2TRXA

Crystal structure of thioredoxin from escherichia coli at 1.68 angstroms resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Crystal structure of thioredoxin from Escherichia coli at 1.68 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 32
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2trxA00
1XWGA 1SKSB 1AAZA 5JCGA 1TI3A 4ZILA 3VWUA 1B4QA 3UMAA 4KSMA 3TJBA 4EF0A 4E8HA 3ZL5A 3TJKA 2PVQA 2LUSA 5IPHA 1Z7RA 3I9V2 1M7TA 3WGXA 3ZVJD 3TUEA 2O89A 2QSIA 3F63A 4KX4A 1O8WA 1MDJA 3ZREA 3A2XA 1EWXA 2E2GA 4YAVA 1NHYA 3LGCA 2LQQA 3QFAC 6GSXA 2IMIA 4JE1A 1PX6A 2H6XA 3KGKA 1DBYA 5ECNB 4JEDA 2FD3A 3GSSA 8GSSA 3FW2A 3EYTA 1E6BA 2X64A 4X1UA 3DVWA 5IMVA 4L0WA 2PPTA 3TOUA 3DIEA 3KH9A 4RI7A 1OC9B 1SU9A 1UC7A 2GZPA 2H6YA 3KEBA 1AQXA 1YDKA 2VIMA 4G2EA 4HQZA 3FYGA 4HQSA 2WRTA 2H6ZA 1H75A 1OC8A 4KH7A 3TKQA 1ZCPA 1GTIA 1EOHA 1GTBA 4PX1A 3QAGA 4MMMA 2DBCA 2L5OA 2LNSA 2MZCA 18GSA 4K0GA 2GT5A 2O8VB 2TRCP 1T4ZA 2H1GA 4G19A 2C0DA 2I3YA 3GTUA 3WGDA 3N9JA 2KOKA 4NV5A 3D21A 1EV4A 2H0IA 2VCQA 3LYPA 3ZRDA 2CX3A 1GSEA 3HJOA 2V6KA 3RDWA 1HQOA 1X9MB 4EXJA 3RAZA 1F9MA 2JSYA 2N5FA 1MTCA 3KTLA 2I81A 3VI5A 3SWLA 1X9WB 1MD3A 4N11A 1PRXA 3F0IA 2HYXA 1SD9A 4KNDA 4MP4A 1EGOA 1ILOA 4NMUA 3MDKA 2BTOT 4XS4A 3BJ5A 3KH7A 4YH2A 2DJKA 1FVJA 3ZITA 1M0UA 3CRTA 3M0FA 5EL8A 1DE1A 2CX4A 2B1KA 2GT6A 1ZOFA 2EC4A 3HVXA 2MBTA 4MJCA 3FK8A 2B7JA 3UEMA 2FHEA 1K3LA 1F3AA 22GSA 2L4CA 3ZVJA 3O3TA 4ECIA 3F4SA 4YQVA 4RI6A 4HU7A 1XOAA 2L5LA 4F0BA 4WBRD 1WP0A 3LORA 5L71A 4OWYA 1SYRA 2FA4A 2Z9SA 1PMTA 3KIJA 2YWMA 3FR3A 1IYHA 5KN2A 3LXTA 4PURA 1ZMAA 2PWJA 4RQRA 4YQMA 1HYUA 13GSA 1K0DA 2MBSA 3UBKA 3J7Yb 1PQNA 3I43A 5AISA 4MCUA 2NDOA 3QR6A 4O7HA 1XOBA 2E2MA 5G1LA 1XVWA 3QDNA 1PA3A 1Y25A 4WF5A 1WOUA 1AIUA 5H5SA 2BMXA 3GH9A 4MZWA 1K0MA 2XPDA 1U3AA 2IMDA 2IJYA 3GL5A 3QAWA 2MMZA 1GRXA 1FAAA 4F0CA 5IO0A 2OJLA 2GDRA 2YPMA 3HXSA 3VK9A 5C04A 3ZIJA 4KCAA 5DCHA 3A2VA 5HR0A 1UN2A 2V32A 1PL2A 2YP6A 4POLA 2IWTA 5AIVA 1PX7A 4Q5QA 5CRDA 1ZL9A 5CO3A 1TU7A 4WEYA 5EPFA 1ST9A 1PL1A 2YCDA 4ZBDA 1B48A 3W6GA 3GYKA 2GTUA 4KB3A 3APOA 12GSA 5F06A 4XRAA 4WETA 1MD4A 2H1BA 4K7NA 1WRYA 4F82A 1YF1A 1TU8A 2CAQA 3C71A 1XPVA 1F2EA 2KHPA 4NPBA 2H30A 2GZYA 2JADA 4DSSB 5H5QA 2DJ1A 1CQGA 2PERA 4ISDA 4IW9A 2R2JA 4MH2A 1USBA 3GKNA 1JZDA 2PBJA 3M9KA 3W8SA 4QL9A 3GURA 2H71A 5ECMB 5IM9A 1O7UA 1KNGA 4OCEA 4NHWA 1EP7A 4LA1A 9GSSA 2CAIA 4ECCA 1V40A 1GUHA 1YKCA 3APSA 1AC1A 5CYYA 2JACA 5KN3A 3LXZA 5HFKA 3DGQA 2H8LA 2K8SA 1DSBA 4IKHA 4E8EA 4DSQA 2OACA 3TKPA 4ZL8A 2ES7A 2WDUA 3IHQA 3VPQA 1ACVA 2H70A 1K0NA 2VL2A 4K6XA 1EOGA 4K7IA 4HUAA 2DJ3A 1T3BA 1A8YA 1BX9A 1G6WA 3ZYWA 2AB6A 1JFUA 1U6TA 2ON7A 4BVXA 2HLSA 3GKMA 1AW9A 2X99A 2CVBA 2H01A 1A8LA 3GKKA 3CSHA 2P5QA 1THOA 5DJLA 1OC9A 4WBJA 4XTSA 2JZRA 4K2DA 3VWVA 2REMA 2HNLA 1G7EA 4ZL9A 5JCUA 4IELA 1Z9HA 3FR6A 5GZZB 2LV3A 5B6NA 4MJEA 1Q4JA 1S3DA 3M3MA 2F8AA 1TDIA 5DJMA 5IMDA 1Z5YE 1GNWA 2WB9A 1LJRA 2MYGA 4ECJA 4H86A 2C0GA 5A4UA 5ECIB 1K3OA 2H73A 3RPPA 1XWCA 3IBHA 4K9ZA 4MF5A 3VWXA 1B8XA 17GSA 1QK8A 2QGVA 2IFQB 2L6CA 2B5YA 4V2NA 2MMNA 4N30A 3EVIA 3BBYA 3HVVA 4V2MA 3GH6A 2HZFA 2C8UA 3HY2A 1EEMA 3LJRA 2K18A 1A2MA 4XS6A 3FKFA 2DJJA 3CMIA 3F3QA 3G7JA 2N5BA 1O6JA 2HSHA 2HI7A 4ZB8A 2GSTA 2LTKA 1T7PB 5A4VA 2E0QA 2JL4A 1FW1A 5ABRA 3U5RE 2LKUA 1YEXA 5CRWA 1BQ7A 1M9AA 2WGRA 3IA1A 5HQPA 2R4VA 3Q19A 2FLSA 3D4MA 4MDCA 2B5XA 1TK5B 1YEPA 5ECPB 2WCIA 1FG4A 4TXOB 3RBTA 2FCHA 2O87A 5CAXA 4DVCA 4O5RA 1T4YA 4MK3A 2EIOA 3KM6A 1ABAA 3IXRA 1O73A 1FO5A 2JU5A 5IO2A 3WT1A 1QXHA 1X5EA 5G5EA 2RUFA 3E9JB 3EC3A 3ME8A 5DAKB 5ECOB 2K9FA 4V1Ag 3A3TA 3KP9A 1LU4A 3TGZA 5E59A 1G0TA 1K0BA 5INYA 14GSA 4EUYA 2FWHA 4NWYA 4TR1A 4MLYA 5F0GA 3UL3A 2C1YA 1OVNA 1F37A 4FO5A 1AXDA 2H72A 3GX8A 4LLRA 2DIYA 3BD2A 1W89A 1MEKA 1WE0A 4WXTA 5J4UA 3H4KA 4JU5A 3FZ4A 1N2AA 3GRXA 2C0FA 4PUAA 2LEGA 3GNJA 4ZB9A 3EU4A 3QFBC 4F2IA 5A4WA 4IJIA 5GSSA 3VPTA 1A0FA 3NIVA 4G10A 3IV4A 3L78A 3EINA 2PN8A 3GSTA 2ALBA 3LG6A 5ECRB 1HNCA 7GSSA 2NVLA 3Q6OA 4MZBA 3P2AA 1TW9A 1HNBA 2CQ9A 4PUFC 1V98A 4AF2A 5JWOB 4EVMA 1TRWA 5LCZA 2YV7A 3DKSA 3F6FA 4EC0A 4V2LA 2I4AA 3C1RA 4GSNA 1YJ6A 4G9HA 4DSSA 5B8AA 3IK9A 4JRRA 2F8FA 1B9XC 5IMZA 2VCWA 1JZRA 4KW6A 2NPBA 3HA9A 2HZEA 2LJRA 1SK0A 2HSYA 4Z7XA 3O76A 2AUVA 4ACSA 1GUMA 2YWNA 4KDXA 2YWIA 6GSUA 3HYPA 1OE8A 1A23A 4TW5A 1YY7A 3UBLA 4O92A 3H1NA 4HU9A 4I97A 3VFIA 1XZOA 5ENUA 2VLVA 5D9TA 3FZ9A 1GSSA 2CVKA 6GSYA 2VL3A 3Q18A 1CQHA 1W4VA 4CW9A 1FB0A 1H4OA 4KDUA 4X0XA 3GX0A 3LEFA 3IAM2 2C4JA 1YZXA 4POBA 2DC5A 4ID0A 1K0CA 4POMA 5DVBA 1Z6NA 2RIIA 2EIQA 4TR4A 3TJFA 3D5JA 2LRCA 4IS0A 2KUCA 3L9SA 4GWRA 3O6TA 2H1DA 1S3AA 2DSAA 1R4WA 2JZTA 1MDIA 2AV4A 1GNEA 4GF0A 5J9BA 2X8CA 1SENA 3F9UA 4JR4A 1SL2B 2YV9A 2RLIA 3KD0A 2P0GA 5H5RA 3QMXA 1TI1A 4KSOA 2ZCTA 1O85A 4MABA 4N10A 3TKSC 1R7HA 4BVYA 2IMKA 3KCMA 3NZNA 4KE3A 2HFDA 2AAWA 1SL1B 5IOWA 3FZ5A 1NSWA 4GSTA 2GQKA 1U87A 2LJAA 3EURA 3LYKA 3GTUB 1KTEA 3TJGA 2KLXA 1AQVA 1QMVA 3VI7A 5HFIA 1BJXA 3G7IA 3VURA 5GSTA 4JR6A 4YAPA 1QUWA 5D9XA 2CA8A 3FRCA 3GKXA 3P90A 3ZFBA 2R3XA 4KAEA 3TOTA 4XCSA 3HVSA 2KP1A 4EKZA 3AY8A 1Z3EA 2TRXA 2XPEA 4I6XA 1VF2A 1AUCA 4IHUA 4K7OA 3H79A 1J9BA 2GVPA 4FIWA 2IFQA 2B6MA 1VF1A 2C3QA 4EE0A 4OO5A 3ZTLA 4CHSA 1TRUA 1V57A 2XBIA 4MZCA 1FHEA 3D0ZA 1M2BA 3L9UA 5JCWA 3ZMKA 3FHKA 4TXVA 2WZ9A 3IC4A 2YOIA 1JLVA 3E0UA 3L4NA 5ECQB 4IQAA 3J7Yk 4GXZA 3VWWA 5G5FA 3K8NA 3V1WA 4OO4A 1SJ6A 2YJHA 3H93A 3LSZA 3DRNA 4GCIA 3UVHA 1ERTA 1U88A 3TRXA 4FYCA 1WIKA 3UAPA 4PNFA 4NV2A 1M9BA 2VD1A 1KEBA 2AJQB 4V1Ap 4AJ7A 3KJYA 1XWKA 2CZ3A 4ECBA 4N0VA 4ZB6A 1GSDA 1YQ1A 1J0FA 1F3BA 2VLUA 3BOAA 5FT3A 4TXOA 1XBSA 3N5OA 4KUNA 4TR0A 3ZMLA 4Q5NA 2OE1A 1GSUA 3ISOA 4OCFA 4J2FA 3MWHA 2A2RA 2GSSA 2R37A 1R26A 4OD7A 4I2TA 2H74A 1SD8A 4IJ3A 5DAKA 4PNGA 3CXGA 2PVOC 1VF3A 3F6DA 3I6AA 4XRDA 1XWBA 1B4PA 5F8BA 5IQYA 2A2SA 3PINA 1GSQA 1R5PA 3UVTA 5CRGA 3PR8A 4ML1A 3FZAA 2PMTA 3G9BA 1BAYA 3KZQA 4X43A 5FHIA 2HE3A 5G30A 3CBUA 2OE0A 2WULA 3OR5A 3LFLA 3NOFA 2L59A 5IIZA 2K6VA 5DALB 1WJKA 3HCZA 4Q5FA 1JHBA 1ERVA 1GL8A 1GSYA 5J41A 2VAFA 2LRTA 4KDYA 4KA0A 2C80A 4P3YB 3IDVA 1TXXA 4EDYA 2JSZA 3IPZA 5J3RA 2B7KA 4K0NA 3IAS2 3BCKA 1OYJA 1GP1A 1ZZYA 3TDGA 4NAXA 1SL0B 5D9WA 1T00A 3A5WA 2FUG2 4FYBA 5GAND 4HZ2A 5D93A 4I5QA 3DXBA 4XHMA 4CDOA 1BEDA 3KMOA 2YWOA 4TKYA 5IMFA 1JZWA 1C72A 1E2YA 4EL1A 2O85A 3KTBA 3L0HA 1UA5A 5ECHB 2B3SA 3KMNA 3WGEA 5IMAA 5AN1A 3C8EA 3WT2A 1M2AA 3UOMA 1V2AA 2VM1A 5ID2B 4O32A 2P31A 5GAPD 1PSQA 4HZ4A 4TR3A 4L0UA 3VLNA 4JZQA 5IPGA 2R5GA 16GSA 3ZIVA 3RHBA 4JBBA 4WR4A 3S9FA 4IGJA 1SK1A 2V6OA 2VD0A 2C3NA 3RHCA 5A5KA 2TIRA 4IQ1A 3LQ7A 4OFMA 2LS5A 2C3TA 1LBKA 2GS3A 1FVKA 1FB6A 2B5EA 4PQHA 2VM2A 4PQ1A 5IMCA 3F8UA 4MH3A 2HXKA 1PN9A 1X0RA 4IP1A 4ZBAA 2M72A 1ON4A 1TKDB 3CRUA 3C7MA 4GQFA 4TOPA 3WYWA 1XW6A 3ZFLA 1MDKA 1XVQA 2LJKA 1T8EB 4FH8A 4Q5RA 3QOUA 1IYIA 6GSVA 1SKWB 4LL1B 4WF4A 3FY7A 3F4RA 6GSTA 3QAVA 4BL7A 4TN8A 1URMA 1U3IA 1ZYEA 3SBCA 2AHEA 3HDCA 2FWEA 2WS2A 3HZ4A 2NTOA 4D73B 4BA7A 2L57A 3GUSA 3DYRA 3CTGA 4I8BA 2OBKA 4WR5A 4KCEA 4AJ8A 2G0FA 1VRSD 2X8HA 4ML6A 5DDLA 5DQSA 2GSQA 3D4TA 5DQYA 2BJXA 2RUEA 2N5AA 1SJIA 3Q74A 4HS1A 3I69A 1VGLA 4WKWA 2H0HA 3ERFA 1EZKA 1EEJA 1OC3A 4LL4B 3P8WA 4IN0A 1QFNA 3E3EA 3EMXA 2NBSA 1EP8A 1X9SB 2PU9C 1AQWA 1RW1A 3M8NA 2V1MA 5CP1A 2ON5A 5EVOA 2VCTA 2IMEA 1J08A 4HI7A 3TKSE 1TOFA 3MNGA 3RPNA 3IK7A 2FWFA 3EU3A 1ERWA 2R6KA 3TRPA 3ZLPA 4DSRA 2M46A 4YQUA 1NM3A 4KGIA 2PUKC 3PH9A 2OE3A 2IN3A 4POKA 3US3A 1ZYQB 3UJ1A 5E4WA 1OKTA 4HJMA 4TRXA 5B6MA 5CREA 2L4QA 4GLTA 1XXUA 4L5LA 3QD9A 4J57E 1X5CA 2M80A 1THXA 3CSIA 2V41A 2C0EA 2EIRA 2RM5A 2VUPA 1EGRA 3R2QA 3G7YA 1DE2A 2F3MA 1GSFA 3CTFA 1SK2A 2VL9A 5HR2A 4FYUA 3GL3A 1WPIA 2OADA 1K0AA 3JCML 2IMFA 2QKEA 2QC7A 5D96A 1F6MC 1TP9A 5J5NA 2FNOA 2WJUA 3IR4A 4EO3A 4ILFA 1JLWA 2X8GA 2DJ2A 1M99A 2OKAA 3UARA 5D9VA 1K0OA 4L5OA 1SJZA 1DUGA 2J23A 2O7KA 3HJMA 2IL3A 5HR3A 3BCIA 2PGTA 2IPAA 2LNTA 2H76A 2F51A 1KBNA 4TR1B 4MJBA 10GSA 3GIXA 3F3RA 5FWGA 3TKSA 1I5GA 3IRAA 3GV1A 1XW5A 4XS1A 5AGYA 2ZUPA 1T1VA 2YANA 2VO4A 4MF6A 3H8QA 4AGSA 2OBIA 19GSA 5JWRB 4ZIJA 2YNXA 2HRFA 4QQ7A 3ZZXA 1OAZA 5ECKB 3W8JA 4ZBBA 2H19A 2CZ2A 3M1GA 4N0ZA 1V9WA 5KN0A 5G1KA 2IIYA 4HEA2 2YZUA 2CV4A 5KEJA 1QGVA 3ED3A 3GFKA 3EE2A 1TTZA 2F9SA 2FGXA 2GQLA 1OE7A 1TRSA 1G6YA 1XW9A 1N8JA 2L6DA 1XCCA 2VOCA 1SKRB 1FOVA 5IOXA 5D8IA 3LWAA 1XFLA 5JWQB 5B8BA 4GQCA 2FY6A 3CSJA 5DALA 5ECSA 1G7OA 1VF4A 4HOJA 4ULXA 2B1LA 1UVZA 3KP8A 2CT6A 3P7XA 4I2UA 4LMVA 1JZOA 3F4TA 1ERUA 2JZSA 1PKWA 1TJDA 4EDZA 3DD3A 1PKZA 3DVXA 3QCPA 2GSRA 4XS4B 2GQMA 5D73A 4GRFA 3DWVA 2XHFA 4NHZA 2DIZA 2VCVA 4BPYA 3KXOA 3MSZA 2XBQA 1HNAA 2G2QA 3IOSA 1A24A 4OMVA 1Z6MA 4F9ZA 3EWLA 1ML6A 2YJ7A 4HJ2A 1B9YC 3GA4A 5C00A 5B7CA 2YZHA 1NHOA 2DMMA 5ELAA 3HHVA 2HZEB 3HZ8A 5DBQA 2HRNA 1GLQA 1GH2A 2GZZA 20GSA 3IE3A 4IVFA 5COHA 3L9VA 2WFCA 1R5AA 1YF0A 2VCZA 2HT9A 4XIHA 1BYEA 1GLPA 1TK0B 2K8VA 2A4VA 4MA9A 2VLTA 5ID2A 3D6IA 3A2WA 11GSA 2H0GA 5HFGA 1Y6EA 2RM6A 2CVDA 2AYTA 4OFTA 4OFNA 2LRNA 1Q98A 5KN1A 1RQMA 4GTUA 2P5RA 5F07A 3QPMA 4MF7A 5G31A 2KP2A 3GMFA 4MPFA 5CRHA 3ERGA 2H1AA 1A2LA 1RK4A 5EY6A 1X5DA 6GSWA 1A0RP 4MPGA 1S3CA 1WMJA 3GN3A 2FA8A 4QL7A 2H75A 3ERWA 2V2GA 4PGTA 2LSTA 5ECLB 3UIWA 2GGTA 4DEJA 4PQIA 2OA7A 2VL2C 4ZXGA 2H66A 4HDEA 1QQ2A 3PGTA 4PXOA 4GSSA 1M2DA 2ZNMA 1TK8B 1YKAA 1EV9A 1ZGNA 1GUKA 2I9HA 2VCXA 4K1FA 2MMOA 4TVEA 3ME7A 2I1UA 4BWQA 5AIXA 3DEXA 2MMAA 4IBPA 4D73A 1GWCA 3C1SA 3TRQA 2DJ0A 1WWJA 5J9CA 3D22A 4IP6A 3EMPA 1A2JA 2DMLA 5DCGA 4AJ6A 2YN1A 4RQXA 3C73A 2FWGA 1GTAA 1PGTA 3TB2A 3U6VA 1I9DA 4L8EA 3CYNA 4NXIA 4LMWA 3HJPA 3TCOA 1XWAA 5LD0A 3WD6A 1GULA 4MJAA 1O8XA 2XC2A 3FR9A 2J9HA 5LNKe 3GHAA 1O81A 5CNWA 5HR1A 4BWSA 3TKRA 1TRVA 4J56E 1SYXA 3APQA 5ELGA 3M9JA 1V58A 3DMLA 1NW2A 3HKRA 1Z7PA 3FEUA 5F05A 1XIYA 2D2ZA 4K8MA 4ZL7A 1K3YA 6GSSA 2DLXA 5G2ZA 1OKDA 1HD2A 3HD5A 3TJJA 2LQOA 1PD21 2GLRA 4RUVA 4F03A 3MAKA 1GTUA 2E7PA 1BG5A
chains in the Genus database with same CATH superfamily
1XWGA 1SKSB 1AAZA 5JCGA 1TI3A 1XG8A 4ZILA 3VWUA 1B4QA 3UMAA 4KSMA 3TJBA 4EF0A 4E8HA 3ZL5A 4Z2UA 3TJKA 2PVQA 2LUSA 5IPHA 1Z7RA 3I9V2 1M7TA 3A5IA 3WGXA 3ZVJD 3TUEA 2O89A 2QSIA 3F63A 4KX4A 1O8WA 1MDJA 3ZREA 3A2XA 1EWXA 2E2GA 3MYDA 4YAVA 1NHYA 3LGCA 2LQQA 3QFAC 6GSXA 2IMIA 4JE1A 1PX6A 2H6XA 3KGKA 1DBYA 5ECNB 4JEDA 4BVXB 2FD3A 3GSSA 8GSSA 3FW2A 3EYTA 4BIKA 1E6BA 2X64A 4X1UA 3DVWA 5IMVA 4L0WA 2PPTA 3TOUA 3DIEA 3KH9A 4RI7A 1OC9B 1SU9A 1UC7A 4K5RA 2GZPA 2H6YA 3KEBA 1AQXA 1YDKA 2VIMA 4G2EA 4HQZA 3FYGA 4HQSA 2WRTA 2H6ZA 1H75A 1OC8A 4KH7A 3TKQA 1ZCPA 1GTIA 1EOHA 1S3RA 1GTBA 4PX1A 3QAGA 4MMMA 2DBCA 2L5OA 3MIXA 2LNSA 2MZCA 18GSA 4K0GA 2GT5A 2O8VB 2TRCP 1T4ZA 2H1GA 4G19A 2C0DA 2I3YA 3GTUA 3WGDA 3N9JA 2KOKA 4NV5A 3D21A 1EV4A 2H0IA 2VCQA 3LYPA 3ZRDA 2CX3A 1GSEA 3HJOA 2V6KA 3RDWA 1HQOA 1X9MB 4EXJA 3RAZA 1F9MA 2JSYA 2N5FA 1MTCA 3KTLA 2I81A 4KF9A 3VI5A 3SWLA 1X9WB 1MD3A 4N11A 1PRXA 3F0IA 2HYXA 1SD9A 4KNDA 4MP4A 1EGOA 1ILOA 4NMUA 3MDKA 2BTOT 4XS4A 3BJ5A 3KH7A 4YH2A 2DJKA 1FVJA 3ZITA 1M0UA 3CRTA 3M0FA 5EL8A 1DE1A 2CX4A 2B1KA 2GT6A 1ZOFA 2EC4A 3HVXA 2MBTA 4MJCA 3FK8A 2B7JA 3UEMA 2FHEA 1K3LA 1F3AA 22GSA 2L4CA 3ZVJA 3O3TA 4ECIA 3F4SA 4YQVA 4RI6A 4HU7A 1XOAA 2L5LA 3FMWA 4F0BA 4WBRD 1WP0A 3LORA 5L71A 4OWYA 1SYRA 2FA4A 2Z9SA 1PMTA 3KIJA 2YWMA 3FR3A 1IYHA 5KN2A 3LXTA 4PURA 1ZMAA 2PWJA 4RQRA 4YQMA 1HYUA 13GSA 1K0DA 2MBSA 3UBKA 3J7Yb 1PQNA 3I43A 5AISA 4MCUA 2NDOA 3QR6A 4O5UA 4O7HA 1XOBA 2E2MA 5G1LA 1XVWA 3QDNA 1PA3A 1Y25A 4WF5A 1WOUA 1AIUA 5H5SA 2BMXA 3GH9A 4MZWA 1K0MA 2XPDA 1U3AA 2IMDA 2IJYA 3GL5A 3QAWA 2MMZA 1GRXA 1FAAA 4F0CA 5IO0A 2OJLA 2GDRA 2YPMA 3HXSA 3VK9A 5C04A 2R0PA 3ZIJA 4KCAA 5DCHA 3A2VA 5HR0A 1UN2A 2V32A 1PL2A 2YP6A 4POLA 2IWTA 5AIVA 1PX7A 4Q5QA 5CRDA 1ZL9A 5CO3A 1TU7A 4WEYA 5EPFA 1ST9A 1PL1A 2YCDA 4ZBDA 1B48A 3W6GA 3GYKA 2GTUA 4KB3A 3APOA 12GSA 5F06A 4XRAA 4WETA 1MD4A 2H1BA 4K7NA 1WRYA 4F82A 1YF1A 1TU8A 2CAQA 3C71A 1XPVA 1F2EA 2KHPA 4NPBA 2H30A 2GZYA 2JADA 4DSSB 5H5QA 2DJ1A 1CQGA 2PERA 4ISDA 4IW9A 2R2JA 4MH2A 1USBA 3GKNA 1JZDA 2PBJA 3M9KA 3W8SA 4QL9A 3GURA 2H71A 5ECMB 5IM9A 1O7UA 1KNGA 4OCEA 4NHWA 1EP7A 4LA1A 9GSSA 2CAIA 4ECCA 1V40A 1GUHA 1YKCA 3APSA 1AC1A 5CYYA 2JACA 5KN3A 3LXZA 5HFKA 3DGQA 2H8LA 2K8SA 1DSBA 4IKHA 4E8EA 4DSQA 2OACA 3TKPA 4ZL8A 2ES7A 2WDUA 3IHQA 3VPQA 1ACVA 2H70A 1K0NA 2VL2A 4K6XA 1EOGA 4K7IA 4HUAA 2DJ3A 1T3BA 1A8YA 1BX9A 1G6WA 3ZYWA 2AB6A 1JFUA 1U6TA 2ON7A 4BVXA 2HLSA 3GKMA 1AW9A 2X99A 2CVBA 2H01A 1A8LA 3GKKA 3CSHA 2P5QA 1THOA 5DJLA 1OC9A 1PFOA 4BVYB 4WBJA 4XTSA 2JZRA 4K2DA 3VWVA 4HSCX 2REMA 2HNLA 1G7EA 4ZL9A 5JCUA 4IELA 1Z9HA 3FR6A 5GZZB 2LV3A 5B6NA 4MJEA 1Q4JA 1S3DA 3M3MA 2F8AA 1TDIA 5DJMA 5IMDA 1Z5YE 1GNWA 2WB9A 1LJRA 2MYGA 4ECJA 4H86A 2C0GA 5A4UA 5ECIB 1K3OA 2H73A 3RPPA 1XWCA 3IBHA 4K9ZA 4MF5A 3VWXA 1B8XA 17GSA 1QK8A 2QGVA 2IFQB 2L6CA 2B5YA 4V2NA 2MMNA 4N30A 3EVIA 3BBYA 3HVVA 4V2MA 3GH6A 2HZFA 3EPTA 2C8UA 2DKHA 3HY2A 1EEMA 3LJRA 2K18A 1A2MA 4XS6A 3FKFA 2DJJA 3CMIA 3F3QA 3G7JA 2N5BA 1O6JA 2HSHA 2HI7A 4ZB8A 2GSTA 2LTKA 1T7PB 5A4VA 2E0QA 2JL4A 1FW1A 5ABRA 3U5RE 2LKUA 1YEXA 5CRWA 1BQ7A 1M9AA 2WGRA 3IA1A 5HQPA 3R3EA 2R4VA 3Q19A 2FLSA 3D4MA 4MDCA 2B5XA 1TK5B 1YEPA 5ECPB 2WCIA 1FG4A 4TXOB 3RBTA 2FCHA 2O87A 5CAXA 4DVCA 4O5RA 1T4YA 4MK3A 2EIOA 3KM6A 1ABAA 3IXRA 1O73A 1FO5A 2JU5A 5IO2A 3WT1A 4EIQA 1QXHA 1X5EA 5G5EA 2RUFA 3E9JB 3EC3A 3ME8A 5DAKB 5ECOB 2K9FA 4V1Ag 3A3TA 3KP9A 1LU4A 3TGZA 5E59A 1G0TA 1K0BA 5INYA 14GSA 4EUYA 4O5QA 2FWHA 4NWYA 4TR1A 4MLYA 5F0GA 3UL3A 2C1YA 1OVNA 1F37A 4FO5A 1AXDA 2H72A 3GX8A 4LLRA 2DIYA 3BD2A 1W89A 1MEKA 1WE0A 4WXTA 5J4UA 3H4KA 4JU5A 3FZ4A 1N2AA 3GRXA 2C0FA 4PUAA 2LEGA 3GNJA 4ZB9A 3EU4A 3QFBC 4F2IA 5A4WA 4IJIA 5GSSA 3VPTA 1A0FA 3NIVA 4G10A 3IV4A 3L78A 3EINA 2PN8A 3GSTA 2ALBA 3LG6A 5ECRB 1HNCA 7GSSA 2NVLA 3Q6OA 4MZBA 3P2AA 1TW9A 1HNBA 2CQ9A 4PUFC 1V98A 4AF2A 5JWOB 4EVMA 1TRWA 5LCZA 2YV7A 3DKSA 3F6FA 4EC0A 4V2LA 1ZYPA 3LW9A 2I4AA 3C1RA 4GSNA 1YJ6A 4G9HA 4DSSA 5B8AA 3IK9A 4JRRA 2F8FA 1B9XC 5IMZA 2VCWA 1JZRA 3IHGA 4KW6A 2NPBA 3HA9A 2HZEA 2LJRA 1SK0A 2HSYA 4Z7XA 3O76A 2AUVA 4ACSA 1GUMA 2YWNA 4KDXA 2YWIA 6GSUA 4USSA 3HYPA 1OE8A 1A23A 4TW5A 1YY7A 3UBLA 4O92A 3H1NA 4HU9A 4I97A 3VFIA 1XZOA 5ENUA 2VLVA 5D9TA 3FZ9A 1GSSA 2CVKA 6GSYA 2VL3A 3Q18A 1CQHA 1W4VA 4CW9A 1FB0A 1H4OA 4KDUA 4X0XA 3GX0A 3LEFA 3IAM2 2C4JA 1YZXA 4POBA 2DC5A 4ID0A 1K0CA 4POMA 5DVBA 1Z6NA 2RIIA 2EIQA 4TR4A 3TJFA 3D5JA 2LRCA 4IS0A 2KUCA 3L9SA 4GWRA 3O6TA 2H1DA 1S3AA 4A5PA 2DSAA 1R4WA 2JZTA 2A2PA 1MDIA 2AV4A 1GNEA 4GF0A 5J9BA 2X8CA 4BL7B 1SENA 3F9UA 4JR4A 1SL2B 2YV9A 2RLIA 3KD0A 2P0GA 5H5RA 3QMXA 1TI1A 4KSOA 2ZCTA 1O85A 4MABA 4N10A 1M3IA 3TKSC 1R7HA 4BVYA 2IMKA 3KCMA 3NZNA 4KE3A 2HFDA 2AAWA 1SL1B 5IOWA 3FZ5A 1NSWA 4GSTA 2GQKA 1U87A 2LJAA 3EURA 3LYKA 3GTUB 1KTEA 3TJGA 2KLXA 1AQVA 1QMVA 3VI7A 5HFIA 1BJXA 3G7IA 3VURA 5GSTA 4JR6A 4YAPA 1QUWA 5D9XA 2CA8A 3FRCA 3GKXA 3P90A 3ZFBA 2R3XA 4KAEA 3TOTA 4XCSA 3HVSA 2KP1A 4EKZA 3AY8A 1Z3EA 2TRXA 2XPEA 4I6XA 1VF2A 1AUCA 4IHUA 4K7OA 3H79A 1J9BA 2GVPA 4FIWA 2IFQA 2B6MA 1VF1A 2HRAA 2C3QA 4EE0A 1M3JA 4OO5A 3ZTLA 4CHSA 1TRUA 1V57A 2XBIA 4MZCA 1FHEA 3D0ZA 1M2BA 3L9UA 5JCWA 3ZMKA 3FHKA 4TXVA 2WZ9A 3IC4A 4ICYA 2YOIA 1JLVA 3E0UA 3L4NA 5ECQB 4IQAA 3J7Yk 4GXZA 3VWWA 5G5FA 2X4AA 3K8NA 3V1WA 4OO4A 1SJ6A 2YJHA 3H93A 3LSZA 3DRNA 4GCIA 3UVHA 1ERTA 1U88A 3TRXA 4FYCA 1WIKA 3UAPA 4PNFA 4NV2A 1M9BA 2VD1A 1KEBA 4FQUA 2AJQB 4V1Ap 4AJ7A 3KJYA 1XWKA 2CZ3A 4ECBA 4N0VA 4ZB6A 1GSDA 1YQ1A 1J0FA 1F3BA 2VLUA 3BOAA 5FT3A 4TXOA 1XBSA 3N5OA 4KUNA 4TR0A 3ZMLA 4Q5NA 2OE1A 1GSUA 3ISOA 4OCFA 4J2FA 3MWHA 2A2RA 2GSSA 2R37A 1R26A 4OD7A 4I2TA 2H74A 1SD8A 4IJ3A 5DAKA 4PNGA 3CXGA 2PVOC 1VF3A 3F6DA 3I6AA 4XRDA 1XWBA 1B4PA 5F8BA 5IQYA 2A2SA 3PINA 1GSQA 1R5PA 2X49A 3UVTA 5CRGA 3PR8A 4ML1A 3FZAA 2PMTA 3G9BA 1BAYA 3KZQA 4X43A 5FHIA 2HE3A 5G30A 3CBUA 2OE0A 2WULA 3OR5A 3LFLA 3NOFA 2L59A 5IIZA 2K6VA 5DALB 1WJKA 3HCZA 4Q5FA 1JHBA 1ERVA 1GL8A 4Z2RA 1GSYA 5J41A 2VAFA 2LRTA 4KDYA 4KA0A 2C80A 4P3YB 3IDVA 1TXXA 4EDYA 2JSZA 3IPZA 5J3RA 2B7KA 4K0NA 3IAS2 3BCKA 1OYJA 1GP1A 1ZZYA 3TDGA 4NAXA 3PPUA 1SL0B 5D9WA 1T00A 3A5WA 2FUG2 4FYBA 5GAND 4HZ2A 5D93A 4I5QA 3DXBA 4XHMA 4CDOA 1BEDA 2UZ8A 3KMOA 2YWOA 4TKYA 5IMFA 1JZWA 1C72A 1E2YA 4EL1A 2O85A 3KTBA 3L0HA 1UA5A 2B3SA 5ECHB 3KMNA 3WGEA 5IMAA 5AN1A 3C8EA 3WT2A 1M2AA 3UOMA 1V2AA 2VM1A 5ID2B 4O32A 2P31A 5GAPD 1PN0A 1PSQA 4TR3A 4HZ4A 4L0UA 3VLNA 4JZQA 5IPGA 2R5GA 16GSA 3ZIVA 3RHBA 4JBBA 4WR4A 5KOXA 3S9FA 4IGJA 1SK1A 2V6OA 2VD0A 2C3NA 3RHCA 5A5KA 2TIRA 4IQ1A 3LQ7A 4OFMA 2LS5A 2C3TA 1LBKA 2GS3A 1FVKA 1FB6A 2B5EA 4PQHA 2VM2A 4PQ1A 5IMCA 3F8UA 4MH3A 2HXKA 4MNNA 1PN9A 1X0RA 4IP1A 4ZBAA 1FOHA 2M72A 1ON4A 1TKDB 3CRUA 3C7MA 4GQFA 4TOPA 3WYWA 3HVNA 1XW6A 3ZFLA 1MDKA 1XVQA 2LJKA 1ZYNA 1T8EB 4FH8A 4Q5RA 3QOUA 1IYIA 6GSVA 1SKWB 4LL1B 4WF4A 3FY7A 4G0KA 3F4RA 6GSTA 3QAVA 4BL7A 4TN8A 1URMA 1U3IA 1ZYEA 3SBCA 2AHEA 3HDCA 2FWEA 2WS2A 3HZ4A 2NTOA 4D73B 4BA7A 2L57A 3GUSA 4CY8A 3DYRA 4K5SA 3CTGA 4I8BA 2OBKA 4WR5A 4KCEA 4AJ8A 2G0FA 1VRSD 2X8HA 4ML6A 5DDLA 5DQSA 2GSQA 3D4TA 5DQYA 2BJXA 2RUEA 2N5AA 1SJIA 3Q74A 4HS1A 3I69A 1VGLA 4WKWA 2H0HA 3ERFA 1EZKA 1EEJA 1OC3A 4LL4B 3P8WA 4IN0A 1QFNA 3E3EA 3EMXA 2NBSA 1EP8A 1X9SB 2PU9C 1AQWA 1RW1A 3M8NA 2V1MA 5CP1A 2ON5A 5EVOA 2VCTA 2IMEA 1J08A 4HI7A 3TKSE 1TOFA 3MNGA 3RPNA 3IK7A 2FWFA 3EU3A 1ERWA 2R6KA 3TRPA 3ZLPA 4DSRA 2M46A 3IC8A 4YQUA 1NM3A 2HSMA 4KGIA 2PUKC 3PH9A 2OE3A 2IN3A 4POKA 3US3A 1ZYQB 3UJ1A 5E4WA 1OKTA 4HJMA 4TRXA 5B6MA 5CREA 2L4QA 4GLTA 1XXUA 4L5LA 2QA2A 3QD9A 4J57E 1X5CA 2M80A 1THXA 3CSIA 2V41A 2C0EA 2EIRA 2RM5A 2VUPA 1EGRA 3R2QA 3G7YA 1DE2A 2F3MA 1GSFA 2R0GA 1SK2A 2VL9A 3CTFA 5HR2A 4FYUA 3GL3A 1WPIA 2OADA 1K0AA 3JCML 2IMFA 2QKEA 2QC7A 5D96A 4X4JA 1F6MC 1TP9A 5J5NA 2FNOA 2WJUA 3IR4A 4EO3A 4ILFA 1JLWA 2X8GA 2DJ2A 1M99A 2OKAA 4PTSA 3UARA 5D9VA 1K0OA 4L5OA 1SJZA 4YKFA 1DUGA 2J23A 2O7KA 3HJMA 2IL3A 5HR3A 3BCIA 2PGTA 2IPAA 2LNTA 2H76A 2F51A 1KBNA 4TR1B 4MJBA 10GSA 3GIXA 3F3RA 5FWGA 3TKSA 1I5GA 3IRAA 3CQFA 3GV1A 1XW5A 4XS1A 5AGYA 2ZUPA 1T1VA 2YANA 2VO4A 4MF6A 3H8QA 4AGSA 2OBIA 19GSA 5JWRB 4ZIJA 2YNXA 2HRFA 4QQ7A 3ZZXA 1OAZA 5ECKB 3W8JA 4ZBBA 2H19A 2CZ2A 3M1GA 4N0ZA 1V9WA 5KN0A 5G1KA 2IIYA 4HEA2 2YZUA 2CV4A 5KEJA 1QGVA 3ED3A 3GFKA 3EE2A 1TTZA 2F9SA 2FGXA 2GQLA 1OE7A 1TRSA 1G6YA 1XW9A 1N8JA 2L6DA 1XCCA 2VOCA 1SKRB 1FOVA 5IOXA 5D8IA 3LWAA 1XFLA 5JWQB 5B8BA 4GQCA 2FY6A 3CSJA 5DALA 5ECSA 1G7OA 1VF4A 4HOJA 2A4HA 4ULXA 2HRKA 2B1LA 1UVZA 3KP8A 2CT6A 3P7XA 4I2UA 4LMVA 1JZOA 3F4TA 1ERUA 2JZSA 1PKWA 1TJDA 4EDZA 3DD3A 1PKZA 3DVXA 3QCPA 2GSRA 4XS4B 2GQMA 5D73A 4GRFA 3DWVA 2XHFA 4NHZA 2DIZA 2VCVA 4BPYA 3KXOA 2DKIA 5KOWA 3MSZA 2XBQA 1HNAA 2G2QA 3IOSA 1A24A 4OMVA 1Z6MA 4F9ZA 3EWLA 1ML6A 2YJ7A 4HJ2A 2R0CA 1B9YC 3GA4A 5C00A 5B7CA 2YZHA 1NHOA 2DMMA 5ELAA 3HHVA 2HZEB 3HZ8A 5DBQA 2HRNA 4K2XA 1GLQA 1GH2A 2GZZA 20GSA 3IE3A 4IVFA 5COHA 3L9VA 2WFCA 1R5AA 4EIPA 1YF0A 2VCZA 2HT9A 4XIHA 1BYEA 1GLPA 1TK0B 2K8VA 2A4VA 4MA9A 2VLTA 5ID2A 3D6IA 3A2WA 11GSA 2H0GA 5HFGA 1Y6EA 2RM6A 2CVDA 2AYTA 4OFTA 4OFNA 2LRNA 1Q98A 5KN1A 1RQMA 4GTUA 2P5RA 4MF7A 3QPMA 5F07A 5G31A 2KP2A 3GMFA 4MPFA 5CRHA 3ERGA 2H1AA 1A2LA 1RK4A 5EY6A 1X5DA 6GSWA 1A0RP 4MPGA 1S3CA 1WMJA 3GN3A 2FA8A 4QL7A 2H75A 3ERWA 2V2GA 4PGTA 2LSTA 5ECLB 3UIWA 2GGTA 4DEJA 4PQIA 2OA7A 2VL2C 4ZXGA 4Z2TA 2H66A 4HDEA 1QQ2A 3PGTA 4PXOA 4GSSA 1M2DA 2ZNMA 1TK8B 1YKAA 1EV9A 1ZGNA 1GUKA 2I9HA 4CY6A 2VCXA 4K1FA 2MMOA 4TVEA 3ME7A 2I1UA 4BWQA 5AIXA 5BRTA 3DEXA 2MMAA 4IBPA 4D73A 1GWCA 3C1SA 4G0LA 5BMUA 3TRQA 2DJ0A 1WWJA 5J9CA 3D22A 4IP6A 3EMPA 1A2JA 2DMLA 5DCGA 4AJ6A 2YN1A 4RQXA 3C73A 2FWGA 1GTAA 1PGTA 3TB2A 3U6VA 1I9DA 4L8EA 3CYNA 4NXIA 4LMWA 3HJPA 3TCOA 1XWAA 5LD0A 3WD6A 1GULA 4MJAA 1O8XA 2XC2A 3FR9A 2J9HA 5LNKe 3GHAA 1O81A 5CNWA 5HR1A 4BWSA 3TKRA 1TRVA 4J56E 1SYXA 3APQA 5ELGA 4G0IA 3M9JA 1V58A 3DMLA 1NW2A 3HKRA 1Z7PA 3FEUA 5F05A 4YKGA 1XIYA 2QA1A 2D2ZA 4K8MA 4ZL7A 1K3YA 6GSSA 2DLXA 5G2ZA 1OKDA 1HD2A 3HD5A 3TJJA 2LQOA 1PD21 2GLRA 4RUVA 4F03A 3MAKA 1GTUA 2E7PA 1BG5A
chains in the Genus database with same CATH topology
1XWGA 1SKSB 1AAZA 5JCGA 1TI3A 4ZILA 3VWUA 1B4QA 3UMAA 4KSMA 3TJBA 4EF0A 4E8HA 3ZL5A 4Z2UA 3TJKA 2PVQA 2LUSA 5IPHA 1Z7RA 3I9V2 1M7TA 3A5IA 3WGXA 3ZVJD 3TUEA 2O89A 2QSIA 3F63A 4KX4A 1O8WA 1MDJA 3ZREA 3A2XA 1EWXA 2E2GA 3MYDA 4YAVA 1NHYA 3LGCA 2LQQA 3QFAC 6GSXA 2IMIA 4JE1A 1PX6A 2H6XA 3KGKA 1DBYA 5ECNB 4JEDA 4BVXB 2FD3A 3GSSA 8GSSA 3FW2A 3EYTA 1E6BA 2X64A 4X1UA 3DVWA 5IMVA 4L0WA 2PPTA 3TOUA 3DIEA 3KH9A 4RI7A 1OC9B 1SU9A 1UC7A 4K5RA 2GZPA 2H6YA 3KEBA 1AQXA 1YDKA 2VIMA 4G2EA 4HQZA 3FYGA 4HQSA 2WRTA 2H6ZA 1H75A 1OC8A 4KH7A 3TKQA 1ZCPA 1GTIA 1EOHA 1GTBA 4PX1A 3QAGA 4MMMA 2DBCA 2L5OA 3MIXA 2LNSA 2MZCA 18GSA 4K0GA 2GT5A 2O8VB 2TRCP 1T4ZA 2H1GA 4G19A 2C0DA 2I3YA 3GTUA 3WGDA 3N9JA 2KOKA 4NV5A 3D21A 1EV4A 2H0IA 2VCQA 3LYPA 3ZRDA 2CX3A 1GSEA 3HJOA 2V6KA 3RDWA 1HQOA 1X9MB 4EXJA 3RAZA 1F9MA 2JSYA 2N5FA 1MTCA 3KTLA 2I81A 4KF9A 3VI5A 3SWLA 1X9WB 1MD3A 4N11A 1PRXA 3F0IA 2HYXA 1SD9A 4KNDA 4MP4A 1EGOA 1ILOA 4NMUA 3MDKA 2BTOT 4XS4A 3BJ5A 3KH7A 4YH2A 2DJKA 1FVJA 3ZITA 1M0UA 3CRTA 3M0FA 5EL8A 1DE1A 2CX4A 2B1KA 2GT6A 1ZOFA 2EC4A 3HVXA 2MBTA 4MJCA 3FK8A 2B7JA 3UEMA 2FHEA 1K3LA 1F3AA 22GSA 2L4CA 3ZVJA 3O3TA 4ECIA 3F4SA 4YQVA 4RI6A 4HU7A 1XOAA 2L5LA 3FMWA 4F0BA 4WBRD 1WP0A 3LORA 5L71A 4OWYA 1SYRA 2FA4A 2Z9SA 1PMTA 3KIJA 2YWMA 3FR3A 1IYHA 5KN2A 3LXTA 4PURA 1ZMAA 2PWJA 4RQRA 4YQMA 1HYUA 13GSA 1K0DA 2MBSA 3UBKA 3J7Yb 1PQNA 3I43A 5AISA 4MCUA 2NDOA 3QR6A 4O5UA 4O7HA 1XOBA 2E2MA 5G1LA 1XVWA 3QDNA 1PA3A 1Y25A 4WF5A 1WOUA 1AIUA 5H5SA 2BMXA 3GH9A 4MZWA 1K0MA 2XPDA 1U3AA 2IMDA 2IJYA 3GL5A 3QAWA 2MMZA 1GRXA 1FAAA 4F0CA 5IO0A 2OJLA 2GDRA 2YPMA 3HXSA 3VK9A 5C04A 2R0PA 3ZIJA 4KCAA 5DCHA 3A2VA 5HR0A 1UN2A 2V32A 1PL2A 2YP6A 4POLA 2IWTA 5AIVA 1PX7A 4Q5QA 5CRDA 1ZL9A 5CO3A 1TU7A 4WEYA 5EPFA 1ST9A 1PL1A 2YCDA 4ZBDA 1B48A 3W6GA 3GYKA 2GTUA 4KB3A 3APOA 12GSA 5F06A 4XRAA 4WETA 1MD4A 2H1BA 4K7NA 1WRYA 4F82A 1YF1A 1TU8A 2CAQA 3C71A 1XPVA 1F2EA 2KHPA 4NPBA 2H30A 2GZYA 2JADA 4DSSB 5H5QA 2DJ1A 1CQGA 2PERA 4ISDA 4IW9A 2R2JA 4MH2A 1USBA 3GKNA 1JZDA 2PBJA 3M9KA 3W8SA 4QL9A 3GURA 2H71A 5ECMB 5IM9A 1O7UA 1KNGA 4OCEA 4NHWA 1EP7A 4LA1A 9GSSA 2CAIA 4ECCA 1V40A 1GUHA 1YKCA 3APSA 1AC1A 5CYYA 2JACA 5KN3A 3LXZA 5HFKA 3DGQA 2H8LA 2K8SA 1DSBA 4IKHA 4E8EA 4DSQA 2OACA 3TKPA 4ZL8A 2ES7A 2WDUA 3IHQA 3VPQA 1ACVA 2H70A 1K0NA 2VL2A 4K6XA 1EOGA 4K7IA 4HUAA 2DJ3A 1T3BA 1A8YA 1BX9A 1G6WA 3ZYWA 2AB6A 1JFUA 1U6TA 2ON7A 4BVXA 2HLSA 3GKMA 1AW9A 2X99A 2CVBA 2H01A 1A8LA 3GKKA 3CSHA 2P5QA 1THOA 5DJLA 1OC9A 4BVYB 4WBJA 4XTSA 2JZRA 4K2DA 3VWVA 2REMA 2HNLA 1G7EA 4ZL9A 5JCUA 4IELA 1Z9HA 3FR6A 5GZZB 2LV3A 5B6NA 4MJEA 1Q4JA 1S3DA 3M3MA 2F8AA 1TDIA 5DJMA 5IMDA 1Z5YE 1GNWA 2WB9A 1LJRA 2MYGA 4ECJA 4H86A 2C0GA 5A4UA 5ECIB 1K3OA 2H73A 3RPPA 1XWCA 3IBHA 4K9ZA 4MF5A 3VWXA 1B8XA 17GSA 1QK8A 2QGVA 2IFQB 2L6CA 2B5YA 4V2NA 2MMNA 4N30A 3EVIA 3BBYA 3HVVA 4V2MA 3GH6A 2HZFA 3EPTA 2C8UA 2DKHA 3HY2A 1EEMA 3LJRA 2K18A 1A2MA 4XS6A 3FKFA 2DJJA 3CMIA 3F3QA 3G7JA 2N5BA 1O6JA 2HSHA 2HI7A 4ZB8A 2GSTA 2LTKA 1T7PB 5A4VA 2E0QA 2JL4A 1FW1A 5ABRA 3U5RE 2LKUA 1YEXA 5CRWA 1BQ7A 1M9AA 2WGRA 3IA1A 5HQPA 3R3EA 2R4VA 3Q19A 2FLSA 3D4MA 4MDCA 2B5XA 1TK5B 1YEPA 5ECPB 2WCIA 1FG4A 4TXOB 3RBTA 2FCHA 2O87A 5CAXA 4DVCA 4O5RA 1T4YA 4MK3A 2EIOA 3KM6A 1ABAA 3IXRA 1O73A 1FO5A 2JU5A 5IO2A 3WT1A 4EIQA 1QXHA 1X5EA 5G5EA 2RUFA 3E9JB 3EC3A 3ME8A 5DAKB 5ECOB 2K9FA 4V1Ag 3A3TA 3KP9A 1LU4A 3TGZA 5E59A 1G0TA 1K0BA 5INYA 14GSA 4EUYA 4O5QA 2FWHA 4NWYA 4TR1A 4MLYA 5F0GA 3UL3A 2C1YA 1OVNA 1F37A 4FO5A 1AXDA 2H72A 3GX8A 4LLRA 2DIYA 3BD2A 1W89A 1MEKA 1WE0A 4WXTA 5J4UA 3H4KA 4JU5A 3FZ4A 1N2AA 3GRXA 2C0FA 4PUAA 2LEGA 3GNJA 4ZB9A 3EU4A 3QFBC 4F2IA 5A4WA 4IJIA 5GSSA 3VPTA 1A0FA 3NIVA 4G10A 3IV4A 3L78A 3EINA 2PN8A 3GSTA 2ALBA 3LG6A 5ECRB 1HNCA 7GSSA 2NVLA 3Q6OA 4MZBA 3P2AA 1TW9A 1HNBA 2CQ9A 4PUFC 1V98A 4AF2A 5JWOB 4EVMA 1TRWA 5LCZA 2YV7A 3DKSA 3F6FA 4EC0A 4V2LA 1ZYPA 3LW9A 2I4AA 3C1RA 4GSNA 1YJ6A 4G9HA 4DSSA 5B8AA 3IK9A 4JRRA 2F8FA 1B9XC 5IMZA 2VCWA 1JZRA 3IHGA 4KW6A 2NPBA 3HA9A 2HZEA 2LJRA 1SK0A 2HSYA 4Z7XA 3O76A 2AUVA 4ACSA 1GUMA 2YWNA 4KDXA 2YWIA 6GSUA 4USSA 3HYPA 1OE8A 1A23A 4TW5A 1YY7A 3UBLA 4O92A 3H1NA 4HU9A 4I97A 3VFIA 1XZOA 5ENUA 2VLVA 5D9TA 3FZ9A 1GSSA 2CVKA 6GSYA 2VL3A 3Q18A 1CQHA 1W4VA 4CW9A 1FB0A 1H4OA 4KDUA 4X0XA 3GX0A 3LEFA 3IAM2 2C4JA 1YZXA 4POBA 2DC5A 4ID0A 1K0CA 4POMA 5DVBA 1Z6NA 2RIIA 2EIQA 4TR4A 3TJFA 3D5JA 2LRCA 4IS0A 2KUCA 3L9SA 4GWRA 3O6TA 2H1DA 1S3AA 4A5PA 2DSAA 1R4WA 2JZTA 2A2PA 1MDIA 2AV4A 1GNEA 4GF0A 5J9BA 2X8CA 4BL7B 1SENA 3F9UA 4JR4A 1SL2B 2YV9A 2RLIA 3KD0A 2P0GA 5H5RA 3QMXA 1TI1A 4KSOA 2ZCTA 1O85A 4MABA 4N10A 3TKSC 1R7HA 4BVYA 2IMKA 3KCMA 3NZNA 4KE3A 2HFDA 2AAWA 1SL1B 5IOWA 3FZ5A 1NSWA 4GSTA 2GQKA 1U87A 2LJAA 3EURA 3LYKA 3GTUB 1KTEA 3TJGA 2KLXA 1AQVA 1QMVA 3VI7A 5HFIA 1BJXA 3G7IA 3VURA 5GSTA 4JR6A 4YAPA 1QUWA 5D9XA 2CA8A 3FRCA 3GKXA 3P90A 3ZFBA 2R3XA 4KAEA 3TOTA 4XCSA 3HVSA 2KP1A 4EKZA 3AY8A 1Z3EA 2TRXA 2XPEA 4I6XA 1VF2A 1AUCA 4IHUA 4K7OA 3H79A 1J9BA 2GVPA 4FIWA 2IFQA 2B6MA 1VF1A 2HRAA 2C3QA 4EE0A 4OO5A 3ZTLA 4CHSA 1TRUA 1V57A 2XBIA 4MZCA 1FHEA 3D0ZA 1M2BA 3L9UA 5JCWA 3ZMKA 3FHKA 4TXVA 2WZ9A 3IC4A 4ICYA 2YOIA 1JLVA 3E0UA 3L4NA 5ECQB 4IQAA 3J7Yk 4GXZA 3VWWA 5G5FA 2X4AA 3K8NA 3V1WA 4OO4A 1SJ6A 2YJHA 3H93A 3LSZA 3DRNA 4GCIA 3UVHA 1ERTA 1U88A 3TRXA 4FYCA 1WIKA 3UAPA 4PNFA 4NV2A 1M9BA 2VD1A 1KEBA 4FQUA 2AJQB 4V1Ap 4AJ7A 3KJYA 1XWKA 2CZ3A 4ECBA 4N0VA 4ZB6A 1GSDA 1YQ1A 1J0FA 1F3BA 2VLUA 3BOAA 5FT3A 4TXOA 1XBSA 3N5OA 4KUNA 4TR0A 3ZMLA 4Q5NA 2OE1A 1GSUA 3ISOA 4OCFA 4J2FA 3MWHA 2A2RA 2GSSA 2R37A 1R26A 4OD7A 4I2TA 2H74A 1SD8A 4IJ3A 5DAKA 4PNGA 3CXGA 2PVOC 1VF3A 3F6DA 3I6AA 4XRDA 1XWBA 1B4PA 5F8BA 5IQYA 2A2SA 3PINA 1GSQA 1R5PA 2X49A 3UVTA 5CRGA 3PR8A 4ML1A 3FZAA 2PMTA 3G9BA 1BAYA 3KZQA 4X43A 5FHIA 2HE3A 5G30A 3CBUA 2OE0A 2WULA 3OR5A 3LFLA 3NOFA 2L59A 5IIZA 2K6VA 5DALB 1WJKA 3HCZA 4Q5FA 1JHBA 1ERVA 1GL8A 4Z2RA 1GSYA 5J41A 2VAFA 2LRTA 4KDYA 4KA0A 2C80A 4P3YB 3IDVA 1TXXA 4EDYA 2JSZA 3IPZA 5J3RA 2B7KA 4K0NA 3IAS2 3BCKA 1OYJA 1GP1A 1ZZYA 3TDGA 4NAXA 3PPUA 1SL0B 5D9WA 1T00A 3A5WA 2FUG2 4FYBA 5GAND 4HZ2A 5D93A 4I5QA 3DXBA 4XHMA 4CDOA 1BEDA 2UZ8A 3KMOA 2YWOA 4TKYA 5IMFA 1JZWA 1C72A 1E2YA 4EL1A 2O85A 3KTBA 3L0HA 1UA5A 2B3SA 5ECHB 3KMNA 3WGEA 5IMAA 5AN1A 3C8EA 3WT2A 1M2AA 3UOMA 1V2AA 2VM1A 5ID2B 4O32A 2P31A 5GAPD 1PN0A 1PSQA 4TR3A 4HZ4A 4L0UA 3VLNA 4JZQA 5IPGA 2R5GA 16GSA 3ZIVA 3RHBA 4JBBA 4WR4A 5KOXA 3S9FA 4IGJA 1SK1A 2V6OA 2VD0A 2C3NA 3RHCA 5A5KA 2TIRA 4IQ1A 3LQ7A 4OFMA 2LS5A 2C3TA 1LBKA 2GS3A 1FVKA 1FB6A 2B5EA 4PQHA 2VM2A 4PQ1A 5IMCA 3F8UA 4MH3A 2HXKA 4MNNA 1PN9A 1X0RA 4IP1A 4ZBAA 1FOHA 2M72A 1ON4A 1TKDB 3CRUA 3C7MA 4GQFA 4TOPA 3WYWA 1XW6A 3ZFLA 1MDKA 1XVQA 2LJKA 1ZYNA 1T8EB 4FH8A 4Q5RA 3QOUA 1IYIA 6GSVA 1SKWB 4LL1B 4WF4A 3FY7A 4G0KA 3F4RA 6GSTA 3QAVA 4BL7A 4TN8A 1URMA 1U3IA 1ZYEA 3SBCA 2AHEA 3HDCA 2FWEA 2WS2A 3HZ4A 2NTOA 4D73B 4BA7A 2L57A 3GUSA 4CY8A 3DYRA 4K5SA 3CTGA 4I8BA 2OBKA 4WR5A 4KCEA 4AJ8A 2G0FA 1VRSD 2X8HA 4ML6A 5DDLA 5DQSA 2GSQA 3D4TA 5DQYA 2BJXA 2RUEA 2N5AA 1SJIA 3Q74A 4HS1A 3I69A 1VGLA 4WKWA 2H0HA 3ERFA 1EZKA 1EEJA 1OC3A 4LL4B 3P8WA 4IN0A 1QFNA 3E3EA 3EMXA 2NBSA 1EP8A 1X9SB 2PU9C 1AQWA 1RW1A 3M8NA 2V1MA 5CP1A 2ON5A 5EVOA 2VCTA 2IMEA 1J08A 4HI7A 3TKSE 1TOFA 3MNGA 3RPNA 3IK7A 2FWFA 3EU3A 1ERWA 2R6KA 3TRPA 3ZLPA 4DSRA 2M46A 3IC8A 4YQUA 1NM3A 2HSMA 4KGIA 2PUKC 3PH9A 2OE3A 2IN3A 4POKA 3US3A 1ZYQB 3UJ1A 5E4WA 1OKTA 4HJMA 4TRXA 5B6MA 5CREA 2L4QA 4GLTA 1XXUA 4L5LA 2QA2A 3QD9A 4J57E 1X5CA 2M80A 1THXA 3CSIA 2V41A 2C0EA 2EIRA 2RM5A 2VUPA 1EGRA 3R2QA 3G7YA 1DE2A 2F3MA 1GSFA 2R0GA 1SK2A 2VL9A 3CTFA 5HR2A 4FYUA 3GL3A 1WPIA 2OADA 1K0AA 3JCML 2IMFA 2QKEA 2QC7A 5D96A 4X4JA 1F6MC 1TP9A 5J5NA 2FNOA 2WJUA 3IR4A 4EO3A 4ILFA 1JLWA 2X8GA 2DJ2A 1M99A 2OKAA 4PTSA 3UARA 5D9VA 1K0OA 4L5OA 1SJZA 4YKFA 1DUGA 2J23A 2O7KA 3HJMA 2IL3A 5HR3A 3BCIA 2PGTA 2IPAA 2LNTA 2H76A 2F51A 1KBNA 4TR1B 4MJBA 10GSA 3GIXA 3F3RA 5FWGA 3TKSA 1I5GA 3IRAA 3GV1A 1XW5A 4XS1A 5AGYA 2ZUPA 1T1VA 2YANA 2VO4A 4MF6A 3H8QA 4AGSA 2OBIA 19GSA 5JWRB 4ZIJA 2YNXA 2HRFA 4QQ7A 3ZZXA 1OAZA 5ECKB 3W8JA 4ZBBA 2H19A 2CZ2A 3M1GA 4N0ZA 1V9WA 5KN0A 5G1KA 2IIYA 4HEA2 2YZUA 2CV4A 5KEJA 1QGVA 3ED3A 3GFKA 3EE2A 1TTZA 2F9SA 2FGXA 2GQLA 1OE7A 1TRSA 1G6YA 1XW9A 1N8JA 2L6DA 1XCCA 2VOCA 1SKRB 1FOVA 5IOXA 5D8IA 3LWAA 1XFLA 5JWQB 5B8BA 4GQCA 2FY6A 3CSJA 5DALA 5ECSA 1G7OA 1VF4A 4HOJA 2A4HA 4ULXA 2HRKA 2B1LA 1UVZA 3KP8A 2CT6A 3P7XA 4I2UA 4LMVA 1JZOA 3F4TA 1ERUA 2JZSA 1PKWA 1TJDA 4EDZA 3DD3A 1PKZA 3DVXA 3QCPA 2GSRA 4XS4B 2GQMA 5D73A 4GRFA 3DWVA 2XHFA 4NHZA 2DIZA 2VCVA 4BPYA 3KXOA 2DKIA 5KOWA 3MSZA 2XBQA 1HNAA 2G2QA 3IOSA 1A24A 4OMVA 1Z6MA 4F9ZA 3EWLA 1ML6A 2YJ7A 4HJ2A 2R0CA 1B9YC 3GA4A 5C00A 5B7CA 2YZHA 1NHOA 2DMMA 5ELAA 3HHVA 2HZEB 3HZ8A 5DBQA 2HRNA 4K2XA 1GLQA 1GH2A 2GZZA 20GSA 3IE3A 4IVFA 5COHA 3L9VA 2WFCA 1R5AA 4EIPA 1YF0A 2VCZA 2HT9A 4XIHA 1BYEA 1GLPA 1TK0B 2K8VA 2A4VA 4MA9A 2VLTA 5ID2A 3D6IA 3A2WA 11GSA 2H0GA 5HFGA 1Y6EA 2RM6A 2CVDA 2AYTA 4OFTA 4OFNA 2LRNA 1Q98A 5KN1A 1RQMA 4GTUA 2P5RA 4MF7A 3QPMA 5F07A 5G31A 2KP2A 3GMFA 4MPFA 5CRHA 3ERGA 2H1AA 1A2LA 1RK4A 5EY6A 1X5DA 6GSWA 1A0RP 4MPGA 1S3CA 1WMJA 3GN3A 2FA8A 4QL7A 2H75A 3ERWA 2V2GA 4PGTA 2LSTA 5ECLB 3UIWA 2GGTA 4DEJA 4PQIA 2OA7A 2VL2C 4ZXGA 4Z2TA 2H66A 4HDEA 1QQ2A 3PGTA 4PXOA 4GSSA 1M2DA 2ZNMA 1TK8B 1YKAA 1EV9A 1ZGNA 1GUKA 2I9HA 4CY6A 2VCXA 4K1FA 2MMOA 4TVEA 3ME7A 2I1UA 4BWQA 5AIXA 5BRTA 3DEXA 2MMAA 4IBPA 4D73A 1GWCA 3C1SA 4G0LA 5BMUA 3TRQA 2DJ0A 1WWJA 5J9CA 3D22A 4IP6A 3EMPA 1A2JA 2DMLA 5DCGA 4AJ6A 2YN1A 4RQXA 3C73A 2FWGA 1GTAA 1PGTA 3TB2A 3U6VA 1I9DA 4L8EA 3CYNA 4NXIA 4LMWA 3HJPA 3TCOA 1XWAA 5LD0A 3WD6A 1GULA 4MJAA 1O8XA 2XC2A 3FR9A 2J9HA 5LNKe 3GHAA 1O81A 5CNWA 5HR1A 4BWSA 3TKRA 1TRVA 4J56E 1SYXA 3APQA 5ELGA 4G0IA 3M9JA 1V58A 3DMLA 1NW2A 3HKRA 1Z7PA 3FEUA 5F05A 4YKGA 1XIYA 2QA1A 2D2ZA 4K8MA 4ZL7A 1K3YA 6GSSA 2DLXA 5G2ZA 1OKDA 1HD2A 3HD5A 3TJJA 2LQOA 1PD21 2GLRA 4RUVA 4F03A 3MAKA 1GTUA 2E7PA 1BG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWG A;  1SKS B;  1AAZ A;  5JCG A;  1TI3 A;  4ZIL A;  3VWU A;  1B4Q A;  3UMA A;  4KSM A;  3TJB A;  4EF0 A;  4E8H A;  3ZL5 A;  3TJK A;  2PVQ A;  2LUS A;  5IPH A;  1Z7R A;  3I9V 2;  1M7T A;  3WGX A;  3ZVJ D;  3TUE A;  2O89 A;  2QSI A;  3F63 A;  4KX4 A;  1O8W A;  1MDJ A;  3ZRE A;  3A2X A;  1EWX A;  2E2G A;  4YAV A;  1NHY A;  3LGC A;  2LQQ A;  3QFA C;  6GSX A;  2IMI A;  4JE1 A;  1PX6 A;  2H6X A;  3KGK A;  1DBY A;  5ECN B;  4JED A;  2FD3 A;  3GSS A;  8GSS A;  3FW2 A;  3EYT A;  1E6B A;  2X64 A;  4X1U A;  3DVW A;  5IMV A;  4L0W A;  2PPT A;  3TOU A;  3DIE A;  3KH9 A;  4RI7 A;  1OC9 B;  1SU9 A;  1UC7 A;  2GZP A;  2H6Y A;  3KEB A;  1AQX A;  1YDK A;  2VIM A;  4G2E A;  4HQZ A;  3FYG A;  4HQS A;  2WRT A;  2H6Z A;  1H75 A;  1OC8 A;  4KH7 A;  3TKQ A;  1ZCP A;  1GTI A;  1EOH A;  1GTB A;  4PX1 A;  3QAG A;  4MMM A;  2DBC A;  2L5O A;  2LNS A;  2MZC A;  18GS A;  4K0G A;  2GT5 A;  2O8V B;  2TRC P;  1T4Z A;  2H1G A;  4G19 A;  2C0D A;  2I3Y A;  3GTU A;  3WGD A;  3N9J A;  2KOK A;  4NV5 A;  3D21 A;  1EV4 A;  2H0I A;  2VCQ A;  3LYP A;  3ZRD A;  2CX3 A;  1GSE A;  3HJO A;  2V6K A;  3RDW A;  1HQO A;  1X9M B;  4EXJ A;  3RAZ A;  1F9M A;  2JSY A;  2N5F A;  1MTC A;  3KTL A;  2I81 A;  3VI5 A;  3SWL A;  1X9W B;  1MD3 A;  4N11 A;  1PRX A;  3F0I A;  2HYX A;  1SD9 A;  4KND A;  4MP4 A;  1EGO A;  1ILO A;  4NMU A;  3MDK A;  2BTO T;  4XS4 A;  3BJ5 A;  3KH7 A;  4YH2 A;  2DJK A;  1FVJ A;  3ZIT A;  1M0U A;  3CRT A;  3M0F A;  5EL8 A;  1DE1 A;  2CX4 A;  2B1K A;  2GT6 A;  1ZOF A;  2EC4 A;  3HVX A;  2MBT A;  4MJC A;  3FK8 A;  2B7J A;  3UEM A;  2FHE A;  1K3L A;  1F3A A;  22GS A;  2L4C A;  3ZVJ A;  3O3T A;  4ECI A;  3F4S A;  4YQV A;  4RI6 A;  4HU7 A;  1XOA A;  2L5L A;  4F0B A;  4WBR D;  1WP0 A;  3LOR A;  5L71 A;  4OWY A;  1SYR A;  2FA4 A;  2Z9S A;  1PMT A;  3KIJ A;  2YWM A;  3FR3 A;  1IYH A;  5KN2 A;  3LXT A;  4PUR A;  1ZMA A;  2PWJ A;  4RQR A;  4YQM A;  1HYU A;  13GS A;  1K0D A;  2MBS A;  3UBK A;  3J7Y b;  1PQN A;  3I43 A;  5AIS A;  4MCU A;  2NDO A;  3QR6 A;  4O7H A;  1XOB A;  2E2M A;  5G1L A;  1XVW A;  3QDN A;  1PA3 A;  1Y25 A;  4WF5 A;  1WOU A;  1AIU A;  5H5S A;  2BMX A;  3GH9 A;  4MZW A;  1K0M A;  2XPD A;  1U3A A;  2IMD A;  2IJY A;  3GL5 A;  3QAW A;  2MMZ A;  1GRX A;  1FAA A;  4F0C A;  5IO0 A;  2OJL A;  2GDR A;  2YPM A;  3HXS A;  3VK9 A;  5C04 A;  3ZIJ A;  4KCA A;  5DCH A;  3A2V A;  5HR0 A;  1UN2 A;  2V32 A;  1PL2 A;  2YP6 A;  4POL A;  2IWT A;  5AIV A;  1PX7 A;  4Q5Q A;  5CRD A;  1ZL9 A;  5CO3 A;  1TU7 A;  4WEY A;  5EPF A;  1ST9 A;  1PL1 A;  2YCD A;  4ZBD A;  1B48 A;  3W6G A;  3GYK A;  2GTU A;  4KB3 A;  3APO A;  12GS A;  5F06 A;  4XRA A;  4WET A;  1MD4 A;  2H1B A;  4K7N A;  1WRY A;  4F82 A;  1YF1 A;  1TU8 A;  2CAQ A;  3C71 A;  1XPV A;  1F2E A;  2KHP A;  4NPB A;  2H30 A;  2GZY A;  2JAD A;  4DSS B;  5H5Q A;  2DJ1 A;  1CQG A;  2PER A;  4ISD A;  4IW9 A;  2R2J A;  4MH2 A;  1USB A;  3GKN A;  1JZD A;  2PBJ A;  3M9K A;  3W8S A;  4QL9 A;  3GUR A;  2H71 A;  5ECM B;  5IM9 A;  1O7U A;  1KNG A;  4OCE A;  4NHW A;  1EP7 A;  4LA1 A;  9GSS A;  2CAI A;  4ECC A;  1V40 A;  1GUH A;  1YKC A;  3APS A;  1AC1 A;  5CYY A;  2JAC A;  5KN3 A;  3LXZ A;  5HFK A;  3DGQ A;  2H8L A;  2K8S A;  1DSB A;  4IKH A;  4E8E A;  4DSQ A;  2OAC A;  3TKP A;  4ZL8 A;  2ES7 A;  2WDU A;  3IHQ A;  3VPQ A;  1ACV A;  2H70 A;  1K0N A;  2VL2 A;  4K6X A;  1EOG A;  4K7I A;  4HUA A;  2DJ3 A;  1T3B A;  1A8Y A;  1BX9 A;  1G6W A;  3ZYW A;  2AB6 A;  1JFU A;  1U6T A;  2ON7 A;  4BVX A;  2HLS A;  3GKM A;  1AW9 A;  2X99 A;  2CVB A;  2H01 A;  1A8L A;  3GKK A;  3CSH A;  2P5Q A;  1THO A;  5DJL A;  1OC9 A;  4WBJ A;  4XTS A;  2JZR A;  4K2D A;  3VWV A;  2REM A;  2HNL A;  1G7E A;  4ZL9 A;  5JCU A;  4IEL A;  1Z9H A;  3FR6 A;  5GZZ B;  2LV3 A;  5B6N A;  4MJE A;  1Q4J A;  1S3D A;  3M3M A;  2F8A A;  1TDI A;  5DJM A;  5IMD A;  1Z5Y E;  1GNW A;  2WB9 A;  1LJR A;  2MYG A;  4ECJ A;  4H86 A;  2C0G A;  5A4U A;  5ECI B;  1K3O A;  2H73 A;  3RPP A;  1XWC A;  3IBH A;  4K9Z A;  4MF5 A;  3VWX A;  1B8X A;  17GS A;  1QK8 A;  2QGV A;  2IFQ B;  2L6C A;  2B5Y A;  4V2N A;  2MMN A;  4N30 A;  3EVI A;  3BBY A;  3HVV A;  4V2M A;  3GH6 A;  2HZF A;  2C8U A;  3HY2 A;  1EEM A;  3LJR A;  2K18 A;  1A2M A;  4XS6 A;  3FKF A;  2DJJ A;  3CMI A;  3F3Q A;  3G7J A;  2N5B A;  1O6J A;  2HSH A;  2HI7 A;  4ZB8 A;  2GST A;  2LTK A;  1T7P B;  5A4V A;  2E0Q A;  2JL4 A;  1FW1 A;  5ABR A;  3U5R E;  2LKU A;  1YEX A;  5CRW A;  1BQ7 A;  1M9A A;  2WGR A;  3IA1 A;  5HQP A;  2R4V A;  3Q19 A;  2FLS A;  3D4M A;  4MDC A;  2B5X A;  1TK5 B;  1YEP A;  5ECP B;  2WCI A;  1FG4 A;  4TXO B;  3RBT A;  2FCH A;  2O87 A;  5CAX A;  4DVC A;  4O5R A;  1T4Y A;  4MK3 A;  2EIO A;  3KM6 A;  1ABA A;  3IXR A;  1O73 A;  1FO5 A;  2JU5 A;  5IO2 A;  3WT1 A;  1QXH A;  1X5E A;  5G5E A;  2RUF A;  3E9J B;  3EC3 A;  3ME8 A;  5DAK B;  5ECO B;  2K9F A;  4V1A g;  3A3T A;  3KP9 A;  1LU4 A;  3TGZ A;  5E59 A;  1G0T A;  1K0B A;  5INY A;  14GS A;  4EUY A;  2FWH A;  4NWY A;  4TR1 A;  4MLY A;  5F0G A;  3UL3 A;  2C1Y A;  1OVN A;  1F37 A;  4FO5 A;  1AXD A;  2H72 A;  3GX8 A;  4LLR A;  2DIY A;  3BD2 A;  1W89 A;  1MEK A;  1WE0 A;  4WXT A;  5J4U A;  3H4K A;  4JU5 A;  3FZ4 A;  1N2A A;  3GRX A;  2C0F A;  4PUA A;  2LEG A;  3GNJ A;  4ZB9 A;  3EU4 A;  3QFB C;  4F2I A;  5A4W A;  4IJI A;  5GSS A;  3VPT A;  1A0F A;  3NIV A;  4G10 A;  3IV4 A;  3L78 A;  3EIN A;  2PN8 A;  3GST A;  2ALB A;  3LG6 A;  5ECR B;  1HNC A;  7GSS A;  2NVL A;  3Q6O A;  4MZB A;  3P2A A;  1TW9 A;  1HNB A;  2CQ9 A;  4PUF C;  1V98 A;  4AF2 A;  5JWO B;  4EVM A;  1TRW A;  5LCZ A;  2YV7 A;  3DKS A;  3F6F A;  4EC0 A;  4V2L A;  2I4A A;  3C1R A;  4GSN A;  1YJ6 A;  4G9H A;  4DSS A;  5B8A A;  3IK9 A;  4JRR A;  2F8F A;  1B9X C;  5IMZ A;  2VCW A;  1JZR A;  4KW6 A;  2NPB A;  3HA9 A;  2HZE A;  2LJR A;  1SK0 A;  2HSY A;  4Z7X A;  3O76 A;  2AUV A;  4ACS A;  1GUM A;  2YWN A;  4KDX A;  2YWI A;  6GSU A;  3HYP A;  1OE8 A;  1A23 A;  4TW5 A;  1YY7 A;  3UBL A;  4O92 A;  3H1N A;  4HU9 A;  4I97 A;  3VFI A;  1XZO A;  5ENU A;  2VLV A;  5D9T A;  3FZ9 A;  1GSS A;  2CVK A;  6GSY A;  2VL3 A;  3Q18 A;  1CQH A;  1W4V A;  4CW9 A;  1FB0 A;  1H4O A;  4KDU A;  4X0X A;  3GX0 A;  3LEF A;  3IAM 2;  2C4J A;  1YZX A;  4POB A;  2DC5 A;  4ID0 A;  1K0C A;  4POM A;  5DVB A;  1Z6N A;  2RII A;  2EIQ A;  4TR4 A;  3TJF A;  3D5J A;  2LRC A;  4IS0 A;  2KUC A;  3L9S A;  4GWR A;  3O6T A;  2H1D A;  1S3A A;  2DSA A;  1R4W A;  2JZT A;  1MDI A;  2AV4 A;  1GNE A;  4GF0 A;  5J9B A;  2X8C A;  1SEN A;  3F9U A;  4JR4 A;  1SL2 B;  2YV9 A;  2RLI A;  3KD0 A;  2P0G A;  5H5R A;  3QMX A;  1TI1 A;  4KSO A;  2ZCT A;  1O85 A;  4MAB A;  4N10 A;  3TKS C;  1R7H A;  4BVY A;  2IMK A;  3KCM A;  3NZN A;  4KE3 A;  2HFD A;  2AAW A;  1SL1 B;  5IOW A;  3FZ5 A;  1NSW A;  4GST A;  2GQK A;  1U87 A;  2LJA A;  3EUR A;  3LYK A;  3GTU B;  1KTE A;  3TJG A;  2KLX A;  1AQV A;  1QMV A;  3VI7 A;  5HFI A;  1BJX A;  3G7I A;  3VUR A;  5GST A;  4JR6 A;  4YAP A;  1QUW A;  5D9X A;  2CA8 A;  3FRC A;  3GKX A;  3P90 A;  3ZFB A;  2R3X A;  4KAE A;  3TOT A;  4XCS A;  3HVS A;  2KP1 A;  4EKZ A;  3AY8 A;  1Z3E A;  2TRX A;  2XPE A;  4I6X A;  1VF2 A;  1AUC A;  4IHU A;  4K7O A;  3H79 A;  1J9B A;  2GVP A;  4FIW A;  2IFQ A;  2B6M A;  1VF1 A;  2C3Q A;  4EE0 A;  4OO5 A;  3ZTL A;  4CHS A;  1TRU A;  1V57 A;  2XBI A;  4MZC A;  1FHE A;  3D0Z A;  1M2B A;  3L9U A;  5JCW A;  3ZMK A;  3FHK A;  4TXV A;  2WZ9 A;  3IC4 A;  2YOI A;  1JLV A;  3E0U A;  3L4N A;  5ECQ B;  4IQA A;  3J7Y k;  4GXZ A;  3VWW A;  5G5F A;  3K8N A;  3V1W A;  4OO4 A;  1SJ6 A;  2YJH A;  3H93 A;  3LSZ A;  3DRN A;  4GCI A;  3UVH A;  1ERT A;  1U88 A;  3TRX A;  4FYC A;  1WIK A;  3UAP A;  4PNF A;  4NV2 A;  1M9B A;  2VD1 A;  1KEB A;  2AJQ B;  4V1A p;  4AJ7 A;  3KJY A;  1XWK A;  2CZ3 A;  4ECB A;  4N0V A;  4ZB6 A;  1GSD A;  1YQ1 A;  1J0F A;  1F3B A;  2VLU A;  3BOA A;  5FT3 A;  4TXO A;  1XBS A;  3N5O A;  4KUN A;  4TR0 A;  3ZML A;  4Q5N A;  2OE1 A;  1GSU A;  3ISO A;  4OCF A;  4J2F A;  3MWH A;  2A2R A;  2GSS A;  2R37 A;  1R26 A;  4OD7 A;  4I2T A;  2H74 A;  1SD8 A;  4IJ3 A;  5DAK A;  4PNG A;  3CXG A;  2PVO C;  1VF3 A;  3F6D A;  3I6A A;  4XRD A;  1XWB A;  1B4P A;  5F8B A;  5IQY A;  2A2S A;  3PIN A;  1GSQ A;  1R5P A;  3UVT A;  5CRG A;  3PR8 A;  4ML1 A;  3FZA A;  2PMT A;  3G9B A;  1BAY A;  3KZQ A;  4X43 A;  5FHI A;  2HE3 A;  5G30 A;  3CBU A;  2OE0 A;  2WUL A;  3OR5 A;  3LFL A;  3NOF A;  2L59 A;  5IIZ A;  2K6V A;  5DAL B;  1WJK A;  3HCZ A;  4Q5F A;  1JHB A;  1ERV A;  1GL8 A;  1GSY A;  5J41 A;  2VAF A;  2LRT A;  4KDY A;  4KA0 A;  2C80 A;  4P3Y B;  3IDV A;  1TXX A;  4EDY A;  2JSZ A;  3IPZ A;  5J3R A;  2B7K A;  4K0N A;  3IAS 2;  3BCK A;  1OYJ A;  1GP1 A;  1ZZY A;  3TDG A;  4NAX A;  1SL0 B;  5D9W A;  1T00 A;  3A5W A;  2FUG 2;  4FYB A;  5GAN D;  4HZ2 A;  5D93 A;  4I5Q A;  3DXB A;  4XHM A;  4CDO A;  1BED A;  3KMO A;  2YWO A;  4TKY A;  5IMF A;  1JZW A;  1C72 A;  1E2Y A;  4EL1 A;  2O85 A;  3KTB A;  3L0H A;  1UA5 A;  5ECH B;  2B3S A;  3KMN A;  3WGE A;  5IMA A;  5AN1 A;  3C8E A;  3WT2 A;  1M2A A;  3UOM A;  1V2A A;  2VM1 A;  5ID2 B;  4O32 A;  2P31 A;  5GAP D;  1PSQ A;  4HZ4 A;  4TR3 A;  4L0U A;  3VLN A;  4JZQ A;  5IPG A;  2R5G A;  16GS A;  3ZIV A;  3RHB A;  4JBB A;  4WR4 A;  3S9F A;  4IGJ A;  1SK1 A;  2V6O A;  2VD0 A;  2C3N A;  3RHC A;  5A5K A;  2TIR A;  4IQ1 A;  3LQ7 A;  4OFM A;  2LS5 A;  2C3T A;  1LBK A;  2GS3 A;  1FVK A;  1FB6 A;  2B5E A;  4PQH A;  2VM2 A;  4PQ1 A;  5IMC A;  3F8U A;  4MH3 A;  2HXK A;  1PN9 A;  1X0R A;  4IP1 A;  4ZBA A;  2M72 A;  1ON4 A;  1TKD B;  3CRU A;  3C7M A;  4GQF A;  4TOP A;  3WYW A;  1XW6 A;  3ZFL A;  1MDK A;  1XVQ A;  2LJK A;  1T8E B;  4FH8 A;  4Q5R A;  3QOU A;  1IYI A;  6GSV A;  1SKW B;  4LL1 B;  4WF4 A;  3FY7 A;  3F4R A;  6GST A;  3QAV A;  4BL7 A;  4TN8 A;  1URM A;  1U3I A;  1ZYE A;  3SBC A;  2AHE A;  3HDC A;  2FWE A;  2WS2 A;  3HZ4 A;  2NTO A;  4D73 B;  4BA7 A;  2L57 A;  3GUS A;  3DYR A;  3CTG A;  4I8B A;  2OBK A;  4WR5 A;  4KCE A;  4AJ8 A;  2G0F A;  1VRS D;  2X8H A;  4ML6 A;  5DDL A;  5DQS A;  2GSQ A;  3D4T A;  5DQY A;  2BJX A;  2RUE A;  2N5A A;  1SJI A;  3Q74 A;  4HS1 A;  3I69 A;  1VGL A;  4WKW A;  2H0H A;  3ERF A;  1EZK A;  1EEJ A;  1OC3 A;  4LL4 B;  3P8W A;  4IN0 A;  1QFN A;  3E3E A;  3EMX A;  2NBS A;  1EP8 A;  1X9S B;  2PU9 C;  1AQW A;  1RW1 A;  3M8N A;  2V1M A;  5CP1 A;  2ON5 A;  5EVO A;  2VCT A;  2IME A;  1J08 A;  4HI7 A;  3TKS E;  1TOF A;  3MNG A;  3RPN A;  3IK7 A;  2FWF A;  3EU3 A;  1ERW A;  2R6K A;  3TRP A;  3ZLP A;  4DSR A;  2M46 A;  4YQU A;  1NM3 A;  4KGI A;  2PUK C;  3PH9 A;  2OE3 A;  2IN3 A;  4POK A;  3US3 A;  1ZYQ B;  3UJ1 A;  5E4W A;  1OKT A;  4HJM A;  4TRX A;  5B6M A;  5CRE A;  2L4Q A;  4GLT A;  1XXU A;  4L5L A;  3QD9 A;  4J57 E;  1X5C A;  2M80 A;  1THX A;  3CSI A;  2V41 A;  2C0E A;  2EIR A;  2RM5 A;  2VUP A;  1EGR A;  3R2Q A;  3G7Y A;  1DE2 A;  2F3M A;  1GSF A;  3CTF A;  1SK2 A;  2VL9 A;  5HR2 A;  4FYU A;  3GL3 A;  1WPI A;  2OAD A;  1K0A A;  3JCM L;  2IMF A;  2QKE A;  2QC7 A;  5D96 A;  1F6M C;  1TP9 A;  5J5N A;  2FNO A;  2WJU A;  3IR4 A;  4EO3 A;  4ILF A;  1JLW A;  2X8G A;  2DJ2 A;  1M99 A;  2OKA A;  3UAR A;  5D9V A;  1K0O A;  4L5O A;  1SJZ A;  1DUG A;  2J23 A;  2O7K A;  3HJM A;  2IL3 A;  5HR3 A;  3BCI A;  2PGT A;  2IPA A;  2LNT A;  2H76 A;  2F51 A;  1KBN A;  4TR1 B;  4MJB A;  10GS A;  3GIX A;  3F3R A;  5FWG A;  3TKS A;  1I5G A;  3IRA A;  3GV1 A;  1XW5 A;  4XS1 A;  5AGY A;  2ZUP A;  1T1V A;  2YAN A;  2VO4 A;  4MF6 A;  3H8Q A;  4AGS A;  2OBI A;  19GS A;  5JWR B;  4ZIJ A;  2YNX A;  2HRF A;  4QQ7 A;  3ZZX A;  1OAZ A;  5ECK B;  3W8J A;  4ZBB A;  2H19 A;  2CZ2 A;  3M1G A;  4N0Z A;  1V9W A;  5KN0 A;  5G1K A;  2IIY A;  4HEA 2;  2YZU A;  2CV4 A;  5KEJ A;  1QGV A;  3ED3 A;  3GFK A;  3EE2 A;  1TTZ A;  2F9S A;  2FGX A;  2GQL A;  1OE7 A;  1TRS A;  1G6Y A;  1XW9 A;  1N8J A;  2L6D A;  1XCC A;  2VOC A;  1SKR B;  1FOV A;  5IOX A;  5D8I A;  3LWA A;  1XFL A;  5JWQ B;  5B8B A;  4GQC A;  2FY6 A;  3CSJ A;  5DAL A;  5ECS A;  1G7O A;  1VF4 A;  4HOJ A;  4ULX A;  2B1L A;  1UVZ A;  3KP8 A;  2CT6 A;  3P7X A;  4I2U A;  4LMV A;  1JZO A;  3F4T A;  1ERU A;  2JZS A;  1PKW A;  1TJD A;  4EDZ A;  3DD3 A;  1PKZ A;  3DVX A;  3QCP A;  2GSR A;  4XS4 B;  2GQM A;  5D73 A;  4GRF A;  3DWV A;  2XHF A;  4NHZ A;  2DIZ A;  2VCV A;  4BPY A;  3KXO A;  3MSZ A;  2XBQ A;  1HNA A;  2G2Q A;  3IOS A;  1A24 A;  4OMV A;  1Z6M A;  4F9Z A;  3EWL A;  1ML6 A;  2YJ7 A;  4HJ2 A;  1B9Y C;  3GA4 A;  5C00 A;  5B7C A;  2YZH A;  1NHO A;  2DMM A;  5ELA A;  3HHV A;  2HZE B;  3HZ8 A;  5DBQ A;  2HRN A;  1GLQ A;  1GH2 A;  2GZZ A;  20GS A;  3IE3 A;  4IVF A;  5COH A;  3L9V A;  2WFC A;  1R5A A;  1YF0 A;  2VCZ A;  2HT9 A;  4XIH A;  1BYE A;  1GLP A;  1TK0 B;  2K8V A;  2A4V A;  4MA9 A;  2VLT A;  5ID2 A;  3D6I A;  3A2W A;  11GS A;  2H0G A;  5HFG A;  1Y6E A;  2RM6 A;  2CVD A;  2AYT A;  4OFT A;  4OFN A;  2LRN A;  1Q98 A;  5KN1 A;  1RQM A;  4GTU A;  2P5R A;  5F07 A;  3QPM A;  4MF7 A;  5G31 A;  2KP2 A;  3GMF A;  4MPF A;  5CRH A;  3ERG A;  2H1A A;  1A2L A;  1RK4 A;  5EY6 A;  1X5D A;  6GSW A;  1A0R P;  4MPG A;  1S3C A;  1WMJ A;  3GN3 A;  2FA8 A;  4QL7 A;  2H75 A;  3ERW A;  2V2G A;  4PGT A;  2LST A;  5ECL B;  3UIW A;  2GGT A;  4DEJ A;  4PQI A;  2OA7 A;  2VL2 C;  4ZXG A;  2H66 A;  4HDE A;  1QQ2 A;  3PGT A;  4PXO A;  4GSS A;  1M2D A;  2ZNM A;  1TK8 B;  1YKA A;  1EV9 A;  1ZGN A;  1GUK A;  2I9H A;  2VCX A;  4K1F A;  2MMO A;  4TVE A;  3ME7 A;  2I1U A;  4BWQ A;  5AIX A;  3DEX A;  2MMA A;  4IBP A;  4D73 A;  1GWC A;  3C1S A;  3TRQ A;  2DJ0 A;  1WWJ A;  5J9C A;  3D22 A;  4IP6 A;  3EMP A;  1A2J A;  2DML A;  5DCG A;  4AJ6 A;  2YN1 A;  4RQX A;  3C73 A;  2FWG A;  1GTA A;  1PGT A;  3TB2 A;  3U6V A;  1I9D A;  4L8E A;  3CYN A;  4NXI A;  4LMW A;  3HJP A;  3TCO A;  1XWA A;  5LD0 A;  3WD6 A;  1GUL A;  4MJA A;  1O8X A;  2XC2 A;  3FR9 A;  2J9H A;  5LNK e;  3GHA A;  1O81 A;  5CNW A;  5HR1 A;  4BWS A;  3TKR A;  1TRV A;  4J56 E;  1SYX A;  3APQ A;  5ELG A;  3M9J A;  1V58 A;  3DML A;  1NW2 A;  3HKR A;  1Z7P A;  3FEU A;  5F05 A;  1XIY A;  2D2Z A;  4K8M A;  4ZL7 A;  1K3Y A;  6GSS A;  2DLX A;  5G2Z A;  1OKD A;  1HD2 A;  3HD5 A;  3TJJ A;  2LQO A;  1PD2 1;  2GLR A;  4RUV A;  4F03 A;  3MAK A;  1GTU A;  2E7P A;  1BG5 A; 
#chains in the Genus database with same CATH topology
 1XWG A;  1SKS B;  1AAZ A;  5JCG A;  1TI3 A;  1XG8 A;  4ZIL A;  3VWU A;  1B4Q A;  3UMA A;  4KSM A;  3TJB A;  4EF0 A;  4E8H A;  3ZL5 A;  4Z2U A;  3TJK A;  2PVQ A;  2LUS A;  5IPH A;  1Z7R A;  3I9V 2;  1M7T A;  3A5I A;  3WGX A;  3ZVJ D;  3TUE A;  2O89 A;  2QSI A;  3F63 A;  4KX4 A;  1O8W A;  1MDJ A;  3ZRE A;  3A2X A;  1EWX A;  2E2G A;  3MYD A;  4YAV A;  1NHY A;  3LGC A;  2LQQ A;  3QFA C;  6GSX A;  2IMI A;  4JE1 A;  1PX6 A;  2H6X A;  3KGK A;  1DBY A;  5ECN B;  4JED A;  4BVX B;  2FD3 A;  3GSS A;  8GSS A;  3FW2 A;  3EYT A;  4BIK A;  1E6B A;  2X64 A;  4X1U A;  3DVW A;  5IMV A;  4L0W A;  2PPT A;  3TOU A;  3DIE A;  3KH9 A;  4RI7 A;  1OC9 B;  1SU9 A;  1UC7 A;  4K5R A;  2GZP A;  2H6Y A;  3KEB A;  1AQX A;  1YDK A;  2VIM A;  4G2E A;  4HQZ A;  3FYG A;  4HQS A;  2WRT A;  2H6Z A;  1H75 A;  1OC8 A;  4KH7 A;  3TKQ A;  1ZCP A;  1GTI A;  1EOH A;  1S3R A;  1GTB A;  4PX1 A;  3QAG A;  4MMM A;  2DBC A;  2L5O A;  3MIX A;  2LNS A;  2MZC A;  18GS A;  4K0G A;  2GT5 A;  2O8V B;  2TRC P;  1T4Z A;  2H1G A;  4G19 A;  2C0D A;  2I3Y A;  3GTU A;  3WGD A;  3N9J A;  2KOK A;  4NV5 A;  3D21 A;  1EV4 A;  2H0I A;  2VCQ A;  3LYP A;  3ZRD A;  2CX3 A;  1GSE A;  3HJO A;  2V6K A;  3RDW A;  1HQO A;  1X9M B;  4EXJ A;  3RAZ A;  1F9M A;  2JSY A;  2N5F A;  1MTC A;  3KTL A;  2I81 A;  4KF9 A;  3VI5 A;  3SWL A;  1X9W B;  1MD3 A;  4N11 A;  1PRX A;  3F0I A;  2HYX A;  1SD9 A;  4KND A;  4MP4 A;  1EGO A;  1ILO A;  4NMU A;  3MDK A;  2BTO T;  4XS4 A;  3BJ5 A;  3KH7 A;  4YH2 A;  2DJK A;  1FVJ A;  3ZIT A;  1M0U A;  3CRT A;  3M0F A;  5EL8 A;  1DE1 A;  2CX4 A;  2B1K A;  2GT6 A;  1ZOF A;  2EC4 A;  3HVX A;  2MBT A;  4MJC A;  3FK8 A;  2B7J A;  3UEM A;  2FHE A;  1K3L A;  1F3A A;  22GS A;  2L4C A;  3ZVJ A;  3O3T A;  4ECI A;  3F4S A;  4YQV A;  4RI6 A;  4HU7 A;  1XOA A;  2L5L A;  3FMW A;  4F0B A;  4WBR D;  1WP0 A;  3LOR A;  5L71 A;  4OWY A;  1SYR A;  2FA4 A;  2Z9S A;  1PMT A;  3KIJ A;  2YWM A;  3FR3 A;  1IYH A;  5KN2 A;  3LXT A;  4PUR A;  1ZMA A;  2PWJ A;  4RQR A;  4YQM A;  1HYU A;  13GS A;  1K0D A;  2MBS A;  3UBK A;  3J7Y b;  1PQN A;  3I43 A;  5AIS A;  4MCU A;  2NDO A;  3QR6 A;  4O5U A;  4O7H A;  1XOB A;  2E2M A;  5G1L A;  1XVW A;  3QDN A;  1PA3 A;  1Y25 A;  4WF5 A;  1WOU A;  1AIU A;  5H5S A;  2BMX A;  3GH9 A;  4MZW A;  1K0M A;  2XPD A;  1U3A A;  2IMD A;  2IJY A;  3GL5 A;  3QAW A;  2MMZ A;  1GRX A;  1FAA A;  4F0C A;  5IO0 A;  2OJL A;  2GDR A;  2YPM A;  3HXS A;  3VK9 A;  5C04 A;  2R0P A;  3ZIJ A;  4KCA A;  5DCH A;  3A2V A;  5HR0 A;  1UN2 A;  2V32 A;  1PL2 A;  2YP6 A;  4POL A;  2IWT A;  5AIV A;  1PX7 A;  4Q5Q A;  5CRD A;  1ZL9 A;  5CO3 A;  1TU7 A;  4WEY A;  5EPF A;  1ST9 A;  1PL1 A;  2YCD A;  4ZBD A;  1B48 A;  3W6G A;  3GYK A;  2GTU A;  4KB3 A;  3APO A;  12GS A;  5F06 A;  4XRA A;  4WET A;  1MD4 A;  2H1B A;  4K7N A;  1WRY A;  4F82 A;  1YF1 A;  1TU8 A;  2CAQ A;  3C71 A;  1XPV A;  1F2E A;  2KHP A;  4NPB A;  2H30 A;  2GZY A;  2JAD A;  4DSS B;  5H5Q A;  2DJ1 A;  1CQG A;  2PER A;  4ISD A;  4IW9 A;  2R2J A;  4MH2 A;  1USB A;  3GKN A;  1JZD A;  2PBJ A;  3M9K A;  3W8S A;  4QL9 A;  3GUR A;  2H71 A;  5ECM B;  5IM9 A;  1O7U A;  1KNG A;  4OCE A;  4NHW A;  1EP7 A;  4LA1 A;  9GSS A;  2CAI A;  4ECC A;  1V40 A;  1GUH A;  1YKC A;  3APS A;  1AC1 A;  5CYY A;  2JAC A;  5KN3 A;  3LXZ A;  5HFK A;  3DGQ A;  2H8L A;  2K8S A;  1DSB A;  4IKH A;  4E8E A;  4DSQ A;  2OAC A;  3TKP A;  4ZL8 A;  2ES7 A;  2WDU A;  3IHQ A;  3VPQ A;  1ACV A;  2H70 A;  1K0N A;  2VL2 A;  4K6X A;  1EOG A;  4K7I A;  4HUA A;  2DJ3 A;  1T3B A;  1A8Y A;  1BX9 A;  1G6W A;  3ZYW A;  2AB6 A;  1JFU A;  1U6T A;  2ON7 A;  4BVX A;  2HLS A;  3GKM A;  1AW9 A;  2X99 A;  2CVB A;  2H01 A;  1A8L A;  3GKK A;  3CSH A;  2P5Q A;  1THO A;  5DJL A;  1OC9 A;  1PFO A;  4BVY B;  4WBJ A;  4XTS A;  2JZR A;  4K2D A;  3VWV A;  4HSC X;  2REM A;  2HNL A;  1G7E A;  4ZL9 A;  5JCU A;  4IEL A;  1Z9H A;  3FR6 A;  5GZZ B;  2LV3 A;  5B6N A;  4MJE A;  1Q4J A;  1S3D A;  3M3M A;  2F8A A;  1TDI A;  5DJM A;  5IMD A;  1Z5Y E;  1GNW A;  2WB9 A;  1LJR A;  2MYG A;  4ECJ A;  4H86 A;  2C0G A;  5A4U A;  5ECI B;  1K3O A;  2H73 A;  3RPP A;  1XWC A;  3IBH A;  4K9Z A;  4MF5 A;  3VWX A;  1B8X A;  17GS A;  1QK8 A;  2QGV A;  2IFQ B;  2L6C A;  2B5Y A;  4V2N A;  2MMN A;  4N30 A;  3EVI A;  3BBY A;  3HVV A;  4V2M A;  3GH6 A;  2HZF A;  3EPT A;  2C8U A;  2DKH A;  3HY2 A;  1EEM A;  3LJR A;  2K18 A;  1A2M A;  4XS6 A;  3FKF A;  2DJJ A;  3CMI A;  3F3Q A;  3G7J A;  2N5B A;  1O6J A;  2HSH A;  2HI7 A;  4ZB8 A;  2GST A;  2LTK A;  1T7P B;  5A4V A;  2E0Q A;  2JL4 A;  1FW1 A;  5ABR A;  3U5R E;  2LKU A;  1YEX A;  5CRW A;  1BQ7 A;  1M9A A;  2WGR A;  3IA1 A;  5HQP A;  3R3E A;  2R4V A;  3Q19 A;  2FLS A;  3D4M A;  4MDC A;  2B5X A;  1TK5 B;  1YEP A;  5ECP B;  2WCI A;  1FG4 A;  4TXO B;  3RBT A;  2FCH A;  2O87 A;  5CAX A;  4DVC A;  4O5R A;  1T4Y A;  4MK3 A;  2EIO A;  3KM6 A;  1ABA A;  3IXR A;  1O73 A;  1FO5 A;  2JU5 A;  5IO2 A;  3WT1 A;  4EIQ A;  1QXH A;  1X5E A;  5G5E A;  2RUF A;  3E9J B;  3EC3 A;  3ME8 A;  5DAK B;  5ECO B;  2K9F A;  4V1A g;  3A3T A;  3KP9 A;  1LU4 A;  3TGZ A;  5E59 A;  1G0T A;  1K0B A;  5INY A;  14GS A;  4EUY A;  4O5Q A;  2FWH A;  4NWY A;  4TR1 A;  4MLY A;  5F0G A;  3UL3 A;  2C1Y A;  1OVN A;  1F37 A;  4FO5 A;  1AXD A;  2H72 A;  3GX8 A;  4LLR A;  2DIY A;  3BD2 A;  1W89 A;  1MEK A;  1WE0 A;  4WXT A;  5J4U A;  3H4K A;  4JU5 A;  3FZ4 A;  1N2A A;  3GRX A;  2C0F A;  4PUA A;  2LEG A;  3GNJ A;  4ZB9 A;  3EU4 A;  3QFB C;  4F2I A;  5A4W A;  4IJI A;  5GSS A;  3VPT A;  1A0F A;  3NIV A;  4G10 A;  3IV4 A;  3L78 A;  3EIN A;  2PN8 A;  3GST A;  2ALB A;  3LG6 A;  5ECR B;  1HNC A;  7GSS A;  2NVL A;  3Q6O A;  4MZB A;  3P2A A;  1TW9 A;  1HNB A;  2CQ9 A;  4PUF C;  1V98 A;  4AF2 A;  5JWO B;  4EVM A;  1TRW A;  5LCZ A;  2YV7 A;  3DKS A;  3F6F A;  4EC0 A;  4V2L A;  1ZYP A;  3LW9 A;  2I4A A;  3C1R A;  4GSN A;  1YJ6 A;  4G9H A;  4DSS A;  5B8A A;  3IK9 A;  4JRR A;  2F8F A;  1B9X C;  5IMZ A;  2VCW A;  1JZR A;  3IHG A;  4KW6 A;  2NPB A;  3HA9 A;  2HZE A;  2LJR A;  1SK0 A;  2HSY A;  4Z7X A;  3O76 A;  2AUV A;  4ACS A;  1GUM A;  2YWN A;  4KDX A;  2YWI A;  6GSU A;  4USS A;  3HYP A;  1OE8 A;  1A23 A;  4TW5 A;  1YY7 A;  3UBL A;  4O92 A;  3H1N A;  4HU9 A;  4I97 A;  3VFI A;  1XZO A;  5ENU A;  2VLV A;  5D9T A;  3FZ9 A;  1GSS A;  2CVK A;  6GSY A;  2VL3 A;  3Q18 A;  1CQH A;  1W4V A;  4CW9 A;  1FB0 A;  1H4O A;  4KDU A;  4X0X A;  3GX0 A;  3LEF A;  3IAM 2;  2C4J A;  1YZX A;  4POB A;  2DC5 A;  4ID0 A;  1K0C A;  4POM A;  5DVB A;  1Z6N A;  2RII A;  2EIQ A;  4TR4 A;  3TJF A;  3D5J A;  2LRC A;  4IS0 A;  2KUC A;  3L9S A;  4GWR A;  3O6T A;  2H1D A;  1S3A A;  4A5P A;  2DSA A;  1R4W A;  2JZT A;  2A2P A;  1MDI A;  2AV4 A;  1GNE A;  4GF0 A;  5J9B A;  2X8C A;  4BL7 B;  1SEN A;  3F9U A;  4JR4 A;  1SL2 B;  2YV9 A;  2RLI A;  3KD0 A;  2P0G A;  5H5R A;  3QMX A;  1TI1 A;  4KSO A;  2ZCT A;  1O85 A;  4MAB A;  4N10 A;  1M3I A;  3TKS C;  1R7H A;  4BVY A;  2IMK A;  3KCM A;  3NZN A;  4KE3 A;  2HFD A;  2AAW A;  1SL1 B;  5IOW A;  3FZ5 A;  1NSW A;  4GST A;  2GQK A;  1U87 A;  2LJA A;  3EUR A;  3LYK A;  3GTU B;  1KTE A;  3TJG A;  2KLX A;  1AQV A;  1QMV A;  3VI7 A;  5HFI A;  1BJX A;  3G7I A;  3VUR A;  5GST A;  4JR6 A;  4YAP A;  1QUW A;  5D9X A;  2CA8 A;  3FRC A;  3GKX A;  3P90 A;  3ZFB A;  2R3X A;  4KAE A;  3TOT A;  4XCS A;  3HVS A;  2KP1 A;  4EKZ A;  3AY8 A;  1Z3E A;  2TRX A;  2XPE A;  4I6X A;  1VF2 A;  1AUC A;  4IHU A;  4K7O A;  3H79 A;  1J9B A;  2GVP A;  4FIW A;  2IFQ A;  2B6M A;  1VF1 A;  2HRA A;  2C3Q A;  4EE0 A;  1M3J A;  4OO5 A;  3ZTL A;  4CHS A;  1TRU A;  1V57 A;  2XBI A;  4MZC A;  1FHE A;  3D0Z A;  1M2B A;  3L9U A;  5JCW A;  3ZMK A;  3FHK A;  4TXV A;  2WZ9 A;  3IC4 A;  4ICY A;  2YOI A;  1JLV A;  3E0U A;  3L4N A;  5ECQ B;  4IQA A;  3J7Y k;  4GXZ A;  3VWW A;  5G5F A;  2X4A A;  3K8N A;  3V1W A;  4OO4 A;  1SJ6 A;  2YJH A;  3H93 A;  3LSZ A;  3DRN A;  4GCI A;  3UVH A;  1ERT A;  1U88 A;  3TRX A;  4FYC A;  1WIK A;  3UAP A;  4PNF A;  4NV2 A;  1M9B A;  2VD1 A;  1KEB A;  4FQU A;  2AJQ B;  4V1A p;  4AJ7 A;  3KJY A;  1XWK A;  2CZ3 A;  4ECB A;  4N0V A;  4ZB6 A;  1GSD A;  1YQ1 A;  1J0F A;  1F3B A;  2VLU A;  3BOA A;  5FT3 A;  4TXO A;  1XBS A;  3N5O A;  4KUN A;  4TR0 A;  3ZML A;  4Q5N A;  2OE1 A;  1GSU A;  3ISO A;  4OCF A;  4J2F A;  3MWH A;  2A2R A;  2GSS A;  2R37 A;  1R26 A;  4OD7 A;  4I2T A;  2H74 A;  1SD8 A;  4IJ3 A;  5DAK A;  4PNG A;  3CXG A;  2PVO C;  1VF3 A;  3F6D A;  3I6A A;  4XRD A;  1XWB A;  1B4P A;  5F8B A;  5IQY A;  2A2S A;  3PIN A;  1GSQ A;  1R5P A;  2X49 A;  3UVT A;  5CRG A;  3PR8 A;  4ML1 A;  3FZA A;  2PMT A;  3G9B A;  1BAY A;  3KZQ A;  4X43 A;  5FHI A;  2HE3 A;  5G30 A;  3CBU A;  2OE0 A;  2WUL A;  3OR5 A;  3LFL A;  3NOF A;  2L59 A;  5IIZ A;  2K6V A;  5DAL B;  1WJK A;  3HCZ A;  4Q5F A;  1JHB A;  1ERV A;  1GL8 A;  4Z2R A;  1GSY A;  5J41 A;  2VAF A;  2LRT A;  4KDY A;  4KA0 A;  2C80 A;  4P3Y B;  3IDV A;  1TXX A;  4EDY A;  2JSZ A;  3IPZ A;  5J3R A;  2B7K A;  4K0N A;  3IAS 2;  3BCK A;  1OYJ A;  1GP1 A;  1ZZY A;  3TDG A;  4NAX A;  3PPU A;  1SL0 B;  5D9W A;  1T00 A;  3A5W A;  2FUG 2;  4FYB A;  5GAN D;  4HZ2 A;  5D93 A;  4I5Q A;  3DXB A;  4XHM A;  4CDO A;  1BED A;  2UZ8 A;  3KMO A;  2YWO A;  4TKY A;  5IMF A;  1JZW A;  1C72 A;  1E2Y A;  4EL1 A;  2O85 A;  3KTB A;  3L0H A;  1UA5 A;  2B3S A;  5ECH B;  3KMN A;  3WGE A;  5IMA A;  5AN1 A;  3C8E A;  3WT2 A;  1M2A A;  3UOM A;  1V2A A;  2VM1 A;  5ID2 B;  4O32 A;  2P31 A;  5GAP D;  1PN0 A;  1PSQ A;  4TR3 A;  4HZ4 A;  4L0U A;  3VLN A;  4JZQ A;  5IPG A;  2R5G A;  16GS A;  3ZIV A;  3RHB A;  4JBB A;  4WR4 A;  5KOX A;  3S9F A;  4IGJ A;  1SK1 A;  2V6O A;  2VD0 A;  2C3N A;  3RHC A;  5A5K A;  2TIR A;  4IQ1 A;  3LQ7 A;  4OFM A;  2LS5 A;  2C3T A;  1LBK A;  2GS3 A;  1FVK A;  1FB6 A;  2B5E A;  4PQH A;  2VM2 A;  4PQ1 A;  5IMC A;  3F8U A;  4MH3 A;  2HXK A;  4MNN A;  1PN9 A;  1X0R A;  4IP1 A;  4ZBA A;  1FOH A;  2M72 A;  1ON4 A;  1TKD B;  3CRU A;  3C7M A;  4GQF A;  4TOP A;  3WYW A;  3HVN A;  1XW6 A;  3ZFL A;  1MDK A;  1XVQ A;  2LJK A;  1ZYN A;  1T8E B;  4FH8 A;  4Q5R A;  3QOU A;  1IYI A;  6GSV A;  1SKW B;  4LL1 B;  4WF4 A;  3FY7 A;  4G0K A;  3F4R A;  6GST A;  3QAV A;  4BL7 A;  4TN8 A;  1URM A;  1U3I A;  1ZYE A;  3SBC A;  2AHE A;  3HDC A;  2FWE A;  2WS2 A;  3HZ4 A;  2NTO A;  4D73 B;  4BA7 A;  2L57 A;  3GUS A;  4CY8 A;  3DYR A;  4K5S A;  3CTG A;  4I8B A;  2OBK A;  4WR5 A;  4KCE A;  4AJ8 A;  2G0F A;  1VRS D;  2X8H A;  4ML6 A;  5DDL A;  5DQS A;  2GSQ A;  3D4T A;  5DQY A;  2BJX A;  2RUE A;  2N5A A;  1SJI A;  3Q74 A;  4HS1 A;  3I69 A;  1VGL A;  4WKW A;  2H0H A;  3ERF A;  1EZK A;  1EEJ A;  1OC3 A;  4LL4 B;  3P8W A;  4IN0 A;  1QFN A;  3E3E A;  3EMX A;  2NBS A;  1EP8 A;  1X9S B;  2PU9 C;  1AQW A;  1RW1 A;  3M8N A;  2V1M A;  5CP1 A;  2ON5 A;  5EVO A;  2VCT A;  2IME A;  1J08 A;  4HI7 A;  3TKS E;  1TOF A;  3MNG A;  3RPN A;  3IK7 A;  2FWF A;  3EU3 A;  1ERW A;  2R6K A;  3TRP A;  3ZLP A;  4DSR A;  2M46 A;  3IC8 A;  4YQU A;  1NM3 A;  2HSM A;  4KGI A;  2PUK C;  3PH9 A;  2OE3 A;  2IN3 A;  4POK A;  3US3 A;  1ZYQ B;  3UJ1 A;  5E4W A;  1OKT A;  4HJM A;  4TRX A;  5B6M A;  5CRE A;  2L4Q A;  4GLT A;  1XXU A;  4L5L A;  2QA2 A;  3QD9 A;  4J57 E;  1X5C A;  2M80 A;  1THX A;  3CSI A;  2V41 A;  2C0E A;  2EIR A;  2RM5 A;  2VUP A;  1EGR A;  3R2Q A;  3G7Y A;  1DE2 A;  2F3M A;  1GSF A;  2R0G A;  1SK2 A;  2VL9 A;  3CTF A;  5HR2 A;  4FYU A;  3GL3 A;  1WPI A;  2OAD A;  1K0A A;  3JCM L;  2IMF A;  2QKE A;  2QC7 A;  5D96 A;  4X4J A;  1F6M C;  1TP9 A;  5J5N A;  2FNO A;  2WJU A;  3IR4 A;  4EO3 A;  4ILF A;  1JLW A;  2X8G A;  2DJ2 A;  1M99 A;  2OKA A;  4PTS A;  3UAR A;  5D9V A;  1K0O A;  4L5O A;  1SJZ A;  4YKF A;  1DUG A;  2J23 A;  2O7K A;  3HJM A;  2IL3 A;  5HR3 A;  3BCI A;  2PGT A;  2IPA A;  2LNT A;  2H76 A;  2F51 A;  1KBN A;  4TR1 B;  4MJB A;  10GS A;  3GIX A;  3F3R A;  5FWG A;  3TKS A;  1I5G A;  3IRA A;  3CQF A;  3GV1 A;  1XW5 A;  4XS1 A;  5AGY A;  2ZUP A;  1T1V A;  2YAN A;  2VO4 A;  4MF6 A;  3H8Q A;  4AGS A;  2OBI A;  19GS A;  5JWR B;  4ZIJ A;  2YNX A;  2HRF A;  4QQ7 A;  3ZZX A;  1OAZ A;  5ECK B;  3W8J A;  4ZBB A;  2H19 A;  2CZ2 A;  3M1G A;  4N0Z A;  1V9W A;  5KN0 A;  5G1K A;  2IIY A;  4HEA 2;  2YZU A;  2CV4 A;  5KEJ A;  1QGV A;  3ED3 A;  3GFK A;  3EE2 A;  1TTZ A;  2F9S A;  2FGX A;  2GQL A;  1OE7 A;  1TRS A;  1G6Y A;  1XW9 A;  1N8J A;  2L6D A;  1XCC A;  2VOC A;  1SKR B;  1FOV A;  5IOX A;  5D8I A;  3LWA A;  1XFL A;  5JWQ B;  5B8B A;  4GQC A;  2FY6 A;  3CSJ A;  5DAL A;  5ECS A;  1G7O A;  1VF4 A;  4HOJ A;  2A4H A;  4ULX A;  2HRK A;  2B1L A;  1UVZ A;  3KP8 A;  2CT6 A;  3P7X A;  4I2U A;  4LMV A;  1JZO A;  3F4T A;  1ERU A;  2JZS A;  1PKW A;  1TJD A;  4EDZ A;  3DD3 A;  1PKZ A;  3DVX A;  3QCP A;  2GSR A;  4XS4 B;  2GQM A;  5D73 A;  4GRF A;  3DWV A;  2XHF A;  4NHZ A;  2DIZ A;  2VCV A;  4BPY A;  3KXO A;  2DKI A;  5KOW A;  3MSZ A;  2XBQ A;  1HNA A;  2G2Q A;  3IOS A;  1A24 A;  4OMV A;  1Z6M A;  4F9Z A;  3EWL A;  1ML6 A;  2YJ7 A;  4HJ2 A;  2R0C A;  1B9Y C;  3GA4 A;  5C00 A;  5B7C A;  2YZH A;  1NHO A;  2DMM A;  5ELA A;  3HHV A;  2HZE B;  3HZ8 A;  5DBQ A;  2HRN A;  4K2X A;  1GLQ A;  1GH2 A;  2GZZ A;  20GS A;  3IE3 A;  4IVF A;  5COH A;  3L9V A;  2WFC A;  1R5A A;  4EIP A;  1YF0 A;  2VCZ A;  2HT9 A;  4XIH A;  1BYE A;  1GLP A;  1TK0 B;  2K8V A;  2A4V A;  4MA9 A;  2VLT A;  5ID2 A;  3D6I A;  3A2W A;  11GS A;  2H0G A;  5HFG A;  1Y6E A;  2RM6 A;  2CVD A;  2AYT A;  4OFT A;  4OFN A;  2LRN A;  1Q98 A;  5KN1 A;  1RQM A;  4GTU A;  2P5R A;  4MF7 A;  3QPM A;  5F07 A;  5G31 A;  2KP2 A;  3GMF A;  4MPF A;  5CRH A;  3ERG A;  2H1A A;  1A2L A;  1RK4 A;  5EY6 A;  1X5D A;  6GSW A;  1A0R P;  4MPG A;  1S3C A;  1WMJ A;  3GN3 A;  2FA8 A;  4QL7 A;  2H75 A;  3ERW A;  2V2G A;  4PGT A;  2LST A;  5ECL B;  3UIW A;  2GGT A;  4DEJ A;  4PQI A;  2OA7 A;  2VL2 C;  4ZXG A;  4Z2T A;  2H66 A;  4HDE A;  1QQ2 A;  3PGT A;  4PXO A;  4GSS A;  1M2D A;  2ZNM A;  1TK8 B;  1YKA A;  1EV9 A;  1ZGN A;  1GUK A;  2I9H A;  4CY6 A;  2VCX A;  4K1F A;  2MMO A;  4TVE A;  3ME7 A;  2I1U A;  4BWQ A;  5AIX A;  5BRT A;  3DEX A;  2MMA A;  4IBP A;  4D73 A;  1GWC A;  3C1S A;  4G0L A;  5BMU A;  3TRQ A;  2DJ0 A;  1WWJ A;  5J9C A;  3D22 A;  4IP6 A;  3EMP A;  1A2J A;  2DML A;  5DCG A;  4AJ6 A;  2YN1 A;  4RQX A;  3C73 A;  2FWG A;  1GTA A;  1PGT A;  3TB2 A;  3U6V A;  1I9D A;  4L8E A;  3CYN A;  4NXI A;  4LMW A;  3HJP A;  3TCO A;  1XWA A;  5LD0 A;  3WD6 A;  1GUL A;  4MJA A;  1O8X A;  2XC2 A;  3FR9 A;  2J9H A;  5LNK e;  3GHA A;  1O81 A;  5CNW A;  5HR1 A;  4BWS A;  3TKR A;  1TRV A;  4J56 E;  1SYX A;  3APQ A;  5ELG A;  4G0I A;  3M9J A;  1V58 A;  3DML A;  1NW2 A;  3HKR A;  1Z7P A;  3FEU A;  5F05 A;  4YKG A;  1XIY A;  2QA1 A;  2D2Z A;  4K8M A;  4ZL7 A;  1K3Y A;  6GSS A;  2DLX A;  5G2Z A;  1OKD A;  1HD2 A;  3HD5 A;  3TJJ A;  2LQO A;  1PD2 1;  2GLR A;  4RUV A;  4F03 A;  3MAK A;  1GTU A;  2E7P A;  1BG5 A; 
#chains in the Genus database with same CATH homology
 1XWG A;  1SKS B;  1AAZ A;  5JCG A;  1TI3 A;  4ZIL A;  3VWU A;  1B4Q A;  3UMA A;  4KSM A;  3TJB A;  4EF0 A;  4E8H A;  3ZL5 A;  4Z2U A;  3TJK A;  2PVQ A;  2LUS A;  5IPH A;  1Z7R A;  3I9V 2;  1M7T A;  3A5I A;  3WGX A;  3ZVJ D;  3TUE A;  2O89 A;  2QSI A;  3F63 A;  4KX4 A;  1O8W A;  1MDJ A;  3ZRE A;  3A2X A;  1EWX A;  2E2G A;  3MYD A;  4YAV A;  1NHY A;  3LGC A;  2LQQ A;  3QFA C;  6GSX A;  2IMI A;  4JE1 A;  1PX6 A;  2H6X A;  3KGK A;  1DBY A;  5ECN B;  4JED A;  4BVX B;  2FD3 A;  3GSS A;  8GSS A;  3FW2 A;  3EYT A;  1E6B A;  2X64 A;  4X1U A;  3DVW A;  5IMV A;  4L0W A;  2PPT A;  3TOU A;  3DIE A;  3KH9 A;  4RI7 A;  1OC9 B;  1SU9 A;  1UC7 A;  4K5R A;  2GZP A;  2H6Y A;  3KEB A;  1AQX A;  1YDK A;  2VIM A;  4G2E A;  4HQZ A;  3FYG A;  4HQS A;  2WRT A;  2H6Z A;  1H75 A;  1OC8 A;  4KH7 A;  3TKQ A;  1ZCP A;  1GTI A;  1EOH A;  1GTB A;  4PX1 A;  3QAG A;  4MMM A;  2DBC A;  2L5O A;  3MIX A;  2LNS A;  2MZC A;  18GS A;  4K0G A;  2GT5 A;  2O8V B;  2TRC P;  1T4Z A;  2H1G A;  4G19 A;  2C0D A;  2I3Y A;  3GTU A;  3WGD A;  3N9J A;  2KOK A;  4NV5 A;  3D21 A;  1EV4 A;  2H0I A;  2VCQ A;  3LYP A;  3ZRD A;  2CX3 A;  1GSE A;  3HJO A;  2V6K A;  3RDW A;  1HQO A;  1X9M B;  4EXJ A;  3RAZ A;  1F9M A;  2JSY A;  2N5F A;  1MTC A;  3KTL A;  2I81 A;  4KF9 A;  3VI5 A;  3SWL A;  1X9W B;  1MD3 A;  4N11 A;  1PRX A;  3F0I A;  2HYX A;  1SD9 A;  4KND A;  4MP4 A;  1EGO A;  1ILO A;  4NMU A;  3MDK A;  2BTO T;  4XS4 A;  3BJ5 A;  3KH7 A;  4YH2 A;  2DJK A;  1FVJ A;  3ZIT A;  1M0U A;  3CRT A;  3M0F A;  5EL8 A;  1DE1 A;  2CX4 A;  2B1K A;  2GT6 A;  1ZOF A;  2EC4 A;  3HVX A;  2MBT A;  4MJC A;  3FK8 A;  2B7J A;  3UEM A;  2FHE A;  1K3L A;  1F3A A;  22GS A;  2L4C A;  3ZVJ A;  3O3T A;  4ECI A;  3F4S A;  4YQV A;  4RI6 A;  4HU7 A;  1XOA A;  2L5L A;  3FMW A;  4F0B A;  4WBR D;  1WP0 A;  3LOR A;  5L71 A;  4OWY A;  1SYR A;  2FA4 A;  2Z9S A;  1PMT A;  3KIJ A;  2YWM A;  3FR3 A;  1IYH A;  5KN2 A;  3LXT A;  4PUR A;  1ZMA A;  2PWJ A;  4RQR A;  4YQM A;  1HYU A;  13GS A;  1K0D A;  2MBS A;  3UBK A;  3J7Y b;  1PQN A;  3I43 A;  5AIS A;  4MCU A;  2NDO A;  3QR6 A;  4O5U A;  4O7H A;  1XOB A;  2E2M A;  5G1L A;  1XVW A;  3QDN A;  1PA3 A;  1Y25 A;  4WF5 A;  1WOU A;  1AIU A;  5H5S A;  2BMX A;  3GH9 A;  4MZW A;  1K0M A;  2XPD A;  1U3A A;  2IMD A;  2IJY A;  3GL5 A;  3QAW A;  2MMZ A;  1GRX A;  1FAA A;  4F0C A;  5IO0 A;  2OJL A;  2GDR A;  2YPM A;  3HXS A;  3VK9 A;  5C04 A;  2R0P A;  3ZIJ A;  4KCA A;  5DCH A;  3A2V A;  5HR0 A;  1UN2 A;  2V32 A;  1PL2 A;  2YP6 A;  4POL A;  2IWT A;  5AIV A;  1PX7 A;  4Q5Q A;  5CRD A;  1ZL9 A;  5CO3 A;  1TU7 A;  4WEY A;  5EPF A;  1ST9 A;  1PL1 A;  2YCD A;  4ZBD A;  1B48 A;  3W6G A;  3GYK A;  2GTU A;  4KB3 A;  3APO A;  12GS A;  5F06 A;  4XRA A;  4WET A;  1MD4 A;  2H1B A;  4K7N A;  1WRY A;  4F82 A;  1YF1 A;  1TU8 A;  2CAQ A;  3C71 A;  1XPV A;  1F2E A;  2KHP A;  4NPB A;  2H30 A;  2GZY A;  2JAD A;  4DSS B;  5H5Q A;  2DJ1 A;  1CQG A;  2PER A;  4ISD A;  4IW9 A;  2R2J A;  4MH2 A;  1USB A;  3GKN A;  1JZD A;  2PBJ A;  3M9K A;  3W8S A;  4QL9 A;  3GUR A;  2H71 A;  5ECM B;  5IM9 A;  1O7U A;  1KNG A;  4OCE A;  4NHW A;  1EP7 A;  4LA1 A;  9GSS A;  2CAI A;  4ECC A;  1V40 A;  1GUH A;  1YKC A;  3APS A;  1AC1 A;  5CYY A;  2JAC A;  5KN3 A;  3LXZ A;  5HFK A;  3DGQ A;  2H8L A;  2K8S A;  1DSB A;  4IKH A;  4E8E A;  4DSQ A;  2OAC A;  3TKP A;  4ZL8 A;  2ES7 A;  2WDU A;  3IHQ A;  3VPQ A;  1ACV A;  2H70 A;  1K0N A;  2VL2 A;  4K6X A;  1EOG A;  4K7I A;  4HUA A;  2DJ3 A;  1T3B A;  1A8Y A;  1BX9 A;  1G6W A;  3ZYW A;  2AB6 A;  1JFU A;  1U6T A;  2ON7 A;  4BVX A;  2HLS A;  3GKM A;  1AW9 A;  2X99 A;  2CVB A;  2H01 A;  1A8L A;  3GKK A;  3CSH A;  2P5Q A;  1THO A;  5DJL A;  1OC9 A;  4BVY B;  4WBJ A;  4XTS A;  2JZR A;  4K2D A;  3VWV A;  2REM A;  2HNL A;  1G7E A;  4ZL9 A;  5JCU A;  4IEL A;  1Z9H A;  3FR6 A;  5GZZ B;  2LV3 A;  5B6N A;  4MJE A;  1Q4J A;  1S3D A;  3M3M A;  2F8A A;  1TDI A;  5DJM A;  5IMD A;  1Z5Y E;  1GNW A;  2WB9 A;  1LJR A;  2MYG A;  4ECJ A;  4H86 A;  2C0G A;  5A4U A;  5ECI B;  1K3O A;  2H73 A;  3RPP A;  1XWC A;  3IBH A;  4K9Z A;  4MF5 A;  3VWX A;  1B8X A;  17GS A;  1QK8 A;  2QGV A;  2IFQ B;  2L6C A;  2B5Y A;  4V2N A;  2MMN A;  4N30 A;  3EVI A;  3BBY A;  3HVV A;  4V2M A;  3GH6 A;  2HZF A;  3EPT A;  2C8U A;  2DKH A;  3HY2 A;  1EEM A;  3LJR A;  2K18 A;  1A2M A;  4XS6 A;  3FKF A;  2DJJ A;  3CMI A;  3F3Q A;  3G7J A;  2N5B A;  1O6J A;  2HSH A;  2HI7 A;  4ZB8 A;  2GST A;  2LTK A;  1T7P B;  5A4V A;  2E0Q A;  2JL4 A;  1FW1 A;  5ABR A;  3U5R E;  2LKU A;  1YEX A;  5CRW A;  1BQ7 A;  1M9A A;  2WGR A;  3IA1 A;  5HQP A;  3R3E A;  2R4V A;  3Q19 A;  2FLS A;  3D4M A;  4MDC A;  2B5X A;  1TK5 B;  1YEP A;  5ECP B;  2WCI A;  1FG4 A;  4TXO B;  3RBT A;  2FCH A;  2O87 A;  5CAX A;  4DVC A;  4O5R A;  1T4Y A;  4MK3 A;  2EIO A;  3KM6 A;  1ABA A;  3IXR A;  1O73 A;  1FO5 A;  2JU5 A;  5IO2 A;  3WT1 A;  4EIQ A;  1QXH A;  1X5E A;  5G5E A;  2RUF A;  3E9J B;  3EC3 A;  3ME8 A;  5DAK B;  5ECO B;  2K9F A;  4V1A g;  3A3T A;  3KP9 A;  1LU4 A;  3TGZ A;  5E59 A;  1G0T A;  1K0B A;  5INY A;  14GS A;  4EUY A;  4O5Q A;  2FWH A;  4NWY A;  4TR1 A;  4MLY A;  5F0G A;  3UL3 A;  2C1Y A;  1OVN A;  1F37 A;  4FO5 A;  1AXD A;  2H72 A;  3GX8 A;  4LLR A;  2DIY A;  3BD2 A;  1W89 A;  1MEK A;  1WE0 A;  4WXT A;  5J4U A;  3H4K A;  4JU5 A;  3FZ4 A;  1N2A A;  3GRX A;  2C0F A;  4PUA A;  2LEG A;  3GNJ A;  4ZB9 A;  3EU4 A;  3QFB C;  4F2I A;  5A4W A;  4IJI A;  5GSS A;  3VPT A;  1A0F A;  3NIV A;  4G10 A;  3IV4 A;  3L78 A;  3EIN A;  2PN8 A;  3GST A;  2ALB A;  3LG6 A;  5ECR B;  1HNC A;  7GSS A;  2NVL A;  3Q6O A;  4MZB A;  3P2A A;  1TW9 A;  1HNB A;  2CQ9 A;  4PUF C;  1V98 A;  4AF2 A;  5JWO B;  4EVM A;  1TRW A;  5LCZ A;  2YV7 A;  3DKS A;  3F6F A;  4EC0 A;  4V2L A;  1ZYP A;  3LW9 A;  2I4A A;  3C1R A;  4GSN A;  1YJ6 A;  4G9H A;  4DSS A;  5B8A A;  3IK9 A;  4JRR A;  2F8F A;  1B9X C;  5IMZ A;  2VCW A;  1JZR A;  3IHG A;  4KW6 A;  2NPB A;  3HA9 A;  2HZE A;  2LJR A;  1SK0 A;  2HSY A;  4Z7X A;  3O76 A;  2AUV A;  4ACS A;  1GUM A;  2YWN A;  4KDX A;  2YWI A;  6GSU A;  4USS A;  3HYP A;  1OE8 A;  1A23 A;  4TW5 A;  1YY7 A;  3UBL A;  4O92 A;  3H1N A;  4HU9 A;  4I97 A;  3VFI A;  1XZO A;  5ENU A;  2VLV A;  5D9T A;  3FZ9 A;  1GSS A;  2CVK A;  6GSY A;  2VL3 A;  3Q18 A;  1CQH A;  1W4V A;  4CW9 A;  1FB0 A;  1H4O A;  4KDU A;  4X0X A;  3GX0 A;  3LEF A;  3IAM 2;  2C4J A;  1YZX A;  4POB A;  2DC5 A;  4ID0 A;  1K0C A;  4POM A;  5DVB A;  1Z6N A;  2RII A;  2EIQ A;  4TR4 A;  3TJF A;  3D5J A;  2LRC A;  4IS0 A;  2KUC A;  3L9S A;  4GWR A;  3O6T A;  2H1D A;  1S3A A;  4A5P A;  2DSA A;  1R4W A;  2JZT A;  2A2P A;  1MDI A;  2AV4 A;  1GNE A;  4GF0 A;  5J9B A;  2X8C A;  4BL7 B;  1SEN A;  3F9U A;  4JR4 A;  1SL2 B;  2YV9 A;  2RLI A;  3KD0 A;  2P0G A;  5H5R A;  3QMX A;  1TI1 A;  4KSO A;  2ZCT A;  1O85 A;  4MAB A;  4N10 A;  3TKS C;  1R7H A;  4BVY A;  2IMK A;  3KCM A;  3NZN A;  4KE3 A;  2HFD A;  2AAW A;  1SL1 B;  5IOW A;  3FZ5 A;  1NSW A;  4GST A;  2GQK A;  1U87 A;  2LJA A;  3EUR A;  3LYK A;  3GTU B;  1KTE A;  3TJG A;  2KLX A;  1AQV A;  1QMV A;  3VI7 A;  5HFI A;  1BJX A;  3G7I A;  3VUR A;  5GST A;  4JR6 A;  4YAP A;  1QUW A;  5D9X A;  2CA8 A;  3FRC A;  3GKX A;  3P90 A;  3ZFB A;  2R3X A;  4KAE A;  3TOT A;  4XCS A;  3HVS A;  2KP1 A;  4EKZ A;  3AY8 A;  1Z3E A;  2TRX A;  2XPE A;  4I6X A;  1VF2 A;  1AUC A;  4IHU A;  4K7O A;  3H79 A;  1J9B A;  2GVP A;  4FIW A;  2IFQ A;  2B6M A;  1VF1 A;  2HRA A;  2C3Q A;  4EE0 A;  4OO5 A;  3ZTL A;  4CHS A;  1TRU A;  1V57 A;  2XBI A;  4MZC A;  1FHE A;  3D0Z A;  1M2B A;  3L9U A;  5JCW A;  3ZMK A;  3FHK A;  4TXV A;  2WZ9 A;  3IC4 A;  4ICY A;  2YOI A;  1JLV A;  3E0U A;  3L4N A;  5ECQ B;  4IQA A;  3J7Y k;  4GXZ A;  3VWW A;  5G5F A;  2X4A A;  3K8N A;  3V1W A;  4OO4 A;  1SJ6 A;  2YJH A;  3H93 A;  3LSZ A;  3DRN A;  4GCI A;  3UVH A;  1ERT A;  1U88 A;  3TRX A;  4FYC A;  1WIK A;  3UAP A;  4PNF A;  4NV2 A;  1M9B A;  2VD1 A;  1KEB A;  4FQU A;  2AJQ B;  4V1A p;  4AJ7 A;  3KJY A;  1XWK A;  2CZ3 A;  4ECB A;  4N0V A;  4ZB6 A;  1GSD A;  1YQ1 A;  1J0F A;  1F3B A;  2VLU A;  3BOA A;  5FT3 A;  4TXO A;  1XBS A;  3N5O A;  4KUN A;  4TR0 A;  3ZML A;  4Q5N A;  2OE1 A;  1GSU A;  3ISO A;  4OCF A;  4J2F A;  3MWH A;  2A2R A;  2GSS A;  2R37 A;  1R26 A;  4OD7 A;  4I2T A;  2H74 A;  1SD8 A;  4IJ3 A;  5DAK A;  4PNG A;  3CXG A;  2PVO C;  1VF3 A;  3F6D A;  3I6A A;  4XRD A;  1XWB A;  1B4P A;  5F8B A;  5IQY A;  2A2S A;  3PIN A;  1GSQ A;  1R5P A;  2X49 A;  3UVT A;  5CRG A;  3PR8 A;  4ML1 A;  3FZA A;  2PMT A;  3G9B A;  1BAY A;  3KZQ A;  4X43 A;  5FHI A;  2HE3 A;  5G30 A;  3CBU A;  2OE0 A;  2WUL A;  3OR5 A;  3LFL A;  3NOF A;  2L59 A;  5IIZ A;  2K6V A;  5DAL B;  1WJK A;  3HCZ A;  4Q5F A;  1JHB A;  1ERV A;  1GL8 A;  4Z2R A;  1GSY A;  5J41 A;  2VAF A;  2LRT A;  4KDY A;  4KA0 A;  2C80 A;  4P3Y B;  3IDV A;  1TXX A;  4EDY A;  2JSZ A;  3IPZ A;  5J3R A;  2B7K A;  4K0N A;  3IAS 2;  3BCK A;  1OYJ A;  1GP1 A;  1ZZY A;  3TDG A;  4NAX A;  3PPU A;  1SL0 B;  5D9W A;  1T00 A;  3A5W A;  2FUG 2;  4FYB A;  5GAN D;  4HZ2 A;  5D93 A;  4I5Q A;  3DXB A;  4XHM A;  4CDO A;  1BED A;  2UZ8 A;  3KMO A;  2YWO A;  4TKY A;  5IMF A;  1JZW A;  1C72 A;  1E2Y A;  4EL1 A;  2O85 A;  3KTB A;  3L0H A;  1UA5 A;  2B3S A;  5ECH B;  3KMN A;  3WGE A;  5IMA A;  5AN1 A;  3C8E A;  3WT2 A;  1M2A A;  3UOM A;  1V2A A;  2VM1 A;  5ID2 B;  4O32 A;  2P31 A;  5GAP D;  1PN0 A;  1PSQ A;  4TR3 A;  4HZ4 A;  4L0U A;  3VLN A;  4JZQ A;  5IPG A;  2R5G A;  16GS A;  3ZIV A;  3RHB A;  4JBB A;  4WR4 A;  5KOX A;  3S9F A;  4IGJ A;  1SK1 A;  2V6O A;  2VD0 A;  2C3N A;  3RHC A;  5A5K A;  2TIR A;  4IQ1 A;  3LQ7 A;  4OFM A;  2LS5 A;  2C3T A;  1LBK A;  2GS3 A;  1FVK A;  1FB6 A;  2B5E A;  4PQH A;  2VM2 A;  4PQ1 A;  5IMC A;  3F8U A;  4MH3 A;  2HXK A;  4MNN A;  1PN9 A;  1X0R A;  4IP1 A;  4ZBA A;  1FOH A;  2M72 A;  1ON4 A;  1TKD B;  3CRU A;  3C7M A;  4GQF A;  4TOP A;  3WYW A;  1XW6 A;  3ZFL A;  1MDK A;  1XVQ A;  2LJK A;  1ZYN A;  1T8E B;  4FH8 A;  4Q5R A;  3QOU A;  1IYI A;  6GSV A;  1SKW B;  4LL1 B;  4WF4 A;  3FY7 A;  4G0K A;  3F4R A;  6GST A;  3QAV A;  4BL7 A;  4TN8 A;  1URM A;  1U3I A;  1ZYE A;  3SBC A;  2AHE A;  3HDC A;  2FWE A;  2WS2 A;  3HZ4 A;  2NTO A;  4D73 B;  4BA7 A;  2L57 A;  3GUS A;  4CY8 A;  3DYR A;  4K5S A;  3CTG A;  4I8B A;  2OBK A;  4WR5 A;  4KCE A;  4AJ8 A;  2G0F A;  1VRS D;  2X8H A;  4ML6 A;  5DDL A;  5DQS A;  2GSQ A;  3D4T A;  5DQY A;  2BJX A;  2RUE A;  2N5A A;  1SJI A;  3Q74 A;  4HS1 A;  3I69 A;  1VGL A;  4WKW A;  2H0H A;  3ERF A;  1EZK A;  1EEJ A;  1OC3 A;  4LL4 B;  3P8W A;  4IN0 A;  1QFN A;  3E3E A;  3EMX A;  2NBS A;  1EP8 A;  1X9S B;  2PU9 C;  1AQW A;  1RW1 A;  3M8N A;  2V1M A;  5CP1 A;  2ON5 A;  5EVO A;  2VCT A;  2IME A;  1J08 A;  4HI7 A;  3TKS E;  1TOF A;  3MNG A;  3RPN A;  3IK7 A;  2FWF A;  3EU3 A;  1ERW A;  2R6K A;  3TRP A;  3ZLP A;  4DSR A;  2M46 A;  3IC8 A;  4YQU A;  1NM3 A;  2HSM A;  4KGI A;  2PUK C;  3PH9 A;  2OE3 A;  2IN3 A;  4POK A;  3US3 A;  1ZYQ B;  3UJ1 A;  5E4W A;  1OKT A;  4HJM A;  4TRX A;  5B6M A;  5CRE A;  2L4Q A;  4GLT A;  1XXU A;  4L5L A;  2QA2 A;  3QD9 A;  4J57 E;  1X5C A;  2M80 A;  1THX A;  3CSI A;  2V41 A;  2C0E A;  2EIR A;  2RM5 A;  2VUP A;  1EGR A;  3R2Q A;  3G7Y A;  1DE2 A;  2F3M A;  1GSF A;  2R0G A;  1SK2 A;  2VL9 A;  3CTF A;  5HR2 A;  4FYU A;  3GL3 A;  1WPI A;  2OAD A;  1K0A A;  3JCM L;  2IMF A;  2QKE A;  2QC7 A;  5D96 A;  4X4J A;  1F6M C;  1TP9 A;  5J5N A;  2FNO A;  2WJU A;  3IR4 A;  4EO3 A;  4ILF A;  1JLW A;  2X8G A;  2DJ2 A;  1M99 A;  2OKA A;  4PTS A;  3UAR A;  5D9V A;  1K0O A;  4L5O A;  1SJZ A;  4YKF A;  1DUG A;  2J23 A;  2O7K A;  3HJM A;  2IL3 A;  5HR3 A;  3BCI A;  2PGT A;  2IPA A;  2LNT A;  2H76 A;  2F51 A;  1KBN A;  4TR1 B;  4MJB A;  10GS A;  3GIX A;  3F3R A;  5FWG A;  3TKS A;  1I5G A;  3IRA A;  3GV1 A;  1XW5 A;  4XS1 A;  5AGY A;  2ZUP A;  1T1V A;  2YAN A;  2VO4 A;  4MF6 A;  3H8Q A;  4AGS A;  2OBI A;  19GS A;  5JWR B;  4ZIJ A;  2YNX A;  2HRF A;  4QQ7 A;  3ZZX A;  1OAZ A;  5ECK B;  3W8J A;  4ZBB A;  2H19 A;  2CZ2 A;  3M1G A;  4N0Z A;  1V9W A;  5KN0 A;  5G1K A;  2IIY A;  4HEA 2;  2YZU A;  2CV4 A;  5KEJ A;  1QGV A;  3ED3 A;  3GFK A;  3EE2 A;  1TTZ A;  2F9S A;  2FGX A;  2GQL A;  1OE7 A;  1TRS A;  1G6Y A;  1XW9 A;  1N8J A;  2L6D A;  1XCC A;  2VOC A;  1SKR B;  1FOV A;  5IOX A;  5D8I A;  3LWA A;  1XFL A;  5JWQ B;  5B8B A;  4GQC A;  2FY6 A;  3CSJ A;  5DAL A;  5ECS A;  1G7O A;  1VF4 A;  4HOJ A;  2A4H A;  4ULX A;  2HRK A;  2B1L A;  1UVZ A;  3KP8 A;  2CT6 A;  3P7X A;  4I2U A;  4LMV A;  1JZO A;  3F4T A;  1ERU A;  2JZS A;  1PKW A;  1TJD A;  4EDZ A;  3DD3 A;  1PKZ A;  3DVX A;  3QCP A;  2GSR A;  4XS4 B;  2GQM A;  5D73 A;  4GRF A;  3DWV A;  2XHF A;  4NHZ A;  2DIZ A;  2VCV A;  4BPY A;  3KXO A;  2DKI A;  5KOW A;  3MSZ A;  2XBQ A;  1HNA A;  2G2Q A;  3IOS A;  1A24 A;  4OMV A;  1Z6M A;  4F9Z A;  3EWL A;  1ML6 A;  2YJ7 A;  4HJ2 A;  2R0C A;  1B9Y C;  3GA4 A;  5C00 A;  5B7C A;  2YZH A;  1NHO A;  2DMM A;  5ELA A;  3HHV A;  2HZE B;  3HZ8 A;  5DBQ A;  2HRN A;  4K2X A;  1GLQ A;  1GH2 A;  2GZZ A;  20GS A;  3IE3 A;  4IVF A;  5COH A;  3L9V A;  2WFC A;  1R5A A;  4EIP A;  1YF0 A;  2VCZ A;  2HT9 A;  4XIH A;  1BYE A;  1GLP A;  1TK0 B;  2K8V A;  2A4V A;  4MA9 A;  2VLT A;  5ID2 A;  3D6I A;  3A2W A;  11GS A;  2H0G A;  5HFG A;  1Y6E A;  2RM6 A;  2CVD A;  2AYT A;  4OFT A;  4OFN A;  2LRN A;  1Q98 A;  5KN1 A;  1RQM A;  4GTU A;  2P5R A;  4MF7 A;  3QPM A;  5F07 A;  5G31 A;  2KP2 A;  3GMF A;  4MPF A;  5CRH A;  3ERG A;  2H1A A;  1A2L A;  1RK4 A;  5EY6 A;  1X5D A;  6GSW A;  1A0R P;  4MPG A;  1S3C A;  1WMJ A;  3GN3 A;  2FA8 A;  4QL7 A;  2H75 A;  3ERW A;  2V2G A;  4PGT A;  2LST A;  5ECL B;  3UIW A;  2GGT A;  4DEJ A;  4PQI A;  2OA7 A;  2VL2 C;  4ZXG A;  4Z2T A;  2H66 A;  4HDE A;  1QQ2 A;  3PGT A;  4PXO A;  4GSS A;  1M2D A;  2ZNM A;  1TK8 B;  1YKA A;  1EV9 A;  1ZGN A;  1GUK A;  2I9H A;  4CY6 A;  2VCX A;  4K1F A;  2MMO A;  4TVE A;  3ME7 A;  2I1U A;  4BWQ A;  5AIX A;  5BRT A;  3DEX A;  2MMA A;  4IBP A;  4D73 A;  1GWC A;  3C1S A;  4G0L A;  5BMU A;  3TRQ A;  2DJ0 A;  1WWJ A;  5J9C A;  3D22 A;  4IP6 A;  3EMP A;  1A2J A;  2DML A;  5DCG A;  4AJ6 A;  2YN1 A;  4RQX A;  3C73 A;  2FWG A;  1GTA A;  1PGT A;  3TB2 A;  3U6V A;  1I9D A;  4L8E A;  3CYN A;  4NXI A;  4LMW A;  3HJP A;  3TCO A;  1XWA A;  5LD0 A;  3WD6 A;  1GUL A;  4MJA A;  1O8X A;  2XC2 A;  3FR9 A;  2J9H A;  5LNK e;  3GHA A;  1O81 A;  5CNW A;  5HR1 A;  4BWS A;  3TKR A;  1TRV A;  4J56 E;  1SYX A;  3APQ A;  5ELG A;  4G0I A;  3M9J A;  1V58 A;  3DML A;  1NW2 A;  3HKR A;  1Z7P A;  3FEU A;  5F05 A;  4YKG A;  1XIY A;  2QA1 A;  2D2Z A;  4K8M A;  4ZL7 A;  1K3Y A;  6GSS A;  2DLX A;  5G2Z A;  1OKD A;  1HD2 A;  3HD5 A;  3TJJ A;  2LQO A;  1PD2 1;  2GLR A;  4RUV A;  4F03 A;  3MAK A;  1GTU A;  2E7P A;  1BG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...