  2MMN A;  1SKW B;  4YKG A;  2YWO A;  3F9U A;  20GS A;  1FVK A;  2JSY A;  3FKF A;  2GZY A;  5G1K A;  3R3E A;  1X5E A;  4IJ3 A;  3IK7 A;  4BVX B;  3CYN A;  5JCW A;  2V6K A;  1AUC A;  2HZE B;  1ZYN A;  3R2Q A;  1MDJ A;  1K3Y A;  3KTL A;  4CW9 A;  4IS0 A;  6GSY A;  2FWH A;  5JCG A;  1XWK A;  4TXV A;  1AXD A;  5KOX A;  4PGT A;  1PX6 A;  2DJK A;  4IP1 A;  2FCH A;  3LGC A;  5GZZ B;  2H74 A;  3ZYW A;  2GVP A;  5D9W A;  3UJ1 A;  1EWX A;  1NSW A;  2DLX A;  1BJX A;  2K6V A;  5DAK A;  3TJB A;  1GSE A;  3D21 A;  4HEA 2;  3TCO A;  5BRT A;  3US3 A;  3TOU A;  2P31 A;  3WGE A;  3IRA A;  1ZL9 A;  1F37 A;  2YCD A;  2D2Z A;  3KM6 A;  4EF0 A;  5ID2 B;  2VAF A;  4LMW A;  4L0W A;  5ECM B;  3ZIT A;  3GSS A;  5ECL B;  1Z7P A;  3GKM A;  1V40 A;  3TUE A;  4PQH A;  3MDK A;  2R6K A;  4PUR A;  5D9V A;  1GUM A;  1DSB A;  3TKS E;  3GKN A;  2IMF A;  2H0G A;  4KDX A;  1ERV A;  2AV4 A;  4WET A;  3VLN A;  2R4V A;  3BJ5 A;  4MZB A;  4ZL7 A;  7GSS A;  2X4A A;  2AJQ B;  2XBQ A;  5IO2 A;  2ZUP A;  1TRV A;  4KW6 A;  4TN8 A;  5F05 A;  3IXR A;  2GQL A;  2H30 A;  1YEX A;  4XHM A;  3VPQ A;  4JE1 A;  3MSZ A;  2GSR A;  3W8J A;  2FGX A;  2TRC P;  2VM2 A;  4KUN A;  1X0R A;  3EC3 A;  1E2Y A;  1JHB A;  5C00 A;  2X99 A;  2PMT A;  3QDN A;  1GUH A;  2IIY A;  4Z7X A;  3C1R A;  4IQ1 A;  2NPB A;  3GKK A;  4GCI A;  2OE0 A;  3GH6 A;  1B4Q A;  1ZYQ B;  3PIN A;  4Q5Q A;  3RDW A;  1EEM A;  5IMC A;  5GAN D;  4EC0 A;  3CTG A;  4HZ2 A;  2FD3 A;  2CQ9 A;  3IOS A;  2OE1 A;  3EUR A;  1FO5 A;  1MDK A;  5DAL B;  5FHI A;  1BX9 A;  3L9V A;  3FEU A;  2A2S A;  1TK8 B;  2GZZ A;  4FYC A;  6GST A;  2DMM A;  2VLU A;  4IN0 A;  1XIY A;  3UMA A;  3F4R A;  5ID2 A;  2PWJ A;  1NM3 A;  4MP4 A;  1WIK A;  1XBS A;  2IN3 A;  5J9B A;  1XFL A;  3TDG A;  1W89 A;  1YKC A;  1N2A A;  1K0O A;  2I3Y A;  1A0F A;  4LMV A;  1XW6 A;  2R2J A;  5G2Z A;  4O5U A;  4FYU A;  3MNG A;  5DVB A;  17GS A;  5CRH A;  3W6G A;  1AIU A;  4TR1 B;  1TRU A;  3A2X A;  4MF7 A;  3QFA C;  4QL7 A;  1M7T A;  1EV9 A;  1B9X C;  2M46 A;  4GWR A;  1J0F A;  3H1N A;  2WJU A;  3GYK A;  4F9Z A;  4NXI A;  3M1G A;  1W4V A;  2AB6 A;  2IME A;  1IYH A;  1MD3 A;  4I6X A;  3DWV A;  5ECP B;  4YH2 A;  1VF3 A;  3QAG A;  2HXK A;  2KP2 A;  3F3R A;  1HNB A;  2KUC A;  4G19 A;  3VUR A;  3ZL5 A;  2HLS A;  2VCZ A;  1XWA A;  3MIX A;  5AIX A;  2KP1 A;  4HQS A;  4IKH A;  3IK9 A;  3BBY A;  3FZ9 A;  1GSQ A;  4XIH A;  4AJ8 A;  1X9W B;  1GLP A;  3GUS A;  2WCI A;  4X1U A;  3HJM A;  2OBK A;  4BPY A;  1USB A;  5GAP D;  3TGZ A;  2JAD A;  5ECH B;  5IMF A;  3EU3 A;  1RW1 A;  1B48 A;  1Z7R A;  3UOM A;  6GSV A;  2H71 A;  3D5J A;  2GQK A;  4G0L A;  4KCA A;  1KEB A;  3KH9 A;  1JZO A;  2CX4 A;  18GS A;  4NV5 A;  5HFG A;  1QUW A;  2PGT A;  3M9J A;  1YQ1 A;  4ZBB A;  4I2U A;  1EGO A;  1O8W A;  2O7K A;  5E4W A;  5IMD A;  4XS4 A;  5CYY A;  3ZVJ A;  2UZ8 A;  1Z5Y E;  1PQN A;  3TJK A;  3VI5 A;  4TOP A;  2YV7 A;  1JZW A;  22GS A;  1TP9 A;  3TKS C;  1SD9 A;  1UA5 A;  2LNT A;  3FYG A;  3EVI A;  1QFN A;  1XZO A;  3EE2 A;  2IL3 A;  1GSF A;  1J08 A;  3Q19 A;  1M9B A;  1M99 A;  5L71 A;  1GL8 A;  1EZK A;  3UEM A;  2B1K A;  1WE0 A;  2CV4 A;  2MMA A;  1V98 A;  5B8B A;  12GS A;  2GDR A;  3TRP A;  3HZ4 A;  3C1S A;  1PD2 1;  1XW5 A;  1F6M C;  3I9V 2;  1ZCP A;  2DBC A;  5DJL A;  2JU5 A;  3I6A A;  3J7Y k;  4KA0 A;  4POK A;  4BVY B;  1OC8 A;  1R5A A;  3GH9 A;  4USS A;  3CBU A;  1OVN A;  1A2M A;  4TR0 A;  2TIR A;  3I69 A;  1OKD A;  4GST A;  1EP7 A;  2XBI A;  2FA4 A;  4LA1 A;  4OO4 A;  2YWM A;  3U6V A;  2YWI A;  2FHE A;  5ECR B;  1M2A A;  4POB A;  5HR3 A;  1TK0 B;  1THO A;  2WZ9 A;  4MPG A;  3U5R E;  4BWQ A;  4PUA A;  2X8G A;  4XCS A;  3KZQ A;  3P2A A;  3TB2 A;  1GH2 A;  4MF5 A;  1PN9 A;  3LFL A;  2FUG 2;  3V1W A;  3ZFL A;  4K8M A;  1V57 A;  3GTU A;  5INY A;  5KEJ A;  1T7P B;  1WJK A;  5HR0 A;  1QK8 A;  4YQU A;  3UBL A;  2RM6 A;  1SK1 A;  2HE3 A;  3ERG A;  1JLW A;  1VF4 A;  2WUL A;  3DVX A;  2YP6 A;  2G2Q A;  1DBY A;  5IO0 A;  2H75 A;  1YF0 A;  1PKZ A;  2H1B A;  3GX0 A;  2CVK A;  1H4O A;  2HSM A;  5H5Q A;  2VLT A;  2B5Y A;  1JZR A;  2KOK A;  1FVJ A;  4JRR A;  5COH A;  3LXT A;  4F82 A;  3HVX A;  2IWT A;  4NWY A;  3UIW A;  2MYG A;  3AY8 A;  5DQY A;  1XCC A;  2LJK A;  3MYD A;  3ZML A;  4MK3 A;  4YQM A;  1O6J A;  2YOI A;  1ABA A;  5J5N A;  4NHZ A;  2GSS A;  2C0D A;  3EMP A;  4DEJ A;  3KMN A;  2F51 A;  3FZ4 A;  4JR4 A;  3GIX A;  5B6M A;  4DSR A;  3HCZ A;  4ZIJ A;  3RHB A;  5DAK B;  1SYX A;  2VIM A;  3O6T A;  4PQ1 A;  1GNE A;  3VPT A;  5EVO A;  1M2D A;  5G5E A;  1K3O A;  4TXO B;  5D8I A;  1ST9 A;  1SJZ A;  2EC4 A;  3WYW A;  2BTO T;  4IJI A;  4POM A;  2DKH A;  2O85 A;  2E7P A;  4KDY A;  3QD9 A;  4KAE A;  4X43 A;  3FZA A;  3GHA A;  2EIQ A;  2CA8 A;  1XVW A;  1AC1 A;  2PER A;  1WMJ A;  3N9J A;  3HKR A;  4TR3 A;  4PNG A;  2JZT A;  3FW2 A;  1X5D A;  3CRT A;  2K18 A;  1OKT A;  2XHF A;  4Q5N A;  2FWG A;  4N11 A;  3KH7 A;  1ILO A;  1AAZ A;  5F07 A;  4Z2U A;  1FB0 A;  5B8A A;  5KN0 A;  1BED A;  4N0V A;  3CSI A;  4YAP A;  4IW9 A;  2IFQ A;  1JFU A;  4MJC A;  4ZL8 A;  1DE1 A;  2N5A A;  1AQW A;  2FLS A;  2GT6 A;  3VWV A;  1UVZ A;  1EEJ A;  1TJD A;  4K0G A;  2HFD A;  1GSY A;  2L6D A;  5J9C A;  3DRN A;  3PPU A;  4D73 A;  1BAY A;  4FIW A;  2LTK A;  5DDL A;  1V2A A;  2K8S A;  3VK9 A;  2C3Q A;  3F63 A;  4MDC A;  2VCX A;  13GS A;  3DD3 A;  2XPE A;  1C72 A;  2N5B A;  1PMT A;  3FZ5 A;  1QQ2 A;  1U88 A;  2DJ1 A;  3E3E A;  3IHG A;  2E2M A;  2O8V B;  2OBI A;  1PGT A;  3DXB A;  3P7X A;  4G0I A;  4O92 A;  4CHS A;  1TI3 A;  1EGR A;  5J3R A;  4TXO A;  4ICY A;  3PGT A;  2LJA A;  2HRA A;  1N8J A;  1AW9 A;  1DUG A;  2HI7 A;  4O7H A;  2HSY A;  1TU7 A;  4J2F A;  1NHY A;  5D96 A;  1BG5 A;  3IBH A;  5ELG A;  4ISD A;  3M9K A;  3EMX A;  3ZTL A;  1G7E A;  3LQ7 A;  1A8Y A;  4ZIL A;  2TRX A;  3ZIJ A;  2F8F A;  4ID0 A;  4RUV A;  5J41 A;  1NW2 A;  1VF1 A;  1SL0 B;  1Q4J A;  3D0Z A;  2NVL A;  2PN8 A;  1SKS B;  19GS A;  3F8U A;  4WF5 A;  1OE8 A;  4N10 A;  3F0I A;  3DGQ A;  4ILF A;  2AHE A;  2FA8 A;  4F0B A;  3CXG A;  1MEK A;  1GRX A;  1XPV A;  4WR4 A;  2B5X A;  5F0G A;  4IQA A;  4OWY A;  1XOA A;  2GST A;  1ZYE A;  1TRS A;  1PX7 A;  2DJ0 A;  4ECB A;  2L4Q A;  1GUL A;  2I1U A;  1QXH A;  2VL3 A;  2C3N A;  2C3T A;  4ZB8 A;  2P5R A;  2YPM A;  2CZ3 A;  2E0Q A;  5GSS A;  3LOR A;  3UVT A;  2JZS A;  2MBT A;  1O81 A;  5LNK e;  1OE7 A;  1PSQ A;  3FR9 A;  4L5O A;  5A4W A;  3ZRE A;  4P3Y B;  3A2V A;  5CRW A;  1GSD A;  6GSS A;  4V1A p;  4K7O A;  3KCM A;  4Z2T A;  4XS4 B;  3O3T A;  1A23 A;  2B1L A;  3FRC A;  1K3L A;  3RHC A;  2FWF A;  3CRU A;  4HZ4 A;  3APS A;  1M2B A;  4FQU A;  3LYP A;  3D4M A;  3EYT A;  3ERW A;  4V1A g;  1OYJ A;  5G30 A;  14GS A;  1EOH A;  5IMZ A;  3HY2 A;  2QC7 A;  3PR8 A;  4OFT A;  4FO5 A;  5D9T A;  4WF4 A;  1IYI A;  3RPP A;  3HZ8 A;  1DE2 A;  3TOT A;  3LSZ A;  2OAC A;  3GV1 A;  4ZB9 A;  3GST A;  2GTU A;  1U3I A;  4OFN A;  3C71 A;  3F4S A;  1K0A A;  5AGY A;  4HS1 A;  5E59 A;  4WKW A;  6GSU A;  3O76 A;  3GNJ A;  4TVE A;  5JWR B;  5DBQ A;  3GL5 A;  1GSU A;  1QMV A;  1FAA A;  1HNA A;  2DKI A;  1SK2 A;  3NOF A;  2VL2 A;  5CRE A;  4KSM A;  1TW9 A;  1NHO A;  2CX3 A;  2C0G A;  3C7M A;  3ZZX A;  2YZH A;  4E8H A;  4MF6 A;  4K2X A;  5IIZ A;  5LCZ A;  4MLY A;  4BL7 B;  2EIO A;  1TK5 B;  1TXX A;  4X4J A;  2WFC A;  3M3M A;  1T00 A;  3KEB A;  5ABR A;  1WP0 A;  4EUY A;  1VRS D;  2X8C A;  3A5I A;  4EL1 A;  2REM A;  2K8V A;  2NDO A;  2LUS A;  1PRX A;  4MAB A;  1A2L A;  4G0K A;  2PUK C;  5DCG A;  4RI6 A;  5AIS A;  3HYP A;  3GTU B;  4PX1 A;  1B9Y C;  4G10 A;  3A5W A;  4KCE A;  5IMV A;  3G7J A;  3F3Q A;  2GS3 A;  4MH2 A;  4WBJ A;  2H76 A;  4HU7 A;  3MWH A;  1SU9 A;  2PU9 C;  2OE3 A;  2LNS A;  3NIV A;  5KN2 A;  1MD4 A;  2YJH A;  1FOV A;  1K0B A;  3HA9 A;  2WGR A;  2IMD A;  1FOH A;  2I81 A;  3GA4 A;  3P8W A;  2C8U A;  2HSH A;  3F4T A;  5LD0 A;  4EDZ A;  9GSS A;  1WWJ A;  2VCV A;  3RPN A;  3QAW A;  5B6N A;  1G6W A;  1TU8 A;  4O5R A;  3ZMK A;  2AUV A;  4GXZ A;  2DIZ A;  2L5L A;  2YV9 A;  3KMO A;  4IHU A;  4EKZ A;  4IGJ A;  2PPT A;  2E2G A;  3N5O A;  2CVD A;  3LW9 A;  3TJJ A;  1OAZ A;  2DJ3 A;  5KN1 A;  1KNG A;  3FR3 A;  5EPF A;  3BCI A;  1SYR A;  2VCT A;  1G0T A;  4HI7 A;  2DJJ A;  4ZL9 A;  3EWL A;  4PXO A;  3TKR A;  2C80 A;  3F6D A;  2VCQ A;  1M0U A;  2LS5 A;  1ERT A;  4BL7 A;  1SK0 A;  1XWG A;  1WOU A;  2CZ2 A;  2L57 A;  1LBK A;  1HNC A;  4MJB A;  2H73 A;  2B3S A;  1PN0 A;  3UAP A;  3S9F A;  1A24 A;  3C73 A;  2C4J A;  2X49 A;  1O73 A;  5G1L A;  2EIR A;  3WT1 A;  3QPM A;  1PA3 A;  5JWO B;  4AF2 A;  3IA1 A;  3L0H A;  2VO4 A;  4K9Z A;  2I9H A;  2LRC A;  3KP9 A;  4EE0 A;  4MJA A;  1R4W A;  2H72 A;  1SJ6 A;  3HHV A;  2GSQ A;  2R3X A;  4GF0 A;  2B5E A;  2RLI A;  6GSX A;  3BCK A;  4WXT A;  3ZFB A;  1EOG A;  5AIV A;  4MNN A;  1OC9 B;  1K0D A;  1VGL A;  1K0C A;  3H4K A;  4HDE A;  4PUF C;  2IFQ B;  4N30 A;  5IPH A;  5GST A;  2CAQ A;  3LEF A;  4IBP A;  1X9M B;  1GTI A;  1R26 A;  4ZBD A;  2WS2 A;  3DEX A;  1KBN A;  4XRD A;  3I43 A;  5HQP A;  3ERF A;  2CT6 A;  2VD1 A;  3LG6 A;  3CTF A;  1RQM A;  2OJL A;  4D73 B;  1V58 A;  16GS A;  2LRN A;  1T4Y A;  5CP1 A;  3WD6 A;  2WB9 A;  1O85 A;  3DYR A;  4DVC A;  4WEY A;  4E8E A;  3M0F A;  4JU5 A;  4OO5 A;  4CDO A;  1F2E A;  3LWA A;  2H6Z A;  3ME8 A;  1ACV A;  1GUK A;  1FG4 A;  4I2T A;  5D93 A;  4Q5R A;  4I8B A;  4HUA A;  2V32 A;  3ED3 A;  4IP6 A;  1B8X A;  4POL A;  4NPB A;  3KD0 A;  2CAI A;  5G31 A;  2VUP A;  1HQO A;  4J57 E;  4MZW A;  4DSS B;  2MMO A;  4Z2R A;  4V2N A;  4N0Z A;  2N5F A;  4NAX A;  4PNF A;  5IMA A;  3UVH A;  2JL4 A;  4QQ7 A;  2OAD A;  4O5Q A;  3H93 A;  1BYE A;  4WBR D;  3TKP A;  3VFI A;  2BJX A;  1OC9 A;  4ML1 A;  2VL9 A;  1SEN A;  4EVM A;  2Z9S A;  3EIN A;  2AYT A;  3QAV A;  5FWG A;  4YAV A;  5IQY A;  5G5F A;  4EIP A;  4XS1 A;  4O32 A;  1G7O A;  3KP8 A;  3CMI A;  3ME7 A;  4NMU A;  2ZNM A;  2LEG A;  5ECN B;  3MAK A;  4H86 A;  1EV4 A;  4AGS A;  1U6T A;  5IOX A;  4RQX A;  2VM1 A;  3HXS A;  5DCH A;  3QFB C;  2H01 A;  1Z6M A;  1F9M A;  2P0G A;  1TDI A;  5IOW A;  4TKY A;  1XWC A;  3GN3 A;  3FMW A;  5EY6 A;  3VWW A;  1X9S B;  3IC8 A;  3KGK A;  2GT5 A;  1GLQ A;  5ECS A;  4JBB A;  2H8L A;  5FT3 A;  3FY7 A;  3IPZ A;  5A4U A;  1PL2 A;  1UC7 A;  1YF1 A;  4OCE A;  4XRA A;  5ENU A;  4HJM A;  2P5Q A;  2R0P A;  2O87 A;  2VD0 A;  1H75 A;  2C0F A;  2DSA A;  1ERU A;  2X64 A;  3HVS A;  4MH3 A;  1I9D A;  5ECO B;  2JSZ A;  5IM9 A;  2H0I A;  2KHP A;  4DSS A;  3E9J B;  4JZQ A;  1BQ7 A;  2ON5 A;  1XVQ A;  3CSJ A;  1CQH A;  2IJY A;  5KOW A;  4ZBA A;  3QOU A;  2OA7 A;  4GTU A;  1K0M A;  3TRQ A;  10GS A;  4JR6 A;  1I5G A;  2LQO A;  1ZOF A;  4IEL A;  1R7H A;  4K6X A;  1YKA A;  2GLR A;  4A5P A;  2C0E A;  2JAC A;  3ISO A;  1MDI A;  3APQ A;  4WR5 A;  2QA2 A;  4OMV A;  4NHW A;  4K2D A;  3G7I A;  4ZXG A;  3BD2 A;  3OR5 A;  4ECJ A;  2QA1 A;  3IE3 A;  2H19 A;  5DQS A;  4ECI A;  2YWN A;  4GQC A;  2HNL A;  5F8B A;  2F9S A;  3KIJ A;  4F2I A;  2A2P A;  4TRX A;  1YJ6 A;  4EDY A;  1LU4 A;  4CY6 A;  1A2J A;  1TTZ A;  4TW5 A;  3IDV A;  5A4V A;  1S3C A;  4BVX A;  4BA7 A;  3D22 A;  2HZE A;  3TJF A;  3LXZ A;  2R5G A;  3D6I A;  3Q18 A;  2IMI A;  4YQV A;  1ZMA A;  3C8E A;  11GS A;  3A2W A;  2AAW A;  2LST A;  3VWU A;  4GRF A;  3QCP A;  2A4H A;  1B4P A;  4OD7 A;  2YJ7 A;  4KDU A;  4HJ2 A;  1X5C A;  2ES7 A;  4KSO A;  2G0F A;  5A5K A;  3M8N A;  3VI7 A;  5DJM A;  3GX8 A;  3HDC A;  2F8A A;  5JWQ B;  5ECI B;  3TKS A;  2L5O A;  4V2M A;  4L8E A;  3KXO A;  2C1Y A;  4GSS A;  5F06 A;  2LKU A;  2L4C A;  1PKW A;  5ECK B;  3QMX A;  1T8E B;  1T4Z A;  4K7I A;  4OFM A;  5CNW A;  3TRX A;  2H0H A;  3A3T A;  4I5Q A;  3ZVJ D;  2R0C A;  2B7J A;  4FYB A;  3GKX A;  4GQF A;  3F6F A;  1XWB A;  2K9F A;  2CVB A;  5ECQ B;  2ON7 A;  4K7N A;  3IV4 A;  4HU9 A;  5HR1 A;  3IC4 A;  4F0C A;  3GUR A;  1K0N A;  2V6O A;  2GZP A;  3E0U A;  2PVQ A;  3UAR A;  4PTS A;  2VLV A;  2X8H A;  3ZLP A;  1ZGN A;  1URM A;  5D9X A;  4QL9 A;  5HR2 A;  2FWE A;  4LL1 B;  3D4T A;  2GGT A;  4OCF A;  2B7K A;  3RAZ A;  2DIY A;  2J23 A;  3FK8 A;  3JCM L;  6GSW A;  2V41 A;  4KB3 A;  2H6Y A;  1TRW A;  2PVO C;  1O7U A;  1T3B A;  2HZF A;  2R0G A;  3DKS A;  2HRF A;  1JLV A;  1TI1 A;  4XTS A;  2VCW A;  4MZC A;  1Y6E A;  5CAX A;  3L78 A;  2ALB A;  5CRD A;  4L5L A;  4EIQ A;  5D73 A;  1ERW A;  3DML A;  1HYU A;  1M9A A;  4LLR A;  4BWS A;  2NBS A;  1QGV A;  3UL3 A;  4K5R A;  3IAS 2;  4V2L A;  2IMK A;  1SL1 B;  1TOF A;  3W8S A;  4LL4 B;  3PH9 A;  4JED A;  3TKQ A;  5DAL A;  5B7C A;  1U3A A;  1GSS A;  4NV2 A;  3J7Y b;  3G9B A;  3KTB A;  1EP8 A;  4ACS A;  2L59 A;  2WDU A;  3KJY A;  3APO A;  4KH7 A;  4K0N A;  1TKD B;  1ON4 A;  4MPF A;  1XOB A;  1FW1 A;  2V1M A;  2QSI A;  2RM5 A;  1MTC A;  3TJG A;  2LV3 A;  2H1A A;  2M72 A;  2RUE A;  5H5S A;  1XW9 A;  4J56 E;  8GSS A;  2HRN A;  3WGD A;  4TR1 A;  2HYX A;  2PBJ A;  2JZR A;  3FHK A;  4KX4 A;  5IPG A;  4L0U A;  1CQG A;  3WT2 A;  2NTO A;  1Q98 A;  1YY7 A;  3IAM 2;  2LRT A;  4Q5F A;  1ZZY A;  4RI7 A;  3QR6 A;  5ELA A;  2I4A A;  4ML6 A;  1AQV A;  1S3D A;  2H6X A;  1Z6N A;  1GTA A;  1Z3E A;  1GTU A;  5H5R A;  1GNW A;  2LJR A;  1SL2 B;  1A0R P;  2ZCT A;  2XPD A;  4AJ6 A;  4X0X A;  4AJ7 A;  1GTB A;  2MMZ A;  4KND A;  2XC2 A;  3H79 A;  2V2G A;  2R37 A;  2DJ2 A;  4K5S A;  2A2R A;  4KF9 A;  2J9H A;  2F3M A;  4MA9 A;  2H1G A;  3GFK A;  4GLT A;  1YEP A;  2YN1 A;  3HJO A;  5CO3 A;  2QGV A;  2LQQ A;  5EL8 A;  1VF2 A;  2IPA A;  4PQI A;  3EPT A;  4YKF A;  2GQM A;  3BOA A;  4RQR A;  5C04 A;  1ZYP A;  1SKR B;  3UBK A;  2VL2 C;  3WGX A;  3Q74 A;  3VWX A;  2B6M A;  3K8N A;  3RBT A;  2RII A;  1UN2 A;  1V9W A;  2OKA A;  4KE3 A;  3LYK A;  2H1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...