2TRXA

Crystal structure of thioredoxin from escherichia coli at 1.68 angstroms resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords THIOREDOXIN
publication title Crystal structure of thioredoxin from Escherichia coli at 1.68 A resolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 32
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2trxA00
3VWVA 3G7JA 3P8WA 2HXKA 3QDNA 5INYA 1WRYA 1U6TA 2B5YA 4FYCA 3G9BA 1J0FA 3APSA 3WGEA 3FEUA 1RW1A 2GZPA 4N0ZA 1HYUA 5AISA 5KEJA 2HRNA 5F05A 2N5FA 3FZAA 4OD7A 4D73B 3HZ4A 5B8AA 4ZXGA 2NPBA 2FWFA 1RQMA 1M2BA 2H1AA 5IO0A 3UARA 5IPHA 2GTUA 3GKNA 4HQSA 4OO4A 1DSBA 2R2JA 3LG6A 5IMAA 2CQ9A 3KEBA 2OJLA 1B8XA 4V2MA 2LV3A 3RAZA 1CQHA 4I6XA 5LD0A 4MF7A 3ZLPA 1ZYEA 3D21A 2O85A 4MJAA 3LYPA 5EVOA 2XBQA 1IYIA 4TR1B 1ZL9A 5A4UA 5ID2B 1MD4A 3EMPA 3DMLA 4EE0A 3KJYA 2H0GA 4IVFA 1UN2A 1HNBA 3G7IA 3EWLA 4WXTA 2L59A 5GSTA 1AQWA 4PX1A 3EVIA 4NHZA 5CYYA 2RLIA 3BCKA 3FY7A 4KSMA 1A2LA 4Q5RA 1HNAA 1R26A 2LS5A 5IOWA 1ERWA 4NMUA 2OE1A 2FNOA 1AC1A 1TOFA 3WGXA 3KZQA 5ENUA 1X9MB 3ZMKA 4MCUA 1GP1A 4O92A 4WETA 4N0VA 4MZBA 2YWOA 4PUFC 3VWUA 4POMA 2YJ7A 5DBQA 1V58A 2VCWA 1SJZA 4HJ2A 4KSOA 3FR6A 3GA4A 2LNTA 4K9ZA 1SKSB 1GULA 4ZB6A 3GUSA 4K0GA 4TXVA 3EMXA 2B1KA 3CRUA 4YAVA 3O3TA 1ACVA 3W8SA 2PN8A 4HS1A 5GSSA 5J41A 2B7KA 4MP4A 3VI7A 2LRCA 4CW9A 3MSZA 2IMDA 3RBTA 1SK0A 1URMA 2C3NA 4Z7XA 4ML1A 3DD3A 3VPQA 1M0UA 5ECOB 5HR3A 3HHVA 2VLVA 3TGZA 1TJDA 4ID0A 2KOKA 4WEYA 3UVTA 5IMDA 3H79A 5G30A 3Q6OA 4HOJA 3GH6A 1WPIA 3F0IA 5CRWA 3F3RA 3ZRDA 3K8NA 1FVKA 3A2VA 4MMMA 3KH9A 1O8XA 4EF0A 4NV5A 3F4TA 2H6ZA 1SKRB 3KTBA 5D9TA 5IIZA 2F8AA 2AAWA 4OCEA 1U87A 2CVBA 1R5PA 2BMXA 1VF2A 4F03A 1AIUA 2FHEA 5D73A 1ZMAA 2P31A 2DJ0A 2X8GA 2QSIA 2CX4A 3VURA 3FZ9A 1G0TA 2CT6A 3RPPA 2VCVA 2ZUPA 2WCIA 5DALA 5IPGA 1X9SB 2DJJA 1K0OA 4POLA 3APQA 3U6VA 5J9CA 1OE7A 1XW9A 1A0RP 1K3LA 2GGTA 1BAYA 5DQYA 2M72A 1VF3A 3TCOA 4ILFA 2VM2A 5H5SA 3QCPA 3A5WA 4O5RA 3F8UA 4PQHA 2DIZA 4KH7A 4LL4B 2IMEA 1NHOA 5IM9A 3ME7A 1EEJA 4ECBA 1GLQA 4BL7A 2KUCA 2X99A 4POKA 19GSA 3IK7A 4J57E 5ABRA 4LLRA 5ECQB 2AYTA 3QAGA 3IC4A 2RUEA 1A2MA 1W89A 1ZOFA 2AB6A 3F4SA 2YWMA 2XPEA 2XPDA 3ZITA 2XHFA 1Q4JA 4AJ7A 1SENA 2YV7A 1O85A 3I9V2 4HQZA 3VLNA 4BVYA 1M2DA 2A2RA 3KMOA 4GLTA 1SK1A 5ECLB 1SYXA 3QPMA 4X1UA 1NHYA 3D6IA 2WZ9A 4KW6A 3W6GA 1AUCA 4ZILA 2YWNA 1XOBA 2YZUA 4YQUA 5C04A 3KTLA 2N5AA 4KGIA 2EIQA 1TK5B 1SL2B 4ML6A 3MDKA 1V9WA 2YNXA 1VGLA 5AGYA 3IR4A 1PMTA 1WIKA 2EIRA 2WJUA 2L6CA 1EZKA 2KP1A 4ZIJA 4WBJA 4K1FA 1F6MC 1LU4A 4WKWA 1TU8A 5H5RA 4LMWA 1YEXA 4I2UA 3GKXA 2B1LA 1OAZA 1OC8A 4XCSA 1PL2A 1JZWA 4EKZA 1K3OA 1ERUA 1XWKA 3C1SA 5G5EA 2L6DA 3QD9A 1T7PB 7GSSA 1KNGA 3I43A 4HJMA 1H75A 5CREA 1J08A 3M3MA 2OBIA 2JSZA 3CTFA 4MH3A 4EDYA 5DDLA 1A24A 3VK9A 2GZYA 1FO5A 2JADA 3GSTA 4TR1A 4MABA 4TRXA 1XWAA 2OKAA 4HDEA 2FCHA 4EDZA 5GZZB 2C3TA 4K7IA 5G5FA 2VD0A 3GKMA 1PKWA 5DALB 2JSYA 1PL1A 3O76A 4LA1A 3TKSA 2LJRA 1W4VA 4WR5A 2V6OA 1GLPA 1T00A 3GV1A 4OO5A 3QFBC 1YF1A 2WS2A 4OFMA 1THOA 1SU9A 3MNGA 5DAKA 18GSA 1FB0A 3RPNA 4F0CA 3IDVA 4G10A 1G7EA 1LBKA 1WMJA 2GQKA 2WULA 3FZ4A 3VWXA 3HYPA 4PXOA 4XS1A 3F6DA 5AN1A 5E4WA 4AJ8A 3ZIJA 4LL1B 4E8HA 2C1YA 4DSRA 4ZBDA 2PGTA 3N9JA 5F8BA 2MBSA 2V1MA 3HXSA 5CAXA 2MMZA 4ECCA 4KE3A 9GSSA 3GH9A 3PR8A 2ALBA 2OADA 3CXGA 3ZYWA 2YANA 1HD2A 3GX8A 1ST9A 2GSQA 1E2YA 2MZCA 2TIRA 1MD3A 1X5DA 3KM6A 1PA3A 1EEMA 1TI3A 4RI7A 1OC9A 2X8HA 2IMIA 2C8UA 1SD8A 4DVCA 1B9YC 1TRVA 1O6JA 4MLYA 2LRTA 3ZL5A 3M8NA 2R4VA 1JZRA 2NDOA 4GWRA 4OFTA 2E0QA 3GTUA 1OYJA 3TRPA 3H93A 3CYNA 5JCGA 2MBTA 5DCGA 5EPFA 4POBA 4EO3A 2DJ3A 3DVXA 1A2JA 4MF6A 3BOAA 3HVXA 1XZOA 5J5NA 2FD3A 3HJOA 2OE0A 1OVNA 2NVLA 4BWQA 1GUKA 1ML6A 5F06A 3HKRA 4XIHA 3LYKA 1TTZA 5J3RA 4RQXA 3ZFLA 1DE1A 2HFDA 4V2NA 2O89A 1OKTA 3DKSA 2H0HA 4HUAA 2ZCTA 1N8JA 1YDKA 1O73A 1HQOA 3TKQA 3UOMA 5FWGA 2X64A 4GF0A 1SL0B 3KGKA 3TJFA 22GSA 4IELA 3TOUA 1JLVA 6GSXA 5D9WA 1ILOA 2LNSA 3HVSA 1VF4A 5FT3A 2J23A 4IBPA 2IIYA 1O7UA 2O87A 2PVOC 5ELAA 3VWWA 1FVJA 2L5LA 3FYGA 4J56E 11GSA 5G1KA 3F9UA 1PKZA 3GSSA 2CZ3A 2LJKA 1X5EA 1K0NA 1OKDA 4XRAA 3QAVA 2K9FA 3UAPA 4FYBA 3WT2A 2DJKA 6GSYA 4F82A 1DBYA 2HSHA 1THXA 2K8SA 5DAKB 2PWJA 3PINA 1SK2A 3FR9A 2H75A 4IS0A 2H72A 1GTUA 1RK4A 3NIVA 4O32A 3LWAA 1MEKA 4ZB9A 3ED3A 4L0WA 3KXOA 1S3AA 2G0FA 3F63A 1DE2A 2GVPA 1GSUA 4QL7A 3IBHA 1Q98A 1EGRA 2L4CA 4ISDA 1BEDA 5CNWA 2H1DA 2HT9A 4GQFA 17GSA 3R2QA 2VOCA 3IPZA 3IXRA 4ECIA 3GN3A 3EURA 1BJXA 2CZ2A 1YF0A 4NV2A 1TK0B 4OCFA 3ISOA 2JL4A 1SD9A 3P90A 4RI6A 5G1LA 3EU3A 1OC9B 3HY2A 3TRQA 2VL9A 4PGTA 1EP8A 1V57A 3KP8A 2V2GA 2WDUA 3KMNA 1CQGA 3H4KA 4IW9A 5EY6A 3DIEA 2VL3A 1M2AA 5CRHA 2YV9A 2MMAA 3VI5A 2B5XA 1FB6A 5AIVA 1LJRA 1XW6A 3GTUB 4HZ2A 3ERFA 3UVHA 1AAZA 2FUG2 1ZYQB 3GHAA 3HJMA 4GSNA 4GXZA 2V41A 3KP9A 3J7Yk 2CVKA 5A4VA 1GH2A 1TRWA 3HVVA 1ON4A 4N10A 5KN0A 3RDWA 1EOGA 2R5GA 2GQLA 1XFLA 1T3BA 3IA1A 4IGJA 2LTKA 2I1UA 4FH8A 2JZTA 1GSSA 1QXHA 3LGCA 2ON5A 4AGSA 3L0HA 5HR2A 4I8BA 1Z7RA 4XTSA 2WB9A 1PSQA 1KBNA 2H6XA 2WRTA 1X0RA 2RIIA 4GQCA 2DLXA 3SBCA 1XPVA 1XWBA 4K0NA 1MDIA 2IWTA 3NOFA 3TJKA 1J9BA 5HFKA 2LKUA 4KX4A 1PN9A 2VLUA 5A5KA 2N5BA 4BA7A 3RHCA 1WJKA 2IMKA 2ZNMA 10GSA 2IL3A 1M7TA 3IAS2 1V2AA 2IJYA 2CX3A 4TOPA 4HZ4A 4IJIA 5IO2A 2VAFA 5D9VA 4F2IA 1TRSA 2YWIA 2YCDA 3CSIA 3IAM2 2LQOA 3H8QA 1WP0A 2FGXA 2PMTA 1DUGA 2JU5A 2VO4A 2B3SA 4KA0A 1Z7PA 5IMVA 2OE3A 4J2FA 4JBBA 3V1WA 5EL8A 4PNFA 1N2AA 3HD5A 6GSVA 3UEMA 1TW9A 3IHQA 3FW2A 1ABAA 2G2QA 4IN0A 3F4RA 5D9XA 1TU7A 4DSQA 1YEPA 3MAKA 2H19A 2JZRA 3EC3A 3ME8A 2J9HA 4YQMA 3F6FA 1GNWA 4XRDA 1AXDA 3FR3A 3LEFA 2DIYA 3TRXA 1XIYA 2YN1A 2H76A 3A2XA 3I69A 4KB3A 2P5QA 2MMNA 1NW2A 4MDCA 3IK9A 4TW5A 2KHPA 2FY6A 3F3QA 2HSYA 3C8EA 3ZREA 3UBLA 2MYGA 4TR0A 2B6MA 3M0FA 1QFNA 2ON7A 4MF5A 3CRTA 1F37A 5G2ZA 1Z9HA 2R3XA 4I97A 1YQ1A 1Z6MA 4FIWA 1OE8A 1JLWA 2REMA 5JWQB 2JZSA 4MH2A 1JZDA 4K7NA 2B5EA 1K3YA 2HI7A 4IKHA 4NXIA 4F9ZA 1UVZA 1AW9A 12GSA 4TXOA 1USBA 1YY7A 3ERWA 1SYRA 4PUAA 2F8FA 2VL2A 2VCQA 2HLSA 2YP6A 1K0MA 3GRXA 1B48A 5ECNB 2FA4A 5E59A 4JRRA 2EC4A 1U3AA 1PD21 1BG5A 2RM5A 4ZL9A 3KD0A 2YZHA 5B7CA 3M1GA 4CHSA 1GSEA 3BJ5A 2VLTA 2VCXA 3M9KA 2H30A 3A3TA 4MZCA 3LJRA 2XBIA 3TB2A 2KP2A 3QAWA 3IV4A 3FRCA 5ECRB 2H1GA 4ZBAA 2H66A 4ULXA 4H86A 5KN1A 3BD2A 2IPAA 3I6AA 3QFAC 2IMFA 3WT1A 1A8YA 1XVWA 5CO3A 1G6YA 3DVWA 20GSA 4RQRA 4DSSB 4L8EA 1OC3A 1M9AA 2LSTA 4QL9A 3L9UA 2QGVA 2V32A 3GL5A 5CP1A 2C0GA 4MA9A 1PX6A 4MK3A 3DEXA 1EV4A 3A2WA 4IJ3A 4IQAA 2YOIA 1K0CA 3E9JB 2P0GA 2JACA 5GAPD 2H0IA 1B9XC 3DXBA 2L5OA 2VD1A 5B8BA 4IP6A 2CVDA 1BX9A 3D4TA 4QQ7A 1AQXA 1XBSA 3APOA 4KAEA 1GNEA 5IMZA 4K2DA 1M99A 5HQPA 2DJ2A 3QMXA 3LXTA 2YPMA 6GSUA 5FHIA 4FYUA 1T4ZA 5IMFA 1T1VA 3ERGA 3PH9A 1Y25A 3KCMA 1QGVA 5A4WA 5IOXA 4MJCA 2LJAA 3ZVJA 4EXJA 1ERVA 2H70A 4N30A 4EUYA 3TJBA 5COHA 3C73A 5J4UA 4TN8A 1V40A 4G9HA 1TI1A 3BCIA 3D4MA 2DMMA 3GFKA 5F07A 3HCZA 4X0XA 1GTBA 1I5GA 1WOUA 3HDCA 2HZEA 2NTOA 1BYEA 1TRUA 2DBCA 2I3YA 2M46A 2E7PA 3D22A 5ELGA 4AJ6A 3CTGA 4K7OA 3TDGA 2FA8A 4MZWA 1PQNA 3GKKA 3DGQA 2GDRA 4TXOB 5LCZA 1UC7A 1VRSD 3MWHA 3EINA 2D2ZA 3TKPA 4P3YB 2C4JA 2FWGA 5D96A 5ECPB 4XS6A 3EE2A 2FWHA 2LUSA 1JFUA 3J7Yb 4Q5FA 3D5JA 3LXZA 4GRFA 3TKRA 3CSHA 3L78A 4TKYA 4TR3A 2GS3A 3L9SA 1G7OA 2R37A 1R5AA 5JWRB 1Z3EA 4Q5QA 2WFCA 4L0UA 2EIOA 2PVQA 4EL1A 3LSZA 2AHEA 2NBSA 4KDUA 4V1Ap 2GSTA 3BBYA 2H8LA 3O6TA 4F0BA 4ZL7A 4JR4A 4OFNA 2PPTA 2VCTA 5H5QA 2C0DA 3L9VA 3TKSE 5JWOB 1EWXA 5GAND 1MDJA 4ZL8A 6GSWA 1O8WA 1Y6EA 3EYTA 2B7JA 3GURA 1GSFA 2Z9SA 1EP7A 3HZ8A 2GSSA 1I9DA 3LORA 3KIJA 5HFGA 3IE3A 4XS4A 4G2EA 2R6KA 1WE0A 4ZBBA 2OBKA 2FWEA 3ZMLA 5AIXA 3WGDA 4ECJA 1GWCA 4PURA 1GSDA 3US3A 1A8LA 4GCIA 1QK8A 1G6WA 2AJQB 1EGOA 3GL3A 2QKEA 1EOHA 5JCWA 5D8IA 2TRXA 1QUWA 1E6BA 1YZXA 3GNJA 2CAIA 3TJGA 1GTIA 1GUHA 3DWVA 4IHUA 3H1NA 2I4AA 2C80A 3UMAA 1M9BA 1S3DA 3FKFA 1FOVA 4YAPA 1MDKA 2GZZA 3ZFBA 4CDOA 2GLRA 16GSA 1X5CA 4HU9A 3NZNA 5ECIB 5ECMB 3LFLA 3C1RA 2O8VB 4TVEA 2DJ1A 4NPBA 2BJXA 3ZIVA 5HR0A 2HZEB 4GTUA 5DCHA 4MJEA 1TP9A 5F0GA 2HZFA 2XC2A 2GSRA 2V6KA 1Z6NA 2F9SA 2DSAA 5DVBA 2VCZA 1C72A 4ZB8A 2YJHA 1U88A 3QOUA 4IP1A 2E2MA 2VUPA 5HR1A 2CA8A 3IRAA 1FAAA 5J9BA 4DEJA 1MTCA 1GL8A 2DC5A 1QQ2A 1A23A 1XWGA 5IQYA 5C00A 2VL2C 3DRNA 4X43A 3U5RE 4PQ1A 4OWYA 4MJBA 2GT5A 6GSTA 2IFQA 4YQVA 1FW1A 3VFIA 2OA7A 5DJLA 1R4WA 1XOAA 2DMLA 3UBKA 2VM1A 1B4PA 1ERTA 3P2AA 4DSSA 2RM6A 3GX0A 1WWJA 3RHBA 1Z5YE 3PGTA 1GUMA 3HJPA 2PUKC 1F9MA 2H71A 4EVMA 4WF4A 3EU4A 3UIWA 3TKSC 4FO5A 5HFIA 4JEDA 3GIXA 1BQ7A 1EV9A 2FLSA 3SWLA 1GRXA 4MPGA 4V1Ag 5JCUA 1XW5A 5CRDA 3WD6A 3TJJA 4KNDA 5DJMA 3ZTLA 3GMFA 3TOTA 1GSYA 1TDIA 1R7HA 4I5QA 2F3MA 1XXUA 3CSJA 14GSA 2L57A 4BWSA 4EC0A 4HI7A 1YKAA 1AQVA 2BTOT 3P7XA 1T8EB 4XHMA 4V2LA 2H01A 1F3BA 4XS4B 4K6XA 1YJ6A 5CRGA 2A2SA 2TRCP 2PERA 2H6YA 5B6NA 5G31A 4I2TA 4E8EA 3M9JA 2HE3A 4NHWA 1T4YA 1ZGNA 3AY8A 3CBUA 4L5OA 4OMVA 2CAQA 2GQMA 2AUVA 3Q18A 1UA5A 4GSSA 3KH7A 5IMCA 6GSSA 2IN3A 4YH2A 5KN3A 5B6MA 1HNCA 4AF2A 3Q74A 3CMIA 3C7MA 1IYHA 4KDYA 1SJ6A 1PX7A 3ZVJD 4RUVA 1NSWA 3C71A 1K0AA 4KUNA 4JE1A 2K18A 4D73A 1XVQA 2P5RA 1FHEA 3WYWA 1ZCPA 2LQQA 1K0BA 4PQIA 4G19A 5DQSA 3S9FA 1S3CA 4PNGA 5L71A 2HNLA 4KCAA 13GSA 4IQ1A 4WR4A 4BVXA 2I9HA 1SKWB 2C0FA 4LMVA 2MMOA 1TXXA 1VF1A 3UL3A 3HA9A 2H1BA 3QR6A 1QMVA 5ID2A 4JU5A 1ZZYA 1JZOA 4BPYA 1KEBA 1TK8B 1O81A 1GSQA 2F51A 2CV4A 4GSTA 1SL1B 1XWCA 4TR4A 2AV4A 1NM3A 2IFQB 5D93A 1K0DA 2K6VA 2ES7A 5ECSA 1B4QA 1F2EA 1X9WB 4KDXA 2M80A 3GYKA 2H74A 3IOSA 1XCCA 3FZ5A 4MPFA 1YKCA 1F3AA 1H4OA 5ECKB 2O7KA 3E3EA 3G7YA 1SJIA 2K8VA 4N11A 3D0ZA 2WGRA 4HU7A 2H73A 4KCEA 4HEA2 3L4NA 3LQ7A 1PRXA 2A4VA 8GSSA 1PGTA 1A0FA 1U3IA 1V98A 2C3QA 3FHKA 3W8JA 4NWYA 2VIMA 3UJ1A 2L4QA 3VPTA 3ZZXA 2PU9C 4O7HA 5ECHB 2KLXA 2PBJA 2I81A 4K8MA 2LRNA 3Q19A 2RUFA 1FG4A 3OR5A 4ACSA 4Q5NA 4JZQA 4JR6A 2LEGA 3TUEA 2E2GA 1KTEA 2QC7A 2C0EA 2OACA 2X8CA 5KN2A 2GT6A 2HRFA 3N5OA 4L5LA 5LNKe 3E0UA 1TKDB 3JCML 4WBRD 2HYXA 3DYRA 1GTAA 4NAXA 1JHBA 3FK8A 4WF5A
chains in the Genus database with same CATH superfamily
3VWVA 3G7JA 2DKHA 3P8WA 2HXKA 3QDNA 5INYA 4K5RA 1WRYA 1U6TA 2B5YA 4FYCA 3G9BA 1J0FA 3APSA 3WGEA 3FEUA 1RW1A 2GZPA 4N0ZA 1HYUA 5AISA 5KEJA 2HRNA 5F05A 2N5FA 3FZAA 4OD7A 4D73B 3HZ4A 5B8AA 4ZXGA 2NPBA 2FWFA 1RQMA 1M2BA 2H1AA 5IO0A 3UARA 5IPHA 2GTUA 3GKNA 4HQSA 4OO4A 1DSBA 2R2JA 3LG6A 5IMAA 2CQ9A 3KEBA 2OJLA 1B8XA 4V2MA 4BVXB 2LV3A 3RAZA 1CQHA 4I6XA 5LD0A 4MF7A 3ZLPA 1ZYEA 3D21A 2O85A 4MJAA 3LYPA 5EVOA 4EIQA 2XBQA 1IYIA 4TR1B 1ZL9A 5A4UA 5ID2B 1MD4A 3EMPA 3DMLA 4EE0A 3KJYA 2H0GA 4IVFA 1UN2A 1HNBA 3G7IA 3EWLA 4WXTA 2L59A 5GSTA 1AQWA 4PX1A 3EVIA 4NHZA 5CYYA 2RLIA 3BCKA 3FY7A 4KSMA 1A2LA 4Q5RA 1HNAA 1R26A 2LS5A 5IOWA 1ERWA 4NMUA 2OE1A 2FNOA 1AC1A 1TOFA 3WGXA 3KZQA 5ENUA 1X9MB 3ZMKA 4MCUA 1GP1A 4O92A 4WETA 4N0VA 4MZBA 2YWOA 4PUFC 3VWUA 2QA1A 4POMA 2YJ7A 5DBQA 1V58A 2VCWA 1SJZA 4HJ2A 4KSOA 3FR6A 3GA4A 4K5SA 2LNTA 4K9ZA 1SKSB 1GULA 4ZB6A 3GUSA 4K0GA 4TXVA 3EMXA 4USSA 2B1KA 3CRUA 4YAVA 3O3TA 1ACVA 3W8SA 2PN8A 4HS1A 5GSSA 5J41A 2B7KA 4MP4A 3VI7A 2LRCA 4CW9A 3MSZA 2IMDA 3RBTA 1FOHA 1SK0A 1URMA 2C3NA 4Z7XA 4ML1A 3DD3A 3VPQA 1M0UA 5ECOB 5HR3A 3HHVA 2VLVA 3TGZA 1TJDA 4ID0A 2KOKA 4WEYA 3UVTA 5IMDA 3H79A 5G30A 3Q6OA 4HOJA 3GH6A 1WPIA 3F0IA 5CRWA 3F3RA 3ZRDA 3K8NA 1FVKA 3EPTA 3A2VA 4MMMA 3KH9A 1O8XA 4EF0A 4NV5A 3F4TA 2H6ZA 1SKRB 3KTBA 5D9TA 5IIZA 2F8AA 2AAWA 4OCEA 1U87A 2CVBA 1R5PA 2BMXA 1VF2A 4F03A 1AIUA 2FHEA 5D73A 1ZMAA 2P31A 2DJ0A 2X8GA 2QSIA 2CX4A 3VURA 3FZ9A 1G0TA 2CT6A 4O5UA 3RPPA 2VCVA 2ZUPA 2WCIA 5DALA 5IPGA 1X9SB 2DJJA 1K0OA 4POLA 3APQA 3U6VA 5J9CA 1OE7A 1XW9A 1A0RP 1K3LA 2GGTA 1BAYA 5DQYA 2M72A 1VF3A 3TCOA 4ILFA 2VM2A 5H5SA 3QCPA 3A5WA 4O5RA 3F8UA 4PQHA 2DIZA 4KH7A 4LL4B 2IMEA 1NHOA 5IM9A 3ME7A 1EEJA 4ECBA 1GLQA 4BL7A 2KUCA 2X99A 4POKA 19GSA 3IK7A 4J57E 5ABRA 4LLRA 5ECQB 2AYTA 3QAGA 3IC4A 2RUEA 1A2MA 1W89A 1ZOFA 2AB6A 3F4SA 2YWMA 2XPEA 2XPDA 3ZITA 2XHFA 1Q4JA 4AJ7A 1SENA 2R0GA 2YV7A 1O85A 3I9V2 4HQZA 3VLNA 4BVYA 1M2DA 2A2RA 3KMOA 4GLTA 1SK1A 5ECLB 1SYXA 3QPMA 4X1UA 1NHYA 3D6IA 2WZ9A 4KW6A 3W6GA 1AUCA 4ZILA 2YWNA 3A5IA 1XOBA 2YZUA 4YQUA 5C04A 3KTLA 2N5AA 4CY8A 4KGIA 2EIQA 1TK5B 1SL2B 4ML6A 3MDKA 1V9WA 2YNXA 1VGLA 5AGYA 3IR4A 1PMTA 1WIKA 2EIRA 2WJUA 2L6CA 1EZKA 2KP1A 4ZIJA 4WBJA 4K1FA 1F6MC 1LU4A 4WKWA 1TU8A 5H5RA 4LMWA 1YEXA 4I2UA 3GKXA 2B1LA 1OAZA 1OC8A 4XCSA 1PL2A 1JZWA 4EKZA 1K3OA 1ERUA 1XWKA 3C1SA 5G5EA 2L6DA 3QD9A 1T7PB 7GSSA 1KNGA 3I43A 4HJMA 1H75A 5CREA 1J08A 3M3MA 2OBIA 2JSZA 3CTFA 4MH3A 4EDYA 5DDLA 1A24A 3VK9A 2GZYA 1FO5A 2JADA 3GSTA 4TR1A 4MABA 4TRXA 1XWAA 2OKAA 4HDEA 2FCHA 2A4HA 4EDZA 5GZZB 2C3TA 4K7IA 5G5FA 2VD0A 3GKMA 1PKWA 5DALB 2JSYA 1PL1A 3O76A 4LA1A 3TKSA 2LJRA 1W4VA 4WR5A 2V6OA 1GLPA 1T00A 3GV1A 4OO5A 3QFBC 1YF1A 2WS2A 4OFMA 1THOA 1SU9A 3MNGA 5DAKA 18GSA 1FB0A 3RPNA 4F0CA 3IDVA 4G10A 1G7EA 1LBKA 1WMJA 2GQKA 2WULA 3FZ4A 3VWXA 3HYPA 4PXOA 4XS1A 3F6DA 5AN1A 5E4WA 4AJ8A 3ZIJA 4LL1B 4G0LA 4E8HA 2C1YA 4DSRA 4BL7B 4ZBDA 2PGTA 3N9JA 5F8BA 2MBSA 2V1MA 3HXSA 3MYDA 5CAXA 2MMZA 4ECCA 4KE3A 2R0PA 9GSSA 3PR8A 3GH9A 2ALBA 2OADA 3CXGA 3ZYWA 2YANA 1HD2A 3GX8A 1ST9A 2GSQA 1E2YA 2MZCA 2TIRA 4FQUA 1MD3A 1X5DA 3KM6A 1PA3A 1EEMA 3MIXA 1TI3A 4RI7A 1OC9A 2X8HA 2IMIA 2C8UA 1SD8A 4DVCA 1B9YC 1TRVA 1O6JA 4MLYA 2LRTA 3ZL5A 3M8NA 4Z2RA 2A2PA 2R4VA 1JZRA 2NDOA 4GWRA 4OFTA 2E0QA 3GTUA 1OYJA 3TRPA 3H93A 3CYNA 5JCGA 2MBTA 5DCGA 5EPFA 4POBA 4EO3A 2DJ3A 3DVXA 1A2JA 4MF6A 3BOAA 3HVXA 1XZOA 5J5NA 2FD3A 3HJOA 2OE0A 1OVNA 2NVLA 4BWQA 1GUKA 1ML6A 5F06A 3HKRA 4XIHA 3LYKA 1TTZA 2HRKA 5J3RA 4RQXA 3ZFLA 1DE1A 2QA2A 2HFDA 4MNNA 4V2NA 2O89A 1OKTA 3DKSA 2H0HA 4HUAA 2ZCTA 1N8JA 1YDKA 1O73A 1HQOA 3TKQA 3UOMA 5FWGA 2X64A 4GF0A 1SL0B 3KGKA 3TJFA 22GSA 4IELA 3TOUA 1JLVA 6GSXA 5D9WA 1ILOA 2LNSA 5BRTA 3HVSA 1VF4A 5FT3A 2J23A 4IBPA 2IIYA 1O7UA 2O87A 2PVOC 5ELAA 3VWWA 3IHGA 1FVJA 2L5LA 3FYGA 4J56E 11GSA 5G1KA 3F9UA 1PKZA 3GSSA 2CZ3A 2LJKA 1X5EA 1K0NA 3R3EA 1OKDA 4BIKA 4XRAA 3QAVA 2K9FA 4A5PA 3UAPA 4FYBA 3WT2A 2DJKA 6GSYA 4F82A 1DBYA 2HSHA 1THXA 2K8SA 5DAKB 4PTSA 2PWJA 3PINA 1SK2A 3FR9A 2H75A 4IS0A 2H72A 1GTUA 1RK4A 3NIVA 4O32A 3LWAA 1MEKA 4ZB9A 3ED3A 4L0WA 3KXOA 1S3AA 2G0FA 3F63A 1DE2A 2GVPA 1GSUA 4QL7A 3IBHA 1Q98A 1EGRA 2L4CA 4ISDA 1BEDA 5CNWA 2H1DA 2HT9A 4GQFA 17GSA 3R2QA 2VOCA 3IPZA 3IXRA 4ECIA 3GN3A 3EURA 1BJXA 2CZ2A 1YF0A 4NV2A 1TK0B 4OCFA 3ISOA 2JL4A 1SD9A 3P90A 4RI6A 5G1LA 3EU3A 1OC9B 3HY2A 3TRQA 2VL9A 4PGTA 1EP8A 1V57A 3KP8A 2V2GA 2WDUA 3KMNA 1CQGA 3H4KA 4IW9A 5EY6A 3DIEA 2VL3A 1M2AA 5CRHA 2YV9A 2MMAA 3VI5A 2B5XA 1FB6A 5AIVA 1LJRA 1XW6A 3GTUB 4HZ2A 3ERFA 3UVHA 1AAZA 2FUG2 1ZYQB 3GHAA 3HJMA 4GSNA 4GXZA 2V41A 3KP9A 3J7Yk 2CVKA 5A4VA 1GH2A 1TRWA 3HVVA 4O5QA 1ON4A 4N10A 5KN0A 3RDWA 1EOGA 2R5GA 2GQLA 1XFLA 1T3BA 3IA1A 4IGJA 2LTKA 2I1UA 4FH8A 2JZTA 1GSSA 1QXHA 3LGCA 2ON5A 4AGSA 3L0HA 5HR2A 4I8BA 1Z7RA 4XTSA 2WB9A 1PSQA 1KBNA 2H6XA 2WRTA 1X0RA 2RIIA 4GQCA 2DLXA 3SBCA 1XPVA 1XWBA 4K0NA 1MDIA 2IWTA 3NOFA 3TJKA 1J9BA 5HFKA 2LKUA 4KX4A 1PN9A 2VLUA 5A5KA 2N5BA 4Z2TA 4BA7A 3RHCA 1WJKA 2IMKA 2ZNMA 10GSA 2X49A 2IL3A 1PN0A 1M7TA 3IAS2 1V2AA 2IJYA 2CX3A 4TOPA 4HZ4A 4IJIA 5IO2A 2VAFA 5D9VA 4F2IA 1TRSA 2YWIA 2YCDA 3CSIA 3IAM2 2LQOA 3H8QA 1WP0A 2FGXA 2PMTA 1DUGA 2JU5A 2VO4A 2B3SA 4KA0A 1Z7PA 5IMVA 2OE3A 4J2FA 4JBBA 3V1WA 5EL8A 4PNFA 1N2AA 3HD5A 6GSVA 3UEMA 1TW9A 3IHQA 3FW2A 1ABAA 2G2QA 4IN0A 3F4RA 5D9XA 1TU7A 4DSQA 1YEPA 3MAKA 2H19A 2JZRA 3EC3A 3ME8A 2J9HA 4YQMA 3F6FA 1GNWA 2X4AA 4XRDA 1AXDA 3FR3A 3LEFA 2HRAA 2DIYA 3TRXA 1XIYA 2YN1A 2H76A 3A2XA 3I69A 4KB3A 2P5QA 2MMNA 1NW2A 4MDCA 3IK9A 4TW5A 2KHPA 2FY6A 1M3JA 3F3QA 2HSYA 3C8EA 3ZREA 4YKFA 3UBLA 2MYGA 4TR0A 2B6MA 3M0FA 1QFNA 2ON7A 4MF5A 3CRTA 1F37A 5G2ZA 1Z9HA 2R3XA 4I97A 1YQ1A 1Z6MA 4FIWA 3HVNA 1OE8A 1JLWA 2REMA 5JWQB 2JZSA 4MH2A 1JZDA 4K7NA 2B5EA 1K3YA 2HI7A 4IKHA 4NXIA 4F9ZA 3IC8A 1UVZA 1AW9A 12GSA 4TXOA 1USBA 1YY7A 3ERWA 1SYRA 4PUAA 2F8FA 2VL2A 2VCQA 2HLSA 2YP6A 1K0MA 3GRXA 1B48A 5ECNB 2FA4A 5E59A 3LW9A 4JRRA 2EC4A 1U3AA 1PD21 1BG5A 2RM5A 4ZL9A 3KD0A 2YZHA 5B7CA 3M1GA 4CHSA 1GSEA 3BJ5A 2UZ8A 2VLTA 2VCXA 3M9KA 2H30A 3A3TA 4MZCA 3LJRA 2XBIA 3TB2A 2KP2A 3QAWA 3IV4A 3FRCA 5ECRB 2H1GA 4ZBAA 2H66A 4ULXA 4H86A 5KN1A 3BD2A 2IPAA 3I6AA 3QFAC 2IMFA 3WT1A 1A8YA 4YKGA 1XVWA 5CO3A 1G6YA 3DVWA 20GSA 3FMWA 4RQRA 4DSSB 4L8EA 1OC3A 1M9AA 2LSTA 4QL9A 3L9UA 2QGVA 2V32A 3GL5A 5CP1A 2C0GA 4MA9A 1PX6A 4MK3A 3DEXA 1EV4A 3A2WA 4IJ3A 4IQAA 2YOIA 1K0CA 3E9JB 2P0GA 2JACA 5GAPD 2H0IA 1B9XC 3DXBA 2L5OA 2VD1A 5B8BA 4IP6A 2CVDA 1BX9A 3D4TA 4QQ7A 1AQXA 1XBSA 3APOA 4KAEA 1GNEA 5IMZA 4K2DA 1M99A 5HQPA 2DJ2A 3QMXA 3LXTA 2YPMA 6GSUA 5FHIA 4FYUA 1T4ZA 5IMFA 1T1VA 3ERGA 3PH9A 1Y25A 3KCMA 1QGVA 5A4WA 5IOXA 4MJCA 2LJAA 3ZVJA 4EXJA 1ERVA 2H70A 4N30A 1PFOA 4EUYA 3TJBA 5COHA 3C73A 5J4UA 4TN8A 1V40A 4ICYA 4G9HA 1TI1A 3BCIA 3D4MA 2DMMA 3GFKA 5F07A 3HCZA 4X0XA 1GTBA 1I5GA 1WOUA 3HDCA 2HZEA 2NTOA 1BYEA 1TRUA 2DBCA 2I3YA 2M46A 2E7PA 3D22A 5ELGA 4AJ6A 3CTGA 5BMUA 4K7OA 3TDGA 4MZWA 2FA8A 1PQNA 2R0CA 3GKKA 3DGQA 2GDRA 4TXOB 5LCZA 1UC7A 1VRSD 3MWHA 3EINA 2D2ZA 3TKPA 4P3YB 2C4JA 2FWGA 5D96A 5ECPB 4XS6A 3EE2A 2FWHA 2LUSA 1JFUA 3J7Yb 4Q5FA 3D5JA 3LXZA 4GRFA 3TKRA 3CSHA 3L78A 4TKYA 4TR3A 2GS3A 3L9SA 1G7OA 2R37A 1R5AA 5JWRB 1Z3EA 4Q5QA 2WFCA 4L0UA 2EIOA 2PVQA 4EL1A 3LSZA 2AHEA 2NBSA 4KDUA 4V1Ap 2GSTA 3BBYA 2H8LA 3O6TA 3PPUA 4F0BA 4ZL7A 4JR4A 4OFNA 2PPTA 2VCTA 5H5QA 2C0DA 3L9VA 3TKSE 5JWOB 1EWXA 5GAND 1MDJA 4ZL8A 6GSWA 4EIPA 1O8WA 1Y6EA 3EYTA 2B7JA 3GURA 1GSFA 2Z9SA 1EP7A 3HZ8A 2GSSA 1I9DA 3LORA 3KIJA 5HFGA 3IE3A 4XS4A 4G2EA 2R6KA 1WE0A 4ZBBA 1S3RA 2OBKA 2FWEA 3ZMLA 5AIXA 3WGDA 4ECJA 1GWCA 4PURA 1GSDA 1ZYNA 3US3A 1A8LA 4GCIA 1QK8A 1G6WA 2AJQB 1EGOA 4K2XA 3GL3A 2QKEA 1EOHA 5JCWA 5D8IA 2TRXA 1QUWA 1E6BA 1YZXA 3GNJA 2CAIA 3TJGA 1GTIA 1GUHA 3DWVA 4IHUA 3H1NA 2I4AA 2C80A 3UMAA 1M9BA 1S3DA 3FKFA 1FOVA 4YAPA 1MDKA 2GZZA 3ZFBA 4CDOA 2GLRA 16GSA 1X5CA 4HU9A 3NZNA 5ECIB 5ECMB 3LFLA 3C1RA 2O8VB 4TVEA 2DJ1A 4NPBA 2BJXA 4X4JA 3ZIVA 5HR0A 2HZEB 4GTUA 5DCHA 4MJEA 1TP9A 5F0GA 2HZFA 2XC2A 2GSRA 2V6KA 1Z6NA 2F9SA 2DSAA 5DVBA 2VCZA 1C72A 4ZB8A 2YJHA 1U88A 3QOUA 4IP1A 2E2MA 4CY6A 2VUPA 5HR1A 2CA8A 3IRAA 2HSMA 1FAAA 5J9BA 4DEJA 1MTCA 1GL8A 2DC5A 1QQ2A 1A23A 1XWGA 5IQYA 5C00A 2VL2C 3DRNA 4X43A 3U5RE 4PQ1A 4OWYA 4MJBA 2GT5A 6GSTA 2IFQA 4YQVA 1FW1A 3VFIA 2OA7A 5DJLA 1R4WA 1XOAA 2DMLA 2DKIA 3UBKA 1M3IA 2VM1A 1B4PA 1ERTA 3P2AA 4DSSA 2RM6A 3GX0A 1WWJA 3RHBA 1Z5YE 3PGTA 1GUMA 3HJPA 2PUKC 1F9MA 2H71A 4EVMA 4WF4A 3EU4A 3UIWA 3TKSC 4FO5A 5HFIA 4JEDA 3GIXA 1BQ7A 1EV9A 2FLSA 4Z2UA 3SWLA 1GRXA 4MPGA 4V1Ag 5JCUA 1XW5A 5CRDA 3WD6A 3TJJA 4KNDA 5DJMA 3ZTLA 3GMFA 3TOTA 1GSYA 1TDIA 1R7HA 4KF9A 4I5QA 2F3MA 1XXUA 3CSJA 14GSA 2L57A 4BWSA 1XG8A 4EC0A 4HI7A 1YKAA 1AQVA 2BTOT 3P7XA 1T8EB 4XHMA 4V2LA 2H01A 1F3BA 4G0IA 4XS4B 4K6XA 1YJ6A 5CRGA 2A2SA 2TRCP 2PERA 2H6YA 5B6NA 5G31A 4I2TA 4E8EA 3M9JA 2HE3A 4NHWA 1T4YA 1ZGNA 3AY8A 3CBUA 4L5OA 4OMVA 2CAQA 2GQMA 2AUVA 3Q18A 1UA5A 4GSSA 3KH7A 5IMCA 6GSSA 2IN3A 4YH2A 5KN3A 5B6MA 1HNCA 4AF2A 3Q74A 3CMIA 3C7MA 1IYHA 4KDYA 1SJ6A 1PX7A 3ZVJD 4RUVA 1NSWA 3C71A 1K0AA 4KUNA 4JE1A 2K18A 4D73A 1XVQA 2P5RA 1FHEA 3WYWA 1ZCPA 3CQFA 2LQQA 1K0BA 4PQIA 4G19A 5DQSA 3S9FA 1S3CA 4PNGA 5L71A 2HNLA 4KCAA 13GSA 4IQ1A 4WR4A 4BVXA 2I9HA 1SKWB 2C0FA 4LMVA 4HSCX 2MMOA 1TXXA 1VF1A 3UL3A 3HA9A 2H1BA 3QR6A 1QMVA 5ID2A 4JU5A 1ZZYA 1JZOA 4BPYA 1KEBA 1TK8B 1O81A 1GSQA 2F51A 2CV4A 4GSTA 1SL1B 1XWCA 4TR4A 2AV4A 1NM3A 2IFQB 1ZYPA 5D93A 1K0DA 2K6VA 2ES7A 5ECSA 1B4QA 1F2EA 1X9WB 4KDXA 2M80A 3GYKA 2H74A 3IOSA 1XCCA 3FZ5A 4MPFA 1YKCA 1F3AA 1H4OA 5ECKB 2O7KA 3E3EA 3G7YA 1SJIA 2K8VA 4N11A 3D0ZA 2WGRA 4HU7A 5KOWA 2H73A 4KCEA 4HEA2 3L4NA 3LQ7A 1PRXA 2A4VA 8GSSA 1PGTA 1A0FA 1U3IA 1V98A 2C3QA 3FHKA 3W8JA 4NWYA 2VIMA 3UJ1A 2L4QA 3VPTA 3ZZXA 2PU9C 4G0KA 4O7HA 5ECHB 2KLXA 2PBJA 2I81A 4K8MA 2LRNA 3Q19A 2RUFA 1FG4A 3OR5A 4ACSA 4Q5NA 4JZQA 4JR6A 4BVYB 2LEGA 3TUEA 2E2GA 1KTEA 2QC7A 2C0EA 2OACA 2X8CA 5KN2A 2GT6A 2HRFA 3N5OA 4L5LA 5LNKe 3E0UA 1TKDB 3JCML 4WBRD 5KOXA 2HYXA 3DYRA 1GTAA 4NAXA 1JHBA 3FK8A 4WF5A
chains in the Genus database with same CATH topology
3VWVA 3G7JA 2DKHA 3P8WA 2HXKA 3QDNA 5INYA 4K5RA 1WRYA 1U6TA 2B5YA 4FYCA 3G9BA 1J0FA 3APSA 3WGEA 3FEUA 1RW1A 2GZPA 4N0ZA 1HYUA 5AISA 5KEJA 2HRNA 5F05A 2N5FA 3FZAA 4OD7A 4D73B 3HZ4A 5B8AA 4ZXGA 2NPBA 2FWFA 1RQMA 1M2BA 2H1AA 5IO0A 3UARA 5IPHA 2GTUA 3GKNA 4HQSA 4OO4A 1DSBA 2R2JA 3LG6A 5IMAA 2CQ9A 3KEBA 2OJLA 1B8XA 4V2MA 4BVXB 2LV3A 3RAZA 1CQHA 4I6XA 5LD0A 4MF7A 3ZLPA 1ZYEA 3D21A 2O85A 4MJAA 3LYPA 5EVOA 4EIQA 2XBQA 1IYIA 4TR1B 1ZL9A 5A4UA 5ID2B 1MD4A 3EMPA 3DMLA 4EE0A 3KJYA 2H0GA 4IVFA 1UN2A 1HNBA 3G7IA 3EWLA 4WXTA 2L59A 5GSTA 1AQWA 4PX1A 3EVIA 4NHZA 5CYYA 2RLIA 3BCKA 3FY7A 4KSMA 1A2LA 4Q5RA 1HNAA 1R26A 2LS5A 5IOWA 1ERWA 4NMUA 2OE1A 2FNOA 1AC1A 1TOFA 3WGXA 3KZQA 5ENUA 1X9MB 3ZMKA 4MCUA 1GP1A 4O92A 4WETA 4N0VA 4MZBA 2YWOA 4PUFC 3VWUA 2QA1A 4POMA 2YJ7A 5DBQA 1V58A 2VCWA 1SJZA 4HJ2A 4KSOA 3FR6A 3GA4A 4K5SA 2LNTA 4K9ZA 1SKSB 1GULA 4ZB6A 3GUSA 4K0GA 4TXVA 3EMXA 4USSA 2B1KA 3CRUA 4YAVA 3O3TA 1ACVA 3W8SA 2PN8A 4HS1A 5GSSA 5J41A 2B7KA 4MP4A 3VI7A 2LRCA 4CW9A 3MSZA 2IMDA 3RBTA 1FOHA 1SK0A 1URMA 2C3NA 4Z7XA 4ML1A 3DD3A 3VPQA 1M0UA 5ECOB 5HR3A 3HHVA 2VLVA 3TGZA 1TJDA 4ID0A 2KOKA 4WEYA 3UVTA 5IMDA 3H79A 5G30A 3Q6OA 4HOJA 3GH6A 1WPIA 3F0IA 5CRWA 3F3RA 3ZRDA 3K8NA 1FVKA 3EPTA 3A2VA 4MMMA 3KH9A 1O8XA 4EF0A 4NV5A 3F4TA 2H6ZA 1SKRB 3KTBA 5D9TA 5IIZA 2F8AA 2AAWA 4OCEA 1U87A 2CVBA 1R5PA 2BMXA 1VF2A 4F03A 1AIUA 2FHEA 5D73A 1ZMAA 2P31A 2DJ0A 2X8GA 2QSIA 2CX4A 3VURA 3FZ9A 1G0TA 2CT6A 4O5UA 3RPPA 2VCVA 2ZUPA 2WCIA 5DALA 5IPGA 1X9SB 2DJJA 1K0OA 4POLA 3APQA 3U6VA 5J9CA 1OE7A 1XW9A 1A0RP 1K3LA 2GGTA 1BAYA 5DQYA 2M72A 1VF3A 3TCOA 4ILFA 2VM2A 5H5SA 3QCPA 3A5WA 4O5RA 3F8UA 4PQHA 2DIZA 4KH7A 4LL4B 2IMEA 1NHOA 5IM9A 3ME7A 1EEJA 4ECBA 1GLQA 4BL7A 2KUCA 2X99A 4POKA 19GSA 3IK7A 4J57E 5ABRA 4LLRA 5ECQB 2AYTA 3QAGA 3IC4A 2RUEA 1A2MA 1W89A 1ZOFA 2AB6A 3F4SA 2YWMA 2XPEA 2XPDA 3ZITA 2XHFA 1Q4JA 4AJ7A 1SENA 2R0GA 2YV7A 1O85A 3I9V2 4HQZA 3VLNA 4BVYA 1M2DA 2A2RA 3KMOA 4GLTA 1SK1A 5ECLB 1SYXA 3QPMA 4X1UA 1NHYA 3D6IA 2WZ9A 4KW6A 3W6GA 1AUCA 4ZILA 2YWNA 3A5IA 1XOBA 2YZUA 4YQUA 5C04A 3KTLA 2N5AA 4CY8A 4KGIA 2EIQA 1TK5B 1SL2B 4ML6A 3MDKA 1V9WA 2YNXA 1VGLA 5AGYA 3IR4A 1PMTA 1WIKA 2EIRA 2WJUA 2L6CA 1EZKA 2KP1A 4ZIJA 4WBJA 4K1FA 1F6MC 1LU4A 4WKWA 1TU8A 5H5RA 4LMWA 1YEXA 4I2UA 3GKXA 2B1LA 1OAZA 1OC8A 4XCSA 1PL2A 1JZWA 4EKZA 1K3OA 1ERUA 1XWKA 3C1SA 5G5EA 2L6DA 3QD9A 1T7PB 7GSSA 1KNGA 3I43A 4HJMA 1H75A 5CREA 1J08A 3M3MA 2OBIA 2JSZA 3CTFA 4MH3A 4EDYA 5DDLA 1A24A 3VK9A 2GZYA 1FO5A 2JADA 3GSTA 4TR1A 4MABA 4TRXA 1XWAA 2OKAA 4HDEA 2FCHA 2A4HA 4EDZA 5GZZB 2C3TA 4K7IA 5G5FA 2VD0A 3GKMA 1PKWA 5DALB 2JSYA 1PL1A 3O76A 4LA1A 3TKSA 2LJRA 1W4VA 4WR5A 2V6OA 1GLPA 1T00A 3GV1A 4OO5A 3QFBC 1YF1A 2WS2A 4OFMA 1THOA 1SU9A 3MNGA 5DAKA 18GSA 1FB0A 3RPNA 4F0CA 3IDVA 4G10A 1G7EA 1LBKA 1WMJA 2GQKA 2WULA 3FZ4A 3VWXA 3HYPA 4PXOA 4XS1A 3F6DA 5AN1A 5E4WA 4AJ8A 3ZIJA 4LL1B 4G0LA 4E8HA 2C1YA 4DSRA 4BL7B 4ZBDA 2PGTA 3N9JA 5F8BA 2MBSA 2V1MA 3HXSA 3MYDA 5CAXA 2MMZA 4ECCA 4KE3A 2R0PA 9GSSA 3GH9A 3PR8A 2ALBA 2OADA 3CXGA 3ZYWA 2YANA 1HD2A 3GX8A 1ST9A 2GSQA 1E2YA 2MZCA 2TIRA 4FQUA 1MD3A 1X5DA 3KM6A 1PA3A 1EEMA 3MIXA 1TI3A 4RI7A 1OC9A 2X8HA 2IMIA 2C8UA 1SD8A 4DVCA 1B9YC 1TRVA 1O6JA 4MLYA 2LRTA 3ZL5A 3M8NA 4Z2RA 2A2PA 2R4VA 1JZRA 2NDOA 4GWRA 4OFTA 2E0QA 3GTUA 1OYJA 3TRPA 3H93A 3CYNA 5JCGA 2MBTA 5DCGA 5EPFA 4POBA 4EO3A 2DJ3A 3DVXA 1A2JA 4MF6A 3BOAA 3HVXA 1XZOA 5J5NA 2FD3A 3HJOA 2OE0A 1OVNA 2NVLA 4BWQA 1GUKA 1ML6A 5F06A 3HKRA 4XIHA 3LYKA 1TTZA 2HRKA 5J3RA 4RQXA 3ZFLA 1DE1A 2QA2A 2HFDA 4MNNA 4V2NA 2O89A 1OKTA 3DKSA 2H0HA 4HUAA 2ZCTA 1N8JA 1YDKA 1O73A 1HQOA 3TKQA 3UOMA 5FWGA 2X64A 4GF0A 1SL0B 3KGKA 3TJFA 22GSA 4IELA 3TOUA 1JLVA 6GSXA 5D9WA 1ILOA 2LNSA 5BRTA 3HVSA 1VF4A 5FT3A 2J23A 4IBPA 2IIYA 1O7UA 2O87A 2PVOC 5ELAA 3VWWA 3IHGA 1FVJA 2L5LA 3FYGA 4J56E 11GSA 5G1KA 3F9UA 1PKZA 3GSSA 2CZ3A 2LJKA 1X5EA 1K0NA 3R3EA 1OKDA 4XRAA 3QAVA 2K9FA 4A5PA 3UAPA 4FYBA 3WT2A 2DJKA 6GSYA 4F82A 1DBYA 2HSHA 1THXA 2K8SA 5DAKB 4PTSA 2PWJA 3PINA 1SK2A 3FR9A 2H75A 4IS0A 2H72A 1GTUA 1RK4A 3NIVA 4O32A 3LWAA 1MEKA 4ZB9A 3ED3A 4L0WA 3KXOA 1S3AA 2G0FA 3F63A 1DE2A 2GVPA 1GSUA 4QL7A 3IBHA 1Q98A 1EGRA 2L4CA 4ISDA 1BEDA 5CNWA 2H1DA 2HT9A 4GQFA 17GSA 3R2QA 2VOCA 3IPZA 3IXRA 4ECIA 3GN3A 3EURA 1BJXA 2CZ2A 1YF0A 4NV2A 1TK0B 4OCFA 3ISOA 2JL4A 1SD9A 3P90A 4RI6A 5G1LA 3EU3A 1OC9B 3HY2A 3TRQA 2VL9A 4PGTA 1EP8A 1V57A 3KP8A 2V2GA 2WDUA 3KMNA 1CQGA 3H4KA 4IW9A 5EY6A 3DIEA 2VL3A 1M2AA 5CRHA 2YV9A 2MMAA 3VI5A 2B5XA 1FB6A 5AIVA 1LJRA 1XW6A 3GTUB 4HZ2A 3ERFA 3UVHA 1AAZA 2FUG2 1ZYQB 3GHAA 3HJMA 4GSNA 4GXZA 2V41A 3KP9A 3J7Yk 2CVKA 5A4VA 1GH2A 1TRWA 3HVVA 4O5QA 1ON4A 4N10A 5KN0A 3RDWA 1EOGA 2R5GA 2GQLA 1XFLA 1T3BA 3IA1A 4IGJA 2LTKA 2I1UA 4FH8A 2JZTA 1GSSA 1QXHA 3LGCA 2ON5A 4AGSA 3L0HA 5HR2A 4I8BA 1Z7RA 4XTSA 2WB9A 1PSQA 1KBNA 2H6XA 2WRTA 1X0RA 2RIIA 4GQCA 2DLXA 3SBCA 1XPVA 1XWBA 4K0NA 1MDIA 2IWTA 3NOFA 3TJKA 1J9BA 5HFKA 2LKUA 4KX4A 1PN9A 2VLUA 5A5KA 2N5BA 4Z2TA 4BA7A 3RHCA 1WJKA 2IMKA 2ZNMA 10GSA 2X49A 2IL3A 1PN0A 1M7TA 3IAS2 1V2AA 2IJYA 2CX3A 4TOPA 4HZ4A 4IJIA 5IO2A 2VAFA 5D9VA 4F2IA 1TRSA 2YWIA 2YCDA 3CSIA 3IAM2 2LQOA 3H8QA 1WP0A 2FGXA 2PMTA 1DUGA 2JU5A 2VO4A 2B3SA 4KA0A 1Z7PA 5IMVA 2OE3A 4J2FA 4JBBA 3V1WA 5EL8A 4PNFA 1N2AA 3HD5A 6GSVA 3UEMA 1TW9A 3IHQA 3FW2A 1ABAA 2G2QA 4IN0A 3F4RA 5D9XA 1TU7A 4DSQA 1YEPA 3MAKA 2H19A 2JZRA 3EC3A 3ME8A 2J9HA 4YQMA 3F6FA 1GNWA 2X4AA 4XRDA 1AXDA 3FR3A 3LEFA 2HRAA 2DIYA 3TRXA 1XIYA 2YN1A 2H76A 3A2XA 3I69A 4KB3A 2P5QA 2MMNA 1NW2A 4MDCA 3IK9A 4TW5A 2KHPA 2FY6A 3F3QA 2HSYA 3C8EA 3ZREA 4YKFA 3UBLA 2MYGA 4TR0A 2B6MA 3M0FA 1QFNA 2ON7A 4MF5A 3CRTA 1F37A 5G2ZA 1Z9HA 2R3XA 4I97A 1YQ1A 1Z6MA 4FIWA 1OE8A 1JLWA 2REMA 5JWQB 2JZSA 4MH2A 1JZDA 4K7NA 2B5EA 1K3YA 2HI7A 4IKHA 4NXIA 4F9ZA 3IC8A 1UVZA 1AW9A 12GSA 4TXOA 1USBA 1YY7A 3ERWA 1SYRA 4PUAA 2F8FA 2VL2A 2VCQA 2HLSA 2YP6A 1K0MA 3GRXA 1B48A 5ECNB 2FA4A 5E59A 3LW9A 4JRRA 2EC4A 1U3AA 1PD21 1BG5A 2RM5A 4ZL9A 3KD0A 2YZHA 5B7CA 3M1GA 4CHSA 1GSEA 3BJ5A 2UZ8A 2VLTA 2VCXA 3M9KA 2H30A 3A3TA 4MZCA 3LJRA 2XBIA 3TB2A 2KP2A 3QAWA 3IV4A 3FRCA 5ECRB 2H1GA 4ZBAA 2H66A 4ULXA 4H86A 5KN1A 3BD2A 2IPAA 3I6AA 3QFAC 2IMFA 3WT1A 1A8YA 4YKGA 1XVWA 5CO3A 1G6YA 3DVWA 20GSA 3FMWA 4RQRA 4DSSB 4L8EA 1OC3A 1M9AA 2LSTA 4QL9A 3L9UA 2QGVA 2V32A 3GL5A 5CP1A 2C0GA 4MA9A 1PX6A 4MK3A 3DEXA 1EV4A 3A2WA 4IJ3A 4IQAA 2YOIA 1K0CA 3E9JB 2P0GA 2JACA 5GAPD 2H0IA 1B9XC 3DXBA 2L5OA 2VD1A 5B8BA 4IP6A 2CVDA 1BX9A 3D4TA 4QQ7A 1AQXA 1XBSA 3APOA 4KAEA 1GNEA 5IMZA 4K2DA 1M99A 5HQPA 2DJ2A 3QMXA 3LXTA 2YPMA 6GSUA 5FHIA 4FYUA 1T4ZA 5IMFA 1T1VA 3ERGA 3PH9A 1Y25A 3KCMA 1QGVA 5A4WA 5IOXA 4MJCA 2LJAA 3ZVJA 4EXJA 1ERVA 2H70A 4N30A 4EUYA 3TJBA 5COHA 3C73A 5J4UA 4TN8A 1V40A 4ICYA 4G9HA 1TI1A 3BCIA 3D4MA 2DMMA 3GFKA 5F07A 3HCZA 4X0XA 1GTBA 1I5GA 1WOUA 3HDCA 2HZEA 2NTOA 1BYEA 1TRUA 2DBCA 2I3YA 2M46A 2E7PA 3D22A 5ELGA 4AJ6A 3CTGA 5BMUA 4K7OA 3TDGA 4MZWA 2FA8A 1PQNA 2R0CA 3GKKA 3DGQA 2GDRA 4TXOB 5LCZA 1UC7A 1VRSD 3MWHA 3EINA 2D2ZA 3TKPA 4P3YB 2C4JA 2FWGA 5D96A 5ECPB 4XS6A 3EE2A 2FWHA 2LUSA 1JFUA 3J7Yb 4Q5FA 3D5JA 3LXZA 4GRFA 3TKRA 3CSHA 3L78A 4TKYA 4TR3A 2GS3A 3L9SA 1G7OA 2R37A 1R5AA 5JWRB 1Z3EA 4Q5QA 2WFCA 4L0UA 2EIOA 2PVQA 4EL1A 3LSZA 2AHEA 2NBSA 4KDUA 4V1Ap 2GSTA 3BBYA 2H8LA 3O6TA 3PPUA 4F0BA 4ZL7A 4JR4A 4OFNA 2PPTA 2VCTA 5H5QA 2C0DA 3L9VA 3TKSE 5JWOB 1EWXA 5GAND 1MDJA 4ZL8A 6GSWA 4EIPA 1O8WA 1Y6EA 3EYTA 2B7JA 3GURA 1GSFA 2Z9SA 1EP7A 3HZ8A 2GSSA 1I9DA 3LORA 3KIJA 5HFGA 3IE3A 4XS4A 4G2EA 2R6KA 1WE0A 4ZBBA 2OBKA 2FWEA 3ZMLA 5AIXA 3WGDA 4ECJA 1GWCA 4PURA 1GSDA 1ZYNA 3US3A 1A8LA 4GCIA 1QK8A 1G6WA 2AJQB 1EGOA 4K2XA 3GL3A 2QKEA 1EOHA 5JCWA 5D8IA 2TRXA 1QUWA 1E6BA 1YZXA 3GNJA 2CAIA 3TJGA 1GTIA 1GUHA 3DWVA 4IHUA 3H1NA 2I4AA 2C80A 3UMAA 1M9BA 1S3DA 3FKFA 1FOVA 4YAPA 1MDKA 2GZZA 3ZFBA 4CDOA 2GLRA 16GSA 1X5CA 4HU9A 3NZNA 5ECIB 5ECMB 3LFLA 3C1RA 2O8VB 4TVEA 2DJ1A 4NPBA 2BJXA 4X4JA 3ZIVA 5HR0A 2HZEB 4GTUA 5DCHA 4MJEA 1TP9A 5F0GA 2HZFA 2XC2A 2GSRA 2V6KA 1Z6NA 2F9SA 2DSAA 5DVBA 2VCZA 1C72A 4ZB8A 2YJHA 1U88A 3QOUA 4IP1A 2E2MA 4CY6A 2VUPA 5HR1A 2CA8A 3IRAA 2HSMA 1FAAA 5J9BA 4DEJA 1MTCA 1GL8A 2DC5A 1QQ2A 1A23A 1XWGA 5IQYA 5C00A 2VL2C 3DRNA 4X43A 3U5RE 4PQ1A 4OWYA 4MJBA 2GT5A 6GSTA 2IFQA 4YQVA 1FW1A 3VFIA 2OA7A 5DJLA 1R4WA 1XOAA 2DMLA 2DKIA 3UBKA 2VM1A 1B4PA 1ERTA 3P2AA 4DSSA 2RM6A 3GX0A 1WWJA 3RHBA 1Z5YE 3PGTA 1GUMA 3HJPA 2PUKC 1F9MA 2H71A 4EVMA 4WF4A 3EU4A 3UIWA 3TKSC 4FO5A 5HFIA 4JEDA 3GIXA 1BQ7A 1EV9A 2FLSA 4Z2UA 3SWLA 1GRXA 4MPGA 4V1Ag 5JCUA 1XW5A 5CRDA 3WD6A 3TJJA 4KNDA 5DJMA 3ZTLA 3GMFA 3TOTA 1GSYA 1TDIA 1R7HA 4KF9A 4I5QA 2F3MA 1XXUA 3CSJA 14GSA 2L57A 4BWSA 4EC0A 4HI7A 1YKAA 1AQVA 2BTOT 3P7XA 1T8EB 4XHMA 4V2LA 2H01A 1F3BA 4G0IA 4XS4B 4K6XA 1YJ6A 5CRGA 2A2SA 2TRCP 2PERA 2H6YA 5B6NA 5G31A 4I2TA 4E8EA 3M9JA 2HE3A 4NHWA 1T4YA 1ZGNA 3AY8A 3CBUA 4L5OA 4OMVA 2CAQA 2GQMA 2AUVA 3Q18A 1UA5A 4GSSA 3KH7A 5IMCA 6GSSA 2IN3A 4YH2A 5KN3A 5B6MA 1HNCA 4AF2A 3Q74A 3CMIA 3C7MA 1IYHA 4KDYA 1SJ6A 1PX7A 3ZVJD 4RUVA 1NSWA 3C71A 1K0AA 4KUNA 4JE1A 2K18A 4D73A 1XVQA 2P5RA 1FHEA 3WYWA 1ZCPA 2LQQA 1K0BA 4PQIA 4G19A 5DQSA 3S9FA 1S3CA 4PNGA 5L71A 2HNLA 4KCAA 13GSA 4IQ1A 4WR4A 4BVXA 2I9HA 1SKWB 2C0FA 4LMVA 2MMOA 1TXXA 1VF1A 3UL3A 3HA9A 2H1BA 3QR6A 1QMVA 5ID2A 4JU5A 1ZZYA 1JZOA 4BPYA 1KEBA 1TK8B 1O81A 1GSQA 2F51A 2CV4A 4GSTA 1SL1B 1XWCA 4TR4A 2AV4A 1NM3A 2IFQB 1ZYPA 5D93A 1K0DA 2K6VA 2ES7A 5ECSA 1B4QA 1F2EA 1X9WB 4KDXA 2M80A 3GYKA 2H74A 3IOSA 1XCCA 3FZ5A 4MPFA 1YKCA 1F3AA 1H4OA 5ECKB 2O7KA 3E3EA 3G7YA 1SJIA 2K8VA 4N11A 3D0ZA 2WGRA 4HU7A 5KOWA 2H73A 4KCEA 4HEA2 3L4NA 3LQ7A 1PRXA 2A4VA 8GSSA 1PGTA 1A0FA 1U3IA 1V98A 2C3QA 3FHKA 3W8JA 4NWYA 2VIMA 3UJ1A 2L4QA 3VPTA 3ZZXA 2PU9C 4G0KA 4O7HA 5ECHB 2KLXA 2PBJA 2I81A 4K8MA 2LRNA 3Q19A 2RUFA 1FG4A 3OR5A 4ACSA 4Q5NA 4JZQA 4JR6A 4BVYB 2LEGA 3TUEA 2E2GA 1KTEA 2QC7A 2C0EA 2OACA 2X8CA 5KN2A 2GT6A 2HRFA 3N5OA 4L5LA 5LNKe 3E0UA 1TKDB 3JCML 4WBRD 5KOXA 2HYXA 3DYRA 1GTAA 4NAXA 1JHBA 3FK8A 4WF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VWV A;  3G7J A;  3P8W A;  2HXK A;  3QDN A;  5INY A;  1WRY A;  1U6T A;  2B5Y A;  4FYC A;  3G9B A;  1J0F A;  3APS A;  3WGE A;  3FEU A;  1RW1 A;  2GZP A;  4N0Z A;  1HYU A;  5AIS A;  5KEJ A;  2HRN A;  5F05 A;  2N5F A;  3FZA A;  4OD7 A;  4D73 B;  3HZ4 A;  5B8A A;  4ZXG A;  2NPB A;  2FWF A;  1RQM A;  1M2B A;  2H1A A;  5IO0 A;  3UAR A;  5IPH A;  2GTU A;  3GKN A;  4HQS A;  4OO4 A;  1DSB A;  2R2J A;  3LG6 A;  5IMA A;  2CQ9 A;  3KEB A;  2OJL A;  1B8X A;  4V2M A;  2LV3 A;  3RAZ A;  1CQH A;  4I6X A;  5LD0 A;  4MF7 A;  3ZLP A;  1ZYE A;  3D21 A;  2O85 A;  4MJA A;  3LYP A;  5EVO A;  2XBQ A;  1IYI A;  4TR1 B;  1ZL9 A;  5A4U A;  5ID2 B;  1MD4 A;  3EMP A;  3DML A;  4EE0 A;  3KJY A;  2H0G A;  4IVF A;  1UN2 A;  1HNB A;  3G7I A;  3EWL A;  4WXT A;  2L59 A;  5GST A;  1AQW A;  4PX1 A;  3EVI A;  4NHZ A;  5CYY A;  2RLI A;  3BCK A;  3FY7 A;  4KSM A;  1A2L A;  4Q5R A;  1HNA A;  1R26 A;  2LS5 A;  5IOW A;  1ERW A;  4NMU A;  2OE1 A;  2FNO A;  1AC1 A;  1TOF A;  3WGX A;  3KZQ A;  5ENU A;  1X9M B;  3ZMK A;  4MCU A;  1GP1 A;  4O92 A;  4WET A;  4N0V A;  4MZB A;  2YWO A;  4PUF C;  3VWU A;  4POM A;  2YJ7 A;  5DBQ A;  1V58 A;  2VCW A;  1SJZ A;  4HJ2 A;  4KSO A;  3FR6 A;  3GA4 A;  2LNT A;  4K9Z A;  1SKS B;  1GUL A;  4ZB6 A;  3GUS A;  4K0G A;  4TXV A;  3EMX A;  2B1K A;  3CRU A;  4YAV A;  3O3T A;  1ACV A;  3W8S A;  2PN8 A;  4HS1 A;  5GSS A;  5J41 A;  2B7K A;  4MP4 A;  3VI7 A;  2LRC A;  4CW9 A;  3MSZ A;  2IMD A;  3RBT A;  1SK0 A;  1URM A;  2C3N A;  4Z7X A;  4ML1 A;  3DD3 A;  3VPQ A;  1M0U A;  5ECO B;  5HR3 A;  3HHV A;  2VLV A;  3TGZ A;  1TJD A;  4ID0 A;  2KOK A;  4WEY A;  3UVT A;  5IMD A;  3H79 A;  5G30 A;  3Q6O A;  4HOJ A;  3GH6 A;  1WPI A;  3F0I A;  5CRW A;  3F3R A;  3ZRD A;  3K8N A;  1FVK A;  3A2V A;  4MMM A;  3KH9 A;  1O8X A;  4EF0 A;  4NV5 A;  3F4T A;  2H6Z A;  1SKR B;  3KTB A;  5D9T A;  5IIZ A;  2F8A A;  2AAW A;  4OCE A;  1U87 A;  2CVB A;  1R5P A;  2BMX A;  1VF2 A;  4F03 A;  1AIU A;  2FHE A;  5D73 A;  1ZMA A;  2P31 A;  2DJ0 A;  2X8G A;  2QSI A;  2CX4 A;  3VUR A;  3FZ9 A;  1G0T A;  2CT6 A;  3RPP A;  2VCV A;  2ZUP A;  2WCI A;  5DAL A;  5IPG A;  1X9S B;  2DJJ A;  1K0O A;  4POL A;  3APQ A;  3U6V A;  5J9C A;  1OE7 A;  1XW9 A;  1A0R P;  1K3L A;  2GGT A;  1BAY A;  5DQY A;  2M72 A;  1VF3 A;  3TCO A;  4ILF A;  2VM2 A;  5H5S A;  3QCP A;  3A5W A;  4O5R A;  3F8U A;  4PQH A;  2DIZ A;  4KH7 A;  4LL4 B;  2IME A;  1NHO A;  5IM9 A;  3ME7 A;  1EEJ A;  4ECB A;  1GLQ A;  4BL7 A;  2KUC A;  2X99 A;  4POK A;  19GS A;  3IK7 A;  4J57 E;  5ABR A;  4LLR A;  5ECQ B;  2AYT A;  3QAG A;  3IC4 A;  2RUE A;  1A2M A;  1W89 A;  1ZOF A;  2AB6 A;  3F4S A;  2YWM A;  2XPE A;  2XPD A;  3ZIT A;  2XHF A;  1Q4J A;  4AJ7 A;  1SEN A;  2YV7 A;  1O85 A;  3I9V 2;  4HQZ A;  3VLN A;  4BVY A;  1M2D A;  2A2R A;  3KMO A;  4GLT A;  1SK1 A;  5ECL B;  1SYX A;  3QPM A;  4X1U A;  1NHY A;  3D6I A;  2WZ9 A;  4KW6 A;  3W6G A;  1AUC A;  4ZIL A;  2YWN A;  1XOB A;  2YZU A;  4YQU A;  5C04 A;  3KTL A;  2N5A A;  4KGI A;  2EIQ A;  1TK5 B;  1SL2 B;  4ML6 A;  3MDK A;  1V9W A;  2YNX A;  1VGL A;  5AGY A;  3IR4 A;  1PMT A;  1WIK A;  2EIR A;  2WJU A;  2L6C A;  1EZK A;  2KP1 A;  4ZIJ A;  4WBJ A;  4K1F A;  1F6M C;  1LU4 A;  4WKW A;  1TU8 A;  5H5R A;  4LMW A;  1YEX A;  4I2U A;  3GKX A;  2B1L A;  1OAZ A;  1OC8 A;  4XCS A;  1PL2 A;  1JZW A;  4EKZ A;  1K3O A;  1ERU A;  1XWK A;  3C1S A;  5G5E A;  2L6D A;  3QD9 A;  1T7P B;  7GSS A;  1KNG A;  3I43 A;  4HJM A;  1H75 A;  5CRE A;  1J08 A;  3M3M A;  2OBI A;  2JSZ A;  3CTF A;  4MH3 A;  4EDY A;  5DDL A;  1A24 A;  3VK9 A;  2GZY A;  1FO5 A;  2JAD A;  3GST A;  4TR1 A;  4MAB A;  4TRX A;  1XWA A;  2OKA A;  4HDE A;  2FCH A;  4EDZ A;  5GZZ B;  2C3T A;  4K7I A;  5G5F A;  2VD0 A;  3GKM A;  1PKW A;  5DAL B;  2JSY A;  1PL1 A;  3O76 A;  4LA1 A;  3TKS A;  2LJR A;  1W4V A;  4WR5 A;  2V6O A;  1GLP A;  1T00 A;  3GV1 A;  4OO5 A;  3QFB C;  1YF1 A;  2WS2 A;  4OFM A;  1THO A;  1SU9 A;  3MNG A;  5DAK A;  18GS A;  1FB0 A;  3RPN A;  4F0C A;  3IDV A;  4G10 A;  1G7E A;  1LBK A;  1WMJ A;  2GQK A;  2WUL A;  3FZ4 A;  3VWX A;  3HYP A;  4PXO A;  4XS1 A;  3F6D A;  5AN1 A;  5E4W A;  4AJ8 A;  3ZIJ A;  4LL1 B;  4E8H A;  2C1Y A;  4DSR A;  4ZBD A;  2PGT A;  3N9J A;  5F8B A;  2MBS A;  2V1M A;  3HXS A;  5CAX A;  2MMZ A;  4ECC A;  4KE3 A;  9GSS A;  3GH9 A;  3PR8 A;  2ALB A;  2OAD A;  3CXG A;  3ZYW A;  2YAN A;  1HD2 A;  3GX8 A;  1ST9 A;  2GSQ A;  1E2Y A;  2MZC A;  2TIR A;  1MD3 A;  1X5D A;  3KM6 A;  1PA3 A;  1EEM A;  1TI3 A;  4RI7 A;  1OC9 A;  2X8H A;  2IMI A;  2C8U A;  1SD8 A;  4DVC A;  1B9Y C;  1TRV A;  1O6J A;  4MLY A;  2LRT A;  3ZL5 A;  3M8N A;  2R4V A;  1JZR A;  2NDO A;  4GWR A;  4OFT A;  2E0Q A;  3GTU A;  1OYJ A;  3TRP A;  3H93 A;  3CYN A;  5JCG A;  2MBT A;  5DCG A;  5EPF A;  4POB A;  4EO3 A;  2DJ3 A;  3DVX A;  1A2J A;  4MF6 A;  3BOA A;  3HVX A;  1XZO A;  5J5N A;  2FD3 A;  3HJO A;  2OE0 A;  1OVN A;  2NVL A;  4BWQ A;  1GUK A;  1ML6 A;  5F06 A;  3HKR A;  4XIH A;  3LYK A;  1TTZ A;  5J3R A;  4RQX A;  3ZFL A;  1DE1 A;  2HFD A;  4V2N A;  2O89 A;  1OKT A;  3DKS A;  2H0H A;  4HUA A;  2ZCT A;  1N8J A;  1YDK A;  1O73 A;  1HQO A;  3TKQ A;  3UOM A;  5FWG A;  2X64 A;  4GF0 A;  1SL0 B;  3KGK A;  3TJF A;  22GS A;  4IEL A;  3TOU A;  1JLV A;  6GSX A;  5D9W A;  1ILO A;  2LNS A;  3HVS A;  1VF4 A;  5FT3 A;  2J23 A;  4IBP A;  2IIY A;  1O7U A;  2O87 A;  2PVO C;  5ELA A;  3VWW A;  1FVJ A;  2L5L A;  3FYG A;  4J56 E;  11GS A;  5G1K A;  3F9U A;  1PKZ A;  3GSS A;  2CZ3 A;  2LJK A;  1X5E A;  1K0N A;  1OKD A;  4XRA A;  3QAV A;  2K9F A;  3UAP A;  4FYB A;  3WT2 A;  2DJK A;  6GSY A;  4F82 A;  1DBY A;  2HSH A;  1THX A;  2K8S A;  5DAK B;  2PWJ A;  3PIN A;  1SK2 A;  3FR9 A;  2H75 A;  4IS0 A;  2H72 A;  1GTU A;  1RK4 A;  3NIV A;  4O32 A;  3LWA A;  1MEK A;  4ZB9 A;  3ED3 A;  4L0W A;  3KXO A;  1S3A A;  2G0F A;  3F63 A;  1DE2 A;  2GVP A;  1GSU A;  4QL7 A;  3IBH A;  1Q98 A;  1EGR A;  2L4C A;  4ISD A;  1BED A;  5CNW A;  2H1D A;  2HT9 A;  4GQF A;  17GS A;  3R2Q A;  2VOC A;  3IPZ A;  3IXR A;  4ECI A;  3GN3 A;  3EUR A;  1BJX A;  2CZ2 A;  1YF0 A;  4NV2 A;  1TK0 B;  4OCF A;  3ISO A;  2JL4 A;  1SD9 A;  3P90 A;  4RI6 A;  5G1L A;  3EU3 A;  1OC9 B;  3HY2 A;  3TRQ A;  2VL9 A;  4PGT A;  1EP8 A;  1V57 A;  3KP8 A;  2V2G A;  2WDU A;  3KMN A;  1CQG A;  3H4K A;  4IW9 A;  5EY6 A;  3DIE A;  2VL3 A;  1M2A A;  5CRH A;  2YV9 A;  2MMA A;  3VI5 A;  2B5X A;  1FB6 A;  5AIV A;  1LJR A;  1XW6 A;  3GTU B;  4HZ2 A;  3ERF A;  3UVH A;  1AAZ A;  2FUG 2;  1ZYQ B;  3GHA A;  3HJM A;  4GSN A;  4GXZ A;  2V41 A;  3KP9 A;  3J7Y k;  2CVK A;  5A4V A;  1GH2 A;  1TRW A;  3HVV A;  1ON4 A;  4N10 A;  5KN0 A;  3RDW A;  1EOG A;  2R5G A;  2GQL A;  1XFL A;  1T3B A;  3IA1 A;  4IGJ A;  2LTK A;  2I1U A;  4FH8 A;  2JZT A;  1GSS A;  1QXH A;  3LGC A;  2ON5 A;  4AGS A;  3L0H A;  5HR2 A;  4I8B A;  1Z7R A;  4XTS A;  2WB9 A;  1PSQ A;  1KBN A;  2H6X A;  2WRT A;  1X0R A;  2RII A;  4GQC A;  2DLX A;  3SBC A;  1XPV A;  1XWB A;  4K0N A;  1MDI A;  2IWT A;  3NOF A;  3TJK A;  1J9B A;  5HFK A;  2LKU A;  4KX4 A;  1PN9 A;  2VLU A;  5A5K A;  2N5B A;  4BA7 A;  3RHC A;  1WJK A;  2IMK A;  2ZNM A;  10GS A;  2IL3 A;  1M7T A;  3IAS 2;  1V2A A;  2IJY A;  2CX3 A;  4TOP A;  4HZ4 A;  4IJI A;  5IO2 A;  2VAF A;  5D9V A;  4F2I A;  1TRS A;  2YWI A;  2YCD A;  3CSI A;  3IAM 2;  2LQO A;  3H8Q A;  1WP0 A;  2FGX A;  2PMT A;  1DUG A;  2JU5 A;  2VO4 A;  2B3S A;  4KA0 A;  1Z7P A;  5IMV A;  2OE3 A;  4J2F A;  4JBB A;  3V1W A;  5EL8 A;  4PNF A;  1N2A A;  3HD5 A;  6GSV A;  3UEM A;  1TW9 A;  3IHQ A;  3FW2 A;  1ABA A;  2G2Q A;  4IN0 A;  3F4R A;  5D9X A;  1TU7 A;  4DSQ A;  1YEP A;  3MAK A;  2H19 A;  2JZR A;  3EC3 A;  3ME8 A;  2J9H A;  4YQM A;  3F6F A;  1GNW A;  4XRD A;  1AXD A;  3FR3 A;  3LEF A;  2DIY A;  3TRX A;  1XIY A;  2YN1 A;  2H76 A;  3A2X A;  3I69 A;  4KB3 A;  2P5Q A;  2MMN A;  1NW2 A;  4MDC A;  3IK9 A;  4TW5 A;  2KHP A;  2FY6 A;  3F3Q A;  2HSY A;  3C8E A;  3ZRE A;  3UBL A;  2MYG A;  4TR0 A;  2B6M A;  3M0F A;  1QFN A;  2ON7 A;  4MF5 A;  3CRT A;  1F37 A;  5G2Z A;  1Z9H A;  2R3X A;  4I97 A;  1YQ1 A;  1Z6M A;  4FIW A;  1OE8 A;  1JLW A;  2REM A;  5JWQ B;  2JZS A;  4MH2 A;  1JZD A;  4K7N A;  2B5E A;  1K3Y A;  2HI7 A;  4IKH A;  4NXI A;  4F9Z A;  1UVZ A;  1AW9 A;  12GS A;  4TXO A;  1USB A;  1YY7 A;  3ERW A;  1SYR A;  4PUA A;  2F8F A;  2VL2 A;  2VCQ A;  2HLS A;  2YP6 A;  1K0M A;  3GRX A;  1B48 A;  5ECN B;  2FA4 A;  5E59 A;  4JRR A;  2EC4 A;  1U3A A;  1PD2 1;  1BG5 A;  2RM5 A;  4ZL9 A;  3KD0 A;  2YZH A;  5B7C A;  3M1G A;  4CHS A;  1GSE A;  3BJ5 A;  2VLT A;  2VCX A;  3M9K A;  2H30 A;  3A3T A;  4MZC A;  3LJR A;  2XBI A;  3TB2 A;  2KP2 A;  3QAW A;  3IV4 A;  3FRC A;  5ECR B;  2H1G A;  4ZBA A;  2H66 A;  4ULX A;  4H86 A;  5KN1 A;  3BD2 A;  2IPA A;  3I6A A;  3QFA C;  2IMF A;  3WT1 A;  1A8Y A;  1XVW A;  5CO3 A;  1G6Y A;  3DVW A;  20GS A;  4RQR A;  4DSS B;  4L8E A;  1OC3 A;  1M9A A;  2LST A;  4QL9 A;  3L9U A;  2QGV A;  2V32 A;  3GL5 A;  5CP1 A;  2C0G A;  4MA9 A;  1PX6 A;  4MK3 A;  3DEX A;  1EV4 A;  3A2W A;  4IJ3 A;  4IQA A;  2YOI A;  1K0C A;  3E9J B;  2P0G A;  2JAC A;  5GAP D;  2H0I A;  1B9X C;  3DXB A;  2L5O A;  2VD1 A;  5B8B A;  4IP6 A;  2CVD A;  1BX9 A;  3D4T A;  4QQ7 A;  1AQX A;  1XBS A;  3APO A;  4KAE A;  1GNE A;  5IMZ A;  4K2D A;  1M99 A;  5HQP A;  2DJ2 A;  3QMX A;  3LXT A;  2YPM A;  6GSU A;  5FHI A;  4FYU A;  1T4Z A;  5IMF A;  1T1V A;  3ERG A;  3PH9 A;  1Y25 A;  3KCM A;  1QGV A;  5A4W A;  5IOX A;  4MJC A;  2LJA A;  3ZVJ A;  4EXJ A;  1ERV A;  2H70 A;  4N30 A;  4EUY A;  3TJB A;  5COH A;  3C73 A;  5J4U A;  4TN8 A;  1V40 A;  4G9H A;  1TI1 A;  3BCI A;  3D4M A;  2DMM A;  3GFK A;  5F07 A;  3HCZ A;  4X0X A;  1GTB A;  1I5G A;  1WOU A;  3HDC A;  2HZE A;  2NTO A;  1BYE A;  1TRU A;  2DBC A;  2I3Y A;  2M46 A;  2E7P A;  3D22 A;  5ELG A;  4AJ6 A;  3CTG A;  4K7O A;  3TDG A;  2FA8 A;  4MZW A;  1PQN A;  3GKK A;  3DGQ A;  2GDR A;  4TXO B;  5LCZ A;  1UC7 A;  1VRS D;  3MWH A;  3EIN A;  2D2Z A;  3TKP A;  4P3Y B;  2C4J A;  2FWG A;  5D96 A;  5ECP B;  4XS6 A;  3EE2 A;  2FWH A;  2LUS A;  1JFU A;  3J7Y b;  4Q5F A;  3D5J A;  3LXZ A;  4GRF A;  3TKR A;  3CSH A;  3L78 A;  4TKY A;  4TR3 A;  2GS3 A;  3L9S A;  1G7O A;  2R37 A;  1R5A A;  5JWR B;  1Z3E A;  4Q5Q A;  2WFC A;  4L0U A;  2EIO A;  2PVQ A;  4EL1 A;  3LSZ A;  2AHE A;  2NBS A;  4KDU A;  4V1A p;  2GST A;  3BBY A;  2H8L A;  3O6T A;  4F0B A;  4ZL7 A;  4JR4 A;  4OFN A;  2PPT A;  2VCT A;  5H5Q A;  2C0D A;  3L9V A;  3TKS E;  5JWO B;  1EWX A;  5GAN D;  1MDJ A;  4ZL8 A;  6GSW A;  1O8W A;  1Y6E A;  3EYT A;  2B7J A;  3GUR A;  1GSF A;  2Z9S A;  1EP7 A;  3HZ8 A;  2GSS A;  1I9D A;  3LOR A;  3KIJ A;  5HFG A;  3IE3 A;  4XS4 A;  4G2E A;  2R6K A;  1WE0 A;  4ZBB A;  2OBK A;  2FWE A;  3ZML A;  5AIX A;  3WGD A;  4ECJ A;  1GWC A;  4PUR A;  1GSD A;  3US3 A;  1A8L A;  4GCI A;  1QK8 A;  1G6W A;  2AJQ B;  1EGO A;  3GL3 A;  2QKE A;  1EOH A;  5JCW A;  5D8I A;  2TRX A;  1QUW A;  1E6B A;  1YZX A;  3GNJ A;  2CAI A;  3TJG A;  1GTI A;  1GUH A;  3DWV A;  4IHU A;  3H1N A;  2I4A A;  2C80 A;  3UMA A;  1M9B A;  1S3D A;  3FKF A;  1FOV A;  4YAP A;  1MDK A;  2GZZ A;  3ZFB A;  4CDO A;  2GLR A;  16GS A;  1X5C A;  4HU9 A;  3NZN A;  5ECI B;  5ECM B;  3LFL A;  3C1R A;  2O8V B;  4TVE A;  2DJ1 A;  4NPB A;  2BJX A;  3ZIV A;  5HR0 A;  2HZE B;  4GTU A;  5DCH A;  4MJE A;  1TP9 A;  5F0G A;  2HZF A;  2XC2 A;  2GSR A;  2V6K A;  1Z6N A;  2F9S A;  2DSA A;  5DVB A;  2VCZ A;  1C72 A;  4ZB8 A;  2YJH A;  1U88 A;  3QOU A;  4IP1 A;  2E2M A;  2VUP A;  5HR1 A;  2CA8 A;  3IRA A;  1FAA A;  5J9B A;  4DEJ A;  1MTC A;  1GL8 A;  2DC5 A;  1QQ2 A;  1A23 A;  1XWG A;  5IQY A;  5C00 A;  2VL2 C;  3DRN A;  4X43 A;  3U5R E;  4PQ1 A;  4OWY A;  4MJB A;  2GT5 A;  6GST A;  2IFQ A;  4YQV A;  1FW1 A;  3VFI A;  2OA7 A;  5DJL A;  1R4W A;  1XOA A;  2DML A;  3UBK A;  2VM1 A;  1B4P A;  1ERT A;  3P2A A;  4DSS A;  2RM6 A;  3GX0 A;  1WWJ A;  3RHB A;  1Z5Y E;  3PGT A;  1GUM A;  3HJP A;  2PUK C;  1F9M A;  2H71 A;  4EVM A;  4WF4 A;  3EU4 A;  3UIW A;  3TKS C;  4FO5 A;  5HFI A;  4JED A;  3GIX A;  1BQ7 A;  1EV9 A;  2FLS A;  3SWL A;  1GRX A;  4MPG A;  4V1A g;  5JCU A;  1XW5 A;  5CRD A;  3WD6 A;  3TJJ A;  4KND A;  5DJM A;  3ZTL A;  3GMF A;  3TOT A;  1GSY A;  1TDI A;  1R7H A;  4I5Q A;  2F3M A;  1XXU A;  3CSJ A;  14GS A;  2L57 A;  4BWS A;  4EC0 A;  4HI7 A;  1YKA A;  1AQV A;  2BTO T;  3P7X A;  1T8E B;  4XHM A;  4V2L A;  2H01 A;  1F3B A;  4XS4 B;  4K6X A;  1YJ6 A;  5CRG A;  2A2S A;  2TRC P;  2PER A;  2H6Y A;  5B6N A;  5G31 A;  4I2T A;  4E8E A;  3M9J A;  2HE3 A;  4NHW A;  1T4Y A;  1ZGN A;  3AY8 A;  3CBU A;  4L5O A;  4OMV A;  2CAQ A;  2GQM A;  2AUV A;  3Q18 A;  1UA5 A;  4GSS A;  3KH7 A;  5IMC A;  6GSS A;  2IN3 A;  4YH2 A;  5KN3 A;  5B6M A;  1HNC A;  4AF2 A;  3Q74 A;  3CMI A;  3C7M A;  1IYH A;  4KDY A;  1SJ6 A;  1PX7 A;  3ZVJ D;  4RUV A;  1NSW A;  3C71 A;  1K0A A;  4KUN A;  4JE1 A;  2K18 A;  4D73 A;  1XVQ A;  2P5R A;  1FHE A;  3WYW A;  1ZCP A;  2LQQ A;  1K0B A;  4PQI A;  4G19 A;  5DQS A;  3S9F A;  1S3C A;  4PNG A;  5L71 A;  2HNL A;  4KCA A;  13GS A;  4IQ1 A;  4WR4 A;  4BVX A;  2I9H A;  1SKW B;  2C0F A;  4LMV A;  2MMO A;  1TXX A;  1VF1 A;  3UL3 A;  3HA9 A;  2H1B A;  3QR6 A;  1QMV A;  5ID2 A;  4JU5 A;  1ZZY A;  1JZO A;  4BPY A;  1KEB A;  1TK8 B;  1O81 A;  1GSQ A;  2F51 A;  2CV4 A;  4GST A;  1SL1 B;  1XWC A;  4TR4 A;  2AV4 A;  1NM3 A;  2IFQ B;  5D93 A;  1K0D A;  2K6V A;  2ES7 A;  5ECS A;  1B4Q A;  1F2E A;  1X9W B;  4KDX A;  2M80 A;  3GYK A;  2H74 A;  3IOS A;  1XCC A;  3FZ5 A;  4MPF A;  1YKC A;  1F3A A;  1H4O A;  5ECK B;  2O7K A;  3E3E A;  3G7Y A;  1SJI A;  2K8V A;  4N11 A;  3D0Z A;  2WGR A;  4HU7 A;  2H73 A;  4KCE A;  4HEA 2;  3L4N A;  3LQ7 A;  1PRX A;  2A4V A;  8GSS A;  1PGT A;  1A0F A;  1U3I A;  1V98 A;  2C3Q A;  3FHK A;  3W8J A;  4NWY A;  2VIM A;  3UJ1 A;  2L4Q A;  3VPT A;  3ZZX A;  2PU9 C;  4O7H A;  5ECH B;  2KLX A;  2PBJ A;  2I81 A;  4K8M A;  2LRN A;  3Q19 A;  2RUF A;  1FG4 A;  3OR5 A;  4ACS A;  4Q5N A;  4JZQ A;  4JR6 A;  2LEG A;  3TUE A;  2E2G A;  1KTE A;  2QC7 A;  2C0E A;  2OAC A;  2X8C A;  5KN2 A;  2GT6 A;  2HRF A;  3N5O A;  4L5L A;  5LNK e;  3E0U A;  1TKD B;  3JCM L;  4WBR D;  2HYX A;  3DYR A;  1GTA A;  4NAX A;  1JHB A;  3FK8 A;  4WF5 A; 
#chains in the Genus database with same CATH topology
 3VWV A;  3G7J A;  2DKH A;  3P8W A;  2HXK A;  3QDN A;  5INY A;  4K5R A;  1WRY A;  1U6T A;  2B5Y A;  4FYC A;  3G9B A;  1J0F A;  3APS A;  3WGE A;  3FEU A;  1RW1 A;  2GZP A;  4N0Z A;  1HYU A;  5AIS A;  5KEJ A;  2HRN A;  5F05 A;  2N5F A;  3FZA A;  4OD7 A;  4D73 B;  3HZ4 A;  5B8A A;  4ZXG A;  2NPB A;  2FWF A;  1RQM A;  1M2B A;  2H1A A;  5IO0 A;  3UAR A;  5IPH A;  2GTU A;  3GKN A;  4HQS A;  4OO4 A;  1DSB A;  2R2J A;  3LG6 A;  5IMA A;  2CQ9 A;  3KEB A;  2OJL A;  1B8X A;  4V2M A;  4BVX B;  2LV3 A;  3RAZ A;  1CQH A;  4I6X A;  5LD0 A;  4MF7 A;  3ZLP A;  1ZYE A;  3D21 A;  2O85 A;  4MJA A;  3LYP A;  5EVO A;  4EIQ A;  2XBQ A;  1IYI A;  4TR1 B;  1ZL9 A;  5A4U A;  5ID2 B;  1MD4 A;  3EMP A;  3DML A;  4EE0 A;  3KJY A;  2H0G A;  4IVF A;  1UN2 A;  1HNB A;  3G7I A;  3EWL A;  4WXT A;  2L59 A;  5GST A;  1AQW A;  4PX1 A;  3EVI A;  4NHZ A;  5CYY A;  2RLI A;  3BCK A;  3FY7 A;  4KSM A;  1A2L A;  4Q5R A;  1HNA A;  1R26 A;  2LS5 A;  5IOW A;  1ERW A;  4NMU A;  2OE1 A;  2FNO A;  1AC1 A;  1TOF A;  3WGX A;  3KZQ A;  5ENU A;  1X9M B;  3ZMK A;  4MCU A;  1GP1 A;  4O92 A;  4WET A;  4N0V A;  4MZB A;  2YWO A;  4PUF C;  3VWU A;  2QA1 A;  4POM A;  2YJ7 A;  5DBQ A;  1V58 A;  2VCW A;  1SJZ A;  4HJ2 A;  4KSO A;  3FR6 A;  3GA4 A;  4K5S A;  2LNT A;  4K9Z A;  1SKS B;  1GUL A;  4ZB6 A;  3GUS A;  4K0G A;  4TXV A;  3EMX A;  4USS A;  2B1K A;  3CRU A;  4YAV A;  3O3T A;  1ACV A;  3W8S A;  2PN8 A;  4HS1 A;  5GSS A;  5J41 A;  2B7K A;  4MP4 A;  3VI7 A;  2LRC A;  4CW9 A;  3MSZ A;  2IMD A;  3RBT A;  1FOH A;  1SK0 A;  1URM A;  2C3N A;  4Z7X A;  4ML1 A;  3DD3 A;  3VPQ A;  1M0U A;  5ECO B;  5HR3 A;  3HHV A;  2VLV A;  3TGZ A;  1TJD A;  4ID0 A;  2KOK A;  4WEY A;  3UVT A;  5IMD A;  3H79 A;  5G30 A;  3Q6O A;  4HOJ A;  3GH6 A;  1WPI A;  3F0I A;  5CRW A;  3F3R A;  3ZRD A;  3K8N A;  1FVK A;  3EPT A;  3A2V A;  4MMM A;  3KH9 A;  1O8X A;  4EF0 A;  4NV5 A;  3F4T A;  2H6Z A;  1SKR B;  3KTB A;  5D9T A;  5IIZ A;  2F8A A;  2AAW A;  4OCE A;  1U87 A;  2CVB A;  1R5P A;  2BMX A;  1VF2 A;  4F03 A;  1AIU A;  2FHE A;  5D73 A;  1ZMA A;  2P31 A;  2DJ0 A;  2X8G A;  2QSI A;  2CX4 A;  3VUR A;  3FZ9 A;  1G0T A;  2CT6 A;  4O5U A;  3RPP A;  2VCV A;  2ZUP A;  2WCI A;  5DAL A;  5IPG A;  1X9S B;  2DJJ A;  1K0O A;  4POL A;  3APQ A;  3U6V A;  5J9C A;  1OE7 A;  1XW9 A;  1A0R P;  1K3L A;  2GGT A;  1BAY A;  5DQY A;  2M72 A;  1VF3 A;  3TCO A;  4ILF A;  2VM2 A;  5H5S A;  3QCP A;  3A5W A;  4O5R A;  3F8U A;  4PQH A;  2DIZ A;  4KH7 A;  4LL4 B;  2IME A;  1NHO A;  5IM9 A;  3ME7 A;  1EEJ A;  4ECB A;  1GLQ A;  4BL7 A;  2KUC A;  2X99 A;  4POK A;  19GS A;  3IK7 A;  4J57 E;  5ABR A;  4LLR A;  5ECQ B;  2AYT A;  3QAG A;  3IC4 A;  2RUE A;  1A2M A;  1W89 A;  1ZOF A;  2AB6 A;  3F4S A;  2YWM A;  2XPE A;  2XPD A;  3ZIT A;  2XHF A;  1Q4J A;  4AJ7 A;  1SEN A;  2R0G A;  2YV7 A;  1O85 A;  3I9V 2;  4HQZ A;  3VLN A;  4BVY A;  1M2D A;  2A2R A;  3KMO A;  4GLT A;  1SK1 A;  5ECL B;  1SYX A;  3QPM A;  4X1U A;  1NHY A;  3D6I A;  2WZ9 A;  4KW6 A;  3W6G A;  1AUC A;  4ZIL A;  2YWN A;  3A5I A;  1XOB A;  2YZU A;  4YQU A;  5C04 A;  3KTL A;  2N5A A;  4CY8 A;  4KGI A;  2EIQ A;  1TK5 B;  1SL2 B;  4ML6 A;  3MDK A;  1V9W A;  2YNX A;  1VGL A;  5AGY A;  3IR4 A;  1PMT A;  1WIK A;  2EIR A;  2WJU A;  2L6C A;  1EZK A;  2KP1 A;  4ZIJ A;  4WBJ A;  4K1F A;  1F6M C;  1LU4 A;  4WKW A;  1TU8 A;  5H5R A;  4LMW A;  1YEX A;  4I2U A;  3GKX A;  2B1L A;  1OAZ A;  1OC8 A;  4XCS A;  1PL2 A;  1JZW A;  4EKZ A;  1K3O A;  1ERU A;  1XWK A;  3C1S A;  5G5E A;  2L6D A;  3QD9 A;  1T7P B;  7GSS A;  1KNG A;  3I43 A;  4HJM A;  1H75 A;  5CRE A;  1J08 A;  3M3M A;  2OBI A;  2JSZ A;  3CTF A;  4MH3 A;  4EDY A;  5DDL A;  1A24 A;  3VK9 A;  2GZY A;  1FO5 A;  2JAD A;  3GST A;  4TR1 A;  4MAB A;  4TRX A;  1XWA A;  2OKA A;  4HDE A;  2FCH A;  2A4H A;  4EDZ A;  5GZZ B;  2C3T A;  4K7I A;  5G5F A;  2VD0 A;  3GKM A;  1PKW A;  5DAL B;  2JSY A;  1PL1 A;  3O76 A;  4LA1 A;  3TKS A;  2LJR A;  1W4V A;  4WR5 A;  2V6O A;  1GLP A;  1T00 A;  3GV1 A;  4OO5 A;  3QFB C;  1YF1 A;  2WS2 A;  4OFM A;  1THO A;  1SU9 A;  3MNG A;  5DAK A;  18GS A;  1FB0 A;  3RPN A;  4F0C A;  3IDV A;  4G10 A;  1G7E A;  1LBK A;  1WMJ A;  2GQK A;  2WUL A;  3FZ4 A;  3VWX A;  3HYP A;  4PXO A;  4XS1 A;  3F6D A;  5AN1 A;  5E4W A;  4AJ8 A;  3ZIJ A;  4LL1 B;  4G0L A;  4E8H A;  2C1Y A;  4DSR A;  4BL7 B;  4ZBD A;  2PGT A;  3N9J A;  5F8B A;  2MBS A;  2V1M A;  3HXS A;  3MYD A;  5CAX A;  2MMZ A;  4ECC A;  4KE3 A;  2R0P A;  9GSS A;  3PR8 A;  3GH9 A;  2ALB A;  2OAD A;  3CXG A;  3ZYW A;  2YAN A;  1HD2 A;  3GX8 A;  1ST9 A;  2GSQ A;  1E2Y A;  2MZC A;  2TIR A;  4FQU A;  1MD3 A;  1X5D A;  3KM6 A;  1PA3 A;  1EEM A;  3MIX A;  1TI3 A;  4RI7 A;  1OC9 A;  2X8H A;  2IMI A;  2C8U A;  1SD8 A;  4DVC A;  1B9Y C;  1TRV A;  1O6J A;  4MLY A;  2LRT A;  3ZL5 A;  3M8N A;  4Z2R A;  2A2P A;  2R4V A;  1JZR A;  2NDO A;  4GWR A;  4OFT A;  2E0Q A;  3GTU A;  1OYJ A;  3TRP A;  3H93 A;  3CYN A;  5JCG A;  2MBT A;  5DCG A;  5EPF A;  4POB A;  4EO3 A;  2DJ3 A;  3DVX A;  1A2J A;  4MF6 A;  3BOA A;  3HVX A;  1XZO A;  5J5N A;  2FD3 A;  3HJO A;  2OE0 A;  1OVN A;  2NVL A;  4BWQ A;  1GUK A;  1ML6 A;  5F06 A;  3HKR A;  4XIH A;  3LYK A;  1TTZ A;  2HRK A;  5J3R A;  4RQX A;  3ZFL A;  1DE1 A;  2QA2 A;  2HFD A;  4MNN A;  4V2N A;  2O89 A;  1OKT A;  3DKS A;  2H0H A;  4HUA A;  2ZCT A;  1N8J A;  1YDK A;  1O73 A;  1HQO A;  3TKQ A;  3UOM A;  5FWG A;  2X64 A;  4GF0 A;  1SL0 B;  3KGK A;  3TJF A;  22GS A;  4IEL A;  3TOU A;  1JLV A;  6GSX A;  5D9W A;  1ILO A;  2LNS A;  5BRT A;  3HVS A;  1VF4 A;  5FT3 A;  2J23 A;  4IBP A;  2IIY A;  1O7U A;  2O87 A;  2PVO C;  5ELA A;  3VWW A;  3IHG A;  1FVJ A;  2L5L A;  3FYG A;  4J56 E;  11GS A;  5G1K A;  3F9U A;  1PKZ A;  3GSS A;  2CZ3 A;  2LJK A;  1X5E A;  1K0N A;  3R3E A;  1OKD A;  4BIK A;  4XRA A;  3QAV A;  2K9F A;  4A5P A;  3UAP A;  4FYB A;  3WT2 A;  2DJK A;  6GSY A;  4F82 A;  1DBY A;  2HSH A;  1THX A;  2K8S A;  5DAK B;  4PTS A;  2PWJ A;  3PIN A;  1SK2 A;  3FR9 A;  2H75 A;  4IS0 A;  2H72 A;  1GTU A;  1RK4 A;  3NIV A;  4O32 A;  3LWA A;  1MEK A;  4ZB9 A;  3ED3 A;  4L0W A;  3KXO A;  1S3A A;  2G0F A;  3F63 A;  1DE2 A;  2GVP A;  1GSU A;  4QL7 A;  3IBH A;  1Q98 A;  1EGR A;  2L4C A;  4ISD A;  1BED A;  5CNW A;  2H1D A;  2HT9 A;  4GQF A;  17GS A;  3R2Q A;  2VOC A;  3IPZ A;  3IXR A;  4ECI A;  3GN3 A;  3EUR A;  1BJX A;  2CZ2 A;  1YF0 A;  4NV2 A;  1TK0 B;  4OCF A;  3ISO A;  2JL4 A;  1SD9 A;  3P90 A;  4RI6 A;  5G1L A;  3EU3 A;  1OC9 B;  3HY2 A;  3TRQ A;  2VL9 A;  4PGT A;  1EP8 A;  1V57 A;  3KP8 A;  2V2G A;  2WDU A;  3KMN A;  1CQG A;  3H4K A;  4IW9 A;  5EY6 A;  3DIE A;  2VL3 A;  1M2A A;  5CRH A;  2YV9 A;  2MMA A;  3VI5 A;  2B5X A;  1FB6 A;  5AIV A;  1LJR A;  1XW6 A;  3GTU B;  4HZ2 A;  3ERF A;  3UVH A;  1AAZ A;  2FUG 2;  1ZYQ B;  3GHA A;  3HJM A;  4GSN A;  4GXZ A;  2V41 A;  3KP9 A;  3J7Y k;  2CVK A;  5A4V A;  1GH2 A;  1TRW A;  3HVV A;  4O5Q A;  1ON4 A;  4N10 A;  5KN0 A;  3RDW A;  1EOG A;  2R5G A;  2GQL A;  1XFL A;  1T3B A;  3IA1 A;  4IGJ A;  2LTK A;  2I1U A;  4FH8 A;  2JZT A;  1GSS A;  1QXH A;  3LGC A;  2ON5 A;  4AGS A;  3L0H A;  5HR2 A;  4I8B A;  1Z7R A;  4XTS A;  2WB9 A;  1PSQ A;  1KBN A;  2H6X A;  2WRT A;  1X0R A;  2RII A;  4GQC A;  2DLX A;  3SBC A;  1XPV A;  1XWB A;  4K0N A;  1MDI A;  2IWT A;  3NOF A;  3TJK A;  1J9B A;  5HFK A;  2LKU A;  4KX4 A;  1PN9 A;  2VLU A;  5A5K A;  2N5B A;  4Z2T A;  4BA7 A;  3RHC A;  1WJK A;  2IMK A;  2ZNM A;  10GS A;  2X49 A;  2IL3 A;  1PN0 A;  1M7T A;  3IAS 2;  1V2A A;  2IJY A;  2CX3 A;  4TOP A;  4HZ4 A;  4IJI A;  5IO2 A;  2VAF A;  5D9V A;  4F2I A;  1TRS A;  2YWI A;  2YCD A;  3CSI A;  3IAM 2;  2LQO A;  3H8Q A;  1WP0 A;  2FGX A;  2PMT A;  1DUG A;  2JU5 A;  2VO4 A;  2B3S A;  4KA0 A;  1Z7P A;  5IMV A;  2OE3 A;  4J2F A;  4JBB A;  3V1W A;  5EL8 A;  4PNF A;  1N2A A;  3HD5 A;  6GSV A;  3UEM A;  1TW9 A;  3IHQ A;  3FW2 A;  1ABA A;  2G2Q A;  4IN0 A;  3F4R A;  5D9X A;  1TU7 A;  4DSQ A;  1YEP A;  3MAK A;  2H19 A;  2JZR A;  3EC3 A;  3ME8 A;  2J9H A;  4YQM A;  3F6F A;  1GNW A;  2X4A A;  4XRD A;  1AXD A;  3FR3 A;  3LEF A;  2HRA A;  2DIY A;  3TRX A;  1XIY A;  2YN1 A;  2H76 A;  3A2X A;  3I69 A;  4KB3 A;  2P5Q A;  2MMN A;  1NW2 A;  4MDC A;  3IK9 A;  4TW5 A;  2KHP A;  2FY6 A;  1M3J A;  3F3Q A;  2HSY A;  3C8E A;  3ZRE A;  4YKF A;  3UBL A;  2MYG A;  4TR0 A;  2B6M A;  3M0F A;  1QFN A;  2ON7 A;  4MF5 A;  3CRT A;  1F37 A;  5G2Z A;  1Z9H A;  2R3X A;  4I97 A;  1YQ1 A;  1Z6M A;  4FIW A;  3HVN A;  1OE8 A;  1JLW A;  2REM A;  5JWQ B;  2JZS A;  4MH2 A;  1JZD A;  4K7N A;  2B5E A;  1K3Y A;  2HI7 A;  4IKH A;  4NXI A;  4F9Z A;  3IC8 A;  1UVZ A;  1AW9 A;  12GS A;  4TXO A;  1USB A;  1YY7 A;  3ERW A;  1SYR A;  4PUA A;  2F8F A;  2VL2 A;  2VCQ A;  2HLS A;  2YP6 A;  1K0M A;  3GRX A;  1B48 A;  5ECN B;  2FA4 A;  5E59 A;  3LW9 A;  4JRR A;  2EC4 A;  1U3A A;  1PD2 1;  1BG5 A;  2RM5 A;  4ZL9 A;  3KD0 A;  2YZH A;  5B7C A;  3M1G A;  4CHS A;  1GSE A;  3BJ5 A;  2UZ8 A;  2VLT A;  2VCX A;  3M9K A;  2H30 A;  3A3T A;  4MZC A;  3LJR A;  2XBI A;  3TB2 A;  2KP2 A;  3QAW A;  3IV4 A;  3FRC A;  5ECR B;  2H1G A;  4ZBA A;  2H66 A;  4ULX A;  4H86 A;  5KN1 A;  3BD2 A;  2IPA A;  3I6A A;  3QFA C;  2IMF A;  3WT1 A;  1A8Y A;  4YKG A;  1XVW A;  5CO3 A;  1G6Y A;  3DVW A;  20GS A;  3FMW A;  4RQR A;  4DSS B;  4L8E A;  1OC3 A;  1M9A A;  2LST A;  4QL9 A;  3L9U A;  2QGV A;  2V32 A;  3GL5 A;  5CP1 A;  2C0G A;  4MA9 A;  1PX6 A;  4MK3 A;  3DEX A;  1EV4 A;  3A2W A;  4IJ3 A;  4IQA A;  2YOI A;  1K0C A;  3E9J B;  2P0G A;  2JAC A;  5GAP D;  2H0I A;  1B9X C;  3DXB A;  2L5O A;  2VD1 A;  5B8B A;  4IP6 A;  2CVD A;  1BX9 A;  3D4T A;  4QQ7 A;  1AQX A;  1XBS A;  3APO A;  4KAE A;  1GNE A;  5IMZ A;  4K2D A;  1M99 A;  5HQP A;  2DJ2 A;  3QMX A;  3LXT A;  2YPM A;  6GSU A;  5FHI A;  4FYU A;  1T4Z A;  5IMF A;  1T1V A;  3ERG A;  3PH9 A;  1Y25 A;  3KCM A;  1QGV A;  5A4W A;  5IOX A;  4MJC A;  2LJA A;  3ZVJ A;  4EXJ A;  1ERV A;  2H70 A;  4N30 A;  1PFO A;  4EUY A;  3TJB A;  5COH A;  3C73 A;  5J4U A;  4TN8 A;  1V40 A;  4ICY A;  4G9H A;  1TI1 A;  3BCI A;  3D4M A;  2DMM A;  3GFK A;  5F07 A;  3HCZ A;  4X0X A;  1GTB A;  1I5G A;  1WOU A;  3HDC A;  2HZE A;  2NTO A;  1BYE A;  1TRU A;  2DBC A;  2I3Y A;  2M46 A;  2E7P A;  3D22 A;  5ELG A;  4AJ6 A;  3CTG A;  5BMU A;  4K7O A;  3TDG A;  4MZW A;  2FA8 A;  1PQN A;  2R0C A;  3GKK A;  3DGQ A;  2GDR A;  4TXO B;  5LCZ A;  1UC7 A;  1VRS D;  3MWH A;  3EIN A;  2D2Z A;  3TKP A;  4P3Y B;  2C4J A;  2FWG A;  5D96 A;  5ECP B;  4XS6 A;  3EE2 A;  2FWH A;  2LUS A;  1JFU A;  3J7Y b;  4Q5F A;  3D5J A;  3LXZ A;  4GRF A;  3TKR A;  3CSH A;  3L78 A;  4TKY A;  4TR3 A;  2GS3 A;  3L9S A;  1G7O A;  2R37 A;  1R5A A;  5JWR B;  1Z3E A;  4Q5Q A;  2WFC A;  4L0U A;  2EIO A;  2PVQ A;  4EL1 A;  3LSZ A;  2AHE A;  2NBS A;  4KDU A;  4V1A p;  2GST A;  3BBY A;  2H8L A;  3O6T A;  3PPU A;  4F0B A;  4ZL7 A;  4JR4 A;  4OFN A;  2PPT A;  2VCT A;  5H5Q A;  2C0D A;  3L9V A;  3TKS E;  5JWO B;  1EWX A;  5GAN D;  1MDJ A;  4ZL8 A;  6GSW A;  4EIP A;  1O8W A;  1Y6E A;  3EYT A;  2B7J A;  3GUR A;  1GSF A;  2Z9S A;  1EP7 A;  3HZ8 A;  2GSS A;  1I9D A;  3LOR A;  3KIJ A;  5HFG A;  3IE3 A;  4XS4 A;  4G2E A;  2R6K A;  1WE0 A;  4ZBB A;  1S3R A;  2OBK A;  2FWE A;  3ZML A;  5AIX A;  3WGD A;  4ECJ A;  1GWC A;  4PUR A;  1GSD A;  1ZYN A;  3US3 A;  1A8L A;  4GCI A;  1QK8 A;  1G6W A;  2AJQ B;  1EGO A;  4K2X A;  3GL3 A;  2QKE A;  1EOH A;  5JCW A;  5D8I A;  2TRX A;  1QUW A;  1E6B A;  1YZX A;  3GNJ A;  2CAI A;  3TJG A;  1GTI A;  1GUH A;  3DWV A;  4IHU A;  3H1N A;  2I4A A;  2C80 A;  3UMA A;  1M9B A;  1S3D A;  3FKF A;  1FOV A;  4YAP A;  1MDK A;  2GZZ A;  3ZFB A;  4CDO A;  2GLR A;  16GS A;  1X5C A;  4HU9 A;  3NZN A;  5ECI B;  5ECM B;  3LFL A;  3C1R A;  2O8V B;  4TVE A;  2DJ1 A;  4NPB A;  2BJX A;  4X4J A;  3ZIV A;  5HR0 A;  2HZE B;  4GTU A;  5DCH A;  4MJE A;  1TP9 A;  5F0G A;  2HZF A;  2XC2 A;  2GSR A;  2V6K A;  1Z6N A;  2F9S A;  2DSA A;  5DVB A;  2VCZ A;  1C72 A;  4ZB8 A;  2YJH A;  1U88 A;  3QOU A;  4IP1 A;  2E2M A;  4CY6 A;  2VUP A;  5HR1 A;  2CA8 A;  3IRA A;  2HSM A;  1FAA A;  5J9B A;  4DEJ A;  1MTC A;  1GL8 A;  2DC5 A;  1QQ2 A;  1A23 A;  1XWG A;  5IQY A;  5C00 A;  2VL2 C;  3DRN A;  4X43 A;  3U5R E;  4PQ1 A;  4OWY A;  4MJB A;  2GT5 A;  6GST A;  2IFQ A;  4YQV A;  1FW1 A;  3VFI A;  2OA7 A;  5DJL A;  1R4W A;  1XOA A;  2DML A;  2DKI A;  3UBK A;  1M3I A;  2VM1 A;  1B4P A;  1ERT A;  3P2A A;  4DSS A;  2RM6 A;  3GX0 A;  1WWJ A;  3RHB A;  1Z5Y E;  3PGT A;  1GUM A;  3HJP A;  2PUK C;  1F9M A;  2H71 A;  4EVM A;  4WF4 A;  3EU4 A;  3UIW A;  3TKS C;  4FO5 A;  5HFI A;  4JED A;  3GIX A;  1BQ7 A;  1EV9 A;  2FLS A;  4Z2U A;  3SWL A;  1GRX A;  4MPG A;  4V1A g;  5JCU A;  1XW5 A;  5CRD A;  3WD6 A;  3TJJ A;  4KND A;  5DJM A;  3ZTL A;  3GMF A;  3TOT A;  1GSY A;  1TDI A;  1R7H A;  4KF9 A;  4I5Q A;  2F3M A;  1XXU A;  3CSJ A;  14GS A;  2L57 A;  4BWS A;  1XG8 A;  4EC0 A;  4HI7 A;  1YKA A;  1AQV A;  2BTO T;  3P7X A;  1T8E B;  4XHM A;  4V2L A;  2H01 A;  1F3B A;  4G0I A;  4XS4 B;  4K6X A;  1YJ6 A;  5CRG A;  2A2S A;  2TRC P;  2PER A;  2H6Y A;  5B6N A;  5G31 A;  4I2T A;  4E8E A;  3M9J A;  2HE3 A;  4NHW A;  1T4Y A;  1ZGN A;  3AY8 A;  3CBU A;  4L5O A;  4OMV A;  2CAQ A;  2GQM A;  2AUV A;  3Q18 A;  1UA5 A;  4GSS A;  3KH7 A;  5IMC A;  6GSS A;  2IN3 A;  4YH2 A;  5KN3 A;  5B6M A;  1HNC A;  4AF2 A;  3Q74 A;  3CMI A;  3C7M A;  1IYH A;  4KDY A;  1SJ6 A;  1PX7 A;  3ZVJ D;  4RUV A;  1NSW A;  3C71 A;  1K0A A;  4KUN A;  4JE1 A;  2K18 A;  4D73 A;  1XVQ A;  2P5R A;  1FHE A;  3WYW A;  1ZCP A;  3CQF A;  2LQQ A;  1K0B A;  4PQI A;  4G19 A;  5DQS A;  3S9F A;  1S3C A;  4PNG A;  5L71 A;  2HNL A;  4KCA A;  13GS A;  4IQ1 A;  4WR4 A;  4BVX A;  2I9H A;  1SKW B;  2C0F A;  4LMV A;  4HSC X;  2MMO A;  1TXX A;  1VF1 A;  3UL3 A;  3HA9 A;  2H1B A;  3QR6 A;  1QMV A;  5ID2 A;  4JU5 A;  1ZZY A;  1JZO A;  4BPY A;  1KEB A;  1TK8 B;  1O81 A;  1GSQ A;  2F51 A;  2CV4 A;  4GST A;  1SL1 B;  1XWC A;  4TR4 A;  2AV4 A;  1NM3 A;  2IFQ B;  1ZYP A;  5D93 A;  1K0D A;  2K6V A;  2ES7 A;  5ECS A;  1B4Q A;  1F2E A;  1X9W B;  4KDX A;  2M80 A;  3GYK A;  2H74 A;  3IOS A;  1XCC A;  3FZ5 A;  4MPF A;  1YKC A;  1F3A A;  1H4O A;  5ECK B;  2O7K A;  3E3E A;  3G7Y A;  1SJI A;  2K8V A;  4N11 A;  3D0Z A;  2WGR A;  4HU7 A;  5KOW A;  2H73 A;  4KCE A;  4HEA 2;  3L4N A;  3LQ7 A;  1PRX A;  2A4V A;  8GSS A;  1PGT A;  1A0F A;  1U3I A;  1V98 A;  2C3Q A;  3FHK A;  3W8J A;  4NWY A;  2VIM A;  3UJ1 A;  2L4Q A;  3VPT A;  3ZZX A;  2PU9 C;  4G0K A;  4O7H A;  5ECH B;  2KLX A;  2PBJ A;  2I81 A;  4K8M A;  2LRN A;  3Q19 A;  2RUF A;  1FG4 A;  3OR5 A;  4ACS A;  4Q5N A;  4JZQ A;  4JR6 A;  4BVY B;  2LEG A;  3TUE A;  2E2G A;  1KTE A;  2QC7 A;  2C0E A;  2OAC A;  2X8C A;  5KN2 A;  2GT6 A;  2HRF A;  3N5O A;  4L5L A;  5LNK e;  3E0U A;  1TKD B;  3JCM L;  4WBR D;  5KOX A;  2HYX A;  3DYR A;  1GTA A;  4NAX A;  1JHB A;  3FK8 A;  4WF5 A; 
#chains in the Genus database with same CATH homology
 3VWV A;  3G7J A;  2DKH A;  3P8W A;  2HXK A;  3QDN A;  5INY A;  4K5R A;  1WRY A;  1U6T A;  2B5Y A;  4FYC A;  3G9B A;  1J0F A;  3APS A;  3WGE A;  3FEU A;  1RW1 A;  2GZP A;  4N0Z A;  1HYU A;  5AIS A;  5KEJ A;  2HRN A;  5F05 A;  2N5F A;  3FZA A;  4OD7 A;  4D73 B;  3HZ4 A;  5B8A A;  4ZXG A;  2NPB A;  2FWF A;  1RQM A;  1M2B A;  2H1A A;  5IO0 A;  3UAR A;  5IPH A;  2GTU A;  3GKN A;  4HQS A;  4OO4 A;  1DSB A;  2R2J A;  3LG6 A;  5IMA A;  2CQ9 A;  3KEB A;  2OJL A;  1B8X A;  4V2M A;  4BVX B;  2LV3 A;  3RAZ A;  1CQH A;  4I6X A;  5LD0 A;  4MF7 A;  3ZLP A;  1ZYE A;  3D21 A;  2O85 A;  4MJA A;  3LYP A;  5EVO A;  4EIQ A;  2XBQ A;  1IYI A;  4TR1 B;  1ZL9 A;  5A4U A;  5ID2 B;  1MD4 A;  3EMP A;  3DML A;  4EE0 A;  3KJY A;  2H0G A;  4IVF A;  1UN2 A;  1HNB A;  3G7I A;  3EWL A;  4WXT A;  2L59 A;  5GST A;  1AQW A;  4PX1 A;  3EVI A;  4NHZ A;  5CYY A;  2RLI A;  3BCK A;  3FY7 A;  4KSM A;  1A2L A;  4Q5R A;  1HNA A;  1R26 A;  2LS5 A;  5IOW A;  1ERW A;  4NMU A;  2OE1 A;  2FNO A;  1AC1 A;  1TOF A;  3WGX A;  3KZQ A;  5ENU A;  1X9M B;  3ZMK A;  4MCU A;  1GP1 A;  4O92 A;  4WET A;  4N0V A;  4MZB A;  2YWO A;  4PUF C;  3VWU A;  2QA1 A;  4POM A;  2YJ7 A;  5DBQ A;  1V58 A;  2VCW A;  1SJZ A;  4HJ2 A;  4KSO A;  3FR6 A;  3GA4 A;  4K5S A;  2LNT A;  4K9Z A;  1SKS B;  1GUL A;  4ZB6 A;  3GUS A;  4K0G A;  4TXV A;  3EMX A;  4USS A;  2B1K A;  3CRU A;  4YAV A;  3O3T A;  1ACV A;  3W8S A;  2PN8 A;  4HS1 A;  5GSS A;  5J41 A;  2B7K A;  4MP4 A;  3VI7 A;  2LRC A;  4CW9 A;  3MSZ A;  2IMD A;  3RBT A;  1FOH A;  1SK0 A;  1URM A;  2C3N A;  4Z7X A;  4ML1 A;  3DD3 A;  3VPQ A;  1M0U A;  5ECO B;  5HR3 A;  3HHV A;  2VLV A;  3TGZ A;  1TJD A;  4ID0 A;  2KOK A;  4WEY A;  3UVT A;  5IMD A;  3H79 A;  5G30 A;  3Q6O A;  4HOJ A;  3GH6 A;  1WPI A;  3F0I A;  5CRW A;  3F3R A;  3ZRD A;  3K8N A;  1FVK A;  3EPT A;  3A2V A;  4MMM A;  3KH9 A;  1O8X A;  4EF0 A;  4NV5 A;  3F4T A;  2H6Z A;  1SKR B;  3KTB A;  5D9T A;  5IIZ A;  2F8A A;  2AAW A;  4OCE A;  1U87 A;  2CVB A;  1R5P A;  2BMX A;  1VF2 A;  4F03 A;  1AIU A;  2FHE A;  5D73 A;  1ZMA A;  2P31 A;  2DJ0 A;  2X8G A;  2QSI A;  2CX4 A;  3VUR A;  3FZ9 A;  1G0T A;  2CT6 A;  4O5U A;  3RPP A;  2VCV A;  2ZUP A;  2WCI A;  5DAL A;  5IPG A;  1X9S B;  2DJJ A;  1K0O A;  4POL A;  3APQ A;  3U6V A;  5J9C A;  1OE7 A;  1XW9 A;  1A0R P;  1K3L A;  2GGT A;  1BAY A;  5DQY A;  2M72 A;  1VF3 A;  3TCO A;  4ILF A;  2VM2 A;  5H5S A;  3QCP A;  3A5W A;  4O5R A;  3F8U A;  4PQH A;  2DIZ A;  4KH7 A;  4LL4 B;  2IME A;  1NHO A;  5IM9 A;  3ME7 A;  1EEJ A;  4ECB A;  1GLQ A;  4BL7 A;  2KUC A;  2X99 A;  4POK A;  19GS A;  3IK7 A;  4J57 E;  5ABR A;  4LLR A;  5ECQ B;  2AYT A;  3QAG A;  3IC4 A;  2RUE A;  1A2M A;  1W89 A;  1ZOF A;  2AB6 A;  3F4S A;  2YWM A;  2XPE A;  2XPD A;  3ZIT A;  2XHF A;  1Q4J A;  4AJ7 A;  1SEN A;  2R0G A;  2YV7 A;  1O85 A;  3I9V 2;  4HQZ A;  3VLN A;  4BVY A;  1M2D A;  2A2R A;  3KMO A;  4GLT A;  1SK1 A;  5ECL B;  1SYX A;  3QPM A;  4X1U A;  1NHY A;  3D6I A;  2WZ9 A;  4KW6 A;  3W6G A;  1AUC A;  4ZIL A;  2YWN A;  3A5I A;  1XOB A;  2YZU A;  4YQU A;  5C04 A;  3KTL A;  2N5A A;  4CY8 A;  4KGI A;  2EIQ A;  1TK5 B;  1SL2 B;  4ML6 A;  3MDK A;  1V9W A;  2YNX A;  1VGL A;  5AGY A;  3IR4 A;  1PMT A;  1WIK A;  2EIR A;  2WJU A;  2L6C A;  1EZK A;  2KP1 A;  4ZIJ A;  4WBJ A;  4K1F A;  1F6M C;  1LU4 A;  4WKW A;  1TU8 A;  5H5R A;  4LMW A;  1YEX A;  4I2U A;  3GKX A;  2B1L A;  1OAZ A;  1OC8 A;  4XCS A;  1PL2 A;  1JZW A;  4EKZ A;  1K3O A;  1ERU A;  1XWK A;  3C1S A;  5G5E A;  2L6D A;  3QD9 A;  1T7P B;  7GSS A;  1KNG A;  3I43 A;  4HJM A;  1H75 A;  5CRE A;  1J08 A;  3M3M A;  2OBI A;  2JSZ A;  3CTF A;  4MH3 A;  4EDY A;  5DDL A;  1A24 A;  3VK9 A;  2GZY A;  1FO5 A;  2JAD A;  3GST A;  4TR1 A;  4MAB A;  4TRX A;  1XWA A;  2OKA A;  4HDE A;  2FCH A;  2A4H A;  4EDZ A;  5GZZ B;  2C3T A;  4K7I A;  5G5F A;  2VD0 A;  3GKM A;  1PKW A;  5DAL B;  2JSY A;  1PL1 A;  3O76 A;  4LA1 A;  3TKS A;  2LJR A;  1W4V A;  4WR5 A;  2V6O A;  1GLP A;  1T00 A;  3GV1 A;  4OO5 A;  3QFB C;  1YF1 A;  2WS2 A;  4OFM A;  1THO A;  1SU9 A;  3MNG A;  5DAK A;  18GS A;  1FB0 A;  3RPN A;  4F0C A;  3IDV A;  4G10 A;  1G7E A;  1LBK A;  1WMJ A;  2GQK A;  2WUL A;  3FZ4 A;  3VWX A;  3HYP A;  4PXO A;  4XS1 A;  3F6D A;  5AN1 A;  5E4W A;  4AJ8 A;  3ZIJ A;  4LL1 B;  4G0L A;  4E8H A;  2C1Y A;  4DSR A;  4BL7 B;  4ZBD A;  2PGT A;  3N9J A;  5F8B A;  2MBS A;  2V1M A;  3HXS A;  3MYD A;  5CAX A;  2MMZ A;  4ECC A;  4KE3 A;  2R0P A;  9GSS A;  3GH9 A;  3PR8 A;  2ALB A;  2OAD A;  3CXG A;  3ZYW A;  2YAN A;  1HD2 A;  3GX8 A;  1ST9 A;  2GSQ A;  1E2Y A;  2MZC A;  2TIR A;  4FQU A;  1MD3 A;  1X5D A;  3KM6 A;  1PA3 A;  1EEM A;  3MIX A;  1TI3 A;  4RI7 A;  1OC9 A;  2X8H A;  2IMI A;  2C8U A;  1SD8 A;  4DVC A;  1B9Y C;  1TRV A;  1O6J A;  4MLY A;  2LRT A;  3ZL5 A;  3M8N A;  4Z2R A;  2A2P A;  2R4V A;  1JZR A;  2NDO A;  4GWR A;  4OFT A;  2E0Q A;  3GTU A;  1OYJ A;  3TRP A;  3H93 A;  3CYN A;  5JCG A;  2MBT A;  5DCG A;  5EPF A;  4POB A;  4EO3 A;  2DJ3 A;  3DVX A;  1A2J A;  4MF6 A;  3BOA A;  3HVX A;  1XZO A;  5J5N A;  2FD3 A;  3HJO A;  2OE0 A;  1OVN A;  2NVL A;  4BWQ A;  1GUK A;  1ML6 A;  5F06 A;  3HKR A;  4XIH A;  3LYK A;  1TTZ A;  2HRK A;  5J3R A;  4RQX A;  3ZFL A;  1DE1 A;  2QA2 A;  2HFD A;  4MNN A;  4V2N A;  2O89 A;  1OKT A;  3DKS A;  2H0H A;  4HUA A;  2ZCT A;  1N8J A;  1YDK A;  1O73 A;  1HQO A;  3TKQ A;  3UOM A;  5FWG A;  2X64 A;  4GF0 A;  1SL0 B;  3KGK A;  3TJF A;  22GS A;  4IEL A;  3TOU A;  1JLV A;  6GSX A;  5D9W A;  1ILO A;  2LNS A;  5BRT A;  3HVS A;  1VF4 A;  5FT3 A;  2J23 A;  4IBP A;  2IIY A;  1O7U A;  2O87 A;  2PVO C;  5ELA A;  3VWW A;  3IHG A;  1FVJ A;  2L5L A;  3FYG A;  4J56 E;  11GS A;  5G1K A;  3F9U A;  1PKZ A;  3GSS A;  2CZ3 A;  2LJK A;  1X5E A;  1K0N A;  3R3E A;  1OKD A;  4XRA A;  3QAV A;  2K9F A;  4A5P A;  3UAP A;  4FYB A;  3WT2 A;  2DJK A;  6GSY A;  4F82 A;  1DBY A;  2HSH A;  1THX A;  2K8S A;  5DAK B;  4PTS A;  2PWJ A;  3PIN A;  1SK2 A;  3FR9 A;  2H75 A;  4IS0 A;  2H72 A;  1GTU A;  1RK4 A;  3NIV A;  4O32 A;  3LWA A;  1MEK A;  4ZB9 A;  3ED3 A;  4L0W A;  3KXO A;  1S3A A;  2G0F A;  3F63 A;  1DE2 A;  2GVP A;  1GSU A;  4QL7 A;  3IBH A;  1Q98 A;  1EGR A;  2L4C A;  4ISD A;  1BED A;  5CNW A;  2H1D A;  2HT9 A;  4GQF A;  17GS A;  3R2Q A;  2VOC A;  3IPZ A;  3IXR A;  4ECI A;  3GN3 A;  3EUR A;  1BJX A;  2CZ2 A;  1YF0 A;  4NV2 A;  1TK0 B;  4OCF A;  3ISO A;  2JL4 A;  1SD9 A;  3P90 A;  4RI6 A;  5G1L A;  3EU3 A;  1OC9 B;  3HY2 A;  3TRQ A;  2VL9 A;  4PGT A;  1EP8 A;  1V57 A;  3KP8 A;  2V2G A;  2WDU A;  3KMN A;  1CQG A;  3H4K A;  4IW9 A;  5EY6 A;  3DIE A;  2VL3 A;  1M2A A;  5CRH A;  2YV9 A;  2MMA A;  3VI5 A;  2B5X A;  1FB6 A;  5AIV A;  1LJR A;  1XW6 A;  3GTU B;  4HZ2 A;  3ERF A;  3UVH A;  1AAZ A;  2FUG 2;  1ZYQ B;  3GHA A;  3HJM A;  4GSN A;  4GXZ A;  2V41 A;  3KP9 A;  3J7Y k;  2CVK A;  5A4V A;  1GH2 A;  1TRW A;  3HVV A;  4O5Q A;  1ON4 A;  4N10 A;  5KN0 A;  3RDW A;  1EOG A;  2R5G A;  2GQL A;  1XFL A;  1T3B A;  3IA1 A;  4IGJ A;  2LTK A;  2I1U A;  4FH8 A;  2JZT A;  1GSS A;  1QXH A;  3LGC A;  2ON5 A;  4AGS A;  3L0H A;  5HR2 A;  4I8B A;  1Z7R A;  4XTS A;  2WB9 A;  1PSQ A;  1KBN A;  2H6X A;  2WRT A;  1X0R A;  2RII A;  4GQC A;  2DLX A;  3SBC A;  1XPV A;  1XWB A;  4K0N A;  1MDI A;  2IWT A;  3NOF A;  3TJK A;  1J9B A;  5HFK A;  2LKU A;  4KX4 A;  1PN9 A;  2VLU A;  5A5K A;  2N5B A;  4Z2T A;  4BA7 A;  3RHC A;  1WJK A;  2IMK A;  2ZNM A;  10GS A;  2X49 A;  2IL3 A;  1PN0 A;  1M7T A;  3IAS 2;  1V2A A;  2IJY A;  2CX3 A;  4TOP A;  4HZ4 A;  4IJI A;  5IO2 A;  2VAF A;  5D9V A;  4F2I A;  1TRS A;  2YWI A;  2YCD A;  3CSI A;  3IAM 2;  2LQO A;  3H8Q A;  1WP0 A;  2FGX A;  2PMT A;  1DUG A;  2JU5 A;  2VO4 A;  2B3S A;  4KA0 A;  1Z7P A;  5IMV A;  2OE3 A;  4J2F A;  4JBB A;  3V1W A;  5EL8 A;  4PNF A;  1N2A A;  3HD5 A;  6GSV A;  3UEM A;  1TW9 A;  3IHQ A;  3FW2 A;  1ABA A;  2G2Q A;  4IN0 A;  3F4R A;  5D9X A;  1TU7 A;  4DSQ A;  1YEP A;  3MAK A;  2H19 A;  2JZR A;  3EC3 A;  3ME8 A;  2J9H A;  4YQM A;  3F6F A;  1GNW A;  2X4A A;  4XRD A;  1AXD A;  3FR3 A;  3LEF A;  2HRA A;  2DIY A;  3TRX A;  1XIY A;  2YN1 A;  2H76 A;  3A2X A;  3I69 A;  4KB3 A;  2P5Q A;  2MMN A;  1NW2 A;  4MDC A;  3IK9 A;  4TW5 A;  2KHP A;  2FY6 A;  3F3Q A;  2HSY A;  3C8E A;  3ZRE A;  4YKF A;  3UBL A;  2MYG A;  4TR0 A;  2B6M A;  3M0F A;  1QFN A;  2ON7 A;  4MF5 A;  3CRT A;  1F37 A;  5G2Z A;  1Z9H A;  2R3X A;  4I97 A;  1YQ1 A;  1Z6M A;  4FIW A;  1OE8 A;  1JLW A;  2REM A;  5JWQ B;  2JZS A;  4MH2 A;  1JZD A;  4K7N A;  2B5E A;  1K3Y A;  2HI7 A;  4IKH A;  4NXI A;  4F9Z A;  3IC8 A;  1UVZ A;  1AW9 A;  12GS A;  4TXO A;  1USB A;  1YY7 A;  3ERW A;  1SYR A;  4PUA A;  2F8F A;  2VL2 A;  2VCQ A;  2HLS A;  2YP6 A;  1K0M A;  3GRX A;  1B48 A;  5ECN B;  2FA4 A;  5E59 A;  3LW9 A;  4JRR A;  2EC4 A;  1U3A A;  1PD2 1;  1BG5 A;  2RM5 A;  4ZL9 A;  3KD0 A;  2YZH A;  5B7C A;  3M1G A;  4CHS A;  1GSE A;  3BJ5 A;  2UZ8 A;  2VLT A;  2VCX A;  3M9K A;  2H30 A;  3A3T A;  4MZC A;  3LJR A;  2XBI A;  3TB2 A;  2KP2 A;  3QAW A;  3IV4 A;  3FRC A;  5ECR B;  2H1G A;  4ZBA A;  2H66 A;  4ULX A;  4H86 A;  5KN1 A;  3BD2 A;  2IPA A;  3I6A A;  3QFA C;  2IMF A;  3WT1 A;  1A8Y A;  4YKG A;  1XVW A;  5CO3 A;  1G6Y A;  3DVW A;  20GS A;  3FMW A;  4RQR A;  4DSS B;  4L8E A;  1OC3 A;  1M9A A;  2LST A;  4QL9 A;  3L9U A;  2QGV A;  2V32 A;  3GL5 A;  5CP1 A;  2C0G A;  4MA9 A;  1PX6 A;  4MK3 A;  3DEX A;  1EV4 A;  3A2W A;  4IJ3 A;  4IQA A;  2YOI A;  1K0C A;  3E9J B;  2P0G A;  2JAC A;  5GAP D;  2H0I A;  1B9X C;  3DXB A;  2L5O A;  2VD1 A;  5B8B A;  4IP6 A;  2CVD A;  1BX9 A;  3D4T A;  4QQ7 A;  1AQX A;  1XBS A;  3APO A;  4KAE A;  1GNE A;  5IMZ A;  4K2D A;  1M99 A;  5HQP A;  2DJ2 A;  3QMX A;  3LXT A;  2YPM A;  6GSU A;  5FHI A;  4FYU A;  1T4Z A;  5IMF A;  1T1V A;  3ERG A;  3PH9 A;  1Y25 A;  3KCM A;  1QGV A;  5A4W A;  5IOX A;  4MJC A;  2LJA A;  3ZVJ A;  4EXJ A;  1ERV A;  2H70 A;  4N30 A;  4EUY A;  3TJB A;  5COH A;  3C73 A;  5J4U A;  4TN8 A;  1V40 A;  4ICY A;  4G9H A;  1TI1 A;  3BCI A;  3D4M A;  2DMM A;  3GFK A;  5F07 A;  3HCZ A;  4X0X A;  1GTB A;  1I5G A;  1WOU A;  3HDC A;  2HZE A;  2NTO A;  1BYE A;  1TRU A;  2DBC A;  2I3Y A;  2M46 A;  2E7P A;  3D22 A;  5ELG A;  4AJ6 A;  3CTG A;  5BMU A;  4K7O A;  3TDG A;  4MZW A;  2FA8 A;  1PQN A;  2R0C A;  3GKK A;  3DGQ A;  2GDR A;  4TXO B;  5LCZ A;  1UC7 A;  1VRS D;  3MWH A;  3EIN A;  2D2Z A;  3TKP A;  4P3Y B;  2C4J A;  2FWG A;  5D96 A;  5ECP B;  4XS6 A;  3EE2 A;  2FWH A;  2LUS A;  1JFU A;  3J7Y b;  4Q5F A;  3D5J A;  3LXZ A;  4GRF A;  3TKR A;  3CSH A;  3L78 A;  4TKY A;  4TR3 A;  2GS3 A;  3L9S A;  1G7O A;  2R37 A;  1R5A A;  5JWR B;  1Z3E A;  4Q5Q A;  2WFC A;  4L0U A;  2EIO A;  2PVQ A;  4EL1 A;  3LSZ A;  2AHE A;  2NBS A;  4KDU A;  4V1A p;  2GST A;  3BBY A;  2H8L A;  3O6T A;  3PPU A;  4F0B A;  4ZL7 A;  4JR4 A;  4OFN A;  2PPT A;  2VCT A;  5H5Q A;  2C0D A;  3L9V A;  3TKS E;  5JWO B;  1EWX A;  5GAN D;  1MDJ A;  4ZL8 A;  6GSW A;  4EIP A;  1O8W A;  1Y6E A;  3EYT A;  2B7J A;  3GUR A;  1GSF A;  2Z9S A;  1EP7 A;  3HZ8 A;  2GSS A;  1I9D A;  3LOR A;  3KIJ A;  5HFG A;  3IE3 A;  4XS4 A;  4G2E A;  2R6K A;  1WE0 A;  4ZBB A;  2OBK A;  2FWE A;  3ZML A;  5AIX A;  3WGD A;  4ECJ A;  1GWC A;  4PUR A;  1GSD A;  1ZYN A;  3US3 A;  1A8L A;  4GCI A;  1QK8 A;  1G6W A;  2AJQ B;  1EGO A;  4K2X A;  3GL3 A;  2QKE A;  1EOH A;  5JCW A;  5D8I A;  2TRX A;  1QUW A;  1E6B A;  1YZX A;  3GNJ A;  2CAI A;  3TJG A;  1GTI A;  1GUH A;  3DWV A;  4IHU A;  3H1N A;  2I4A A;  2C80 A;  3UMA A;  1M9B A;  1S3D A;  3FKF A;  1FOV A;  4YAP A;  1MDK A;  2GZZ A;  3ZFB A;  4CDO A;  2GLR A;  16GS A;  1X5C A;  4HU9 A;  3NZN A;  5ECI B;  5ECM B;  3LFL A;  3C1R A;  2O8V B;  4TVE A;  2DJ1 A;  4NPB A;  2BJX A;  4X4J A;  3ZIV A;  5HR0 A;  2HZE B;  4GTU A;  5DCH A;  4MJE A;  1TP9 A;  5F0G A;  2HZF A;  2XC2 A;  2GSR A;  2V6K A;  1Z6N A;  2F9S A;  2DSA A;  5DVB A;  2VCZ A;  1C72 A;  4ZB8 A;  2YJH A;  1U88 A;  3QOU A;  4IP1 A;  2E2M A;  4CY6 A;  2VUP A;  5HR1 A;  2CA8 A;  3IRA A;  2HSM A;  1FAA A;  5J9B A;  4DEJ A;  1MTC A;  1GL8 A;  2DC5 A;  1QQ2 A;  1A23 A;  1XWG A;  5IQY A;  5C00 A;  2VL2 C;  3DRN A;  4X43 A;  3U5R E;  4PQ1 A;  4OWY A;  4MJB A;  2GT5 A;  6GST A;  2IFQ A;  4YQV A;  1FW1 A;  3VFI A;  2OA7 A;  5DJL A;  1R4W A;  1XOA A;  2DML A;  2DKI A;  3UBK A;  2VM1 A;  1B4P A;  1ERT A;  3P2A A;  4DSS A;  2RM6 A;  3GX0 A;  1WWJ A;  3RHB A;  1Z5Y E;  3PGT A;  1GUM A;  3HJP A;  2PUK C;  1F9M A;  2H71 A;  4EVM A;  4WF4 A;  3EU4 A;  3UIW A;  3TKS C;  4FO5 A;  5HFI A;  4JED A;  3GIX A;  1BQ7 A;  1EV9 A;  2FLS A;  4Z2U A;  3SWL A;  1GRX A;  4MPG A;  4V1A g;  5JCU A;  1XW5 A;  5CRD A;  3WD6 A;  3TJJ A;  4KND A;  5DJM A;  3ZTL A;  3GMF A;  3TOT A;  1GSY A;  1TDI A;  1R7H A;  4KF9 A;  4I5Q A;  2F3M A;  1XXU A;  3CSJ A;  14GS A;  2L57 A;  4BWS A;  4EC0 A;  4HI7 A;  1YKA A;  1AQV A;  2BTO T;  3P7X A;  1T8E B;  4XHM A;  4V2L A;  2H01 A;  1F3B A;  4G0I A;  4XS4 B;  4K6X A;  1YJ6 A;  5CRG A;  2A2S A;  2TRC P;  2PER A;  2H6Y A;  5B6N A;  5G31 A;  4I2T A;  4E8E A;  3M9J A;  2HE3 A;  4NHW A;  1T4Y A;  1ZGN A;  3AY8 A;  3CBU A;  4L5O A;  4OMV A;  2CAQ A;  2GQM A;  2AUV A;  3Q18 A;  1UA5 A;  4GSS A;  3KH7 A;  5IMC A;  6GSS A;  2IN3 A;  4YH2 A;  5KN3 A;  5B6M A;  1HNC A;  4AF2 A;  3Q74 A;  3CMI A;  3C7M A;  1IYH A;  4KDY A;  1SJ6 A;  1PX7 A;  3ZVJ D;  4RUV A;  1NSW A;  3C71 A;  1K0A A;  4KUN A;  4JE1 A;  2K18 A;  4D73 A;  1XVQ A;  2P5R A;  1FHE A;  3WYW A;  1ZCP A;  2LQQ A;  1K0B A;  4PQI A;  4G19 A;  5DQS A;  3S9F A;  1S3C A;  4PNG A;  5L71 A;  2HNL A;  4KCA A;  13GS A;  4IQ1 A;  4WR4 A;  4BVX A;  2I9H A;  1SKW B;  2C0F A;  4LMV A;  2MMO A;  1TXX A;  1VF1 A;  3UL3 A;  3HA9 A;  2H1B A;  3QR6 A;  1QMV A;  5ID2 A;  4JU5 A;  1ZZY A;  1JZO A;  4BPY A;  1KEB A;  1TK8 B;  1O81 A;  1GSQ A;  2F51 A;  2CV4 A;  4GST A;  1SL1 B;  1XWC A;  4TR4 A;  2AV4 A;  1NM3 A;  2IFQ B;  1ZYP A;  5D93 A;  1K0D A;  2K6V A;  2ES7 A;  5ECS A;  1B4Q A;  1F2E A;  1X9W B;  4KDX A;  2M80 A;  3GYK A;  2H74 A;  3IOS A;  1XCC A;  3FZ5 A;  4MPF A;  1YKC A;  1F3A A;  1H4O A;  5ECK B;  2O7K A;  3E3E A;  3G7Y A;  1SJI A;  2K8V A;  4N11 A;  3D0Z A;  2WGR A;  4HU7 A;  5KOW A;  2H73 A;  4KCE A;  4HEA 2;  3L4N A;  3LQ7 A;  1PRX A;  2A4V A;  8GSS A;  1PGT A;  1A0F A;  1U3I A;  1V98 A;  2C3Q A;  3FHK A;  3W8J A;  4NWY A;  2VIM A;  3UJ1 A;  2L4Q A;  3VPT A;  3ZZX A;  2PU9 C;  4G0K A;  4O7H A;  5ECH B;  2KLX A;  2PBJ A;  2I81 A;  4K8M A;  2LRN A;  3Q19 A;  2RUF A;  1FG4 A;  3OR5 A;  4ACS A;  4Q5N A;  4JZQ A;  4JR6 A;  4BVY B;  2LEG A;  3TUE A;  2E2G A;  1KTE A;  2QC7 A;  2C0E A;  2OAC A;  2X8C A;  5KN2 A;  2GT6 A;  2HRF A;  3N5O A;  4L5L A;  5LNK e;  3E0U A;  1TKD B;  3JCM L;  4WBR D;  5KOX A;  2HYX A;  3DYR A;  1GTA A;  4NAX A;  1JHB A;  3FK8 A;  4WF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...