2XBQA

Crystal structure of reduced schistosoma mansoni thioredoxin pre- protein at 1.7 angstrom
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
105
structure length
105
Chain Sequence
SELIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKYDAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN
publication title Structural and Functional Characterization of Schistosoma Mansoni Thioredoxin.
pubmed doi rcsb
source organism Schistosoma mansoni
total genus 32
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2010-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2xbqA00
1PKZA 3VI5A 5IO0A 4KB3A 1FVKA 1GTBA 4PUFC 2VIMA 2X8HA 1M7TA 5ECHB 2OA7A 2WB9A 2OBIA 2I4AA 4KUNA 1MDJA 3GUSA 2VCZA 3FW2A 1G7EA 3PR8A 5DJLA 4TR4A 2OJLA 4I8BA 2X8GA 3GSTA 5CNWA 1OVNA 1TTZA 2BMXA 3KEBA 4EDYA 3EMXA 3A2XA 5EVOA 1N8JA 5E4WA 5DVBA 2WDUA 1ZOFA 1O6JA 1OKDA 17GSA 2V1MA 2LJKA 3HA9A 4G19A 4YQMA 2YN1A 5J5NA 3WT2A 1VF1A 3ZMLA 4ZL7A 3KP8A 4MA9A 1ILOA 4YH2A 5CO3A 2VCQA 1OAZA 2H71A 2HZEB 4X1UA 1PMTA 5AN1A 1AW9A 4LA1A 2IMDA 4F82A 1EV4A 1A8LA 3P2AA 1BYEA 3IAS2 3ISOA 3L4NA 1M99A 5GAND 2GQMA 1A2JA 2HI7A 2LRCA 2I9HA 2CZ3A 5G5FA 2XBQA 4HQZA 4OO4A 3US3A 2H6YA 2AHEA 2AUVA 2VM1A 3TOUA 4HEA2 1FOVA 1NM3A 2L59A 4TN8A 1SD9A 1MDIA 1EOHA 2EC4A 1IYHA 3TRXA 3ZMKA 5C00A 3GN3A 4MH3A 5A4VA 4PUAA 4LLRA 5CRHA 4J2FA 1JZDA 1B48A 2IMKA 4ZB9A 4IP6A 2PN8A 4NWYA 1BX9A 5HFIA 1PX7A 3MSZA 3GTUB 3F6FA 4RI6A 2TIRA 2V2GA 5J41A 1BQ7A 2FA4A 2P5QA 1WRYA 2H74A 2VCTA 3RAZA 2GT6A 5ECPB 3U5RE 5IOXA 2HZEA 4V2NA 1CQHA 2N5FA 5F8BA 3UVTA 4MF5A 2WZ9A 2GSTA 2BTOT 1YDKA 2JU5A 2DJKA 1XWAA 1GUHA 4MPGA 1FHEA 2LNSA 2FWFA 3CTFA 4PNGA 1U88A 1K0NA 5ECLB 1O8WA 2EIQA 4POMA 1TRVA 2WGRA 1AQWA 2ZCTA 4MF6A 5J9BA 4K8MA 2QGVA 4EL1A 5AGYA 4PURA 3LWAA 1A2MA 1ZZYA 3QR6A 2KOKA 5FWGA 1O85A 2WJUA 2DMLA 1Z5YE 1SKRB 1E2YA 4I97A 3KP9A 2XPDA 1NHOA 2O87A 2VCWA 3L78A 3HJOA 4ZILA 3UEMA 5J9CA 3GL3A 4TRXA 4HZ4A 2Z9SA 3GHAA 4YQVA 2KP1A 3DIEA 2H1AA 1ERUA 2C0GA 3WGXA 2CZ2A 1F2EA 3GTUA 3FKFA 4EVMA 2NDOA 5LNKe 2PMTA 4K1FA 4CW9A 1JHBA 1QK8A 1ZGNA 5A4UA 1NHYA 5J4UA 1ST9A 2B3SA 2O85A 2B5EA 1WJKA 3CXGA 3H1NA 3G9BA 4MZWA 2YNXA 1GLPA 2J23A 3G7YA 3NZNA 3TJKA 4IW9A 5ENUA 6GSVA 1AQXA 3C7MA 2C1YA 3PGTA 1U3IA 4NAXA 3A5WA 5HR0A 1NW2A 5JWOB 2NTOA 3FZAA 2FA8A 3LEFA 5ID2B 4ZIJA 3ERGA 2C0EA 2DJ1A 1YQ1A 2IPAA 1PRXA 3HJMA 2GSSA 4QQ7A 5CRDA 3L9VA 4ZXGA 5H5SA 3ME7A 1B4PA 5D9WA 2FUG2 3FZ4A 3F0IA 1NSWA 1K0OA 2H0GA 2I1UA 4IS0A 1A0RP 3HVSA 4N30A 2YPMA 2R6KA 2IWTA 5H5QA 4ZBBA 2GSQA 3ZLPA 2L6DA 3D22A 1Q4JA 1SD8A 1YJ6A 3F4SA 5F06A 4PXOA 5AIXA 1HYUA 2X64A 3N9JA 1EGRA 2L4QA 3ERFA 4I6XA 2VL9A 4ECCA 1W89A 1EWXA 4KCEA 2C3QA 4MH2A 2IMIA 3UBKA 1EP8A 1F3BA 3GFKA 2LTKA 2KHPA 1WIKA 4HS1A 3VLNA 5FT3A 2PVOC 3QAWA 5GZZB 1SL2B 1GUMA 2YV7A 4MP4A 1O8XA 1UN2A 1R5PA 4LL1B 1ERVA 2R4VA 3M3MA 2ALBA 2K8SA 5G5EA 4MJAA 3A2WA 3F63A 2WULA 3EE2A 4HJ2A 4I2TA 3VPQA 1XWBA 2GQKA 2HYXA 1UA5A 4FO5A 1K0BA 1SU9A 2JZSA 2LJAA 1TDIA 4OFNA 2K9FA 5ID2A 3QFAC 2LJRA 5FHIA 1H75A 5GSSA 3LQ7A 2RIIA 2YJ7A 4EF0A 2MMNA 3FR9A 4JEDA 3RPPA 5LD0A 2WCIA 1K0MA 1URMA 2H72A 2I81A 4K7NA 2RUFA 1JZWA 1K0CA 2HT9A 3TGZA 3FYGA 4GQCA 3EMPA 2YCDA 1Z6MA 1IYIA 5CRWA 1XOAA 1FG4A 4BL7A 3UAPA 3GV1A 2A2SA 4BPYA 1GTUA 4L0WA 1K3OA 2IMFA 2L5LA 2OADA 3KMOA 2H73A 4K2DA 5HFGA 3UARA 1BEDA 2VUPA 1PA3A 3I43A 5CRGA 5B6NA 2XHFA 4L0UA 2H1GA 3ZFBA 5KEJA 4ECIA 4K9ZA 1S3AA 2PPTA 2K6VA 3IHQA 3F6DA 2H1DA 3IOSA 3ZL5A 3TRPA 3BD2A 2YP6A 1V98A 1FB0A 4NXIA 4XS1A 5JWQB 3SBCA 4O92A 12GSA 3BCKA 1THOA 3LSZA 3M9KA 4ML6A 3R2QA 2L5OA 4BWQA 3GMFA 4F2IA 4GSTA 3G7JA 4OCFA 1C72A 5B8BA 3KGKA 1ERTA 1Z3EA 1R4WA 3ED3A 1GSYA 1TXXA 1SK0A 3O76A 3FRCA 4WETA 4IELA 5E59A 5IMFA 2H70A 1OE7A 3CSIA 4RQRA 5A5KA 3GRXA 5JCWA 2WS2A 2B7JA 2VM2A 4BVYA 2FY6A 4NPBA 4KDXA 4PQIA 3HZ8A 9GSSA 1VF4A 6GSYA 3M1GA 4JR6A 1DE2A 2LS5A 3KJYA 3KXOA 5ELGA 3E3EA 3VWWA 2HLSA 1JZOA 4NV2A 2MBTA 4TR3A 4LMVA 6GSUA 1A23A 4TW5A 2RUEA 5G31A 1GP1A 2RM6A 1EOGA 3CSJA 1QGVA 3F3QA 1ABAA 4AJ8A 3HY2A 1E6BA 4FH8A 4NHWA 3DVXA 3F4RA 3HKRA 1OKTA 3QAVA 13GSA 1CQGA 3I69A 4EE0A 1TU8A 3FK8A 4K0NA 5G30A 4CDOA 1K3YA 3UIWA 1H4OA 3DWVA 4HZ2A 5DQSA 1AUCA 6GSXA 5JCUA 2H6ZA 4NMUA 4EO3A 1GLQA 4F9ZA 1GL8A 3DYRA 1TOFA 1Z7PA 3EU3A 1GNWA 5ECRB 3ZYWA 3LG6A 1M2DA 3QMXA 3CMIA 4WKWA 3FR3A 1YEXA 3CYNA 4XCSA 2YWOA 4QL9A 2HZFA 5H5RA 3EYTA 4N0VA 1RQMA 2WRTA 2EIOA 4GF0A 5ECIB 2E0QA 2ZUPA 2HXKA 4N10A 3KH9A 3WT1A 2GZPA 3P90A 2VL3A 1XWKA 1B9XC 1Y25A 1G7OA 2GZZA 2E2MA 5F0GA 5HR2A 2RM5A 1EEMA 3WGEA 2VL2A 4OCEA 4PGTA 6GSSA 3V1WA 2M72A 5EY6A 1R5AA 2N5AA 3Q74A 3ERWA 1AQVA 2DSAA 3W8JA 3GA4A 4IGJA 2XC2A 5LCZA 1EV9A 3D6IA 1GNEA 1V57A 4ML1A 2H8LA 1DSBA 5IPHA 3DD3A 3CTGA 4EDZA 1GTAA 2GVPA 4XS6A 2V6OA 3HXSA 1DE1A 1YF1A 2FD3A 1MDKA 4ZB6A 1XBSA 3VWXA 4PNFA 2K8VA 3EU4A 4HU7A 3TOTA 2L4CA 2AV4A 3ZTLA 2JZTA 5B8AA 5IMDA 1B4QA 1ZMAA 4PQHA 4V2MA 5F05A 1U87A 1PD21 1S3DA 2R5GA 18GSA 4O7HA 3TCOA 1I9DA 4GLTA 4L5OA 2V6KA 3ZIJA 1DUGA 2YWMA 3APOA 3CRTA 4V1Ap 4E8HA 2FWGA 3QCPA 2ES7A 16GSA 1MD4A 4G10A 1XOBA 3Q19A 1U3AA 5ECSA 3QOUA 4XHMA 2D2ZA 3KMNA 4POBA 3L0HA 3DRNA 3IDVA 2F3MA 2C80A 3IC4A 3KTLA 1GSFA 2PGTA 3M0FA 1SJZA 2IIYA 3FR6A 1TU7A 4KH7A 5COHA 1WWJA 5CAXA 2QC7A 4QL7A 1SL1B 4MABA 4N11A 4GXZA 3GURA 5AIVA 2LEGA 2DBCA 2RLIA 2H76A 4JU5A 2MMOA 1F3AA 1GUKA 1SJIA 1G6YA 3APSA 2LV3A 2FGXA 2CAQA 3IA1A 5HQPA 5J3RA 4ZBDA 1UC7A 2JZRA 4LL4B 1O7UA 1T4YA 1R26A 1VRSD 1K0AA 3KZQA 1LBKA 2OKAA 3KIJA 3NOFA 3UBLA 2TRXA 1G0TA 5D96A 3UJ1A 5ELAA 3WD6A 1EEJA 4KDUA 5IM9A 2GTUA 4Q5NA 2YOIA 1QXHA 4MZBA 4TR0A 1W4VA 2CVBA 3WGDA 2B5XA 2HE3A 3TKRA 2REMA 1T4ZA 1B8XA 4F0BA 4GTUA 4X0XA 3GYKA 1Z6NA 1FVJA 3BOAA 4H86A 2K18A 3ZZXA 4RUVA 3TKQA 4XS4B 3O3TA 6GSTA 5IIZA 3I9V2 2GT5A 3IAM2 2GS3A 2VCVA 4AGSA 3BBYA 3TUEA 3Q6OA 1OC3A 4FYBA 2DJ2A 4MJBA 2XBIA 3FHKA 1TI3A 5IMZA 1X9WB 3G7IA 4BVXA 3GKKA 1XIYA 4GSNA 5ECNB 5ABRA 4ZB8A 3K8NA 4F03A 3D4MA 3HVXA 4IJ3A 4Z7XA 2PERA 3TKSC 1AAZA 2X8CA 1A2LA 4TOPA 2CV4A 3M8NA 1FO5A 2LNTA 2G2QA 2JADA 3ME8A 1QFNA 1LU4A 4HJMA 2P5RA 1OYJA 1HNBA 3MAKA 3D4TA 4FYUA 1VF3A 2XPEA 1EGOA 2JL4A 5DCGA 3WYWA 4FIWA 4RQXA 3TKPA 3APQA 2AYTA 4K7IA 3NIVA 2B6MA 3VURA 1J9BA 3CRUA 3EURA 5D93A 1Z9HA 3GX8A 2M46A 2QKEA 14GSA 3F8UA 3IXRA 3JCML 3CSHA 2OE3A 3QPMA 5F07A 1QMVA 4TXOB 3TJFA 3S9FA 4NHZA 10GSA 2C3NA 3EC3A 2VD1A 3N5OA 4ULXA 4OFMA 1JLVA 1GTIA 2WFCA 1XFLA 2OE0A 4XS4A 3LYKA 1GWCA 1TI1A 2F8AA 2CQ9A 5CREA 4BWSA 4GSSA 1M2BA 2KP2A 3U6VA 5DJMA 2M80A 5A4WA 4GRFA 2CAIA 2YANA 2ON7A 3D21A 4GQFA 2R37A 1F9MA 3GKXA 1A8YA 3H4KA 2J9HA 3HJPA 4ECJA 3UOMA 4HDEA 2HSYA 3ZITA 3LXZA 4I5QA 4OMVA 4EC0A 3ZVJD 1KTEA 4MJEA 4IQAA 2VL2C 2TRCP 4DSSB 4PQ1A 4DSQA 1U6TA 3IR4A 3MDKA 3C8EA 3QAGA 1GSDA 5CP1A 2KLXA 4F0CA 3HCZA 1ZYEA 2VLUA 5DALB 1YKCA 4TXOA 3FEUA 1X5EA 4IVFA 3UMAA 4OO5A 1X9MB 2PVQA 3KD0A 2H0IA 2H75A 2YZHA 3MNGA 5D9XA 2GSRA 5B6MA 4J56E 2AB6A 2C4JA 4Q5FA 3TJJA 4DEJA 5HFKA 1T00A 3BJ5A 3TKSA 2HSHA 1V58A 1HD2A 4K0GA 1OE8A 2O8VB 3ZVJA 4KE3A 5IQYA 2C8UA 5DCHA 4BA7A 1PX6A 3FY7A 5DBQA 1G6WA 1UVZA 1TK8B 1OC8A 1SENA 2BJXA 4OFTA 4TKYA 4X43A 1EZKA 1A0FA 1USBA 2N5BA 3C71A 2FCHA 1JZRA 1SKWB 2YWIA 2CA8A 1ZL9A 5ECKB 4K7OA 3PH9A 4G9HA 4HUAA 5EPFA 4DSSA 4KSMA 4PX1A 4O32A 2X99A 1TJDA 4YAPA 1T1VA 1V9WA 4JE1A 3ZRDA 2MBSA 6GSWA 1GSSA 3IRAA 4D73B 1XPVA 4MK3A 4XRAA 5GAPD 4MJCA 1O73A 4MPFA 3DMLA 1MD3A 5DALA 2I3YA 3RHBA 3ZFLA 2DJ0A 5L71A 1DBYA 1K3LA 3HD5A 4V1Ag 5G1KA 2L57A 4P3YB 3DKSA 2E2GA 1HNAA 2IMEA 4MCUA 2CX3A 4ECBA 4IKHA 1PGTA 1TK5B 2DJ3A 3LGCA 4KAEA 3HDCA 1PL1A 4KNDA 3TJBA 3DXBA 2HRFA 1PN9A 1WP0A 1VGLA 1GSQA 5HR3A 4KCAA 3ZREA 3HVVA 1TP9A 2JSYA 4IQ1A 2H6XA 3TKSE 8GSSA 1T7PB 3RHCA 5C04A 2DIYA 2O7KA 1HQOA 3HHVA 2NBSA 3ZIVA 1KNGA 2GLRA 4WF4A 1YZXA 1XW9A 1SYXA 3P7XA 1ERWA 4ACSA 1LJRA 22GSA 2YJHA 4WF5A 4J57E 4DVCA 3KCMA 5KN3A 4XIHA 1Q98A 4V2LA 2NPBA 1AIUA 1F6MC 3HZ4A 2HFDA 4N0ZA 1YF0A 3LORA 4D73A 1R7HA 1WOUA 11GSA 1XWCA 2JACA 5DDLA 3H8QA 4O5RA 2CX4A 1V2AA 3GX0A 3C1SA 3LJRA 3J7Yb 4I2UA 1XZOA 2LUSA 4CHSA 3RPNA 2DJJA 2YWNA 2P31A 1TW9A 3A3TA 4TR1B 4Q5QA 1GSUA 2B1KA 4WXTA 1T8EB 2IFQB 2AJQB 3RDWA 2GZYA 2OACA 2DMMA 2IJYA 3GH6A 2KUCA 2ZNMA 4IN0A 3C73A 3FZ9A 4GCIA 3F4TA 4K6XA 4L5LA 4WR5A 1SJ6A 1SK1A 3H79A 1WPIA 1XXUA 3L9UA 4LMWA 4ZL9A 2MZCA 2LRTA 5ECMB 4JRRA 2FHEA 2PUKC 3GIXA 2FWEA 2VD0A 3VK9A 4AJ6A 2B7KA 1S3CA 1GULA 1MEKA 3IV4A 1THXA 4WEYA 7GSSA 4WR4A 1FW1A 3KM6A 1M9AA 3HYPA 2OE1A 19GSA 1ZYQB 2VCXA 1GSEA 2FNOA 4ID0A 3A2VA 1MTCA 1F37A 1XW6A 1YEPA 2MMZA 2R2JA 3GL5A 3GSSA 5HR1A 2C0FA 2GGTA 2NVLA 3KTBA 1OC9B 3Q18A 4EXJA 1ZCPA 3EWLA 3IK9A 5IMVA 5D9TA 1X5CA 1YKAA 5EL8A 3C1RA 2YV9A 2DLXA 3H93A 4TR1A 2G0FA 1AXDA 4HU9A 2IFQA 3SWLA 1SYRA 1A24A 2F9SA 3GH9A 1ACVA 3DGQA 4L8EA 1BG5A 3E0UA 1GH2A 1SK2A 1GRXA 4IP1A 1XCCA 3IK7A 20GSA 5IMAA 2PWJA 1X5DA 3W6GA 3J7Yk 3LYPA 2PBJA 2LQQA 3O6TA 4KGIA 2LKUA 2MMAA 3UVHA 1WE0A 4MF7A 4HQSA 1Y6EA 4KX4A 1WMJA 3IBHA 1RK4A 3GKMA 5IOWA 5IO2A 3L9SA 2JSZA 1EP7A 5IMCA 1PQNA 2LSTA 4MZCA 1PL2A 3DEXA 3W8SA 5IPGA 5B7CA 3TRQA 4MMMA 3TDGA 5DQYA 5GSTA 3IE3A 3QDNA 4ILFA 5KN1A 3DVWA 3TB2A 4ISDA 4WBJA 3GNJA 2PU9C 3VI7A 1OC9A 2H01A 2A2RA 4E8EA 4YAVA 1K0DA 4NV5A 1TKDB 2H0HA 4FYCA 3QFBC 2GDRA 1TRSA 1FB6A 2H66A 5D8IA 4IJIA 4HOJA 1T3BA 2VO4A 4POKA 4KW6A 5G1LA 5JCGA 1FAAA 3KH7A 4AF2A 1J08A 4YQUA 1M9BA 4AJ7A 2HNLA 4RI7A 4EKZA 1XW5A 2F51A 2FWHA 2C3TA 3VWVA 3E9JB 1TK0B 1AC1A 1TRUA 3F9UA 2HRNA 1N2AA 1PKWA 5JWRB 3VFIA 3F3RA 2DIZA 2VAFA 1SL0B 2QSIA 3FZ5A 5DAKB 1M0UA 2O89A 1QUWA 4ZL8A 1X9SB 3RBTA 4TXVA 1J0FA 3P8WA 2H30A 1KEBA 2B1LA 3EINA 5KN2A 2E7PA 3VWUA 2P0GA 2H1BA 1HNCA 1TRWA 1JLWA 5AISA 2FLSA 1JFUA 5CYYA 4MDCA 4KA0A 4MLYA 3PINA 4OWYA 5D73A 2DC5A 3I6AA 2VOCA 2YZUA 5D9VA 3D0ZA 3QD9A 2VLTA 1KBNA 2LQOA 1M2AA 4DSRA 4JR4A 4POLA 2F8FA 2CVDA 3IPZA 4G2EA 1BAYA 5ECOB 1B9YC 3LFLA 2MYGA 3TJGA 4HI7A 2L6CA 1SKSB 1XWGA 2H19A 2IN3A 2IL3A 3LXTA 4GWRA 4XTSA 2ON5A 4ZBAA 4XRDA 2EIRA 2V41A 1ML6A 3EVIA 3D5JA 3AY8A 2R3XA 4TVEA 1XVWA 4OD7A 1I5GA 3CBUA 3M9JA 4EUYA 5ECQB 2CT6A 2V32A 3OR5A 4KSOA 1RW1A 4JZQA 1VF2A 4Q5RA 1QQ2A 2LRNA 4KDYA 3BCIA 2VLVA 5G2ZA 5INYA 1PSQA 4JBBA 4IBPA 1V40A 1BJXA 2GQLA 1O81A 2C0DA 1YY7A 5DAKA 3VPTA 2AAWA 1X0RA 3GKNA 5KN0A 3UL3A 1ON4A 1XVQA 4WBRD 2OBKA 1Z7RA 4IHUA 3MWHA 2B5YA 2CVKA 2A4VA
chains in the Genus database with same CATH superfamily
1PKZA 3VI5A 5IO0A 4KB3A 1FVKA 1GTBA 4PUFC 2VIMA 2X8HA 1M7TA 5ECHB 2OA7A 2WB9A 2OBIA 2I4AA 4CY8A 4KUNA 1MDJA 1PN0A 3GUSA 2VCZA 3FW2A 4Z2TA 1G7EA 3PR8A 5DJLA 4TR4A 2OJLA 4I8BA 2X8GA 3GSTA 5CNWA 1OVNA 1TTZA 2BMXA 3KEBA 4EDYA 3EMXA 3A2XA 5EVOA 1N8JA 5E4WA 5DVBA 2WDUA 1ZOFA 1O6JA 1OKDA 17GSA 2V1MA 2LJKA 3HA9A 4G19A 4YQMA 2YN1A 5J5NA 3WT2A 1VF1A 3ZMLA 4ZL7A 3KP8A 4MA9A 1ILOA 4YH2A 5CO3A 2VCQA 1OAZA 2H71A 2HZEB 4X1UA 1PMTA 5AN1A 1AW9A 4LA1A 2IMDA 4F82A 1EV4A 1A8LA 3P2AA 1BYEA 3IAS2 3ISOA 3L4NA 1M99A 5GAND 2GQMA 1A2JA 2HI7A 2LRCA 2I9HA 2CZ3A 5G5FA 2XBQA 4HQZA 4OO4A 3US3A 2H6YA 4O5QA 2AHEA 2AUVA 2VM1A 3TOUA 4HEA2 1FOVA 1NM3A 2L59A 4TN8A 1SD9A 1MDIA 1EOHA 2EC4A 1IYHA 3TRXA 3ZMKA 5C00A 3GN3A 4MH3A 5A4VA 4PUAA 4LLRA 5CRHA 4J2FA 1JZDA 1B48A 2IMKA 3IHGA 4ZB9A 4IP6A 2PN8A 4NWYA 1BX9A 5HFIA 1S3RA 1PX7A 3MSZA 3GTUB 3F6FA 4RI6A 2TIRA 2V2GA 5J41A 1BQ7A 2FA4A 2P5QA 1WRYA 2H74A 2VCTA 3RAZA 2GT6A 5BMUA 5ECPB 3U5RE 5IOXA 2HZEA 4V2NA 1CQHA 2N5FA 5F8BA 3UVTA 4MF5A 2WZ9A 2GSTA 2BTOT 1YDKA 2JU5A 2DJKA 1XWAA 1GUHA 4MPGA 1FHEA 2LNSA 2FWFA 3CTFA 4PNGA 1U88A 1K0NA 5ECLB 1O8WA 2EIQA 4POMA 1TRVA 2WGRA 1AQWA 2ZCTA 4USSA 4PTSA 2DKHA 4MF6A 5J9BA 4K8MA 2QGVA 4EL1A 3IC8A 5AGYA 4PURA 3LWAA 1A2MA 1ZZYA 3QR6A 2KOKA 5FWGA 1O85A 2WJUA 2DMLA 1Z5YE 1SKRB 1E2YA 4O5UA 1FOHA 4I97A 3KP9A 2XPDA 1NHOA 2O87A 2VCWA 3L78A 3HJOA 4ZILA 3UEMA 5J9CA 3GL3A 4TRXA 4HZ4A 2Z9SA 3GHAA 1M3JA 4YQVA 2KP1A 3DIEA 2H1AA 1ERUA 2C0GA 3WGXA 2CZ2A 1F2EA 3GTUA 3FKFA 4EVMA 2NDOA 5LNKe 2PMTA 4CY6A 4K1FA 4CW9A 1JHBA 1QK8A 1ZGNA 5A4UA 1NHYA 5J4UA 1ST9A 2B3SA 2O85A 2B5EA 1WJKA 3CXGA 2A2PA 3H1NA 3G9BA 4MZWA 2YNXA 2DKIA 1GLPA 2J23A 3G7YA 3NZNA 3TJKA 4IW9A 5ENUA 6GSVA 1AQXA 3C7MA 2C1YA 3PGTA 1U3IA 4NAXA 3A5WA 5HR0A 1NW2A 5JWOB 2NTOA 3FZAA 2FA8A 3LEFA 5ID2B 4ZIJA 3ERGA 2C0EA 2DJ1A 1YQ1A 2IPAA 1PRXA 3HJMA 2GSSA 4QQ7A 5CRDA 3L9VA 4ZXGA 5H5SA 3ME7A 1B4PA 5D9WA 2FUG2 3FZ4A 3F0IA 1NSWA 1K0OA 2H0GA 2I1UA 4IS0A 1A0RP 3HVSA 4N30A 2YPMA 2R6KA 2IWTA 5H5QA 4ZBBA 2GSQA 3ZLPA 2L6DA 4MNNA 3D22A 1Q4JA 1SD8A 1YJ6A 3F4SA 5F06A 4PXOA 5AIXA 1HYUA 4G0LA 4BL7B 2X64A 3N9JA 1EGRA 2L4QA 3ERFA 4I6XA 2VL9A 5KOXA 4ECCA 1W89A 1EWXA 4KCEA 2C3QA 4MH2A 2IMIA 3UBKA 1EP8A 1F3BA 3GFKA 2LTKA 2KHPA 1WIKA 4HS1A 3VLNA 5FT3A 2PVOC 3QAWA 5GZZB 1SL2B 1GUMA 2YV7A 4MP4A 1O8XA 4K5SA 1UN2A 1R5PA 4LL1B 1ERVA 4KF9A 2R4VA 1PFOA 3M3MA 2ALBA 2K8SA 5G5EA 4MJAA 3A2WA 3F63A 3MIXA 2WULA 3EE2A 4HJ2A 4I2TA 3VPQA 1XWBA 2GQKA 2HYXA 1UA5A 4FO5A 1K0BA 1SU9A 2JZSA 2LJAA 1TDIA 4OFNA 2K9FA 5ID2A 3QFAC 2LJRA 5FHIA 1H75A 5GSSA 3LQ7A 2RIIA 2YJ7A 4EF0A 2MMNA 3FR9A 4JEDA 3RPPA 5LD0A 2WCIA 1K0MA 1URMA 2H72A 2I81A 4K7NA 2RUFA 1JZWA 1K0CA 2HT9A 3TGZA 3FYGA 4GQCA 3EMPA 2YCDA 1Z6MA 3FMWA 1IYIA 5CRWA 1XOAA 1FG4A 4BVYB 4BL7A 3UAPA 3GV1A 2A2SA 4BPYA 1GTUA 4L0WA 1K3OA 2IMFA 2L5LA 2OADA 3KMOA 2H73A 4K2DA 5HFGA 3UARA 1BEDA 2VUPA 1PA3A 3I43A 5CRGA 5B6NA 4EIPA 2XHFA 4L0UA 2H1GA 3ZFBA 5KEJA 4ECIA 4K9ZA 1S3AA 2PPTA 2R0CA 2K6VA 3IHQA 3F6DA 2H1DA 2HSMA 3IOSA 3ZL5A 3TRPA 3BD2A 2YP6A 1V98A 1FB0A 4NXIA 3HVNA 4XS1A 5JWQB 3SBCA 4O92A 12GSA 3BCKA 1THOA 3LSZA 3M9KA 4ML6A 3R2QA 2L5OA 4BWQA 3GMFA 4F2IA 4GSTA 3G7JA 4OCFA 1C72A 5B8BA 3KGKA 1ERTA 1Z3EA 1R4WA 3ED3A 1GSYA 1TXXA 1SK0A 3O76A 3FRCA 4WETA 4IELA 5E59A 5IMFA 2H70A 1OE7A 3CSIA 4RQRA 5A5KA 3GRXA 5JCWA 2WS2A 2B7JA 2VM2A 4BVYA 2FY6A 4NPBA 4KDXA 4PQIA 3HZ8A 9GSSA 1VF4A 6GSYA 3M1GA 4JR6A 1DE2A 2LS5A 3KJYA 3KXOA 5ELGA 3E3EA 3VWWA 2HLSA 1JZOA 2R0GA 4NV2A 2MBTA 4TR3A 4LMVA 6GSUA 1A23A 4TW5A 2RUEA 5G31A 1GP1A 2RM6A 1EOGA 3CSJA 1QGVA 3F3QA 1ABAA 4AJ8A 3HY2A 1E6BA 4FH8A 4NHWA 3DVXA 3F4RA 3HKRA 1OKTA 3QAVA 13GSA 1CQGA 3I69A 4EE0A 1TU8A 3FK8A 4K0NA 5G30A 4CDOA 1K3YA 3UIWA 1H4OA 3DWVA 3CQFA 4HZ2A 5DQSA 1AUCA 6GSXA 5JCUA 3MYDA 2H6ZA 4NMUA 4EO3A 1GLQA 4F9ZA 1GL8A 3DYRA 1TOFA 1Z7PA 3EU3A 1GNWA 5ECRB 3ZYWA 3LG6A 1M2DA 3QMXA 3CMIA 4WKWA 3FR3A 1YEXA 3CYNA 4XCSA 2YWOA 4QL9A 5BRTA 2HZFA 5H5RA 3EYTA 4N0VA 1RQMA 2WRTA 2EIOA 4GF0A 5ECIB 2E0QA 2ZUPA 2HXKA 4N10A 3KH9A 3WT1A 2GZPA 3P90A 2VL3A 1XWKA 1B9XC 1Y25A 1G7OA 2GZZA 2E2MA 5F0GA 5HR2A 2RM5A 1EEMA 3WGEA 2VL2A 4OCEA 4PGTA 6GSSA 3V1WA 2M72A 5EY6A 1R5AA 2N5AA 3Q74A 3ERWA 1AQVA 2DSAA 3W8JA 3GA4A 4IGJA 2XC2A 5LCZA 1EV9A 3D6IA 1GNEA 1V57A 4ML1A 2H8LA 1DSBA 4YKGA 5IPHA 3DD3A 3CTGA 4EDZA 1GTAA 2GVPA 4XS6A 2V6OA 3HXSA 1DE1A 1YF1A 2FD3A 1MDKA 4ZB6A 1XBSA 3VWXA 4PNFA 2K8VA 3EU4A 4HU7A 3TOTA 2L4CA 2AV4A 3ZTLA 2JZTA 5B8AA 5IMDA 1B4QA 1ZMAA 4PQHA 4V2MA 5F05A 1U87A 1PD21 1S3DA 2R5GA 18GSA 2HRKA 4O7HA 3TCOA 1I9DA 4GLTA 4L5OA 2V6KA 3ZIJA 1DUGA 2YWMA 3APOA 3CRTA 4V1Ap 4E8HA 2FWGA 3QCPA 2ES7A 16GSA 1MD4A 4G10A 1XOBA 3Q19A 1U3AA 5ECSA 3QOUA 4XHMA 2D2ZA 3KMNA 4POBA 3L0HA 3DRNA 3IDVA 2F3MA 2C80A 2QA2A 3IC4A 2R0PA 3KTLA 1GSFA 2PGTA 3M0FA 1M3IA 1SJZA 2IIYA 3FR6A 1TU7A 4KH7A 5COHA 1WWJA 5CAXA 2QC7A 4QL7A 4BVXB 1SL1B 4MABA 4N11A 4GXZA 3GURA 5AIVA 2LEGA 2A4HA 2DBCA 2RLIA 2H76A 4JU5A 2MMOA 1F3AA 1GUKA 1SJIA 1G6YA 3APSA 2LV3A 2FGXA 2CAQA 3IA1A 5HQPA 5J3RA 4ZBDA 1UC7A 2JZRA 4LL4B 1O7UA 1T4YA 1R26A 1VRSD 1K0AA 3KZQA 1LBKA 2OKAA 3KIJA 3NOFA 3UBLA 1ZYNA 2TRXA 1G0TA 5D96A 3UJ1A 5ELAA 3WD6A 1EEJA 4KDUA 5IM9A 2GTUA 4Q5NA 2YOIA 1QXHA 4MZBA 4TR0A 1W4VA 2CVBA 3WGDA 2B5XA 2HE3A 3TKRA 2REMA 3PPUA 1T4ZA 1B8XA 4F0BA 4GTUA 4X0XA 3GYKA 1Z6NA 1FVJA 3BOAA 4H86A 2K18A 3ZZXA 4RUVA 3TKQA 4XS4B 3O3TA 6GSTA 5IIZA 3I9V2 2GT5A 3IAM2 2GS3A 2VCVA 4AGSA 3BBYA 3TUEA 3Q6OA 1OC3A 4FYBA 4BIKA 2DJ2A 4MJBA 2XBIA 3FHKA 1TI3A 5IMZA 1X9WB 3G7IA 4BVXA 3GKKA 1XIYA 4GSNA 5ECNB 5ABRA 4ZB8A 3K8NA 4F03A 3D4MA 3HVXA 4IJ3A 4Z7XA 1XG8A 2PERA 3TKSC 1AAZA 2X8CA 1A2LA 4TOPA 2CV4A 3M8NA 1FO5A 2LNTA 2G2QA 2JADA 3ME8A 1QFNA 1LU4A 4HJMA 2P5RA 1OYJA 1HNBA 3MAKA 3D4TA 4FYUA 1VF3A 2XPEA 1EGOA 2JL4A 5DCGA 3WYWA 4FIWA 4RQXA 3TKPA 3APQA 2AYTA 4K7IA 3NIVA 2B6MA 3VURA 1J9BA 3CRUA 3EURA 5D93A 1Z9HA 3GX8A 2M46A 2QKEA 14GSA 3F8UA 3IXRA 3JCML 3CSHA 2OE3A 3QPMA 5F07A 1QMVA 4TXOB 3TJFA 3S9FA 4NHZA 10GSA 4EIQA 2C3NA 3EC3A 4HSCX 2VD1A 3N5OA 4ULXA 4OFMA 1JLVA 1GTIA 2WFCA 4X4JA 1XFLA 2OE0A 4XS4A 3LYKA 1GWCA 1TI1A 2F8AA 2CQ9A 5CREA 4BWSA 4GSSA 1M2BA 2KP2A 3U6VA 1ZYPA 5DJMA 2M80A 5A4WA 4GRFA 2CAIA 2YANA 2ON7A 3D21A 4GQFA 2R37A 1F9MA 3GKXA 1A8YA 3H4KA 2J9HA 3HJPA 4ECJA 3UOMA 4HDEA 2HSYA 3ZITA 4Z2RA 3LXZA 4I5QA 4OMVA 4EC0A 3ZVJD 1KTEA 4MJEA 4IQAA 2VL2C 2TRCP 4DSSB 4PQ1A 4DSQA 1U6TA 3A5IA 3IR4A 3MDKA 3C8EA 3QAGA 1GSDA 5CP1A 2KLXA 4F0CA 3HCZA 1ZYEA 2VLUA 5DALB 1YKCA 4TXOA 3FEUA 1X5EA 4IVFA 3UMAA 4OO5A 1X9MB 2PVQA 3KD0A 2H0IA 2H75A 2YZHA 3MNGA 5D9XA 2GSRA 5B6MA 4J56E 2AB6A 2C4JA 4Q5FA 3TJJA 4DEJA 5HFKA 1T00A 3BJ5A 3TKSA 2HSHA 1V58A 1HD2A 4K0GA 1OE8A 2O8VB 3ZVJA 4KE3A 5IQYA 2C8UA 5DCHA 4BA7A 1PX6A 3FY7A 5DBQA 1G6WA 1UVZA 1TK8B 1OC8A 1SENA 2BJXA 4OFTA 4TKYA 4X43A 1EZKA 1A0FA 1USBA 2N5BA 3C71A 2FCHA 1JZRA 1SKWB 2YWIA 2CA8A 1ZL9A 5ECKB 4G0IA 4K7OA 3PH9A 4G9HA 4HUAA 5EPFA 4DSSA 4KSMA 4PX1A 4O32A 2X99A 1TJDA 2QA1A 4YAPA 1T1VA 1V9WA 4JE1A 3ZRDA 2MBSA 6GSWA 1GSSA 3IRAA 4D73B 1XPVA 4MK3A 4XRAA 5GAPD 4MJCA 1O73A 4MPFA 3DMLA 1MD3A 5DALA 2I3YA 3RHBA 3ZFLA 2DJ0A 5L71A 1DBYA 4A5PA 1K3LA 3HD5A 4V1Ag 5G1KA 2L57A 4P3YB 3DKSA 2E2GA 1HNAA 2IMEA 4MCUA 2CX3A 4ECBA 4IKHA 1PGTA 1TK5B 2DJ3A 3LGCA 4KAEA 3HDCA 1PL1A 4KNDA 3TJBA 3DXBA 2HRFA 1PN9A 1WP0A 1VGLA 1GSQA 5HR3A 4KCAA 3ZREA 3HVVA 1TP9A 2JSYA 4IQ1A 2H6XA 3TKSE 8GSSA 1T7PB 3RHCA 5C04A 2DIYA 2O7KA 1HQOA 3HHVA 2NBSA 3ZIVA 1KNGA 2GLRA 4WF4A 1YZXA 1XW9A 1SYXA 3P7XA 1ERWA 4ACSA 1LJRA 22GSA 2YJHA 4WF5A 4J57E 4DVCA 3KCMA 5KN3A 4XIHA 1Q98A 5KOWA 4V2LA 2NPBA 1AIUA 1F6MC 3HZ4A 2HFDA 4N0ZA 1YF0A 3LORA 4D73A 1R7HA 1WOUA 11GSA 1XWCA 2JACA 5DDLA 3H8QA 4O5RA 2CX4A 1V2AA 3GX0A 3C1SA 3LJRA 3J7Yb 4I2UA 1XZOA 2LUSA 4CHSA 3RPNA 2DJJA 2YWNA 2P31A 1TW9A 3A3TA 4TR1B 4Q5QA 1GSUA 2B1KA 4WXTA 1T8EB 2IFQB 2AJQB 3RDWA 2GZYA 2OACA 2DMMA 2IJYA 3GH6A 2KUCA 2ZNMA 4IN0A 3C73A 3FZ9A 4GCIA 3F4TA 4K6XA 4L5LA 4WR5A 1SJ6A 1SK1A 3H79A 1WPIA 1XXUA 3L9UA 4LMWA 4ZL9A 2MZCA 2LRTA 5ECMB 4JRRA 2FHEA 2PUKC 3GIXA 2FWEA 2VD0A 3VK9A 4AJ6A 2B7KA 1S3CA 1GULA 1MEKA 3IV4A 1THXA 4WEYA 7GSSA 4WR4A 1FW1A 3KM6A 1M9AA 3HYPA 2OE1A 19GSA 1ZYQB 2VCXA 1GSEA 2FNOA 4ID0A 3A2VA 1MTCA 2X4AA 1F37A 1XW6A 1YEPA 2MMZA 2R2JA 3GL5A 3GSSA 5HR1A 2C0FA 2GGTA 2NVLA 3KTBA 1OC9B 3Q18A 4EXJA 1ZCPA 3EWLA 3IK9A 5IMVA 5D9TA 1X5CA 1YKAA 5EL8A 3C1RA 2YV9A 2DLXA 3H93A 4TR1A 2G0FA 1AXDA 4HU9A 2IFQA 3SWLA 1SYRA 1A24A 2F9SA 3GH9A 1ACVA 3DGQA 4L8EA 1BG5A 3E0UA 1GH2A 1SK2A 1GRXA 4IP1A 1XCCA 3IK7A 20GSA 5IMAA 2PWJA 1X5DA 3W6GA 4YKFA 3J7Yk 3LYPA 2PBJA 2LQQA 3O6TA 4KGIA 2LKUA 4ICYA 2MMAA 3UVHA 1WE0A 4MF7A 4HQSA 1Y6EA 4KX4A 1WMJA 3IBHA 1RK4A 4Z2UA 3GKMA 5IOWA 5IO2A 3L9SA 2JSZA 1EP7A 5IMCA 1PQNA 2LSTA 4MZCA 1PL2A 3R3EA 3DEXA 3W8SA 5IPGA 5B7CA 3TRQA 4MMMA 3TDGA 5DQYA 5GSTA 3IE3A 3QDNA 4ILFA 5KN1A 3DVWA 3TB2A 4ISDA 4WBJA 3GNJA 2PU9C 3VI7A 1OC9A 2H01A 2A2RA 4E8EA 4YAVA 1K0DA 4NV5A 1TKDB 3LW9A 2H0HA 4FYCA 3QFBC 2GDRA 4K5RA 1TRSA 1FB6A 2H66A 5D8IA 4IJIA 4HOJA 1T3BA 2VO4A 4POKA 4KW6A 5G1LA 5JCGA 1FAAA 3KH7A 4AF2A 1J08A 4YQUA 1M9BA 4AJ7A 2HNLA 4RI7A 4EKZA 1XW5A 2F51A 2FWHA 2C3TA 3VWVA 3E9JB 1TK0B 1AC1A 1TRUA 3F9UA 2HRNA 1N2AA 1PKWA 5JWRB 3VFIA 3F3RA 2DIZA 2VAFA 1SL0B 2QSIA 3FZ5A 5DAKB 4K2XA 1M0UA 2O89A 1QUWA 4ZL8A 1X9SB 3RBTA 4TXVA 1J0FA 3P8WA 2H30A 1KEBA 2B1LA 3EINA 5KN2A 2E7PA 3VWUA 2P0GA 2H1BA 1HNCA 1TRWA 1JLWA 5AISA 2FLSA 1JFUA 5CYYA 4MDCA 4KA0A 4MLYA 3PINA 4OWYA 5D73A 2DC5A 3I6AA 2VOCA 2YZUA 5D9VA 3D0ZA 3QD9A 2VLTA 1KBNA 2LQOA 1M2AA 4DSRA 4JR4A 4POLA 2F8FA 2CVDA 3IPZA 4G2EA 1BAYA 5ECOB 1B9YC 3LFLA 2MYGA 3TJGA 4HI7A 2L6CA 1SKSB 1XWGA 2H19A 2IN3A 2IL3A 3LXTA 3EPTA 4GWRA 4XTSA 2ON5A 4ZBAA 4XRDA 2EIRA 2V41A 1ML6A 3EVIA 3D5JA 3AY8A 2R3XA 4TVEA 1XVWA 4OD7A 1I5GA 3CBUA 3M9JA 4EUYA 2X49A 5ECQB 2CT6A 2V32A 3OR5A 2UZ8A 4KSOA 1RW1A 4JZQA 1VF2A 4Q5RA 1QQ2A 2LRNA 4KDYA 3BCIA 2VLVA 5G2ZA 5INYA 1PSQA 2HRAA 4JBBA 4IBPA 1V40A 4G0KA 1BJXA 2GQLA 1O81A 2C0DA 1YY7A 5DAKA 3VPTA 2AAWA 4FQUA 1X0RA 3GKNA 5KN0A 3UL3A 1ON4A 1XVQA 4WBRD 2OBKA 1Z7RA 4IHUA 3MWHA 2B5YA 2CVKA 2A4VA
chains in the Genus database with same CATH topology
1PKZA 3VI5A 5IO0A 4KB3A 1FVKA 1GTBA 4PUFC 2VIMA 2X8HA 1M7TA 5ECHB 2OA7A 2WB9A 2OBIA 2I4AA 4CY8A 4KUNA 1MDJA 1PN0A 3GUSA 2VCZA 3FW2A 4Z2TA 1G7EA 3PR8A 5DJLA 4TR4A 2OJLA 4I8BA 2X8GA 3GSTA 5CNWA 1OVNA 1TTZA 2BMXA 3KEBA 4EDYA 3EMXA 3A2XA 5EVOA 1N8JA 5E4WA 5DVBA 2WDUA 1ZOFA 1O6JA 1OKDA 17GSA 2V1MA 2LJKA 3HA9A 4G19A 4YQMA 2YN1A 5J5NA 3WT2A 1VF1A 3ZMLA 4ZL7A 3KP8A 4MA9A 1ILOA 4YH2A 5CO3A 2VCQA 1OAZA 2H71A 2HZEB 4X1UA 1PMTA 5AN1A 1AW9A 4LA1A 2IMDA 4F82A 1EV4A 1A8LA 3P2AA 1BYEA 3IAS2 3ISOA 3L4NA 1M99A 5GAND 2GQMA 1A2JA 2HI7A 2LRCA 2I9HA 2CZ3A 5G5FA 2XBQA 4HQZA 4OO4A 3US3A 2H6YA 4O5QA 2AHEA 2AUVA 2VM1A 3TOUA 4HEA2 1FOVA 1NM3A 2L59A 4TN8A 1SD9A 1MDIA 1EOHA 2EC4A 1IYHA 3TRXA 3ZMKA 5C00A 3GN3A 4MH3A 5A4VA 4PUAA 4LLRA 5CRHA 4J2FA 1JZDA 1B48A 2IMKA 3IHGA 4ZB9A 4IP6A 2PN8A 4NWYA 1BX9A 5HFIA 1PX7A 3MSZA 3GTUB 3F6FA 4RI6A 2TIRA 2V2GA 5J41A 1BQ7A 2FA4A 2P5QA 1WRYA 2H74A 2VCTA 3RAZA 2GT6A 5BMUA 5ECPB 3U5RE 5IOXA 2HZEA 4V2NA 1CQHA 2N5FA 5F8BA 3UVTA 4MF5A 2WZ9A 2GSTA 2BTOT 1YDKA 2JU5A 2DJKA 1XWAA 1GUHA 4MPGA 1FHEA 2LNSA 2FWFA 3CTFA 4PNGA 1U88A 1K0NA 5ECLB 1O8WA 2EIQA 4POMA 1TRVA 2WGRA 1AQWA 2ZCTA 4USSA 4PTSA 2DKHA 4MF6A 5J9BA 4K8MA 2QGVA 4EL1A 3IC8A 5AGYA 4PURA 3LWAA 1A2MA 1ZZYA 3QR6A 2KOKA 5FWGA 1O85A 2WJUA 2DMLA 1Z5YE 1SKRB 1E2YA 4O5UA 1FOHA 4I97A 3KP9A 2XPDA 1NHOA 2O87A 2VCWA 3L78A 3HJOA 4ZILA 3UEMA 5J9CA 3GL3A 4TRXA 4HZ4A 2Z9SA 3GHAA 4YQVA 2KP1A 3DIEA 2H1AA 1ERUA 2C0GA 3WGXA 2CZ2A 1F2EA 3GTUA 3FKFA 4EVMA 2NDOA 5LNKe 2PMTA 4CY6A 4K1FA 4CW9A 1JHBA 1QK8A 1ZGNA 5A4UA 1NHYA 5J4UA 1ST9A 2B3SA 2O85A 2B5EA 1WJKA 3CXGA 2A2PA 3H1NA 3G9BA 4MZWA 2YNXA 2DKIA 1GLPA 2J23A 3G7YA 3NZNA 3TJKA 4IW9A 5ENUA 6GSVA 1AQXA 3C7MA 2C1YA 3PGTA 1U3IA 4NAXA 3A5WA 5HR0A 1NW2A 5JWOB 2NTOA 3FZAA 2FA8A 3LEFA 5ID2B 4ZIJA 3ERGA 2C0EA 2DJ1A 1YQ1A 2IPAA 1PRXA 3HJMA 2GSSA 4QQ7A 5CRDA 3L9VA 4ZXGA 5H5SA 3ME7A 1B4PA 5D9WA 2FUG2 3FZ4A 3F0IA 1NSWA 1K0OA 2H0GA 2I1UA 4IS0A 1A0RP 3HVSA 4N30A 2YPMA 2R6KA 2IWTA 5H5QA 4ZBBA 2GSQA 3ZLPA 2L6DA 4MNNA 3D22A 1Q4JA 1SD8A 1YJ6A 3F4SA 5F06A 4PXOA 5AIXA 1HYUA 4G0LA 4BL7B 2X64A 3N9JA 1EGRA 2L4QA 3ERFA 4I6XA 2VL9A 5KOXA 4ECCA 1W89A 1EWXA 4KCEA 2C3QA 4MH2A 2IMIA 3UBKA 1EP8A 1F3BA 3GFKA 2LTKA 2KHPA 1WIKA 4HS1A 3VLNA 5FT3A 2PVOC 3QAWA 5GZZB 1SL2B 1GUMA 2YV7A 4MP4A 1O8XA 4K5SA 1UN2A 1R5PA 4LL1B 1ERVA 4KF9A 2R4VA 3M3MA 2ALBA 2K8SA 5G5EA 4MJAA 3A2WA 3F63A 3MIXA 2WULA 3EE2A 4HJ2A 4I2TA 3VPQA 1XWBA 2GQKA 2HYXA 1UA5A 4FO5A 1K0BA 1SU9A 2JZSA 2LJAA 1TDIA 4OFNA 2K9FA 5ID2A 3QFAC 2LJRA 5FHIA 1H75A 5GSSA 3LQ7A 2RIIA 2YJ7A 4EF0A 2MMNA 3FR9A 4JEDA 3RPPA 5LD0A 2WCIA 1K0MA 1URMA 2H72A 2I81A 4K7NA 2RUFA 1JZWA 1K0CA 2HT9A 3TGZA 3FYGA 4GQCA 3EMPA 2YCDA 1Z6MA 3FMWA 1IYIA 5CRWA 1XOAA 1FG4A 4BVYB 4BL7A 3UAPA 3GV1A 2A2SA 4BPYA 1GTUA 4L0WA 1K3OA 2IMFA 2L5LA 2OADA 3KMOA 2H73A 4K2DA 5HFGA 3UARA 1BEDA 2VUPA 1PA3A 3I43A 5CRGA 5B6NA 4EIPA 2XHFA 4L0UA 2H1GA 3ZFBA 5KEJA 4ECIA 4K9ZA 1S3AA 2PPTA 2R0CA 2K6VA 3IHQA 3F6DA 2H1DA 2HSMA 3IOSA 3ZL5A 3TRPA 3BD2A 2YP6A 1V98A 1FB0A 4NXIA 4XS1A 5JWQB 3SBCA 4O92A 12GSA 3BCKA 1THOA 3LSZA 3M9KA 4ML6A 3R2QA 2L5OA 4BWQA 3GMFA 4F2IA 4GSTA 3G7JA 4OCFA 1C72A 5B8BA 3KGKA 1ERTA 1Z3EA 1R4WA 3ED3A 1GSYA 1TXXA 1SK0A 3O76A 3FRCA 4WETA 4IELA 5E59A 5IMFA 2H70A 1OE7A 3CSIA 4RQRA 5A5KA 3GRXA 5JCWA 2WS2A 2B7JA 2VM2A 4BVYA 2FY6A 4NPBA 4KDXA 4PQIA 3HZ8A 9GSSA 1VF4A 6GSYA 3M1GA 4JR6A 1DE2A 2LS5A 3KJYA 3KXOA 5ELGA 3E3EA 3VWWA 2HLSA 1JZOA 2R0GA 4NV2A 2MBTA 4TR3A 4LMVA 6GSUA 1A23A 4TW5A 2RUEA 5G31A 1GP1A 2RM6A 1EOGA 3CSJA 1QGVA 3F3QA 1ABAA 4AJ8A 3HY2A 1E6BA 4FH8A 4NHWA 3DVXA 3F4RA 3HKRA 1OKTA 3QAVA 13GSA 1CQGA 3I69A 4EE0A 1TU8A 3FK8A 4K0NA 5G30A 4CDOA 1K3YA 3UIWA 1H4OA 3DWVA 4HZ2A 5DQSA 1AUCA 6GSXA 5JCUA 3MYDA 2H6ZA 4NMUA 4EO3A 1GLQA 4F9ZA 1GL8A 3DYRA 1TOFA 1Z7PA 3EU3A 1GNWA 5ECRB 3ZYWA 3LG6A 1M2DA 3QMXA 3CMIA 4WKWA 3FR3A 1YEXA 3CYNA 4XCSA 2YWOA 4QL9A 5BRTA 2HZFA 5H5RA 3EYTA 4N0VA 1RQMA 2WRTA 2EIOA 4GF0A 5ECIB 2E0QA 2ZUPA 2HXKA 4N10A 3KH9A 3WT1A 2GZPA 3P90A 2VL3A 1XWKA 1B9XC 1Y25A 1G7OA 2GZZA 2E2MA 5F0GA 5HR2A 2RM5A 1EEMA 3WGEA 2VL2A 4OCEA 4PGTA 6GSSA 3V1WA 2M72A 5EY6A 1R5AA 2N5AA 3Q74A 3ERWA 1AQVA 2DSAA 3W8JA 3GA4A 4IGJA 2XC2A 5LCZA 1EV9A 3D6IA 1GNEA 1V57A 4ML1A 2H8LA 1DSBA 4YKGA 5IPHA 3DD3A 3CTGA 4EDZA 1GTAA 2GVPA 4XS6A 2V6OA 3HXSA 1DE1A 1YF1A 2FD3A 1MDKA 4ZB6A 1XBSA 3VWXA 4PNFA 2K8VA 3EU4A 4HU7A 3TOTA 2L4CA 2AV4A 3ZTLA 2JZTA 5B8AA 5IMDA 1B4QA 1ZMAA 4PQHA 4V2MA 5F05A 1U87A 1PD21 1S3DA 2R5GA 18GSA 2HRKA 4O7HA 3TCOA 1I9DA 4GLTA 4L5OA 2V6KA 3ZIJA 1DUGA 2YWMA 3APOA 3CRTA 4V1Ap 4E8HA 2FWGA 3QCPA 2ES7A 16GSA 1MD4A 4G10A 1XOBA 3Q19A 1U3AA 5ECSA 3QOUA 4XHMA 2D2ZA 3KMNA 4POBA 3L0HA 3DRNA 3IDVA 2F3MA 2C80A 2QA2A 3IC4A 2R0PA 3KTLA 1GSFA 2PGTA 3M0FA 1SJZA 2IIYA 3FR6A 1TU7A 4KH7A 5COHA 1WWJA 5CAXA 2QC7A 4QL7A 4BVXB 1SL1B 4MABA 4N11A 4GXZA 3GURA 5AIVA 2LEGA 2A4HA 2DBCA 2RLIA 2H76A 4JU5A 2MMOA 1F3AA 1GUKA 1SJIA 1G6YA 3APSA 2LV3A 2FGXA 2CAQA 3IA1A 5HQPA 5J3RA 4ZBDA 1UC7A 2JZRA 4LL4B 1O7UA 1T4YA 1R26A 1VRSD 1K0AA 3KZQA 1LBKA 2OKAA 3KIJA 3NOFA 3UBLA 1ZYNA 2TRXA 1G0TA 5D96A 3UJ1A 5ELAA 3WD6A 1EEJA 4KDUA 5IM9A 2GTUA 4Q5NA 2YOIA 1QXHA 4MZBA 4TR0A 1W4VA 2CVBA 3WGDA 2B5XA 2HE3A 3TKRA 2REMA 3PPUA 1T4ZA 1B8XA 4F0BA 4GTUA 4X0XA 3GYKA 1Z6NA 1FVJA 3BOAA 4H86A 2K18A 3ZZXA 4RUVA 3TKQA 4XS4B 3O3TA 6GSTA 5IIZA 3I9V2 2GT5A 3IAM2 2GS3A 2VCVA 4AGSA 3BBYA 3TUEA 3Q6OA 1OC3A 4FYBA 2DJ2A 4MJBA 2XBIA 3FHKA 1TI3A 5IMZA 1X9WB 3G7IA 4BVXA 3GKKA 1XIYA 4GSNA 5ECNB 5ABRA 4ZB8A 3K8NA 4F03A 3D4MA 3HVXA 4IJ3A 4Z7XA 2PERA 3TKSC 1AAZA 2X8CA 1A2LA 4TOPA 2CV4A 3M8NA 1FO5A 2LNTA 2G2QA 2JADA 3ME8A 1QFNA 1LU4A 4HJMA 2P5RA 1OYJA 1HNBA 3MAKA 3D4TA 4FYUA 1VF3A 2XPEA 1EGOA 2JL4A 5DCGA 3WYWA 4FIWA 4RQXA 3TKPA 3APQA 2AYTA 4K7IA 3NIVA 2B6MA 3VURA 1J9BA 3CRUA 3EURA 5D93A 1Z9HA 3GX8A 2M46A 2QKEA 14GSA 3F8UA 3IXRA 3JCML 3CSHA 2OE3A 3QPMA 5F07A 1QMVA 4TXOB 3TJFA 3S9FA 4NHZA 10GSA 4EIQA 2C3NA 3EC3A 2VD1A 3N5OA 4ULXA 4OFMA 1JLVA 1GTIA 2WFCA 4X4JA 1XFLA 2OE0A 4XS4A 3LYKA 1GWCA 1TI1A 2F8AA 2CQ9A 5CREA 4BWSA 4GSSA 1M2BA 2KP2A 3U6VA 1ZYPA 5DJMA 2M80A 5A4WA 4GRFA 2CAIA 2YANA 2ON7A 3D21A 4GQFA 2R37A 1F9MA 3GKXA 1A8YA 3H4KA 2J9HA 3HJPA 4ECJA 3UOMA 4HDEA 2HSYA 3ZITA 4Z2RA 3LXZA 4I5QA 4OMVA 4EC0A 3ZVJD 1KTEA 4MJEA 4IQAA 2VL2C 2TRCP 4DSSB 4PQ1A 4DSQA 1U6TA 3A5IA 3IR4A 3MDKA 3C8EA 3QAGA 1GSDA 5CP1A 2KLXA 4F0CA 3HCZA 1ZYEA 2VLUA 5DALB 1YKCA 4TXOA 3FEUA 1X5EA 4IVFA 3UMAA 4OO5A 1X9MB 2PVQA 3KD0A 2H0IA 2H75A 2YZHA 3MNGA 5D9XA 2GSRA 5B6MA 4J56E 2AB6A 2C4JA 4Q5FA 3TJJA 4DEJA 5HFKA 1T00A 3BJ5A 3TKSA 2HSHA 1V58A 1HD2A 4K0GA 1OE8A 2O8VB 3ZVJA 4KE3A 5IQYA 2C8UA 5DCHA 4BA7A 1PX6A 3FY7A 5DBQA 1G6WA 1UVZA 1TK8B 1OC8A 1SENA 2BJXA 4OFTA 4TKYA 4X43A 1EZKA 1A0FA 1USBA 2N5BA 3C71A 2FCHA 1JZRA 1SKWB 2YWIA 2CA8A 1ZL9A 5ECKB 4G0IA 4K7OA 3PH9A 4G9HA 4HUAA 5EPFA 4DSSA 4KSMA 4PX1A 4O32A 2X99A 1TJDA 2QA1A 4YAPA 1T1VA 1V9WA 4JE1A 3ZRDA 2MBSA 6GSWA 1GSSA 3IRAA 4D73B 1XPVA 4MK3A 4XRAA 5GAPD 4MJCA 1O73A 4MPFA 3DMLA 1MD3A 5DALA 2I3YA 3RHBA 3ZFLA 2DJ0A 5L71A 1DBYA 4A5PA 1K3LA 3HD5A 4V1Ag 5G1KA 2L57A 4P3YB 3DKSA 2E2GA 1HNAA 2IMEA 4MCUA 2CX3A 4ECBA 4IKHA 1PGTA 1TK5B 2DJ3A 3LGCA 4KAEA 3HDCA 1PL1A 4KNDA 3TJBA 3DXBA 2HRFA 1PN9A 1WP0A 1VGLA 1GSQA 5HR3A 4KCAA 3ZREA 3HVVA 1TP9A 2JSYA 4IQ1A 2H6XA 3TKSE 8GSSA 1T7PB 3RHCA 5C04A 2DIYA 2O7KA 1HQOA 3HHVA 2NBSA 3ZIVA 1KNGA 2GLRA 4WF4A 1YZXA 1XW9A 1SYXA 3P7XA 1ERWA 4ACSA 1LJRA 22GSA 2YJHA 4WF5A 4J57E 4DVCA 3KCMA 5KN3A 4XIHA 1Q98A 5KOWA 4V2LA 2NPBA 1AIUA 1F6MC 3HZ4A 2HFDA 4N0ZA 1YF0A 3LORA 4D73A 1R7HA 1WOUA 11GSA 1XWCA 2JACA 5DDLA 3H8QA 4O5RA 2CX4A 1V2AA 3GX0A 3C1SA 3LJRA 3J7Yb 4I2UA 1XZOA 2LUSA 4CHSA 3RPNA 2DJJA 2YWNA 2P31A 1TW9A 3A3TA 4TR1B 4Q5QA 1GSUA 2B1KA 4WXTA 1T8EB 2IFQB 2AJQB 3RDWA 2GZYA 2OACA 2DMMA 2IJYA 3GH6A 2KUCA 2ZNMA 4IN0A 3C73A 3FZ9A 4GCIA 3F4TA 4K6XA 4L5LA 4WR5A 1SJ6A 1SK1A 3H79A 1WPIA 1XXUA 3L9UA 4LMWA 4ZL9A 2MZCA 2LRTA 5ECMB 4JRRA 2FHEA 2PUKC 3GIXA 2FWEA 2VD0A 3VK9A 4AJ6A 2B7KA 1S3CA 1GULA 1MEKA 3IV4A 1THXA 4WEYA 7GSSA 4WR4A 1FW1A 3KM6A 1M9AA 3HYPA 2OE1A 19GSA 1ZYQB 2VCXA 1GSEA 2FNOA 4ID0A 3A2VA 1MTCA 2X4AA 1F37A 1XW6A 1YEPA 2MMZA 2R2JA 3GL5A 3GSSA 5HR1A 2C0FA 2GGTA 2NVLA 3KTBA 1OC9B 3Q18A 4EXJA 1ZCPA 3EWLA 3IK9A 5IMVA 5D9TA 1X5CA 1YKAA 5EL8A 3C1RA 2YV9A 2DLXA 3H93A 4TR1A 2G0FA 1AXDA 4HU9A 2IFQA 3SWLA 1SYRA 1A24A 2F9SA 3GH9A 1ACVA 3DGQA 4L8EA 1BG5A 3E0UA 1GH2A 1SK2A 1GRXA 4IP1A 1XCCA 3IK7A 20GSA 5IMAA 2PWJA 1X5DA 3W6GA 4YKFA 3J7Yk 3LYPA 2PBJA 2LQQA 3O6TA 4KGIA 2LKUA 4ICYA 2MMAA 3UVHA 1WE0A 4MF7A 4HQSA 1Y6EA 4KX4A 1WMJA 3IBHA 1RK4A 4Z2UA 3GKMA 5IOWA 5IO2A 3L9SA 2JSZA 1EP7A 5IMCA 1PQNA 2LSTA 4MZCA 1PL2A 3R3EA 3DEXA 3W8SA 5IPGA 5B7CA 3TRQA 4MMMA 3TDGA 5DQYA 5GSTA 3IE3A 3QDNA 4ILFA 5KN1A 3DVWA 3TB2A 4ISDA 4WBJA 3GNJA 2PU9C 3VI7A 1OC9A 2H01A 2A2RA 4E8EA 4YAVA 1K0DA 4NV5A 1TKDB 3LW9A 2H0HA 4FYCA 3QFBC 2GDRA 4K5RA 1TRSA 1FB6A 2H66A 5D8IA 4IJIA 4HOJA 1T3BA 2VO4A 4POKA 4KW6A 5G1LA 5JCGA 1FAAA 3KH7A 4AF2A 1J08A 4YQUA 1M9BA 4AJ7A 2HNLA 4RI7A 4EKZA 1XW5A 2F51A 2FWHA 2C3TA 3VWVA 3E9JB 1TK0B 1AC1A 1TRUA 3F9UA 2HRNA 1N2AA 1PKWA 5JWRB 3VFIA 3F3RA 2DIZA 2VAFA 1SL0B 2QSIA 3FZ5A 5DAKB 4K2XA 1M0UA 2O89A 1QUWA 4ZL8A 1X9SB 3RBTA 4TXVA 1J0FA 3P8WA 2H30A 1KEBA 2B1LA 3EINA 5KN2A 2E7PA 3VWUA 2P0GA 2H1BA 1HNCA 1TRWA 1JLWA 5AISA 2FLSA 1JFUA 5CYYA 4MDCA 4KA0A 4MLYA 3PINA 4OWYA 5D73A 2DC5A 3I6AA 2VOCA 2YZUA 5D9VA 3D0ZA 3QD9A 2VLTA 1KBNA 2LQOA 1M2AA 4DSRA 4JR4A 4POLA 2F8FA 2CVDA 3IPZA 4G2EA 1BAYA 5ECOB 1B9YC 3LFLA 2MYGA 3TJGA 4HI7A 2L6CA 1SKSB 1XWGA 2H19A 2IN3A 2IL3A 3LXTA 3EPTA 4GWRA 4XTSA 2ON5A 4ZBAA 4XRDA 2EIRA 2V41A 1ML6A 3EVIA 3D5JA 3AY8A 2R3XA 4TVEA 1XVWA 4OD7A 1I5GA 3CBUA 3M9JA 4EUYA 2X49A 5ECQB 2CT6A 2V32A 3OR5A 2UZ8A 4KSOA 1RW1A 4JZQA 1VF2A 4Q5RA 1QQ2A 2LRNA 4KDYA 3BCIA 2VLVA 5G2ZA 5INYA 1PSQA 2HRAA 4JBBA 4IBPA 1V40A 4G0KA 1BJXA 2GQLA 1O81A 2C0DA 1YY7A 5DAKA 3VPTA 2AAWA 4FQUA 1X0RA 3GKNA 5KN0A 3UL3A 1ON4A 1XVQA 4WBRD 2OBKA 1Z7RA 4IHUA 3MWHA 2B5YA 2CVKA 2A4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PKZ A;  3VI5 A;  5IO0 A;  4KB3 A;  1FVK A;  1GTB A;  4PUF C;  2VIM A;  2X8H A;  1M7T A;  5ECH B;  2OA7 A;  2WB9 A;  2OBI A;  2I4A A;  4KUN A;  1MDJ A;  3GUS A;  2VCZ A;  3FW2 A;  1G7E A;  3PR8 A;  5DJL A;  4TR4 A;  2OJL A;  4I8B A;  2X8G A;  3GST A;  5CNW A;  1OVN A;  1TTZ A;  2BMX A;  3KEB A;  4EDY A;  3EMX A;  3A2X A;  5EVO A;  1N8J A;  5E4W A;  5DVB A;  2WDU A;  1ZOF A;  1O6J A;  1OKD A;  17GS A;  2V1M A;  2LJK A;  3HA9 A;  4G19 A;  4YQM A;  2YN1 A;  5J5N A;  3WT2 A;  1VF1 A;  3ZML A;  4ZL7 A;  3KP8 A;  4MA9 A;  1ILO A;  4YH2 A;  5CO3 A;  2VCQ A;  1OAZ A;  2H71 A;  2HZE B;  4X1U A;  1PMT A;  5AN1 A;  1AW9 A;  4LA1 A;  2IMD A;  4F82 A;  1EV4 A;  1A8L A;  3P2A A;  1BYE A;  3IAS 2;  3ISO A;  3L4N A;  1M99 A;  5GAN D;  2GQM A;  1A2J A;  2HI7 A;  2LRC A;  2I9H A;  2CZ3 A;  5G5F A;  2XBQ A;  4HQZ A;  4OO4 A;  3US3 A;  2H6Y A;  2AHE A;  2AUV A;  2VM1 A;  3TOU A;  4HEA 2;  1FOV A;  1NM3 A;  2L59 A;  4TN8 A;  1SD9 A;  1MDI A;  1EOH A;  2EC4 A;  1IYH A;  3TRX A;  3ZMK A;  5C00 A;  3GN3 A;  4MH3 A;  5A4V A;  4PUA A;  4LLR A;  5CRH A;  4J2F A;  1JZD A;  1B48 A;  2IMK A;  4ZB9 A;  4IP6 A;  2PN8 A;  4NWY A;  1BX9 A;  5HFI A;  1PX7 A;  3MSZ A;  3GTU B;  3F6F A;  4RI6 A;  2TIR A;  2V2G A;  5J41 A;  1BQ7 A;  2FA4 A;  2P5Q A;  1WRY A;  2H74 A;  2VCT A;  3RAZ A;  2GT6 A;  5ECP B;  3U5R E;  5IOX A;  2HZE A;  4V2N A;  1CQH A;  2N5F A;  5F8B A;  3UVT A;  4MF5 A;  2WZ9 A;  2GST A;  2BTO T;  1YDK A;  2JU5 A;  2DJK A;  1XWA A;  1GUH A;  4MPG A;  1FHE A;  2LNS A;  2FWF A;  3CTF A;  4PNG A;  1U88 A;  1K0N A;  5ECL B;  1O8W A;  2EIQ A;  4POM A;  1TRV A;  2WGR A;  1AQW A;  2ZCT A;  4MF6 A;  5J9B A;  4K8M A;  2QGV A;  4EL1 A;  5AGY A;  4PUR A;  3LWA A;  1A2M A;  1ZZY A;  3QR6 A;  2KOK A;  5FWG A;  1O85 A;  2WJU A;  2DML A;  1Z5Y E;  1SKR B;  1E2Y A;  4I97 A;  3KP9 A;  2XPD A;  1NHO A;  2O87 A;  2VCW A;  3L78 A;  3HJO A;  4ZIL A;  3UEM A;  5J9C A;  3GL3 A;  4TRX A;  4HZ4 A;  2Z9S A;  3GHA A;  4YQV A;  2KP1 A;  3DIE A;  2H1A A;  1ERU A;  2C0G A;  3WGX A;  2CZ2 A;  1F2E A;  3GTU A;  3FKF A;  4EVM A;  2NDO A;  5LNK e;  2PMT A;  4K1F A;  4CW9 A;  1JHB A;  1QK8 A;  1ZGN A;  5A4U A;  1NHY A;  5J4U A;  1ST9 A;  2B3S A;  2O85 A;  2B5E A;  1WJK A;  3CXG A;  3H1N A;  3G9B A;  4MZW A;  2YNX A;  1GLP A;  2J23 A;  3G7Y A;  3NZN A;  3TJK A;  4IW9 A;  5ENU A;  6GSV A;  1AQX A;  3C7M A;  2C1Y A;  3PGT A;  1U3I A;  4NAX A;  3A5W A;  5HR0 A;  1NW2 A;  5JWO B;  2NTO A;  3FZA A;  2FA8 A;  3LEF A;  5ID2 B;  4ZIJ A;  3ERG A;  2C0E A;  2DJ1 A;  1YQ1 A;  2IPA A;  1PRX A;  3HJM A;  2GSS A;  4QQ7 A;  5CRD A;  3L9V A;  4ZXG A;  5H5S A;  3ME7 A;  1B4P A;  5D9W A;  2FUG 2;  3FZ4 A;  3F0I A;  1NSW A;  1K0O A;  2H0G A;  2I1U A;  4IS0 A;  1A0R P;  3HVS A;  4N30 A;  2YPM A;  2R6K A;  2IWT A;  5H5Q A;  4ZBB A;  2GSQ A;  3ZLP A;  2L6D A;  3D22 A;  1Q4J A;  1SD8 A;  1YJ6 A;  3F4S A;  5F06 A;  4PXO A;  5AIX A;  1HYU A;  2X64 A;  3N9J A;  1EGR A;  2L4Q A;  3ERF A;  4I6X A;  2VL9 A;  4ECC A;  1W89 A;  1EWX A;  4KCE A;  2C3Q A;  4MH2 A;  2IMI A;  3UBK A;  1EP8 A;  1F3B A;  3GFK A;  2LTK A;  2KHP A;  1WIK A;  4HS1 A;  3VLN A;  5FT3 A;  2PVO C;  3QAW A;  5GZZ B;  1SL2 B;  1GUM A;  2YV7 A;  4MP4 A;  1O8X A;  1UN2 A;  1R5P A;  4LL1 B;  1ERV A;  2R4V A;  3M3M A;  2ALB A;  2K8S A;  5G5E A;  4MJA A;  3A2W A;  3F63 A;  2WUL A;  3EE2 A;  4HJ2 A;  4I2T A;  3VPQ A;  1XWB A;  2GQK A;  2HYX A;  1UA5 A;  4FO5 A;  1K0B A;  1SU9 A;  2JZS A;  2LJA A;  1TDI A;  4OFN A;  2K9F A;  5ID2 A;  3QFA C;  2LJR A;  5FHI A;  1H75 A;  5GSS A;  3LQ7 A;  2RII A;  2YJ7 A;  4EF0 A;  2MMN A;  3FR9 A;  4JED A;  3RPP A;  5LD0 A;  2WCI A;  1K0M A;  1URM A;  2H72 A;  2I81 A;  4K7N A;  2RUF A;  1JZW A;  1K0C A;  2HT9 A;  3TGZ A;  3FYG A;  4GQC A;  3EMP A;  2YCD A;  1Z6M A;  1IYI A;  5CRW A;  1XOA A;  1FG4 A;  4BL7 A;  3UAP A;  3GV1 A;  2A2S A;  4BPY A;  1GTU A;  4L0W A;  1K3O A;  2IMF A;  2L5L A;  2OAD A;  3KMO A;  2H73 A;  4K2D A;  5HFG A;  3UAR A;  1BED A;  2VUP A;  1PA3 A;  3I43 A;  5CRG A;  5B6N A;  2XHF A;  4L0U A;  2H1G A;  3ZFB A;  5KEJ A;  4ECI A;  4K9Z A;  1S3A A;  2PPT A;  2K6V A;  3IHQ A;  3F6D A;  2H1D A;  3IOS A;  3ZL5 A;  3TRP A;  3BD2 A;  2YP6 A;  1V98 A;  1FB0 A;  4NXI A;  4XS1 A;  5JWQ B;  3SBC A;  4O92 A;  12GS A;  3BCK A;  1THO A;  3LSZ A;  3M9K A;  4ML6 A;  3R2Q A;  2L5O A;  4BWQ A;  3GMF A;  4F2I A;  4GST A;  3G7J A;  4OCF A;  1C72 A;  5B8B A;  3KGK A;  1ERT A;  1Z3E A;  1R4W A;  3ED3 A;  1GSY A;  1TXX A;  1SK0 A;  3O76 A;  3FRC A;  4WET A;  4IEL A;  5E59 A;  5IMF A;  2H70 A;  1OE7 A;  3CSI A;  4RQR A;  5A5K A;  3GRX A;  5JCW A;  2WS2 A;  2B7J A;  2VM2 A;  4BVY A;  2FY6 A;  4NPB A;  4KDX A;  4PQI A;  3HZ8 A;  9GSS A;  1VF4 A;  6GSY A;  3M1G A;  4JR6 A;  1DE2 A;  2LS5 A;  3KJY A;  3KXO A;  5ELG A;  3E3E A;  3VWW A;  2HLS A;  1JZO A;  4NV2 A;  2MBT A;  4TR3 A;  4LMV A;  6GSU A;  1A23 A;  4TW5 A;  2RUE A;  5G31 A;  1GP1 A;  2RM6 A;  1EOG A;  3CSJ A;  1QGV A;  3F3Q A;  1ABA A;  4AJ8 A;  3HY2 A;  1E6B A;  4FH8 A;  4NHW A;  3DVX A;  3F4R A;  3HKR A;  1OKT A;  3QAV A;  13GS A;  1CQG A;  3I69 A;  4EE0 A;  1TU8 A;  3FK8 A;  4K0N A;  5G30 A;  4CDO A;  1K3Y A;  3UIW A;  1H4O A;  3DWV A;  4HZ2 A;  5DQS A;  1AUC A;  6GSX A;  5JCU A;  2H6Z A;  4NMU A;  4EO3 A;  1GLQ A;  4F9Z A;  1GL8 A;  3DYR A;  1TOF A;  1Z7P A;  3EU3 A;  1GNW A;  5ECR B;  3ZYW A;  3LG6 A;  1M2D A;  3QMX A;  3CMI A;  4WKW A;  3FR3 A;  1YEX A;  3CYN A;  4XCS A;  2YWO A;  4QL9 A;  2HZF A;  5H5R A;  3EYT A;  4N0V A;  1RQM A;  2WRT A;  2EIO A;  4GF0 A;  5ECI B;  2E0Q A;  2ZUP A;  2HXK A;  4N10 A;  3KH9 A;  3WT1 A;  2GZP A;  3P90 A;  2VL3 A;  1XWK A;  1B9X C;  1Y25 A;  1G7O A;  2GZZ A;  2E2M A;  5F0G A;  5HR2 A;  2RM5 A;  1EEM A;  3WGE A;  2VL2 A;  4OCE A;  4PGT A;  6GSS A;  3V1W A;  2M72 A;  5EY6 A;  1R5A A;  2N5A A;  3Q74 A;  3ERW A;  1AQV A;  2DSA A;  3W8J A;  3GA4 A;  4IGJ A;  2XC2 A;  5LCZ A;  1EV9 A;  3D6I A;  1GNE A;  1V57 A;  4ML1 A;  2H8L A;  1DSB A;  5IPH A;  3DD3 A;  3CTG A;  4EDZ A;  1GTA A;  2GVP A;  4XS6 A;  2V6O A;  3HXS A;  1DE1 A;  1YF1 A;  2FD3 A;  1MDK A;  4ZB6 A;  1XBS A;  3VWX A;  4PNF A;  2K8V A;  3EU4 A;  4HU7 A;  3TOT A;  2L4C A;  2AV4 A;  3ZTL A;  2JZT A;  5B8A A;  5IMD A;  1B4Q A;  1ZMA A;  4PQH A;  4V2M A;  5F05 A;  1U87 A;  1PD2 1;  1S3D A;  2R5G A;  18GS A;  4O7H A;  3TCO A;  1I9D A;  4GLT A;  4L5O A;  2V6K A;  3ZIJ A;  1DUG A;  2YWM A;  3APO A;  3CRT A;  4V1A p;  4E8H A;  2FWG A;  3QCP A;  2ES7 A;  16GS A;  1MD4 A;  4G10 A;  1XOB A;  3Q19 A;  1U3A A;  5ECS A;  3QOU A;  4XHM A;  2D2Z A;  3KMN A;  4POB A;  3L0H A;  3DRN A;  3IDV A;  2F3M A;  2C80 A;  3IC4 A;  3KTL A;  1GSF A;  2PGT A;  3M0F A;  1SJZ A;  2IIY A;  3FR6 A;  1TU7 A;  4KH7 A;  5COH A;  1WWJ A;  5CAX A;  2QC7 A;  4QL7 A;  1SL1 B;  4MAB A;  4N11 A;  4GXZ A;  3GUR A;  5AIV A;  2LEG A;  2DBC A;  2RLI A;  2H76 A;  4JU5 A;  2MMO A;  1F3A A;  1GUK A;  1SJI A;  1G6Y A;  3APS A;  2LV3 A;  2FGX A;  2CAQ A;  3IA1 A;  5HQP A;  5J3R A;  4ZBD A;  1UC7 A;  2JZR A;  4LL4 B;  1O7U A;  1T4Y A;  1R26 A;  1VRS D;  1K0A A;  3KZQ A;  1LBK A;  2OKA A;  3KIJ A;  3NOF A;  3UBL A;  2TRX A;  1G0T A;  5D96 A;  3UJ1 A;  5ELA A;  3WD6 A;  1EEJ A;  4KDU A;  5IM9 A;  2GTU A;  4Q5N A;  2YOI A;  1QXH A;  4MZB A;  4TR0 A;  1W4V A;  2CVB A;  3WGD A;  2B5X A;  2HE3 A;  3TKR A;  2REM A;  1T4Z A;  1B8X A;  4F0B A;  4GTU A;  4X0X A;  3GYK A;  1Z6N A;  1FVJ A;  3BOA A;  4H86 A;  2K18 A;  3ZZX A;  4RUV A;  3TKQ A;  4XS4 B;  3O3T A;  6GST A;  5IIZ A;  3I9V 2;  2GT5 A;  3IAM 2;  2GS3 A;  2VCV A;  4AGS A;  3BBY A;  3TUE A;  3Q6O A;  1OC3 A;  4FYB A;  2DJ2 A;  4MJB A;  2XBI A;  3FHK A;  1TI3 A;  5IMZ A;  1X9W B;  3G7I A;  4BVX A;  3GKK A;  1XIY A;  4GSN A;  5ECN B;  5ABR A;  4ZB8 A;  3K8N A;  4F03 A;  3D4M A;  3HVX A;  4IJ3 A;  4Z7X A;  2PER A;  3TKS C;  1AAZ A;  2X8C A;  1A2L A;  4TOP A;  2CV4 A;  3M8N A;  1FO5 A;  2LNT A;  2G2Q A;  2JAD A;  3ME8 A;  1QFN A;  1LU4 A;  4HJM A;  2P5R A;  1OYJ A;  1HNB A;  3MAK A;  3D4T A;  4FYU A;  1VF3 A;  2XPE A;  1EGO A;  2JL4 A;  5DCG A;  3WYW A;  4FIW A;  4RQX A;  3TKP A;  3APQ A;  2AYT A;  4K7I A;  3NIV A;  2B6M A;  3VUR A;  1J9B A;  3CRU A;  3EUR A;  5D93 A;  1Z9H A;  3GX8 A;  2M46 A;  2QKE A;  14GS A;  3F8U A;  3IXR A;  3JCM L;  3CSH A;  2OE3 A;  3QPM A;  5F07 A;  1QMV A;  4TXO B;  3TJF A;  3S9F A;  4NHZ A;  10GS A;  2C3N A;  3EC3 A;  2VD1 A;  3N5O A;  4ULX A;  4OFM A;  1JLV A;  1GTI A;  2WFC A;  1XFL A;  2OE0 A;  4XS4 A;  3LYK A;  1GWC A;  1TI1 A;  2F8A A;  2CQ9 A;  5CRE A;  4BWS A;  4GSS A;  1M2B A;  2KP2 A;  3U6V A;  5DJM A;  2M80 A;  5A4W A;  4GRF A;  2CAI A;  2YAN A;  2ON7 A;  3D21 A;  4GQF A;  2R37 A;  1F9M A;  3GKX A;  1A8Y A;  3H4K A;  2J9H A;  3HJP A;  4ECJ A;  3UOM A;  4HDE A;  2HSY A;  3ZIT A;  3LXZ A;  4I5Q A;  4OMV A;  4EC0 A;  3ZVJ D;  1KTE A;  4MJE A;  4IQA A;  2VL2 C;  2TRC P;  4DSS B;  4PQ1 A;  4DSQ A;  1U6T A;  3IR4 A;  3MDK A;  3C8E A;  3QAG A;  1GSD A;  5CP1 A;  2KLX A;  4F0C A;  3HCZ A;  1ZYE A;  2VLU A;  5DAL B;  1YKC A;  4TXO A;  3FEU A;  1X5E A;  4IVF A;  3UMA A;  4OO5 A;  1X9M B;  2PVQ A;  3KD0 A;  2H0I A;  2H75 A;  2YZH A;  3MNG A;  5D9X A;  2GSR A;  5B6M A;  4J56 E;  2AB6 A;  2C4J A;  4Q5F A;  3TJJ A;  4DEJ A;  5HFK A;  1T00 A;  3BJ5 A;  3TKS A;  2HSH A;  1V58 A;  1HD2 A;  4K0G A;  1OE8 A;  2O8V B;  3ZVJ A;  4KE3 A;  5IQY A;  2C8U A;  5DCH A;  4BA7 A;  1PX6 A;  3FY7 A;  5DBQ A;  1G6W A;  1UVZ A;  1TK8 B;  1OC8 A;  1SEN A;  2BJX A;  4OFT A;  4TKY A;  4X43 A;  1EZK A;  1A0F A;  1USB A;  2N5B A;  3C71 A;  2FCH A;  1JZR A;  1SKW B;  2YWI A;  2CA8 A;  1ZL9 A;  5ECK B;  4K7O A;  3PH9 A;  4G9H A;  4HUA A;  5EPF A;  4DSS A;  4KSM A;  4PX1 A;  4O32 A;  2X99 A;  1TJD A;  4YAP A;  1T1V A;  1V9W A;  4JE1 A;  3ZRD A;  2MBS A;  6GSW A;  1GSS A;  3IRA A;  4D73 B;  1XPV A;  4MK3 A;  4XRA A;  5GAP D;  4MJC A;  1O73 A;  4MPF A;  3DML A;  1MD3 A;  5DAL A;  2I3Y A;  3RHB A;  3ZFL A;  2DJ0 A;  5L71 A;  1DBY A;  1K3L A;  3HD5 A;  4V1A g;  5G1K A;  2L57 A;  4P3Y B;  3DKS A;  2E2G A;  1HNA A;  2IME A;  4MCU A;  2CX3 A;  4ECB A;  4IKH A;  1PGT A;  1TK5 B;  2DJ3 A;  3LGC A;  4KAE A;  3HDC A;  1PL1 A;  4KND A;  3TJB A;  3DXB A;  2HRF A;  1PN9 A;  1WP0 A;  1VGL A;  1GSQ A;  5HR3 A;  4KCA A;  3ZRE A;  3HVV A;  1TP9 A;  2JSY A;  4IQ1 A;  2H6X A;  3TKS E;  8GSS A;  1T7P B;  3RHC A;  5C04 A;  2DIY A;  2O7K A;  1HQO A;  3HHV A;  2NBS A;  3ZIV A;  1KNG A;  2GLR A;  4WF4 A;  1YZX A;  1XW9 A;  1SYX A;  3P7X A;  1ERW A;  4ACS A;  1LJR A;  22GS A;  2YJH A;  4WF5 A;  4J57 E;  4DVC A;  3KCM A;  5KN3 A;  4XIH A;  1Q98 A;  4V2L A;  2NPB A;  1AIU A;  1F6M C;  3HZ4 A;  2HFD A;  4N0Z A;  1YF0 A;  3LOR A;  4D73 A;  1R7H A;  1WOU A;  11GS A;  1XWC A;  2JAC A;  5DDL A;  3H8Q A;  4O5R A;  2CX4 A;  1V2A A;  3GX0 A;  3C1S A;  3LJR A;  3J7Y b;  4I2U A;  1XZO A;  2LUS A;  4CHS A;  3RPN A;  2DJJ A;  2YWN A;  2P31 A;  1TW9 A;  3A3T A;  4TR1 B;  4Q5Q A;  1GSU A;  2B1K A;  4WXT A;  1T8E B;  2IFQ B;  2AJQ B;  3RDW A;  2GZY A;  2OAC A;  2DMM A;  2IJY A;  3GH6 A;  2KUC A;  2ZNM A;  4IN0 A;  3C73 A;  3FZ9 A;  4GCI A;  3F4T A;  4K6X A;  4L5L A;  4WR5 A;  1SJ6 A;  1SK1 A;  3H79 A;  1WPI A;  1XXU A;  3L9U A;  4LMW A;  4ZL9 A;  2MZC A;  2LRT A;  5ECM B;  4JRR A;  2FHE A;  2PUK C;  3GIX A;  2FWE A;  2VD0 A;  3VK9 A;  4AJ6 A;  2B7K A;  1S3C A;  1GUL A;  1MEK A;  3IV4 A;  1THX A;  4WEY A;  7GSS A;  4WR4 A;  1FW1 A;  3KM6 A;  1M9A A;  3HYP A;  2OE1 A;  19GS A;  1ZYQ B;  2VCX A;  1GSE A;  2FNO A;  4ID0 A;  3A2V A;  1MTC A;  1F37 A;  1XW6 A;  1YEP A;  2MMZ A;  2R2J A;  3GL5 A;  3GSS A;  5HR1 A;  2C0F A;  2GGT A;  2NVL A;  3KTB A;  1OC9 B;  3Q18 A;  4EXJ A;  1ZCP A;  3EWL A;  3IK9 A;  5IMV A;  5D9T A;  1X5C A;  1YKA A;  5EL8 A;  3C1R A;  2YV9 A;  2DLX A;  3H93 A;  4TR1 A;  2G0F A;  1AXD A;  4HU9 A;  2IFQ A;  3SWL A;  1SYR A;  1A24 A;  2F9S A;  3GH9 A;  1ACV A;  3DGQ A;  4L8E A;  1BG5 A;  3E0U A;  1GH2 A;  1SK2 A;  1GRX A;  4IP1 A;  1XCC A;  3IK7 A;  20GS A;  5IMA A;  2PWJ A;  1X5D A;  3W6G A;  3J7Y k;  3LYP A;  2PBJ A;  2LQQ A;  3O6T A;  4KGI A;  2LKU A;  2MMA A;  3UVH A;  1WE0 A;  4MF7 A;  4HQS A;  1Y6E A;  4KX4 A;  1WMJ A;  3IBH A;  1RK4 A;  3GKM A;  5IOW A;  5IO2 A;  3L9S A;  2JSZ A;  1EP7 A;  5IMC A;  1PQN A;  2LST A;  4MZC A;  1PL2 A;  3DEX A;  3W8S A;  5IPG A;  5B7C A;  3TRQ A;  4MMM A;  3TDG A;  5DQY A;  5GST A;  3IE3 A;  3QDN A;  4ILF A;  5KN1 A;  3DVW A;  3TB2 A;  4ISD A;  4WBJ A;  3GNJ A;  2PU9 C;  3VI7 A;  1OC9 A;  2H01 A;  2A2R A;  4E8E A;  4YAV A;  1K0D A;  4NV5 A;  1TKD B;  2H0H A;  4FYC A;  3QFB C;  2GDR A;  1TRS A;  1FB6 A;  2H66 A;  5D8I A;  4IJI A;  4HOJ A;  1T3B A;  2VO4 A;  4POK A;  4KW6 A;  5G1L A;  5JCG A;  1FAA A;  3KH7 A;  4AF2 A;  1J08 A;  4YQU A;  1M9B A;  4AJ7 A;  2HNL A;  4RI7 A;  4EKZ A;  1XW5 A;  2F51 A;  2FWH A;  2C3T A;  3VWV A;  3E9J B;  1TK0 B;  1AC1 A;  1TRU A;  3F9U A;  2HRN A;  1N2A A;  1PKW A;  5JWR B;  3VFI A;  3F3R A;  2DIZ A;  2VAF A;  1SL0 B;  2QSI A;  3FZ5 A;  5DAK B;  1M0U A;  2O89 A;  1QUW A;  4ZL8 A;  1X9S B;  3RBT A;  4TXV A;  1J0F A;  3P8W A;  2H30 A;  1KEB A;  2B1L A;  3EIN A;  5KN2 A;  2E7P A;  3VWU A;  2P0G A;  2H1B A;  1HNC A;  1TRW A;  1JLW A;  5AIS A;  2FLS A;  1JFU A;  5CYY A;  4MDC A;  4KA0 A;  4MLY A;  3PIN A;  4OWY A;  5D73 A;  2DC5 A;  3I6A A;  2VOC A;  2YZU A;  5D9V A;  3D0Z A;  3QD9 A;  2VLT A;  1KBN A;  2LQO A;  1M2A A;  4DSR A;  4JR4 A;  4POL A;  2F8F A;  2CVD A;  3IPZ A;  4G2E A;  1BAY A;  5ECO B;  1B9Y C;  3LFL A;  2MYG A;  3TJG A;  4HI7 A;  2L6C A;  1SKS B;  1XWG A;  2H19 A;  2IN3 A;  2IL3 A;  3LXT A;  4GWR A;  4XTS A;  2ON5 A;  4ZBA A;  4XRD A;  2EIR A;  2V41 A;  1ML6 A;  3EVI A;  3D5J A;  3AY8 A;  2R3X A;  4TVE A;  1XVW A;  4OD7 A;  1I5G A;  3CBU A;  3M9J A;  4EUY A;  5ECQ B;  2CT6 A;  2V32 A;  3OR5 A;  4KSO A;  1RW1 A;  4JZQ A;  1VF2 A;  4Q5R A;  1QQ2 A;  2LRN A;  4KDY A;  3BCI A;  2VLV A;  5G2Z A;  5INY A;  1PSQ A;  4JBB A;  4IBP A;  1V40 A;  1BJX A;  2GQL A;  1O81 A;  2C0D A;  1YY7 A;  5DAK A;  3VPT A;  2AAW A;  1X0R A;  3GKN A;  5KN0 A;  3UL3 A;  1ON4 A;  1XVQ A;  4WBR D;  2OBK A;  1Z7R A;  4IHU A;  3MWH A;  2B5Y A;  2CVK A;  2A4V A; 
#chains in the Genus database with same CATH topology
 1PKZ A;  3VI5 A;  5IO0 A;  4KB3 A;  1FVK A;  1GTB A;  4PUF C;  2VIM A;  2X8H A;  1M7T A;  5ECH B;  2OA7 A;  2WB9 A;  2OBI A;  2I4A A;  4CY8 A;  4KUN A;  1MDJ A;  1PN0 A;  3GUS A;  2VCZ A;  3FW2 A;  4Z2T A;  1G7E A;  3PR8 A;  5DJL A;  4TR4 A;  2OJL A;  4I8B A;  2X8G A;  3GST A;  5CNW A;  1OVN A;  1TTZ A;  2BMX A;  3KEB A;  4EDY A;  3EMX A;  3A2X A;  5EVO A;  1N8J A;  5E4W A;  5DVB A;  2WDU A;  1ZOF A;  1O6J A;  1OKD A;  17GS A;  2V1M A;  2LJK A;  3HA9 A;  4G19 A;  4YQM A;  2YN1 A;  5J5N A;  3WT2 A;  1VF1 A;  3ZML A;  4ZL7 A;  3KP8 A;  4MA9 A;  1ILO A;  4YH2 A;  5CO3 A;  2VCQ A;  1OAZ A;  2H71 A;  2HZE B;  4X1U A;  1PMT A;  5AN1 A;  1AW9 A;  4LA1 A;  2IMD A;  4F82 A;  1EV4 A;  1A8L A;  3P2A A;  1BYE A;  3IAS 2;  3ISO A;  3L4N A;  1M99 A;  5GAN D;  2GQM A;  1A2J A;  2HI7 A;  2LRC A;  2I9H A;  2CZ3 A;  5G5F A;  2XBQ A;  4HQZ A;  4OO4 A;  3US3 A;  2H6Y A;  4O5Q A;  2AHE A;  2AUV A;  2VM1 A;  3TOU A;  4HEA 2;  1FOV A;  1NM3 A;  2L59 A;  4TN8 A;  1SD9 A;  1MDI A;  1EOH A;  2EC4 A;  1IYH A;  3TRX A;  3ZMK A;  5C00 A;  3GN3 A;  4MH3 A;  5A4V A;  4PUA A;  4LLR A;  5CRH A;  4J2F A;  1JZD A;  1B48 A;  2IMK A;  3IHG A;  4ZB9 A;  4IP6 A;  2PN8 A;  4NWY A;  1BX9 A;  5HFI A;  1S3R A;  1PX7 A;  3MSZ A;  3GTU B;  3F6F A;  4RI6 A;  2TIR A;  2V2G A;  5J41 A;  1BQ7 A;  2FA4 A;  2P5Q A;  1WRY A;  2H74 A;  2VCT A;  3RAZ A;  2GT6 A;  5BMU A;  5ECP B;  3U5R E;  5IOX A;  2HZE A;  4V2N A;  1CQH A;  2N5F A;  5F8B A;  3UVT A;  4MF5 A;  2WZ9 A;  2GST A;  2BTO T;  1YDK A;  2JU5 A;  2DJK A;  1XWA A;  1GUH A;  4MPG A;  1FHE A;  2LNS A;  2FWF A;  3CTF A;  4PNG A;  1U88 A;  1K0N A;  5ECL B;  1O8W A;  2EIQ A;  4POM A;  1TRV A;  2WGR A;  1AQW A;  2ZCT A;  4USS A;  4PTS A;  2DKH A;  4MF6 A;  5J9B A;  4K8M A;  2QGV A;  4EL1 A;  3IC8 A;  5AGY A;  4PUR A;  3LWA A;  1A2M A;  1ZZY A;  3QR6 A;  2KOK A;  5FWG A;  1O85 A;  2WJU A;  2DML A;  1Z5Y E;  1SKR B;  1E2Y A;  4O5U A;  1FOH A;  4I97 A;  3KP9 A;  2XPD A;  1NHO A;  2O87 A;  2VCW A;  3L78 A;  3HJO A;  4ZIL A;  3UEM A;  5J9C A;  3GL3 A;  4TRX A;  4HZ4 A;  2Z9S A;  3GHA A;  1M3J A;  4YQV A;  2KP1 A;  3DIE A;  2H1A A;  1ERU A;  2C0G A;  3WGX A;  2CZ2 A;  1F2E A;  3GTU A;  3FKF A;  4EVM A;  2NDO A;  5LNK e;  2PMT A;  4CY6 A;  4K1F A;  4CW9 A;  1JHB A;  1QK8 A;  1ZGN A;  5A4U A;  1NHY A;  5J4U A;  1ST9 A;  2B3S A;  2O85 A;  2B5E A;  1WJK A;  3CXG A;  2A2P A;  3H1N A;  3G9B A;  4MZW A;  2YNX A;  2DKI A;  1GLP A;  2J23 A;  3G7Y A;  3NZN A;  3TJK A;  4IW9 A;  5ENU A;  6GSV A;  1AQX A;  3C7M A;  2C1Y A;  3PGT A;  1U3I A;  4NAX A;  3A5W A;  5HR0 A;  1NW2 A;  5JWO B;  2NTO A;  3FZA A;  2FA8 A;  3LEF A;  5ID2 B;  4ZIJ A;  3ERG A;  2C0E A;  2DJ1 A;  1YQ1 A;  2IPA A;  1PRX A;  3HJM A;  2GSS A;  4QQ7 A;  5CRD A;  3L9V A;  4ZXG A;  5H5S A;  3ME7 A;  1B4P A;  5D9W A;  2FUG 2;  3FZ4 A;  3F0I A;  1NSW A;  1K0O A;  2H0G A;  2I1U A;  4IS0 A;  1A0R P;  3HVS A;  4N30 A;  2YPM A;  2R6K A;  2IWT A;  5H5Q A;  4ZBB A;  2GSQ A;  3ZLP A;  2L6D A;  4MNN A;  3D22 A;  1Q4J A;  1SD8 A;  1YJ6 A;  3F4S A;  5F06 A;  4PXO A;  5AIX A;  1HYU A;  4G0L A;  4BL7 B;  2X64 A;  3N9J A;  1EGR A;  2L4Q A;  3ERF A;  4I6X A;  2VL9 A;  5KOX A;  4ECC A;  1W89 A;  1EWX A;  4KCE A;  2C3Q A;  4MH2 A;  2IMI A;  3UBK A;  1EP8 A;  1F3B A;  3GFK A;  2LTK A;  2KHP A;  1WIK A;  4HS1 A;  3VLN A;  5FT3 A;  2PVO C;  3QAW A;  5GZZ B;  1SL2 B;  1GUM A;  2YV7 A;  4MP4 A;  1O8X A;  4K5S A;  1UN2 A;  1R5P A;  4LL1 B;  1ERV A;  4KF9 A;  2R4V A;  1PFO A;  3M3M A;  2ALB A;  2K8S A;  5G5E A;  4MJA A;  3A2W A;  3F63 A;  3MIX A;  2WUL A;  3EE2 A;  4HJ2 A;  4I2T A;  3VPQ A;  1XWB A;  2GQK A;  2HYX A;  1UA5 A;  4FO5 A;  1K0B A;  1SU9 A;  2JZS A;  2LJA A;  1TDI A;  4OFN A;  2K9F A;  5ID2 A;  3QFA C;  2LJR A;  5FHI A;  1H75 A;  5GSS A;  3LQ7 A;  2RII A;  2YJ7 A;  4EF0 A;  2MMN A;  3FR9 A;  4JED A;  3RPP A;  5LD0 A;  2WCI A;  1K0M A;  1URM A;  2H72 A;  2I81 A;  4K7N A;  2RUF A;  1JZW A;  1K0C A;  2HT9 A;  3TGZ A;  3FYG A;  4GQC A;  3EMP A;  2YCD A;  1Z6M A;  3FMW A;  1IYI A;  5CRW A;  1XOA A;  1FG4 A;  4BVY B;  4BL7 A;  3UAP A;  3GV1 A;  2A2S A;  4BPY A;  1GTU A;  4L0W A;  1K3O A;  2IMF A;  2L5L A;  2OAD A;  3KMO A;  2H73 A;  4K2D A;  5HFG A;  3UAR A;  1BED A;  2VUP A;  1PA3 A;  3I43 A;  5CRG A;  5B6N A;  4EIP A;  2XHF A;  4L0U A;  2H1G A;  3ZFB A;  5KEJ A;  4ECI A;  4K9Z A;  1S3A A;  2PPT A;  2R0C A;  2K6V A;  3IHQ A;  3F6D A;  2H1D A;  2HSM A;  3IOS A;  3ZL5 A;  3TRP A;  3BD2 A;  2YP6 A;  1V98 A;  1FB0 A;  4NXI A;  3HVN A;  4XS1 A;  5JWQ B;  3SBC A;  4O92 A;  12GS A;  3BCK A;  1THO A;  3LSZ A;  3M9K A;  4ML6 A;  3R2Q A;  2L5O A;  4BWQ A;  3GMF A;  4F2I A;  4GST A;  3G7J A;  4OCF A;  1C72 A;  5B8B A;  3KGK A;  1ERT A;  1Z3E A;  1R4W A;  3ED3 A;  1GSY A;  1TXX A;  1SK0 A;  3O76 A;  3FRC A;  4WET A;  4IEL A;  5E59 A;  5IMF A;  2H70 A;  1OE7 A;  3CSI A;  4RQR A;  5A5K A;  3GRX A;  5JCW A;  2WS2 A;  2B7J A;  2VM2 A;  4BVY A;  2FY6 A;  4NPB A;  4KDX A;  4PQI A;  3HZ8 A;  9GSS A;  1VF4 A;  6GSY A;  3M1G A;  4JR6 A;  1DE2 A;  2LS5 A;  3KJY A;  3KXO A;  5ELG A;  3E3E A;  3VWW A;  2HLS A;  1JZO A;  2R0G A;  4NV2 A;  2MBT A;  4TR3 A;  4LMV A;  6GSU A;  1A23 A;  4TW5 A;  2RUE A;  5G31 A;  1GP1 A;  2RM6 A;  1EOG A;  3CSJ A;  1QGV A;  3F3Q A;  1ABA A;  4AJ8 A;  3HY2 A;  1E6B A;  4FH8 A;  4NHW A;  3DVX A;  3F4R A;  3HKR A;  1OKT A;  3QAV A;  13GS A;  1CQG A;  3I69 A;  4EE0 A;  1TU8 A;  3FK8 A;  4K0N A;  5G30 A;  4CDO A;  1K3Y A;  3UIW A;  1H4O A;  3DWV A;  3CQF A;  4HZ2 A;  5DQS A;  1AUC A;  6GSX A;  5JCU A;  3MYD A;  2H6Z A;  4NMU A;  4EO3 A;  1GLQ A;  4F9Z A;  1GL8 A;  3DYR A;  1TOF A;  1Z7P A;  3EU3 A;  1GNW A;  5ECR B;  3ZYW A;  3LG6 A;  1M2D A;  3QMX A;  3CMI A;  4WKW A;  3FR3 A;  1YEX A;  3CYN A;  4XCS A;  2YWO A;  4QL9 A;  5BRT A;  2HZF A;  5H5R A;  3EYT A;  4N0V A;  1RQM A;  2WRT A;  2EIO A;  4GF0 A;  5ECI B;  2E0Q A;  2ZUP A;  2HXK A;  4N10 A;  3KH9 A;  3WT1 A;  2GZP A;  3P90 A;  2VL3 A;  1XWK A;  1B9X C;  1Y25 A;  1G7O A;  2GZZ A;  2E2M A;  5F0G A;  5HR2 A;  2RM5 A;  1EEM A;  3WGE A;  2VL2 A;  4OCE A;  4PGT A;  6GSS A;  3V1W A;  2M72 A;  5EY6 A;  1R5A A;  2N5A A;  3Q74 A;  3ERW A;  1AQV A;  2DSA A;  3W8J A;  3GA4 A;  4IGJ A;  2XC2 A;  5LCZ A;  1EV9 A;  3D6I A;  1GNE A;  1V57 A;  4ML1 A;  2H8L A;  1DSB A;  4YKG A;  5IPH A;  3DD3 A;  3CTG A;  4EDZ A;  1GTA A;  2GVP A;  4XS6 A;  2V6O A;  3HXS A;  1DE1 A;  1YF1 A;  2FD3 A;  1MDK A;  4ZB6 A;  1XBS A;  3VWX A;  4PNF A;  2K8V A;  3EU4 A;  4HU7 A;  3TOT A;  2L4C A;  2AV4 A;  3ZTL A;  2JZT A;  5B8A A;  5IMD A;  1B4Q A;  1ZMA A;  4PQH A;  4V2M A;  5F05 A;  1U87 A;  1PD2 1;  1S3D A;  2R5G A;  18GS A;  2HRK A;  4O7H A;  3TCO A;  1I9D A;  4GLT A;  4L5O A;  2V6K A;  3ZIJ A;  1DUG A;  2YWM A;  3APO A;  3CRT A;  4V1A p;  4E8H A;  2FWG A;  3QCP A;  2ES7 A;  16GS A;  1MD4 A;  4G10 A;  1XOB A;  3Q19 A;  1U3A A;  5ECS A;  3QOU A;  4XHM A;  2D2Z A;  3KMN A;  4POB A;  3L0H A;  3DRN A;  3IDV A;  2F3M A;  2C80 A;  2QA2 A;  3IC4 A;  2R0P A;  3KTL A;  1GSF A;  2PGT A;  3M0F A;  1M3I A;  1SJZ A;  2IIY A;  3FR6 A;  1TU7 A;  4KH7 A;  5COH A;  1WWJ A;  5CAX A;  2QC7 A;  4QL7 A;  4BVX B;  1SL1 B;  4MAB A;  4N11 A;  4GXZ A;  3GUR A;  5AIV A;  2LEG A;  2A4H A;  2DBC A;  2RLI A;  2H76 A;  4JU5 A;  2MMO A;  1F3A A;  1GUK A;  1SJI A;  1G6Y A;  3APS A;  2LV3 A;  2FGX A;  2CAQ A;  3IA1 A;  5HQP A;  5J3R A;  4ZBD A;  1UC7 A;  2JZR A;  4LL4 B;  1O7U A;  1T4Y A;  1R26 A;  1VRS D;  1K0A A;  3KZQ A;  1LBK A;  2OKA A;  3KIJ A;  3NOF A;  3UBL A;  1ZYN A;  2TRX A;  1G0T A;  5D96 A;  3UJ1 A;  5ELA A;  3WD6 A;  1EEJ A;  4KDU A;  5IM9 A;  2GTU A;  4Q5N A;  2YOI A;  1QXH A;  4MZB A;  4TR0 A;  1W4V A;  2CVB A;  3WGD A;  2B5X A;  2HE3 A;  3TKR A;  2REM A;  3PPU A;  1T4Z A;  1B8X A;  4F0B A;  4GTU A;  4X0X A;  3GYK A;  1Z6N A;  1FVJ A;  3BOA A;  4H86 A;  2K18 A;  3ZZX A;  4RUV A;  3TKQ A;  4XS4 B;  3O3T A;  6GST A;  5IIZ A;  3I9V 2;  2GT5 A;  3IAM 2;  2GS3 A;  2VCV A;  4AGS A;  3BBY A;  3TUE A;  3Q6O A;  1OC3 A;  4FYB A;  4BIK A;  2DJ2 A;  4MJB A;  2XBI A;  3FHK A;  1TI3 A;  5IMZ A;  1X9W B;  3G7I A;  4BVX A;  3GKK A;  1XIY A;  4GSN A;  5ECN B;  5ABR A;  4ZB8 A;  3K8N A;  4F03 A;  3D4M A;  3HVX A;  4IJ3 A;  4Z7X A;  1XG8 A;  2PER A;  3TKS C;  1AAZ A;  2X8C A;  1A2L A;  4TOP A;  2CV4 A;  3M8N A;  1FO5 A;  2LNT A;  2G2Q A;  2JAD A;  3ME8 A;  1QFN A;  1LU4 A;  4HJM A;  2P5R A;  1OYJ A;  1HNB A;  3MAK A;  3D4T A;  4FYU A;  1VF3 A;  2XPE A;  1EGO A;  2JL4 A;  5DCG A;  3WYW A;  4FIW A;  4RQX A;  3TKP A;  3APQ A;  2AYT A;  4K7I A;  3NIV A;  2B6M A;  3VUR A;  1J9B A;  3CRU A;  3EUR A;  5D93 A;  1Z9H A;  3GX8 A;  2M46 A;  2QKE A;  14GS A;  3F8U A;  3IXR A;  3JCM L;  3CSH A;  2OE3 A;  3QPM A;  5F07 A;  1QMV A;  4TXO B;  3TJF A;  3S9F A;  4NHZ A;  10GS A;  4EIQ A;  2C3N A;  3EC3 A;  4HSC X;  2VD1 A;  3N5O A;  4ULX A;  4OFM A;  1JLV A;  1GTI A;  2WFC A;  4X4J A;  1XFL A;  2OE0 A;  4XS4 A;  3LYK A;  1GWC A;  1TI1 A;  2F8A A;  2CQ9 A;  5CRE A;  4BWS A;  4GSS A;  1M2B A;  2KP2 A;  3U6V A;  1ZYP A;  5DJM A;  2M80 A;  5A4W A;  4GRF A;  2CAI A;  2YAN A;  2ON7 A;  3D21 A;  4GQF A;  2R37 A;  1F9M A;  3GKX A;  1A8Y A;  3H4K A;  2J9H A;  3HJP A;  4ECJ A;  3UOM A;  4HDE A;  2HSY A;  3ZIT A;  4Z2R A;  3LXZ A;  4I5Q A;  4OMV A;  4EC0 A;  3ZVJ D;  1KTE A;  4MJE A;  4IQA A;  2VL2 C;  2TRC P;  4DSS B;  4PQ1 A;  4DSQ A;  1U6T A;  3A5I A;  3IR4 A;  3MDK A;  3C8E A;  3QAG A;  1GSD A;  5CP1 A;  2KLX A;  4F0C A;  3HCZ A;  1ZYE A;  2VLU A;  5DAL B;  1YKC A;  4TXO A;  3FEU A;  1X5E A;  4IVF A;  3UMA A;  4OO5 A;  1X9M B;  2PVQ A;  3KD0 A;  2H0I A;  2H75 A;  2YZH A;  3MNG A;  5D9X A;  2GSR A;  5B6M A;  4J56 E;  2AB6 A;  2C4J A;  4Q5F A;  3TJJ A;  4DEJ A;  5HFK A;  1T00 A;  3BJ5 A;  3TKS A;  2HSH A;  1V58 A;  1HD2 A;  4K0G A;  1OE8 A;  2O8V B;  3ZVJ A;  4KE3 A;  5IQY A;  2C8U A;  5DCH A;  4BA7 A;  1PX6 A;  3FY7 A;  5DBQ A;  1G6W A;  1UVZ A;  1TK8 B;  1OC8 A;  1SEN A;  2BJX A;  4OFT A;  4TKY A;  4X43 A;  1EZK A;  1A0F A;  1USB A;  2N5B A;  3C71 A;  2FCH A;  1JZR A;  1SKW B;  2YWI A;  2CA8 A;  1ZL9 A;  5ECK B;  4G0I A;  4K7O A;  3PH9 A;  4G9H A;  4HUA A;  5EPF A;  4DSS A;  4KSM A;  4PX1 A;  4O32 A;  2X99 A;  1TJD A;  2QA1 A;  4YAP A;  1T1V A;  1V9W A;  4JE1 A;  3ZRD A;  2MBS A;  6GSW A;  1GSS A;  3IRA A;  4D73 B;  1XPV A;  4MK3 A;  4XRA A;  5GAP D;  4MJC A;  1O73 A;  4MPF A;  3DML A;  1MD3 A;  5DAL A;  2I3Y A;  3RHB A;  3ZFL A;  2DJ0 A;  5L71 A;  1DBY A;  4A5P A;  1K3L A;  3HD5 A;  4V1A g;  5G1K A;  2L57 A;  4P3Y B;  3DKS A;  2E2G A;  1HNA A;  2IME A;  4MCU A;  2CX3 A;  4ECB A;  4IKH A;  1PGT A;  1TK5 B;  2DJ3 A;  3LGC A;  4KAE A;  3HDC A;  1PL1 A;  4KND A;  3TJB A;  3DXB A;  2HRF A;  1PN9 A;  1WP0 A;  1VGL A;  1GSQ A;  5HR3 A;  4KCA A;  3ZRE A;  3HVV A;  1TP9 A;  2JSY A;  4IQ1 A;  2H6X A;  3TKS E;  8GSS A;  1T7P B;  3RHC A;  5C04 A;  2DIY A;  2O7K A;  1HQO A;  3HHV A;  2NBS A;  3ZIV A;  1KNG A;  2GLR A;  4WF4 A;  1YZX A;  1XW9 A;  1SYX A;  3P7X A;  1ERW A;  4ACS A;  1LJR A;  22GS A;  2YJH A;  4WF5 A;  4J57 E;  4DVC A;  3KCM A;  5KN3 A;  4XIH A;  1Q98 A;  5KOW A;  4V2L A;  2NPB A;  1AIU A;  1F6M C;  3HZ4 A;  2HFD A;  4N0Z A;  1YF0 A;  3LOR A;  4D73 A;  1R7H A;  1WOU A;  11GS A;  1XWC A;  2JAC A;  5DDL A;  3H8Q A;  4O5R A;  2CX4 A;  1V2A A;  3GX0 A;  3C1S A;  3LJR A;  3J7Y b;  4I2U A;  1XZO A;  2LUS A;  4CHS A;  3RPN A;  2DJJ A;  2YWN A;  2P31 A;  1TW9 A;  3A3T A;  4TR1 B;  4Q5Q A;  1GSU A;  2B1K A;  4WXT A;  1T8E B;  2IFQ B;  2AJQ B;  3RDW A;  2GZY A;  2OAC A;  2DMM A;  2IJY A;  3GH6 A;  2KUC A;  2ZNM A;  4IN0 A;  3C73 A;  3FZ9 A;  4GCI A;  3F4T A;  4K6X A;  4L5L A;  4WR5 A;  1SJ6 A;  1SK1 A;  3H79 A;  1WPI A;  1XXU A;  3L9U A;  4LMW A;  4ZL9 A;  2MZC A;  2LRT A;  5ECM B;  4JRR A;  2FHE A;  2PUK C;  3GIX A;  2FWE A;  2VD0 A;  3VK9 A;  4AJ6 A;  2B7K A;  1S3C A;  1GUL A;  1MEK A;  3IV4 A;  1THX A;  4WEY A;  7GSS A;  4WR4 A;  1FW1 A;  3KM6 A;  1M9A A;  3HYP A;  2OE1 A;  19GS A;  1ZYQ B;  2VCX A;  1GSE A;  2FNO A;  4ID0 A;  3A2V A;  1MTC A;  2X4A A;  1F37 A;  1XW6 A;  1YEP A;  2MMZ A;  2R2J A;  3GL5 A;  3GSS A;  5HR1 A;  2C0F A;  2GGT A;  2NVL A;  3KTB A;  1OC9 B;  3Q18 A;  4EXJ A;  1ZCP A;  3EWL A;  3IK9 A;  5IMV A;  5D9T A;  1X5C A;  1YKA A;  5EL8 A;  3C1R A;  2YV9 A;  2DLX A;  3H93 A;  4TR1 A;  2G0F A;  1AXD A;  4HU9 A;  2IFQ A;  3SWL A;  1SYR A;  1A24 A;  2F9S A;  3GH9 A;  1ACV A;  3DGQ A;  4L8E A;  1BG5 A;  3E0U A;  1GH2 A;  1SK2 A;  1GRX A;  4IP1 A;  1XCC A;  3IK7 A;  20GS A;  5IMA A;  2PWJ A;  1X5D A;  3W6G A;  4YKF A;  3J7Y k;  3LYP A;  2PBJ A;  2LQQ A;  3O6T A;  4KGI A;  2LKU A;  4ICY A;  2MMA A;  3UVH A;  1WE0 A;  4MF7 A;  4HQS A;  1Y6E A;  4KX4 A;  1WMJ A;  3IBH A;  1RK4 A;  4Z2U A;  3GKM A;  5IOW A;  5IO2 A;  3L9S A;  2JSZ A;  1EP7 A;  5IMC A;  1PQN A;  2LST A;  4MZC A;  1PL2 A;  3R3E A;  3DEX A;  3W8S A;  5IPG A;  5B7C A;  3TRQ A;  4MMM A;  3TDG A;  5DQY A;  5GST A;  3IE3 A;  3QDN A;  4ILF A;  5KN1 A;  3DVW A;  3TB2 A;  4ISD A;  4WBJ A;  3GNJ A;  2PU9 C;  3VI7 A;  1OC9 A;  2H01 A;  2A2R A;  4E8E A;  4YAV A;  1K0D A;  4NV5 A;  1TKD B;  3LW9 A;  2H0H A;  4FYC A;  3QFB C;  2GDR A;  4K5R A;  1TRS A;  1FB6 A;  2H66 A;  5D8I A;  4IJI A;  4HOJ A;  1T3B A;  2VO4 A;  4POK A;  4KW6 A;  5G1L A;  5JCG A;  1FAA A;  3KH7 A;  4AF2 A;  1J08 A;  4YQU A;  1M9B A;  4AJ7 A;  2HNL A;  4RI7 A;  4EKZ A;  1XW5 A;  2F51 A;  2FWH A;  2C3T A;  3VWV A;  3E9J B;  1TK0 B;  1AC1 A;  1TRU A;  3F9U A;  2HRN A;  1N2A A;  1PKW A;  5JWR B;  3VFI A;  3F3R A;  2DIZ A;  2VAF A;  1SL0 B;  2QSI A;  3FZ5 A;  5DAK B;  4K2X A;  1M0U A;  2O89 A;  1QUW A;  4ZL8 A;  1X9S B;  3RBT A;  4TXV A;  1J0F A;  3P8W A;  2H30 A;  1KEB A;  2B1L A;  3EIN A;  5KN2 A;  2E7P A;  3VWU A;  2P0G A;  2H1B A;  1HNC A;  1TRW A;  1JLW A;  5AIS A;  2FLS A;  1JFU A;  5CYY A;  4MDC A;  4KA0 A;  4MLY A;  3PIN A;  4OWY A;  5D73 A;  2DC5 A;  3I6A A;  2VOC A;  2YZU A;  5D9V A;  3D0Z A;  3QD9 A;  2VLT A;  1KBN A;  2LQO A;  1M2A A;  4DSR A;  4JR4 A;  4POL A;  2F8F A;  2CVD A;  3IPZ A;  4G2E A;  1BAY A;  5ECO B;  1B9Y C;  3LFL A;  2MYG A;  3TJG A;  4HI7 A;  2L6C A;  1SKS B;  1XWG A;  2H19 A;  2IN3 A;  2IL3 A;  3LXT A;  3EPT A;  4GWR A;  4XTS A;  2ON5 A;  4ZBA A;  4XRD A;  2EIR A;  2V41 A;  1ML6 A;  3EVI A;  3D5J A;  3AY8 A;  2R3X A;  4TVE A;  1XVW A;  4OD7 A;  1I5G A;  3CBU A;  3M9J A;  4EUY A;  2X49 A;  5ECQ B;  2CT6 A;  2V32 A;  3OR5 A;  2UZ8 A;  4KSO A;  1RW1 A;  4JZQ A;  1VF2 A;  4Q5R A;  1QQ2 A;  2LRN A;  4KDY A;  3BCI A;  2VLV A;  5G2Z A;  5INY A;  1PSQ A;  2HRA A;  4JBB A;  4IBP A;  1V40 A;  4G0K A;  1BJX A;  2GQL A;  1O81 A;  2C0D A;  1YY7 A;  5DAK A;  3VPT A;  2AAW A;  4FQU A;  1X0R A;  3GKN A;  5KN0 A;  3UL3 A;  1ON4 A;  1XVQ A;  4WBR D;  2OBK A;  1Z7R A;  4IHU A;  3MWH A;  2B5Y A;  2CVK A;  2A4V A; 
#chains in the Genus database with same CATH homology
 1PKZ A;  3VI5 A;  5IO0 A;  4KB3 A;  1FVK A;  1GTB A;  4PUF C;  2VIM A;  2X8H A;  1M7T A;  5ECH B;  2OA7 A;  2WB9 A;  2OBI A;  2I4A A;  4CY8 A;  4KUN A;  1MDJ A;  1PN0 A;  3GUS A;  2VCZ A;  3FW2 A;  4Z2T A;  1G7E A;  3PR8 A;  5DJL A;  4TR4 A;  2OJL A;  4I8B A;  2X8G A;  3GST A;  5CNW A;  1OVN A;  1TTZ A;  2BMX A;  3KEB A;  4EDY A;  3EMX A;  3A2X A;  5EVO A;  1N8J A;  5E4W A;  5DVB A;  2WDU A;  1ZOF A;  1O6J A;  1OKD A;  17GS A;  2V1M A;  2LJK A;  3HA9 A;  4G19 A;  4YQM A;  2YN1 A;  5J5N A;  3WT2 A;  1VF1 A;  3ZML A;  4ZL7 A;  3KP8 A;  4MA9 A;  1ILO A;  4YH2 A;  5CO3 A;  2VCQ A;  1OAZ A;  2H71 A;  2HZE B;  4X1U A;  1PMT A;  5AN1 A;  1AW9 A;  4LA1 A;  2IMD A;  4F82 A;  1EV4 A;  1A8L A;  3P2A A;  1BYE A;  3IAS 2;  3ISO A;  3L4N A;  1M99 A;  5GAN D;  2GQM A;  1A2J A;  2HI7 A;  2LRC A;  2I9H A;  2CZ3 A;  5G5F A;  2XBQ A;  4HQZ A;  4OO4 A;  3US3 A;  2H6Y A;  4O5Q A;  2AHE A;  2AUV A;  2VM1 A;  3TOU A;  4HEA 2;  1FOV A;  1NM3 A;  2L59 A;  4TN8 A;  1SD9 A;  1MDI A;  1EOH A;  2EC4 A;  1IYH A;  3TRX A;  3ZMK A;  5C00 A;  3GN3 A;  4MH3 A;  5A4V A;  4PUA A;  4LLR A;  5CRH A;  4J2F A;  1JZD A;  1B48 A;  2IMK A;  3IHG A;  4ZB9 A;  4IP6 A;  2PN8 A;  4NWY A;  1BX9 A;  5HFI A;  1PX7 A;  3MSZ A;  3GTU B;  3F6F A;  4RI6 A;  2TIR A;  2V2G A;  5J41 A;  1BQ7 A;  2FA4 A;  2P5Q A;  1WRY A;  2H74 A;  2VCT A;  3RAZ A;  2GT6 A;  5BMU A;  5ECP B;  3U5R E;  5IOX A;  2HZE A;  4V2N A;  1CQH A;  2N5F A;  5F8B A;  3UVT A;  4MF5 A;  2WZ9 A;  2GST A;  2BTO T;  1YDK A;  2JU5 A;  2DJK A;  1XWA A;  1GUH A;  4MPG A;  1FHE A;  2LNS A;  2FWF A;  3CTF A;  4PNG A;  1U88 A;  1K0N A;  5ECL B;  1O8W A;  2EIQ A;  4POM A;  1TRV A;  2WGR A;  1AQW A;  2ZCT A;  4USS A;  4PTS A;  2DKH A;  4MF6 A;  5J9B A;  4K8M A;  2QGV A;  4EL1 A;  3IC8 A;  5AGY A;  4PUR A;  3LWA A;  1A2M A;  1ZZY A;  3QR6 A;  2KOK A;  5FWG A;  1O85 A;  2WJU A;  2DML A;  1Z5Y E;  1SKR B;  1E2Y A;  4O5U A;  1FOH A;  4I97 A;  3KP9 A;  2XPD A;  1NHO A;  2O87 A;  2VCW A;  3L78 A;  3HJO A;  4ZIL A;  3UEM A;  5J9C A;  3GL3 A;  4TRX A;  4HZ4 A;  2Z9S A;  3GHA A;  4YQV A;  2KP1 A;  3DIE A;  2H1A A;  1ERU A;  2C0G A;  3WGX A;  2CZ2 A;  1F2E A;  3GTU A;  3FKF A;  4EVM A;  2NDO A;  5LNK e;  2PMT A;  4CY6 A;  4K1F A;  4CW9 A;  1JHB A;  1QK8 A;  1ZGN A;  5A4U A;  1NHY A;  5J4U A;  1ST9 A;  2B3S A;  2O85 A;  2B5E A;  1WJK A;  3CXG A;  2A2P A;  3H1N A;  3G9B A;  4MZW A;  2YNX A;  2DKI A;  1GLP A;  2J23 A;  3G7Y A;  3NZN A;  3TJK A;  4IW9 A;  5ENU A;  6GSV A;  1AQX A;  3C7M A;  2C1Y A;  3PGT A;  1U3I A;  4NAX A;  3A5W A;  5HR0 A;  1NW2 A;  5JWO B;  2NTO A;  3FZA A;  2FA8 A;  3LEF A;  5ID2 B;  4ZIJ A;  3ERG A;  2C0E A;  2DJ1 A;  1YQ1 A;  2IPA A;  1PRX A;  3HJM A;  2GSS A;  4QQ7 A;  5CRD A;  3L9V A;  4ZXG A;  5H5S A;  3ME7 A;  1B4P A;  5D9W A;  2FUG 2;  3FZ4 A;  3F0I A;  1NSW A;  1K0O A;  2H0G A;  2I1U A;  4IS0 A;  1A0R P;  3HVS A;  4N30 A;  2YPM A;  2R6K A;  2IWT A;  5H5Q A;  4ZBB A;  2GSQ A;  3ZLP A;  2L6D A;  4MNN A;  3D22 A;  1Q4J A;  1SD8 A;  1YJ6 A;  3F4S A;  5F06 A;  4PXO A;  5AIX A;  1HYU A;  4G0L A;  4BL7 B;  2X64 A;  3N9J A;  1EGR A;  2L4Q A;  3ERF A;  4I6X A;  2VL9 A;  5KOX A;  4ECC A;  1W89 A;  1EWX A;  4KCE A;  2C3Q A;  4MH2 A;  2IMI A;  3UBK A;  1EP8 A;  1F3B A;  3GFK A;  2LTK A;  2KHP A;  1WIK A;  4HS1 A;  3VLN A;  5FT3 A;  2PVO C;  3QAW A;  5GZZ B;  1SL2 B;  1GUM A;  2YV7 A;  4MP4 A;  1O8X A;  4K5S A;  1UN2 A;  1R5P A;  4LL1 B;  1ERV A;  4KF9 A;  2R4V A;  3M3M A;  2ALB A;  2K8S A;  5G5E A;  4MJA A;  3A2W A;  3F63 A;  3MIX A;  2WUL A;  3EE2 A;  4HJ2 A;  4I2T A;  3VPQ A;  1XWB A;  2GQK A;  2HYX A;  1UA5 A;  4FO5 A;  1K0B A;  1SU9 A;  2JZS A;  2LJA A;  1TDI A;  4OFN A;  2K9F A;  5ID2 A;  3QFA C;  2LJR A;  5FHI A;  1H75 A;  5GSS A;  3LQ7 A;  2RII A;  2YJ7 A;  4EF0 A;  2MMN A;  3FR9 A;  4JED A;  3RPP A;  5LD0 A;  2WCI A;  1K0M A;  1URM A;  2H72 A;  2I81 A;  4K7N A;  2RUF A;  1JZW A;  1K0C A;  2HT9 A;  3TGZ A;  3FYG A;  4GQC A;  3EMP A;  2YCD A;  1Z6M A;  3FMW A;  1IYI A;  5CRW A;  1XOA A;  1FG4 A;  4BVY B;  4BL7 A;  3UAP A;  3GV1 A;  2A2S A;  4BPY A;  1GTU A;  4L0W A;  1K3O A;  2IMF A;  2L5L A;  2OAD A;  3KMO A;  2H73 A;  4K2D A;  5HFG A;  3UAR A;  1BED A;  2VUP A;  1PA3 A;  3I43 A;  5CRG A;  5B6N A;  4EIP A;  2XHF A;  4L0U A;  2H1G A;  3ZFB A;  5KEJ A;  4ECI A;  4K9Z A;  1S3A A;  2PPT A;  2R0C A;  2K6V A;  3IHQ A;  3F6D A;  2H1D A;  2HSM A;  3IOS A;  3ZL5 A;  3TRP A;  3BD2 A;  2YP6 A;  1V98 A;  1FB0 A;  4NXI A;  4XS1 A;  5JWQ B;  3SBC A;  4O92 A;  12GS A;  3BCK A;  1THO A;  3LSZ A;  3M9K A;  4ML6 A;  3R2Q A;  2L5O A;  4BWQ A;  3GMF A;  4F2I A;  4GST A;  3G7J A;  4OCF A;  1C72 A;  5B8B A;  3KGK A;  1ERT A;  1Z3E A;  1R4W A;  3ED3 A;  1GSY A;  1TXX A;  1SK0 A;  3O76 A;  3FRC A;  4WET A;  4IEL A;  5E59 A;  5IMF A;  2H70 A;  1OE7 A;  3CSI A;  4RQR A;  5A5K A;  3GRX A;  5JCW A;  2WS2 A;  2B7J A;  2VM2 A;  4BVY A;  2FY6 A;  4NPB A;  4KDX A;  4PQI A;  3HZ8 A;  9GSS A;  1VF4 A;  6GSY A;  3M1G A;  4JR6 A;  1DE2 A;  2LS5 A;  3KJY A;  3KXO A;  5ELG A;  3E3E A;  3VWW A;  2HLS A;  1JZO A;  2R0G A;  4NV2 A;  2MBT A;  4TR3 A;  4LMV A;  6GSU A;  1A23 A;  4TW5 A;  2RUE A;  5G31 A;  1GP1 A;  2RM6 A;  1EOG A;  3CSJ A;  1QGV A;  3F3Q A;  1ABA A;  4AJ8 A;  3HY2 A;  1E6B A;  4FH8 A;  4NHW A;  3DVX A;  3F4R A;  3HKR A;  1OKT A;  3QAV A;  13GS A;  1CQG A;  3I69 A;  4EE0 A;  1TU8 A;  3FK8 A;  4K0N A;  5G30 A;  4CDO A;  1K3Y A;  3UIW A;  1H4O A;  3DWV A;  4HZ2 A;  5DQS A;  1AUC A;  6GSX A;  5JCU A;  3MYD A;  2H6Z A;  4NMU A;  4EO3 A;  1GLQ A;  4F9Z A;  1GL8 A;  3DYR A;  1TOF A;  1Z7P A;  3EU3 A;  1GNW A;  5ECR B;  3ZYW A;  3LG6 A;  1M2D A;  3QMX A;  3CMI A;  4WKW A;  3FR3 A;  1YEX A;  3CYN A;  4XCS A;  2YWO A;  4QL9 A;  5BRT A;  2HZF A;  5H5R A;  3EYT A;  4N0V A;  1RQM A;  2WRT A;  2EIO A;  4GF0 A;  5ECI B;  2E0Q A;  2ZUP A;  2HXK A;  4N10 A;  3KH9 A;  3WT1 A;  2GZP A;  3P90 A;  2VL3 A;  1XWK A;  1B9X C;  1Y25 A;  1G7O A;  2GZZ A;  2E2M A;  5F0G A;  5HR2 A;  2RM5 A;  1EEM A;  3WGE A;  2VL2 A;  4OCE A;  4PGT A;  6GSS A;  3V1W A;  2M72 A;  5EY6 A;  1R5A A;  2N5A A;  3Q74 A;  3ERW A;  1AQV A;  2DSA A;  3W8J A;  3GA4 A;  4IGJ A;  2XC2 A;  5LCZ A;  1EV9 A;  3D6I A;  1GNE A;  1V57 A;  4ML1 A;  2H8L A;  1DSB A;  4YKG A;  5IPH A;  3DD3 A;  3CTG A;  4EDZ A;  1GTA A;  2GVP A;  4XS6 A;  2V6O A;  3HXS A;  1DE1 A;  1YF1 A;  2FD3 A;  1MDK A;  4ZB6 A;  1XBS A;  3VWX A;  4PNF A;  2K8V A;  3EU4 A;  4HU7 A;  3TOT A;  2L4C A;  2AV4 A;  3ZTL A;  2JZT A;  5B8A A;  5IMD A;  1B4Q A;  1ZMA A;  4PQH A;  4V2M A;  5F05 A;  1U87 A;  1PD2 1;  1S3D A;  2R5G A;  18GS A;  2HRK A;  4O7H A;  3TCO A;  1I9D A;  4GLT A;  4L5O A;  2V6K A;  3ZIJ A;  1DUG A;  2YWM A;  3APO A;  3CRT A;  4V1A p;  4E8H A;  2FWG A;  3QCP A;  2ES7 A;  16GS A;  1MD4 A;  4G10 A;  1XOB A;  3Q19 A;  1U3A A;  5ECS A;  3QOU A;  4XHM A;  2D2Z A;  3KMN A;  4POB A;  3L0H A;  3DRN A;  3IDV A;  2F3M A;  2C80 A;  2QA2 A;  3IC4 A;  2R0P A;  3KTL A;  1GSF A;  2PGT A;  3M0F A;  1SJZ A;  2IIY A;  3FR6 A;  1TU7 A;  4KH7 A;  5COH A;  1WWJ A;  5CAX A;  2QC7 A;  4QL7 A;  4BVX B;  1SL1 B;  4MAB A;  4N11 A;  4GXZ A;  3GUR A;  5AIV A;  2LEG A;  2A4H A;  2DBC A;  2RLI A;  2H76 A;  4JU5 A;  2MMO A;  1F3A A;  1GUK A;  1SJI A;  1G6Y A;  3APS A;  2LV3 A;  2FGX A;  2CAQ A;  3IA1 A;  5HQP A;  5J3R A;  4ZBD A;  1UC7 A;  2JZR A;  4LL4 B;  1O7U A;  1T4Y A;  1R26 A;  1VRS D;  1K0A A;  3KZQ A;  1LBK A;  2OKA A;  3KIJ A;  3NOF A;  3UBL A;  1ZYN A;  2TRX A;  1G0T A;  5D96 A;  3UJ1 A;  5ELA A;  3WD6 A;  1EEJ A;  4KDU A;  5IM9 A;  2GTU A;  4Q5N A;  2YOI A;  1QXH A;  4MZB A;  4TR0 A;  1W4V A;  2CVB A;  3WGD A;  2B5X A;  2HE3 A;  3TKR A;  2REM A;  3PPU A;  1T4Z A;  1B8X A;  4F0B A;  4GTU A;  4X0X A;  3GYK A;  1Z6N A;  1FVJ A;  3BOA A;  4H86 A;  2K18 A;  3ZZX A;  4RUV A;  3TKQ A;  4XS4 B;  3O3T A;  6GST A;  5IIZ A;  3I9V 2;  2GT5 A;  3IAM 2;  2GS3 A;  2VCV A;  4AGS A;  3BBY A;  3TUE A;  3Q6O A;  1OC3 A;  4FYB A;  2DJ2 A;  4MJB A;  2XBI A;  3FHK A;  1TI3 A;  5IMZ A;  1X9W B;  3G7I A;  4BVX A;  3GKK A;  1XIY A;  4GSN A;  5ECN B;  5ABR A;  4ZB8 A;  3K8N A;  4F03 A;  3D4M A;  3HVX A;  4IJ3 A;  4Z7X A;  2PER A;  3TKS C;  1AAZ A;  2X8C A;  1A2L A;  4TOP A;  2CV4 A;  3M8N A;  1FO5 A;  2LNT A;  2G2Q A;  2JAD A;  3ME8 A;  1QFN A;  1LU4 A;  4HJM A;  2P5R A;  1OYJ A;  1HNB A;  3MAK A;  3D4T A;  4FYU A;  1VF3 A;  2XPE A;  1EGO A;  2JL4 A;  5DCG A;  3WYW A;  4FIW A;  4RQX A;  3TKP A;  3APQ A;  2AYT A;  4K7I A;  3NIV A;  2B6M A;  3VUR A;  1J9B A;  3CRU A;  3EUR A;  5D93 A;  1Z9H A;  3GX8 A;  2M46 A;  2QKE A;  14GS A;  3F8U A;  3IXR A;  3JCM L;  3CSH A;  2OE3 A;  3QPM A;  5F07 A;  1QMV A;  4TXO B;  3TJF A;  3S9F A;  4NHZ A;  10GS A;  4EIQ A;  2C3N A;  3EC3 A;  2VD1 A;  3N5O A;  4ULX A;  4OFM A;  1JLV A;  1GTI A;  2WFC A;  4X4J A;  1XFL A;  2OE0 A;  4XS4 A;  3LYK A;  1GWC A;  1TI1 A;  2F8A A;  2CQ9 A;  5CRE A;  4BWS A;  4GSS A;  1M2B A;  2KP2 A;  3U6V A;  1ZYP A;  5DJM A;  2M80 A;  5A4W A;  4GRF A;  2CAI A;  2YAN A;  2ON7 A;  3D21 A;  4GQF A;  2R37 A;  1F9M A;  3GKX A;  1A8Y A;  3H4K A;  2J9H A;  3HJP A;  4ECJ A;  3UOM A;  4HDE A;  2HSY A;  3ZIT A;  4Z2R A;  3LXZ A;  4I5Q A;  4OMV A;  4EC0 A;  3ZVJ D;  1KTE A;  4MJE A;  4IQA A;  2VL2 C;  2TRC P;  4DSS B;  4PQ1 A;  4DSQ A;  1U6T A;  3A5I A;  3IR4 A;  3MDK A;  3C8E A;  3QAG A;  1GSD A;  5CP1 A;  2KLX A;  4F0C A;  3HCZ A;  1ZYE A;  2VLU A;  5DAL B;  1YKC A;  4TXO A;  3FEU A;  1X5E A;  4IVF A;  3UMA A;  4OO5 A;  1X9M B;  2PVQ A;  3KD0 A;  2H0I A;  2H75 A;  2YZH A;  3MNG A;  5D9X A;  2GSR A;  5B6M A;  4J56 E;  2AB6 A;  2C4J A;  4Q5F A;  3TJJ A;  4DEJ A;  5HFK A;  1T00 A;  3BJ5 A;  3TKS A;  2HSH A;  1V58 A;  1HD2 A;  4K0G A;  1OE8 A;  2O8V B;  3ZVJ A;  4KE3 A;  5IQY A;  2C8U A;  5DCH A;  4BA7 A;  1PX6 A;  3FY7 A;  5DBQ A;  1G6W A;  1UVZ A;  1TK8 B;  1OC8 A;  1SEN A;  2BJX A;  4OFT A;  4TKY A;  4X43 A;  1EZK A;  1A0F A;  1USB A;  2N5B A;  3C71 A;  2FCH A;  1JZR A;  1SKW B;  2YWI A;  2CA8 A;  1ZL9 A;  5ECK B;  4G0I A;  4K7O A;  3PH9 A;  4G9H A;  4HUA A;  5EPF A;  4DSS A;  4KSM A;  4PX1 A;  4O32 A;  2X99 A;  1TJD A;  2QA1 A;  4YAP A;  1T1V A;  1V9W A;  4JE1 A;  3ZRD A;  2MBS A;  6GSW A;  1GSS A;  3IRA A;  4D73 B;  1XPV A;  4MK3 A;  4XRA A;  5GAP D;  4MJC A;  1O73 A;  4MPF A;  3DML A;  1MD3 A;  5DAL A;  2I3Y A;  3RHB A;  3ZFL A;  2DJ0 A;  5L71 A;  1DBY A;  4A5P A;  1K3L A;  3HD5 A;  4V1A g;  5G1K A;  2L57 A;  4P3Y B;  3DKS A;  2E2G A;  1HNA A;  2IME A;  4MCU A;  2CX3 A;  4ECB A;  4IKH A;  1PGT A;  1TK5 B;  2DJ3 A;  3LGC A;  4KAE A;  3HDC A;  1PL1 A;  4KND A;  3TJB A;  3DXB A;  2HRF A;  1PN9 A;  1WP0 A;  1VGL A;  1GSQ A;  5HR3 A;  4KCA A;  3ZRE A;  3HVV A;  1TP9 A;  2JSY A;  4IQ1 A;  2H6X A;  3TKS E;  8GSS A;  1T7P B;  3RHC A;  5C04 A;  2DIY A;  2O7K A;  1HQO A;  3HHV A;  2NBS A;  3ZIV A;  1KNG A;  2GLR A;  4WF4 A;  1YZX A;  1XW9 A;  1SYX A;  3P7X A;  1ERW A;  4ACS A;  1LJR A;  22GS A;  2YJH A;  4WF5 A;  4J57 E;  4DVC A;  3KCM A;  5KN3 A;  4XIH A;  1Q98 A;  5KOW A;  4V2L A;  2NPB A;  1AIU A;  1F6M C;  3HZ4 A;  2HFD A;  4N0Z A;  1YF0 A;  3LOR A;  4D73 A;  1R7H A;  1WOU A;  11GS A;  1XWC A;  2JAC A;  5DDL A;  3H8Q A;  4O5R A;  2CX4 A;  1V2A A;  3GX0 A;  3C1S A;  3LJR A;  3J7Y b;  4I2U A;  1XZO A;  2LUS A;  4CHS A;  3RPN A;  2DJJ A;  2YWN A;  2P31 A;  1TW9 A;  3A3T A;  4TR1 B;  4Q5Q A;  1GSU A;  2B1K A;  4WXT A;  1T8E B;  2IFQ B;  2AJQ B;  3RDW A;  2GZY A;  2OAC A;  2DMM A;  2IJY A;  3GH6 A;  2KUC A;  2ZNM A;  4IN0 A;  3C73 A;  3FZ9 A;  4GCI A;  3F4T A;  4K6X A;  4L5L A;  4WR5 A;  1SJ6 A;  1SK1 A;  3H79 A;  1WPI A;  1XXU A;  3L9U A;  4LMW A;  4ZL9 A;  2MZC A;  2LRT A;  5ECM B;  4JRR A;  2FHE A;  2PUK C;  3GIX A;  2FWE A;  2VD0 A;  3VK9 A;  4AJ6 A;  2B7K A;  1S3C A;  1GUL A;  1MEK A;  3IV4 A;  1THX A;  4WEY A;  7GSS A;  4WR4 A;  1FW1 A;  3KM6 A;  1M9A A;  3HYP A;  2OE1 A;  19GS A;  1ZYQ B;  2VCX A;  1GSE A;  2FNO A;  4ID0 A;  3A2V A;  1MTC A;  2X4A A;  1F37 A;  1XW6 A;  1YEP A;  2MMZ A;  2R2J A;  3GL5 A;  3GSS A;  5HR1 A;  2C0F A;  2GGT A;  2NVL A;  3KTB A;  1OC9 B;  3Q18 A;  4EXJ A;  1ZCP A;  3EWL A;  3IK9 A;  5IMV A;  5D9T A;  1X5C A;  1YKA A;  5EL8 A;  3C1R A;  2YV9 A;  2DLX A;  3H93 A;  4TR1 A;  2G0F A;  1AXD A;  4HU9 A;  2IFQ A;  3SWL A;  1SYR A;  1A24 A;  2F9S A;  3GH9 A;  1ACV A;  3DGQ A;  4L8E A;  1BG5 A;  3E0U A;  1GH2 A;  1SK2 A;  1GRX A;  4IP1 A;  1XCC A;  3IK7 A;  20GS A;  5IMA A;  2PWJ A;  1X5D A;  3W6G A;  4YKF A;  3J7Y k;  3LYP A;  2PBJ A;  2LQQ A;  3O6T A;  4KGI A;  2LKU A;  4ICY A;  2MMA A;  3UVH A;  1WE0 A;  4MF7 A;  4HQS A;  1Y6E A;  4KX4 A;  1WMJ A;  3IBH A;  1RK4 A;  4Z2U A;  3GKM A;  5IOW A;  5IO2 A;  3L9S A;  2JSZ A;  1EP7 A;  5IMC A;  1PQN A;  2LST A;  4MZC A;  1PL2 A;  3R3E A;  3DEX A;  3W8S A;  5IPG A;  5B7C A;  3TRQ A;  4MMM A;  3TDG A;  5DQY A;  5GST A;  3IE3 A;  3QDN A;  4ILF A;  5KN1 A;  3DVW A;  3TB2 A;  4ISD A;  4WBJ A;  3GNJ A;  2PU9 C;  3VI7 A;  1OC9 A;  2H01 A;  2A2R A;  4E8E A;  4YAV A;  1K0D A;  4NV5 A;  1TKD B;  3LW9 A;  2H0H A;  4FYC A;  3QFB C;  2GDR A;  4K5R A;  1TRS A;  1FB6 A;  2H66 A;  5D8I A;  4IJI A;  4HOJ A;  1T3B A;  2VO4 A;  4POK A;  4KW6 A;  5G1L A;  5JCG A;  1FAA A;  3KH7 A;  4AF2 A;  1J08 A;  4YQU A;  1M9B A;  4AJ7 A;  2HNL A;  4RI7 A;  4EKZ A;  1XW5 A;  2F51 A;  2FWH A;  2C3T A;  3VWV A;  3E9J B;  1TK0 B;  1AC1 A;  1TRU A;  3F9U A;  2HRN A;  1N2A A;  1PKW A;  5JWR B;  3VFI A;  3F3R A;  2DIZ A;  2VAF A;  1SL0 B;  2QSI A;  3FZ5 A;  5DAK B;  4K2X A;  1M0U A;  2O89 A;  1QUW A;  4ZL8 A;  1X9S B;  3RBT A;  4TXV A;  1J0F A;  3P8W A;  2H30 A;  1KEB A;  2B1L A;  3EIN A;  5KN2 A;  2E7P A;  3VWU A;  2P0G A;  2H1B A;  1HNC A;  1TRW A;  1JLW A;  5AIS A;  2FLS A;  1JFU A;  5CYY A;  4MDC A;  4KA0 A;  4MLY A;  3PIN A;  4OWY A;  5D73 A;  2DC5 A;  3I6A A;  2VOC A;  2YZU A;  5D9V A;  3D0Z A;  3QD9 A;  2VLT A;  1KBN A;  2LQO A;  1M2A A;  4DSR A;  4JR4 A;  4POL A;  2F8F A;  2CVD A;  3IPZ A;  4G2E A;  1BAY A;  5ECO B;  1B9Y C;  3LFL A;  2MYG A;  3TJG A;  4HI7 A;  2L6C A;  1SKS B;  1XWG A;  2H19 A;  2IN3 A;  2IL3 A;  3LXT A;  3EPT A;  4GWR A;  4XTS A;  2ON5 A;  4ZBA A;  4XRD A;  2EIR A;  2V41 A;  1ML6 A;  3EVI A;  3D5J A;  3AY8 A;  2R3X A;  4TVE A;  1XVW A;  4OD7 A;  1I5G A;  3CBU A;  3M9J A;  4EUY A;  2X49 A;  5ECQ B;  2CT6 A;  2V32 A;  3OR5 A;  2UZ8 A;  4KSO A;  1RW1 A;  4JZQ A;  1VF2 A;  4Q5R A;  1QQ2 A;  2LRN A;  4KDY A;  3BCI A;  2VLV A;  5G2Z A;  5INY A;  1PSQ A;  2HRA A;  4JBB A;  4IBP A;  1V40 A;  4G0K A;  1BJX A;  2GQL A;  1O81 A;  2C0D A;  1YY7 A;  5DAK A;  3VPT A;  2AAW A;  4FQU A;  1X0R A;  3GKN A;  5KN0 A;  3UL3 A;  1ON4 A;  1XVQ A;  4WBR D;  2OBK A;  1Z7R A;  4IHU A;  3MWH A;  2B5Y A;  2CVK A;  2A4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...