2TRXA

Crystal structure of thioredoxin from escherichia coli at 1.68 angstroms resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Crystal structure of thioredoxin from Escherichia coli at 1.68 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 32
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2trxA00
5LD0A 2YOIA 4ECBA 1KBNA 4PQ1A 2M46A 2C3TA 4GLTA 4RQRA 4HJMA 4D73B 2VO4A 5CP1A 2DC5A 4XTSA 2BTOT 1SKRB 4G19A 4KE3A 4PXOA 3GKMA 4WBJA 4FH8A 6GSTA 5J3RA 4JR6A 3TKSC 2F3MA 4OCEA 1M9BA 3VI5A 2AHEA 1H75A 5F8BA 3ZMLA 2V6KA 4EDYA 2XHFA 3GX8A 3LWAA 4KGIA 5IPGA 6GSVA 3TCOA 1UN2A 2XPEA 5FWGA 1ZL9A 4HZ4A 4HDEA 4NPBA 1XFLA 5D8IA 1X0RA 5GZZB 3TOTA 2CVBA 2OBIA 4OFNA 1MTCA 2VOCA 4V2MA 3E9JB 2HXKA 3LSZA 4YH2A 2WJUA 4JRRA 2AJQB 3OR5A 5J4UA 2RUEA 5DQYA 5E4WA 3KXOA 2LQQA 2WULA 4GSNA 5G30A 2H1GA 1SK1A 3CSIA 2QKEA 3DYRA 3GNJA 2A2SA 1Z9HA 1JLWA 3VURA 4V1Ap 3UMAA 3BBYA 2WDUA 2LQOA 4MA9A 3EVIA 4MP4A 4K7OA 2B1KA 3BJ5A 1WWJA 2VLUA 3LQ7A 1EV4A 2YCDA 3QAWA 1XWBA 5IMZA 5AN1A 4TVEA 5AIVA 4PGTA 1TP9A 5E59A 5DQSA 1IYIA 1GH2A 1B9XC 4L8EA 4I8BA 2H01A 3BOAA 2C1YA 3L9VA 2HZEA 4GF0A 2EC4A 3ZL5A 3F6DA 5H5SA 2ZNMA 3IV4A 3CSHA 4ZIJA 1Z7RA 3VK9A 3LGCA 1A0FA 4POBA 3A2VA 1DBYA 2JZSA 3FR3A 1EWXA 3HY2A 3KCMA 4MPGA 1FO5A 1A23A 4IELA 2R37A 3FEUA 1HNBA 2WFCA 4ULXA 1WRYA 3JCML 5KN3A 1BX9A 2K18A 3TUEA 2GT5A 5COHA 1HQOA 1OE8A 1FHEA 1QQ2A 1MDJA 3MDKA 1K3LA 5HFGA 5IMAA 4O92A 2YJHA 1PN9A 3CSJA 4KDYA 1ERUA 4YQUA 3ERWA 3F4TA 3WGXA 3RHBA 1XZOA 3GH9A 2GDRA 2J9HA 4GSSA 2F9SA 2GVPA 3VWUA 4V1Ag 4L0WA 4WETA 5CRGA 4MF5A 4FIWA 3EURA 3QOUA 1S3DA 2GQMA 2WZ9A 4X43A 4KSMA 4KDUA 2GSTA 2CVDA 3HJPA 2HLSA 4BWSA 1B9YC 4I6XA 1GSDA 1XOAA 2B6MA 4LMVA 1AW9A 4O32A 5IIZA 1YKAA 2L5OA 2R5GA 3EE2A 3L0HA 1Z5YE 3KMOA 5D96A 1DSBA 1R26A 2V41A 4ML6A 1TOFA 1YKCA 3GURA 3KH7A 2HSYA 3IC4A 4MJEA 2VL2C 3DMLA 1SYRA 1TU8A 1A8YA 1VRSD 5A4UA 3H8QA 1GNEA 4NAXA 2NPBA 5D9WA 2IL3A 3GL3A 1TRUA 3TKRA 3F9UA 5KEJA 4TN8A 2FA4A 3MAKA 3KMNA 3A3TA 4TW5A 2N5FA 1OAZA 2GZYA 2YZHA 1NHOA 3KZQA 1ON4A 5DJMA 1AQXA 2E0QA 2AV4A 5C04A 4GRFA 1SD8A 1M2DA 5KN2A 2ALBA 4L0UA 3IDVA 5F05A 1WE0A 5B6MA 2YV9A 5AISA 4MDCA 4TXOB 1AC1A 2QSIA 3FRCA 1ZYEA 4WF5A 1ILOA 1F3AA 4OFTA 2H75A 1UC7A 1PA3A 4L5LA 5FHIA 1YDKA 3W8SA 5B8BA 1TI1A 4HEA2 1PX6A 2RIIA 3M9KA 4RI7A 2H72A 1A0RP 4AJ7A 3RHCA 2NBSA 1BAYA 2G2QA 2O87A 2PU9C 1RK4A 1JHBA 2HT9A 1V40A 3EYTA 2JL4A 1GTIA 4WF4A 3IE3A 4PUAA 4D73A 3BCIA 3GSSA 3GH6A 3UBKA 4PNGA 2KLXA 4K2DA 4GQCA 1F2EA 2VL9A 1X9WB 3EWLA 4OWYA 6GSUA 2YNXA 2PVQA 1M2AA 4WKWA 1URMA 3N9JA 3CXGA 3HJMA 1O73A 1NW2A 5ECNB 2LTKA 4KAEA 2MBSA 11GSA 5AGYA 3WGEA 2IN3A 1OC9B 2LJRA 1UVZA 1TDIA 1A2JA 5EPFA 3MWHA 2E2GA 2GQLA 2R6KA 4JU5A 1PX7A 2JSZA 4Z7XA 1VF2A 5INYA 1QXHA 3US3A 2I81A 1X5EA 2M72A 2PMTA 1PKZA 2ON5A 3GUSA 2ES7A 3KGKA 3M0FA 4OFMA 4HOJA 3ZMKA 2O89A 1ST9A 4G9HA 1MD3A 1FB6A 3C71A 3WGDA 1GTAA 2IMIA 1TRSA 1JZDA 3NIVA 2V32A 1GSYA 2H71A 1TK5B 2RLIA 4QQ7A 1Z7PA 2C3NA 1U88A 2H6YA 2MBTA 3FZ4A 5EY6A 2HZFA 2IFQB 4TOPA 1JZOA 3P7XA 2CQ9A 2DJ2A 5IOXA 2H8LA 4HQZA 3ZFLA 1OKTA 4F0CA 5F07A 2M80A 3H93A 1C72A 1SU9A 4BL7A 1G6YA 1DUGA 3Q18A 2K8VA 2VD1A 2CX3A 1TRWA 3F4SA 2GLRA 2MMOA 1YJ6A 3H4KA 3VPQA 1Q98A 3W6GA 1GL8A 3HYPA 3U5RE 3TB2A 3LXZA 1HD2A 1TI3A 2IMFA 3DD3A 1XCCA 1S3CA 1FAAA 1J0FA 3M9JA 1A2MA 2FA8A 2TRXA 5HQPA 1XVQA 2DJ1A 2X8HA 3KTLA 5JCUA 4G2EA 4CDOA 1ZYQB 3N5OA 1N2AA 4IP1A 2L6CA 1QMVA 2L5LA 4XS4B 2FWGA 3HJOA 3SBCA 2OKAA 4DSSB 3CRUA 9GSSA 4ZBDA 4JZQA 1PQNA 4K7IA 4TR0A 4EVMA 3P90A 3PINA 1RQMA 1TKDB 1H4OA 4Q5FA 5EL8A 4KUNA 5CRHA 3IPZA 2YWMA 1X5CA 1XWGA 4GTUA 4DSRA 3HXSA 3H79A 4GWRA 14GSA 3KM6A 3UJ1A 22GSA 1TTZA 2L59A 3R2QA 4QL9A 4ZL8A 1LBKA 1WPIA 2E2MA 1T1VA 4KX4A 2R3XA 2V6OA 2FHEA 4LMWA 1WIKA 4HU9A 4MK3A 3C1SA 3ZITA 5CAXA 2H74A 3KTBA 4X0XA 5A4VA 3V1WA 1OKDA 3J7Yk 4K0NA 2LNTA 4P3YB 3UEMA 3L9SA 3CTFA 6GSXA 3G7JA 4N10A 3LORA 3UARA 4X1UA 4IP6A 4NHWA 2IWTA 1EEJA 4I2UA 1EGOA 2CT6A 4XIHA 1K0CA 5G1KA 4IKHA 1EGRA 2HFDA 1EEMA 1TK8B 2ZUPA 2YWIA 5IMFA 3EINA 17GSA 2VCTA 2XC2A 4POMA 4EKZA 5CNWA 4JEDA 2KP1A 3I69A 1F6MC 1OE7A 1GLPA 2DJKA 3W8JA 1OYJA 1BEDA 5C00A 4ZXGA 2O8VB 4F2IA 5G1LA 2GZZA 1GTBA 3AY8A 3DGQA 2LRCA 4K0GA 2X8CA 1USBA 1T8EB 1XW6A 3HVSA 2B5YA 4KB3A 3SWLA 1GTUA 5GSSA 2VIMA 2VLTA 2F8AA 4K6XA 1JZWA 1EP7A 4WBRD 1B48A 4TXOA 1EV9A 2JACA 3KP8A 1JZRA 2LRTA 3ZVJD 4ML1A 2BJXA 2DIYA 4MCUA 4CHSA 3TJBA 1K0MA 4OO4A 2B3SA 1J08A 5HR3A 1U6TA 1M99A 3GFKA 1K3YA 4PURA 3L9UA 5ECMB 1CQHA 2HRNA 5H5RA 3VLNA 2DJ0A 3EU3A 2AYTA 2FWEA 4AGSA 3TGZA 2C0FA 1GUKA 1O6JA 2CAIA 3BD2A 1NHYA 2YN1A 5DCHA 4TR1B 1ZZYA 4HI7A 3IXRA 2EIRA 3TRQA 4HQSA 3HCZA 4F0BA 2LJKA 2HRFA 4NXIA 2CAQA 2L6DA 3ED3A 3F0IA 5JWQB 2DIZA 5HR2A 3GRXA 2FCHA 1BQ7A 4FYUA 2H1BA 1OC9A 2CX4A 3DWVA 3GKXA 4ECIA 1TK0B 1XWKA 1FW1A 3TDGA 4O7HA 3FY7A 1Z6MA 1ML6A 2EIOA 1R5PA 1XW5A 2F8FA 1V58A 5HFKA 3FKFA 3ZFBA 1M2BA 3QMXA 2L57A 3C8EA 2VM2A 4ZB8A 4V2LA 3D5JA 4ILFA 2HE3A 4MJAA 4TR3A 2P31A 3GV1A 5J9BA 1AUCA 1TU7A 4KNDA 4N30A 4WR4A 2C8UA 2VL3A 1O7UA 1WP0A 1SL0B 3UAPA 2ZCTA 2IFQA 2K8SA 1BYEA 4ID0A 1EZKA 5G2ZA 5IO2A 4MZWA 3TRPA 2HSHA 3TJFA 4MABA 1VF1A 3D22A 2DSAA 2E7PA 1LJRA 3RDWA 1XOBA 1O85A 1R5AA 4OMVA 5D9XA 1S3AA 3MSZA 4G10A 1AQVA 2PWJA 1Z3EA 1M7TA 4K9ZA 4O5RA 4N0ZA 3TKPA 3NZNA 4IHUA 2JSYA 5KN1A 2YV7A 4QL7A 4BVYA 1MEKA 1E6BA 2YZUA 3ZIJA 2I4AA 4N11A 2C0GA 3ME8A 5LCZA 3DVXA 1OC8A 4YQVA 2KP2A 4IJ3A 4TR4A 1DE1A 5HFIA 5HR0A 4AF2A 5JCGA 4DEJA 3J7Yb 1I5GA 2PERA 3APQA 1SKWB 1ZMAA 2C4JA 4XS4A 2X8GA 3QCPA 4OD7A 3TOUA 4DSSA 5CREA 1I9DA 2IMDA 3IHQA 4MZBA 5B8AA 1M0UA 5J9CA 5ECLB 5ID2B 2FD3A 3PGTA 5LNKe 4KW6A 3GKNA 3P2AA 1XPVA 3HZ8A 2XBIA 5F0GA 1A2LA 1GP1A 5ECQB 4Q5RA 4ZILA 1F9MA 2CVKA 2VCZA 4TXVA 4ISDA 3WT1A 2XPDA 1GSQA 3MNGA 4FYCA 4OCFA 2MMZA 2N5BA 3Q6OA 2B7JA 6GSWA 5GSTA 1BG5A 3GKKA 2LEGA 3ZIVA 1B4QA 1U87A 2LRNA 2MMAA 3IBHA 1YEXA 1YF0A 1OVNA 4Q5NA 1QK8A 2H30A 2MMNA 3HHVA 3U6VA 2A4VA 4MH2A 4POKA 3I6AA 1GWCA 5ECOB 2LUSA 1ERTA 2H1AA 5FT3A 1PKWA 2VUPA 3HVXA 4EUYA 4FO5A 2PN8A 2I3YA 4GQFA 5A4WA 4JE1A 1ZGNA 3TJJA 1GSUA 2GSSA 5KN0A 2GT6A 5ECSA 1T7PB 2KHPA 3DVWA 4H86A 1ABAA 1K0NA 1W4VA 4AJ6A 4EXJA 4XRDA 3CRTA 2YPMA 3FR6A 3HZ4A 4F9ZA 2PUKC 3IRAA 2H0HA 4TRXA 4XRAA 2H73A 4MPFA 3VWWA 2HI7A 4PNFA 2H76A 3WYWA 3VPTA 4IW9A 1A24A 5ECIB 1ERWA 2WRTA 2DMLA 4XHMA 3D4MA 2FY6A 5EVOA 4KCEA 2VCQA 4YAPA 3QFAC 4MJBA 1X9MB 2X64A 4NV5A 4ECJA 1PGTA 2B5XA 4EC0A 2DJ3A 3ZREA 1ACVA 5J41A 2OE3A 3KD0A 3RPNA 2ON7A 1G7EA 2VM1A 4TR1A 2RM6A 3A5WA 3TRXA 1K0BA 5JWRB 4IN0A 4BA7A 2YWNA 1FG4A 4HUAA 1N8JA 1QFNA 4XCSA 3TKQA 2H0IA 1V57A 1KTEA 2FWFA 3IAS2 3QDNA 1DE2A 4XS6A 4ZBAA 3UBLA 1XVWA 2H19A 4EO3A 3KEBA 5G5FA 2YWOA 5DALB 4BVXA 3I9V2 4N0VA 4HJ2A 2TIRA 4IQAA 1PSQA 3Q19A 4RI6A 2OA7A 2DLXA 4MF6A 5J5NA 3HDCA 2D2ZA 2NDOA 3HKRA 4EL1A 1THOA 1B8XA 4V2NA 5IOWA 3QD9A 3LYKA 1T4YA 1GSSA 4LL1B 4BWQA 1Z6NA 4I5QA 4K1FA 4LA1A 4PX1A 4ZB9A 2OE0A 2P0GA 2FGXA 4J2FA 1Y6EA 2OE1A 4KA0A 4OO5A 1F3BA 2CV4A 2OJLA 3UIWA 4LL4B 4WEYA 4CW9A 4MF7A 4EE0A 2AAWA 3C7MA 4WXTA 2PVOC 5IMCA 2CZ2A 1XW9A 5ECHB 5ELAA 5IPHA 2I1UA 1K3OA 2IMKA 3APSA 3O76A 2EIQA 2B7KA 3Q74A 2R2JA 1K0AA 5DJLA 2B1LA 1PMTA 4PQIA 5ECKB 2HYXA 3ERFA 3GIXA 2P5QA 3G7YA 1Y25A 2NTOA 3GSTA 3FR9A 3WD6A 2IIYA 3ZLPA 3FHKA 4I97A 2V1MA 3IAM2 3EMXA 3IK9A 3D21A 1J9BA 3LFLA 3ZTLA 4AJ8A 2XBQA 1ERVA 5DAKB 3TJGA 4RUVA 5ECPB 2GQKA 5A5KA 3HD5A 3FW2A 2IMEA 5CRWA 1SJZA 1EOHA 2WGRA 6GSYA 6GSSA 10GSA 4HU7A 1JLVA 1XBSA 5G5EA 1A8LA 3QFBC 5IO0A 3F8UA 2JADA 3QAGA 1YZXA 1BJXA 4NV2A 4DSQA 1SYXA 2LSTA 3GTUB 3DKSA 2DMMA 4DVCA 1G6WA 5ID2A 5ELGA 5GAND 3F63A 3D0ZA 5JWOB 4EDZA 18GSA 4IBPA 2H1DA 3ZRDA 2Z9SA 3IK7A 4NWYA 5D9TA 4BPYA 3VI7A 4XS1A 1XIYA 1EOGA 1VGLA 4YQMA 3ISOA 1W89A 3LEFA 1SL1B 2NVLA 3E0UA 3D4TA 2H6XA 2FLSA 1FB0A 2WB9A 2DBCA 1PD21 2L4CA 3QR6A 2X99A 3HA9A 4F82A 5ABRA 1GNWA 2RUFA 2GSRA 3O6TA 2VCWA 5D73A 3F4RA 4IQ1A 2REMA 3PR8A 2B5EA 1UA5A 1GSEA 1YEPA 4IJIA 3LXTA 2G0FA 2CZ3A 3C73A 1O81A 2V2GA 3S9FA 2OACA 3EMPA 1WJKA 4WR5A 2PGTA 4TKYA 3CMIA 4E8EA 3F6FA 3APOA 3M3MA 1XWCA 3KH9A 1GUMA 5DCGA 3HVVA 13GSA 5ENUA 2QGVA 2FWHA 1T00A 2P5RA 3CTGA 4KH7A 1PL2A 1O8WA 4MZCA 5IMVA 1V9WA 3GX0A 1MDKA 3RAZA 1CQGA 1HYUA 5CYYA 2GZPA 3ZZXA 4K8MA 4NHZA 3I43A 1T3BA 2K6VA 2YP6A 4POLA 3VWVA 1E2YA 4KDXA 3EU4A 2TRCP 1XWAA 2N5AA 3QPMA 1TXXA 3TKSA 3FK8A 2WCIA 4ZL9A 3LG6A 3ZVJA 2A2RA 4J56E 2K9FA 4ECCA 1EP8A 4ZL7A 2R4VA 3LJRA 4J57E 20GSA 3KJYA 3F3RA 4JR4A 4PQHA 1IYHA 2LV3A 3FZ5A 3RPPA 2VCXA 4RQXA 1G7OA 1SK0A 7GSSA 5DALA 4YAVA 2C0EA 1T4ZA 3L4NA 1O8XA 3UOMA 2RM5A 1AIUA 3GA4A 1GULA 1U3AA 1JFUA 3KP9A 3K8NA 2O7KA 1TW9A 1Q4JA 2GTUA 3ZYWA 2OBKA 4NMUA 1V2AA 2LS5A 2KOKA 4MLYA 1QUWA 1GSFA 2JZRA 4PUFC 3IR4A 4FYBA 4KSOA 2O85A 1NM3A 2KUCA 1YF1A 2PPTA 3H1NA 1AAZA 3UL3A 3CYNA 5HR1A 3BCKA 3FZ9A 5G31A 3GYKA 4MJCA 1PRXA 5IMDA 4IVFA 19GSA 1U3IA 5D93A 2C0DA 2PBJA 2MYGA 5IQYA 2HZEB 2VD0A 4JBBA 1R4WA 3A2XA 3L78A 1WOUA 2AB6A 2GGTA 4K7NA 1XXUA 3GL5A 3M1GA 5IM9A 2QC7A 3LYPA 5DDLA 3F3QA 3GMFA 2MZCA 1GLQA 5F06A 2L4QA 5DAKA 4KCAA 3FYGA 5JCWA 2H70A 2CA8A 5DBQA 1LU4A 2WS2A 1MDIA 4Q5QA 3GHAA 5D9VA 3UVHA 4EF0A 3DEXA 4MMMA 5L71A 16GSA 1V98A 2DJJA 3ME7A 5B6NA 2LJAA 4ACSA 3GTUA 3P8WA 5CRDA 1M9AA 3NOFA 4HS1A 1SJ6A 8GSSA 3G7IA 3M8NA 5CO3A 3IA1A 2BMXA 1FVJA 1K0OA 2YJ7A 1GUHA 4L5OA 3O3TA 1MD4A 3IOSA 5H5QA 1GRXA 2YANA 2VAFA 3UVTA 2GS3A 5B7CA 2VLVA 4E8HA 1FVKA 4GCIA 4I2TA 2H66A 1B4PA 1YQ1A 1SL2B 3ERGA 1SKSB 1SK2A 2I9HA 1HNAA 2FUG2 3DRNA 1SD9A 2IPAA 1TRVA 2F51A 2C80A 1VF3A 1ZOFA 2VL2A 4GXZA 4MH3A 3WT2A 1SJIA 1K0DA 1F37A 1QGVA 2GSQA 3GN3A 1G0TA 5GAPD 3DXBA 3EC3A 3G9BA 3E3EA 3A2WA 2VCVA 2C3QA 4LLRA 1R7HA 2FNOA 5ECRB 1VF4A 1RW1A 2J23A 1ZCPA 3VFIA 3FZAA 3RBTA 3VWXA 1THXA 4IS0A 2IJYA 1KNGA 4ZB6A 5AIXA 4HZ2A 2AUVA 3KIJA 4F03A 1WMJA 1FOVA 2HNLA 1PL1A 3PH9A 2H0GA 1X9SB 2JU5A 12GSA 1OC3A 3TJKA 2JZTA 1HNCA 2LNSA 4IGJA 2OADA 1YY7A 1AXDA 1KEBA 1TJDA 1SENA 3CBUA 3DIEA 3C1RA 1AQWA 3QAVA 2LKUA 3TKSE 4ZBBA 1X5DA 2H6ZA 4GSTA 5DVBA 1NSWA 3D6IA
chains in the Genus database with same CATH superfamily
5LD0A 2YOIA 3FMWA 4ECBA 1KBNA 4KF9A 4PQ1A 2M46A 2C3TA 4GLTA 4RQRA 1ZYPA 4HJMA 4D73B 2VO4A 5CP1A 2DC5A 4XTSA 2BTOT 1SKRB 4G19A 4KE3A 4PXOA 3GKMA 4WBJA 4FH8A 6GSTA 5J3RA 4JR6A 3TKSC 2F3MA 4OCEA 1M9BA 3VI5A 2AHEA 1H75A 5F8BA 3ZMLA 2V6KA 4EDYA 2XHFA 3GX8A 3LWAA 4KGIA 5IPGA 4CY8A 6GSVA 3TCOA 1UN2A 2XPEA 5FWGA 1ZL9A 4HZ4A 4HDEA 4NPBA 1XFLA 5D8IA 1X0RA 5GZZB 3TOTA 2CVBA 2OBIA 4OFNA 1MTCA 2VOCA 4V2MA 3E9JB 2HXKA 3LSZA 4YH2A 2WJUA 4JRRA 2AJQB 3OR5A 5J4UA 2RUEA 5DQYA 5E4WA 3KXOA 2LQQA 2WULA 4GSNA 5G30A 2H1GA 1SK1A 3CSIA 2QKEA 3DYRA 3GNJA 2A2SA 1Z9HA 1JLWA 3VURA 4V1Ap 3UMAA 3A5IA 3BBYA 2WDUA 2LQOA 4MA9A 3EVIA 4MP4A 4K7OA 2B1KA 3BJ5A 1WWJA 2VLUA 3LQ7A 1EV4A 2YCDA 4BL7B 3QAWA 1XWBA 5IMZA 5AN1A 4TVEA 5AIVA 3MYDA 4PGTA 1TP9A 5E59A 5DQSA 1IYIA 1GH2A 1B9XC 4L8EA 4I8BA 2H01A 3BOAA 2C1YA 3L9VA 2HZEA 4GF0A 2EC4A 3ZL5A 3F6DA 5H5SA 2ZNMA 3IV4A 3CSHA 4ZIJA 1Z7RA 3VK9A 3LGCA 1A0FA 4POBA 3A2VA 1DBYA 2JZSA 3FR3A 1EWXA 3HY2A 3KCMA 4MPGA 1FO5A 1A23A 4IELA 2R37A 3FEUA 1HNBA 2WFCA 4ULXA 1WRYA 3JCML 5KN3A 1BX9A 2K18A 3TUEA 2GT5A 5COHA 1HQOA 1OE8A 1FHEA 1QQ2A 1MDJA 3MDKA 1K3LA 5HFGA 5IMAA 4O92A 2YJHA 1PN9A 3CSJA 4KDYA 1ERUA 4YQUA 3ERWA 3F4TA 3WGXA 3RHBA 1XZOA 3GH9A 2GDRA 2J9HA 4G0LA 4GSSA 2F9SA 2GVPA 1PFOA 3VWUA 4V1Ag 4L0WA 4WETA 5CRGA 4MF5A 4FIWA 3EURA 3QOUA 1S3DA 2GQMA 2WZ9A 4X43A 4KSMA 4KDUA 2GSTA 2CVDA 3HJPA 2HLSA 4BWSA 1B9YC 4I6XA 1GSDA 1XOAA 2B6MA 4LMVA 1AW9A 4O32A 5IIZA 1YKAA 2L5OA 2R5GA 3EE2A 3L0HA 1Z5YE 3KMOA 5D96A 1DSBA 1R26A 2V41A 4ML6A 1TOFA 1YKCA 3GURA 3KH7A 2HSYA 3IC4A 4MJEA 2VL2C 3DMLA 1SYRA 1TU8A 1A8YA 1VRSD 5A4UA 3H8QA 1GNEA 4NAXA 2NPBA 5D9WA 2IL3A 3GL3A 1TRUA 3TKRA 3F9UA 5KEJA 4TN8A 2FA4A 3MAKA 3KMNA 3A3TA 4TW5A 2N5FA 1OAZA 2GZYA 2YZHA 1NHOA 3KZQA 1ON4A 4BIKA 5DJMA 1AQXA 2E0QA 2AV4A 5C04A 4GRFA 4K5RA 1SD8A 1M2DA 5KN2A 2ALBA 4L0UA 3IDVA 5F05A 1WE0A 5B6MA 2YV9A 5AISA 4MDCA 3PPUA 4TXOB 1AC1A 2QSIA 3FRCA 1ZYEA 4WF5A 1ILOA 1F3AA 4OFTA 4O5QA 2H75A 1UC7A 1PA3A 4L5LA 5FHIA 1YDKA 3W8SA 5B8BA 1TI1A 4HEA2 1PX6A 2RIIA 3M9KA 4RI7A 2H72A 1A0RP 4AJ7A 2X49A 3RHCA 2NBSA 3MIXA 1BAYA 2G2QA 2O87A 2PU9C 1RK4A 1JHBA 2HT9A 1V40A 3EYTA 2JL4A 1GTIA 4WF4A 3IE3A 4PUAA 4D73A 3BCIA 3GSSA 3GH6A 3UBKA 4PNGA 2KLXA 4K2DA 4GQCA 1F2EA 2VL9A 1X9WB 3EWLA 4OWYA 6GSUA 2YNXA 2PVQA 1M2AA 4WKWA 1URMA 3N9JA 3CXGA 3HJMA 1O73A 1NW2A 5ECNB 2LTKA 4KAEA 2MBSA 11GSA 5AGYA 3WGEA 2IN3A 1OC9B 2LJRA 4CY6A 1UVZA 1TDIA 1A2JA 5EPFA 3MWHA 2E2GA 2GQLA 2R6KA 4JU5A 1PX7A 2JSZA 4Z7XA 1VF2A 5INYA 1QXHA 3US3A 2I81A 1X5EA 2M72A 2PMTA 1PKZA 2ON5A 3GUSA 2ES7A 3KGKA 3M0FA 4OFMA 4HOJA 3ZMKA 2O89A 1ST9A 4G9HA 1MD3A 1FB6A 3C71A 3WGDA 1GTAA 2IMIA 1TRSA 1JZDA 2X4AA 3NIVA 2V32A 1GSYA 2H71A 1TK5B 2RLIA 4QQ7A 1Z7PA 2C3NA 1U88A 2H6YA 2QA1A 2MBTA 3FZ4A 5EY6A 2HZFA 2IFQB 4TOPA 1JZOA 3P7XA 2CQ9A 2DJ2A 5IOXA 2H8LA 4HQZA 3ZFLA 1OKTA 4F0CA 5F07A 2M80A 3H93A 1C72A 1SU9A 1M3JA 4BL7A 1G6YA 1DUGA 3Q18A 2K8VA 2VD1A 2CX3A 1TRWA 3F4SA 2GLRA 2MMOA 1YJ6A 4Z2RA 3H4KA 3VPQA 1Q98A 3W6GA 1GL8A 3HYPA 4BVYB 3U5RE 3TB2A 3LXZA 1HD2A 1TI3A 2IMFA 3DD3A 3EPTA 1XCCA 1S3CA 1FAAA 1J0FA 3M9JA 1A2MA 4EIPA 2FA8A 2TRXA 5HQPA 1XVQA 1S3RA 2DJ1A 2X8HA 3KTLA 5JCUA 4G2EA 4CDOA 1FOHA 1ZYQB 3N5OA 1N2AA 4IP1A 2L6CA 1QMVA 2L5LA 4XS4B 2FWGA 3HJOA 3SBCA 2OKAA 4DSSB 3CRUA 9GSSA 4ZBDA 4O5UA 2R0CA 4JZQA 1PQNA 4K7IA 4TR0A 4EVMA 3P90A 3PINA 1RQMA 1TKDB 1H4OA 4Q5FA 5EL8A 4KUNA 5CRHA 3IPZA 2YWMA 1X5CA 1XWGA 4GTUA 4DSRA 3HXSA 3H79A 4GWRA 14GSA 3KM6A 3UJ1A 22GSA 1TTZA 2L59A 3R2QA 4QL9A 4ZL8A 1LBKA 1WPIA 2E2MA 1T1VA 4KX4A 2R3XA 2V6OA 2FHEA 4LMWA 1WIKA 4HU9A 4MK3A 3C1SA 3ZITA 5CAXA 2H74A 3KTBA 4X0XA 5A4VA 3V1WA 1OKDA 3J7Yk 4K0NA 2LNTA 4P3YB 3UEMA 3L9SA 3CTFA 6GSXA 3G7JA 4N10A 3LORA 3UARA 4X1UA 4IP6A 4NHWA 2IWTA 3HVNA 1EEJA 4I2UA 1EGOA 2CT6A 4XIHA 1K0CA 5G1KA 4IKHA 1EGRA 2HFDA 1EEMA 1TK8B 2ZUPA 2YWIA 5IMFA 3EINA 17GSA 2VCTA 2XC2A 4POMA 4EKZA 5CNWA 4JEDA 2KP1A 3I69A 1F6MC 1OE7A 1GLPA 2DJKA 3W8JA 1OYJA 1BEDA 5C00A 4ZXGA 2O8VB 4F2IA 5G1LA 2GZZA 1GTBA 3AY8A 3DGQA 2LRCA 4K0GA 2X8CA 1USBA 1T8EB 1XW6A 3HVSA 2B5YA 4KB3A 3SWLA 1GTUA 5GSSA 2VIMA 2VLTA 2F8AA 4K6XA 1JZWA 1EP7A 4WBRD 1B48A 4TXOA 1EV9A 2JACA 3KP8A 1JZRA 2LRTA 3ZVJD 4ML1A 2BJXA 2DIYA 4MCUA 4CHSA 4A5PA 3TJBA 1K0MA 4OO4A 2B3SA 1J08A 5HR3A 1U6TA 1M99A 3GFKA 1K3YA 4PURA 3L9UA 3IHGA 5ECMB 1CQHA 2HRNA 5H5RA 3VLNA 2DJ0A 3EU3A 2AYTA 2FWEA 4G0IA 3TGZA 4AGSA 2C0FA 1GUKA 1O6JA 2CAIA 3BD2A 1NHYA 2YN1A 5DCHA 4TR1B 1ZZYA 2DKHA 4HI7A 3IXRA 2EIRA 3TRQA 4HQSA 3HCZA 4F0BA 2LJKA 2HRFA 4NXIA 2CAQA 1ZYNA 2L6DA 3ED3A 3F0IA 5JWQB 2DIZA 5HR2A 3GRXA 2FCHA 1BQ7A 4FYUA 2H1BA 1OC9A 2CX4A 3DWVA 3GKXA 4ECIA 1TK0B 1XWKA 1FW1A 3TDGA 4BVXB 4O7HA 3FY7A 1Z6MA 1ML6A 2EIOA 1R5PA 1XW5A 2F8FA 1V58A 5HFKA 3FKFA 3ZFBA 1M2BA 3QMXA 2L57A 3C8EA 2VM2A 4ZB8A 4V2LA 3D5JA 4ILFA 2HE3A 4MJAA 4TR3A 2P31A 3GV1A 5J9BA 1AUCA 1TU7A 4KNDA 4N30A 4WR4A 2C8UA 2VL3A 1O7UA 1WP0A 1SL0B 3UAPA 2ZCTA 2IFQA 4K2XA 2K8SA 1BYEA 4ID0A 1EZKA 5G2ZA 5IO2A 4MZWA 3TRPA 2HSHA 3TJFA 4MABA 1VF1A 3D22A 2DSAA 2E7PA 1LJRA 3RDWA 1XOBA 1O85A 1R5AA 4OMVA 5D9XA 1S3AA 3MSZA 4G10A 1AQVA 2PWJA 1Z3EA 1M7TA 4K9ZA 4O5RA 4N0ZA 3TKPA 3IC8A 3NZNA 4IHUA 2JSYA 5KN1A 2YV7A 4QL7A 4BVYA 1MEKA 1E6BA 2YZUA 3ZIJA 2I4AA 4N11A 2C0GA 3ME8A 5LCZA 3DVXA 2HRAA 1OC8A 4YQVA 2KP2A 4IJ3A 4TR4A 1DE1A 5HFIA 5HR0A 4AF2A 5JCGA 4X4JA 4DEJA 3J7Yb 1I5GA 2PERA 3APQA 1SKWB 1ZMAA 2C4JA 4XS4A 2X8GA 3QCPA 4OD7A 3TOUA 4DSSA 5CREA 1I9DA 2IMDA 3IHQA 4MZBA 5B8AA 1M0UA 5J9CA 5ECLB 5ID2B 2FD3A 3PGTA 5BMUA 5LNKe 4KW6A 3GKNA 3P2AA 1XPVA 3HZ8A 2XBIA 5F0GA 1A2LA 1GP1A 5ECQB 4Q5RA 4ZILA 1F9MA 2CVKA 2VCZA 4TXVA 4ISDA 3WT1A 2XPDA 1GSQA 3MNGA 4FYCA 4OCFA 2MMZA 2N5BA 3Q6OA 2B7JA 6GSWA 5GSTA 1BG5A 3GKKA 2LEGA 3ZIVA 1B4QA 1U87A 4USSA 2LRNA 2MMAA 3IBHA 1YEXA 1YF0A 1OVNA 4Q5NA 1QK8A 2H30A 2MMNA 3HHVA 3U6VA 2A4VA 4MH2A 4POKA 3I6AA 1GWCA 5ECOB 2LUSA 1ERTA 2H1AA 5FT3A 1PKWA 2VUPA 3HVXA 4EUYA 4FO5A 2PN8A 2I3YA 4GQFA 5A4WA 4JE1A 1ZGNA 3TJJA 1GSUA 2DKIA 2GSSA 5KN0A 2GT6A 5ECSA 1T7PB 2KHPA 3DVWA 4H86A 1ABAA 1K0NA 1W4VA 4AJ6A 4EXJA 3LW9A 4XRDA 3CRTA 2YPMA 3FR6A 3HZ4A 4F9ZA 2PUKC 3IRAA 2H0HA 4TRXA 4XRAA 2H73A 4MPFA 3VWWA 2HI7A 4PNFA 2H76A 3WYWA 3VPTA 4IW9A 1A24A 5ECIB 1ERWA 4G0KA 2WRTA 2DMLA 4XHMA 3D4MA 2FY6A 5EVOA 4KCEA 2VCQA 4YAPA 3QFAC 4MJBA 1X9MB 2X64A 4NV5A 4ECJA 1PGTA 2B5XA 4EC0A 2DJ3A 3ZREA 5BRTA 1ACVA 5J41A 2OE3A 3KD0A 3RPNA 2R0PA 2ON7A 1G7EA 2VM1A 4TR1A 2RM6A 3A5WA 3TRXA 1K0BA 5JWRB 4IN0A 4BA7A 2YWNA 1FG4A 4HUAA 1N8JA 1QFNA 4XCSA 3TKQA 2H0IA 1V57A 1KTEA 2FWFA 3IAS2 3QDNA 1DE2A 4XS6A 4ZBAA 3UBLA 1XVWA 2H19A 4EO3A 3KEBA 5G5FA 2YWOA 5DALB 4BVXA 3I9V2 4N0VA 4HJ2A 2TIRA 4IQAA 4EIQA 1PSQA 3Q19A 4RI6A 2OA7A 2DLXA 4MF6A 5J5NA 3HDCA 2D2ZA 2NDOA 2R0GA 3HKRA 4EL1A 1THOA 1B8XA 4V2NA 5IOWA 3QD9A 3LYKA 1T4YA 1GSSA 4LL1B 4BWQA 1Z6NA 4I5QA 4K1FA 4LA1A 4PX1A 4ZB9A 1M3IA 2OE0A 2P0GA 2FGXA 4J2FA 1Y6EA 2OE1A 4KA0A 2UZ8A 4OO5A 1F3BA 2CV4A 3CQFA 2OJLA 3UIWA 4LL4B 4WEYA 4CW9A 4MF7A 4EE0A 2AAWA 3C7MA 4WXTA 2PVOC 5IMCA 2CZ2A 1XW9A 5ECHB 5ELAA 5IPHA 2I1UA 1K3OA 2IMKA 3APSA 3O76A 2EIQA 2B7KA 3Q74A 2R2JA 1K0AA 5DJLA 2B1LA 1PMTA 4PQIA 5ECKB 2HYXA 3ERFA 3GIXA 2P5QA 3G7YA 1Y25A 2NTOA 3GSTA 3FR9A 3WD6A 2IIYA 3ZLPA 3FHKA 1PN0A 4I97A 2V1MA 3IAM2 3EMXA 3IK9A 3D21A 1J9BA 3LFLA 3ZTLA 4AJ8A 4FQUA 2XBQA 1ERVA 5DAKB 3TJGA 4RUVA 5ECPB 2GQKA 5A5KA 3HD5A 3FW2A 2IMEA 2A4HA 5CRWA 1SJZA 1EOHA 2WGRA 6GSYA 6GSSA 10GSA 4HU7A 1JLVA 1XBSA 5G5EA 1A8LA 3QFBC 5IO0A 3F8UA 2JADA 3QAGA 1YZXA 1BJXA 4NV2A 4DSQA 1SYXA 2LSTA 3GTUB 3DKSA 2DMMA 4DVCA 1G6WA 5ID2A 5ELGA 5GAND 3F63A 3D0ZA 5JWOB 4EDZA 18GSA 4IBPA 2H1DA 3ZRDA 2Z9SA 3IK7A 4NWYA 5D9TA 4BPYA 3VI7A 4XS1A 1XIYA 1EOGA 1VGLA 3ISOA 4YQMA 1W89A 3LEFA 1SL1B 2NVLA 3E0UA 4ICYA 3D4TA 2H6XA 2FLSA 1FB0A 2WB9A 2DBCA 1PD21 2L4CA 3QR6A 2X99A 3HA9A 4F82A 5ABRA 1GNWA 2RUFA 2GSRA 3O6TA 2VCWA 5D73A 3F4RA 4IQ1A 2REMA 3PR8A 2B5EA 1UA5A 1GSEA 1YEPA 4IJIA 3LXTA 2G0FA 2CZ3A 3C73A 1O81A 2V2GA 3S9FA 2OACA 3EMPA 1WJKA 4WR5A 2PGTA 4TKYA 3CMIA 4E8EA 3F6FA 3APOA 3M3MA 1XWCA 3KH9A 1GUMA 5DCGA 3HVVA 13GSA 5ENUA 2QGVA 2FWHA 1T00A 2P5RA 3CTGA 4KH7A 1PL2A 4K5SA 1O8WA 4MZCA 4Z2UA 5IMVA 1V9WA 2HRKA 3GX0A 1MDKA 3RAZA 1CQGA 1HYUA 5KOWA 5CYYA 2GZPA 3ZZXA 4K8MA 4NHZA 3I43A 1T3BA 2K6VA 2YP6A 4POLA 3VWVA 1E2YA 4KDXA 3EU4A 2TRCP 1XWAA 2N5AA 3QPMA 1TXXA 3TKSA 3FK8A 2WCIA 4ZL9A 3LG6A 3ZVJA 2A2RA 4J56E 2K9FA 4ECCA 1EP8A 4ZL7A 2R4VA 3LJRA 4J57E 20GSA 3KJYA 3F3RA 4JR4A 4PQHA 1IYHA 2LV3A 3FZ5A 3RPPA 2VCXA 4RQXA 1G7OA 1SK0A 7GSSA 5DALA 4YAVA 2C0EA 1T4ZA 3L4NA 1O8XA 3UOMA 2RM5A 1AIUA 3GA4A 1GULA 1U3AA 1JFUA 3KP9A 3K8NA 2O7KA 1TW9A 1Q4JA 2GTUA 3ZYWA 2OBKA 4NMUA 1V2AA 2LS5A 2KOKA 4MLYA 1QUWA 1GSFA 2JZRA 4PUFC 3IR4A 4FYBA 4KSOA 2O85A 1NM3A 2KUCA 1YF1A 2PPTA 3H1NA 1AAZA 3UL3A 3CYNA 5HR1A 3BCKA 3FZ9A 5G31A 3GYKA 4MJCA 1PRXA 5IMDA 4IVFA 19GSA 1U3IA 5D93A 2C0DA 2PBJA 2MYGA 5IQYA 2HZEB 2VD0A 4JBBA 1R4WA 3A2XA 3L78A 1WOUA 2AB6A 2GGTA 4K7NA 1XXUA 3GL5A 3M1GA 5IM9A 4MNNA 2QC7A 3LYPA 5DDLA 3F3QA 3GMFA 2MZCA 1GLQA 5F06A 2L4QA 5DAKA 4KCAA 3FYGA 5JCWA 3R3EA 2H70A 2CA8A 5DBQA 1LU4A 2WS2A 1MDIA 4Q5QA 3GHAA 5D9VA 3UVHA 4EF0A 3DEXA 4MMMA 5L71A 16GSA 1V98A 2DJJA 3ME7A 5B6NA 2A2PA 2LJAA 4ACSA 3GTUA 3P8WA 5CRDA 1M9AA 3NOFA 4HS1A 4PTSA 1SJ6A 8GSSA 3G7IA 3M8NA 5CO3A 3IA1A 2BMXA 1FVJA 1K0OA 2YJ7A 1GUHA 4L5OA 3O3TA 1MD4A 3IOSA 5H5QA 1GRXA 2YANA 2VAFA 3UVTA 2GS3A 5B7CA 2VLVA 4E8HA 1FVKA 4GCIA 4I2TA 2H66A 1B4PA 1YQ1A 1SL2B 3ERGA 1SKSB 1SK2A 2I9HA 1HNAA 2FUG2 3DRNA 1SD9A 2IPAA 1TRVA 2F51A 2C80A 1VF3A 1ZOFA 2VL2A 4GXZA 4MH3A 3WT2A 1SJIA 1K0DA 1F37A 1QGVA 2GSQA 3GN3A 1G0TA 4HSCX 5GAPD 2QA2A 3DXBA 3EC3A 3G9BA 3E3EA 3A2WA 4LLRA 2VCVA 2C3QA 1R7HA 2FNOA 5ECRB 5KOXA 1VF4A 1RW1A 2J23A 1ZCPA 3VFIA 3FZAA 3RBTA 3VWXA 1XG8A 1THXA 4IS0A 2IJYA 4YKGA 1KNGA 4ZB6A 5AIXA 4HZ2A 2AUVA 3KIJA 4F03A 1WMJA 1FOVA 2HNLA 1PL1A 3PH9A 2H0GA 1X9SB 2JU5A 12GSA 1OC3A 3TJKA 2JZTA 1HNCA 2LNSA 4Z2TA 4IGJA 2OADA 4YKFA 1YY7A 1AXDA 1KEBA 1TJDA 1SENA 3CBUA 3DIEA 3C1RA 1AQWA 3QAVA 2LKUA 3TKSE 4ZBBA 1X5DA 2H6ZA 2HSMA 4GSTA 5DVBA 1NSWA 3D6IA
chains in the Genus database with same CATH topology
5LD0A 2YOIA 3FMWA 4ECBA 1KBNA 4KF9A 4PQ1A 2M46A 2C3TA 4GLTA 4RQRA 1ZYPA 4HJMA 4D73B 2VO4A 5CP1A 2DC5A 4XTSA 2BTOT 1SKRB 4G19A 4KE3A 4PXOA 3GKMA 4WBJA 4FH8A 6GSTA 5J3RA 4JR6A 3TKSC 2F3MA 4OCEA 1M9BA 3VI5A 2AHEA 1H75A 5F8BA 3ZMLA 2V6KA 4EDYA 2XHFA 3GX8A 3LWAA 4KGIA 5IPGA 4CY8A 6GSVA 3TCOA 1UN2A 2XPEA 5FWGA 1ZL9A 4HZ4A 4HDEA 4NPBA 1XFLA 5D8IA 1X0RA 5GZZB 3TOTA 2CVBA 2OBIA 4OFNA 1MTCA 2VOCA 4V2MA 3E9JB 2HXKA 3LSZA 4YH2A 2WJUA 4JRRA 2AJQB 3OR5A 5J4UA 2RUEA 5DQYA 5E4WA 3KXOA 2LQQA 2WULA 4GSNA 5G30A 2H1GA 1SK1A 3CSIA 2QKEA 3DYRA 3GNJA 2A2SA 1Z9HA 1JLWA 3VURA 4V1Ap 3UMAA 3A5IA 3BBYA 2WDUA 2LQOA 4MA9A 3EVIA 4MP4A 4K7OA 2B1KA 3BJ5A 1WWJA 2VLUA 3LQ7A 1EV4A 2YCDA 4BL7B 3QAWA 1XWBA 5IMZA 5AN1A 4TVEA 5AIVA 3MYDA 4PGTA 1TP9A 5E59A 5DQSA 1IYIA 1GH2A 1B9XC 4L8EA 4I8BA 2H01A 3BOAA 2C1YA 3L9VA 2HZEA 4GF0A 2EC4A 3ZL5A 3F6DA 5H5SA 2ZNMA 3IV4A 3CSHA 4ZIJA 1Z7RA 3VK9A 3LGCA 1A0FA 4POBA 3A2VA 1DBYA 2JZSA 3FR3A 1EWXA 3HY2A 3KCMA 4MPGA 1FO5A 1A23A 4IELA 2R37A 3FEUA 1HNBA 2WFCA 4ULXA 1WRYA 3JCML 5KN3A 1BX9A 2K18A 3TUEA 2GT5A 5COHA 1HQOA 1OE8A 1FHEA 1QQ2A 1MDJA 3MDKA 1K3LA 5HFGA 5IMAA 4O92A 2YJHA 1PN9A 3CSJA 4KDYA 1ERUA 4YQUA 3ERWA 3F4TA 3WGXA 3RHBA 1XZOA 3GH9A 2GDRA 2J9HA 4G0LA 4GSSA 2F9SA 2GVPA 3VWUA 4V1Ag 4L0WA 4WETA 5CRGA 4MF5A 4FIWA 3EURA 3QOUA 1S3DA 2GQMA 2WZ9A 4X43A 4KSMA 4KDUA 2GSTA 2CVDA 3HJPA 2HLSA 4BWSA 1B9YC 4I6XA 1GSDA 1XOAA 2B6MA 4LMVA 1AW9A 4O32A 5IIZA 1YKAA 2L5OA 2R5GA 3EE2A 3L0HA 1Z5YE 3KMOA 5D96A 1DSBA 1R26A 2V41A 4ML6A 1TOFA 1YKCA 3GURA 3KH7A 2HSYA 3IC4A 4MJEA 2VL2C 3DMLA 1SYRA 1TU8A 1A8YA 1VRSD 5A4UA 3H8QA 1GNEA 4NAXA 2NPBA 5D9WA 2IL3A 3GL3A 1TRUA 3TKRA 3F9UA 5KEJA 4TN8A 2FA4A 3MAKA 3KMNA 3A3TA 4TW5A 2N5FA 1OAZA 2GZYA 2YZHA 1NHOA 3KZQA 1ON4A 5DJMA 1AQXA 2E0QA 2AV4A 5C04A 4GRFA 4K5RA 1SD8A 1M2DA 5KN2A 2ALBA 4L0UA 3IDVA 5F05A 1WE0A 5B6MA 2YV9A 5AISA 4MDCA 3PPUA 4TXOB 1AC1A 2QSIA 3FRCA 1ZYEA 4WF5A 1ILOA 1F3AA 4OFTA 4O5QA 2H75A 1UC7A 1PA3A 4L5LA 5FHIA 1YDKA 3W8SA 5B8BA 1TI1A 4HEA2 1PX6A 2RIIA 3M9KA 4RI7A 2H72A 1A0RP 4AJ7A 2X49A 3RHCA 2NBSA 3MIXA 1BAYA 2G2QA 2O87A 2PU9C 1RK4A 1JHBA 2HT9A 1V40A 3EYTA 2JL4A 1GTIA 4WF4A 3IE3A 4PUAA 4D73A 3BCIA 3GSSA 3GH6A 3UBKA 4PNGA 2KLXA 4K2DA 4GQCA 1F2EA 2VL9A 1X9WB 3EWLA 4OWYA 6GSUA 2YNXA 2PVQA 1M2AA 4WKWA 1URMA 3N9JA 3CXGA 3HJMA 1O73A 1NW2A 5ECNB 2LTKA 4KAEA 2MBSA 11GSA 5AGYA 3WGEA 2IN3A 1OC9B 2LJRA 4CY6A 1UVZA 1TDIA 1A2JA 5EPFA 3MWHA 2E2GA 2GQLA 2R6KA 4JU5A 1PX7A 2JSZA 4Z7XA 1VF2A 5INYA 1QXHA 3US3A 2I81A 1X5EA 2M72A 2PMTA 1PKZA 2ON5A 3GUSA 2ES7A 3KGKA 3M0FA 4OFMA 4HOJA 3ZMKA 2O89A 1ST9A 4G9HA 1MD3A 1FB6A 3C71A 3WGDA 1GTAA 2IMIA 1TRSA 1JZDA 2X4AA 3NIVA 2V32A 1GSYA 2H71A 1TK5B 2RLIA 4QQ7A 1Z7PA 2C3NA 1U88A 2H6YA 2QA1A 2MBTA 3FZ4A 5EY6A 2HZFA 2IFQB 4TOPA 1JZOA 3P7XA 2CQ9A 2DJ2A 5IOXA 2H8LA 4HQZA 3ZFLA 1OKTA 4F0CA 5F07A 2M80A 3H93A 1C72A 1SU9A 4BL7A 1G6YA 1DUGA 3Q18A 2K8VA 2VD1A 2CX3A 1TRWA 3F4SA 2GLRA 2MMOA 1YJ6A 4Z2RA 3H4KA 3VPQA 1Q98A 3W6GA 1GL8A 3HYPA 4BVYB 3U5RE 3TB2A 3LXZA 1HD2A 1TI3A 2IMFA 3DD3A 3EPTA 1XCCA 1S3CA 1FAAA 1J0FA 3M9JA 1A2MA 4EIPA 2FA8A 2TRXA 5HQPA 1XVQA 2DJ1A 2X8HA 3KTLA 5JCUA 4G2EA 4CDOA 1FOHA 1ZYQB 3N5OA 1N2AA 4IP1A 2L6CA 1QMVA 2L5LA 4XS4B 2FWGA 3HJOA 3SBCA 2OKAA 4DSSB 3CRUA 9GSSA 4ZBDA 4O5UA 2R0CA 4JZQA 1PQNA 4K7IA 4TR0A 4EVMA 3P90A 3PINA 1RQMA 1TKDB 1H4OA 4Q5FA 5EL8A 4KUNA 5CRHA 3IPZA 2YWMA 1X5CA 1XWGA 4GTUA 4DSRA 3HXSA 3H79A 4GWRA 14GSA 3KM6A 3UJ1A 22GSA 1TTZA 2L59A 3R2QA 4QL9A 4ZL8A 1LBKA 1WPIA 2E2MA 1T1VA 4KX4A 2R3XA 2V6OA 2FHEA 4LMWA 1WIKA 4HU9A 4MK3A 3C1SA 3ZITA 5CAXA 2H74A 3KTBA 4X0XA 5A4VA 3V1WA 1OKDA 3J7Yk 4K0NA 2LNTA 4P3YB 3UEMA 3L9SA 3CTFA 6GSXA 3G7JA 4N10A 3LORA 3UARA 4X1UA 4IP6A 4NHWA 2IWTA 1EEJA 4I2UA 1EGOA 2CT6A 4XIHA 1K0CA 5G1KA 4IKHA 1EGRA 2HFDA 1EEMA 1TK8B 2ZUPA 2YWIA 5IMFA 3EINA 17GSA 2VCTA 2XC2A 4POMA 4EKZA 5CNWA 4JEDA 2KP1A 3I69A 1F6MC 1OE7A 1GLPA 2DJKA 3W8JA 1OYJA 1BEDA 5C00A 4ZXGA 2O8VB 4F2IA 5G1LA 2GZZA 1GTBA 3AY8A 3DGQA 2LRCA 4K0GA 2X8CA 1USBA 1T8EB 1XW6A 3HVSA 2B5YA 4KB3A 3SWLA 1GTUA 5GSSA 2VIMA 2VLTA 2F8AA 4K6XA 1JZWA 1EP7A 4WBRD 1B48A 4TXOA 1EV9A 2JACA 3KP8A 1JZRA 2LRTA 3ZVJD 4ML1A 2BJXA 2DIYA 4MCUA 4CHSA 4A5PA 3TJBA 1K0MA 4OO4A 2B3SA 1J08A 5HR3A 1U6TA 1M99A 3GFKA 1K3YA 4PURA 3L9UA 3IHGA 5ECMB 1CQHA 2HRNA 5H5RA 3VLNA 2DJ0A 3EU3A 2AYTA 2FWEA 4G0IA 3TGZA 4AGSA 2C0FA 1GUKA 1O6JA 2CAIA 3BD2A 1NHYA 2YN1A 5DCHA 4TR1B 1ZZYA 2DKHA 4HI7A 3IXRA 2EIRA 3TRQA 4HQSA 3HCZA 4F0BA 2LJKA 2HRFA 4NXIA 2CAQA 1ZYNA 2L6DA 3ED3A 3F0IA 5JWQB 2DIZA 5HR2A 3GRXA 2FCHA 1BQ7A 4FYUA 2H1BA 1OC9A 2CX4A 3DWVA 3GKXA 4ECIA 1TK0B 1XWKA 1FW1A 3TDGA 4BVXB 4O7HA 3FY7A 1Z6MA 1ML6A 2EIOA 1R5PA 1XW5A 2F8FA 1V58A 5HFKA 3FKFA 3ZFBA 1M2BA 3QMXA 2L57A 3C8EA 2VM2A 4ZB8A 4V2LA 3D5JA 4ILFA 2HE3A 4MJAA 4TR3A 2P31A 3GV1A 5J9BA 1AUCA 1TU7A 4KNDA 4N30A 4WR4A 2C8UA 2VL3A 1O7UA 1WP0A 1SL0B 3UAPA 2ZCTA 2IFQA 4K2XA 2K8SA 1BYEA 4ID0A 1EZKA 5G2ZA 5IO2A 4MZWA 3TRPA 2HSHA 3TJFA 4MABA 1VF1A 3D22A 2DSAA 2E7PA 1LJRA 3RDWA 1XOBA 1O85A 1R5AA 4OMVA 5D9XA 1S3AA 3MSZA 4G10A 1AQVA 2PWJA 1Z3EA 1M7TA 4K9ZA 4O5RA 4N0ZA 3TKPA 3IC8A 3NZNA 4IHUA 2JSYA 5KN1A 2YV7A 4QL7A 4BVYA 1MEKA 1E6BA 2YZUA 3ZIJA 2I4AA 4N11A 2C0GA 3ME8A 5LCZA 3DVXA 2HRAA 1OC8A 4YQVA 2KP2A 4IJ3A 4TR4A 1DE1A 5HFIA 5HR0A 4AF2A 5JCGA 4X4JA 4DEJA 3J7Yb 1I5GA 2PERA 3APQA 1SKWB 1ZMAA 2C4JA 4XS4A 2X8GA 3QCPA 4OD7A 3TOUA 4DSSA 5CREA 1I9DA 2IMDA 3IHQA 4MZBA 5B8AA 1M0UA 5J9CA 5ECLB 5ID2B 2FD3A 3PGTA 5BMUA 5LNKe 4KW6A 3GKNA 3P2AA 1XPVA 3HZ8A 2XBIA 5F0GA 1A2LA 1GP1A 5ECQB 4Q5RA 4ZILA 1F9MA 2CVKA 2VCZA 4TXVA 4ISDA 3WT1A 2XPDA 1GSQA 3MNGA 4FYCA 4OCFA 2MMZA 2N5BA 3Q6OA 2B7JA 6GSWA 5GSTA 1BG5A 3GKKA 2LEGA 3ZIVA 1B4QA 1U87A 4USSA 2LRNA 2MMAA 3IBHA 1YEXA 1YF0A 1OVNA 4Q5NA 1QK8A 2H30A 2MMNA 3HHVA 3U6VA 2A4VA 4MH2A 4POKA 3I6AA 1GWCA 5ECOB 2LUSA 1ERTA 2H1AA 5FT3A 1PKWA 2VUPA 3HVXA 4EUYA 4FO5A 2PN8A 2I3YA 4GQFA 5A4WA 4JE1A 1ZGNA 3TJJA 1GSUA 2DKIA 2GSSA 5KN0A 2GT6A 5ECSA 1T7PB 2KHPA 3DVWA 4H86A 1ABAA 1K0NA 1W4VA 4AJ6A 4EXJA 3LW9A 4XRDA 3CRTA 2YPMA 3FR6A 3HZ4A 4F9ZA 2PUKC 3IRAA 2H0HA 4TRXA 4XRAA 2H73A 4MPFA 3VWWA 2HI7A 4PNFA 2H76A 3WYWA 3VPTA 4IW9A 1A24A 5ECIB 1ERWA 4G0KA 2WRTA 2DMLA 4XHMA 3D4MA 2FY6A 5EVOA 4KCEA 2VCQA 4YAPA 3QFAC 4MJBA 1X9MB 2X64A 4NV5A 4ECJA 1PGTA 2B5XA 4EC0A 2DJ3A 3ZREA 5BRTA 1ACVA 5J41A 2OE3A 3KD0A 3RPNA 2R0PA 2ON7A 1G7EA 2VM1A 4TR1A 2RM6A 3A5WA 3TRXA 1K0BA 5JWRB 4IN0A 4BA7A 2YWNA 1FG4A 4HUAA 1N8JA 1QFNA 4XCSA 3TKQA 2H0IA 1V57A 1KTEA 2FWFA 3IAS2 3QDNA 1DE2A 4XS6A 4ZBAA 3UBLA 1XVWA 2H19A 4EO3A 3KEBA 5G5FA 2YWOA 5DALB 4BVXA 3I9V2 4N0VA 4HJ2A 2TIRA 4IQAA 4EIQA 1PSQA 3Q19A 4RI6A 2OA7A 2DLXA 4MF6A 5J5NA 3HDCA 2D2ZA 2NDOA 2R0GA 3HKRA 4EL1A 1THOA 1B8XA 4V2NA 5IOWA 3QD9A 3LYKA 1T4YA 1GSSA 4LL1B 4BWQA 1Z6NA 4I5QA 4K1FA 4LA1A 4PX1A 4ZB9A 2OE0A 2P0GA 2FGXA 4J2FA 1Y6EA 2OE1A 4KA0A 2UZ8A 4OO5A 1F3BA 2CV4A 2OJLA 3UIWA 4LL4B 4WEYA 4CW9A 4MF7A 4EE0A 2AAWA 3C7MA 4WXTA 2PVOC 5IMCA 2CZ2A 1XW9A 5ECHB 5ELAA 5IPHA 2I1UA 1K3OA 2IMKA 3APSA 3O76A 2EIQA 2B7KA 3Q74A 2R2JA 1K0AA 5DJLA 2B1LA 1PMTA 4PQIA 5ECKB 2HYXA 3ERFA 3GIXA 2P5QA 3G7YA 1Y25A 2NTOA 3GSTA 3FR9A 3WD6A 2IIYA 3ZLPA 3FHKA 1PN0A 4I97A 2V1MA 3IAM2 3EMXA 3IK9A 3D21A 1J9BA 3LFLA 3ZTLA 4AJ8A 4FQUA 2XBQA 1ERVA 5DAKB 3TJGA 4RUVA 5ECPB 2GQKA 5A5KA 3HD5A 3FW2A 2IMEA 2A4HA 5CRWA 1SJZA 1EOHA 2WGRA 6GSYA 6GSSA 10GSA 4HU7A 1JLVA 1XBSA 5G5EA 1A8LA 3QFBC 5IO0A 3F8UA 2JADA 3QAGA 1YZXA 1BJXA 4NV2A 4DSQA 1SYXA 2LSTA 3GTUB 3DKSA 2DMMA 4DVCA 1G6WA 5ID2A 5ELGA 5GAND 3F63A 3D0ZA 5JWOB 4EDZA 18GSA 4IBPA 2H1DA 3ZRDA 2Z9SA 3IK7A 4NWYA 5D9TA 4BPYA 3VI7A 4XS1A 1XIYA 1EOGA 1VGLA 4YQMA 3ISOA 1W89A 3LEFA 1SL1B 2NVLA 3E0UA 4ICYA 3D4TA 2H6XA 2FLSA 1FB0A 2WB9A 2DBCA 1PD21 2L4CA 3QR6A 2X99A 3HA9A 4F82A 5ABRA 1GNWA 2RUFA 2GSRA 3O6TA 2VCWA 5D73A 3F4RA 4IQ1A 2REMA 3PR8A 2B5EA 1UA5A 1GSEA 1YEPA 4IJIA 3LXTA 2G0FA 2CZ3A 3C73A 1O81A 2V2GA 3S9FA 2OACA 3EMPA 1WJKA 4WR5A 2PGTA 4TKYA 3CMIA 4E8EA 3F6FA 3APOA 3M3MA 1XWCA 3KH9A 1GUMA 5DCGA 3HVVA 13GSA 5ENUA 2QGVA 2FWHA 1T00A 2P5RA 3CTGA 4KH7A 1PL2A 4K5SA 1O8WA 4MZCA 4Z2UA 5IMVA 1V9WA 2HRKA 3GX0A 1MDKA 3RAZA 1CQGA 1HYUA 5KOWA 5CYYA 2GZPA 3ZZXA 4K8MA 4NHZA 3I43A 1T3BA 2K6VA 2YP6A 4POLA 3VWVA 1E2YA 4KDXA 3EU4A 2TRCP 1XWAA 2N5AA 3QPMA 1TXXA 3TKSA 3FK8A 2WCIA 4ZL9A 3LG6A 3ZVJA 2A2RA 4J56E 2K9FA 4ECCA 1EP8A 4ZL7A 2R4VA 3LJRA 4J57E 20GSA 3KJYA 3F3RA 4JR4A 4PQHA 1IYHA 2LV3A 3FZ5A 3RPPA 2VCXA 4RQXA 1G7OA 1SK0A 7GSSA 5DALA 4YAVA 2C0EA 1T4ZA 3L4NA 1O8XA 3UOMA 2RM5A 1AIUA 3GA4A 1GULA 1U3AA 1JFUA 3KP9A 3K8NA 2O7KA 1TW9A 1Q4JA 2GTUA 3ZYWA 2OBKA 4NMUA 1V2AA 2LS5A 2KOKA 4MLYA 1QUWA 1GSFA 2JZRA 4PUFC 3IR4A 4FYBA 4KSOA 2O85A 1NM3A 2KUCA 1YF1A 2PPTA 3H1NA 1AAZA 3UL3A 3CYNA 5HR1A 3BCKA 3FZ9A 5G31A 3GYKA 4MJCA 1PRXA 5IMDA 4IVFA 19GSA 1U3IA 5D93A 2C0DA 2PBJA 2MYGA 5IQYA 2HZEB 2VD0A 4JBBA 1R4WA 3A2XA 3L78A 1WOUA 2AB6A 2GGTA 4K7NA 1XXUA 3GL5A 3M1GA 5IM9A 4MNNA 2QC7A 3LYPA 5DDLA 3F3QA 3GMFA 2MZCA 1GLQA 5F06A 2L4QA 5DAKA 4KCAA 3FYGA 5JCWA 3R3EA 2H70A 2CA8A 5DBQA 1LU4A 2WS2A 1MDIA 4Q5QA 3GHAA 5D9VA 3UVHA 4EF0A 3DEXA 4MMMA 5L71A 16GSA 1V98A 2DJJA 3ME7A 5B6NA 2A2PA 2LJAA 4ACSA 3GTUA 3P8WA 5CRDA 1M9AA 3NOFA 4HS1A 4PTSA 1SJ6A 8GSSA 3G7IA 3M8NA 5CO3A 3IA1A 2BMXA 1FVJA 1K0OA 2YJ7A 1GUHA 4L5OA 3O3TA 1MD4A 3IOSA 5H5QA 1GRXA 2YANA 2VAFA 3UVTA 2GS3A 5B7CA 2VLVA 4E8HA 1FVKA 4GCIA 4I2TA 2H66A 1B4PA 1YQ1A 1SL2B 3ERGA 1SKSB 1SK2A 2I9HA 1HNAA 2FUG2 3DRNA 1SD9A 2IPAA 1TRVA 2F51A 2C80A 1VF3A 1ZOFA 2VL2A 4GXZA 4MH3A 3WT2A 1SJIA 1K0DA 1F37A 1QGVA 2GSQA 3GN3A 1G0TA 5GAPD 2QA2A 3DXBA 3EC3A 3G9BA 3E3EA 3A2WA 4LLRA 2VCVA 2C3QA 1R7HA 2FNOA 5ECRB 5KOXA 1VF4A 1RW1A 2J23A 1ZCPA 3VFIA 3FZAA 3RBTA 3VWXA 1THXA 4IS0A 2IJYA 4YKGA 1KNGA 4ZB6A 5AIXA 4HZ2A 2AUVA 3KIJA 4F03A 1WMJA 1FOVA 2HNLA 1PL1A 3PH9A 2H0GA 1X9SB 2JU5A 12GSA 1OC3A 3TJKA 2JZTA 1HNCA 2LNSA 4Z2TA 4IGJA 2OADA 4YKFA 1YY7A 1AXDA 1KEBA 1TJDA 1SENA 3CBUA 3DIEA 3C1RA 1AQWA 3QAVA 2LKUA 3TKSE 4ZBBA 1X5DA 2H6ZA 2HSMA 4GSTA 5DVBA 1NSWA 3D6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LD0 A;  2YOI A;  4ECB A;  1KBN A;  4PQ1 A;  2M46 A;  2C3T A;  4GLT A;  4RQR A;  4HJM A;  4D73 B;  2VO4 A;  5CP1 A;  2DC5 A;  4XTS A;  2BTO T;  1SKR B;  4G19 A;  4KE3 A;  4PXO A;  3GKM A;  4WBJ A;  4FH8 A;  6GST A;  5J3R A;  4JR6 A;  3TKS C;  2F3M A;  4OCE A;  1M9B A;  3VI5 A;  2AHE A;  1H75 A;  5F8B A;  3ZML A;  2V6K A;  4EDY A;  2XHF A;  3GX8 A;  3LWA A;  4KGI A;  5IPG A;  6GSV A;  3TCO A;  1UN2 A;  2XPE A;  5FWG A;  1ZL9 A;  4HZ4 A;  4HDE A;  4NPB A;  1XFL A;  5D8I A;  1X0R A;  5GZZ B;  3TOT A;  2CVB A;  2OBI A;  4OFN A;  1MTC A;  2VOC A;  4V2M A;  3E9J B;  2HXK A;  3LSZ A;  4YH2 A;  2WJU A;  4JRR A;  2AJQ B;  3OR5 A;  5J4U A;  2RUE A;  5DQY A;  5E4W A;  3KXO A;  2LQQ A;  2WUL A;  4GSN A;  5G30 A;  2H1G A;  1SK1 A;  3CSI A;  2QKE A;  3DYR A;  3GNJ A;  2A2S A;  1Z9H A;  1JLW A;  3VUR A;  4V1A p;  3UMA A;  3BBY A;  2WDU A;  2LQO A;  4MA9 A;  3EVI A;  4MP4 A;  4K7O A;  2B1K A;  3BJ5 A;  1WWJ A;  2VLU A;  3LQ7 A;  1EV4 A;  2YCD A;  3QAW A;  1XWB A;  5IMZ A;  5AN1 A;  4TVE A;  5AIV A;  4PGT A;  1TP9 A;  5E59 A;  5DQS A;  1IYI A;  1GH2 A;  1B9X C;  4L8E A;  4I8B A;  2H01 A;  3BOA A;  2C1Y A;  3L9V A;  2HZE A;  4GF0 A;  2EC4 A;  3ZL5 A;  3F6D A;  5H5S A;  2ZNM A;  3IV4 A;  3CSH A;  4ZIJ A;  1Z7R A;  3VK9 A;  3LGC A;  1A0F A;  4POB A;  3A2V A;  1DBY A;  2JZS A;  3FR3 A;  1EWX A;  3HY2 A;  3KCM A;  4MPG A;  1FO5 A;  1A23 A;  4IEL A;  2R37 A;  3FEU A;  1HNB A;  2WFC A;  4ULX A;  1WRY A;  3JCM L;  5KN3 A;  1BX9 A;  2K18 A;  3TUE A;  2GT5 A;  5COH A;  1HQO A;  1OE8 A;  1FHE A;  1QQ2 A;  1MDJ A;  3MDK A;  1K3L A;  5HFG A;  5IMA A;  4O92 A;  2YJH A;  1PN9 A;  3CSJ A;  4KDY A;  1ERU A;  4YQU A;  3ERW A;  3F4T A;  3WGX A;  3RHB A;  1XZO A;  3GH9 A;  2GDR A;  2J9H A;  4GSS A;  2F9S A;  2GVP A;  3VWU A;  4V1A g;  4L0W A;  4WET A;  5CRG A;  4MF5 A;  4FIW A;  3EUR A;  3QOU A;  1S3D A;  2GQM A;  2WZ9 A;  4X43 A;  4KSM A;  4KDU A;  2GST A;  2CVD A;  3HJP A;  2HLS A;  4BWS A;  1B9Y C;  4I6X A;  1GSD A;  1XOA A;  2B6M A;  4LMV A;  1AW9 A;  4O32 A;  5IIZ A;  1YKA A;  2L5O A;  2R5G A;  3EE2 A;  3L0H A;  1Z5Y E;  3KMO A;  5D96 A;  1DSB A;  1R26 A;  2V41 A;  4ML6 A;  1TOF A;  1YKC A;  3GUR A;  3KH7 A;  2HSY A;  3IC4 A;  4MJE A;  2VL2 C;  3DML A;  1SYR A;  1TU8 A;  1A8Y A;  1VRS D;  5A4U A;  3H8Q A;  1GNE A;  4NAX A;  2NPB A;  5D9W A;  2IL3 A;  3GL3 A;  1TRU A;  3TKR A;  3F9U A;  5KEJ A;  4TN8 A;  2FA4 A;  3MAK A;  3KMN A;  3A3T A;  4TW5 A;  2N5F A;  1OAZ A;  2GZY A;  2YZH A;  1NHO A;  3KZQ A;  1ON4 A;  5DJM A;  1AQX A;  2E0Q A;  2AV4 A;  5C04 A;  4GRF A;  1SD8 A;  1M2D A;  5KN2 A;  2ALB A;  4L0U A;  3IDV A;  5F05 A;  1WE0 A;  5B6M A;  2YV9 A;  5AIS A;  4MDC A;  4TXO B;  1AC1 A;  2QSI A;  3FRC A;  1ZYE A;  4WF5 A;  1ILO A;  1F3A A;  4OFT A;  2H75 A;  1UC7 A;  1PA3 A;  4L5L A;  5FHI A;  1YDK A;  3W8S A;  5B8B A;  1TI1 A;  4HEA 2;  1PX6 A;  2RII A;  3M9K A;  4RI7 A;  2H72 A;  1A0R P;  4AJ7 A;  3RHC A;  2NBS A;  1BAY A;  2G2Q A;  2O87 A;  2PU9 C;  1RK4 A;  1JHB A;  2HT9 A;  1V40 A;  3EYT A;  2JL4 A;  1GTI A;  4WF4 A;  3IE3 A;  4PUA A;  4D73 A;  3BCI A;  3GSS A;  3GH6 A;  3UBK A;  4PNG A;  2KLX A;  4K2D A;  4GQC A;  1F2E A;  2VL9 A;  1X9W B;  3EWL A;  4OWY A;  6GSU A;  2YNX A;  2PVQ A;  1M2A A;  4WKW A;  1URM A;  3N9J A;  3CXG A;  3HJM A;  1O73 A;  1NW2 A;  5ECN B;  2LTK A;  4KAE A;  2MBS A;  11GS A;  5AGY A;  3WGE A;  2IN3 A;  1OC9 B;  2LJR A;  1UVZ A;  1TDI A;  1A2J A;  5EPF A;  3MWH A;  2E2G A;  2GQL A;  2R6K A;  4JU5 A;  1PX7 A;  2JSZ A;  4Z7X A;  1VF2 A;  5INY A;  1QXH A;  3US3 A;  2I81 A;  1X5E A;  2M72 A;  2PMT A;  1PKZ A;  2ON5 A;  3GUS A;  2ES7 A;  3KGK A;  3M0F A;  4OFM A;  4HOJ A;  3ZMK A;  2O89 A;  1ST9 A;  4G9H A;  1MD3 A;  1FB6 A;  3C71 A;  3WGD A;  1GTA A;  2IMI A;  1TRS A;  1JZD A;  3NIV A;  2V32 A;  1GSY A;  2H71 A;  1TK5 B;  2RLI A;  4QQ7 A;  1Z7P A;  2C3N A;  1U88 A;  2H6Y A;  2MBT A;  3FZ4 A;  5EY6 A;  2HZF A;  2IFQ B;  4TOP A;  1JZO A;  3P7X A;  2CQ9 A;  2DJ2 A;  5IOX A;  2H8L A;  4HQZ A;  3ZFL A;  1OKT A;  4F0C A;  5F07 A;  2M80 A;  3H93 A;  1C72 A;  1SU9 A;  4BL7 A;  1G6Y A;  1DUG A;  3Q18 A;  2K8V A;  2VD1 A;  2CX3 A;  1TRW A;  3F4S A;  2GLR A;  2MMO A;  1YJ6 A;  3H4K A;  3VPQ A;  1Q98 A;  3W6G A;  1GL8 A;  3HYP A;  3U5R E;  3TB2 A;  3LXZ A;  1HD2 A;  1TI3 A;  2IMF A;  3DD3 A;  1XCC A;  1S3C A;  1FAA A;  1J0F A;  3M9J A;  1A2M A;  2FA8 A;  2TRX A;  5HQP A;  1XVQ A;  2DJ1 A;  2X8H A;  3KTL A;  5JCU A;  4G2E A;  4CDO A;  1ZYQ B;  3N5O A;  1N2A A;  4IP1 A;  2L6C A;  1QMV A;  2L5L A;  4XS4 B;  2FWG A;  3HJO A;  3SBC A;  2OKA A;  4DSS B;  3CRU A;  9GSS A;  4ZBD A;  4JZQ A;  1PQN A;  4K7I A;  4TR0 A;  4EVM A;  3P90 A;  3PIN A;  1RQM A;  1TKD B;  1H4O A;  4Q5F A;  5EL8 A;  4KUN A;  5CRH A;  3IPZ A;  2YWM A;  1X5C A;  1XWG A;  4GTU A;  4DSR A;  3HXS A;  3H79 A;  4GWR A;  14GS A;  3KM6 A;  3UJ1 A;  22GS A;  1TTZ A;  2L59 A;  3R2Q A;  4QL9 A;  4ZL8 A;  1LBK A;  1WPI A;  2E2M A;  1T1V A;  4KX4 A;  2R3X A;  2V6O A;  2FHE A;  4LMW A;  1WIK A;  4HU9 A;  4MK3 A;  3C1S A;  3ZIT A;  5CAX A;  2H74 A;  3KTB A;  4X0X A;  5A4V A;  3V1W A;  1OKD A;  3J7Y k;  4K0N A;  2LNT A;  4P3Y B;  3UEM A;  3L9S A;  3CTF A;  6GSX A;  3G7J A;  4N10 A;  3LOR A;  3UAR A;  4X1U A;  4IP6 A;  4NHW A;  2IWT A;  1EEJ A;  4I2U A;  1EGO A;  2CT6 A;  4XIH A;  1K0C A;  5G1K A;  4IKH A;  1EGR A;  2HFD A;  1EEM A;  1TK8 B;  2ZUP A;  2YWI A;  5IMF A;  3EIN A;  17GS A;  2VCT A;  2XC2 A;  4POM A;  4EKZ A;  5CNW A;  4JED A;  2KP1 A;  3I69 A;  1F6M C;  1OE7 A;  1GLP A;  2DJK A;  3W8J A;  1OYJ A;  1BED A;  5C00 A;  4ZXG A;  2O8V B;  4F2I A;  5G1L A;  2GZZ A;  1GTB A;  3AY8 A;  3DGQ A;  2LRC A;  4K0G A;  2X8C A;  1USB A;  1T8E B;  1XW6 A;  3HVS A;  2B5Y A;  4KB3 A;  3SWL A;  1GTU A;  5GSS A;  2VIM A;  2VLT A;  2F8A A;  4K6X A;  1JZW A;  1EP7 A;  4WBR D;  1B48 A;  4TXO A;  1EV9 A;  2JAC A;  3KP8 A;  1JZR A;  2LRT A;  3ZVJ D;  4ML1 A;  2BJX A;  2DIY A;  4MCU A;  4CHS A;  3TJB A;  1K0M A;  4OO4 A;  2B3S A;  1J08 A;  5HR3 A;  1U6T A;  1M99 A;  3GFK A;  1K3Y A;  4PUR A;  3L9U A;  5ECM B;  1CQH A;  2HRN A;  5H5R A;  3VLN A;  2DJ0 A;  3EU3 A;  2AYT A;  2FWE A;  4AGS A;  3TGZ A;  2C0F A;  1GUK A;  1O6J A;  2CAI A;  3BD2 A;  1NHY A;  2YN1 A;  5DCH A;  4TR1 B;  1ZZY A;  4HI7 A;  3IXR A;  2EIR A;  3TRQ A;  4HQS A;  3HCZ A;  4F0B A;  2LJK A;  2HRF A;  4NXI A;  2CAQ A;  2L6D A;  3ED3 A;  3F0I A;  5JWQ B;  2DIZ A;  5HR2 A;  3GRX A;  2FCH A;  1BQ7 A;  4FYU A;  2H1B A;  1OC9 A;  2CX4 A;  3DWV A;  3GKX A;  4ECI A;  1TK0 B;  1XWK A;  1FW1 A;  3TDG A;  4O7H A;  3FY7 A;  1Z6M A;  1ML6 A;  2EIO A;  1R5P A;  1XW5 A;  2F8F A;  1V58 A;  5HFK A;  3FKF A;  3ZFB A;  1M2B A;  3QMX A;  2L57 A;  3C8E A;  2VM2 A;  4ZB8 A;  4V2L A;  3D5J A;  4ILF A;  2HE3 A;  4MJA A;  4TR3 A;  2P31 A;  3GV1 A;  5J9B A;  1AUC A;  1TU7 A;  4KND A;  4N30 A;  4WR4 A;  2C8U A;  2VL3 A;  1O7U A;  1WP0 A;  1SL0 B;  3UAP A;  2ZCT A;  2IFQ A;  2K8S A;  1BYE A;  4ID0 A;  1EZK A;  5G2Z A;  5IO2 A;  4MZW A;  3TRP A;  2HSH A;  3TJF A;  4MAB A;  1VF1 A;  3D22 A;  2DSA A;  2E7P A;  1LJR A;  3RDW A;  1XOB A;  1O85 A;  1R5A A;  4OMV A;  5D9X A;  1S3A A;  3MSZ A;  4G10 A;  1AQV A;  2PWJ A;  1Z3E A;  1M7T A;  4K9Z A;  4O5R A;  4N0Z A;  3TKP A;  3NZN A;  4IHU A;  2JSY A;  5KN1 A;  2YV7 A;  4QL7 A;  4BVY A;  1MEK A;  1E6B A;  2YZU A;  3ZIJ A;  2I4A A;  4N11 A;  2C0G A;  3ME8 A;  5LCZ A;  3DVX A;  1OC8 A;  4YQV A;  2KP2 A;  4IJ3 A;  4TR4 A;  1DE1 A;  5HFI A;  5HR0 A;  4AF2 A;  5JCG A;  4DEJ A;  3J7Y b;  1I5G A;  2PER A;  3APQ A;  1SKW B;  1ZMA A;  2C4J A;  4XS4 A;  2X8G A;  3QCP A;  4OD7 A;  3TOU A;  4DSS A;  5CRE A;  1I9D A;  2IMD A;  3IHQ A;  4MZB A;  5B8A A;  1M0U A;  5J9C A;  5ECL B;  5ID2 B;  2FD3 A;  3PGT A;  5LNK e;  4KW6 A;  3GKN A;  3P2A A;  1XPV A;  3HZ8 A;  2XBI A;  5F0G A;  1A2L A;  1GP1 A;  5ECQ B;  4Q5R A;  4ZIL A;  1F9M A;  2CVK A;  2VCZ A;  4TXV A;  4ISD A;  3WT1 A;  2XPD A;  1GSQ A;  3MNG A;  4FYC A;  4OCF A;  2MMZ A;  2N5B A;  3Q6O A;  2B7J A;  6GSW A;  5GST A;  1BG5 A;  3GKK A;  2LEG A;  3ZIV A;  1B4Q A;  1U87 A;  2LRN A;  2MMA A;  3IBH A;  1YEX A;  1YF0 A;  1OVN A;  4Q5N A;  1QK8 A;  2H30 A;  2MMN A;  3HHV A;  3U6V A;  2A4V A;  4MH2 A;  4POK A;  3I6A A;  1GWC A;  5ECO B;  2LUS A;  1ERT A;  2H1A A;  5FT3 A;  1PKW A;  2VUP A;  3HVX A;  4EUY A;  4FO5 A;  2PN8 A;  2I3Y A;  4GQF A;  5A4W A;  4JE1 A;  1ZGN A;  3TJJ A;  1GSU A;  2GSS A;  5KN0 A;  2GT6 A;  5ECS A;  1T7P B;  2KHP A;  3DVW A;  4H86 A;  1ABA A;  1K0N A;  1W4V A;  4AJ6 A;  4EXJ A;  4XRD A;  3CRT A;  2YPM A;  3FR6 A;  3HZ4 A;  4F9Z A;  2PUK C;  3IRA A;  2H0H A;  4TRX A;  4XRA A;  2H73 A;  4MPF A;  3VWW A;  2HI7 A;  4PNF A;  2H76 A;  3WYW A;  3VPT A;  4IW9 A;  1A24 A;  5ECI B;  1ERW A;  2WRT A;  2DML A;  4XHM A;  3D4M A;  2FY6 A;  5EVO A;  4KCE A;  2VCQ A;  4YAP A;  3QFA C;  4MJB A;  1X9M B;  2X64 A;  4NV5 A;  4ECJ A;  1PGT A;  2B5X A;  4EC0 A;  2DJ3 A;  3ZRE A;  1ACV A;  5J41 A;  2OE3 A;  3KD0 A;  3RPN A;  2ON7 A;  1G7E A;  2VM1 A;  4TR1 A;  2RM6 A;  3A5W A;  3TRX A;  1K0B A;  5JWR B;  4IN0 A;  4BA7 A;  2YWN A;  1FG4 A;  4HUA A;  1N8J A;  1QFN A;  4XCS A;  3TKQ A;  2H0I A;  1V57 A;  1KTE A;  2FWF A;  3IAS 2;  3QDN A;  1DE2 A;  4XS6 A;  4ZBA A;  3UBL A;  1XVW A;  2H19 A;  4EO3 A;  3KEB A;  5G5F A;  2YWO A;  5DAL B;  4BVX A;  3I9V 2;  4N0V A;  4HJ2 A;  2TIR A;  4IQA A;  1PSQ A;  3Q19 A;  4RI6 A;  2OA7 A;  2DLX A;  4MF6 A;  5J5N A;  3HDC A;  2D2Z A;  2NDO A;  3HKR A;  4EL1 A;  1THO A;  1B8X A;  4V2N A;  5IOW A;  3QD9 A;  3LYK A;  1T4Y A;  1GSS A;  4LL1 B;  4BWQ A;  1Z6N A;  4I5Q A;  4K1F A;  4LA1 A;  4PX1 A;  4ZB9 A;  2OE0 A;  2P0G A;  2FGX A;  4J2F A;  1Y6E A;  2OE1 A;  4KA0 A;  4OO5 A;  1F3B A;  2CV4 A;  2OJL A;  3UIW A;  4LL4 B;  4WEY A;  4CW9 A;  4MF7 A;  4EE0 A;  2AAW A;  3C7M A;  4WXT A;  2PVO C;  5IMC A;  2CZ2 A;  1XW9 A;  5ECH B;  5ELA A;  5IPH A;  2I1U A;  1K3O A;  2IMK A;  3APS A;  3O76 A;  2EIQ A;  2B7K A;  3Q74 A;  2R2J A;  1K0A A;  5DJL A;  2B1L A;  1PMT A;  4PQI A;  5ECK B;  2HYX A;  3ERF A;  3GIX A;  2P5Q A;  3G7Y A;  1Y25 A;  2NTO A;  3GST A;  3FR9 A;  3WD6 A;  2IIY A;  3ZLP A;  3FHK A;  4I97 A;  2V1M A;  3IAM 2;  3EMX A;  3IK9 A;  3D21 A;  1J9B A;  3LFL A;  3ZTL A;  4AJ8 A;  2XBQ A;  1ERV A;  5DAK B;  3TJG A;  4RUV A;  5ECP B;  2GQK A;  5A5K A;  3HD5 A;  3FW2 A;  2IME A;  5CRW A;  1SJZ A;  1EOH A;  2WGR A;  6GSY A;  6GSS A;  10GS A;  4HU7 A;  1JLV A;  1XBS A;  5G5E A;  1A8L A;  3QFB C;  5IO0 A;  3F8U A;  2JAD A;  3QAG A;  1YZX A;  1BJX A;  4NV2 A;  4DSQ A;  1SYX A;  2LST A;  3GTU B;  3DKS A;  2DMM A;  4DVC A;  1G6W A;  5ID2 A;  5ELG A;  5GAN D;  3F63 A;  3D0Z A;  5JWO B;  4EDZ A;  18GS A;  4IBP A;  2H1D A;  3ZRD A;  2Z9S A;  3IK7 A;  4NWY A;  5D9T A;  4BPY A;  3VI7 A;  4XS1 A;  1XIY A;  1EOG A;  1VGL A;  4YQM A;  3ISO A;  1W89 A;  3LEF A;  1SL1 B;  2NVL A;  3E0U A;  3D4T A;  2H6X A;  2FLS A;  1FB0 A;  2WB9 A;  2DBC A;  1PD2 1;  2L4C A;  3QR6 A;  2X99 A;  3HA9 A;  4F82 A;  5ABR A;  1GNW A;  2RUF A;  2GSR A;  3O6T A;  2VCW A;  5D73 A;  3F4R A;  4IQ1 A;  2REM A;  3PR8 A;  2B5E A;  1UA5 A;  1GSE A;  1YEP A;  4IJI A;  3LXT A;  2G0F A;  2CZ3 A;  3C73 A;  1O81 A;  2V2G A;  3S9F A;  2OAC A;  3EMP A;  1WJK A;  4WR5 A;  2PGT A;  4TKY A;  3CMI A;  4E8E A;  3F6F A;  3APO A;  3M3M A;  1XWC A;  3KH9 A;  1GUM A;  5DCG A;  3HVV A;  13GS A;  5ENU A;  2QGV A;  2FWH A;  1T00 A;  2P5R A;  3CTG A;  4KH7 A;  1PL2 A;  1O8W A;  4MZC A;  5IMV A;  1V9W A;  3GX0 A;  1MDK A;  3RAZ A;  1CQG A;  1HYU A;  5CYY A;  2GZP A;  3ZZX A;  4K8M A;  4NHZ A;  3I43 A;  1T3B A;  2K6V A;  2YP6 A;  4POL A;  3VWV A;  1E2Y A;  4KDX A;  3EU4 A;  2TRC P;  1XWA A;  2N5A A;  3QPM A;  1TXX A;  3TKS A;  3FK8 A;  2WCI A;  4ZL9 A;  3LG6 A;  3ZVJ A;  2A2R A;  4J56 E;  2K9F A;  4ECC A;  1EP8 A;  4ZL7 A;  2R4V A;  3LJR A;  4J57 E;  20GS A;  3KJY A;  3F3R A;  4JR4 A;  4PQH A;  1IYH A;  2LV3 A;  3FZ5 A;  3RPP A;  2VCX A;  4RQX A;  1G7O A;  1SK0 A;  7GSS A;  5DAL A;  4YAV A;  2C0E A;  1T4Z A;  3L4N A;  1O8X A;  3UOM A;  2RM5 A;  1AIU A;  3GA4 A;  1GUL A;  1U3A A;  1JFU A;  3KP9 A;  3K8N A;  2O7K A;  1TW9 A;  1Q4J A;  2GTU A;  3ZYW A;  2OBK A;  4NMU A;  1V2A A;  2LS5 A;  2KOK A;  4MLY A;  1QUW A;  1GSF A;  2JZR A;  4PUF C;  3IR4 A;  4FYB A;  4KSO A;  2O85 A;  1NM3 A;  2KUC A;  1YF1 A;  2PPT A;  3H1N A;  1AAZ A;  3UL3 A;  3CYN A;  5HR1 A;  3BCK A;  3FZ9 A;  5G31 A;  3GYK A;  4MJC A;  1PRX A;  5IMD A;  4IVF A;  19GS A;  1U3I A;  5D93 A;  2C0D A;  2PBJ A;  2MYG A;  5IQY A;  2HZE B;  2VD0 A;  4JBB A;  1R4W A;  3A2X A;  3L78 A;  1WOU A;  2AB6 A;  2GGT A;  4K7N A;  1XXU A;  3GL5 A;  3M1G A;  5IM9 A;  2QC7 A;  3LYP A;  5DDL A;  3F3Q A;  3GMF A;  2MZC A;  1GLQ A;  5F06 A;  2L4Q A;  5DAK A;  4KCA A;  3FYG A;  5JCW A;  2H70 A;  2CA8 A;  5DBQ A;  1LU4 A;  2WS2 A;  1MDI A;  4Q5Q A;  3GHA A;  5D9V A;  3UVH A;  4EF0 A;  3DEX A;  4MMM A;  5L71 A;  16GS A;  1V98 A;  2DJJ A;  3ME7 A;  5B6N A;  2LJA A;  4ACS A;  3GTU A;  3P8W A;  5CRD A;  1M9A A;  3NOF A;  4HS1 A;  1SJ6 A;  8GSS A;  3G7I A;  3M8N A;  5CO3 A;  3IA1 A;  2BMX A;  1FVJ A;  1K0O A;  2YJ7 A;  1GUH A;  4L5O A;  3O3T A;  1MD4 A;  3IOS A;  5H5Q A;  1GRX A;  2YAN A;  2VAF A;  3UVT A;  2GS3 A;  5B7C A;  2VLV A;  4E8H A;  1FVK A;  4GCI A;  4I2T A;  2H66 A;  1B4P A;  1YQ1 A;  1SL2 B;  3ERG A;  1SKS B;  1SK2 A;  2I9H A;  1HNA A;  2FUG 2;  3DRN A;  1SD9 A;  2IPA A;  1TRV A;  2F51 A;  2C80 A;  1VF3 A;  1ZOF A;  2VL2 A;  4GXZ A;  4MH3 A;  3WT2 A;  1SJI A;  1K0D A;  1F37 A;  1QGV A;  2GSQ A;  3GN3 A;  1G0T A;  5GAP D;  3DXB A;  3EC3 A;  3G9B A;  3E3E A;  3A2W A;  2VCV A;  2C3Q A;  4LLR A;  1R7H A;  2FNO A;  5ECR B;  1VF4 A;  1RW1 A;  2J23 A;  1ZCP A;  3VFI A;  3FZA A;  3RBT A;  3VWX A;  1THX A;  4IS0 A;  2IJY A;  1KNG A;  4ZB6 A;  5AIX A;  4HZ2 A;  2AUV A;  3KIJ A;  4F03 A;  1WMJ A;  1FOV A;  2HNL A;  1PL1 A;  3PH9 A;  2H0G A;  1X9S B;  2JU5 A;  12GS A;  1OC3 A;  3TJK A;  2JZT A;  1HNC A;  2LNS A;  4IGJ A;  2OAD A;  1YY7 A;  1AXD A;  1KEB A;  1TJD A;  1SEN A;  3CBU A;  3DIE A;  3C1R A;  1AQW A;  3QAV A;  2LKU A;  3TKS E;  4ZBB A;  1X5D A;  2H6Z A;  4GST A;  5DVB A;  1NSW A;  3D6I A; 
#chains in the Genus database with same CATH topology
 5LD0 A;  2YOI A;  3FMW A;  4ECB A;  1KBN A;  4KF9 A;  4PQ1 A;  2M46 A;  2C3T A;  4GLT A;  4RQR A;  1ZYP A;  4HJM A;  4D73 B;  2VO4 A;  5CP1 A;  2DC5 A;  4XTS A;  2BTO T;  1SKR B;  4G19 A;  4KE3 A;  4PXO A;  3GKM A;  4WBJ A;  4FH8 A;  6GST A;  5J3R A;  4JR6 A;  3TKS C;  2F3M A;  4OCE A;  1M9B A;  3VI5 A;  2AHE A;  1H75 A;  5F8B A;  3ZML A;  2V6K A;  4EDY A;  2XHF A;  3GX8 A;  3LWA A;  4KGI A;  5IPG A;  4CY8 A;  6GSV A;  3TCO A;  1UN2 A;  2XPE A;  5FWG A;  1ZL9 A;  4HZ4 A;  4HDE A;  4NPB A;  1XFL A;  5D8I A;  1X0R A;  5GZZ B;  3TOT A;  2CVB A;  2OBI A;  4OFN A;  1MTC A;  2VOC A;  4V2M A;  3E9J B;  2HXK A;  3LSZ A;  4YH2 A;  2WJU A;  4JRR A;  2AJQ B;  3OR5 A;  5J4U A;  2RUE A;  5DQY A;  5E4W A;  3KXO A;  2LQQ A;  2WUL A;  4GSN A;  5G30 A;  2H1G A;  1SK1 A;  3CSI A;  2QKE A;  3DYR A;  3GNJ A;  2A2S A;  1Z9H A;  1JLW A;  3VUR A;  4V1A p;  3UMA A;  3A5I A;  3BBY A;  2WDU A;  2LQO A;  4MA9 A;  3EVI A;  4MP4 A;  4K7O A;  2B1K A;  3BJ5 A;  1WWJ A;  2VLU A;  3LQ7 A;  1EV4 A;  2YCD A;  4BL7 B;  3QAW A;  1XWB A;  5IMZ A;  5AN1 A;  4TVE A;  5AIV A;  3MYD A;  4PGT A;  1TP9 A;  5E59 A;  5DQS A;  1IYI A;  1GH2 A;  1B9X C;  4L8E A;  4I8B A;  2H01 A;  3BOA A;  2C1Y A;  3L9V A;  2HZE A;  4GF0 A;  2EC4 A;  3ZL5 A;  3F6D A;  5H5S A;  2ZNM A;  3IV4 A;  3CSH A;  4ZIJ A;  1Z7R A;  3VK9 A;  3LGC A;  1A0F A;  4POB A;  3A2V A;  1DBY A;  2JZS A;  3FR3 A;  1EWX A;  3HY2 A;  3KCM A;  4MPG A;  1FO5 A;  1A23 A;  4IEL A;  2R37 A;  3FEU A;  1HNB A;  2WFC A;  4ULX A;  1WRY A;  3JCM L;  5KN3 A;  1BX9 A;  2K18 A;  3TUE A;  2GT5 A;  5COH A;  1HQO A;  1OE8 A;  1FHE A;  1QQ2 A;  1MDJ A;  3MDK A;  1K3L A;  5HFG A;  5IMA A;  4O92 A;  2YJH A;  1PN9 A;  3CSJ A;  4KDY A;  1ERU A;  4YQU A;  3ERW A;  3F4T A;  3WGX A;  3RHB A;  1XZO A;  3GH9 A;  2GDR A;  2J9H A;  4G0L A;  4GSS A;  2F9S A;  2GVP A;  1PFO A;  3VWU A;  4V1A g;  4L0W A;  4WET A;  5CRG A;  4MF5 A;  4FIW A;  3EUR A;  3QOU A;  1S3D A;  2GQM A;  2WZ9 A;  4X43 A;  4KSM A;  4KDU A;  2GST A;  2CVD A;  3HJP A;  2HLS A;  4BWS A;  1B9Y C;  4I6X A;  1GSD A;  1XOA A;  2B6M A;  4LMV A;  1AW9 A;  4O32 A;  5IIZ A;  1YKA A;  2L5O A;  2R5G A;  3EE2 A;  3L0H A;  1Z5Y E;  3KMO A;  5D96 A;  1DSB A;  1R26 A;  2V41 A;  4ML6 A;  1TOF A;  1YKC A;  3GUR A;  3KH7 A;  2HSY A;  3IC4 A;  4MJE A;  2VL2 C;  3DML A;  1SYR A;  1TU8 A;  1A8Y A;  1VRS D;  5A4U A;  3H8Q A;  1GNE A;  4NAX A;  2NPB A;  5D9W A;  2IL3 A;  3GL3 A;  1TRU A;  3TKR A;  3F9U A;  5KEJ A;  4TN8 A;  2FA4 A;  3MAK A;  3KMN A;  3A3T A;  4TW5 A;  2N5F A;  1OAZ A;  2GZY A;  2YZH A;  1NHO A;  3KZQ A;  1ON4 A;  4BIK A;  5DJM A;  1AQX A;  2E0Q A;  2AV4 A;  5C04 A;  4GRF A;  4K5R A;  1SD8 A;  1M2D A;  5KN2 A;  2ALB A;  4L0U A;  3IDV A;  5F05 A;  1WE0 A;  5B6M A;  2YV9 A;  5AIS A;  4MDC A;  3PPU A;  4TXO B;  1AC1 A;  2QSI A;  3FRC A;  1ZYE A;  4WF5 A;  1ILO A;  1F3A A;  4OFT A;  4O5Q A;  2H75 A;  1UC7 A;  1PA3 A;  4L5L A;  5FHI A;  1YDK A;  3W8S A;  5B8B A;  1TI1 A;  4HEA 2;  1PX6 A;  2RII A;  3M9K A;  4RI7 A;  2H72 A;  1A0R P;  4AJ7 A;  2X49 A;  3RHC A;  2NBS A;  3MIX A;  1BAY A;  2G2Q A;  2O87 A;  2PU9 C;  1RK4 A;  1JHB A;  2HT9 A;  1V40 A;  3EYT A;  2JL4 A;  1GTI A;  4WF4 A;  3IE3 A;  4PUA A;  4D73 A;  3BCI A;  3GSS A;  3GH6 A;  3UBK A;  4PNG A;  2KLX A;  4K2D A;  4GQC A;  1F2E A;  2VL9 A;  1X9W B;  3EWL A;  4OWY A;  6GSU A;  2YNX A;  2PVQ A;  1M2A A;  4WKW A;  1URM A;  3N9J A;  3CXG A;  3HJM A;  1O73 A;  1NW2 A;  5ECN B;  2LTK A;  4KAE A;  2MBS A;  11GS A;  5AGY A;  3WGE A;  2IN3 A;  1OC9 B;  2LJR A;  4CY6 A;  1UVZ A;  1TDI A;  1A2J A;  5EPF A;  3MWH A;  2E2G A;  2GQL A;  2R6K A;  4JU5 A;  1PX7 A;  2JSZ A;  4Z7X A;  1VF2 A;  5INY A;  1QXH A;  3US3 A;  2I81 A;  1X5E A;  2M72 A;  2PMT A;  1PKZ A;  2ON5 A;  3GUS A;  2ES7 A;  3KGK A;  3M0F A;  4OFM A;  4HOJ A;  3ZMK A;  2O89 A;  1ST9 A;  4G9H A;  1MD3 A;  1FB6 A;  3C71 A;  3WGD A;  1GTA A;  2IMI A;  1TRS A;  1JZD A;  2X4A A;  3NIV A;  2V32 A;  1GSY A;  2H71 A;  1TK5 B;  2RLI A;  4QQ7 A;  1Z7P A;  2C3N A;  1U88 A;  2H6Y A;  2QA1 A;  2MBT A;  3FZ4 A;  5EY6 A;  2HZF A;  2IFQ B;  4TOP A;  1JZO A;  3P7X A;  2CQ9 A;  2DJ2 A;  5IOX A;  2H8L A;  4HQZ A;  3ZFL A;  1OKT A;  4F0C A;  5F07 A;  2M80 A;  3H93 A;  1C72 A;  1SU9 A;  1M3J A;  4BL7 A;  1G6Y A;  1DUG A;  3Q18 A;  2K8V A;  2VD1 A;  2CX3 A;  1TRW A;  3F4S A;  2GLR A;  2MMO A;  1YJ6 A;  4Z2R A;  3H4K A;  3VPQ A;  1Q98 A;  3W6G A;  1GL8 A;  3HYP A;  4BVY B;  3U5R E;  3TB2 A;  3LXZ A;  1HD2 A;  1TI3 A;  2IMF A;  3DD3 A;  3EPT A;  1XCC A;  1S3C A;  1FAA A;  1J0F A;  3M9J A;  1A2M A;  4EIP A;  2FA8 A;  2TRX A;  5HQP A;  1XVQ A;  1S3R A;  2DJ1 A;  2X8H A;  3KTL A;  5JCU A;  4G2E A;  4CDO A;  1FOH A;  1ZYQ B;  3N5O A;  1N2A A;  4IP1 A;  2L6C A;  1QMV A;  2L5L A;  4XS4 B;  2FWG A;  3HJO A;  3SBC A;  2OKA A;  4DSS B;  3CRU A;  9GSS A;  4ZBD A;  4O5U A;  2R0C A;  4JZQ A;  1PQN A;  4K7I A;  4TR0 A;  4EVM A;  3P90 A;  3PIN A;  1RQM A;  1TKD B;  1H4O A;  4Q5F A;  5EL8 A;  4KUN A;  5CRH A;  3IPZ A;  2YWM A;  1X5C A;  1XWG A;  4GTU A;  4DSR A;  3HXS A;  3H79 A;  4GWR A;  14GS A;  3KM6 A;  3UJ1 A;  22GS A;  1TTZ A;  2L59 A;  3R2Q A;  4QL9 A;  4ZL8 A;  1LBK A;  1WPI A;  2E2M A;  1T1V A;  4KX4 A;  2R3X A;  2V6O A;  2FHE A;  4LMW A;  1WIK A;  4HU9 A;  4MK3 A;  3C1S A;  3ZIT A;  5CAX A;  2H74 A;  3KTB A;  4X0X A;  5A4V A;  3V1W A;  1OKD A;  3J7Y k;  4K0N A;  2LNT A;  4P3Y B;  3UEM A;  3L9S A;  3CTF A;  6GSX A;  3G7J A;  4N10 A;  3LOR A;  3UAR A;  4X1U A;  4IP6 A;  4NHW A;  2IWT A;  3HVN A;  1EEJ A;  4I2U A;  1EGO A;  2CT6 A;  4XIH A;  1K0C A;  5G1K A;  4IKH A;  1EGR A;  2HFD A;  1EEM A;  1TK8 B;  2ZUP A;  2YWI A;  5IMF A;  3EIN A;  17GS A;  2VCT A;  2XC2 A;  4POM A;  4EKZ A;  5CNW A;  4JED A;  2KP1 A;  3I69 A;  1F6M C;  1OE7 A;  1GLP A;  2DJK A;  3W8J A;  1OYJ A;  1BED A;  5C00 A;  4ZXG A;  2O8V B;  4F2I A;  5G1L A;  2GZZ A;  1GTB A;  3AY8 A;  3DGQ A;  2LRC A;  4K0G A;  2X8C A;  1USB A;  1T8E B;  1XW6 A;  3HVS A;  2B5Y A;  4KB3 A;  3SWL A;  1GTU A;  5GSS A;  2VIM A;  2VLT A;  2F8A A;  4K6X A;  1JZW A;  1EP7 A;  4WBR D;  1B48 A;  4TXO A;  1EV9 A;  2JAC A;  3KP8 A;  1JZR A;  2LRT A;  3ZVJ D;  4ML1 A;  2BJX A;  2DIY A;  4MCU A;  4CHS A;  4A5P A;  3TJB A;  1K0M A;  4OO4 A;  2B3S A;  1J08 A;  5HR3 A;  1U6T A;  1M99 A;  3GFK A;  1K3Y A;  4PUR A;  3L9U A;  3IHG A;  5ECM B;  1CQH A;  2HRN A;  5H5R A;  3VLN A;  2DJ0 A;  3EU3 A;  2AYT A;  2FWE A;  4G0I A;  3TGZ A;  4AGS A;  2C0F A;  1GUK A;  1O6J A;  2CAI A;  3BD2 A;  1NHY A;  2YN1 A;  5DCH A;  4TR1 B;  1ZZY A;  2DKH A;  4HI7 A;  3IXR A;  2EIR A;  3TRQ A;  4HQS A;  3HCZ A;  4F0B A;  2LJK A;  2HRF A;  4NXI A;  2CAQ A;  1ZYN A;  2L6D A;  3ED3 A;  3F0I A;  5JWQ B;  2DIZ A;  5HR2 A;  3GRX A;  2FCH A;  1BQ7 A;  4FYU A;  2H1B A;  1OC9 A;  2CX4 A;  3DWV A;  3GKX A;  4ECI A;  1TK0 B;  1XWK A;  1FW1 A;  3TDG A;  4BVX B;  4O7H A;  3FY7 A;  1Z6M A;  1ML6 A;  2EIO A;  1R5P A;  1XW5 A;  2F8F A;  1V58 A;  5HFK A;  3FKF A;  3ZFB A;  1M2B A;  3QMX A;  2L57 A;  3C8E A;  2VM2 A;  4ZB8 A;  4V2L A;  3D5J A;  4ILF A;  2HE3 A;  4MJA A;  4TR3 A;  2P31 A;  3GV1 A;  5J9B A;  1AUC A;  1TU7 A;  4KND A;  4N30 A;  4WR4 A;  2C8U A;  2VL3 A;  1O7U A;  1WP0 A;  1SL0 B;  3UAP A;  2ZCT A;  2IFQ A;  4K2X A;  2K8S A;  1BYE A;  4ID0 A;  1EZK A;  5G2Z A;  5IO2 A;  4MZW A;  3TRP A;  2HSH A;  3TJF A;  4MAB A;  1VF1 A;  3D22 A;  2DSA A;  2E7P A;  1LJR A;  3RDW A;  1XOB A;  1O85 A;  1R5A A;  4OMV A;  5D9X A;  1S3A A;  3MSZ A;  4G10 A;  1AQV A;  2PWJ A;  1Z3E A;  1M7T A;  4K9Z A;  4O5R A;  4N0Z A;  3TKP A;  3IC8 A;  3NZN A;  4IHU A;  2JSY A;  5KN1 A;  2YV7 A;  4QL7 A;  4BVY A;  1MEK A;  1E6B A;  2YZU A;  3ZIJ A;  2I4A A;  4N11 A;  2C0G A;  3ME8 A;  5LCZ A;  3DVX A;  2HRA A;  1OC8 A;  4YQV A;  2KP2 A;  4IJ3 A;  4TR4 A;  1DE1 A;  5HFI A;  5HR0 A;  4AF2 A;  5JCG A;  4X4J A;  4DEJ A;  3J7Y b;  1I5G A;  2PER A;  3APQ A;  1SKW B;  1ZMA A;  2C4J A;  4XS4 A;  2X8G A;  3QCP A;  4OD7 A;  3TOU A;  4DSS A;  5CRE A;  1I9D A;  2IMD A;  3IHQ A;  4MZB A;  5B8A A;  1M0U A;  5J9C A;  5ECL B;  5ID2 B;  2FD3 A;  3PGT A;  5BMU A;  5LNK e;  4KW6 A;  3GKN A;  3P2A A;  1XPV A;  3HZ8 A;  2XBI A;  5F0G A;  1A2L A;  1GP1 A;  5ECQ B;  4Q5R A;  4ZIL A;  1F9M A;  2CVK A;  2VCZ A;  4TXV A;  4ISD A;  3WT1 A;  2XPD A;  1GSQ A;  3MNG A;  4FYC A;  4OCF A;  2MMZ A;  2N5B A;  3Q6O A;  2B7J A;  6GSW A;  5GST A;  1BG5 A;  3GKK A;  2LEG A;  3ZIV A;  1B4Q A;  1U87 A;  4USS A;  2LRN A;  2MMA A;  3IBH A;  1YEX A;  1YF0 A;  1OVN A;  4Q5N A;  1QK8 A;  2H30 A;  2MMN A;  3HHV A;  3U6V A;  2A4V A;  4MH2 A;  4POK A;  3I6A A;  1GWC A;  5ECO B;  2LUS A;  1ERT A;  2H1A A;  5FT3 A;  1PKW A;  2VUP A;  3HVX A;  4EUY A;  4FO5 A;  2PN8 A;  2I3Y A;  4GQF A;  5A4W A;  4JE1 A;  1ZGN A;  3TJJ A;  1GSU A;  2DKI A;  2GSS A;  5KN0 A;  2GT6 A;  5ECS A;  1T7P B;  2KHP A;  3DVW A;  4H86 A;  1ABA A;  1K0N A;  1W4V A;  4AJ6 A;  4EXJ A;  3LW9 A;  4XRD A;  3CRT A;  2YPM A;  3FR6 A;  3HZ4 A;  4F9Z A;  2PUK C;  3IRA A;  2H0H A;  4TRX A;  4XRA A;  2H73 A;  4MPF A;  3VWW A;  2HI7 A;  4PNF A;  2H76 A;  3WYW A;  3VPT A;  4IW9 A;  1A24 A;  5ECI B;  1ERW A;  4G0K A;  2WRT A;  2DML A;  4XHM A;  3D4M A;  2FY6 A;  5EVO A;  4KCE A;  2VCQ A;  4YAP A;  3QFA C;  4MJB A;  1X9M B;  2X64 A;  4NV5 A;  4ECJ A;  1PGT A;  2B5X A;  4EC0 A;  2DJ3 A;  3ZRE A;  5BRT A;  1ACV A;  5J41 A;  2OE3 A;  3KD0 A;  3RPN A;  2R0P A;  2ON7 A;  1G7E A;  2VM1 A;  4TR1 A;  2RM6 A;  3A5W A;  3TRX A;  1K0B A;  5JWR B;  4IN0 A;  4BA7 A;  2YWN A;  1FG4 A;  4HUA A;  1N8J A;  1QFN A;  4XCS A;  3TKQ A;  2H0I A;  1V57 A;  1KTE A;  2FWF A;  3IAS 2;  3QDN A;  1DE2 A;  4XS6 A;  4ZBA A;  3UBL A;  1XVW A;  2H19 A;  4EO3 A;  3KEB A;  5G5F A;  2YWO A;  5DAL B;  4BVX A;  3I9V 2;  4N0V A;  4HJ2 A;  2TIR A;  4IQA A;  4EIQ A;  1PSQ A;  3Q19 A;  4RI6 A;  2OA7 A;  2DLX A;  4MF6 A;  5J5N A;  3HDC A;  2D2Z A;  2NDO A;  2R0G A;  3HKR A;  4EL1 A;  1THO A;  1B8X A;  4V2N A;  5IOW A;  3QD9 A;  3LYK A;  1T4Y A;  1GSS A;  4LL1 B;  4BWQ A;  1Z6N A;  4I5Q A;  4K1F A;  4LA1 A;  4PX1 A;  4ZB9 A;  1M3I A;  2OE0 A;  2P0G A;  2FGX A;  4J2F A;  1Y6E A;  2OE1 A;  4KA0 A;  2UZ8 A;  4OO5 A;  1F3B A;  2CV4 A;  3CQF A;  2OJL A;  3UIW A;  4LL4 B;  4WEY A;  4CW9 A;  4MF7 A;  4EE0 A;  2AAW A;  3C7M A;  4WXT A;  2PVO C;  5IMC A;  2CZ2 A;  1XW9 A;  5ECH B;  5ELA A;  5IPH A;  2I1U A;  1K3O A;  2IMK A;  3APS A;  3O76 A;  2EIQ A;  2B7K A;  3Q74 A;  2R2J A;  1K0A A;  5DJL A;  2B1L A;  1PMT A;  4PQI A;  5ECK B;  2HYX A;  3ERF A;  3GIX A;  2P5Q A;  3G7Y A;  1Y25 A;  2NTO A;  3GST A;  3FR9 A;  3WD6 A;  2IIY A;  3ZLP A;  3FHK A;  1PN0 A;  4I97 A;  2V1M A;  3IAM 2;  3EMX A;  3IK9 A;  3D21 A;  1J9B A;  3LFL A;  3ZTL A;  4AJ8 A;  4FQU A;  2XBQ A;  1ERV A;  5DAK B;  3TJG A;  4RUV A;  5ECP B;  2GQK A;  5A5K A;  3HD5 A;  3FW2 A;  2IME A;  2A4H A;  5CRW A;  1SJZ A;  1EOH A;  2WGR A;  6GSY A;  6GSS A;  10GS A;  4HU7 A;  1JLV A;  1XBS A;  5G5E A;  1A8L A;  3QFB C;  5IO0 A;  3F8U A;  2JAD A;  3QAG A;  1YZX A;  1BJX A;  4NV2 A;  4DSQ A;  1SYX A;  2LST A;  3GTU B;  3DKS A;  2DMM A;  4DVC A;  1G6W A;  5ID2 A;  5ELG A;  5GAN D;  3F63 A;  3D0Z A;  5JWO B;  4EDZ A;  18GS A;  4IBP A;  2H1D A;  3ZRD A;  2Z9S A;  3IK7 A;  4NWY A;  5D9T A;  4BPY A;  3VI7 A;  4XS1 A;  1XIY A;  1EOG A;  1VGL A;  3ISO A;  4YQM A;  1W89 A;  3LEF A;  1SL1 B;  2NVL A;  3E0U A;  4ICY A;  3D4T A;  2H6X A;  2FLS A;  1FB0 A;  2WB9 A;  2DBC A;  1PD2 1;  2L4C A;  3QR6 A;  2X99 A;  3HA9 A;  4F82 A;  5ABR A;  1GNW A;  2RUF A;  2GSR A;  3O6T A;  2VCW A;  5D73 A;  3F4R A;  4IQ1 A;  2REM A;  3PR8 A;  2B5E A;  1UA5 A;  1GSE A;  1YEP A;  4IJI A;  3LXT A;  2G0F A;  2CZ3 A;  3C73 A;  1O81 A;  2V2G A;  3S9F A;  2OAC A;  3EMP A;  1WJK A;  4WR5 A;  2PGT A;  4TKY A;  3CMI A;  4E8E A;  3F6F A;  3APO A;  3M3M A;  1XWC A;  3KH9 A;  1GUM A;  5DCG A;  3HVV A;  13GS A;  5ENU A;  2QGV A;  2FWH A;  1T00 A;  2P5R A;  3CTG A;  4KH7 A;  1PL2 A;  4K5S A;  1O8W A;  4MZC A;  4Z2U A;  5IMV A;  1V9W A;  2HRK A;  3GX0 A;  1MDK A;  3RAZ A;  1CQG A;  1HYU A;  5KOW A;  5CYY A;  2GZP A;  3ZZX A;  4K8M A;  4NHZ A;  3I43 A;  1T3B A;  2K6V A;  2YP6 A;  4POL A;  3VWV A;  1E2Y A;  4KDX A;  3EU4 A;  2TRC P;  1XWA A;  2N5A A;  3QPM A;  1TXX A;  3TKS A;  3FK8 A;  2WCI A;  4ZL9 A;  3LG6 A;  3ZVJ A;  2A2R A;  4J56 E;  2K9F A;  4ECC A;  1EP8 A;  4ZL7 A;  2R4V A;  3LJR A;  4J57 E;  20GS A;  3KJY A;  3F3R A;  4JR4 A;  4PQH A;  1IYH A;  2LV3 A;  3FZ5 A;  3RPP A;  2VCX A;  4RQX A;  1G7O A;  1SK0 A;  7GSS A;  5DAL A;  4YAV A;  2C0E A;  1T4Z A;  3L4N A;  1O8X A;  3UOM A;  2RM5 A;  1AIU A;  3GA4 A;  1GUL A;  1U3A A;  1JFU A;  3KP9 A;  3K8N A;  2O7K A;  1TW9 A;  1Q4J A;  2GTU A;  3ZYW A;  2OBK A;  4NMU A;  1V2A A;  2LS5 A;  2KOK A;  4MLY A;  1QUW A;  1GSF A;  2JZR A;  4PUF C;  3IR4 A;  4FYB A;  4KSO A;  2O85 A;  1NM3 A;  2KUC A;  1YF1 A;  2PPT A;  3H1N A;  1AAZ A;  3UL3 A;  3CYN A;  5HR1 A;  3BCK A;  3FZ9 A;  5G31 A;  3GYK A;  4MJC A;  1PRX A;  5IMD A;  4IVF A;  19GS A;  1U3I A;  5D93 A;  2C0D A;  2PBJ A;  2MYG A;  5IQY A;  2HZE B;  2VD0 A;  4JBB A;  1R4W A;  3A2X A;  3L78 A;  1WOU A;  2AB6 A;  2GGT A;  4K7N A;  1XXU A;  3GL5 A;  3M1G A;  5IM9 A;  4MNN A;  2QC7 A;  3LYP A;  5DDL A;  3F3Q A;  3GMF A;  2MZC A;  1GLQ A;  5F06 A;  2L4Q A;  5DAK A;  4KCA A;  3FYG A;  5JCW A;  3R3E A;  2H70 A;  2CA8 A;  5DBQ A;  1LU4 A;  2WS2 A;  1MDI A;  4Q5Q A;  3GHA A;  5D9V A;  3UVH A;  4EF0 A;  3DEX A;  4MMM A;  5L71 A;  16GS A;  1V98 A;  2DJJ A;  3ME7 A;  5B6N A;  2A2P A;  2LJA A;  4ACS A;  3GTU A;  3P8W A;  5CRD A;  1M9A A;  3NOF A;  4HS1 A;  4PTS A;  1SJ6 A;  8GSS A;  3G7I A;  3M8N A;  5CO3 A;  3IA1 A;  2BMX A;  1FVJ A;  1K0O A;  2YJ7 A;  1GUH A;  4L5O A;  3O3T A;  1MD4 A;  3IOS A;  5H5Q A;  1GRX A;  2YAN A;  2VAF A;  3UVT A;  2GS3 A;  5B7C A;  2VLV A;  4E8H A;  1FVK A;  4GCI A;  4I2T A;  2H66 A;  1B4P A;  1YQ1 A;  1SL2 B;  3ERG A;  1SKS B;  1SK2 A;  2I9H A;  1HNA A;  2FUG 2;  3DRN A;  1SD9 A;  2IPA A;  1TRV A;  2F51 A;  2C80 A;  1VF3 A;  1ZOF A;  2VL2 A;  4GXZ A;  4MH3 A;  3WT2 A;  1SJI A;  1K0D A;  1F37 A;  1QGV A;  2GSQ A;  3GN3 A;  1G0T A;  4HSC X;  5GAP D;  2QA2 A;  3DXB A;  3EC3 A;  3G9B A;  3E3E A;  3A2W A;  4LLR A;  2VCV A;  2C3Q A;  1R7H A;  2FNO A;  5ECR B;  5KOX A;  1VF4 A;  1RW1 A;  2J23 A;  1ZCP A;  3VFI A;  3FZA A;  3RBT A;  3VWX A;  1XG8 A;  1THX A;  4IS0 A;  2IJY A;  4YKG A;  1KNG A;  4ZB6 A;  5AIX A;  4HZ2 A;  2AUV A;  3KIJ A;  4F03 A;  1WMJ A;  1FOV A;  2HNL A;  1PL1 A;  3PH9 A;  2H0G A;  1X9S B;  2JU5 A;  12GS A;  1OC3 A;  3TJK A;  2JZT A;  1HNC A;  2LNS A;  4Z2T A;  4IGJ A;  2OAD A;  4YKF A;  1YY7 A;  1AXD A;  1KEB A;  1TJD A;  1SEN A;  3CBU A;  3DIE A;  3C1R A;  1AQW A;  3QAV A;  2LKU A;  3TKS E;  4ZBB A;  1X5D A;  2H6Z A;  2HSM A;  4GST A;  5DVB A;  1NSW A;  3D6I A; 
#chains in the Genus database with same CATH homology
 5LD0 A;  2YOI A;  3FMW A;  4ECB A;  1KBN A;  4KF9 A;  4PQ1 A;  2M46 A;  2C3T A;  4GLT A;  4RQR A;  1ZYP A;  4HJM A;  4D73 B;  2VO4 A;  5CP1 A;  2DC5 A;  4XTS A;  2BTO T;  1SKR B;  4G19 A;  4KE3 A;  4PXO A;  3GKM A;  4WBJ A;  4FH8 A;  6GST A;  5J3R A;  4JR6 A;  3TKS C;  2F3M A;  4OCE A;  1M9B A;  3VI5 A;  2AHE A;  1H75 A;  5F8B A;  3ZML A;  2V6K A;  4EDY A;  2XHF A;  3GX8 A;  3LWA A;  4KGI A;  5IPG A;  4CY8 A;  6GSV A;  3TCO A;  1UN2 A;  2XPE A;  5FWG A;  1ZL9 A;  4HZ4 A;  4HDE A;  4NPB A;  1XFL A;  5D8I A;  1X0R A;  5GZZ B;  3TOT A;  2CVB A;  2OBI A;  4OFN A;  1MTC A;  2VOC A;  4V2M A;  3E9J B;  2HXK A;  3LSZ A;  4YH2 A;  2WJU A;  4JRR A;  2AJQ B;  3OR5 A;  5J4U A;  2RUE A;  5DQY A;  5E4W A;  3KXO A;  2LQQ A;  2WUL A;  4GSN A;  5G30 A;  2H1G A;  1SK1 A;  3CSI A;  2QKE A;  3DYR A;  3GNJ A;  2A2S A;  1Z9H A;  1JLW A;  3VUR A;  4V1A p;  3UMA A;  3A5I A;  3BBY A;  2WDU A;  2LQO A;  4MA9 A;  3EVI A;  4MP4 A;  4K7O A;  2B1K A;  3BJ5 A;  1WWJ A;  2VLU A;  3LQ7 A;  1EV4 A;  2YCD A;  4BL7 B;  3QAW A;  1XWB A;  5IMZ A;  5AN1 A;  4TVE A;  5AIV A;  3MYD A;  4PGT A;  1TP9 A;  5E59 A;  5DQS A;  1IYI A;  1GH2 A;  1B9X C;  4L8E A;  4I8B A;  2H01 A;  3BOA A;  2C1Y A;  3L9V A;  2HZE A;  4GF0 A;  2EC4 A;  3ZL5 A;  3F6D A;  5H5S A;  2ZNM A;  3IV4 A;  3CSH A;  4ZIJ A;  1Z7R A;  3VK9 A;  3LGC A;  1A0F A;  4POB A;  3A2V A;  1DBY A;  2JZS A;  3FR3 A;  1EWX A;  3HY2 A;  3KCM A;  4MPG A;  1FO5 A;  1A23 A;  4IEL A;  2R37 A;  3FEU A;  1HNB A;  2WFC A;  4ULX A;  1WRY A;  3JCM L;  5KN3 A;  1BX9 A;  2K18 A;  3TUE A;  2GT5 A;  5COH A;  1HQO A;  1OE8 A;  1FHE A;  1QQ2 A;  1MDJ A;  3MDK A;  1K3L A;  5HFG A;  5IMA A;  4O92 A;  2YJH A;  1PN9 A;  3CSJ A;  4KDY A;  1ERU A;  4YQU A;  3ERW A;  3F4T A;  3WGX A;  3RHB A;  1XZO A;  3GH9 A;  2GDR A;  2J9H A;  4G0L A;  4GSS A;  2F9S A;  2GVP A;  3VWU A;  4V1A g;  4L0W A;  4WET A;  5CRG A;  4MF5 A;  4FIW A;  3EUR A;  3QOU A;  1S3D A;  2GQM A;  2WZ9 A;  4X43 A;  4KSM A;  4KDU A;  2GST A;  2CVD A;  3HJP A;  2HLS A;  4BWS A;  1B9Y C;  4I6X A;  1GSD A;  1XOA A;  2B6M A;  4LMV A;  1AW9 A;  4O32 A;  5IIZ A;  1YKA A;  2L5O A;  2R5G A;  3EE2 A;  3L0H A;  1Z5Y E;  3KMO A;  5D96 A;  1DSB A;  1R26 A;  2V41 A;  4ML6 A;  1TOF A;  1YKC A;  3GUR A;  3KH7 A;  2HSY A;  3IC4 A;  4MJE A;  2VL2 C;  3DML A;  1SYR A;  1TU8 A;  1A8Y A;  1VRS D;  5A4U A;  3H8Q A;  1GNE A;  4NAX A;  2NPB A;  5D9W A;  2IL3 A;  3GL3 A;  1TRU A;  3TKR A;  3F9U A;  5KEJ A;  4TN8 A;  2FA4 A;  3MAK A;  3KMN A;  3A3T A;  4TW5 A;  2N5F A;  1OAZ A;  2GZY A;  2YZH A;  1NHO A;  3KZQ A;  1ON4 A;  5DJM A;  1AQX A;  2E0Q A;  2AV4 A;  5C04 A;  4GRF A;  4K5R A;  1SD8 A;  1M2D A;  5KN2 A;  2ALB A;  4L0U A;  3IDV A;  5F05 A;  1WE0 A;  5B6M A;  2YV9 A;  5AIS A;  4MDC A;  3PPU A;  4TXO B;  1AC1 A;  2QSI A;  3FRC A;  1ZYE A;  4WF5 A;  1ILO A;  1F3A A;  4OFT A;  4O5Q A;  2H75 A;  1UC7 A;  1PA3 A;  4L5L A;  5FHI A;  1YDK A;  3W8S A;  5B8B A;  1TI1 A;  4HEA 2;  1PX6 A;  2RII A;  3M9K A;  4RI7 A;  2H72 A;  1A0R P;  4AJ7 A;  2X49 A;  3RHC A;  2NBS A;  3MIX A;  1BAY A;  2G2Q A;  2O87 A;  2PU9 C;  1RK4 A;  1JHB A;  2HT9 A;  1V40 A;  3EYT A;  2JL4 A;  1GTI A;  4WF4 A;  3IE3 A;  4PUA A;  4D73 A;  3BCI A;  3GSS A;  3GH6 A;  3UBK A;  4PNG A;  2KLX A;  4K2D A;  4GQC A;  1F2E A;  2VL9 A;  1X9W B;  3EWL A;  4OWY A;  6GSU A;  2YNX A;  2PVQ A;  1M2A A;  4WKW A;  1URM A;  3N9J A;  3CXG A;  3HJM A;  1O73 A;  1NW2 A;  5ECN B;  2LTK A;  4KAE A;  2MBS A;  11GS A;  5AGY A;  3WGE A;  2IN3 A;  1OC9 B;  2LJR A;  4CY6 A;  1UVZ A;  1TDI A;  1A2J A;  5EPF A;  3MWH A;  2E2G A;  2GQL A;  2R6K A;  4JU5 A;  1PX7 A;  2JSZ A;  4Z7X A;  1VF2 A;  5INY A;  1QXH A;  3US3 A;  2I81 A;  1X5E A;  2M72 A;  2PMT A;  1PKZ A;  2ON5 A;  3GUS A;  2ES7 A;  3KGK A;  3M0F A;  4OFM A;  4HOJ A;  3ZMK A;  2O89 A;  1ST9 A;  4G9H A;  1MD3 A;  1FB6 A;  3C71 A;  3WGD A;  1GTA A;  2IMI A;  1TRS A;  1JZD A;  2X4A A;  3NIV A;  2V32 A;  1GSY A;  2H71 A;  1TK5 B;  2RLI A;  4QQ7 A;  1Z7P A;  2C3N A;  1U88 A;  2H6Y A;  2QA1 A;  2MBT A;  3FZ4 A;  5EY6 A;  2HZF A;  2IFQ B;  4TOP A;  1JZO A;  3P7X A;  2CQ9 A;  2DJ2 A;  5IOX A;  2H8L A;  4HQZ A;  3ZFL A;  1OKT A;  4F0C A;  5F07 A;  2M80 A;  3H93 A;  1C72 A;  1SU9 A;  4BL7 A;  1G6Y A;  1DUG A;  3Q18 A;  2K8V A;  2VD1 A;  2CX3 A;  1TRW A;  3F4S A;  2GLR A;  2MMO A;  1YJ6 A;  4Z2R A;  3H4K A;  3VPQ A;  1Q98 A;  3W6G A;  1GL8 A;  3HYP A;  4BVY B;  3U5R E;  3TB2 A;  3LXZ A;  1HD2 A;  1TI3 A;  2IMF A;  3DD3 A;  3EPT A;  1XCC A;  1S3C A;  1FAA A;  1J0F A;  3M9J A;  1A2M A;  4EIP A;  2FA8 A;  2TRX A;  5HQP A;  1XVQ A;  2DJ1 A;  2X8H A;  3KTL A;  5JCU A;  4G2E A;  4CDO A;  1FOH A;  1ZYQ B;  3N5O A;  1N2A A;  4IP1 A;  2L6C A;  1QMV A;  2L5L A;  4XS4 B;  2FWG A;  3HJO A;  3SBC A;  2OKA A;  4DSS B;  3CRU A;  9GSS A;  4ZBD A;  4O5U A;  2R0C A;  4JZQ A;  1PQN A;  4K7I A;  4TR0 A;  4EVM A;  3P90 A;  3PIN A;  1RQM A;  1TKD B;  1H4O A;  4Q5F A;  5EL8 A;  4KUN A;  5CRH A;  3IPZ A;  2YWM A;  1X5C A;  1XWG A;  4GTU A;  4DSR A;  3HXS A;  3H79 A;  4GWR A;  14GS A;  3KM6 A;  3UJ1 A;  22GS A;  1TTZ A;  2L59 A;  3R2Q A;  4QL9 A;  4ZL8 A;  1LBK A;  1WPI A;  2E2M A;  1T1V A;  4KX4 A;  2R3X A;  2V6O A;  2FHE A;  4LMW A;  1WIK A;  4HU9 A;  4MK3 A;  3C1S A;  3ZIT A;  5CAX A;  2H74 A;  3KTB A;  4X0X A;  5A4V A;  3V1W A;  1OKD A;  3J7Y k;  4K0N A;  2LNT A;  4P3Y B;  3UEM A;  3L9S A;  3CTF A;  6GSX A;  3G7J A;  4N10 A;  3LOR A;  3UAR A;  4X1U A;  4IP6 A;  4NHW A;  2IWT A;  1EEJ A;  4I2U A;  1EGO A;  2CT6 A;  4XIH A;  1K0C A;  5G1K A;  4IKH A;  1EGR A;  2HFD A;  1EEM A;  1TK8 B;  2ZUP A;  2YWI A;  5IMF A;  3EIN A;  17GS A;  2VCT A;  2XC2 A;  4POM A;  4EKZ A;  5CNW A;  4JED A;  2KP1 A;  3I69 A;  1F6M C;  1OE7 A;  1GLP A;  2DJK A;  3W8J A;  1OYJ A;  1BED A;  5C00 A;  4ZXG A;  2O8V B;  4F2I A;  5G1L A;  2GZZ A;  1GTB A;  3AY8 A;  3DGQ A;  2LRC A;  4K0G A;  2X8C A;  1USB A;  1T8E B;  1XW6 A;  3HVS A;  2B5Y A;  4KB3 A;  3SWL A;  1GTU A;  5GSS A;  2VIM A;  2VLT A;  2F8A A;  4K6X A;  1JZW A;  1EP7 A;  4WBR D;  1B48 A;  4TXO A;  1EV9 A;  2JAC A;  3KP8 A;  1JZR A;  2LRT A;  3ZVJ D;  4ML1 A;  2BJX A;  2DIY A;  4MCU A;  4CHS A;  4A5P A;  3TJB A;  1K0M A;  4OO4 A;  2B3S A;  1J08 A;  5HR3 A;  1U6T A;  1M99 A;  3GFK A;  1K3Y A;  4PUR A;  3L9U A;  3IHG A;  5ECM B;  1CQH A;  2HRN A;  5H5R A;  3VLN A;  2DJ0 A;  3EU3 A;  2AYT A;  2FWE A;  4G0I A;  3TGZ A;  4AGS A;  2C0F A;  1GUK A;  1O6J A;  2CAI A;  3BD2 A;  1NHY A;  2YN1 A;  5DCH A;  4TR1 B;  1ZZY A;  2DKH A;  4HI7 A;  3IXR A;  2EIR A;  3TRQ A;  4HQS A;  3HCZ A;  4F0B A;  2LJK A;  2HRF A;  4NXI A;  2CAQ A;  1ZYN A;  2L6D A;  3ED3 A;  3F0I A;  5JWQ B;  2DIZ A;  5HR2 A;  3GRX A;  2FCH A;  1BQ7 A;  4FYU A;  2H1B A;  1OC9 A;  2CX4 A;  3DWV A;  3GKX A;  4ECI A;  1TK0 B;  1XWK A;  1FW1 A;  3TDG A;  4BVX B;  4O7H A;  3FY7 A;  1Z6M A;  1ML6 A;  2EIO A;  1R5P A;  1XW5 A;  2F8F A;  1V58 A;  5HFK A;  3FKF A;  3ZFB A;  1M2B A;  3QMX A;  2L57 A;  3C8E A;  2VM2 A;  4ZB8 A;  4V2L A;  3D5J A;  4ILF A;  2HE3 A;  4MJA A;  4TR3 A;  2P31 A;  3GV1 A;  5J9B A;  1AUC A;  1TU7 A;  4KND A;  4N30 A;  4WR4 A;  2C8U A;  2VL3 A;  1O7U A;  1WP0 A;  1SL0 B;  3UAP A;  2ZCT A;  2IFQ A;  4K2X A;  2K8S A;  1BYE A;  4ID0 A;  1EZK A;  5G2Z A;  5IO2 A;  4MZW A;  3TRP A;  2HSH A;  3TJF A;  4MAB A;  1VF1 A;  3D22 A;  2DSA A;  2E7P A;  1LJR A;  3RDW A;  1XOB A;  1O85 A;  1R5A A;  4OMV A;  5D9X A;  1S3A A;  3MSZ A;  4G10 A;  1AQV A;  2PWJ A;  1Z3E A;  1M7T A;  4K9Z A;  4O5R A;  4N0Z A;  3TKP A;  3IC8 A;  3NZN A;  4IHU A;  2JSY A;  5KN1 A;  2YV7 A;  4QL7 A;  4BVY A;  1MEK A;  1E6B A;  2YZU A;  3ZIJ A;  2I4A A;  4N11 A;  2C0G A;  3ME8 A;  5LCZ A;  3DVX A;  2HRA A;  1OC8 A;  4YQV A;  2KP2 A;  4IJ3 A;  4TR4 A;  1DE1 A;  5HFI A;  5HR0 A;  4AF2 A;  5JCG A;  4X4J A;  4DEJ A;  3J7Y b;  1I5G A;  2PER A;  3APQ A;  1SKW B;  1ZMA A;  2C4J A;  4XS4 A;  2X8G A;  3QCP A;  4OD7 A;  3TOU A;  4DSS A;  5CRE A;  1I9D A;  2IMD A;  3IHQ A;  4MZB A;  5B8A A;  1M0U A;  5J9C A;  5ECL B;  5ID2 B;  2FD3 A;  3PGT A;  5BMU A;  5LNK e;  4KW6 A;  3GKN A;  3P2A A;  1XPV A;  3HZ8 A;  2XBI A;  5F0G A;  1A2L A;  1GP1 A;  5ECQ B;  4Q5R A;  4ZIL A;  1F9M A;  2CVK A;  2VCZ A;  4TXV A;  4ISD A;  3WT1 A;  2XPD A;  1GSQ A;  3MNG A;  4FYC A;  4OCF A;  2MMZ A;  2N5B A;  3Q6O A;  2B7J A;  6GSW A;  5GST A;  1BG5 A;  3GKK A;  2LEG A;  3ZIV A;  1B4Q A;  1U87 A;  4USS A;  2LRN A;  2MMA A;  3IBH A;  1YEX A;  1YF0 A;  1OVN A;  4Q5N A;  1QK8 A;  2H30 A;  2MMN A;  3HHV A;  3U6V A;  2A4V A;  4MH2 A;  4POK A;  3I6A A;  1GWC A;  5ECO B;  2LUS A;  1ERT A;  2H1A A;  5FT3 A;  1PKW A;  2VUP A;  3HVX A;  4EUY A;  4FO5 A;  2PN8 A;  2I3Y A;  4GQF A;  5A4W A;  4JE1 A;  1ZGN A;  3TJJ A;  1GSU A;  2DKI A;  2GSS A;  5KN0 A;  2GT6 A;  5ECS A;  1T7P B;  2KHP A;  3DVW A;  4H86 A;  1ABA A;  1K0N A;  1W4V A;  4AJ6 A;  4EXJ A;  3LW9 A;  4XRD A;  3CRT A;  2YPM A;  3FR6 A;  3HZ4 A;  4F9Z A;  2PUK C;  3IRA A;  2H0H A;  4TRX A;  4XRA A;  2H73 A;  4MPF A;  3VWW A;  2HI7 A;  4PNF A;  2H76 A;  3WYW A;  3VPT A;  4IW9 A;  1A24 A;  5ECI B;  1ERW A;  4G0K A;  2WRT A;  2DML A;  4XHM A;  3D4M A;  2FY6 A;  5EVO A;  4KCE A;  2VCQ A;  4YAP A;  3QFA C;  4MJB A;  1X9M B;  2X64 A;  4NV5 A;  4ECJ A;  1PGT A;  2B5X A;  4EC0 A;  2DJ3 A;  3ZRE A;  5BRT A;  1ACV A;  5J41 A;  2OE3 A;  3KD0 A;  3RPN A;  2R0P A;  2ON7 A;  1G7E A;  2VM1 A;  4TR1 A;  2RM6 A;  3A5W A;  3TRX A;  1K0B A;  5JWR B;  4IN0 A;  4BA7 A;  2YWN A;  1FG4 A;  4HUA A;  1N8J A;  1QFN A;  4XCS A;  3TKQ A;  2H0I A;  1V57 A;  1KTE A;  2FWF A;  3IAS 2;  3QDN A;  1DE2 A;  4XS6 A;  4ZBA A;  3UBL A;  1XVW A;  2H19 A;  4EO3 A;  3KEB A;  5G5F A;  2YWO A;  5DAL B;  4BVX A;  3I9V 2;  4N0V A;  4HJ2 A;  2TIR A;  4IQA A;  4EIQ A;  1PSQ A;  3Q19 A;  4RI6 A;  2OA7 A;  2DLX A;  4MF6 A;  5J5N A;  3HDC A;  2D2Z A;  2NDO A;  2R0G A;  3HKR A;  4EL1 A;  1THO A;  1B8X A;  4V2N A;  5IOW A;  3QD9 A;  3LYK A;  1T4Y A;  1GSS A;  4LL1 B;  4BWQ A;  1Z6N A;  4I5Q A;  4K1F A;  4LA1 A;  4PX1 A;  4ZB9 A;  2OE0 A;  2P0G A;  2FGX A;  4J2F A;  1Y6E A;  2OE1 A;  4KA0 A;  2UZ8 A;  4OO5 A;  1F3B A;  2CV4 A;  2OJL A;  3UIW A;  4LL4 B;  4WEY A;  4CW9 A;  4MF7 A;  4EE0 A;  2AAW A;  3C7M A;  4WXT A;  2PVO C;  5IMC A;  2CZ2 A;  1XW9 A;  5ECH B;  5ELA A;  5IPH A;  2I1U A;  1K3O A;  2IMK A;  3APS A;  3O76 A;  2EIQ A;  2B7K A;  3Q74 A;  2R2J A;  1K0A A;  5DJL A;  2B1L A;  1PMT A;  4PQI A;  5ECK B;  2HYX A;  3ERF A;  3GIX A;  2P5Q A;  3G7Y A;  1Y25 A;  2NTO A;  3GST A;  3FR9 A;  3WD6 A;  2IIY A;  3ZLP A;  3FHK A;  1PN0 A;  4I97 A;  2V1M A;  3IAM 2;  3EMX A;  3IK9 A;  3D21 A;  1J9B A;  3LFL A;  3ZTL A;  4AJ8 A;  4FQU A;  2XBQ A;  1ERV A;  5DAK B;  3TJG A;  4RUV A;  5ECP B;  2GQK A;  5A5K A;  3HD5 A;  3FW2 A;  2IME A;  2A4H A;  5CRW A;  1SJZ A;  1EOH A;  2WGR A;  6GSY A;  6GSS A;  10GS A;  4HU7 A;  1JLV A;  1XBS A;  5G5E A;  1A8L A;  3QFB C;  5IO0 A;  3F8U A;  2JAD A;  3QAG A;  1YZX A;  1BJX A;  4NV2 A;  4DSQ A;  1SYX A;  2LST A;  3GTU B;  3DKS A;  2DMM A;  4DVC A;  1G6W A;  5ID2 A;  5ELG A;  5GAN D;  3F63 A;  3D0Z A;  5JWO B;  4EDZ A;  18GS A;  4IBP A;  2H1D A;  3ZRD A;  2Z9S A;  3IK7 A;  4NWY A;  5D9T A;  4BPY A;  3VI7 A;  4XS1 A;  1XIY A;  1EOG A;  1VGL A;  4YQM A;  3ISO A;  1W89 A;  3LEF A;  1SL1 B;  2NVL A;  3E0U A;  4ICY A;  3D4T A;  2H6X A;  2FLS A;  1FB0 A;  2WB9 A;  2DBC A;  1PD2 1;  2L4C A;  3QR6 A;  2X99 A;  3HA9 A;  4F82 A;  5ABR A;  1GNW A;  2RUF A;  2GSR A;  3O6T A;  2VCW A;  5D73 A;  3F4R A;  4IQ1 A;  2REM A;  3PR8 A;  2B5E A;  1UA5 A;  1GSE A;  1YEP A;  4IJI A;  3LXT A;  2G0F A;  2CZ3 A;  3C73 A;  1O81 A;  2V2G A;  3S9F A;  2OAC A;  3EMP A;  1WJK A;  4WR5 A;  2PGT A;  4TKY A;  3CMI A;  4E8E A;  3F6F A;  3APO A;  3M3M A;  1XWC A;  3KH9 A;  1GUM A;  5DCG A;  3HVV A;  13GS A;  5ENU A;  2QGV A;  2FWH A;  1T00 A;  2P5R A;  3CTG A;  4KH7 A;  1PL2 A;  4K5S A;  1O8W A;  4MZC A;  4Z2U A;  5IMV A;  1V9W A;  2HRK A;  3GX0 A;  1MDK A;  3RAZ A;  1CQG A;  1HYU A;  5KOW A;  5CYY A;  2GZP A;  3ZZX A;  4K8M A;  4NHZ A;  3I43 A;  1T3B A;  2K6V A;  2YP6 A;  4POL A;  3VWV A;  1E2Y A;  4KDX A;  3EU4 A;  2TRC P;  1XWA A;  2N5A A;  3QPM A;  1TXX A;  3TKS A;  3FK8 A;  2WCI A;  4ZL9 A;  3LG6 A;  3ZVJ A;  2A2R A;  4J56 E;  2K9F A;  4ECC A;  1EP8 A;  4ZL7 A;  2R4V A;  3LJR A;  4J57 E;  20GS A;  3KJY A;  3F3R A;  4JR4 A;  4PQH A;  1IYH A;  2LV3 A;  3FZ5 A;  3RPP A;  2VCX A;  4RQX A;  1G7O A;  1SK0 A;  7GSS A;  5DAL A;  4YAV A;  2C0E A;  1T4Z A;  3L4N A;  1O8X A;  3UOM A;  2RM5 A;  1AIU A;  3GA4 A;  1GUL A;  1U3A A;  1JFU A;  3KP9 A;  3K8N A;  2O7K A;  1TW9 A;  1Q4J A;  2GTU A;  3ZYW A;  2OBK A;  4NMU A;  1V2A A;  2LS5 A;  2KOK A;  4MLY A;  1QUW A;  1GSF A;  2JZR A;  4PUF C;  3IR4 A;  4FYB A;  4KSO A;  2O85 A;  1NM3 A;  2KUC A;  1YF1 A;  2PPT A;  3H1N A;  1AAZ A;  3UL3 A;  3CYN A;  5HR1 A;  3BCK A;  3FZ9 A;  5G31 A;  3GYK A;  4MJC A;  1PRX A;  5IMD A;  4IVF A;  19GS A;  1U3I A;  5D93 A;  2C0D A;  2PBJ A;  2MYG A;  5IQY A;  2HZE B;  2VD0 A;  4JBB A;  1R4W A;  3A2X A;  3L78 A;  1WOU A;  2AB6 A;  2GGT A;  4K7N A;  1XXU A;  3GL5 A;  3M1G A;  5IM9 A;  4MNN A;  2QC7 A;  3LYP A;  5DDL A;  3F3Q A;  3GMF A;  2MZC A;  1GLQ A;  5F06 A;  2L4Q A;  5DAK A;  4KCA A;  3FYG A;  5JCW A;  3R3E A;  2H70 A;  2CA8 A;  5DBQ A;  1LU4 A;  2WS2 A;  1MDI A;  4Q5Q A;  3GHA A;  5D9V A;  3UVH A;  4EF0 A;  3DEX A;  4MMM A;  5L71 A;  16GS A;  1V98 A;  2DJJ A;  3ME7 A;  5B6N A;  2A2P A;  2LJA A;  4ACS A;  3GTU A;  3P8W A;  5CRD A;  1M9A A;  3NOF A;  4HS1 A;  4PTS A;  1SJ6 A;  8GSS A;  3G7I A;  3M8N A;  5CO3 A;  3IA1 A;  2BMX A;  1FVJ A;  1K0O A;  2YJ7 A;  1GUH A;  4L5O A;  3O3T A;  1MD4 A;  3IOS A;  5H5Q A;  1GRX A;  2YAN A;  2VAF A;  3UVT A;  2GS3 A;  5B7C A;  2VLV A;  4E8H A;  1FVK A;  4GCI A;  4I2T A;  2H66 A;  1B4P A;  1YQ1 A;  1SL2 B;  3ERG A;  1SKS B;  1SK2 A;  2I9H A;  1HNA A;  2FUG 2;  3DRN A;  1SD9 A;  2IPA A;  1TRV A;  2F51 A;  2C80 A;  1VF3 A;  1ZOF A;  2VL2 A;  4GXZ A;  4MH3 A;  3WT2 A;  1SJI A;  1K0D A;  1F37 A;  1QGV A;  2GSQ A;  3GN3 A;  1G0T A;  5GAP D;  2QA2 A;  3DXB A;  3EC3 A;  3G9B A;  3E3E A;  3A2W A;  4LLR A;  2VCV A;  2C3Q A;  1R7H A;  2FNO A;  5ECR B;  5KOX A;  1VF4 A;  1RW1 A;  2J23 A;  1ZCP A;  3VFI A;  3FZA A;  3RBT A;  3VWX A;  1THX A;  4IS0 A;  2IJY A;  4YKG A;  1KNG A;  4ZB6 A;  5AIX A;  4HZ2 A;  2AUV A;  3KIJ A;  4F03 A;  1WMJ A;  1FOV A;  2HNL A;  1PL1 A;  3PH9 A;  2H0G A;  1X9S B;  2JU5 A;  12GS A;  1OC3 A;  3TJK A;  2JZT A;  1HNC A;  2LNS A;  4Z2T A;  4IGJ A;  2OAD A;  4YKF A;  1YY7 A;  1AXD A;  1KEB A;  1TJD A;  1SEN A;  3CBU A;  3DIE A;  3C1R A;  1AQW A;  3QAV A;  2LKU A;  3TKS E;  4ZBB A;  1X5D A;  2H6Z A;  2HSM A;  4GST A;  5DVB A;  1NSW A;  3D6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...