1EGRA

Sequence-specific 1h n.m.r. assignments and determination of the three-dimensional structure of reduced escherichia coli glutaredoxin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
MQTVIFGRSGCPYCVRAKDLAEKLSNERDDFQYQYVDIRAEGITKEDLQQKAGKPVETVPQIFVDQQHIGGYTDFAAWVKENLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords GLUTAREDOXIN
publication title Sequence-specific 1H n.m.r. assignments and determination of the three-dimensional structure of reduced Escherichia coli glutaredoxin.
pubmed doi rcsb
source organism Escherichia coli
total genus 25
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1991-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1egrA00
2BJXA 3ERFA 2V41A 4V1Ap 2HSHA 3C1RA 4JR4A 1SK2A 3GX8A 4ZIJA 4XHMA 4YAVA 4L5LA 2C4JA 1DE1A 2C0DA 1PX7A 4LL4B 5H5SA 3EMXA 1B9YC 2HT9A 1V98A 2A2SA 4I8BA 4D73B 1HNAA 2C0GA 1G0TA 2GZZA 5D9XA 5DAKA 1JZWA 2H6ZA 1SD9A 3ZFBA 1SENA 2L5LA 1PRXA 5HR2A 3L4NA 3S9FA 2GZPA 5E59A 3HXSA 3HZ4A 2F9SA 2OKAA 1URMA 1SYRA 3GIXA 4EC0A 1KTEA 3IXRA 1M2BA 5KEJA 1LU4A 4TR3A 3SBCA 3GX0A 4EKZA 3D0ZA 3GH9A 2VL2C 2DC5A 1RQMA 1YF0A 3GL3A 2KOKA 2LRNA 2FCHA 5A4UA 4EL1A 3LSZA 1GUMA 2PWJA 3EE2A 2H66A 2L6DA 2J23A 3BOAA 1PN9A 1R5AA 1GNWA 1SJIA 10GSA 1F2EA 5GZZB 3HZ8A 4HZ2A 4GF0A 3D5JA 4F2IA 2B5EA 22GSA 3HVXA 1W89A 2HZFA 3KZQA 1GSFA 1X5DA 2FLSA 2C3TA 4DSSA 4MJAA 4L8EA 2YZHA 2EIQA 1JHBA 2B5YA 2V6KA 2P5QA 4N11A 1SD8A 3KTBA 1XVWA 2OACA 4ZB8A 1U88A 4O92A 3IAM2 5CRWA 1GTAA 2CA8A 4MMMA 2QKEA 1E2YA 4BVYA 5KN2A 4EVMA 5IM9A 3GL5A 1EWXA 1ERTA 4MPGA 5ECIB 3FK8A 3VWWA 2L6CA 3A5WA 4PUFC 1Z9HA 2F8AA 5AGYA 3VURA 2IFQA 5HFGA 5F05A 1AQXA 3GUSA 1PSQA 5HFKA 2RLIA 1TU8A 2VL2A 3CSIA 3P8WA 4HQZA 2F51A 4KAEA 2QGVA 3JCML 1ZMAA 2C1YA 4WR5A 4ZL9A 1USBA 1GTBA 2HI7A 5D96A 5J3RA 3UVHA 4WXTA 3N9JA 3TOTA 2H1AA 1DSBA 4OCEA 4GSTA 1IYIA 1M2AA 2E2GA 3CYNA 1TRWA 1HQOA 3VK9A 2N5FA 1SKSB 2DMMA 4EO3A 4MK3A 3HD5A 4MPFA 1GULA 3F6FA 4NXIA 5FWGA 3QDNA 1XOAA 5EVOA 4LL1B 4MJEA 3HKRA 3UMAA 1ILOA 4ECBA 2CT6A 2HLSA 2NPBA 1TTZA 3QMXA 2PUKC 3IC4A 2P5RA 4K7IA 1O7UA 2EIOA 3ZIVA 3GMFA 2H73A 3WT2A 5AIVA 1ERUA 3NOFA 2N5AA 2Z9SA 3A2VA 3BCKA 4HS1A 2MBTA 4IELA 5IOXA 2AJQB 3LQ7A 2TIRA 3LGCA 1MTCA 3EU3A 4ZBDA 3D4TA 2JZRA 3DVWA 1S3DA 1ZYEA 1AIUA 4IS0A 3KEBA 1TRSA 4KSMA 3CTFA 3CMIA 1ERWA 3E9JB 1PKZA 4FYCA 2MMAA 1OE7A 3CBUA 1LBKA 2VCZA 9GSSA 1E6BA 2PU9C 4MF5A 5IPHA 4O5RA 1WMJA 2K9FA 4TN8A 2CAIA 4NMUA 5HFIA 3IR4A 4EXJA 1DE2A 2I1UA 3F9UA 1RW1A 4D73A 1MEKA 3O3TA 1R7HA 4K1FA 4HU9A 4K8MA 5GSTA 6GSUA 2KLXA 5CRGA 5GAND 4ZB9A 3L78A 1G6YA 2ZNMA 5AN1A 3LJRA 4Z7XA 3D6IA 6GSVA 2VLUA 1TP9A 2REMA 3G9BA 3KM6A 3TUEA 2PMTA 1T7PB 5J4UA 2VLTA 2C80A 1U3IA 2C0EA 3TB2A 4MP4A 4JBBA 4Q5FA 4DEJA 2I4AA 4IKHA 4CDOA 3QOUA 2CZ3A 3F4RA 3UBKA 2B1LA 2DJ3A 2LS5A 1OC3A 2PVOC 2HFDA 3GNJA 5DVBA 4G2EA 1U87A 3H79A 3Q74A 5L71A 1GUKA 1VRSD 4BVXA 2LJRA 5DALB 2LJAA 3C73A 4ZILA 2MMNA 4IVFA 1U6TA 3AY8A 4L5OA 1QUWA 2E2MA 2GVPA 3A3TA 2P31A 2XBIA 2AB6A 3D4MA 1ST9A 3LFLA 3Q18A 2WGRA 2XPDA 7GSSA 1EOGA 4KH7A 1GL8A 4TXVA 5INYA 1GLPA 1M7TA 4N0VA 1F9MA 3L9UA 5CRHA 5G31A 1R4WA 2ON7A 3EINA 1VF3A 1FVJA 1WOUA 3MNGA 2DLXA 3UJ1A 4IJ3A 1TKDB 1VF1A 2H76A 4PQ1A 2X64A 4PNFA 1B48A 2CQ9A 1W4VA 2H0HA 1VF4A 3ZMLA 1K0NA 1NHYA 3LXZA 3GKKA 2IJYA 2JZSA 3A2WA 2RM6A 1O6JA 2WDUA 3EVIA 4F0CA 1Z3EA 1NW2A 2AAWA 2WZ9A 3UOMA 3BBYA 1HNBA 4TR4A 4KCAA 4ZBBA 2ALBA 3TKPA 4EDZA 2DIZA 4ACSA 4K0NA 1MDKA 3WGXA 5IMVA 1GWCA 4LMVA 2R5GA 5ELGA 5DBQA 4O7HA 5G2ZA 4N0ZA 1XWBA 1XVQA 2NTOA 4IBPA 4RQRA 2C3NA 4ISDA 1NM3A 4GQCA 4FYBA 3DKSA 3ZIJA 4IJIA 1K0MA 4NPBA 3TJKA 3HYPA 3UBLA 1ABAA 3E3EA 1A23A 5IIZA 1PKWA 2B6MA 4I2UA 1K0AA 4PNGA 3QAWA 1BG5A 4HJ2A 2GT6A 4TXOA 1XW9A 1K0CA 3GH6A 2N5BA 2OJLA 5KN3A 1GSSA 1MD4A 1O81A 4KNDA 2HSYA 3KD0A 4G19A 3KIJA 5LD0A 1BYEA 3SWLA 3KH9A 2KHPA 4KGIA 2XC2A 3WYWA 3I69A 4L0WA 3TOUA 4HUAA 5CNWA 1F37A 2M72A 3Q6OA 1DUGA 2OE3A 2FA4A 4BPYA 2HXKA 3L0HA 1JLVA 4GSSA 1PL1A 2LJKA 4XS4B 4OWYA 3IRAA 5GSSA 2B1KA 3VLNA 2VL9A 4FH8A 1WIKA 1EZKA 3TJFA 4QL9A 3LORA 4BWSA 5LCZA 1OVNA 4MZCA 4I6XA 4IN0A 4PXOA 4MDCA 3P7XA 1GP1A 2GS3A 1EV9A 3PH9A 2WCIA 2VD1A 2YPMA 3DMLA 3TKSA 1WPIA 3FYGA 5CRDA 3MDKA 1AQWA 4KDUA 4F03A 3A2XA 1O8WA 4WF4A 2YOIA 2LUSA 4QQ7A 1UN2A 2F8FA 4MH2A 2E0QA 4MZBA 3DD3A 5ECQB 1BJXA 3IAS2 3J7Yk 3FW2A 3FEUA 4XCSA 2IMIA 2GQKA 2DJ0A 1F3BA 4MZWA 4J2FA 1AXDA 3H1NA 4J57E 2H70A 1OC9B 1PX6A 1S3AA 4QL7A 2PPTA 5G5FA 1YKAA 4NHZA 2R37A 5IO0A 2YZUA 3UEMA 3WGDA 1XCCA 1GTIA 5CREA 1SKRB 2OE1A 2VM1A 1ZL9A 3M0FA 2GSTA 1ZOFA 5H5QA 2FWHA 2CAQA 3F63A 1BQ7A 1NSWA 4YQVA 2JZTA 1ON4A 4KW6A 2A4VA 3QAVA 2FNOA 2PERA 5CO3A 4XTSA 2OBIA 1XWGA 4GSNA 5COHA 1TW9A 3HVSA 3VI5A 3GYKA 4AJ6A 3G7YA 5A4WA 2RUFA 5D73A 4BWQA 5D9WA 3LWAA 3NZNA 3VPQA 1Z7PA 3CRTA 2YWIA 1QQ2A 4ML6A 4PURA 3KCMA 2I3YA 4WETA 4MJBA 2L4QA 5DQYA 3J7Yb 4TR1B 1EGRA 4HDEA 2GQMA 1J08A 1V2AA 3UARA 1U3AA 1T4YA 1H4OA 2GTUA 1M99A 2IMDA 2NVLA 2O7KA 5IO2A 1FW1A 2WRTA 3EYTA 2YV9A 5IMAA 1FB0A 4GRFA 2H0GA 4TRXA 5ECSA 4IP6A 2YWNA 4OCFA 1FHEA 4HJMA 2D2ZA 4N30A 1I9DA 3RHBA 3IDVA 2F3MA 2H74A 3ZITA 1FVKA 2CVDA 4G10A 3DVXA 4RI7A 2P0GA 1XIYA 2RUEA 2FWEA 4X1UA 3GSTA 4HOJA 1QGVA 4HZ4A 1A0RP 2M46A 1A0FA 1EP7A 3L9VA 2DJJA 3DRNA 2IPAA 4XRDA 4PQIA 2PN8A 1KNGA 1UVZA 2L5OA 3UL3A 1YDKA 1PL2A 3H8QA 2HZEB 1TRUA 3ZZXA 1JLWA 4OD7A 4K7OA 5F0GA 1GRXA 3VWXA 5ECMB 2OE0A 5ID2A 4IQ1A 5DQSA 4E8EA 5JCGA 2M80A 2VIMA 4G9HA 3ZREA 6GSTA 1OE8A 5ECOB 4Q5RA 5HR1A 2GT5A 2MMZA 5J5NA 3LG6A 1AUCA 4WKWA 3TGZA 1V58A 2I9HA 1OC8A 3TKQA 1SJZA 3M9JA 2L59A 5B7CA 2XHFA 3F3QA 3D22A 5HQPA 2K6VA 2V1MA 2PVQA 4OO4A 4XS6A 4AF2A 3GN3A 5G30A 4POLA 2X8GA 4DSQA 5HR3A 4IQAA 4XS4A 5JWRB 16GSA 3IE3A 1GH2A 13GSA 3O6TA 2YJHA 3ZMKA 4XS1A 3KP8A 3CSHA 4KDYA 2IMEA 3C7MA 2B5XA 1V40A 1M2DA 2LV3A 3W8SA 3H93A 3LXTA 3IOSA 2FWGA 4ZXGA 2ZCTA 1LJRA 3IPZA 4AGSA 4K6XA 3BD2A 5IMDA 4H86A 2RM5A 1T00A 2X8HA 1QFNA 2XBQA 4ML1A 2G2QA 2KP2A 1SL2B 3FRCA 4JE1A 12GSA 1GSYA 2H71A 2AHEA 1NHOA 1R5PA 1X5CA 5D9VA 14GSA 2L4CA 1DBYA 4OMVA 4V1Ag 2VUPA 2HNLA 2FUG2 4OO5A 1OC9A 3TKSE 1K0OA 3G7JA 1SK0A 2C8UA 1ZCPA 2DJKA 3ZL5A 2K8SA 3CRUA 3GKNA 4AJ7A 4CW9A 1Q98A 4TVEA 1T8EB 2A2RA 3E0UA 4TW5A 1ZYQB 4JZQA 2IL3A 3DYRA 1ZGNA 3EWLA 2VCQA 2FD3A 4NV5A 5D9TA 1X9WB 3QCPA 4IP1A 3GTUB 3WGEA 2QC7A 3QD9A 3APOA 1B8XA 4CHSA 1Z6MA 3HDCA 3I43A 1TI1A 2LQOA 2MZCA 5DCHA 20GSA 3ERWA 5ELAA 4XIHA 4MF7A 1XZOA 3ME7A 5KN1A 3F3RA 1MD3A 2C0FA 5C00A 1J9BA 2AV4A 4DVCA 2H1BA 2VD0A 1I5GA 3FR6A 2R2JA 4JEDA 1A2JA 4I2TA 1YKCA 2H0IA 3GA4A 1G7OA 4TR1A 4PGTA 4I97A 3QFAC 1X9MB 3GKMA 3VWVA 4HI7A 2VL3A 2WFCA 5D8IA 3QR6A 1J0FA 2AYTA 3M1GA 4GWRA 1YEPA 1O85A 2YN1A 5FT3A 3WD6A 2YCDA 2VCVA 2JL4A 5CYYA 3VWUA 2HYXA 2IIYA 4ZL7A 4YQMA 1TOFA 2NBSA 2MYGA 3FZ9A 1THOA 4DSRA 4NV2A 2DMLA 2KP1A 1OAZA 4WEYA 1F3AA 1K0DA 4Q5NA 4F82A 4K2DA 5F8BA 3DIEA 2LTKA 2HRFA 4KX4A 1XBSA 4WF5A 3APQA 2G0FA 2GSQA 1XW6A 3ZTLA 1GNEA 3TDGA 2GGTA 3MSZA 4IGJA 4X0XA 3P90A 5ECNB 2HZEA 3M9KA 4IHUA 1TU7A 4X43A 4Q5QA 5ABRA 5IOWA 1AAZA 2YWOA 2GLRA 3BCIA 3OR5A 3ZFLA 1N8JA 2LNSA 3DEXA 1CQGA 4YQUA 6GSSA 3ZLPA 1PMTA 1X5EA 2O89A 1PA3A 5EPFA 2H1DA 2CX4A 4JU5A 1SK1A 1X9SB 2R3XA 3GFKA 3KXOA 3O76A 4NHWA 5H5RA 2VOCA 1EGOA 5CP1A 1TDIA 5B6NA 2L57A 5ECLB 4ZB6A 8GSSA 1ACVA 2X99A 1THXA 1SKWB 1QK8A 1V9WA 4AJ8A 3US3A 4BA7A 4MH3A 2CV4A 1BEDA 2O85A 1WWJA 1TK0B 2LEGA 3GV1A 1SL0B 4YH2A 1TK5B 3RPNA 3ISOA 2FHEA 2C3QA 4ECCA 1EOHA 5AIXA 2VCWA 3GHAA 4KB3A 3TJGA 2VLVA 3MWHA 1QMVA 1K3YA 2X8CA 2GDRA 4ECJA 1M9BA 2E7PA 5G1LA 1VGLA 1R26A 2JU5A 1UA5A 2LSTA 4P3YB 5F06A 5ECHB 5IMCA 3RHCA 6GSYA 3RAZA 2JSZA 1XW5A 1JFUA 4WR4A 1AW9A 2WULA 2GSSA 1XXUA 2K18A 5A4VA 1EEMA 1O8XA 5EY6A 3W6GA 5IQYA 2H19A 5EL8A 1YEXA 4ID0A 3CTGA 3GSSA 1HYUA 1C72A 3PGTA 2HE3A 1SL1B 3IA1A 1YQ1A 2WJUA 4PQHA 3RDWA 1GSEA 1SYXA 3D21A 1V57A 3TJBA 1YZXA 3IHQA 3C8EA 3EU4A 1IYHA 17GSA 3M3MA 5KN0A 4E8HA 1VF2A 2IMFA 1JZDA 1ZZYA 5DALA 4I5QA 6GSXA 5HR0A 1GSQA 3ZVJA 1CQHA 1RK4A 2YJ7A 1Y6EA 4HU7A 2VAFA 1YY7A 2WB9A 1B9XC 1FG4A 2IN3A 3GTUA 2VCXA 5ECPB 3FY7A 2VM2A 3F6DA 2ON5A 5E4WA 2I81A 3V1WA 4MLYA 1XWAA 2WS2A 4MJCA 1Q4JA 3RPPA 1Y25A 2B3SA 3HCZA 2J9HA 1BAYA 5CAXA 4V2NA 2JACA 1Z6NA 2FA8A 4LLRA 3U5RE 3FZ5A 2R6KA 2TRCP 2DSAA 1TI3A 1A8YA 2LQQA 2CZ2A 2GQLA 1JZRA 4HEA2 5JWQB 2V2GA 2YV7A 1M0UA 4TOPA 2V6OA 5DCGA 3CSJA 3LYKA 2VCTA 1S3CA 2OBKA 2H1GA 4GCIA 3UVTA 5JWOB 2H75A 2O8VB 2FY6A 3EMPA 3F8UA 3HJPA 3NIVA 4ILFA 3ZRDA 4OFMA 3ZVJD 5DJLA 1TXXA 5IMFA 3TJJA 2PBJA 2H72A 2MMOA 1B4QA 3QAGA 3IK7A 3UAPA 3Q19A 4FYUA 2O87A 4TXOB 4GXZA 4V2LA 1KBNA 2GZYA 3PR8A 1T1VA 3KMNA 3GKXA 1WP0A 3I9V2 1QXHA 3QPMA 4NAXA 1FOVA 4NWYA 2V32A 1XFLA 2CX3A 4F9ZA 2NDOA 4K9ZA 4POKA 1H75A 3KP9A 3KH7A 5LNKe 3DXBA 2H6YA 4RUVA 1TJDA 5IMZA 3WT1A 2IWTA 5DAKB 3TRPA 4HQSA 5GAPD 4KUNA 1SJ6A 1T4ZA 2BMXA 3GRXA 3L9SA 3DWVA 4OFTA 4J56E 3LYPA 5C04A 1GSUA 1TRVA 11GSA 3HJOA 2OADA 1BX9A 5AISA 1Z5YE 1A24A 4ULXA 1YJ6A 2K8VA 3HA9A 2CVBA 3M8NA 4EE0A 3FR3A 1OKTA 1K3OA 5FHIA 5B6MA 1GSDA 2R4VA 3F4TA 4EF0A 3KJYA 5ECRB 4TR0A 2IMKA 1PD21 2DJ2A 4F0BA 4XRAA 1XPVA 1A2MA 4KCEA 5G5EA 3U6VA 3HVVA 3HJMA 4JR6A 5J9BA 3PINA 3TCOA 3HY2A 4KE3A 4PUAA 1OKDA 3GURA 5B8BA 1SU9A 2YP6A 3FHKA 3IBHA 1PGTA 2EIRA 4TKYA 1YF1A 1KEBA 1MDJA 2LKUA 5DJMA 4K7NA 4ZL8A 19GSA 1JZOA 3I6AA 1Z7RA 4DSSB 3EURA 2LRTA 3KTLA 4FIWA 2DJ1A 1WJKA 2HRNA 3G7IA 3KGKA 18GSA 1EEJA 4MF6A 3VI7A 3VPTA 1K0BA 3BJ5A 1G6WA 1WE0A 3H4KA 4MABA 1FAAA 3C71A 6GSWA 3ME8A 4MA9A 1UC7A 4GLTA 2CVKA 2H01A 3N5OA 4LMWA 1WRYA 5D93A 2B7KA 1N2AA 1FO5A 1ERVA 5G1KA 1EV4A 1GUHA 3MAKA 4GQFA 3C1SA 4IW9A 1G7EA 4RI6A 3CXGA 2TRXA 3HHVA 2RIIA 1B4PA 2H30A 3DGQA 3QFBC 2QSIA 1F6MC 2DBCA 2B7JA 1A2LA 2IFQB 2KUCA 1O73A 2JSYA 2VO4A 2LRCA 4EDYA 4ZBAA 2AUVA 1X0RA 1OYJA 3KMOA 3FKFA 3P2AA 4EUYA 5IPGA 1EP8A 4KA0A 3APSA 2YNXA 3IK9A 1TK8B 5JCWA 4V2MA 2PGTA 3TRXA 1XWCA 1MDIA 3ERGA 3F4SA 4RQXA 4KDXA 4PX1A 2EC4A 1PQNA 4YAPA 5DDLA 3VFIA 3W8JA 4OFNA 1FB6A 4WBJA 2GSRA 2XPEA 2ZUPA 3FR9A 4LA1A 3IV4A 2LNTA 4KSOA 1HNCA 4BL7A 2MBSA 5ENUA 1GLQA 2OA7A 3R2QA 3TKSC 5J9CA 1AQVA 2DIYA 5A5KA 1GTUA 5B8AA 4L0UA 3EC3A 3LEFA 1A8LA 4FO5A 3RBTA 3ZYWA 3TKRA 3UIWA 5J41A 5ECKB 4WBRD 5F07A 1M9AA 5ID2B 2YANA 4GTUA 4POBA 4JRRA 5JCUA 2BTOT 2JADA 3K8NA 2YWMA 2FGXA 4POMA 3F0IA 4ECIA 4O32A 3TRQA 4K0GA 4N10A 1XOBA 1K3LA 4MCUA 3FZ4A 3ED3A 1HD2A 1XWKA 2H6XA 1T3BA 1AC1A 3FZAA 1ML6A 2ES7A 2FWFA 2H8LA
chains in the Genus database with same CATH superfamily
2BJXA 3ERFA 2V41A 4V1Ap 2HSHA 3C1RA 4JR4A 1SK2A 3GX8A 4ZIJA 4XHMA 4YAVA 4L5LA 2C4JA 1DE1A 2C0DA 1PX7A 4LL4B 5H5SA 3EMXA 1B9YC 2HT9A 1V98A 2A2SA 4I8BA 4D73B 1HNAA 2C0GA 1G0TA 2GZZA 5D9XA 5DAKA 1JZWA 2H6ZA 1SD9A 3ZFBA 1SENA 2L5LA 1PRXA 5HR2A 3L4NA 3S9FA 2GZPA 5E59A 3HXSA 3HZ4A 2F9SA 2OKAA 1M3JA 1URMA 1SYRA 3GIXA 4EC0A 1KTEA 3IXRA 1M2BA 5KEJA 1LU4A 4TR3A 3SBCA 3GX0A 2R0PA 4EKZA 3D0ZA 3GH9A 2VL2C 2DC5A 1RQMA 1YF0A 3GL3A 2KOKA 2LRNA 2FCHA 2R0GA 5A4UA 4EL1A 3LSZA 1GUMA 2PWJA 3EE2A 2H66A 3CQFA 2L6DA 4A5PA 2J23A 3BOAA 1PN9A 1R5AA 1GNWA 1SJIA 10GSA 1F2EA 5GZZB 3HZ8A 4HZ2A 4GF0A 3D5JA 4X4JA 4F2IA 2B5EA 22GSA 3HVXA 1W89A 2HZFA 3KZQA 1GSFA 1X5DA 4Z2UA 2FLSA 2C3TA 4DSSA 4MJAA 4L8EA 2YZHA 2EIQA 1JHBA 2B5YA 2V6KA 2P5QA 4N11A 1SD8A 3KTBA 1XVWA 2OACA 4ZB8A 1U88A 4O92A 3IAM2 5CRWA 1GTAA 2CA8A 4MMMA 2QKEA 1E2YA 4BVYA 5KN2A 4EVMA 5IM9A 3GL5A 1EWXA 1ERTA 4MPGA 5ECIB 3FK8A 3VWWA 2L6CA 3A5WA 4PUFC 1Z9HA 2F8AA 5AGYA 3VURA 2IFQA 5HFGA 5F05A 1AQXA 3GUSA 1PSQA 5HFKA 2RLIA 1TU8A 2VL2A 3CSIA 3P8WA 4HQZA 2F51A 4KAEA 2QGVA 3JCML 1ZMAA 2C1YA 4WR5A 4ZL9A 1USBA 1GTBA 2HI7A 5D96A 2R0CA 5J3RA 4G0LA 4WXTA 3N9JA 3TOTA 3UVHA 2H1AA 1DSBA 4OCEA 4GSTA 1IYIA 1M2AA 2E2GA 3CYNA 1TRWA 1HQOA 3VK9A 2N5FA 1SKSB 2DMMA 4EO3A 4MK3A 3HD5A 4MPFA 1GULA 3F6FA 4NXIA 5FWGA 3QDNA 1XOAA 5EVOA 4LL1B 4MJEA 3HKRA 3UMAA 1ILOA 4ECBA 2CT6A 2HLSA 2NPBA 1TTZA 4PTSA 4YKFA 3QMXA 2PUKC 3IC4A 2P5RA 4K7IA 1O7UA 2EIOA 3ZIVA 3GMFA 2H73A 3WT2A 2HSMA 5AIVA 1ERUA 3NOFA 2N5AA 2Z9SA 3A2VA 3BCKA 4HS1A 2MBTA 4IELA 5IOXA 2AJQB 3LQ7A 2TIRA 3LGCA 1MTCA 3EU3A 4ZBDA 3D4TA 2JZRA 3DVWA 1S3DA 1ZYEA 1AIUA 4IS0A 3KEBA 1TRSA 4KSMA 3CTFA 3CMIA 1ERWA 3E9JB 1PKZA 4FYCA 2MMAA 1OE7A 3CBUA 1LBKA 2VCZA 9GSSA 1E6BA 2PU9C 4MF5A 5IPHA 4O5RA 3IHGA 2HRAA 1WMJA 2K9FA 4TN8A 2CAIA 4NMUA 5HFIA 3IR4A 4EXJA 1DE2A 2I1UA 3F9UA 1RW1A 4D73A 1MEKA 3O3TA 1R7HA 4K1FA 4HU9A 4K8MA 5GSTA 6GSUA 2KLXA 5CRGA 5GAND 4ZB9A 3L78A 1G6YA 2ZNMA 5AN1A 4HSCX 3LJRA 4Z7XA 3D6IA 6GSVA 2VLUA 1TP9A 2REMA 3G9BA 3KM6A 3TUEA 2PMTA 1T7PB 5J4UA 2VLTA 2C80A 1U3IA 2C0EA 3TB2A 4MP4A 4JBBA 4Q5FA 4DEJA 2I4AA 4IKHA 4CDOA 3QOUA 2CZ3A 3F4RA 3UBKA 2B1LA 2DJ3A 2LS5A 1OC3A 2PVOC 2HFDA 3GNJA 5DVBA 4G2EA 1U87A 3H79A 3Q74A 3R3EA 5L71A 1GUKA 1VRSD 4BVXA 2LJRA 5DALB 2LJAA 3C73A 4ZILA 2MMNA 4IVFA 1U6TA 3AY8A 4L5OA 1QUWA 2E2MA 2GVPA 3A3TA 2P31A 3HVNA 2XBIA 2AB6A 3D4MA 1ST9A 3LFLA 3Q18A 2WGRA 2XPDA 7GSSA 1EOGA 4KH7A 1GL8A 4TXVA 5INYA 1GLPA 1M7TA 4N0VA 1F9MA 3L9UA 5CRHA 5G31A 1R4WA 2ON7A 3EINA 1VF3A 1FVJA 1WOUA 3MNGA 2DLXA 3UJ1A 4IJ3A 1TKDB 1VF1A 2H76A 4PQ1A 2X64A 4PNFA 1B48A 2CQ9A 3FMWA 1W4VA 2H0HA 1VF4A 3ZMLA 1K0NA 1NHYA 3LXZA 3GKKA 2IJYA 2JZSA 3A2WA 2RM6A 1O6JA 2WDUA 3EVIA 4F0CA 1Z3EA 1NW2A 2AAWA 2WZ9A 3UOMA 3BBYA 1HNBA 4TR4A 4KCAA 4ZBBA 2ALBA 3TKPA 4EDZA 2DIZA 1ZYNA 4ACSA 4K0NA 1MDKA 3WGXA 5IMVA 1GWCA 4LMVA 2R5GA 5ELGA 5DBQA 4O7HA 5G2ZA 4N0ZA 1XWBA 1XVQA 2NTOA 4IBPA 4RQRA 2C3NA 4ISDA 1NM3A 4GQCA 4FYBA 3DKSA 3ZIJA 4IJIA 1K0MA 4NPBA 3TJKA 3HYPA 3UBLA 1ABAA 3E3EA 1A23A 5IIZA 1PKWA 2B6MA 4I2UA 1K0AA 4PNGA 3QAWA 1BG5A 4HJ2A 2GT6A 4TXOA 1XW9A 1K0CA 3GH6A 2N5BA 2OJLA 5KN3A 1GSSA 1MD4A 1O81A 4KNDA 2HSYA 3KD0A 4G19A 3KIJA 5LD0A 1BYEA 3SWLA 3KH9A 2KHPA 4KGIA 2XC2A 3WYWA 3I69A 4L0WA 3TOUA 4HUAA 5CNWA 1F37A 2M72A 3Q6OA 1DUGA 2OE3A 2FA4A 4BPYA 2HXKA 3L0HA 1JLVA 4GSSA 1PL1A 4CY8A 2LJKA 4XS4B 2X49A 4OWYA 3IRAA 5GSSA 2B1KA 3VLNA 2VL9A 4FH8A 1WIKA 1EZKA 3TJFA 4QL9A 3LORA 4BWSA 5LCZA 1OVNA 4MZCA 4I6XA 4IN0A 4PXOA 4MDCA 3P7XA 1GP1A 2GS3A 4EIQA 1EV9A 3PH9A 2WCIA 2VD1A 2YPMA 3DMLA 3TKSA 1WPIA 3FYGA 5CRDA 3MDKA 1AQWA 4KDUA 4F03A 3A2XA 1O8WA 4WF4A 2YOIA 2LUSA 4QQ7A 1UN2A 2F8FA 4MH2A 2E0QA 4MZBA 3DD3A 5ECQB 1BJXA 3IAS2 3J7Yk 3FW2A 3FEUA 4XCSA 2IMIA 2GQKA 2DJ0A 1F3BA 4MZWA 4J2FA 1AXDA 3H1NA 4J57E 2H70A 1OC9B 1PX6A 1S3AA 4QL7A 2PPTA 5G5FA 1YKAA 4NHZA 2R37A 5IO0A 2QA1A 2YZUA 3UEMA 3WGDA 1XCCA 1GTIA 5CREA 1SKRB 2OE1A 2VM1A 1ZL9A 4O5QA 3M0FA 2GSTA 1ZOFA 5H5QA 2FWHA 2CAQA 3F63A 1BQ7A 1NSWA 4YQVA 2JZTA 1ON4A 2UZ8A 4KW6A 2A4VA 3QAVA 2FNOA 2PERA 1M3IA 5CO3A 4XTSA 2OBIA 1XWGA 4GSNA 5COHA 1TW9A 3HVSA 3VI5A 3GYKA 4AJ6A 3G7YA 5A4WA 2RUFA 5D73A 4BWQA 5D9WA 3LWAA 3NZNA 3VPQA 1Z7PA 3CRTA 2YWIA 1QQ2A 4ML6A 4PURA 3KCMA 2I3YA 4WETA 4K5RA 4MJBA 2L4QA 5DQYA 3J7Yb 4TR1B 1EGRA 1PN0A 4HDEA 2GQMA 1J08A 2HRKA 1V2AA 3UARA 4BIKA 1U3AA 1T4YA 1H4OA 2GTUA 1M99A 2IMDA 2NVLA 2O7KA 5IO2A 4K5SA 1FW1A 2WRTA 3EYTA 2YV9A 5IMAA 1FB0A 4GRFA 2H0GA 4TRXA 5ECSA 4IP6A 2YWNA 4OCFA 1FHEA 4HJMA 2D2ZA 4N30A 1I9DA 3RHBA 3IDVA 2F3MA 2H74A 3ZITA 1FVKA 2CVDA 4G10A 3DVXA 4RI7A 2P0GA 3IC8A 1XIYA 2RUEA 2FWEA 4X1UA 3GSTA 4HOJA 1QGVA 4HZ4A 1A0RP 2M46A 1A0FA 1EP7A 3L9VA 2DJJA 3DRNA 2IPAA 4XRDA 4PQIA 2PN8A 1KNGA 1UVZA 2L5OA 3UL3A 1YDKA 1PL2A 3H8QA 2HZEB 1TRUA 3ZZXA 1JLWA 4OD7A 4K7OA 5F0GA 1GRXA 3VWXA 5ECMB 2OE0A 5ID2A 4IQ1A 1XG8A 5DQSA 4E8EA 5JCGA 2M80A 2VIMA 4G9HA 3ZREA 6GSTA 1OE8A 5ECOB 1PFOA 4Q5RA 5HR1A 2GT5A 2MMZA 5J5NA 3LG6A 1AUCA 4WKWA 3TGZA 1V58A 2I9HA 1OC8A 4Z2RA 3TKQA 1SJZA 3M9JA 2L59A 5B7CA 2XHFA 3F3QA 3D22A 3EPTA 2K6VA 5HQPA 2V1MA 2PVQA 4OO4A 4XS6A 4AF2A 4FQUA 3GN3A 5G30A 4POLA 2X8GA 4DSQA 4Z2TA 5HR3A 4IQAA 4XS4A 5JWRB 16GSA 3IE3A 1GH2A 13GSA 3O6TA 2YJHA 3ZMKA 4XS1A 3KP8A 3CSHA 4KDYA 1FOHA 2IMEA 3C7MA 2B5XA 1V40A 1M2DA 2LV3A 3W8SA 3H93A 3LXTA 3IOSA 2FWGA 4ZXGA 2ZCTA 1LJRA 3IPZA 4AGSA 4K6XA 3BD2A 5IMDA 4H86A 2RM5A 1T00A 2X8HA 1QFNA 2XBQA 4ML1A 2G2QA 2KP2A 1SL2B 3FRCA 4JE1A 12GSA 1GSYA 2H71A 2AHEA 1NHOA 1R5PA 1X5CA 5D9VA 14GSA 2L4CA 1DBYA 4MNNA 4OMVA 4V1Ag 2VUPA 2HNLA 2FUG2 4OO5A 1OC9A 3TKSE 1K0OA 3G7JA 1SK0A 2C8UA 1ZCPA 2DJKA 3ZL5A 2K8SA 3CRUA 3GKNA 4AJ7A 4CW9A 1Q98A 4TVEA 1T8EB 2A2RA 3E0UA 4TW5A 1ZYQB 4JZQA 2IL3A 3DYRA 1ZGNA 3EWLA 2VCQA 2FD3A 4NV5A 5D9TA 1X9WB 3QCPA 4IP1A 3GTUB 3WGEA 2QC7A 3QD9A 3APOA 1B8XA 4CHSA 1Z6MA 3HDCA 3I43A 1TI1A 2LQOA 2MZCA 5DCHA 20GSA 3ERWA 5ELAA 4ICYA 4XIHA 4MF7A 1XZOA 3ME7A 3MYDA 5KN1A 3F3RA 1MD3A 2C0FA 5C00A 1J9BA 2AV4A 4DVCA 2H1BA 2VD0A 1I5GA 3FR6A 2R2JA 4JEDA 1A2JA 4I2TA 1YKCA 2H0IA 3GA4A 1G7OA 4TR1A 4PGTA 4I97A 3QFAC 1X9MB 3GKMA 3VWVA 4HI7A 2VL3A 2WFCA 5D8IA 3QR6A 1J0FA 2AYTA 3M1GA 4GWRA 1YEPA 1O85A 2YN1A 5FT3A 3WD6A 2YCDA 2VCVA 2JL4A 5CYYA 3VWUA 4G0KA 2HYXA 2IIYA 4ZL7A 4YQMA 1TOFA 2NBSA 2MYGA 3FZ9A 1THOA 4DSRA 4NV2A 2DMLA 2KP1A 2A2PA 1OAZA 3MIXA 4WEYA 4EIPA 1F3AA 1K0DA 4Q5NA 4F82A 4K2DA 5F8BA 3DIEA 2LTKA 2HRFA 4KX4A 1XBSA 4WF5A 3APQA 2G0FA 2GSQA 1XW6A 3ZTLA 1GNEA 3TDGA 2GGTA 3MSZA 4IGJA 4X0XA 3P90A 5ECNB 2HZEA 3M9KA 4IHUA 1TU7A 4X43A 4Q5QA 5ABRA 5IOWA 1AAZA 2YWOA 2GLRA 3BCIA 3OR5A 3ZFLA 1N8JA 2LNSA 3DEXA 1CQGA 4YQUA 6GSSA 3ZLPA 1PMTA 1X5EA 2DKIA 1PA3A 2O89A 2H1DA 5EPFA 2CX4A 4JU5A 1SK1A 1X9SB 2R3XA 3GFKA 3KXOA 3O76A 4NHWA 5H5RA 2VOCA 1EGOA 5CP1A 1TDIA 5B6NA 2L57A 5ECLB 4ZB6A 8GSSA 1ACVA 2X99A 1THXA 1SKWB 1QK8A 1V9WA 4AJ8A 3US3A 4BA7A 4MH3A 2CV4A 1BEDA 2O85A 1WWJA 1TK0B 2LEGA 3GV1A 1SL0B 4YH2A 1TK5B 3RPNA 3ISOA 2FHEA 2C3QA 4ECCA 1EOHA 5AIXA 2A4HA 2VCWA 3GHAA 4KB3A 3TJGA 2VLVA 3MWHA 1QMVA 1K3YA 2X8CA 2GDRA 4ECJA 5KOXA 1M9BA 2E7PA 5G1LA 1VGLA 1R26A 4CY6A 2JU5A 1UA5A 2LSTA 4P3YB 5F06A 5ECHB 5IMCA 3RHCA 6GSYA 3RAZA 2JSZA 1XW5A 1JFUA 4WR4A 1AW9A 2WULA 2GSSA 1XXUA 2K18A 5A4VA 3LW9A 1EEMA 1O8XA 5EY6A 3W6GA 4BVXB 5IQYA 2H19A 5EL8A 1YEXA 4ID0A 3CTGA 3GSSA 1HYUA 1C72A 3PGTA 2HE3A 1SL1B 3IA1A 1YQ1A 2WJUA 4PQHA 3RDWA 1GSEA 1SYXA 3D21A 1V57A 3TJBA 1YZXA 3IHQA 3C8EA 3EU4A 1IYHA 17GSA 3M3MA 5KN0A 4E8HA 1VF2A 2IMFA 1JZDA 1ZZYA 5DALA 4I5QA 6GSXA 5HR0A 1GSQA 3ZVJA 1CQHA 1RK4A 2YJ7A 1Y6EA 4HU7A 2VAFA 1YY7A 5BMUA 2WB9A 1B9XC 1FG4A 2IN3A 5KOWA 3GTUA 2VCXA 5ECPB 3FY7A 2VM2A 3F6DA 2ON5A 5E4WA 2I81A 3V1WA 4MLYA 1XWAA 2WS2A 4MJCA 1Q4JA 3RPPA 1Y25A 2B3SA 3HCZA 2J9HA 4BL7B 1BAYA 5CAXA 4V2NA 2JACA 1Z6NA 3PPUA 2FA8A 4LLRA 3U5RE 3FZ5A 2R6KA 2TRCP 2DSAA 1TI3A 1A8YA 2LQQA 2CZ2A 2GQLA 4O5UA 1JZRA 4HEA2 5JWQB 3A5IA 2V2GA 2YV7A 1M0UA 4TOPA 2V6OA 5DCGA 3CSJA 3LYKA 2VCTA 1S3CA 2OBKA 2H1GA 4GCIA 3UVTA 5JWOB 2H75A 2O8VB 2FY6A 3EMPA 3F8UA 5BRTA 3HJPA 3NIVA 4ILFA 3ZRDA 4OFMA 3ZVJD 5DJLA 1TXXA 5IMFA 3TJJA 2PBJA 2H72A 2MMOA 1B4QA 3QAGA 3IK7A 3UAPA 3Q19A 4FYUA 2O87A 4TXOB 4GXZA 4V2LA 1KBNA 2GZYA 3PR8A 1T1VA 3KMNA 3GKXA 1WP0A 3I9V2 1QXHA 3QPMA 4NAXA 1FOVA 4NWYA 4K2XA 2V32A 1XFLA 2CX3A 4F9ZA 2NDOA 4K9ZA 4POKA 1H75A 3KP9A 3KH7A 5LNKe 3DXBA 2H6YA 4RUVA 1TJDA 5IMZA 3WT1A 2IWTA 5DAKB 3TRPA 4HQSA 5GAPD 4KUNA 1SJ6A 1T4ZA 2BMXA 3GRXA 3L9SA 3DWVA 4OFTA 4J56E 3LYPA 5C04A 1GSUA 1TRVA 11GSA 3HJOA 2OADA 1BX9A 5AISA 1Z5YE 1A24A 4ULXA 1YJ6A 2K8VA 3HA9A 2CVBA 3M8NA 4EE0A 3FR3A 1OKTA 1K3OA 5FHIA 5B6MA 1GSDA 2R4VA 3F4TA 4EF0A 3KJYA 5ECRB 4TR0A 2IMKA 1PD21 2DJ2A 4F0BA 4XRAA 1XPVA 1A2MA 4KCEA 5G5EA 3U6VA 3HVVA 4YKGA 3HJMA 4JR6A 5J9BA 3PINA 3TCOA 3HY2A 4KE3A 4PUAA 1OKDA 3GURA 5B8BA 1SU9A 2YP6A 3FHKA 3IBHA 1PGTA 2EIRA 4TKYA 1YF1A 1KEBA 1MDJA 2LKUA 5DJMA 4K7NA 4ZL8A 19GSA 1JZOA 3I6AA 1Z7RA 4DSSB 3EURA 2LRTA 3KTLA 4FIWA 2DJ1A 1WJKA 2HRNA 3G7IA 3KGKA 18GSA 1EEJA 4MF6A 3VI7A 3VPTA 1K0BA 3BJ5A 1G6WA 1WE0A 3H4KA 4MABA 1FAAA 3C71A 6GSWA 3ME8A 4MA9A 1UC7A 4GLTA 2CVKA 2H01A 3N5OA 4LMWA 4BVYB 1WRYA 5D93A 2B7KA 1N2AA 2X4AA 1FO5A 1ERVA 5G1KA 1EV4A 1GUHA 3MAKA 4GQFA 3C1SA 4IW9A 1G7EA 4RI6A 3CXGA 2TRXA 3HHVA 2RIIA 1B4PA 2H30A 3DGQA 3QFBC 2QSIA 1F6MC 2DBCA 4KF9A 1ZYPA 2B7JA 1A2LA 2IFQB 2DKHA 2KUCA 1O73A 2JSYA 2VO4A 4G0IA 2LRCA 4EDYA 4ZBAA 2AUVA 1X0RA 1OYJA 3KMOA 3FKFA 3P2AA 4EUYA 5IPGA 1EP8A 4KA0A 3APSA 2YNXA 3IK9A 1TK8B 5JCWA 4V2MA 2PGTA 3TRXA 1XWCA 1MDIA 4USSA 3ERGA 3F4SA 4RQXA 4KDXA 4PX1A 2EC4A 1PQNA 4YAPA 5DDLA 3VFIA 3W8JA 4OFNA 1FB6A 4WBJA 2GSRA 2XPEA 2ZUPA 3FR9A 4LA1A 3IV4A 2LNTA 4KSOA 1HNCA 4BL7A 2MBSA 5ENUA 1GLQA 2OA7A 3R2QA 3TKSC 5J9CA 1AQVA 2DIYA 5A5KA 1GTUA 5B8AA 4L0UA 3EC3A 3LEFA 1A8LA 4FO5A 3RBTA 3ZYWA 3TKRA 3UIWA 5J41A 5ECKB 4WBRD 5F07A 1M9AA 5ID2B 2YANA 4GTUA 4POBA 4JRRA 5JCUA 2BTOT 2JADA 2QA2A 3K8NA 2YWMA 2FGXA 4POMA 3F0IA 4ECIA 4O32A 3TRQA 4K0GA 4N10A 1XOBA 1K3LA 4MCUA 1S3RA 3FZ4A 3ED3A 1HD2A 1XWKA 2H6XA 1T3BA 1AC1A 3FZAA 1ML6A 2ES7A 2FWFA 2H8LA
chains in the Genus database with same CATH topology
2BJXA 3ERFA 2V41A 4V1Ap 2HSHA 3C1RA 4JR4A 1SK2A 3GX8A 4ZIJA 4XHMA 4YAVA 4L5LA 2C4JA 1DE1A 2C0DA 1PX7A 4LL4B 5H5SA 3EMXA 1B9YC 2HT9A 1V98A 2A2SA 4I8BA 4D73B 1HNAA 2C0GA 1G0TA 2GZZA 5D9XA 5DAKA 1JZWA 2H6ZA 1SD9A 3ZFBA 1SENA 2L5LA 1PRXA 5HR2A 3L4NA 3S9FA 2GZPA 5E59A 3HXSA 3HZ4A 2F9SA 2OKAA 1URMA 1SYRA 3GIXA 4EC0A 1KTEA 3IXRA 1M2BA 5KEJA 1LU4A 4TR3A 3SBCA 3GX0A 2R0PA 4EKZA 3D0ZA 3GH9A 2VL2C 2DC5A 1RQMA 1YF0A 3GL3A 2KOKA 2LRNA 2FCHA 2R0GA 5A4UA 4EL1A 3LSZA 1GUMA 2PWJA 3EE2A 2H66A 2L6DA 4A5PA 2J23A 3BOAA 1PN9A 1R5AA 1GNWA 1SJIA 10GSA 1F2EA 5GZZB 3HZ8A 4HZ2A 4GF0A 3D5JA 4X4JA 4F2IA 2B5EA 22GSA 3HVXA 1W89A 2HZFA 3KZQA 1GSFA 1X5DA 4Z2UA 2FLSA 2C3TA 4DSSA 4MJAA 4L8EA 2YZHA 2EIQA 1JHBA 2B5YA 2V6KA 2P5QA 4N11A 1SD8A 3KTBA 1XVWA 2OACA 4ZB8A 1U88A 4O92A 3IAM2 5CRWA 1GTAA 2CA8A 4MMMA 2QKEA 1E2YA 4BVYA 5KN2A 4EVMA 5IM9A 3GL5A 1EWXA 1ERTA 4MPGA 5ECIB 3FK8A 3VWWA 2L6CA 3A5WA 4PUFC 1Z9HA 2F8AA 5AGYA 3VURA 2IFQA 5HFGA 5F05A 1AQXA 3GUSA 1PSQA 5HFKA 2RLIA 1TU8A 2VL2A 3CSIA 3P8WA 4HQZA 2F51A 4KAEA 2QGVA 3JCML 1ZMAA 2C1YA 4WR5A 4ZL9A 1USBA 1GTBA 2HI7A 5D96A 2R0CA 5J3RA 4G0LA 4WXTA 3N9JA 3TOTA 3UVHA 2H1AA 1DSBA 4OCEA 4GSTA 1IYIA 1M2AA 2E2GA 3CYNA 1TRWA 1HQOA 3VK9A 2N5FA 1SKSB 2DMMA 4EO3A 4MK3A 3HD5A 4MPFA 1GULA 3F6FA 4NXIA 5FWGA 3QDNA 1XOAA 5EVOA 4LL1B 4MJEA 3HKRA 3UMAA 1ILOA 4ECBA 2CT6A 2HLSA 2NPBA 1TTZA 4PTSA 4YKFA 3QMXA 2PUKC 3IC4A 2P5RA 4K7IA 1O7UA 2EIOA 3ZIVA 3GMFA 2H73A 3WT2A 2HSMA 5AIVA 1ERUA 3NOFA 2N5AA 2Z9SA 3A2VA 3BCKA 4HS1A 2MBTA 4IELA 5IOXA 2AJQB 3LQ7A 2TIRA 3LGCA 1MTCA 3EU3A 4ZBDA 3D4TA 2JZRA 3DVWA 1S3DA 1ZYEA 1AIUA 4IS0A 3KEBA 1TRSA 4KSMA 3CTFA 3CMIA 1ERWA 3E9JB 1PKZA 4FYCA 2MMAA 1OE7A 3CBUA 1LBKA 2VCZA 9GSSA 1E6BA 2PU9C 4MF5A 5IPHA 4O5RA 3IHGA 2HRAA 1WMJA 2K9FA 4TN8A 2CAIA 4NMUA 5HFIA 3IR4A 4EXJA 1DE2A 2I1UA 3F9UA 1RW1A 4D73A 1MEKA 3O3TA 1R7HA 4K1FA 4HU9A 4K8MA 5GSTA 6GSUA 2KLXA 5CRGA 5GAND 4ZB9A 3L78A 1G6YA 2ZNMA 5AN1A 3LJRA 4Z7XA 3D6IA 6GSVA 2VLUA 1TP9A 2REMA 3G9BA 3KM6A 3TUEA 2PMTA 1T7PB 5J4UA 2VLTA 2C80A 1U3IA 2C0EA 3TB2A 4MP4A 4JBBA 4Q5FA 4DEJA 2I4AA 4IKHA 4CDOA 3QOUA 2CZ3A 3F4RA 3UBKA 2B1LA 2DJ3A 2LS5A 1OC3A 2PVOC 2HFDA 3GNJA 5DVBA 4G2EA 1U87A 3H79A 3Q74A 3R3EA 5L71A 1GUKA 1VRSD 4BVXA 2LJRA 5DALB 2LJAA 3C73A 4ZILA 2MMNA 4IVFA 1U6TA 3AY8A 4L5OA 1QUWA 2E2MA 2GVPA 3A3TA 2P31A 2XBIA 2AB6A 3D4MA 1ST9A 3LFLA 3Q18A 2WGRA 2XPDA 7GSSA 1EOGA 4KH7A 1GL8A 4TXVA 5INYA 1GLPA 1M7TA 4N0VA 1F9MA 3L9UA 5CRHA 5G31A 1R4WA 2ON7A 3EINA 1VF3A 1FVJA 1WOUA 3MNGA 2DLXA 3UJ1A 4IJ3A 1TKDB 1VF1A 2H76A 4PQ1A 2X64A 4PNFA 1B48A 2CQ9A 3FMWA 1W4VA 2H0HA 1VF4A 3ZMLA 1K0NA 1NHYA 3LXZA 3GKKA 2IJYA 2JZSA 3A2WA 2RM6A 1O6JA 2WDUA 3EVIA 4F0CA 1Z3EA 1NW2A 2AAWA 2WZ9A 3UOMA 3BBYA 1HNBA 4TR4A 4KCAA 4ZBBA 2ALBA 3TKPA 4EDZA 2DIZA 1ZYNA 4ACSA 4K0NA 1MDKA 3WGXA 5IMVA 1GWCA 4LMVA 2R5GA 5ELGA 5DBQA 4O7HA 5G2ZA 4N0ZA 1XWBA 1XVQA 2NTOA 4IBPA 4RQRA 2C3NA 4ISDA 1NM3A 4GQCA 4FYBA 3DKSA 3ZIJA 4IJIA 1K0MA 4NPBA 3TJKA 3HYPA 3UBLA 1ABAA 3E3EA 1A23A 5IIZA 1PKWA 2B6MA 4I2UA 1K0AA 4PNGA 3QAWA 1BG5A 4HJ2A 2GT6A 4TXOA 1XW9A 1K0CA 3GH6A 2N5BA 2OJLA 5KN3A 1GSSA 1MD4A 1O81A 4KNDA 2HSYA 3KD0A 4G19A 3KIJA 5LD0A 1BYEA 3SWLA 3KH9A 2KHPA 4KGIA 2XC2A 3WYWA 3I69A 4L0WA 3TOUA 4HUAA 5CNWA 1F37A 2M72A 3Q6OA 1DUGA 2OE3A 2FA4A 4BPYA 2HXKA 3L0HA 1JLVA 4GSSA 1PL1A 4CY8A 2LJKA 4XS4B 2X49A 4OWYA 3IRAA 5GSSA 2B1KA 3VLNA 2VL9A 4FH8A 1WIKA 1EZKA 3TJFA 4QL9A 3LORA 4BWSA 5LCZA 1OVNA 4MZCA 4I6XA 4IN0A 4PXOA 4MDCA 3P7XA 1GP1A 2GS3A 4EIQA 1EV9A 3PH9A 2WCIA 2VD1A 2YPMA 3DMLA 3TKSA 1WPIA 3FYGA 5CRDA 3MDKA 1AQWA 4KDUA 4F03A 3A2XA 1O8WA 4WF4A 2YOIA 2LUSA 4QQ7A 1UN2A 2F8FA 4MH2A 2E0QA 4MZBA 3DD3A 5ECQB 1BJXA 3IAS2 3J7Yk 3FW2A 3FEUA 4XCSA 2IMIA 2GQKA 2DJ0A 1F3BA 4MZWA 4J2FA 1AXDA 3H1NA 4J57E 2H70A 1OC9B 1PX6A 1S3AA 4QL7A 2PPTA 5G5FA 1YKAA 4NHZA 2R37A 5IO0A 2QA1A 2YZUA 3UEMA 3WGDA 1XCCA 1GTIA 5CREA 1SKRB 2OE1A 2VM1A 1ZL9A 4O5QA 3M0FA 2GSTA 1ZOFA 5H5QA 2FWHA 2CAQA 3F63A 1BQ7A 1NSWA 4YQVA 2JZTA 1ON4A 2UZ8A 4KW6A 2A4VA 3QAVA 2FNOA 2PERA 5CO3A 4XTSA 2OBIA 1XWGA 4GSNA 5COHA 1TW9A 3HVSA 3VI5A 3GYKA 4AJ6A 3G7YA 5A4WA 2RUFA 5D73A 4BWQA 5D9WA 3LWAA 3NZNA 3VPQA 1Z7PA 3CRTA 2YWIA 1QQ2A 4ML6A 4PURA 3KCMA 2I3YA 4WETA 4K5RA 4MJBA 2L4QA 5DQYA 3J7Yb 4TR1B 1EGRA 1PN0A 4HDEA 2GQMA 1J08A 2HRKA 1V2AA 3UARA 1U3AA 1T4YA 1H4OA 2GTUA 1M99A 2IMDA 2NVLA 2O7KA 5IO2A 4K5SA 1FW1A 2WRTA 3EYTA 2YV9A 5IMAA 1FB0A 4GRFA 2H0GA 4TRXA 5ECSA 4IP6A 2YWNA 4OCFA 1FHEA 4HJMA 2D2ZA 4N30A 1I9DA 3RHBA 3IDVA 2F3MA 2H74A 3ZITA 1FVKA 2CVDA 4G10A 3DVXA 4RI7A 2P0GA 3IC8A 1XIYA 2RUEA 2FWEA 4X1UA 3GSTA 4HOJA 1QGVA 4HZ4A 1A0RP 2M46A 1A0FA 1EP7A 3L9VA 2DJJA 3DRNA 2IPAA 4XRDA 4PQIA 2PN8A 1KNGA 1UVZA 2L5OA 3UL3A 1YDKA 1PL2A 3H8QA 2HZEB 1TRUA 3ZZXA 1JLWA 4OD7A 4K7OA 5F0GA 1GRXA 3VWXA 5ECMB 2OE0A 5ID2A 4IQ1A 5DQSA 4E8EA 5JCGA 2M80A 2VIMA 4G9HA 3ZREA 6GSTA 1OE8A 5ECOB 4Q5RA 5HR1A 2GT5A 2MMZA 5J5NA 3LG6A 1AUCA 4WKWA 3TGZA 1V58A 2I9HA 1OC8A 4Z2RA 3TKQA 1SJZA 3M9JA 2L59A 5B7CA 2XHFA 3F3QA 3D22A 3EPTA 2K6VA 5HQPA 2V1MA 2PVQA 4OO4A 4XS6A 4AF2A 4FQUA 3GN3A 5G30A 4POLA 2X8GA 4DSQA 4Z2TA 5HR3A 4IQAA 4XS4A 5JWRB 16GSA 3IE3A 1GH2A 13GSA 3O6TA 2YJHA 3ZMKA 4XS1A 3KP8A 3CSHA 4KDYA 1FOHA 2IMEA 3C7MA 2B5XA 1V40A 1M2DA 2LV3A 3W8SA 3H93A 3LXTA 3IOSA 2FWGA 4ZXGA 2ZCTA 1LJRA 3IPZA 4AGSA 4K6XA 3BD2A 5IMDA 4H86A 2RM5A 1T00A 2X8HA 1QFNA 2XBQA 4ML1A 2G2QA 2KP2A 1SL2B 3FRCA 4JE1A 12GSA 1GSYA 2H71A 2AHEA 1NHOA 1R5PA 1X5CA 5D9VA 14GSA 2L4CA 1DBYA 4MNNA 4OMVA 4V1Ag 2VUPA 2HNLA 2FUG2 4OO5A 1OC9A 3TKSE 1K0OA 3G7JA 1SK0A 2C8UA 1ZCPA 2DJKA 3ZL5A 2K8SA 3CRUA 3GKNA 4AJ7A 4CW9A 1Q98A 4TVEA 1T8EB 2A2RA 3E0UA 4TW5A 1ZYQB 4JZQA 2IL3A 3DYRA 1ZGNA 3EWLA 2VCQA 2FD3A 4NV5A 5D9TA 1X9WB 3QCPA 4IP1A 3GTUB 3WGEA 2QC7A 3QD9A 3APOA 1B8XA 4CHSA 1Z6MA 3HDCA 3I43A 1TI1A 2LQOA 2MZCA 5DCHA 20GSA 3ERWA 5ELAA 4ICYA 4XIHA 4MF7A 1XZOA 3ME7A 3MYDA 5KN1A 3F3RA 1MD3A 2C0FA 5C00A 1J9BA 2AV4A 4DVCA 2H1BA 2VD0A 1I5GA 3FR6A 2R2JA 4JEDA 1A2JA 4I2TA 1YKCA 2H0IA 3GA4A 1G7OA 4TR1A 4PGTA 4I97A 3QFAC 1X9MB 3GKMA 3VWVA 4HI7A 2VL3A 2WFCA 5D8IA 3QR6A 1J0FA 2AYTA 3M1GA 4GWRA 1YEPA 1O85A 2YN1A 5FT3A 3WD6A 2YCDA 2VCVA 2JL4A 5CYYA 3VWUA 4G0KA 2HYXA 2IIYA 4ZL7A 4YQMA 1TOFA 2NBSA 2MYGA 3FZ9A 1THOA 4DSRA 4NV2A 2DMLA 2KP1A 2A2PA 1OAZA 3MIXA 4WEYA 4EIPA 1F3AA 1K0DA 4Q5NA 4F82A 4K2DA 5F8BA 3DIEA 2LTKA 2HRFA 4KX4A 1XBSA 4WF5A 3APQA 2G0FA 2GSQA 1XW6A 3ZTLA 1GNEA 3TDGA 2GGTA 3MSZA 4IGJA 4X0XA 3P90A 5ECNB 2HZEA 3M9KA 4IHUA 1TU7A 4X43A 4Q5QA 5ABRA 5IOWA 1AAZA 2YWOA 2GLRA 3BCIA 3OR5A 3ZFLA 1N8JA 2LNSA 3DEXA 1CQGA 4YQUA 6GSSA 3ZLPA 1PMTA 1X5EA 2DKIA 1PA3A 2O89A 2H1DA 5EPFA 2CX4A 4JU5A 1SK1A 1X9SB 2R3XA 3GFKA 3KXOA 3O76A 4NHWA 5H5RA 2VOCA 1EGOA 5CP1A 1TDIA 5B6NA 2L57A 5ECLB 4ZB6A 8GSSA 1ACVA 2X99A 1THXA 1SKWB 1QK8A 1V9WA 4AJ8A 3US3A 4BA7A 4MH3A 2CV4A 1BEDA 2O85A 1WWJA 1TK0B 2LEGA 3GV1A 1SL0B 4YH2A 1TK5B 3RPNA 3ISOA 2FHEA 2C3QA 4ECCA 1EOHA 5AIXA 2A4HA 2VCWA 3GHAA 4KB3A 3TJGA 2VLVA 3MWHA 1QMVA 1K3YA 2X8CA 2GDRA 4ECJA 5KOXA 1M9BA 2E7PA 5G1LA 1VGLA 1R26A 4CY6A 2JU5A 1UA5A 2LSTA 4P3YB 5F06A 5ECHB 5IMCA 3RHCA 6GSYA 3RAZA 2JSZA 1XW5A 1JFUA 4WR4A 1AW9A 2WULA 2GSSA 1XXUA 2K18A 5A4VA 3LW9A 1EEMA 1O8XA 5EY6A 3W6GA 4BVXB 5IQYA 2H19A 5EL8A 1YEXA 4ID0A 3CTGA 3GSSA 1HYUA 1C72A 3PGTA 2HE3A 1SL1B 3IA1A 1YQ1A 2WJUA 4PQHA 3RDWA 1GSEA 1SYXA 3D21A 1V57A 3TJBA 1YZXA 3IHQA 3C8EA 3EU4A 1IYHA 17GSA 3M3MA 5KN0A 4E8HA 1VF2A 2IMFA 1JZDA 1ZZYA 5DALA 4I5QA 6GSXA 5HR0A 1GSQA 3ZVJA 1CQHA 1RK4A 2YJ7A 1Y6EA 4HU7A 2VAFA 1YY7A 5BMUA 2WB9A 1B9XC 1FG4A 2IN3A 5KOWA 3GTUA 2VCXA 5ECPB 3FY7A 2VM2A 3F6DA 2ON5A 5E4WA 2I81A 3V1WA 4MLYA 1XWAA 2WS2A 4MJCA 1Q4JA 3RPPA 1Y25A 2B3SA 3HCZA 2J9HA 4BL7B 1BAYA 5CAXA 4V2NA 2JACA 1Z6NA 3PPUA 2FA8A 4LLRA 3U5RE 3FZ5A 2R6KA 2TRCP 2DSAA 1TI3A 1A8YA 2LQQA 2CZ2A 2GQLA 4O5UA 1JZRA 4HEA2 5JWQB 3A5IA 2V2GA 2YV7A 1M0UA 4TOPA 2V6OA 5DCGA 3CSJA 3LYKA 2VCTA 1S3CA 2OBKA 2H1GA 4GCIA 3UVTA 5JWOB 2H75A 2O8VB 2FY6A 3EMPA 3F8UA 5BRTA 3HJPA 3NIVA 4ILFA 3ZRDA 4OFMA 3ZVJD 5DJLA 1TXXA 5IMFA 3TJJA 2PBJA 2H72A 2MMOA 1B4QA 3QAGA 3IK7A 3UAPA 3Q19A 4FYUA 2O87A 4TXOB 4GXZA 4V2LA 1KBNA 2GZYA 3PR8A 1T1VA 3KMNA 3GKXA 1WP0A 3I9V2 1QXHA 3QPMA 4NAXA 1FOVA 4NWYA 4K2XA 2V32A 1XFLA 2CX3A 4F9ZA 2NDOA 4K9ZA 4POKA 1H75A 3KP9A 3KH7A 5LNKe 3DXBA 2H6YA 4RUVA 1TJDA 5IMZA 3WT1A 2IWTA 5DAKB 3TRPA 4HQSA 5GAPD 4KUNA 1SJ6A 1T4ZA 2BMXA 3GRXA 3L9SA 3DWVA 4OFTA 4J56E 3LYPA 5C04A 1GSUA 1TRVA 11GSA 3HJOA 2OADA 1BX9A 5AISA 1Z5YE 1A24A 4ULXA 1YJ6A 2K8VA 3HA9A 2CVBA 3M8NA 4EE0A 3FR3A 1OKTA 1K3OA 5FHIA 5B6MA 1GSDA 2R4VA 3F4TA 4EF0A 3KJYA 5ECRB 4TR0A 2IMKA 1PD21 2DJ2A 4F0BA 4XRAA 1XPVA 1A2MA 4KCEA 5G5EA 3U6VA 3HVVA 4YKGA 3HJMA 4JR6A 5J9BA 3PINA 3TCOA 3HY2A 4KE3A 4PUAA 1OKDA 3GURA 5B8BA 1SU9A 2YP6A 3FHKA 3IBHA 1PGTA 2EIRA 4TKYA 1YF1A 1KEBA 1MDJA 2LKUA 5DJMA 4K7NA 4ZL8A 19GSA 1JZOA 3I6AA 1Z7RA 4DSSB 3EURA 2LRTA 3KTLA 4FIWA 2DJ1A 1WJKA 2HRNA 3G7IA 3KGKA 18GSA 1EEJA 4MF6A 3VI7A 3VPTA 1K0BA 3BJ5A 1G6WA 1WE0A 3H4KA 4MABA 1FAAA 3C71A 6GSWA 3ME8A 4MA9A 1UC7A 4GLTA 2CVKA 2H01A 3N5OA 4LMWA 4BVYB 1WRYA 5D93A 2B7KA 1N2AA 2X4AA 1FO5A 1ERVA 5G1KA 1EV4A 1GUHA 3MAKA 4GQFA 3C1SA 4IW9A 1G7EA 4RI6A 3CXGA 2TRXA 3HHVA 2RIIA 1B4PA 2H30A 3DGQA 3QFBC 2QSIA 1F6MC 2DBCA 4KF9A 1ZYPA 2B7JA 1A2LA 2IFQB 2DKHA 2KUCA 1O73A 2JSYA 2VO4A 4G0IA 2LRCA 4EDYA 4ZBAA 2AUVA 1X0RA 1OYJA 3KMOA 3FKFA 3P2AA 4EUYA 5IPGA 1EP8A 4KA0A 3APSA 2YNXA 3IK9A 1TK8B 5JCWA 4V2MA 2PGTA 3TRXA 1XWCA 1MDIA 4USSA 3ERGA 3F4SA 4RQXA 4KDXA 4PX1A 2EC4A 1PQNA 4YAPA 5DDLA 3VFIA 3W8JA 4OFNA 1FB6A 4WBJA 2GSRA 2XPEA 2ZUPA 3FR9A 4LA1A 3IV4A 2LNTA 4KSOA 1HNCA 4BL7A 2MBSA 5ENUA 1GLQA 2OA7A 3R2QA 3TKSC 5J9CA 1AQVA 2DIYA 5A5KA 1GTUA 5B8AA 4L0UA 3EC3A 3LEFA 1A8LA 4FO5A 3RBTA 3ZYWA 3TKRA 3UIWA 5J41A 5ECKB 4WBRD 5F07A 1M9AA 5ID2B 2YANA 4GTUA 4POBA 4JRRA 5JCUA 2BTOT 2JADA 2QA2A 3K8NA 2YWMA 2FGXA 4POMA 3F0IA 4ECIA 4O32A 3TRQA 4K0GA 4N10A 1XOBA 1K3LA 4MCUA 3FZ4A 3ED3A 1HD2A 1XWKA 2H6XA 1T3BA 1AC1A 3FZAA 1ML6A 2ES7A 2FWFA 2H8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJX A;  3ERF A;  2V41 A;  4V1A p;  2HSH A;  3C1R A;  4JR4 A;  1SK2 A;  3GX8 A;  4ZIJ A;  4XHM A;  4YAV A;  4L5L A;  2C4J A;  1DE1 A;  2C0D A;  1PX7 A;  4LL4 B;  5H5S A;  3EMX A;  1B9Y C;  2HT9 A;  1V98 A;  2A2S A;  4I8B A;  4D73 B;  1HNA A;  2C0G A;  1G0T A;  2GZZ A;  5D9X A;  5DAK A;  1JZW A;  2H6Z A;  1SD9 A;  3ZFB A;  1SEN A;  2L5L A;  1PRX A;  5HR2 A;  3L4N A;  3S9F A;  2GZP A;  5E59 A;  3HXS A;  3HZ4 A;  2F9S A;  2OKA A;  1URM A;  1SYR A;  3GIX A;  4EC0 A;  1KTE A;  3IXR A;  1M2B A;  5KEJ A;  1LU4 A;  4TR3 A;  3SBC A;  3GX0 A;  4EKZ A;  3D0Z A;  3GH9 A;  2VL2 C;  2DC5 A;  1RQM A;  1YF0 A;  3GL3 A;  2KOK A;  2LRN A;  2FCH A;  5A4U A;  4EL1 A;  3LSZ A;  1GUM A;  2PWJ A;  3EE2 A;  2H66 A;  2L6D A;  2J23 A;  3BOA A;  1PN9 A;  1R5A A;  1GNW A;  1SJI A;  10GS A;  1F2E A;  5GZZ B;  3HZ8 A;  4HZ2 A;  4GF0 A;  3D5J A;  4F2I A;  2B5E A;  22GS A;  3HVX A;  1W89 A;  2HZF A;  3KZQ A;  1GSF A;  1X5D A;  2FLS A;  2C3T A;  4DSS A;  4MJA A;  4L8E A;  2YZH A;  2EIQ A;  1JHB A;  2B5Y A;  2V6K A;  2P5Q A;  4N11 A;  1SD8 A;  3KTB A;  1XVW A;  2OAC A;  4ZB8 A;  1U88 A;  4O92 A;  3IAM 2;  5CRW A;  1GTA A;  2CA8 A;  4MMM A;  2QKE A;  1E2Y A;  4BVY A;  5KN2 A;  4EVM A;  5IM9 A;  3GL5 A;  1EWX A;  1ERT A;  4MPG A;  5ECI B;  3FK8 A;  3VWW A;  2L6C A;  3A5W A;  4PUF C;  1Z9H A;  2F8A A;  5AGY A;  3VUR A;  2IFQ A;  5HFG A;  5F05 A;  1AQX A;  3GUS A;  1PSQ A;  5HFK A;  2RLI A;  1TU8 A;  2VL2 A;  3CSI A;  3P8W A;  4HQZ A;  2F51 A;  4KAE A;  2QGV A;  3JCM L;  1ZMA A;  2C1Y A;  4WR5 A;  4ZL9 A;  1USB A;  1GTB A;  2HI7 A;  5D96 A;  5J3R A;  3UVH A;  4WXT A;  3N9J A;  3TOT A;  2H1A A;  1DSB A;  4OCE A;  4GST A;  1IYI A;  1M2A A;  2E2G A;  3CYN A;  1TRW A;  1HQO A;  3VK9 A;  2N5F A;  1SKS B;  2DMM A;  4EO3 A;  4MK3 A;  3HD5 A;  4MPF A;  1GUL A;  3F6F A;  4NXI A;  5FWG A;  3QDN A;  1XOA A;  5EVO A;  4LL1 B;  4MJE A;  3HKR A;  3UMA A;  1ILO A;  4ECB A;  2CT6 A;  2HLS A;  2NPB A;  1TTZ A;  3QMX A;  2PUK C;  3IC4 A;  2P5R A;  4K7I A;  1O7U A;  2EIO A;  3ZIV A;  3GMF A;  2H73 A;  3WT2 A;  5AIV A;  1ERU A;  3NOF A;  2N5A A;  2Z9S A;  3A2V A;  3BCK A;  4HS1 A;  2MBT A;  4IEL A;  5IOX A;  2AJQ B;  3LQ7 A;  2TIR A;  3LGC A;  1MTC A;  3EU3 A;  4ZBD A;  3D4T A;  2JZR A;  3DVW A;  1S3D A;  1ZYE A;  1AIU A;  4IS0 A;  3KEB A;  1TRS A;  4KSM A;  3CTF A;  3CMI A;  1ERW A;  3E9J B;  1PKZ A;  4FYC A;  2MMA A;  1OE7 A;  3CBU A;  1LBK A;  2VCZ A;  9GSS A;  1E6B A;  2PU9 C;  4MF5 A;  5IPH A;  4O5R A;  1WMJ A;  2K9F A;  4TN8 A;  2CAI A;  4NMU A;  5HFI A;  3IR4 A;  4EXJ A;  1DE2 A;  2I1U A;  3F9U A;  1RW1 A;  4D73 A;  1MEK A;  3O3T A;  1R7H A;  4K1F A;  4HU9 A;  4K8M A;  5GST A;  6GSU A;  2KLX A;  5CRG A;  5GAN D;  4ZB9 A;  3L78 A;  1G6Y A;  2ZNM A;  5AN1 A;  3LJR A;  4Z7X A;  3D6I A;  6GSV A;  2VLU A;  1TP9 A;  2REM A;  3G9B A;  3KM6 A;  3TUE A;  2PMT A;  1T7P B;  5J4U A;  2VLT A;  2C80 A;  1U3I A;  2C0E A;  3TB2 A;  4MP4 A;  4JBB A;  4Q5F A;  4DEJ A;  2I4A A;  4IKH A;  4CDO A;  3QOU A;  2CZ3 A;  3F4R A;  3UBK A;  2B1L A;  2DJ3 A;  2LS5 A;  1OC3 A;  2PVO C;  2HFD A;  3GNJ A;  5DVB A;  4G2E A;  1U87 A;  3H79 A;  3Q74 A;  5L71 A;  1GUK A;  1VRS D;  4BVX A;  2LJR A;  5DAL B;  2LJA A;  3C73 A;  4ZIL A;  2MMN A;  4IVF A;  1U6T A;  3AY8 A;  4L5O A;  1QUW A;  2E2M A;  2GVP A;  3A3T A;  2P31 A;  2XBI A;  2AB6 A;  3D4M A;  1ST9 A;  3LFL A;  3Q18 A;  2WGR A;  2XPD A;  7GSS A;  1EOG A;  4KH7 A;  1GL8 A;  4TXV A;  5INY A;  1GLP A;  1M7T A;  4N0V A;  1F9M A;  3L9U A;  5CRH A;  5G31 A;  1R4W A;  2ON7 A;  3EIN A;  1VF3 A;  1FVJ A;  1WOU A;  3MNG A;  2DLX A;  3UJ1 A;  4IJ3 A;  1TKD B;  1VF1 A;  2H76 A;  4PQ1 A;  2X64 A;  4PNF A;  1B48 A;  2CQ9 A;  1W4V A;  2H0H A;  1VF4 A;  3ZML A;  1K0N A;  1NHY A;  3LXZ A;  3GKK A;  2IJY A;  2JZS A;  3A2W A;  2RM6 A;  1O6J A;  2WDU A;  3EVI A;  4F0C A;  1Z3E A;  1NW2 A;  2AAW A;  2WZ9 A;  3UOM A;  3BBY A;  1HNB A;  4TR4 A;  4KCA A;  4ZBB A;  2ALB A;  3TKP A;  4EDZ A;  2DIZ A;  4ACS A;  4K0N A;  1MDK A;  3WGX A;  5IMV A;  1GWC A;  4LMV A;  2R5G A;  5ELG A;  5DBQ A;  4O7H A;  5G2Z A;  4N0Z A;  1XWB A;  1XVQ A;  2NTO A;  4IBP A;  4RQR A;  2C3N A;  4ISD A;  1NM3 A;  4GQC A;  4FYB A;  3DKS A;  3ZIJ A;  4IJI A;  1K0M A;  4NPB A;  3TJK A;  3HYP A;  3UBL A;  1ABA A;  3E3E A;  1A23 A;  5IIZ A;  1PKW A;  2B6M A;  4I2U A;  1K0A A;  4PNG A;  3QAW A;  1BG5 A;  4HJ2 A;  2GT6 A;  4TXO A;  1XW9 A;  1K0C A;  3GH6 A;  2N5B A;  2OJL A;  5KN3 A;  1GSS A;  1MD4 A;  1O81 A;  4KND A;  2HSY A;  3KD0 A;  4G19 A;  3KIJ A;  5LD0 A;  1BYE A;  3SWL A;  3KH9 A;  2KHP A;  4KGI A;  2XC2 A;  3WYW A;  3I69 A;  4L0W A;  3TOU A;  4HUA A;  5CNW A;  1F37 A;  2M72 A;  3Q6O A;  1DUG A;  2OE3 A;  2FA4 A;  4BPY A;  2HXK A;  3L0H A;  1JLV A;  4GSS A;  1PL1 A;  2LJK A;  4XS4 B;  4OWY A;  3IRA A;  5GSS A;  2B1K A;  3VLN A;  2VL9 A;  4FH8 A;  1WIK A;  1EZK A;  3TJF A;  4QL9 A;  3LOR A;  4BWS A;  5LCZ A;  1OVN A;  4MZC A;  4I6X A;  4IN0 A;  4PXO A;  4MDC A;  3P7X A;  1GP1 A;  2GS3 A;  1EV9 A;  3PH9 A;  2WCI A;  2VD1 A;  2YPM A;  3DML A;  3TKS A;  1WPI A;  3FYG A;  5CRD A;  3MDK A;  1AQW A;  4KDU A;  4F03 A;  3A2X A;  1O8W A;  4WF4 A;  2YOI A;  2LUS A;  4QQ7 A;  1UN2 A;  2F8F A;  4MH2 A;  2E0Q A;  4MZB A;  3DD3 A;  5ECQ B;  1BJX A;  3IAS 2;  3J7Y k;  3FW2 A;  3FEU A;  4XCS A;  2IMI A;  2GQK A;  2DJ0 A;  1F3B A;  4MZW A;  4J2F A;  1AXD A;  3H1N A;  4J57 E;  2H70 A;  1OC9 B;  1PX6 A;  1S3A A;  4QL7 A;  2PPT A;  5G5F A;  1YKA A;  4NHZ A;  2R37 A;  5IO0 A;  2YZU A;  3UEM A;  3WGD A;  1XCC A;  1GTI A;  5CRE A;  1SKR B;  2OE1 A;  2VM1 A;  1ZL9 A;  3M0F A;  2GST A;  1ZOF A;  5H5Q A;  2FWH A;  2CAQ A;  3F63 A;  1BQ7 A;  1NSW A;  4YQV A;  2JZT A;  1ON4 A;  4KW6 A;  2A4V A;  3QAV A;  2FNO A;  2PER A;  5CO3 A;  4XTS A;  2OBI A;  1XWG A;  4GSN A;  5COH A;  1TW9 A;  3HVS A;  3VI5 A;  3GYK A;  4AJ6 A;  3G7Y A;  5A4W A;  2RUF A;  5D73 A;  4BWQ A;  5D9W A;  3LWA A;  3NZN A;  3VPQ A;  1Z7P A;  3CRT A;  2YWI A;  1QQ2 A;  4ML6 A;  4PUR A;  3KCM A;  2I3Y A;  4WET A;  4MJB A;  2L4Q A;  5DQY A;  3J7Y b;  4TR1 B;  1EGR A;  4HDE A;  2GQM A;  1J08 A;  1V2A A;  3UAR A;  1U3A A;  1T4Y A;  1H4O A;  2GTU A;  1M99 A;  2IMD A;  2NVL A;  2O7K A;  5IO2 A;  1FW1 A;  2WRT A;  3EYT A;  2YV9 A;  5IMA A;  1FB0 A;  4GRF A;  2H0G A;  4TRX A;  5ECS A;  4IP6 A;  2YWN A;  4OCF A;  1FHE A;  4HJM A;  2D2Z A;  4N30 A;  1I9D A;  3RHB A;  3IDV A;  2F3M A;  2H74 A;  3ZIT A;  1FVK A;  2CVD A;  4G10 A;  3DVX A;  4RI7 A;  2P0G A;  1XIY A;  2RUE A;  2FWE A;  4X1U A;  3GST A;  4HOJ A;  1QGV A;  4HZ4 A;  1A0R P;  2M46 A;  1A0F A;  1EP7 A;  3L9V A;  2DJJ A;  3DRN A;  2IPA A;  4XRD A;  4PQI A;  2PN8 A;  1KNG A;  1UVZ A;  2L5O A;  3UL3 A;  1YDK A;  1PL2 A;  3H8Q A;  2HZE B;  1TRU A;  3ZZX A;  1JLW A;  4OD7 A;  4K7O A;  5F0G A;  1GRX A;  3VWX A;  5ECM B;  2OE0 A;  5ID2 A;  4IQ1 A;  5DQS A;  4E8E A;  5JCG A;  2M80 A;  2VIM A;  4G9H A;  3ZRE A;  6GST A;  1OE8 A;  5ECO B;  4Q5R A;  5HR1 A;  2GT5 A;  2MMZ A;  5J5N A;  3LG6 A;  1AUC A;  4WKW A;  3TGZ A;  1V58 A;  2I9H A;  1OC8 A;  3TKQ A;  1SJZ A;  3M9J A;  2L59 A;  5B7C A;  2XHF A;  3F3Q A;  3D22 A;  5HQP A;  2K6V A;  2V1M A;  2PVQ A;  4OO4 A;  4XS6 A;  4AF2 A;  3GN3 A;  5G30 A;  4POL A;  2X8G A;  4DSQ A;  5HR3 A;  4IQA A;  4XS4 A;  5JWR B;  16GS A;  3IE3 A;  1GH2 A;  13GS A;  3O6T A;  2YJH A;  3ZMK A;  4XS1 A;  3KP8 A;  3CSH A;  4KDY A;  2IME A;  3C7M A;  2B5X A;  1V40 A;  1M2D A;  2LV3 A;  3W8S A;  3H93 A;  3LXT A;  3IOS A;  2FWG A;  4ZXG A;  2ZCT A;  1LJR A;  3IPZ A;  4AGS A;  4K6X A;  3BD2 A;  5IMD A;  4H86 A;  2RM5 A;  1T00 A;  2X8H A;  1QFN A;  2XBQ A;  4ML1 A;  2G2Q A;  2KP2 A;  1SL2 B;  3FRC A;  4JE1 A;  12GS A;  1GSY A;  2H71 A;  2AHE A;  1NHO A;  1R5P A;  1X5C A;  5D9V A;  14GS A;  2L4C A;  1DBY A;  4OMV A;  4V1A g;  2VUP A;  2HNL A;  2FUG 2;  4OO5 A;  1OC9 A;  3TKS E;  1K0O A;  3G7J A;  1SK0 A;  2C8U A;  1ZCP A;  2DJK A;  3ZL5 A;  2K8S A;  3CRU A;  3GKN A;  4AJ7 A;  4CW9 A;  1Q98 A;  4TVE A;  1T8E B;  2A2R A;  3E0U A;  4TW5 A;  1ZYQ B;  4JZQ A;  2IL3 A;  3DYR A;  1ZGN A;  3EWL A;  2VCQ A;  2FD3 A;  4NV5 A;  5D9T A;  1X9W B;  3QCP A;  4IP1 A;  3GTU B;  3WGE A;  2QC7 A;  3QD9 A;  3APO A;  1B8X A;  4CHS A;  1Z6M A;  3HDC A;  3I43 A;  1TI1 A;  2LQO A;  2MZC A;  5DCH A;  20GS A;  3ERW A;  5ELA A;  4XIH A;  4MF7 A;  1XZO A;  3ME7 A;  5KN1 A;  3F3R A;  1MD3 A;  2C0F A;  5C00 A;  1J9B A;  2AV4 A;  4DVC A;  2H1B A;  2VD0 A;  1I5G A;  3FR6 A;  2R2J A;  4JED A;  1A2J A;  4I2T A;  1YKC A;  2H0I A;  3GA4 A;  1G7O A;  4TR1 A;  4PGT A;  4I97 A;  3QFA C;  1X9M B;  3GKM A;  3VWV A;  4HI7 A;  2VL3 A;  2WFC A;  5D8I A;  3QR6 A;  1J0F A;  2AYT A;  3M1G A;  4GWR A;  1YEP A;  1O85 A;  2YN1 A;  5FT3 A;  3WD6 A;  2YCD A;  2VCV A;  2JL4 A;  5CYY A;  3VWU A;  2HYX A;  2IIY A;  4ZL7 A;  4YQM A;  1TOF A;  2NBS A;  2MYG A;  3FZ9 A;  1THO A;  4DSR A;  4NV2 A;  2DML A;  2KP1 A;  1OAZ A;  4WEY A;  1F3A A;  1K0D A;  4Q5N A;  4F82 A;  4K2D A;  5F8B A;  3DIE A;  2LTK A;  2HRF A;  4KX4 A;  1XBS A;  4WF5 A;  3APQ A;  2G0F A;  2GSQ A;  1XW6 A;  3ZTL A;  1GNE A;  3TDG A;  2GGT A;  3MSZ A;  4IGJ A;  4X0X A;  3P90 A;  5ECN B;  2HZE A;  3M9K A;  4IHU A;  1TU7 A;  4X43 A;  4Q5Q A;  5ABR A;  5IOW A;  1AAZ A;  2YWO A;  2GLR A;  3BCI A;  3OR5 A;  3ZFL A;  1N8J A;  2LNS A;  3DEX A;  1CQG A;  4YQU A;  6GSS A;  3ZLP A;  1PMT A;  1X5E A;  2O89 A;  1PA3 A;  5EPF A;  2H1D A;  2CX4 A;  4JU5 A;  1SK1 A;  1X9S B;  2R3X A;  3GFK A;  3KXO A;  3O76 A;  4NHW A;  5H5R A;  2VOC A;  1EGO A;  5CP1 A;  1TDI A;  5B6N A;  2L57 A;  5ECL B;  4ZB6 A;  8GSS A;  1ACV A;  2X99 A;  1THX A;  1SKW B;  1QK8 A;  1V9W A;  4AJ8 A;  3US3 A;  4BA7 A;  4MH3 A;  2CV4 A;  1BED A;  2O85 A;  1WWJ A;  1TK0 B;  2LEG A;  3GV1 A;  1SL0 B;  4YH2 A;  1TK5 B;  3RPN A;  3ISO A;  2FHE A;  2C3Q A;  4ECC A;  1EOH A;  5AIX A;  2VCW A;  3GHA A;  4KB3 A;  3TJG A;  2VLV A;  3MWH A;  1QMV A;  1K3Y A;  2X8C A;  2GDR A;  4ECJ A;  1M9B A;  2E7P A;  5G1L A;  1VGL A;  1R26 A;  2JU5 A;  1UA5 A;  2LST A;  4P3Y B;  5F06 A;  5ECH B;  5IMC A;  3RHC A;  6GSY A;  3RAZ A;  2JSZ A;  1XW5 A;  1JFU A;  4WR4 A;  1AW9 A;  2WUL A;  2GSS A;  1XXU A;  2K18 A;  5A4V A;  1EEM A;  1O8X A;  5EY6 A;  3W6G A;  5IQY A;  2H19 A;  5EL8 A;  1YEX A;  4ID0 A;  3CTG A;  3GSS A;  1HYU A;  1C72 A;  3PGT A;  2HE3 A;  1SL1 B;  3IA1 A;  1YQ1 A;  2WJU A;  4PQH A;  3RDW A;  1GSE A;  1SYX A;  3D21 A;  1V57 A;  3TJB A;  1YZX A;  3IHQ A;  3C8E A;  3EU4 A;  1IYH A;  17GS A;  3M3M A;  5KN0 A;  4E8H A;  1VF2 A;  2IMF A;  1JZD A;  1ZZY A;  5DAL A;  4I5Q A;  6GSX A;  5HR0 A;  1GSQ A;  3ZVJ A;  1CQH A;  1RK4 A;  2YJ7 A;  1Y6E A;  4HU7 A;  2VAF A;  1YY7 A;  2WB9 A;  1B9X C;  1FG4 A;  2IN3 A;  3GTU A;  2VCX A;  5ECP B;  3FY7 A;  2VM2 A;  3F6D A;  2ON5 A;  5E4W A;  2I81 A;  3V1W A;  4MLY A;  1XWA A;  2WS2 A;  4MJC A;  1Q4J A;  3RPP A;  1Y25 A;  2B3S A;  3HCZ A;  2J9H A;  1BAY A;  5CAX A;  4V2N A;  2JAC A;  1Z6N A;  2FA8 A;  4LLR A;  3U5R E;  3FZ5 A;  2R6K A;  2TRC P;  2DSA A;  1TI3 A;  1A8Y A;  2LQQ A;  2CZ2 A;  2GQL A;  1JZR A;  4HEA 2;  5JWQ B;  2V2G A;  2YV7 A;  1M0U A;  4TOP A;  2V6O A;  5DCG A;  3CSJ A;  3LYK A;  2VCT A;  1S3C A;  2OBK A;  2H1G A;  4GCI A;  3UVT A;  5JWO B;  2H75 A;  2O8V B;  2FY6 A;  3EMP A;  3F8U A;  3HJP A;  3NIV A;  4ILF A;  3ZRD A;  4OFM A;  3ZVJ D;  5DJL A;  1TXX A;  5IMF A;  3TJJ A;  2PBJ A;  2H72 A;  2MMO A;  1B4Q A;  3QAG A;  3IK7 A;  3UAP A;  3Q19 A;  4FYU A;  2O87 A;  4TXO B;  4GXZ A;  4V2L A;  1KBN A;  2GZY A;  3PR8 A;  1T1V A;  3KMN A;  3GKX A;  1WP0 A;  3I9V 2;  1QXH A;  3QPM A;  4NAX A;  1FOV A;  4NWY A;  2V32 A;  1XFL A;  2CX3 A;  4F9Z A;  2NDO A;  4K9Z A;  4POK A;  1H75 A;  3KP9 A;  3KH7 A;  5LNK e;  3DXB A;  2H6Y A;  4RUV A;  1TJD A;  5IMZ A;  3WT1 A;  2IWT A;  5DAK B;  3TRP A;  4HQS A;  5GAP D;  4KUN A;  1SJ6 A;  1T4Z A;  2BMX A;  3GRX A;  3L9S A;  3DWV A;  4OFT A;  4J56 E;  3LYP A;  5C04 A;  1GSU A;  1TRV A;  11GS A;  3HJO A;  2OAD A;  1BX9 A;  5AIS A;  1Z5Y E;  1A24 A;  4ULX A;  1YJ6 A;  2K8V A;  3HA9 A;  2CVB A;  3M8N A;  4EE0 A;  3FR3 A;  1OKT A;  1K3O A;  5FHI A;  5B6M A;  1GSD A;  2R4V A;  3F4T A;  4EF0 A;  3KJY A;  5ECR B;  4TR0 A;  2IMK A;  1PD2 1;  2DJ2 A;  4F0B A;  4XRA A;  1XPV A;  1A2M A;  4KCE A;  5G5E A;  3U6V A;  3HVV A;  3HJM A;  4JR6 A;  5J9B A;  3PIN A;  3TCO A;  3HY2 A;  4KE3 A;  4PUA A;  1OKD A;  3GUR A;  5B8B A;  1SU9 A;  2YP6 A;  3FHK A;  3IBH A;  1PGT A;  2EIR A;  4TKY A;  1YF1 A;  1KEB A;  1MDJ A;  2LKU A;  5DJM A;  4K7N A;  4ZL8 A;  19GS A;  1JZO A;  3I6A A;  1Z7R A;  4DSS B;  3EUR A;  2LRT A;  3KTL A;  4FIW A;  2DJ1 A;  1WJK A;  2HRN A;  3G7I A;  3KGK A;  18GS A;  1EEJ A;  4MF6 A;  3VI7 A;  3VPT A;  1K0B A;  3BJ5 A;  1G6W A;  1WE0 A;  3H4K A;  4MAB A;  1FAA A;  3C71 A;  6GSW A;  3ME8 A;  4MA9 A;  1UC7 A;  4GLT A;  2CVK A;  2H01 A;  3N5O A;  4LMW A;  1WRY A;  5D93 A;  2B7K A;  1N2A A;  1FO5 A;  1ERV A;  5G1K A;  1EV4 A;  1GUH A;  3MAK A;  4GQF A;  3C1S A;  4IW9 A;  1G7E A;  4RI6 A;  3CXG A;  2TRX A;  3HHV A;  2RII A;  1B4P A;  2H30 A;  3DGQ A;  3QFB C;  2QSI A;  1F6M C;  2DBC A;  2B7J A;  1A2L A;  2IFQ B;  2KUC A;  1O73 A;  2JSY A;  2VO4 A;  2LRC A;  4EDY A;  4ZBA A;  2AUV A;  1X0R A;  1OYJ A;  3KMO A;  3FKF A;  3P2A A;  4EUY A;  5IPG A;  1EP8 A;  4KA0 A;  3APS A;  2YNX A;  3IK9 A;  1TK8 B;  5JCW A;  4V2M A;  2PGT A;  3TRX A;  1XWC A;  1MDI A;  3ERG A;  3F4S A;  4RQX A;  4KDX A;  4PX1 A;  2EC4 A;  1PQN A;  4YAP A;  5DDL A;  3VFI A;  3W8J A;  4OFN A;  1FB6 A;  4WBJ A;  2GSR A;  2XPE A;  2ZUP A;  3FR9 A;  4LA1 A;  3IV4 A;  2LNT A;  4KSO A;  1HNC A;  4BL7 A;  2MBS A;  5ENU A;  1GLQ A;  2OA7 A;  3R2Q A;  3TKS C;  5J9C A;  1AQV A;  2DIY A;  5A5K A;  1GTU A;  5B8A A;  4L0U A;  3EC3 A;  3LEF A;  1A8L A;  4FO5 A;  3RBT A;  3ZYW A;  3TKR A;  3UIW A;  5J41 A;  5ECK B;  4WBR D;  5F07 A;  1M9A A;  5ID2 B;  2YAN A;  4GTU A;  4POB A;  4JRR A;  5JCU A;  2BTO T;  2JAD A;  3K8N A;  2YWM A;  2FGX A;  4POM A;  3F0I A;  4ECI A;  4O32 A;  3TRQ A;  4K0G A;  4N10 A;  1XOB A;  1K3L A;  4MCU A;  3FZ4 A;  3ED3 A;  1HD2 A;  1XWK A;  2H6X A;  1T3B A;  1AC1 A;  3FZA A;  1ML6 A;  2ES7 A;  2FWF A;  2H8L A; 
#chains in the Genus database with same CATH topology
 2BJX A;  3ERF A;  2V41 A;  4V1A p;  2HSH A;  3C1R A;  4JR4 A;  1SK2 A;  3GX8 A;  4ZIJ A;  4XHM A;  4YAV A;  4L5L A;  2C4J A;  1DE1 A;  2C0D A;  1PX7 A;  4LL4 B;  5H5S A;  3EMX A;  1B9Y C;  2HT9 A;  1V98 A;  2A2S A;  4I8B A;  4D73 B;  1HNA A;  2C0G A;  1G0T A;  2GZZ A;  5D9X A;  5DAK A;  1JZW A;  2H6Z A;  1SD9 A;  3ZFB A;  1SEN A;  2L5L A;  1PRX A;  5HR2 A;  3L4N A;  3S9F A;  2GZP A;  5E59 A;  3HXS A;  3HZ4 A;  2F9S A;  2OKA A;  1M3J A;  1URM A;  1SYR A;  3GIX A;  4EC0 A;  1KTE A;  3IXR A;  1M2B A;  5KEJ A;  1LU4 A;  4TR3 A;  3SBC A;  3GX0 A;  2R0P A;  4EKZ A;  3D0Z A;  3GH9 A;  2VL2 C;  2DC5 A;  1RQM A;  1YF0 A;  3GL3 A;  2KOK A;  2LRN A;  2FCH A;  2R0G A;  5A4U A;  4EL1 A;  3LSZ A;  1GUM A;  2PWJ A;  3EE2 A;  2H66 A;  3CQF A;  2L6D A;  4A5P A;  2J23 A;  3BOA A;  1PN9 A;  1R5A A;  1GNW A;  1SJI A;  10GS A;  1F2E A;  5GZZ B;  3HZ8 A;  4HZ2 A;  4GF0 A;  3D5J A;  4X4J A;  4F2I A;  2B5E A;  22GS A;  3HVX A;  1W89 A;  2HZF A;  3KZQ A;  1GSF A;  1X5D A;  4Z2U A;  2FLS A;  2C3T A;  4DSS A;  4MJA A;  4L8E A;  2YZH A;  2EIQ A;  1JHB A;  2B5Y A;  2V6K A;  2P5Q A;  4N11 A;  1SD8 A;  3KTB A;  1XVW A;  2OAC A;  4ZB8 A;  1U88 A;  4O92 A;  3IAM 2;  5CRW A;  1GTA A;  2CA8 A;  4MMM A;  2QKE A;  1E2Y A;  4BVY A;  5KN2 A;  4EVM A;  5IM9 A;  3GL5 A;  1EWX A;  1ERT A;  4MPG A;  5ECI B;  3FK8 A;  3VWW A;  2L6C A;  3A5W A;  4PUF C;  1Z9H A;  2F8A A;  5AGY A;  3VUR A;  2IFQ A;  5HFG A;  5F05 A;  1AQX A;  3GUS A;  1PSQ A;  5HFK A;  2RLI A;  1TU8 A;  2VL2 A;  3CSI A;  3P8W A;  4HQZ A;  2F51 A;  4KAE A;  2QGV A;  3JCM L;  1ZMA A;  2C1Y A;  4WR5 A;  4ZL9 A;  1USB A;  1GTB A;  2HI7 A;  5D96 A;  2R0C A;  5J3R A;  4G0L A;  4WXT A;  3N9J A;  3TOT A;  3UVH A;  2H1A A;  1DSB A;  4OCE A;  4GST A;  1IYI A;  1M2A A;  2E2G A;  3CYN A;  1TRW A;  1HQO A;  3VK9 A;  2N5F A;  1SKS B;  2DMM A;  4EO3 A;  4MK3 A;  3HD5 A;  4MPF A;  1GUL A;  3F6F A;  4NXI A;  5FWG A;  3QDN A;  1XOA A;  5EVO A;  4LL1 B;  4MJE A;  3HKR A;  3UMA A;  1ILO A;  4ECB A;  2CT6 A;  2HLS A;  2NPB A;  1TTZ A;  4PTS A;  4YKF A;  3QMX A;  2PUK C;  3IC4 A;  2P5R A;  4K7I A;  1O7U A;  2EIO A;  3ZIV A;  3GMF A;  2H73 A;  3WT2 A;  2HSM A;  5AIV A;  1ERU A;  3NOF A;  2N5A A;  2Z9S A;  3A2V A;  3BCK A;  4HS1 A;  2MBT A;  4IEL A;  5IOX A;  2AJQ B;  3LQ7 A;  2TIR A;  3LGC A;  1MTC A;  3EU3 A;  4ZBD A;  3D4T A;  2JZR A;  3DVW A;  1S3D A;  1ZYE A;  1AIU A;  4IS0 A;  3KEB A;  1TRS A;  4KSM A;  3CTF A;  3CMI A;  1ERW A;  3E9J B;  1PKZ A;  4FYC A;  2MMA A;  1OE7 A;  3CBU A;  1LBK A;  2VCZ A;  9GSS A;  1E6B A;  2PU9 C;  4MF5 A;  5IPH A;  4O5R A;  3IHG A;  2HRA A;  1WMJ A;  2K9F A;  4TN8 A;  2CAI A;  4NMU A;  5HFI A;  3IR4 A;  4EXJ A;  1DE2 A;  2I1U A;  3F9U A;  1RW1 A;  4D73 A;  1MEK A;  3O3T A;  1R7H A;  4K1F A;  4HU9 A;  4K8M A;  5GST A;  6GSU A;  2KLX A;  5CRG A;  5GAN D;  4ZB9 A;  3L78 A;  1G6Y A;  2ZNM A;  5AN1 A;  4HSC X;  3LJR A;  4Z7X A;  3D6I A;  6GSV A;  2VLU A;  1TP9 A;  2REM A;  3G9B A;  3KM6 A;  3TUE A;  2PMT A;  1T7P B;  5J4U A;  2VLT A;  2C80 A;  1U3I A;  2C0E A;  3TB2 A;  4MP4 A;  4JBB A;  4Q5F A;  4DEJ A;  2I4A A;  4IKH A;  4CDO A;  3QOU A;  2CZ3 A;  3F4R A;  3UBK A;  2B1L A;  2DJ3 A;  2LS5 A;  1OC3 A;  2PVO C;  2HFD A;  3GNJ A;  5DVB A;  4G2E A;  1U87 A;  3H79 A;  3Q74 A;  3R3E A;  5L71 A;  1GUK A;  1VRS D;  4BVX A;  2LJR A;  5DAL B;  2LJA A;  3C73 A;  4ZIL A;  2MMN A;  4IVF A;  1U6T A;  3AY8 A;  4L5O A;  1QUW A;  2E2M A;  2GVP A;  3A3T A;  2P31 A;  3HVN A;  2XBI A;  2AB6 A;  3D4M A;  1ST9 A;  3LFL A;  3Q18 A;  2WGR A;  2XPD A;  7GSS A;  1EOG A;  4KH7 A;  1GL8 A;  4TXV A;  5INY A;  1GLP A;  1M7T A;  4N0V A;  1F9M A;  3L9U A;  5CRH A;  5G31 A;  1R4W A;  2ON7 A;  3EIN A;  1VF3 A;  1FVJ A;  1WOU A;  3MNG A;  2DLX A;  3UJ1 A;  4IJ3 A;  1TKD B;  1VF1 A;  2H76 A;  4PQ1 A;  2X64 A;  4PNF A;  1B48 A;  2CQ9 A;  3FMW A;  1W4V A;  2H0H A;  1VF4 A;  3ZML A;  1K0N A;  1NHY A;  3LXZ A;  3GKK A;  2IJY A;  2JZS A;  3A2W A;  2RM6 A;  1O6J A;  2WDU A;  3EVI A;  4F0C A;  1Z3E A;  1NW2 A;  2AAW A;  2WZ9 A;  3UOM A;  3BBY A;  1HNB A;  4TR4 A;  4KCA A;  4ZBB A;  2ALB A;  3TKP A;  4EDZ A;  2DIZ A;  1ZYN A;  4ACS A;  4K0N A;  1MDK A;  3WGX A;  5IMV A;  1GWC A;  4LMV A;  2R5G A;  5ELG A;  5DBQ A;  4O7H A;  5G2Z A;  4N0Z A;  1XWB A;  1XVQ A;  2NTO A;  4IBP A;  4RQR A;  2C3N A;  4ISD A;  1NM3 A;  4GQC A;  4FYB A;  3DKS A;  3ZIJ A;  4IJI A;  1K0M A;  4NPB A;  3TJK A;  3HYP A;  3UBL A;  1ABA A;  3E3E A;  1A23 A;  5IIZ A;  1PKW A;  2B6M A;  4I2U A;  1K0A A;  4PNG A;  3QAW A;  1BG5 A;  4HJ2 A;  2GT6 A;  4TXO A;  1XW9 A;  1K0C A;  3GH6 A;  2N5B A;  2OJL A;  5KN3 A;  1GSS A;  1MD4 A;  1O81 A;  4KND A;  2HSY A;  3KD0 A;  4G19 A;  3KIJ A;  5LD0 A;  1BYE A;  3SWL A;  3KH9 A;  2KHP A;  4KGI A;  2XC2 A;  3WYW A;  3I69 A;  4L0W A;  3TOU A;  4HUA A;  5CNW A;  1F37 A;  2M72 A;  3Q6O A;  1DUG A;  2OE3 A;  2FA4 A;  4BPY A;  2HXK A;  3L0H A;  1JLV A;  4GSS A;  1PL1 A;  4CY8 A;  2LJK A;  4XS4 B;  2X49 A;  4OWY A;  3IRA A;  5GSS A;  2B1K A;  3VLN A;  2VL9 A;  4FH8 A;  1WIK A;  1EZK A;  3TJF A;  4QL9 A;  3LOR A;  4BWS A;  5LCZ A;  1OVN A;  4MZC A;  4I6X A;  4IN0 A;  4PXO A;  4MDC A;  3P7X A;  1GP1 A;  2GS3 A;  4EIQ A;  1EV9 A;  3PH9 A;  2WCI A;  2VD1 A;  2YPM A;  3DML A;  3TKS A;  1WPI A;  3FYG A;  5CRD A;  3MDK A;  1AQW A;  4KDU A;  4F03 A;  3A2X A;  1O8W A;  4WF4 A;  2YOI A;  2LUS A;  4QQ7 A;  1UN2 A;  2F8F A;  4MH2 A;  2E0Q A;  4MZB A;  3DD3 A;  5ECQ B;  1BJX A;  3IAS 2;  3J7Y k;  3FW2 A;  3FEU A;  4XCS A;  2IMI A;  2GQK A;  2DJ0 A;  1F3B A;  4MZW A;  4J2F A;  1AXD A;  3H1N A;  4J57 E;  2H70 A;  1OC9 B;  1PX6 A;  1S3A A;  4QL7 A;  2PPT A;  5G5F A;  1YKA A;  4NHZ A;  2R37 A;  5IO0 A;  2QA1 A;  2YZU A;  3UEM A;  3WGD A;  1XCC A;  1GTI A;  5CRE A;  1SKR B;  2OE1 A;  2VM1 A;  1ZL9 A;  4O5Q A;  3M0F A;  2GST A;  1ZOF A;  5H5Q A;  2FWH A;  2CAQ A;  3F63 A;  1BQ7 A;  1NSW A;  4YQV A;  2JZT A;  1ON4 A;  2UZ8 A;  4KW6 A;  2A4V A;  3QAV A;  2FNO A;  2PER A;  1M3I A;  5CO3 A;  4XTS A;  2OBI A;  1XWG A;  4GSN A;  5COH A;  1TW9 A;  3HVS A;  3VI5 A;  3GYK A;  4AJ6 A;  3G7Y A;  5A4W A;  2RUF A;  5D73 A;  4BWQ A;  5D9W A;  3LWA A;  3NZN A;  3VPQ A;  1Z7P A;  3CRT A;  2YWI A;  1QQ2 A;  4ML6 A;  4PUR A;  3KCM A;  2I3Y A;  4WET A;  4K5R A;  4MJB A;  2L4Q A;  5DQY A;  3J7Y b;  4TR1 B;  1EGR A;  1PN0 A;  4HDE A;  2GQM A;  1J08 A;  2HRK A;  1V2A A;  3UAR A;  4BIK A;  1U3A A;  1T4Y A;  1H4O A;  2GTU A;  1M99 A;  2IMD A;  2NVL A;  2O7K A;  5IO2 A;  4K5S A;  1FW1 A;  2WRT A;  3EYT A;  2YV9 A;  5IMA A;  1FB0 A;  4GRF A;  2H0G A;  4TRX A;  5ECS A;  4IP6 A;  2YWN A;  4OCF A;  1FHE A;  4HJM A;  2D2Z A;  4N30 A;  1I9D A;  3RHB A;  3IDV A;  2F3M A;  2H74 A;  3ZIT A;  1FVK A;  2CVD A;  4G10 A;  3DVX A;  4RI7 A;  2P0G A;  3IC8 A;  1XIY A;  2RUE A;  2FWE A;  4X1U A;  3GST A;  4HOJ A;  1QGV A;  4HZ4 A;  1A0R P;  2M46 A;  1A0F A;  1EP7 A;  3L9V A;  2DJJ A;  3DRN A;  2IPA A;  4XRD A;  4PQI A;  2PN8 A;  1KNG A;  1UVZ A;  2L5O A;  3UL3 A;  1YDK A;  1PL2 A;  3H8Q A;  2HZE B;  1TRU A;  3ZZX A;  1JLW A;  4OD7 A;  4K7O A;  5F0G A;  1GRX A;  3VWX A;  5ECM B;  2OE0 A;  5ID2 A;  4IQ1 A;  1XG8 A;  5DQS A;  4E8E A;  5JCG A;  2M80 A;  2VIM A;  4G9H A;  3ZRE A;  6GST A;  1OE8 A;  5ECO B;  1PFO A;  4Q5R A;  5HR1 A;  2GT5 A;  2MMZ A;  5J5N A;  3LG6 A;  1AUC A;  4WKW A;  3TGZ A;  1V58 A;  2I9H A;  1OC8 A;  4Z2R A;  3TKQ A;  1SJZ A;  3M9J A;  2L59 A;  5B7C A;  2XHF A;  3F3Q A;  3D22 A;  3EPT A;  2K6V A;  5HQP A;  2V1M A;  2PVQ A;  4OO4 A;  4XS6 A;  4AF2 A;  4FQU A;  3GN3 A;  5G30 A;  4POL A;  2X8G A;  4DSQ A;  4Z2T A;  5HR3 A;  4IQA A;  4XS4 A;  5JWR B;  16GS A;  3IE3 A;  1GH2 A;  13GS A;  3O6T A;  2YJH A;  3ZMK A;  4XS1 A;  3KP8 A;  3CSH A;  4KDY A;  1FOH A;  2IME A;  3C7M A;  2B5X A;  1V40 A;  1M2D A;  2LV3 A;  3W8S A;  3H93 A;  3LXT A;  3IOS A;  2FWG A;  4ZXG A;  2ZCT A;  1LJR A;  3IPZ A;  4AGS A;  4K6X A;  3BD2 A;  5IMD A;  4H86 A;  2RM5 A;  1T00 A;  2X8H A;  1QFN A;  2XBQ A;  4ML1 A;  2G2Q A;  2KP2 A;  1SL2 B;  3FRC A;  4JE1 A;  12GS A;  1GSY A;  2H71 A;  2AHE A;  1NHO A;  1R5P A;  1X5C A;  5D9V A;  14GS A;  2L4C A;  1DBY A;  4MNN A;  4OMV A;  4V1A g;  2VUP A;  2HNL A;  2FUG 2;  4OO5 A;  1OC9 A;  3TKS E;  1K0O A;  3G7J A;  1SK0 A;  2C8U A;  1ZCP A;  2DJK A;  3ZL5 A;  2K8S A;  3CRU A;  3GKN A;  4AJ7 A;  4CW9 A;  1Q98 A;  4TVE A;  1T8E B;  2A2R A;  3E0U A;  4TW5 A;  1ZYQ B;  4JZQ A;  2IL3 A;  3DYR A;  1ZGN A;  3EWL A;  2VCQ A;  2FD3 A;  4NV5 A;  5D9T A;  1X9W B;  3QCP A;  4IP1 A;  3GTU B;  3WGE A;  2QC7 A;  3QD9 A;  3APO A;  1B8X A;  4CHS A;  1Z6M A;  3HDC A;  3I43 A;  1TI1 A;  2LQO A;  2MZC A;  5DCH A;  20GS A;  3ERW A;  5ELA A;  4ICY A;  4XIH A;  4MF7 A;  1XZO A;  3ME7 A;  3MYD A;  5KN1 A;  3F3R A;  1MD3 A;  2C0F A;  5C00 A;  1J9B A;  2AV4 A;  4DVC A;  2H1B A;  2VD0 A;  1I5G A;  3FR6 A;  2R2J A;  4JED A;  1A2J A;  4I2T A;  1YKC A;  2H0I A;  3GA4 A;  1G7O A;  4TR1 A;  4PGT A;  4I97 A;  3QFA C;  1X9M B;  3GKM A;  3VWV A;  4HI7 A;  2VL3 A;  2WFC A;  5D8I A;  3QR6 A;  1J0F A;  2AYT A;  3M1G A;  4GWR A;  1YEP A;  1O85 A;  2YN1 A;  5FT3 A;  3WD6 A;  2YCD A;  2VCV A;  2JL4 A;  5CYY A;  3VWU A;  4G0K A;  2HYX A;  2IIY A;  4ZL7 A;  4YQM A;  1TOF A;  2NBS A;  2MYG A;  3FZ9 A;  1THO A;  4DSR A;  4NV2 A;  2DML A;  2KP1 A;  2A2P A;  1OAZ A;  3MIX A;  4WEY A;  4EIP A;  1F3A A;  1K0D A;  4Q5N A;  4F82 A;  4K2D A;  5F8B A;  3DIE A;  2LTK A;  2HRF A;  4KX4 A;  1XBS A;  4WF5 A;  3APQ A;  2G0F A;  2GSQ A;  1XW6 A;  3ZTL A;  1GNE A;  3TDG A;  2GGT A;  3MSZ A;  4IGJ A;  4X0X A;  3P90 A;  5ECN B;  2HZE A;  3M9K A;  4IHU A;  1TU7 A;  4X43 A;  4Q5Q A;  5ABR A;  5IOW A;  1AAZ A;  2YWO A;  2GLR A;  3BCI A;  3OR5 A;  3ZFL A;  1N8J A;  2LNS A;  3DEX A;  1CQG A;  4YQU A;  6GSS A;  3ZLP A;  1PMT A;  1X5E A;  2DKI A;  1PA3 A;  2O89 A;  2H1D A;  5EPF A;  2CX4 A;  4JU5 A;  1SK1 A;  1X9S B;  2R3X A;  3GFK A;  3KXO A;  3O76 A;  4NHW A;  5H5R A;  2VOC A;  1EGO A;  5CP1 A;  1TDI A;  5B6N A;  2L57 A;  5ECL B;  4ZB6 A;  8GSS A;  1ACV A;  2X99 A;  1THX A;  1SKW B;  1QK8 A;  1V9W A;  4AJ8 A;  3US3 A;  4BA7 A;  4MH3 A;  2CV4 A;  1BED A;  2O85 A;  1WWJ A;  1TK0 B;  2LEG A;  3GV1 A;  1SL0 B;  4YH2 A;  1TK5 B;  3RPN A;  3ISO A;  2FHE A;  2C3Q A;  4ECC A;  1EOH A;  5AIX A;  2A4H A;  2VCW A;  3GHA A;  4KB3 A;  3TJG A;  2VLV A;  3MWH A;  1QMV A;  1K3Y A;  2X8C A;  2GDR A;  4ECJ A;  5KOX A;  1M9B A;  2E7P A;  5G1L A;  1VGL A;  1R26 A;  4CY6 A;  2JU5 A;  1UA5 A;  2LST A;  4P3Y B;  5F06 A;  5ECH B;  5IMC A;  3RHC A;  6GSY A;  3RAZ A;  2JSZ A;  1XW5 A;  1JFU A;  4WR4 A;  1AW9 A;  2WUL A;  2GSS A;  1XXU A;  2K18 A;  5A4V A;  3LW9 A;  1EEM A;  1O8X A;  5EY6 A;  3W6G A;  4BVX B;  5IQY A;  2H19 A;  5EL8 A;  1YEX A;  4ID0 A;  3CTG A;  3GSS A;  1HYU A;  1C72 A;  3PGT A;  2HE3 A;  1SL1 B;  3IA1 A;  1YQ1 A;  2WJU A;  4PQH A;  3RDW A;  1GSE A;  1SYX A;  3D21 A;  1V57 A;  3TJB A;  1YZX A;  3IHQ A;  3C8E A;  3EU4 A;  1IYH A;  17GS A;  3M3M A;  5KN0 A;  4E8H A;  1VF2 A;  2IMF A;  1JZD A;  1ZZY A;  5DAL A;  4I5Q A;  6GSX A;  5HR0 A;  1GSQ A;  3ZVJ A;  1CQH A;  1RK4 A;  2YJ7 A;  1Y6E A;  4HU7 A;  2VAF A;  1YY7 A;  5BMU A;  2WB9 A;  1B9X C;  1FG4 A;  2IN3 A;  5KOW A;  3GTU A;  2VCX A;  5ECP B;  3FY7 A;  2VM2 A;  3F6D A;  2ON5 A;  5E4W A;  2I81 A;  3V1W A;  4MLY A;  1XWA A;  2WS2 A;  4MJC A;  1Q4J A;  3RPP A;  1Y25 A;  2B3S A;  3HCZ A;  2J9H A;  4BL7 B;  1BAY A;  5CAX A;  4V2N A;  2JAC A;  1Z6N A;  3PPU A;  2FA8 A;  4LLR A;  3U5R E;  3FZ5 A;  2R6K A;  2TRC P;  2DSA A;  1TI3 A;  1A8Y A;  2LQQ A;  2CZ2 A;  2GQL A;  4O5U A;  1JZR A;  4HEA 2;  5JWQ B;  3A5I A;  2V2G A;  2YV7 A;  1M0U A;  4TOP A;  2V6O A;  5DCG A;  3CSJ A;  3LYK A;  2VCT A;  1S3C A;  2OBK A;  2H1G A;  4GCI A;  3UVT A;  5JWO B;  2H75 A;  2O8V B;  2FY6 A;  3EMP A;  3F8U A;  5BRT A;  3HJP A;  3NIV A;  4ILF A;  3ZRD A;  4OFM A;  3ZVJ D;  5DJL A;  1TXX A;  5IMF A;  3TJJ A;  2PBJ A;  2H72 A;  2MMO A;  1B4Q A;  3QAG A;  3IK7 A;  3UAP A;  3Q19 A;  4FYU A;  2O87 A;  4TXO B;  4GXZ A;  4V2L A;  1KBN A;  2GZY A;  3PR8 A;  1T1V A;  3KMN A;  3GKX A;  1WP0 A;  3I9V 2;  1QXH A;  3QPM A;  4NAX A;  1FOV A;  4NWY A;  4K2X A;  2V32 A;  1XFL A;  2CX3 A;  4F9Z A;  2NDO A;  4K9Z A;  4POK A;  1H75 A;  3KP9 A;  3KH7 A;  5LNK e;  3DXB A;  2H6Y A;  4RUV A;  1TJD A;  5IMZ A;  3WT1 A;  2IWT A;  5DAK B;  3TRP A;  4HQS A;  5GAP D;  4KUN A;  1SJ6 A;  1T4Z A;  2BMX A;  3GRX A;  3L9S A;  3DWV A;  4OFT A;  4J56 E;  3LYP A;  5C04 A;  1GSU A;  1TRV A;  11GS A;  3HJO A;  2OAD A;  1BX9 A;  5AIS A;  1Z5Y E;  1A24 A;  4ULX A;  1YJ6 A;  2K8V A;  3HA9 A;  2CVB A;  3M8N A;  4EE0 A;  3FR3 A;  1OKT A;  1K3O A;  5FHI A;  5B6M A;  1GSD A;  2R4V A;  3F4T A;  4EF0 A;  3KJY A;  5ECR B;  4TR0 A;  2IMK A;  1PD2 1;  2DJ2 A;  4F0B A;  4XRA A;  1XPV A;  1A2M A;  4KCE A;  5G5E A;  3U6V A;  3HVV A;  4YKG A;  3HJM A;  4JR6 A;  5J9B A;  3PIN A;  3TCO A;  3HY2 A;  4KE3 A;  4PUA A;  1OKD A;  3GUR A;  5B8B A;  1SU9 A;  2YP6 A;  3FHK A;  3IBH A;  1PGT A;  2EIR A;  4TKY A;  1YF1 A;  1KEB A;  1MDJ A;  2LKU A;  5DJM A;  4K7N A;  4ZL8 A;  19GS A;  1JZO A;  3I6A A;  1Z7R A;  4DSS B;  3EUR A;  2LRT A;  3KTL A;  4FIW A;  2DJ1 A;  1WJK A;  2HRN A;  3G7I A;  3KGK A;  18GS A;  1EEJ A;  4MF6 A;  3VI7 A;  3VPT A;  1K0B A;  3BJ5 A;  1G6W A;  1WE0 A;  3H4K A;  4MAB A;  1FAA A;  3C71 A;  6GSW A;  3ME8 A;  4MA9 A;  1UC7 A;  4GLT A;  2CVK A;  2H01 A;  3N5O A;  4LMW A;  4BVY B;  1WRY A;  5D93 A;  2B7K A;  1N2A A;  2X4A A;  1FO5 A;  1ERV A;  5G1K A;  1EV4 A;  1GUH A;  3MAK A;  4GQF A;  3C1S A;  4IW9 A;  1G7E A;  4RI6 A;  3CXG A;  2TRX A;  3HHV A;  2RII A;  1B4P A;  2H30 A;  3DGQ A;  3QFB C;  2QSI A;  1F6M C;  2DBC A;  4KF9 A;  1ZYP A;  2B7J A;  1A2L A;  2IFQ B;  2DKH A;  2KUC A;  1O73 A;  2JSY A;  2VO4 A;  4G0I A;  2LRC A;  4EDY A;  4ZBA A;  2AUV A;  1X0R A;  1OYJ A;  3KMO A;  3FKF A;  3P2A A;  4EUY A;  5IPG A;  1EP8 A;  4KA0 A;  3APS A;  2YNX A;  3IK9 A;  1TK8 B;  5JCW A;  4V2M A;  2PGT A;  3TRX A;  1XWC A;  1MDI A;  4USS A;  3ERG A;  3F4S A;  4RQX A;  4KDX A;  4PX1 A;  2EC4 A;  1PQN A;  4YAP A;  5DDL A;  3VFI A;  3W8J A;  4OFN A;  1FB6 A;  4WBJ A;  2GSR A;  2XPE A;  2ZUP A;  3FR9 A;  4LA1 A;  3IV4 A;  2LNT A;  4KSO A;  1HNC A;  4BL7 A;  2MBS A;  5ENU A;  1GLQ A;  2OA7 A;  3R2Q A;  3TKS C;  5J9C A;  1AQV A;  2DIY A;  5A5K A;  1GTU A;  5B8A A;  4L0U A;  3EC3 A;  3LEF A;  1A8L A;  4FO5 A;  3RBT A;  3ZYW A;  3TKR A;  3UIW A;  5J41 A;  5ECK B;  4WBR D;  5F07 A;  1M9A A;  5ID2 B;  2YAN A;  4GTU A;  4POB A;  4JRR A;  5JCU A;  2BTO T;  2JAD A;  2QA2 A;  3K8N A;  2YWM A;  2FGX A;  4POM A;  3F0I A;  4ECI A;  4O32 A;  3TRQ A;  4K0G A;  4N10 A;  1XOB A;  1K3L A;  4MCU A;  1S3R A;  3FZ4 A;  3ED3 A;  1HD2 A;  1XWK A;  2H6X A;  1T3B A;  1AC1 A;  3FZA A;  1ML6 A;  2ES7 A;  2FWF A;  2H8L A; 
#chains in the Genus database with same CATH homology
 2BJX A;  3ERF A;  2V41 A;  4V1A p;  2HSH A;  3C1R A;  4JR4 A;  1SK2 A;  3GX8 A;  4ZIJ A;  4XHM A;  4YAV A;  4L5L A;  2C4J A;  1DE1 A;  2C0D A;  1PX7 A;  4LL4 B;  5H5S A;  3EMX A;  1B9Y C;  2HT9 A;  1V98 A;  2A2S A;  4I8B A;  4D73 B;  1HNA A;  2C0G A;  1G0T A;  2GZZ A;  5D9X A;  5DAK A;  1JZW A;  2H6Z A;  1SD9 A;  3ZFB A;  1SEN A;  2L5L A;  1PRX A;  5HR2 A;  3L4N A;  3S9F A;  2GZP A;  5E59 A;  3HXS A;  3HZ4 A;  2F9S A;  2OKA A;  1URM A;  1SYR A;  3GIX A;  4EC0 A;  1KTE A;  3IXR A;  1M2B A;  5KEJ A;  1LU4 A;  4TR3 A;  3SBC A;  3GX0 A;  2R0P A;  4EKZ A;  3D0Z A;  3GH9 A;  2VL2 C;  2DC5 A;  1RQM A;  1YF0 A;  3GL3 A;  2KOK A;  2LRN A;  2FCH A;  2R0G A;  5A4U A;  4EL1 A;  3LSZ A;  1GUM A;  2PWJ A;  3EE2 A;  2H66 A;  2L6D A;  4A5P A;  2J23 A;  3BOA A;  1PN9 A;  1R5A A;  1GNW A;  1SJI A;  10GS A;  1F2E A;  5GZZ B;  3HZ8 A;  4HZ2 A;  4GF0 A;  3D5J A;  4X4J A;  4F2I A;  2B5E A;  22GS A;  3HVX A;  1W89 A;  2HZF A;  3KZQ A;  1GSF A;  1X5D A;  4Z2U A;  2FLS A;  2C3T A;  4DSS A;  4MJA A;  4L8E A;  2YZH A;  2EIQ A;  1JHB A;  2B5Y A;  2V6K A;  2P5Q A;  4N11 A;  1SD8 A;  3KTB A;  1XVW A;  2OAC A;  4ZB8 A;  1U88 A;  4O92 A;  3IAM 2;  5CRW A;  1GTA A;  2CA8 A;  4MMM A;  2QKE A;  1E2Y A;  4BVY A;  5KN2 A;  4EVM A;  5IM9 A;  3GL5 A;  1EWX A;  1ERT A;  4MPG A;  5ECI B;  3FK8 A;  3VWW A;  2L6C A;  3A5W A;  4PUF C;  1Z9H A;  2F8A A;  5AGY A;  3VUR A;  2IFQ A;  5HFG A;  5F05 A;  1AQX A;  3GUS A;  1PSQ A;  5HFK A;  2RLI A;  1TU8 A;  2VL2 A;  3CSI A;  3P8W A;  4HQZ A;  2F51 A;  4KAE A;  2QGV A;  3JCM L;  1ZMA A;  2C1Y A;  4WR5 A;  4ZL9 A;  1USB A;  1GTB A;  2HI7 A;  5D96 A;  2R0C A;  5J3R A;  4G0L A;  4WXT A;  3N9J A;  3TOT A;  3UVH A;  2H1A A;  1DSB A;  4OCE A;  4GST A;  1IYI A;  1M2A A;  2E2G A;  3CYN A;  1TRW A;  1HQO A;  3VK9 A;  2N5F A;  1SKS B;  2DMM A;  4EO3 A;  4MK3 A;  3HD5 A;  4MPF A;  1GUL A;  3F6F A;  4NXI A;  5FWG A;  3QDN A;  1XOA A;  5EVO A;  4LL1 B;  4MJE A;  3HKR A;  3UMA A;  1ILO A;  4ECB A;  2CT6 A;  2HLS A;  2NPB A;  1TTZ A;  4PTS A;  4YKF A;  3QMX A;  2PUK C;  3IC4 A;  2P5R A;  4K7I A;  1O7U A;  2EIO A;  3ZIV A;  3GMF A;  2H73 A;  3WT2 A;  2HSM A;  5AIV A;  1ERU A;  3NOF A;  2N5A A;  2Z9S A;  3A2V A;  3BCK A;  4HS1 A;  2MBT A;  4IEL A;  5IOX A;  2AJQ B;  3LQ7 A;  2TIR A;  3LGC A;  1MTC A;  3EU3 A;  4ZBD A;  3D4T A;  2JZR A;  3DVW A;  1S3D A;  1ZYE A;  1AIU A;  4IS0 A;  3KEB A;  1TRS A;  4KSM A;  3CTF A;  3CMI A;  1ERW A;  3E9J B;  1PKZ A;  4FYC A;  2MMA A;  1OE7 A;  3CBU A;  1LBK A;  2VCZ A;  9GSS A;  1E6B A;  2PU9 C;  4MF5 A;  5IPH A;  4O5R A;  3IHG A;  2HRA A;  1WMJ A;  2K9F A;  4TN8 A;  2CAI A;  4NMU A;  5HFI A;  3IR4 A;  4EXJ A;  1DE2 A;  2I1U A;  3F9U A;  1RW1 A;  4D73 A;  1MEK A;  3O3T A;  1R7H A;  4K1F A;  4HU9 A;  4K8M A;  5GST A;  6GSU A;  2KLX A;  5CRG A;  5GAN D;  4ZB9 A;  3L78 A;  1G6Y A;  2ZNM A;  5AN1 A;  3LJR A;  4Z7X A;  3D6I A;  6GSV A;  2VLU A;  1TP9 A;  2REM A;  3G9B A;  3KM6 A;  3TUE A;  2PMT A;  1T7P B;  5J4U A;  2VLT A;  2C80 A;  1U3I A;  2C0E A;  3TB2 A;  4MP4 A;  4JBB A;  4Q5F A;  4DEJ A;  2I4A A;  4IKH A;  4CDO A;  3QOU A;  2CZ3 A;  3F4R A;  3UBK A;  2B1L A;  2DJ3 A;  2LS5 A;  1OC3 A;  2PVO C;  2HFD A;  3GNJ A;  5DVB A;  4G2E A;  1U87 A;  3H79 A;  3Q74 A;  3R3E A;  5L71 A;  1GUK A;  1VRS D;  4BVX A;  2LJR A;  5DAL B;  2LJA A;  3C73 A;  4ZIL A;  2MMN A;  4IVF A;  1U6T A;  3AY8 A;  4L5O A;  1QUW A;  2E2M A;  2GVP A;  3A3T A;  2P31 A;  2XBI A;  2AB6 A;  3D4M A;  1ST9 A;  3LFL A;  3Q18 A;  2WGR A;  2XPD A;  7GSS A;  1EOG A;  4KH7 A;  1GL8 A;  4TXV A;  5INY A;  1GLP A;  1M7T A;  4N0V A;  1F9M A;  3L9U A;  5CRH A;  5G31 A;  1R4W A;  2ON7 A;  3EIN A;  1VF3 A;  1FVJ A;  1WOU A;  3MNG A;  2DLX A;  3UJ1 A;  4IJ3 A;  1TKD B;  1VF1 A;  2H76 A;  4PQ1 A;  2X64 A;  4PNF A;  1B48 A;  2CQ9 A;  3FMW A;  1W4V A;  2H0H A;  1VF4 A;  3ZML A;  1K0N A;  1NHY A;  3LXZ A;  3GKK A;  2IJY A;  2JZS A;  3A2W A;  2RM6 A;  1O6J A;  2WDU A;  3EVI A;  4F0C A;  1Z3E A;  1NW2 A;  2AAW A;  2WZ9 A;  3UOM A;  3BBY A;  1HNB A;  4TR4 A;  4KCA A;  4ZBB A;  2ALB A;  3TKP A;  4EDZ A;  2DIZ A;  1ZYN A;  4ACS A;  4K0N A;  1MDK A;  3WGX A;  5IMV A;  1GWC A;  4LMV A;  2R5G A;  5ELG A;  5DBQ A;  4O7H A;  5G2Z A;  4N0Z A;  1XWB A;  1XVQ A;  2NTO A;  4IBP A;  4RQR A;  2C3N A;  4ISD A;  1NM3 A;  4GQC A;  4FYB A;  3DKS A;  3ZIJ A;  4IJI A;  1K0M A;  4NPB A;  3TJK A;  3HYP A;  3UBL A;  1ABA A;  3E3E A;  1A23 A;  5IIZ A;  1PKW A;  2B6M A;  4I2U A;  1K0A A;  4PNG A;  3QAW A;  1BG5 A;  4HJ2 A;  2GT6 A;  4TXO A;  1XW9 A;  1K0C A;  3GH6 A;  2N5B A;  2OJL A;  5KN3 A;  1GSS A;  1MD4 A;  1O81 A;  4KND A;  2HSY A;  3KD0 A;  4G19 A;  3KIJ A;  5LD0 A;  1BYE A;  3SWL A;  3KH9 A;  2KHP A;  4KGI A;  2XC2 A;  3WYW A;  3I69 A;  4L0W A;  3TOU A;  4HUA A;  5CNW A;  1F37 A;  2M72 A;  3Q6O A;  1DUG A;  2OE3 A;  2FA4 A;  4BPY A;  2HXK A;  3L0H A;  1JLV A;  4GSS A;  1PL1 A;  4CY8 A;  2LJK A;  4XS4 B;  2X49 A;  4OWY A;  3IRA A;  5GSS A;  2B1K A;  3VLN A;  2VL9 A;  4FH8 A;  1WIK A;  1EZK A;  3TJF A;  4QL9 A;  3LOR A;  4BWS A;  5LCZ A;  1OVN A;  4MZC A;  4I6X A;  4IN0 A;  4PXO A;  4MDC A;  3P7X A;  1GP1 A;  2GS3 A;  4EIQ A;  1EV9 A;  3PH9 A;  2WCI A;  2VD1 A;  2YPM A;  3DML A;  3TKS A;  1WPI A;  3FYG A;  5CRD A;  3MDK A;  1AQW A;  4KDU A;  4F03 A;  3A2X A;  1O8W A;  4WF4 A;  2YOI A;  2LUS A;  4QQ7 A;  1UN2 A;  2F8F A;  4MH2 A;  2E0Q A;  4MZB A;  3DD3 A;  5ECQ B;  1BJX A;  3IAS 2;  3J7Y k;  3FW2 A;  3FEU A;  4XCS A;  2IMI A;  2GQK A;  2DJ0 A;  1F3B A;  4MZW A;  4J2F A;  1AXD A;  3H1N A;  4J57 E;  2H70 A;  1OC9 B;  1PX6 A;  1S3A A;  4QL7 A;  2PPT A;  5G5F A;  1YKA A;  4NHZ A;  2R37 A;  5IO0 A;  2QA1 A;  2YZU A;  3UEM A;  3WGD A;  1XCC A;  1GTI A;  5CRE A;  1SKR B;  2OE1 A;  2VM1 A;  1ZL9 A;  4O5Q A;  3M0F A;  2GST A;  1ZOF A;  5H5Q A;  2FWH A;  2CAQ A;  3F63 A;  1BQ7 A;  1NSW A;  4YQV A;  2JZT A;  1ON4 A;  2UZ8 A;  4KW6 A;  2A4V A;  3QAV A;  2FNO A;  2PER A;  5CO3 A;  4XTS A;  2OBI A;  1XWG A;  4GSN A;  5COH A;  1TW9 A;  3HVS A;  3VI5 A;  3GYK A;  4AJ6 A;  3G7Y A;  5A4W A;  2RUF A;  5D73 A;  4BWQ A;  5D9W A;  3LWA A;  3NZN A;  3VPQ A;  1Z7P A;  3CRT A;  2YWI A;  1QQ2 A;  4ML6 A;  4PUR A;  3KCM A;  2I3Y A;  4WET A;  4K5R A;  4MJB A;  2L4Q A;  5DQY A;  3J7Y b;  4TR1 B;  1EGR A;  1PN0 A;  4HDE A;  2GQM A;  1J08 A;  2HRK A;  1V2A A;  3UAR A;  1U3A A;  1T4Y A;  1H4O A;  2GTU A;  1M99 A;  2IMD A;  2NVL A;  2O7K A;  5IO2 A;  4K5S A;  1FW1 A;  2WRT A;  3EYT A;  2YV9 A;  5IMA A;  1FB0 A;  4GRF A;  2H0G A;  4TRX A;  5ECS A;  4IP6 A;  2YWN A;  4OCF A;  1FHE A;  4HJM A;  2D2Z A;  4N30 A;  1I9D A;  3RHB A;  3IDV A;  2F3M A;  2H74 A;  3ZIT A;  1FVK A;  2CVD A;  4G10 A;  3DVX A;  4RI7 A;  2P0G A;  3IC8 A;  1XIY A;  2RUE A;  2FWE A;  4X1U A;  3GST A;  4HOJ A;  1QGV A;  4HZ4 A;  1A0R P;  2M46 A;  1A0F A;  1EP7 A;  3L9V A;  2DJJ A;  3DRN A;  2IPA A;  4XRD A;  4PQI A;  2PN8 A;  1KNG A;  1UVZ A;  2L5O A;  3UL3 A;  1YDK A;  1PL2 A;  3H8Q A;  2HZE B;  1TRU A;  3ZZX A;  1JLW A;  4OD7 A;  4K7O A;  5F0G A;  1GRX A;  3VWX A;  5ECM B;  2OE0 A;  5ID2 A;  4IQ1 A;  5DQS A;  4E8E A;  5JCG A;  2M80 A;  2VIM A;  4G9H A;  3ZRE A;  6GST A;  1OE8 A;  5ECO B;  4Q5R A;  5HR1 A;  2GT5 A;  2MMZ A;  5J5N A;  3LG6 A;  1AUC A;  4WKW A;  3TGZ A;  1V58 A;  2I9H A;  1OC8 A;  4Z2R A;  3TKQ A;  1SJZ A;  3M9J A;  2L59 A;  5B7C A;  2XHF A;  3F3Q A;  3D22 A;  3EPT A;  2K6V A;  5HQP A;  2V1M A;  2PVQ A;  4OO4 A;  4XS6 A;  4AF2 A;  4FQU A;  3GN3 A;  5G30 A;  4POL A;  2X8G A;  4DSQ A;  4Z2T A;  5HR3 A;  4IQA A;  4XS4 A;  5JWR B;  16GS A;  3IE3 A;  1GH2 A;  13GS A;  3O6T A;  2YJH A;  3ZMK A;  4XS1 A;  3KP8 A;  3CSH A;  4KDY A;  1FOH A;  2IME A;  3C7M A;  2B5X A;  1V40 A;  1M2D A;  2LV3 A;  3W8S A;  3H93 A;  3LXT A;  3IOS A;  2FWG A;  4ZXG A;  2ZCT A;  1LJR A;  3IPZ A;  4AGS A;  4K6X A;  3BD2 A;  5IMD A;  4H86 A;  2RM5 A;  1T00 A;  2X8H A;  1QFN A;  2XBQ A;  4ML1 A;  2G2Q A;  2KP2 A;  1SL2 B;  3FRC A;  4JE1 A;  12GS A;  1GSY A;  2H71 A;  2AHE A;  1NHO A;  1R5P A;  1X5C A;  5D9V A;  14GS A;  2L4C A;  1DBY A;  4MNN A;  4OMV A;  4V1A g;  2VUP A;  2HNL A;  2FUG 2;  4OO5 A;  1OC9 A;  3TKS E;  1K0O A;  3G7J A;  1SK0 A;  2C8U A;  1ZCP A;  2DJK A;  3ZL5 A;  2K8S A;  3CRU A;  3GKN A;  4AJ7 A;  4CW9 A;  1Q98 A;  4TVE A;  1T8E B;  2A2R A;  3E0U A;  4TW5 A;  1ZYQ B;  4JZQ A;  2IL3 A;  3DYR A;  1ZGN A;  3EWL A;  2VCQ A;  2FD3 A;  4NV5 A;  5D9T A;  1X9W B;  3QCP A;  4IP1 A;  3GTU B;  3WGE A;  2QC7 A;  3QD9 A;  3APO A;  1B8X A;  4CHS A;  1Z6M A;  3HDC A;  3I43 A;  1TI1 A;  2LQO A;  2MZC A;  5DCH A;  20GS A;  3ERW A;  5ELA A;  4ICY A;  4XIH A;  4MF7 A;  1XZO A;  3ME7 A;  3MYD A;  5KN1 A;  3F3R A;  1MD3 A;  2C0F A;  5C00 A;  1J9B A;  2AV4 A;  4DVC A;  2H1B A;  2VD0 A;  1I5G A;  3FR6 A;  2R2J A;  4JED A;  1A2J A;  4I2T A;  1YKC A;  2H0I A;  3GA4 A;  1G7O A;  4TR1 A;  4PGT A;  4I97 A;  3QFA C;  1X9M B;  3GKM A;  3VWV A;  4HI7 A;  2VL3 A;  2WFC A;  5D8I A;  3QR6 A;  1J0F A;  2AYT A;  3M1G A;  4GWR A;  1YEP A;  1O85 A;  2YN1 A;  5FT3 A;  3WD6 A;  2YCD A;  2VCV A;  2JL4 A;  5CYY A;  3VWU A;  4G0K A;  2HYX A;  2IIY A;  4ZL7 A;  4YQM A;  1TOF A;  2NBS A;  2MYG A;  3FZ9 A;  1THO A;  4DSR A;  4NV2 A;  2DML A;  2KP1 A;  2A2P A;  1OAZ A;  3MIX A;  4WEY A;  4EIP A;  1F3A A;  1K0D A;  4Q5N A;  4F82 A;  4K2D A;  5F8B A;  3DIE A;  2LTK A;  2HRF A;  4KX4 A;  1XBS A;  4WF5 A;  3APQ A;  2G0F A;  2GSQ A;  1XW6 A;  3ZTL A;  1GNE A;  3TDG A;  2GGT A;  3MSZ A;  4IGJ A;  4X0X A;  3P90 A;  5ECN B;  2HZE A;  3M9K A;  4IHU A;  1TU7 A;  4X43 A;  4Q5Q A;  5ABR A;  5IOW A;  1AAZ A;  2YWO A;  2GLR A;  3BCI A;  3OR5 A;  3ZFL A;  1N8J A;  2LNS A;  3DEX A;  1CQG A;  4YQU A;  6GSS A;  3ZLP A;  1PMT A;  1X5E A;  2DKI A;  1PA3 A;  2O89 A;  2H1D A;  5EPF A;  2CX4 A;  4JU5 A;  1SK1 A;  1X9S B;  2R3X A;  3GFK A;  3KXO A;  3O76 A;  4NHW A;  5H5R A;  2VOC A;  1EGO A;  5CP1 A;  1TDI A;  5B6N A;  2L57 A;  5ECL B;  4ZB6 A;  8GSS A;  1ACV A;  2X99 A;  1THX A;  1SKW B;  1QK8 A;  1V9W A;  4AJ8 A;  3US3 A;  4BA7 A;  4MH3 A;  2CV4 A;  1BED A;  2O85 A;  1WWJ A;  1TK0 B;  2LEG A;  3GV1 A;  1SL0 B;  4YH2 A;  1TK5 B;  3RPN A;  3ISO A;  2FHE A;  2C3Q A;  4ECC A;  1EOH A;  5AIX A;  2A4H A;  2VCW A;  3GHA A;  4KB3 A;  3TJG A;  2VLV A;  3MWH A;  1QMV A;  1K3Y A;  2X8C A;  2GDR A;  4ECJ A;  5KOX A;  1M9B A;  2E7P A;  5G1L A;  1VGL A;  1R26 A;  4CY6 A;  2JU5 A;  1UA5 A;  2LST A;  4P3Y B;  5F06 A;  5ECH B;  5IMC A;  3RHC A;  6GSY A;  3RAZ A;  2JSZ A;  1XW5 A;  1JFU A;  4WR4 A;  1AW9 A;  2WUL A;  2GSS A;  1XXU A;  2K18 A;  5A4V A;  3LW9 A;  1EEM A;  1O8X A;  5EY6 A;  3W6G A;  4BVX B;  5IQY A;  2H19 A;  5EL8 A;  1YEX A;  4ID0 A;  3CTG A;  3GSS A;  1HYU A;  1C72 A;  3PGT A;  2HE3 A;  1SL1 B;  3IA1 A;  1YQ1 A;  2WJU A;  4PQH A;  3RDW A;  1GSE A;  1SYX A;  3D21 A;  1V57 A;  3TJB A;  1YZX A;  3IHQ A;  3C8E A;  3EU4 A;  1IYH A;  17GS A;  3M3M A;  5KN0 A;  4E8H A;  1VF2 A;  2IMF A;  1JZD A;  1ZZY A;  5DAL A;  4I5Q A;  6GSX A;  5HR0 A;  1GSQ A;  3ZVJ A;  1CQH A;  1RK4 A;  2YJ7 A;  1Y6E A;  4HU7 A;  2VAF A;  1YY7 A;  5BMU A;  2WB9 A;  1B9X C;  1FG4 A;  2IN3 A;  5KOW A;  3GTU A;  2VCX A;  5ECP B;  3FY7 A;  2VM2 A;  3F6D A;  2ON5 A;  5E4W A;  2I81 A;  3V1W A;  4MLY A;  1XWA A;  2WS2 A;  4MJC A;  1Q4J A;  3RPP A;  1Y25 A;  2B3S A;  3HCZ A;  2J9H A;  4BL7 B;  1BAY A;  5CAX A;  4V2N A;  2JAC A;  1Z6N A;  3PPU A;  2FA8 A;  4LLR A;  3U5R E;  3FZ5 A;  2R6K A;  2TRC P;  2DSA A;  1TI3 A;  1A8Y A;  2LQQ A;  2CZ2 A;  2GQL A;  4O5U A;  1JZR A;  4HEA 2;  5JWQ B;  3A5I A;  2V2G A;  2YV7 A;  1M0U A;  4TOP A;  2V6O A;  5DCG A;  3CSJ A;  3LYK A;  2VCT A;  1S3C A;  2OBK A;  2H1G A;  4GCI A;  3UVT A;  5JWO B;  2H75 A;  2O8V B;  2FY6 A;  3EMP A;  3F8U A;  5BRT A;  3HJP A;  3NIV A;  4ILF A;  3ZRD A;  4OFM A;  3ZVJ D;  5DJL A;  1TXX A;  5IMF A;  3TJJ A;  2PBJ A;  2H72 A;  2MMO A;  1B4Q A;  3QAG A;  3IK7 A;  3UAP A;  3Q19 A;  4FYU A;  2O87 A;  4TXO B;  4GXZ A;  4V2L A;  1KBN A;  2GZY A;  3PR8 A;  1T1V A;  3KMN A;  3GKX A;  1WP0 A;  3I9V 2;  1QXH A;  3QPM A;  4NAX A;  1FOV A;  4NWY A;  4K2X A;  2V32 A;  1XFL A;  2CX3 A;  4F9Z A;  2NDO A;  4K9Z A;  4POK A;  1H75 A;  3KP9 A;  3KH7 A;  5LNK e;  3DXB A;  2H6Y A;  4RUV A;  1TJD A;  5IMZ A;  3WT1 A;  2IWT A;  5DAK B;  3TRP A;  4HQS A;  5GAP D;  4KUN A;  1SJ6 A;  1T4Z A;  2BMX A;  3GRX A;  3L9S A;  3DWV A;  4OFT A;  4J56 E;  3LYP A;  5C04 A;  1GSU A;  1TRV A;  11GS A;  3HJO A;  2OAD A;  1BX9 A;  5AIS A;  1Z5Y E;  1A24 A;  4ULX A;  1YJ6 A;  2K8V A;  3HA9 A;  2CVB A;  3M8N A;  4EE0 A;  3FR3 A;  1OKT A;  1K3O A;  5FHI A;  5B6M A;  1GSD A;  2R4V A;  3F4T A;  4EF0 A;  3KJY A;  5ECR B;  4TR0 A;  2IMK A;  1PD2 1;  2DJ2 A;  4F0B A;  4XRA A;  1XPV A;  1A2M A;  4KCE A;  5G5E A;  3U6V A;  3HVV A;  4YKG A;  3HJM A;  4JR6 A;  5J9B A;  3PIN A;  3TCO A;  3HY2 A;  4KE3 A;  4PUA A;  1OKD A;  3GUR A;  5B8B A;  1SU9 A;  2YP6 A;  3FHK A;  3IBH A;  1PGT A;  2EIR A;  4TKY A;  1YF1 A;  1KEB A;  1MDJ A;  2LKU A;  5DJM A;  4K7N A;  4ZL8 A;  19GS A;  1JZO A;  3I6A A;  1Z7R A;  4DSS B;  3EUR A;  2LRT A;  3KTL A;  4FIW A;  2DJ1 A;  1WJK A;  2HRN A;  3G7I A;  3KGK A;  18GS A;  1EEJ A;  4MF6 A;  3VI7 A;  3VPT A;  1K0B A;  3BJ5 A;  1G6W A;  1WE0 A;  3H4K A;  4MAB A;  1FAA A;  3C71 A;  6GSW A;  3ME8 A;  4MA9 A;  1UC7 A;  4GLT A;  2CVK A;  2H01 A;  3N5O A;  4LMW A;  4BVY B;  1WRY A;  5D93 A;  2B7K A;  1N2A A;  2X4A A;  1FO5 A;  1ERV A;  5G1K A;  1EV4 A;  1GUH A;  3MAK A;  4GQF A;  3C1S A;  4IW9 A;  1G7E A;  4RI6 A;  3CXG A;  2TRX A;  3HHV A;  2RII A;  1B4P A;  2H30 A;  3DGQ A;  3QFB C;  2QSI A;  1F6M C;  2DBC A;  4KF9 A;  1ZYP A;  2B7J A;  1A2L A;  2IFQ B;  2DKH A;  2KUC A;  1O73 A;  2JSY A;  2VO4 A;  4G0I A;  2LRC A;  4EDY A;  4ZBA A;  2AUV A;  1X0R A;  1OYJ A;  3KMO A;  3FKF A;  3P2A A;  4EUY A;  5IPG A;  1EP8 A;  4KA0 A;  3APS A;  2YNX A;  3IK9 A;  1TK8 B;  5JCW A;  4V2M A;  2PGT A;  3TRX A;  1XWC A;  1MDI A;  4USS A;  3ERG A;  3F4S A;  4RQX A;  4KDX A;  4PX1 A;  2EC4 A;  1PQN A;  4YAP A;  5DDL A;  3VFI A;  3W8J A;  4OFN A;  1FB6 A;  4WBJ A;  2GSR A;  2XPE A;  2ZUP A;  3FR9 A;  4LA1 A;  3IV4 A;  2LNT A;  4KSO A;  1HNC A;  4BL7 A;  2MBS A;  5ENU A;  1GLQ A;  2OA7 A;  3R2Q A;  3TKS C;  5J9C A;  1AQV A;  2DIY A;  5A5K A;  1GTU A;  5B8A A;  4L0U A;  3EC3 A;  3LEF A;  1A8L A;  4FO5 A;  3RBT A;  3ZYW A;  3TKR A;  3UIW A;  5J41 A;  5ECK B;  4WBR D;  5F07 A;  1M9A A;  5ID2 B;  2YAN A;  4GTU A;  4POB A;  4JRR A;  5JCU A;  2BTO T;  2JAD A;  2QA2 A;  3K8N A;  2YWM A;  2FGX A;  4POM A;  3F0I A;  4ECI A;  4O32 A;  3TRQ A;  4K0G A;  4N10 A;  1XOB A;  1K3L A;  4MCU A;  3FZ4 A;  3ED3 A;  1HD2 A;  1XWK A;  2H6X A;  1T3B A;  1AC1 A;  3FZA A;  1ML6 A;  2ES7 A;  2FWF A;  2H8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...