2XBQA

Crystal structure of reduced schistosoma mansoni thioredoxin pre- protein at 1.7 angstrom
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
105
structure length
105
Chain Sequence
b'SELIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKYDAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Structural and Functional Characterization of Schistosoma Mansoni Thioredoxin.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Oxidoreductase
total genus 32
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2010-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2xbqA00
3DRNA 3IHQA 3IV4A 1TTZA 1HNAA 2E7PA 1TDIA 3FY7A 3O6TA 5IPHA 3HKRA 3QMXA 2LQOA 2L59A 2YV7A 4XIHA 3EU4A 1BEDA 1FVJA 2KHPA 4MZBA 1URMA 1V2AA 2MBTA 2V2GA 4K6XA 4PX1A 6GSXA 2O8VB 2VL3A 3FZ5A 4ECJA 4OCEA 3KMOA 1SU9A 2CX3A 2FWGA 4Q5FA 4JRRA 3UJ1A 4CHSA 5KEJA 1KBNA 3IR4A 4DSSB 3G7JA 1SD9A 3GIXA 4ID0A 1OAZA 4IQAA 4WF4A 1TK5B 2J23A 2A4VA 4MA9A 2WS2A 4XHMA 2CVKA 3IXRA 5CO3A 3O3TA 1T3BA 2VL9A 1OC9B 5ABRA 1T1VA 2VCWA 1PMTA 5D9XA 5ECIB 4KDUA 5J3RA 2OKAA 4IELA 1FB6A 3IPZA 1PL1A 2OE0A 3DEXA 3LQ7A 6GSWA 2KUCA 2FHEA 2F9SA 3L9VA 4EE0A 5FT3A 3HXSA 2M72A 4JU5A 3ZFLA 3ME7A 2TRXA 3H8QA 1YEXA 3ZZXA 1O7UA 3M9JA 4IN0A 4IBPA 2WDUA 1U87A 3I69A 2DLXA 2BJXA 1XBSA 2A2RA 4IVFA 2HYXA 4OFMA 2TRCP 1YEPA 3KCMA 1ZOFA 3KH7A 4WEYA 4I97A 4I6XA 3E3EA 3H93A 4KH7A 2I81A 5JCWA 1SKWB 2AJQB 1WWJA 2LRTA 2JSYA 3HDCA 2GVPA 5E59A 3GTUA 2WGRA 1XCCA 3GKXA 4G9HA 3GA4A 4TW5A 5KN0A 2JZRA 3ZTLA 2VLVA 4L5OA 3LG6A 3KH9A 2HSYA 2IPAA 4ZBDA 3SWLA 3UBLA 4LLRA 4MCUA 1J0FA 3KP9A 3FYGA 2C1YA 5J5NA 1JHBA 3K8NA 2PVOC 2B5EA 2H74A 5DQYA 3TKRA 2GDRA 2XPDA 3TKSE 3TCOA 4AJ6A 4JEDA 5IPGA 3UVTA 5A4WA 3RBTA 4Q5NA 4I5QA 1XFLA 2VCTA 4FO5A 2FWHA 2P5QA 2PUKC 4BPYA 1PSQA 2LS5A 1O81A 2PWJA 4OO4A 5F07A 2FCHA 1B8XA 1GSDA 1EP8A 4HU9A 3CSHA 1NHYA 1PN9A 4ZB9A 3VPTA 1E6BA 1EOHA 5DDLA 3H79A 4TVEA 2C8UA 2ON5A 1O8XA 5L71A 3HZ4A 4YAPA 3PR8A 5HFIA 2FWEA 1MD4A 4K7NA 2X8GA 3M9KA 3US3A 3FHKA 2WRTA 4K7OA 2XBQA 1YZXA 3RHBA 5LD0A 5FWGA 3HCZA 1VF2A 4ZIJA 1GUMA 2OACA 8GSSA 2VM2A 2DMLA 3UARA 3BCIA 3UL3A 2HE3A 4N11A 2X8HA 2YP6A 3LYPA 3GV1A 1H4OA 1G7EA 5IMZA 2YWNA 5EPFA 2VIMA 4HJ2A 1HD2A 1Z9HA 2CV4A 4OFNA 1Q98A 1PQNA 2DIZA 1PX6A 1AQWA 1YDKA 3TKSC 2YWOA 4N30A 4V1Ag 3A5WA 1UVZA 2VAFA 3APOA 2HFDA 1NW2A 1OC9A 2GSRA 5CREA 3HY2A 5ID2B 3I6AA 4ZBBA 1TRVA 4KCAA 4NV2A 3VK9A 1GULA 1QMVA 1U3AA 2V32A 1NM3A 4BVXA 1ERWA 4NXIA 3NIVA 5KN3A 1F6MC 4MJCA 2IJYA 4GSTA 1M2BA 1V57A 1PKWA 3CMIA 1PL2A 5D96A 5COHA 3Q74A 4ECCA 3VWUA 2LJRA 2KP1A 3N5OA 4CW9A 2AYTA 2NTOA 4MP4A 2IMEA 4FYBA 4TOPA 1DE2A 3WGDA 4OCFA 3L9SA 3BJ5A 5JWOB 1HNCA 4TR0A 4GQFA 4JBBA 2AUVA 2BTOT 4IJIA 1VGLA 3D0ZA 3GL3A 5IMFA 3ZLPA 5HQPA 2O89A 3QR6A 2IMIA 4HQZA 5J9CA 3UOMA 4LL4B 2MMAA 4MMMA 3EC3A 1F3BA 3GURA 2H1GA 2GSQA 1Z7RA 3L78A 3QOUA 1MDKA 2G0FA 1A2JA 1LBKA 2IMDA 2LTKA 2ES7A 3H1NA 18GSA 1TJDA 5F0GA 2L5LA 3I43A 3TOUA 3QFBC 3FW2A 3U5RE 2CVBA 4K9ZA 1ABAA 3MNGA 22GSA 3QPMA 1EV4A 1SJ6A 1FG4A 2OA7A 2V41A 3BBYA 2LEGA 5DCHA 4MJBA 2XBIA 5G1LA 2CZ3A 5DAKA 4O7HA 3MDKA 4IGJA 1THXA 1ZYQB 1R26A 4YQMA 1BAYA 1B9XC 3P2AA 4IKHA 2CAQA 2ZNMA 3F6FA 1MDIA 1X5EA 3UIWA 3IAS2 2HRFA 4RI7A 3CTGA 1FAAA 5B6NA 2K8SA 2FGXA 1KEBA 2XC2A 2L5OA 4HS1A 1PRXA 3GKMA 4NMUA 3GSSA 4L8EA 5ECRB 3DMLA 2OJLA 1WE0A 1O85A 3M8NA 1AQVA 3LXTA 1YY7A 4F2IA 1S3CA 2DBCA 1BJXA 3UEMA 3DWVA 1K0MA 4IHUA 4IS0A 3MSZA 5GAND 2GGTA 1GWCA 3V1WA 1I5GA 3UAPA 4NAXA 2F51A 1RQMA 4YQVA 4XS4B 5DQSA 3WGXA 2KLXA 2I4AA 2H0GA 3GSTA 4ZL9A 1Q4JA 2VCZA 2K9FA 4V2MA 4GSNA 2JACA 4ACSA 5AIVA 3FR6A 4MPFA 3EWLA 2H6YA 3HJPA 3C1SA 2GSTA 3CYNA 4BL7A 2F8FA 3G7IA 5IMCA 4DVCA 1J9BA 4TR1B 5C04A 2YPMA 3CXGA 3GKNA 3LJRA 1F3AA 4IP6A 4YH2A 2K18A 6GSSA 1DSBA 1G6YA 3VWVA 4PQIA 2ZCTA 5FHIA 3DXBA 3KMNA 4G19A 5C00A 3TJKA 2B5YA 4AJ7A 4IJ3A 2O85A 16GSA 2B6MA 4DSQA 4MF7A 3A2VA 5IOXA 1K3OA 3GRXA 2B3SA 4IW9A 1XWCA 2F3MA 3GL5A 4ZL7A 1EGRA 3PH9A 4EVMA 5G5EA 5GZZB 5IMVA 2O87A 1MD3A 4ZB6A 1G0TA 3LORA 3M3MA 2VM1A 4HJMA 2FUG2 1NHOA 3MWHA 3QDNA 2E0QA 4K0GA 4PNGA 1THOA 1VF3A 1ZCPA 3IAM2 3TKQA 1TXXA 3ZREA 3GMFA 1ZZYA 1QUWA 2PPTA 1YF0A 3F6DA 4NHWA 3DD3A 1K0NA 4PQ1A 4TXOB 1IYHA 2R4VA 3TJGA 1CQHA 1GTAA 1OE7A 3LGCA 4F82A 17GSA 2HXKA 3D4MA 3TRXA 1FO5A 1GLPA 1DBYA 3TRPA 4GSSA 1HNBA 4QL7A 1EGOA 4WF5A 3FZAA 1PKZA 2VL2C 4GQCA 3QAGA 1XXUA 1SENA 4MZCA 2ZUPA 2LRNA 1XOAA 1EZKA 3CBUA 2MBSA 1BG5A 1TK0B 4K1FA 1GSSA 1E2YA 3KTLA 4TXVA 3TJJA 1GTIA 4TN8A 5DALA 4EO3A 3L0HA 4PXOA 1X9MB 1ZMAA 2H66A 2ALBA 4KSOA 2V1MA 2AV4A 3KP8A 4EKZA 1FOVA 1ML6A 1OVNA 2DC5A 4F0CA 1QQ2A 2JZSA 3RDWA 5B8BA 1A8LA 3GYKA 1G6WA 1F37A 2LUSA 2C3QA 1ZYEA 5D8IA 4JZQA 1QFNA 1JZRA 1W89A 5A4VA 2WCIA 3U6VA 2PGTA 5HR3A 1JFUA 4EF0A 4N0VA 5IIZA 1EWXA 2NVLA 5INYA 3HYPA 1BYEA 3QAVA 2BMXA 5G1KA 3GX8A 6GSVA 2HZEB 4YAVA 2H1BA 4PNFA 5JWQB 3D22A 5ECPB 3TOTA 2JU5A 5DJLA 3I9V2 3R2QA 2H0IA 1SL0B 3F4SA 4GLTA 3D5JA 5J4UA 2I1UA 1U88A 3A3TA 5IO2A 1A24A 3TKSA 3M0FA 1YKAA 1SKRB 2B1LA 1XWBA 2QSIA 3VWWA 1Z6NA 5CYYA 3EINA 2LKUA 3JCML 4D73A 1V98A 1Z6MA 5ECKB 2AB6A 4KUNA 3F4RA 2JZTA 2FY6A 4FYUA 1A23A 3W8JA 1V40A 1R5PA 3QCPA 2YZHA 3DKSA 4L0UA 1M99A 1K3YA 3HD5A 2H1DA 5EVOA 2L57A 6GSYA 3VURA 1R5AA 3GUSA 4GTUA 3E0UA 4Q5QA 1XWAA 1ILOA 3L4NA 1BQ7A 2VLUA 4KSMA 3F0IA 5HR1A 1XWKA 2H73A 2VD0A 2WJUA 3F63A 2X64A 5B7CA 2QKEA 2EC4A 4ECBA 3GN3A 5GSSA 3SBCA 3EMPA 4ZBAA 1ZL9A 3M1GA 1JLWA 4MPGA 3ZVJA 2TIRA 4DSSA 1NSWA 1ACVA 4IQ1A 1GSUA 1TRSA 1YF1A 3HA9A 3UMAA 2B7KA 3VPQA 1GNWA 4EDYA 4O32A 1K3LA 4I2TA 2VUPA 3DVWA 3FR3A 2J9HA 5DCGA 5DJMA 4XS1A 1XW6A 3P8WA 3VLNA 2WZ9A 2MMNA 3IC4A 4GF0A 2LQQA 4GWRA 3APQA 4KE3A 2B7JA 4F9ZA 1GSFA 4MJAA 5GAPD 3ISOA 2HRNA 5G2ZA 1M9BA 1U6TA 2P31A 5F06A 4GCIA 2DJ3A 1T4ZA 5A4UA 3D4TA 3ERFA 4OFTA 2H6XA 5IQYA 3ZVJD 4ML1A 4TR3A 4POBA 4EXJA 2K6VA 5D9VA 2GT6A 3G7YA 4ZL8A 1MEKA 2DJ0A 1O6JA 3TJBA 1A0FA 1GTBA 1ERUA 4PGTA 4IP1A 3GFKA 2H6ZA 3J7Yk 3EE2A 1EEJA 3EVIA 2YWIA 5H5QA 3TRQA 5CRWA 4GRFA 4WETA 5LNKe 2LNTA 2YNXA 2DJJA 4EUYA 1OE8A 4N10A 3AY8A 4XTSA 3ERWA 2R37A 1B48A 2FA4A 2IL3A 1TU7A 1CQGA 1YJ6A 3FEUA 2JL4A 1N2AA 2DIYA 2OE3A 4HI7A 3CRUA 4WBJA 5HR0A 4BWSA 5B6MA 2F8AA 1M0UA 1UC7A 1WMJA 2LRCA 4J57E 2P0GA 5DVBA 2DJKA 1JZDA 3KM6A 4ZB8A 4HDEA 1M9AA 1KTEA 1SD8A 3IBHA 5EY6A 1TP9A 4BVYA 2GQMA 4HOJA 2X8CA 2V6OA 5CRGA 3KTBA 1EP7A 3LWAA 4ZILA 2R2JA 11GSA 1SL1B 4OMVA 1MDJA 3GTUB 2IN3A 3Q6OA 5E4WA 5IMDA 2HT9A 5G5FA 1Z3EA 1WRYA 3EU3A 2H71A 3ZL5A 4WKWA 3BD2A 3DIEA 3ZITA 1JZWA 2NDOA 1GSEA 2O7KA 2Z9SA 3PGTA 1J08A 1X0RA 2PERA 2V6KA 4FH8A 4LA1A 4V2NA 2RM5A 2VCVA 3H4KA 4MH2A 3ZMKA 4H86A 2CZ2A 3UVHA 2X99A 1VRSD 4HU7A 1WJKA 1QXHA 2MMOA 3VI5A 1TOFA 2IMFA 3BOAA 2WULA 1A0RP 1GP1A 1PA3A 5CP1A 2CAIA 4TR4A 3ERGA 2I3YA 1XVWA 2VOCA 3QD9A 1S3DA 1EOGA 3HZ8A 3CRTA 1XPVA 2QGVA 2YJHA 1T00A 1V58A 4I2UA 1K0BA 1TI3A 3FK8A 2C4JA 4F03A 3E9JB 1USBA 5ENUA 3MAKA 3ZYWA 2CT6A 4L5LA 2H70A 2IMKA 2RLIA 3W6GA 2AHEA 4EDZA 1XVQA 5ID2A 2HLSA 14GSA 3D6IA 4ILFA 4QL9A 2ON7A 1DE1A 2MZCA 2RUFA 3LEFA 2GZPA 5IM9A 3FR9A 2NBSA 5ELAA 1AUCA 3ZFBA 2VL2A 1RK4A 3A2XA 3RPPA 4RUVA 1UN2A 4KA0A 2NPBA 1UA5A 4MH3A 6GSTA 3DVXA 4O92A 4XS6A 3HJMA 10GSA 3GX0A 5CAXA 5CNWA 2VO4A 1MTCA 1AC1A 2YWMA 4NV5A 1F9MA 3KIJA 1FVKA 3C73A 3N9JA 4TKYA 2GQKA 4LL1B 2VD1A 5A5KA 3S9FA 2HZFA 1XWGA 2LV3A 1ERVA 3CSJA 2WB9A 5HR2A 1GL8A 4KDXA 1OKDA 2GQLA 2H75A 2N5FA 1Z7PA 2DJ1A 6GSUA 3OR5A 3EURA 1K0DA 4HZ2A 2N5BA 2CVDA 1TRUA 5AN1A 5CRDA 5F05A 3KEBA 4KGIA 2C0GA 2R5GA 3D21A 1ON4A 1FB0A 4JE1A 1GRXA 1R4WA 3G9BA 2C0FA 4V2LA 2A2SA 1B4QA 3RAZA 1Z5YE 2LSTA 3IDVA 3KZQA 4DSRA 4KX4A 2FD3A 3WT2A 4PURA 1G7OA 5DBQA 4MF6A 1VF1A 1XIYA 2H8LA 4X1UA 2P5RA 4POMA 2PN8A 2PMTA 2LNSA 2H19A 1ST9A 1X5CA 1XZOA 3ME8A 1FHEA 2DMMA 2L4CA 1EEMA 4HZ4A 3EYTA 4G10A 3F4TA 4DEJA 1B4PA 1V9WA 2OBIA 2YN1A 5J9BA 1JZOA 3L9UA 3DGQA 3QFAC 5ECHB 1A8YA 2CA8A 1GTUA 5KN1A 1GH2A 2HNLA 2E2GA 1AAZA 1LJRA 2H1AA 4WXTA 5IOWA 2IFQB 1GUKA 1TK8B 3ZIVA 1TKDB 4PUAA 4K2DA 2GS3A 1SJIA 3GKKA 2EIOA 4LMVA 4EL1A 3GH6A 2IIYA 2EIQA 2L6CA 4XCSA 4JR4A 1U3IA 2GSSA 3LXZA 5ECNB 1SJZA 2YCDA 1M2DA 1PX7A 5IMAA 3TGZA 4ISDA 4BA7A 5IO0A 2C0DA 3C71A 1HQOA 4MK3A 2XPEA 2KP2A 1AIUA 3APSA 4XS4A 2I9HA 3HJOA 3LYKA 4G2EA 4HEA2 1K0OA 4AJ8A 2EIRA 2M80A 2JADA 4YQUA 2RM6A 4X43A 4TRXA 1PGTA 1X5DA 4J2FA 1LU4A 3VFIA 2GZZA 4NWYA 4I8BA 4TR1A 5DAKB 2L4QA 4K8MA 2C0EA 3TDGA 4Z7XA 2WFCA 5H5RA 4ML6A 2B1KA 19GSA 4HUAA 1X9WB 4E8HA 1HYUA 7GSSA 3VWXA 1WIKA 2HSHA 4OD7A 3FZ4A 4PQHA 1SYXA 1RW1A 2YJ7A 2H0HA 4RI6A 1XW5A 3IE3A 2PBJA 4O5RA 3Q18A 4CDOA 3ZIJA 1GLQA 2GTUA 4ECIA 1Y6EA 4MLYA 2H30A 2MYGA 3P7XA 1FW1A 1GSYA 2C3TA 5ELGA 1C72A 2CX4A 2VLTA 1TW9A 3IK9A 1WOUA 1OC3A 3IRAA 3CTFA 4RQRA 3NOFA 1H75A 3F8UA 1SYRA 5EL8A 4MF5A 3IK7A 3TUEA 5HFGA 1M7TA 3KD0A 4LMWA 12GSA 1EV9A 4WR5A 3J7Yb 5HFKA 1KNGA 2H76A 1QGVA 2CQ9A 3TB2A 4TXOA 1W4VA 5ECQB 1VF4A 2PU9C 2PVQA 1BX9A 3KGKA 2YOIA 13GSA 2HI7A 4MABA 2OE1A 5ECLB 2GT5A 5ECSA 4EC0A 1XW9A 1GNEA 3HVSA 2LJAA 3UBKA 1TRWA 3CSIA 4POKA 5H5SA 4L0WA 2VCXA 2KOKA 3BCKA 3WGEA 1OYJA 4AF2A 3LFLA 5AGYA 4ZXGA 3PINA 3IA1A 4BWQA 2MMZA 2D2ZA 1N8JA 4HQSA 3A2WA 1PD21 2FLSA 3C7MA 4F0BA 3F3RA 3HVXA 2K8VA 4MDCA 1ERTA 1O73A 3P90A 5GSTA 5AISA 3C8EA 3VI7A 4FIWA 4K7IA 5LCZA 2VCQA 1XOBA 3WYWA 3C1RA 4FYCA 2L6DA 2FNOA 1GSQA 5D9WA 5G30A 1YQ1A 2XHFA 1M2AA 2OADA 4Q5RA 9GSSA 2GZYA 3W8SA 3HHVA 4NHZA 5JCUA 5J41A 3RHCA 1T4YA 1I9DA 5JCGA 2IFQA 4WBRD 2FWFA 1K0AA 2RIIA 1QK8A 3FKFA 4XRAA 2RUEA 1TU8A 1F2EA 2REMA 1S3AA 3FRCA 4E8EA 5G31A 1B9YC 5ECOB 1SKSB 2YV9A 1Y25A 1T7PB 2E2MA 4N0ZA 2HZEA 3GHAA 2H72A 3EMXA 1TI1A 4KCEA 4POLA 4KB3A 2IWTA 1A2MA 2M46A 5F8BA 1WP0A 2FA8A 5ECMB 2YZUA 3RPNA 4MJEA 3GNJA 4NPBA 3ED3A 2JSZA 1OC8A 4KDYA 5DALB 2G2QA 4RQXA 1A2LA 2N5AA 2R3XA 4QQ7A 1R7HA 20GSA 4K0NA 5CRHA 1JLVA 3KXOA 1X9SB 4OO5A 5KN2A 1SK1A 2DJ2A 3O76A 5D93A 3QAWA 2QC7A 4V1Ap 4GXZA 1ZGNA 4XRDA 4PUFC 3NZNA 2GLRA 4WR4A 2R6KA 2H01A 2C80A 4KNDA 5AIXA 5JWRB 1OKTA 1AXDA 3LSZA 3WD6A 2LJKA 1DUGA 3WT1A 1AQXA 3F3QA 2YANA 2C3NA 4MZWA 3FZ9A 2OBKA 3KJYA 1AW9A 3Q19A 4KW6A 1K0CA 1T8EB 1YKCA 4P3YB 3TJFA 4OWYA 3HVVA 4ULXA 3DYRA 4J56E 3GH9A 1SK0A 4AGSA 2B5XA 1O8WA 1SL2B 4JR6A 1SK2A 2DSAA 1IYIA 3ZMLA 3ZRDA 5B8AA 4KAEA 3IOSA 3F9UA 2AAWA 4D73B 5D73A 4X0XA 5D9TA 1GUHA 1WPIA 3TKPA
chains in the Genus database with same CATH superfamily
3DRNA 3IHQA 3IV4A 1TTZA 1HNAA 2E7PA 1TDIA 3FY7A 3O6TA 5IPHA 3HKRA 3QMXA 2LQOA 2L59A 2YV7A 4XIHA 3EU4A 1BEDA 1FVJA 2KHPA 4MZBA 1PFOA 1URMA 1V2AA 2MBTA 2V2GA 4K6XA 4PX1A 6GSXA 2O8VB 2VL3A 3FZ5A 4ECJA 4OCEA 3KMOA 1SU9A 2CX3A 2FWGA 4Q5FA 4JRRA 3UJ1A 4CHSA 5KEJA 1KBNA 3IR4A 4DSSB 3G7JA 1SD9A 3GIXA 4ID0A 1OAZA 4IQAA 4WF4A 1TK5B 2J23A 2A4VA 4MA9A 2WS2A 4XHMA 2CVKA 3IXRA 5CO3A 3O3TA 1T3BA 2VL9A 1OC9B 5ABRA 1T1VA 2VCWA 1PMTA 5D9XA 5ECIB 4KDUA 5J3RA 2OKAA 4IELA 1FB6A 3IPZA 1PL1A 2OE0A 3DEXA 3LQ7A 6GSWA 2KUCA 2FHEA 2F9SA 3L9VA 4EE0A 5FT3A 3HXSA 2M72A 4JU5A 3ZFLA 3ME7A 2TRXA 3H8QA 3IC8A 1YEXA 3ZZXA 1O7UA 3M9JA 4IN0A 4IBPA 2WDUA 1U87A 4K5RA 3I69A 2DLXA 2BJXA 1XBSA 2A2RA 4IVFA 2HYXA 4OFMA 2TRCP 1YEPA 3KCMA 1ZOFA 3KH7A 4WEYA 4I97A 4I6XA 3E3EA 3H93A 4KH7A 2I81A 5JCWA 1SKWB 2AJQB 1WWJA 2LRTA 2JSYA 3HDCA 2GVPA 5E59A 3GTUA 2WGRA 1XCCA 3GKXA 4G9HA 3GA4A 4TW5A 5KN0A 2JZRA 3ZTLA 2VLVA 4L5OA 3LG6A 3KH9A 2HSYA 2HRKA 2IPAA 4ZBDA 3EPTA 3SWLA 3UBLA 4LLRA 4MCUA 1J0FA 3KP9A 3FYGA 2C1YA 5J5NA 1JHBA 3K8NA 2PVOC 2B5EA 2H74A 5DQYA 3TKRA 2GDRA 2XPDA 3TKSE 3TCOA 4AJ6A 4JEDA 5IPGA 3UVTA 5A4WA 3RBTA 2R0CA 4Q5NA 4I5QA 1XFLA 2VCTA 4FO5A 2FWHA 2P5QA 2PUKC 4BPYA 1PSQA 2LS5A 4BVYB 1O81A 2PWJA 4OO4A 5F07A 2FCHA 1B8XA 1GSDA 1EP8A 4HU9A 3CSHA 1NHYA 1PN9A 4ZB9A 3VPTA 1E6BA 1EOHA 5DDLA 3H79A 4TVEA 2C8UA 2ON5A 1O8XA 5L71A 3HZ4A 4YAPA 3PR8A 5HFIA 2FWEA 1MD4A 4K7NA 2X8GA 3M9KA 3US3A 3FHKA 2WRTA 4K7OA 2XBQA 1YZXA 3PPUA 3RHBA 5LD0A 5FWGA 3HCZA 1VF2A 4ZIJA 1GUMA 2OACA 8GSSA 2VM2A 2DMLA 3UARA 3BCIA 3UL3A 2HE3A 4N11A 2X8HA 2YP6A 3LYPA 3GV1A 1H4OA 1G7EA 5IMZA 2YWNA 5EPFA 2VIMA 4HJ2A 1HD2A 1Z9HA 2CV4A 4OFNA 1Q98A 1PQNA 2DIZA 1PX6A 1AQWA 5KOWA 1YDKA 3TKSC 2YWOA 4N30A 4V1Ag 3A5WA 1UVZA 2VAFA 3APOA 2HFDA 1NW2A 1OC9A 2GSRA 5CREA 3HY2A 5ID2B 3I6AA 4ZBBA 1TRVA 4KCAA 1FOHA 4NV2A 3VK9A 1GULA 1QMVA 1U3AA 2V32A 1NM3A 4BVXA 1ERWA 4NXIA 3NIVA 5KN3A 1F6MC 4MJCA 2IJYA 4GSTA 2R0GA 1M2BA 1V57A 1PKWA 3CMIA 1PL2A 5D96A 1M3IA 5COHA 3Q74A 4ECCA 3VWUA 2LJRA 2KP1A 3N5OA 4CW9A 4Z2TA 2AYTA 2NTOA 4MP4A 2IMEA 4FYBA 4TOPA 1DE2A 4BIKA 3WGDA 4OCFA 3L9SA 3BJ5A 5JWOB 1HNCA 4TR0A 4GQFA 4JBBA 2AUVA 2BTOT 4IJIA 1VGLA 3D0ZA 3GL3A 4K2XA 5IMFA 3ZLPA 5HQPA 2O89A 3QR6A 2IMIA 4HQZA 5J9CA 3UOMA 4LL4B 2MMAA 4MMMA 3EC3A 1F3BA 3GURA 4K5SA 2H1GA 4MNNA 2GSQA 1Z7RA 3L78A 3QOUA 1MDKA 1XG8A 2G0FA 1A2JA 1LBKA 2QA2A 2IMDA 2LTKA 2ES7A 3H1NA 18GSA 1TJDA 5F0GA 2L5LA 3I43A 4PTSA 3TOUA 3QFBC 3FW2A 3U5RE 2CVBA 4K9ZA 1ABAA 3MNGA 3HVNA 22GSA 3QPMA 1EV4A 1SJ6A 1FG4A 2OA7A 2V41A 3BBYA 2LEGA 5DCHA 4MJBA 2XBIA 5G1LA 2CZ3A 5DAKA 4O7HA 3MDKA 4IGJA 1THXA 1ZYQB 1R26A 4YQMA 1BAYA 1B9XC 4CY8A 3P2AA 4IKHA 2CAQA 2ZNMA 3F6FA 1MDIA 1X5EA 3UIWA 3IAS2 2HRFA 3LW9A 4RI7A 3CTGA 1FAAA 5B6NA 2K8SA 2FGXA 1KEBA 2XC2A 2L5OA 4HS1A 1PRXA 3GKMA 4NMUA 3GSSA 4L8EA 5ECRB 3DMLA 2OJLA 1WE0A 1O85A 3M8NA 1AQVA 3LXTA 1YY7A 4F2IA 1S3CA 2DBCA 1BJXA 3UEMA 3DWVA 1K0MA 4IHUA 4IS0A 3MSZA 5GAND 2GGTA 1GWCA 3V1WA 1I5GA 3UAPA 4NAXA 2F51A 1RQMA 4YQVA 4XS4B 5DQSA 3WGXA 2KLXA 2I4AA 2H0GA 3GSTA 4ZL9A 1Q4JA 2VCZA 2K9FA 4V2MA 4GSNA 2JACA 4ACSA 5AIVA 3FR6A 4MPFA 3EWLA 2H6YA 3HJPA 3C1SA 2GSTA 3CYNA 4BL7A 2F8FA 3G7IA 5IMCA 4DVCA 1J9BA 4TR1B 5C04A 2YPMA 3CXGA 3GKNA 3LJRA 1F3AA 4IP6A 4YH2A 2K18A 6GSSA 1DSBA 1G6YA 3VWVA 4PQIA 3A5IA 2ZCTA 5FHIA 3DXBA 3KMNA 4G19A 5C00A 3TJKA 2B5YA 4AJ7A 4IJ3A 2O85A 16GSA 2B6MA 4DSQA 4MF7A 3A2VA 5IOXA 1K3OA 3GRXA 2B3SA 4IW9A 1XWCA 2F3MA 3GL5A 4ZL7A 1EGRA 3PH9A 4EVMA 5G5EA 5GZZB 5IMVA 2O87A 1MD3A 4ZB6A 1G0TA 3LORA 3M3MA 2VM1A 4HJMA 2FUG2 1NHOA 3MWHA 3QDNA 2E0QA 4K0GA 4PNGA 1THOA 1VF3A 1ZCPA 3IAM2 3TKQA 1TXXA 3ZREA 3GMFA 1ZZYA 1QUWA 2PPTA 1YF0A 3F6DA 4NHWA 3DD3A 1K0NA 4PQ1A 4TXOB 1IYHA 2R4VA 3TJGA 4YKGA 1CQHA 1GTAA 1OE7A 3LGCA 4F82A 17GSA 2HXKA 3D4MA 3TRXA 1FO5A 1GLPA 1DBYA 3TRPA 4GSSA 3R3EA 1HNBA 4QL7A 1EGOA 4WF5A 3FZAA 1PKZA 2VL2C 4GQCA 3QAGA 1XXUA 1SENA 4MZCA 2ZUPA 2LRNA 1XOAA 1EZKA 3CBUA 2MBSA 1BG5A 1TK0B 4K1FA 1GSSA 1E2YA 3KTLA 4TXVA 3TJJA 1GTIA 4TN8A 5DALA 4EO3A 3L0HA 4PXOA 1X9MB 1ZMAA 2H66A 4YKFA 2ALBA 4KSOA 2V1MA 2AV4A 3KP8A 4EKZA 1FOVA 1ML6A 1OVNA 2DC5A 4F0CA 1QQ2A 2JZSA 3RDWA 5B8BA 1A8LA 3GYKA 1G6WA 1F37A 2LUSA 2C3QA 1ZYEA 5D8IA 4JZQA 1QFNA 1JZRA 1W89A 5A4VA 2WCIA 3U6VA 2PGTA 5HR3A 1JFUA 4EF0A 4N0VA 5IIZA 1EWXA 2NVLA 5INYA 3HYPA 1BYEA 3QAVA 2BMXA 2X49A 3GX8A 5G1KA 6GSVA 2HZEB 4YAVA 2H1BA 2UZ8A 4PNFA 5JWQB 3D22A 5ECPB 3TOTA 2JU5A 5DJLA 3I9V2 3R2QA 2H0IA 1SL0B 3F4SA 4GLTA 3D5JA 5J4UA 2I1UA 1U88A 3A3TA 5IO2A 1A24A 3TKSA 3M0FA 1YKAA 1SKRB 2B1LA 2DKHA 3FMWA 1XWBA 2QSIA 3VWWA 1Z6NA 5CYYA 3EINA 2LKUA 3JCML 4D73A 1V98A 1Z6MA 5ECKB 2AB6A 4KUNA 3F4RA 2JZTA 2FY6A 4FYUA 1A23A 3W8JA 1V40A 1R5PA 3QCPA 2YZHA 3DKSA 4L0UA 1M99A 1K3YA 3HD5A 2H1DA 5EVOA 2L57A 6GSYA 3VURA 1R5AA 3GUSA 4GTUA 3E0UA 4Q5QA 1XWAA 1ILOA 3L4NA 1BQ7A 2VLUA 4KSMA 3F0IA 5HR1A 1XWKA 2H73A 2VD0A 2WJUA 3F63A 2X64A 4O5QA 5B7CA 2QKEA 2EC4A 4ECBA 3GN3A 5GSSA 3SBCA 3EMPA 4ZBAA 1ZL9A 3M1GA 1JLWA 4MPGA 3ZVJA 2TIRA 4USSA 4DSSA 5BRTA 1NSWA 1ACVA 4IQ1A 1GSUA 1TRSA 1YF1A 3HA9A 3UMAA 2B7KA 3VPQA 1GNWA 4EDYA 4O32A 1K3LA 4I2TA 2VUPA 3DVWA 3FR3A 2J9HA 5DCGA 4XS1A 5DJMA 1XW6A 3P8WA 3VLNA 2WZ9A 2MMNA 3IC4A 4GF0A 2LQQA 4GWRA 3APQA 4KE3A 2B7JA 4F9ZA 1GSFA 4MJAA 5GAPD 3ISOA 2HRNA 5G2ZA 1M9BA 1U6TA 2P31A 5F06A 4GCIA 2DJ3A 1T4ZA 5A4UA 3D4TA 3ERFA 4OFTA 2H6XA 5IQYA 3ZVJD 4ML1A 4TR3A 4POBA 4EXJA 2K6VA 5D9VA 2GT6A 3G7YA 4ZL8A 1MEKA 2DJ0A 1O6JA 3TJBA 1A0FA 1GTBA 1ERUA 4PGTA 4ICYA 4IP1A 3GFKA 2H6ZA 3J7Yk 3EE2A 1EEJA 3EVIA 2YWIA 5H5QA 3TRQA 5CRWA 4GRFA 4WETA 5LNKe 2LNTA 2YNXA 2DJJA 1M3JA 4EUYA 1OE8A 4N10A 3AY8A 4XTSA 3ERWA 2R37A 1B48A 2FA4A 2IL3A 1TU7A 1CQGA 1YJ6A 3FEUA 2JL4A 1N2AA 2DIYA 2OE3A 4HI7A 3CRUA 4WBJA 5HR0A 4BWSA 5B6MA 2F8AA 3MYDA 1M0UA 1UC7A 1WMJA 2LRCA 4J57E 2P0GA 5DVBA 2DJKA 1JZDA 3KM6A 4ZB8A 4HDEA 1M9AA 1KTEA 1SD8A 3IBHA 5EY6A 1TP9A 4BVYA 2GQMA 4HOJA 1PN0A 2X8CA 2V6OA 5CRGA 3KTBA 1EP7A 3IHGA 3LWAA 4ZILA 2R2JA 11GSA 1SL1B 4OMVA 4EIPA 1MDJA 3GTUB 2IN3A 3Q6OA 5E4WA 5IMDA 2HT9A 5G5FA 1Z3EA 1WRYA 3EU3A 2H71A 3ZL5A 4WKWA 3BD2A 3DIEA 1S3RA 3ZITA 1JZWA 2NDOA 5BMUA 1GSEA 2O7KA 2Z9SA 3PGTA 1J08A 1X0RA 2PERA 2V6KA 4FH8A 4LA1A 4V2NA 2RM5A 2VCVA 3H4KA 4MH2A 3ZMKA 4H86A 2CZ2A 3UVHA 2X99A 1VRSD 4HU7A 1WJKA 1QXHA 2MMOA 3VI5A 1TOFA 2IMFA 3BOAA 2WULA 1A0RP 1GP1A 1PA3A 5CP1A 2CAIA 4TR4A 3ERGA 2I3YA 1XVWA 2VOCA 3QD9A 1S3DA 1EOGA 3HZ8A 3CRTA 1XPVA 2QGVA 2YJHA 1T00A 1V58A 4I2UA 1K0BA 1TI3A 3FK8A 2C4JA 4F03A 3E9JB 1USBA 5ENUA 3MAKA 3ZYWA 2CT6A 4L5LA 2H70A 2IMKA 2RLIA 3W6GA 2AHEA 4EDZA 1XVQA 5ID2A 2HLSA 14GSA 3D6IA 4ILFA 4QL9A 2ON7A 1DE1A 2MZCA 2RUFA 3LEFA 2GZPA 5IM9A 3FR9A 2NBSA 5ELAA 1AUCA 3ZFBA 2VL2A 1RK4A 3A2XA 3RPPA 4RUVA 1UN2A 4KA0A 2NPBA 1UA5A 4MH3A 2HRAA 6GSTA 3DVXA 4O92A 4XS6A 3HJMA 10GSA 3GX0A 5CAXA 5CNWA 2VO4A 1MTCA 1AC1A 2YWMA 4NV5A 1F9MA 3KIJA 1FVKA 3C73A 3N9JA 3MIXA 4TKYA 2DKIA 2GQKA 4LL1B 2VD1A 5A5KA 3S9FA 2HZFA 1XWGA 2LV3A 1ERVA 3CSJA 2WB9A 5HR2A 1GL8A 4KDXA 1OKDA 1ZYPA 2GQLA 2H75A 2N5FA 1Z7PA 2DJ1A 6GSUA 3OR5A 3EURA 1K0DA 4HZ2A 2N5BA 2CVDA 1TRUA 5AN1A 5CRDA 5F05A 3KEBA 4KGIA 2C0GA 2R5GA 3D21A 1ON4A 1FB0A 4Z2RA 4JE1A 1GRXA 1R4WA 3G9BA 2C0FA 4V2LA 2A2SA 1B4QA 3RAZA 1Z5YE 2LSTA 3IDVA 3KZQA 4DSRA 4KX4A 2FD3A 4BVXB 3WT2A 4PURA 5KOXA 1G7OA 5DBQA 4MF6A 1VF1A 1XIYA 2H8LA 4X1UA 2P5RA 4POMA 2PN8A 2PMTA 2LNSA 2H19A 1ST9A 1X5CA 1XZOA 3ME8A 1FHEA 2DMMA 4HSCX 2L4CA 1EEMA 4HZ4A 3EYTA 4G10A 3F4TA 4DEJA 1B4PA 1V9WA 2OBIA 2YN1A 5J9BA 1JZOA 4G0LA 3L9UA 3DGQA 3QFAC 5ECHB 1A8YA 2CA8A 1GTUA 5KN1A 1GH2A 2HNLA 4KF9A 2E2GA 1AAZA 1LJRA 2H1AA 4WXTA 5IOWA 2IFQB 1GUKA 1TK8B 3ZIVA 1TKDB 4PUAA 4K2DA 2GS3A 1SJIA 3GKKA 2EIOA 4LMVA 4EL1A 3GH6A 2IIYA 2EIQA 2L6CA 4XCSA 4JR4A 1U3IA 2GSSA 3LXZA 5ECNB 1SJZA 2YCDA 1M2DA 1PX7A 5IMAA 3TGZA 4ISDA 4BA7A 5IO0A 2C0DA 3C71A 1HQOA 4MK3A 2XPEA 2KP2A 1AIUA 3APSA 4XS4A 2I9HA 3HJOA 3LYKA 4G2EA 4HEA2 1K0OA 4AJ8A 2EIRA 2M80A 2JADA 4YQUA 2RM6A 4X43A 4TRXA 1PGTA 1X5DA 4J2FA 1LU4A 3VFIA 2GZZA 4NWYA 4I8BA 4TR1A 5DAKB 4FQUA 2L4QA 4K8MA 2C0EA 3TDGA 4Z7XA 2WFCA 5H5RA 4ML6A 2B1KA 19GSA 4HUAA 1X9WB 4E8HA 4X4JA 1HYUA 7GSSA 2X4AA 3VWXA 1WIKA 2HSHA 4OD7A 3FZ4A 4PQHA 1SYXA 1RW1A 2YJ7A 2H0HA 4RI6A 1XW5A 4A5PA 3IE3A 2PBJA 4O5RA 3Q18A 4CDOA 3ZIJA 1GLQA 2GTUA 4ECIA 1Y6EA 4MLYA 2H30A 2MYGA 3P7XA 1FW1A 1GSYA 2C3TA 5ELGA 1C72A 2CX4A 2VLTA 1TW9A 3IK9A 1WOUA 1OC3A 3IRAA 3CTFA 4RQRA 3NOFA 1H75A 3F8UA 1SYRA 2A2PA 5EL8A 4MF5A 3IK7A 3TUEA 5HFGA 4BL7B 1M7TA 3KD0A 3CQFA 4LMWA 4CY6A 12GSA 1EV9A 4WR5A 3J7Yb 5HFKA 1KNGA 2H76A 1QGVA 2CQ9A 3TB2A 4TXOA 1W4VA 5ECQB 1VF4A 2PU9C 2PVQA 1BX9A 3KGKA 2YOIA 13GSA 4EIQA 2HI7A 4MABA 2OE1A 5ECLB 2GT5A 5ECSA 4EC0A 1XW9A 1GNEA 3HVSA 2LJAA 3UBKA 1TRWA 3CSIA 4POKA 5H5SA 4L0WA 2VCXA 2KOKA 3BCKA 3WGEA 1OYJA 4AF2A 3LFLA 5AGYA 4ZXGA 3PINA 3IA1A 4BWQA 2MMZA 2D2ZA 1N8JA 4HQSA 3A2WA 1PD21 2FLSA 3C7MA 4F0BA 3F3RA 3HVXA 2K8VA 4MDCA 1ERTA 1O73A 3P90A 5GSTA 5AISA 3C8EA 3VI7A 4FIWA 2R0PA 2QA1A 4K7IA 5LCZA 2VCQA 1XOBA 3WYWA 3C1RA 4FYCA 2L6DA 2FNOA 1GSQA 5D9WA 5G30A 1YQ1A 2XHFA 1M2AA 2OADA 4Q5RA 9GSSA 2GZYA 3W8SA 3HHVA 4NHZA 5JCUA 5J41A 3RHCA 1T4YA 1I9DA 5JCGA 2IFQA 4WBRD 2FWFA 1K0AA 2RIIA 1QK8A 3FKFA 4XRAA 2RUEA 1TU8A 1F2EA 2REMA 1S3AA 3FRCA 4E8EA 5G31A 1B9YC 5ECOB 1ZYNA 1SKSB 2YV9A 1Y25A 1T7PB 2E2MA 4N0ZA 2HZEA 3GHAA 2H72A 3EMXA 1TI1A 4KCEA 4POLA 4KB3A 2IWTA 1A2MA 2M46A 5F8BA 1WP0A 4G0KA 2FA8A 5ECMB 2YZUA 3RPNA 4MJEA 3GNJA 4NPBA 3ED3A 2JSZA 1OC8A 4KDYA 5DALB 4G0IA 2G2QA 4RQXA 1A2LA 2N5AA 2R3XA 4QQ7A 4Z2UA 1R7HA 20GSA 4K0NA 5CRHA 1JLVA 3KXOA 1X9SB 4OO5A 5KN2A 1SK1A 2DJ2A 3O76A 5D93A 3QAWA 2QC7A 4V1Ap 2A4HA 4GXZA 1ZGNA 4XRDA 4PUFC 3NZNA 2GLRA 4WR4A 2R6KA 2H01A 2C80A 4KNDA 5AIXA 5JWRB 1OKTA 1AXDA 3LSZA 3WD6A 2LJKA 1DUGA 3WT1A 1AQXA 3F3QA 2YANA 2C3NA 4MZWA 3FZ9A 2OBKA 3KJYA 1AW9A 3Q19A 4KW6A 1K0CA 1T8EB 1YKCA 4P3YB 3TJFA 4OWYA 3HVVA 4ULXA 3DYRA 4J56E 3GH9A 1SK0A 4AGSA 2B5XA 1O8WA 1SL2B 4JR6A 4O5UA 1SK2A 2DSAA 1IYIA 3ZMLA 3ZRDA 5B8AA 4KAEA 3IOSA 3F9UA 2AAWA 4D73B 5D73A 2HSMA 4X0XA 5D9TA 1GUHA 1WPIA 3TKPA
chains in the Genus database with same CATH topology
3DRNA 3IHQA 3IV4A 1TTZA 1HNAA 2E7PA 1TDIA 3FY7A 3O6TA 5IPHA 3HKRA 3QMXA 2LQOA 2L59A 2YV7A 4XIHA 3EU4A 1BEDA 1FVJA 2KHPA 4MZBA 1URMA 1V2AA 2MBTA 2V2GA 4K6XA 4PX1A 6GSXA 2O8VB 2VL3A 3FZ5A 4ECJA 4OCEA 3KMOA 1SU9A 2CX3A 2FWGA 4Q5FA 4JRRA 3UJ1A 4CHSA 5KEJA 1KBNA 3IR4A 4DSSB 3G7JA 1SD9A 3GIXA 4ID0A 1OAZA 4IQAA 4WF4A 1TK5B 2J23A 2A4VA 4MA9A 2WS2A 4XHMA 2CVKA 3IXRA 5CO3A 3O3TA 1T3BA 2VL9A 1OC9B 5ABRA 1T1VA 2VCWA 1PMTA 5D9XA 5ECIB 4KDUA 5J3RA 2OKAA 4IELA 1FB6A 3IPZA 1PL1A 2OE0A 3DEXA 3LQ7A 6GSWA 2KUCA 2FHEA 2F9SA 3L9VA 4EE0A 5FT3A 3HXSA 2M72A 4JU5A 3ZFLA 3ME7A 2TRXA 3H8QA 3IC8A 1YEXA 3ZZXA 1O7UA 3M9JA 4IN0A 4IBPA 2WDUA 1U87A 4K5RA 3I69A 2DLXA 2BJXA 1XBSA 2A2RA 4IVFA 2HYXA 4OFMA 2TRCP 1YEPA 3KCMA 1ZOFA 3KH7A 4WEYA 4I97A 4I6XA 3E3EA 3H93A 4KH7A 2I81A 5JCWA 1SKWB 2AJQB 1WWJA 2LRTA 2JSYA 3HDCA 2GVPA 5E59A 3GTUA 2WGRA 1XCCA 3GKXA 4G9HA 3GA4A 4TW5A 5KN0A 2JZRA 3ZTLA 2VLVA 4L5OA 3LG6A 3KH9A 2HSYA 2HRKA 2IPAA 4ZBDA 3EPTA 3SWLA 3UBLA 4LLRA 4MCUA 1J0FA 3KP9A 3FYGA 2C1YA 5J5NA 1JHBA 3K8NA 2PVOC 2B5EA 2H74A 5DQYA 3TKRA 2GDRA 2XPDA 3TKSE 3TCOA 4AJ6A 4JEDA 5IPGA 3UVTA 5A4WA 3RBTA 2R0CA 4Q5NA 4I5QA 1XFLA 2VCTA 4FO5A 2FWHA 2P5QA 2PUKC 4BPYA 1PSQA 2LS5A 4BVYB 1O81A 2PWJA 4OO4A 5F07A 2FCHA 1B8XA 1GSDA 1EP8A 4HU9A 3CSHA 1NHYA 1PN9A 4ZB9A 3VPTA 1E6BA 1EOHA 5DDLA 3H79A 4TVEA 2C8UA 2ON5A 1O8XA 5L71A 3HZ4A 4YAPA 3PR8A 5HFIA 2FWEA 1MD4A 4K7NA 2X8GA 3M9KA 3US3A 3FHKA 2WRTA 4K7OA 2XBQA 1YZXA 3PPUA 3RHBA 5LD0A 5FWGA 3HCZA 1VF2A 4ZIJA 1GUMA 2OACA 8GSSA 2VM2A 2DMLA 3UARA 3BCIA 3UL3A 2HE3A 4N11A 2X8HA 2YP6A 3LYPA 3GV1A 1H4OA 1G7EA 5IMZA 2YWNA 5EPFA 2VIMA 4HJ2A 1HD2A 1Z9HA 2CV4A 4OFNA 1Q98A 1PQNA 2DIZA 1PX6A 1AQWA 5KOWA 1YDKA 3TKSC 2YWOA 4N30A 4V1Ag 3A5WA 1UVZA 2VAFA 3APOA 2HFDA 1NW2A 1OC9A 2GSRA 5CREA 3HY2A 5ID2B 3I6AA 4ZBBA 1TRVA 4KCAA 1FOHA 4NV2A 3VK9A 1GULA 1QMVA 1U3AA 2V32A 1NM3A 4BVXA 1ERWA 4NXIA 3NIVA 5KN3A 1F6MC 4MJCA 2IJYA 4GSTA 2R0GA 1M2BA 1V57A 1PKWA 3CMIA 1PL2A 5D96A 5COHA 3Q74A 4ECCA 3VWUA 2LJRA 2KP1A 3N5OA 4CW9A 4Z2TA 2AYTA 2NTOA 4MP4A 2IMEA 4FYBA 4TOPA 1DE2A 3WGDA 4OCFA 3L9SA 3BJ5A 5JWOB 1HNCA 4TR0A 4GQFA 4JBBA 2AUVA 2BTOT 4IJIA 1VGLA 3D0ZA 3GL3A 4K2XA 5IMFA 3ZLPA 5HQPA 2O89A 3QR6A 2IMIA 4HQZA 5J9CA 3UOMA 4LL4B 2MMAA 4MMMA 3EC3A 1F3BA 3GURA 4K5SA 2H1GA 4MNNA 2GSQA 1Z7RA 3L78A 3QOUA 1MDKA 2G0FA 1A2JA 1LBKA 2QA2A 2IMDA 2LTKA 2ES7A 3H1NA 18GSA 1TJDA 5F0GA 2L5LA 3I43A 4PTSA 3TOUA 3QFBC 3FW2A 3U5RE 2CVBA 4K9ZA 1ABAA 3MNGA 22GSA 3QPMA 1EV4A 1SJ6A 1FG4A 2OA7A 2V41A 3BBYA 2LEGA 5DCHA 4MJBA 2XBIA 5G1LA 2CZ3A 5DAKA 4O7HA 3MDKA 4IGJA 1THXA 1ZYQB 1R26A 4YQMA 1BAYA 1B9XC 4CY8A 3P2AA 4IKHA 2CAQA 2ZNMA 3F6FA 1MDIA 1X5EA 3UIWA 3IAS2 2HRFA 3LW9A 4RI7A 3CTGA 1FAAA 5B6NA 2K8SA 2FGXA 1KEBA 2XC2A 2L5OA 4HS1A 1PRXA 3GKMA 4NMUA 3GSSA 4L8EA 5ECRB 3DMLA 2OJLA 1WE0A 1O85A 3M8NA 1AQVA 3LXTA 1YY7A 4F2IA 1S3CA 2DBCA 1BJXA 3UEMA 3DWVA 1K0MA 4IHUA 4IS0A 3MSZA 5GAND 2GGTA 1GWCA 3V1WA 1I5GA 3UAPA 4NAXA 2F51A 1RQMA 4YQVA 4XS4B 5DQSA 3WGXA 2KLXA 2I4AA 2H0GA 3GSTA 4ZL9A 1Q4JA 2VCZA 2K9FA 4V2MA 4GSNA 2JACA 4ACSA 5AIVA 3FR6A 4MPFA 3EWLA 2H6YA 3HJPA 3C1SA 2GSTA 3CYNA 4BL7A 2F8FA 3G7IA 5IMCA 4DVCA 1J9BA 4TR1B 5C04A 2YPMA 3CXGA 3GKNA 3LJRA 1F3AA 4IP6A 4YH2A 2K18A 6GSSA 1DSBA 1G6YA 3VWVA 4PQIA 3A5IA 2ZCTA 5FHIA 3DXBA 3KMNA 4G19A 5C00A 3TJKA 2B5YA 4AJ7A 4IJ3A 2O85A 16GSA 2B6MA 4DSQA 4MF7A 3A2VA 5IOXA 1K3OA 3GRXA 2B3SA 4IW9A 1XWCA 2F3MA 3GL5A 4ZL7A 1EGRA 3PH9A 4EVMA 5G5EA 5GZZB 5IMVA 2O87A 1MD3A 4ZB6A 1G0TA 3LORA 3M3MA 2VM1A 4HJMA 2FUG2 1NHOA 3MWHA 3QDNA 2E0QA 4K0GA 4PNGA 1THOA 1VF3A 1ZCPA 3IAM2 3TKQA 1TXXA 3ZREA 3GMFA 1ZZYA 1QUWA 2PPTA 1YF0A 3F6DA 4NHWA 3DD3A 1K0NA 4PQ1A 4TXOB 1IYHA 2R4VA 3TJGA 4YKGA 1CQHA 1GTAA 1OE7A 3LGCA 4F82A 17GSA 2HXKA 3D4MA 3TRXA 1FO5A 1GLPA 1DBYA 3TRPA 4GSSA 3R3EA 1HNBA 4QL7A 1EGOA 4WF5A 3FZAA 1PKZA 2VL2C 4GQCA 3QAGA 1XXUA 1SENA 4MZCA 2ZUPA 2LRNA 1XOAA 1EZKA 3CBUA 2MBSA 1BG5A 1TK0B 4K1FA 1GSSA 1E2YA 3KTLA 4TXVA 3TJJA 1GTIA 4TN8A 5DALA 4EO3A 3L0HA 4PXOA 1X9MB 1ZMAA 2H66A 4YKFA 2ALBA 4KSOA 2V1MA 2AV4A 3KP8A 4EKZA 1FOVA 1ML6A 1OVNA 2DC5A 4F0CA 1QQ2A 2JZSA 3RDWA 5B8BA 1A8LA 3GYKA 1G6WA 1F37A 2LUSA 2C3QA 1ZYEA 5D8IA 4JZQA 1QFNA 1JZRA 1W89A 5A4VA 2WCIA 3U6VA 2PGTA 5HR3A 1JFUA 4EF0A 4N0VA 5IIZA 1EWXA 2NVLA 5INYA 3HYPA 1BYEA 3QAVA 2BMXA 2X49A 3GX8A 5G1KA 6GSVA 2HZEB 4YAVA 2H1BA 2UZ8A 4PNFA 5JWQB 3D22A 5ECPB 3TOTA 2JU5A 5DJLA 3I9V2 3R2QA 2H0IA 1SL0B 3F4SA 4GLTA 3D5JA 5J4UA 2I1UA 1U88A 3A3TA 5IO2A 1A24A 3TKSA 3M0FA 1YKAA 1SKRB 2B1LA 2DKHA 3FMWA 1XWBA 2QSIA 3VWWA 1Z6NA 5CYYA 3EINA 2LKUA 3JCML 4D73A 1V98A 1Z6MA 5ECKB 2AB6A 4KUNA 3F4RA 2JZTA 2FY6A 4FYUA 1A23A 3W8JA 1V40A 1R5PA 3QCPA 2YZHA 3DKSA 4L0UA 1M99A 1K3YA 3HD5A 2H1DA 5EVOA 2L57A 6GSYA 3VURA 1R5AA 3GUSA 4GTUA 3E0UA 4Q5QA 1XWAA 1ILOA 3L4NA 1BQ7A 2VLUA 4KSMA 3F0IA 5HR1A 1XWKA 2H73A 2VD0A 2WJUA 3F63A 2X64A 4O5QA 5B7CA 2QKEA 2EC4A 4ECBA 3GN3A 5GSSA 3SBCA 3EMPA 4ZBAA 1ZL9A 3M1GA 1JLWA 4MPGA 3ZVJA 2TIRA 4USSA 4DSSA 5BRTA 1NSWA 1ACVA 4IQ1A 1GSUA 1TRSA 1YF1A 3HA9A 3UMAA 2B7KA 3VPQA 1GNWA 4EDYA 4O32A 1K3LA 4I2TA 2VUPA 3DVWA 3FR3A 2J9HA 5DCGA 4XS1A 5DJMA 1XW6A 3P8WA 3VLNA 2WZ9A 2MMNA 3IC4A 4GF0A 2LQQA 4GWRA 3APQA 4KE3A 2B7JA 4F9ZA 1GSFA 4MJAA 5GAPD 3ISOA 2HRNA 5G2ZA 1M9BA 1U6TA 2P31A 5F06A 4GCIA 2DJ3A 1T4ZA 5A4UA 3D4TA 3ERFA 4OFTA 2H6XA 5IQYA 3ZVJD 4ML1A 4TR3A 4POBA 4EXJA 2K6VA 5D9VA 2GT6A 3G7YA 4ZL8A 1MEKA 2DJ0A 1O6JA 3TJBA 1A0FA 1GTBA 1ERUA 4PGTA 4ICYA 4IP1A 3GFKA 2H6ZA 3J7Yk 3EE2A 1EEJA 3EVIA 2YWIA 5H5QA 3TRQA 5CRWA 4GRFA 4WETA 5LNKe 2LNTA 2YNXA 2DJJA 4EUYA 1OE8A 4N10A 3AY8A 4XTSA 3ERWA 2R37A 1B48A 2FA4A 2IL3A 1TU7A 1CQGA 1YJ6A 3FEUA 2JL4A 1N2AA 2DIYA 2OE3A 4HI7A 3CRUA 4WBJA 5HR0A 4BWSA 5B6MA 2F8AA 3MYDA 1M0UA 1UC7A 1WMJA 2LRCA 4J57E 2P0GA 5DVBA 2DJKA 1JZDA 3KM6A 4ZB8A 4HDEA 1M9AA 1KTEA 1SD8A 3IBHA 5EY6A 1TP9A 4BVYA 2GQMA 4HOJA 1PN0A 2X8CA 2V6OA 5CRGA 3KTBA 1EP7A 3IHGA 3LWAA 4ZILA 2R2JA 11GSA 1SL1B 4OMVA 4EIPA 1MDJA 3GTUB 2IN3A 3Q6OA 5E4WA 5IMDA 2HT9A 5G5FA 1Z3EA 1WRYA 3EU3A 2H71A 3ZL5A 4WKWA 3BD2A 3DIEA 3ZITA 1JZWA 2NDOA 5BMUA 1GSEA 2O7KA 2Z9SA 3PGTA 1J08A 1X0RA 2PERA 2V6KA 4FH8A 4LA1A 4V2NA 2RM5A 2VCVA 3H4KA 4MH2A 3ZMKA 4H86A 2CZ2A 3UVHA 2X99A 1VRSD 4HU7A 1WJKA 1QXHA 2MMOA 3VI5A 1TOFA 2IMFA 3BOAA 2WULA 1A0RP 1GP1A 1PA3A 5CP1A 2CAIA 4TR4A 3ERGA 2I3YA 1XVWA 2VOCA 3QD9A 1S3DA 1EOGA 3HZ8A 3CRTA 1XPVA 2QGVA 2YJHA 1T00A 1V58A 4I2UA 1K0BA 1TI3A 3FK8A 2C4JA 4F03A 3E9JB 1USBA 5ENUA 3MAKA 3ZYWA 2CT6A 4L5LA 2H70A 2IMKA 2RLIA 3W6GA 2AHEA 4EDZA 1XVQA 5ID2A 2HLSA 14GSA 3D6IA 4ILFA 4QL9A 2ON7A 1DE1A 2MZCA 2RUFA 3LEFA 2GZPA 5IM9A 3FR9A 2NBSA 5ELAA 1AUCA 3ZFBA 2VL2A 1RK4A 3A2XA 3RPPA 4RUVA 1UN2A 4KA0A 2NPBA 1UA5A 4MH3A 2HRAA 6GSTA 3DVXA 4O92A 4XS6A 3HJMA 10GSA 3GX0A 5CAXA 5CNWA 2VO4A 1MTCA 1AC1A 2YWMA 4NV5A 1F9MA 3KIJA 1FVKA 3C73A 3N9JA 3MIXA 4TKYA 2DKIA 2GQKA 4LL1B 2VD1A 5A5KA 3S9FA 2HZFA 1XWGA 2LV3A 1ERVA 3CSJA 2WB9A 5HR2A 1GL8A 4KDXA 1OKDA 1ZYPA 2GQLA 2H75A 2N5FA 1Z7PA 2DJ1A 6GSUA 3OR5A 3EURA 1K0DA 4HZ2A 2N5BA 2CVDA 1TRUA 5AN1A 5CRDA 5F05A 3KEBA 4KGIA 2C0GA 2R5GA 3D21A 1ON4A 1FB0A 4Z2RA 4JE1A 1GRXA 1R4WA 3G9BA 2C0FA 4V2LA 2A2SA 1B4QA 3RAZA 1Z5YE 2LSTA 3IDVA 3KZQA 4DSRA 4KX4A 2FD3A 4BVXB 3WT2A 4PURA 5KOXA 1G7OA 5DBQA 4MF6A 1VF1A 1XIYA 2H8LA 4X1UA 2P5RA 4POMA 2PN8A 2PMTA 2LNSA 2H19A 1ST9A 1X5CA 1XZOA 3ME8A 1FHEA 2DMMA 2L4CA 1EEMA 4HZ4A 3EYTA 4G10A 3F4TA 4DEJA 1B4PA 1V9WA 2OBIA 2YN1A 5J9BA 1JZOA 4G0LA 3L9UA 3DGQA 3QFAC 5ECHB 1A8YA 2CA8A 1GTUA 5KN1A 1GH2A 2HNLA 4KF9A 2E2GA 1AAZA 1LJRA 2H1AA 4WXTA 5IOWA 2IFQB 1GUKA 1TK8B 3ZIVA 1TKDB 4PUAA 4K2DA 2GS3A 1SJIA 3GKKA 2EIOA 4LMVA 4EL1A 3GH6A 2IIYA 2EIQA 2L6CA 4XCSA 4JR4A 1U3IA 2GSSA 3LXZA 5ECNB 1SJZA 2YCDA 1M2DA 1PX7A 5IMAA 3TGZA 4ISDA 4BA7A 5IO0A 2C0DA 3C71A 1HQOA 4MK3A 2XPEA 2KP2A 1AIUA 3APSA 4XS4A 2I9HA 3HJOA 3LYKA 4G2EA 4HEA2 1K0OA 4AJ8A 2EIRA 2M80A 2JADA 4YQUA 2RM6A 4X43A 4TRXA 1PGTA 1X5DA 4J2FA 1LU4A 3VFIA 2GZZA 4NWYA 4I8BA 4TR1A 5DAKB 4FQUA 2L4QA 4K8MA 2C0EA 3TDGA 4Z7XA 2WFCA 5H5RA 4ML6A 2B1KA 19GSA 4HUAA 1X9WB 4E8HA 4X4JA 1HYUA 7GSSA 2X4AA 3VWXA 1WIKA 2HSHA 4OD7A 3FZ4A 4PQHA 1SYXA 1RW1A 2YJ7A 2H0HA 4RI6A 1XW5A 4A5PA 3IE3A 2PBJA 4O5RA 3Q18A 4CDOA 3ZIJA 1GLQA 2GTUA 4ECIA 1Y6EA 4MLYA 2H30A 2MYGA 3P7XA 1FW1A 1GSYA 2C3TA 5ELGA 1C72A 2CX4A 2VLTA 1TW9A 3IK9A 1WOUA 1OC3A 3IRAA 3CTFA 4RQRA 3NOFA 1H75A 3F8UA 1SYRA 2A2PA 5EL8A 4MF5A 3IK7A 3TUEA 5HFGA 4BL7B 1M7TA 3KD0A 4LMWA 4CY6A 12GSA 1EV9A 4WR5A 3J7Yb 5HFKA 1KNGA 2H76A 1QGVA 2CQ9A 3TB2A 4TXOA 1W4VA 5ECQB 1VF4A 2PU9C 2PVQA 1BX9A 3KGKA 2YOIA 13GSA 4EIQA 2HI7A 4MABA 2OE1A 5ECLB 2GT5A 5ECSA 4EC0A 1XW9A 1GNEA 3HVSA 2LJAA 3UBKA 1TRWA 3CSIA 4POKA 5H5SA 4L0WA 2VCXA 2KOKA 3BCKA 3WGEA 1OYJA 4AF2A 3LFLA 5AGYA 4ZXGA 3PINA 3IA1A 4BWQA 2MMZA 2D2ZA 1N8JA 4HQSA 3A2WA 1PD21 2FLSA 3C7MA 4F0BA 3F3RA 3HVXA 2K8VA 4MDCA 1ERTA 1O73A 3P90A 5GSTA 5AISA 3C8EA 3VI7A 4FIWA 2R0PA 2QA1A 4K7IA 5LCZA 2VCQA 1XOBA 3WYWA 3C1RA 4FYCA 2L6DA 2FNOA 1GSQA 5D9WA 5G30A 1YQ1A 2XHFA 1M2AA 2OADA 4Q5RA 9GSSA 2GZYA 3W8SA 3HHVA 4NHZA 5JCUA 5J41A 3RHCA 1T4YA 1I9DA 5JCGA 2IFQA 4WBRD 2FWFA 1K0AA 2RIIA 1QK8A 3FKFA 4XRAA 2RUEA 1TU8A 1F2EA 2REMA 1S3AA 3FRCA 4E8EA 5G31A 1B9YC 5ECOB 1ZYNA 1SKSB 2YV9A 1Y25A 1T7PB 2E2MA 4N0ZA 2HZEA 3GHAA 2H72A 3EMXA 1TI1A 4KCEA 4POLA 4KB3A 2IWTA 1A2MA 2M46A 5F8BA 1WP0A 4G0KA 2FA8A 5ECMB 2YZUA 3RPNA 4MJEA 3GNJA 4NPBA 3ED3A 2JSZA 1OC8A 4KDYA 5DALB 4G0IA 2G2QA 4RQXA 1A2LA 2N5AA 2R3XA 4QQ7A 4Z2UA 1R7HA 20GSA 4K0NA 5CRHA 1JLVA 3KXOA 1X9SB 4OO5A 5KN2A 1SK1A 2DJ2A 3O76A 5D93A 3QAWA 2QC7A 4V1Ap 2A4HA 4GXZA 1ZGNA 4XRDA 4PUFC 3NZNA 2GLRA 4WR4A 2R6KA 2H01A 2C80A 4KNDA 5AIXA 5JWRB 1OKTA 1AXDA 3LSZA 3WD6A 2LJKA 1DUGA 3WT1A 1AQXA 3F3QA 2YANA 2C3NA 4MZWA 3FZ9A 2OBKA 3KJYA 1AW9A 3Q19A 4KW6A 1K0CA 1T8EB 1YKCA 4P3YB 3TJFA 4OWYA 3HVVA 4ULXA 3DYRA 4J56E 3GH9A 1SK0A 4AGSA 2B5XA 1O8WA 1SL2B 4JR6A 4O5UA 1SK2A 2DSAA 1IYIA 3ZMLA 3ZRDA 5B8AA 4KAEA 3IOSA 3F9UA 2AAWA 4D73B 5D73A 2HSMA 4X0XA 5D9TA 1GUHA 1WPIA 3TKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DRN A;  3IHQ A;  3IV4 A;  1TTZ A;  1HNA A;  2E7P A;  1TDI A;  3FY7 A;  3O6T A;  5IPH A;  3HKR A;  3QMX A;  2LQO A;  2L59 A;  2YV7 A;  4XIH A;  3EU4 A;  1BED A;  1FVJ A;  2KHP A;  4MZB A;  1URM A;  1V2A A;  2MBT A;  2V2G A;  4K6X A;  4PX1 A;  6GSX A;  2O8V B;  2VL3 A;  3FZ5 A;  4ECJ A;  4OCE A;  3KMO A;  1SU9 A;  2CX3 A;  2FWG A;  4Q5F A;  4JRR A;  3UJ1 A;  4CHS A;  5KEJ A;  1KBN A;  3IR4 A;  4DSS B;  3G7J A;  1SD9 A;  3GIX A;  4ID0 A;  1OAZ A;  4IQA A;  4WF4 A;  1TK5 B;  2J23 A;  2A4V A;  4MA9 A;  2WS2 A;  4XHM A;  2CVK A;  3IXR A;  5CO3 A;  3O3T A;  1T3B A;  2VL9 A;  1OC9 B;  5ABR A;  1T1V A;  2VCW A;  1PMT A;  5D9X A;  5ECI B;  4KDU A;  5J3R A;  2OKA A;  4IEL A;  1FB6 A;  3IPZ A;  1PL1 A;  2OE0 A;  3DEX A;  3LQ7 A;  6GSW A;  2KUC A;  2FHE A;  2F9S A;  3L9V A;  4EE0 A;  5FT3 A;  3HXS A;  2M72 A;  4JU5 A;  3ZFL A;  3ME7 A;  2TRX A;  3H8Q A;  1YEX A;  3ZZX A;  1O7U A;  3M9J A;  4IN0 A;  4IBP A;  2WDU A;  1U87 A;  3I69 A;  2DLX A;  2BJX A;  1XBS A;  2A2R A;  4IVF A;  2HYX A;  4OFM A;  2TRC P;  1YEP A;  3KCM A;  1ZOF A;  3KH7 A;  4WEY A;  4I97 A;  4I6X A;  3E3E A;  3H93 A;  4KH7 A;  2I81 A;  5JCW A;  1SKW B;  2AJQ B;  1WWJ A;  2LRT A;  2JSY A;  3HDC A;  2GVP A;  5E59 A;  3GTU A;  2WGR A;  1XCC A;  3GKX A;  4G9H A;  3GA4 A;  4TW5 A;  5KN0 A;  2JZR A;  3ZTL A;  2VLV A;  4L5O A;  3LG6 A;  3KH9 A;  2HSY A;  2IPA A;  4ZBD A;  3SWL A;  3UBL A;  4LLR A;  4MCU A;  1J0F A;  3KP9 A;  3FYG A;  2C1Y A;  5J5N A;  1JHB A;  3K8N A;  2PVO C;  2B5E A;  2H74 A;  5DQY A;  3TKR A;  2GDR A;  2XPD A;  3TKS E;  3TCO A;  4AJ6 A;  4JED A;  5IPG A;  3UVT A;  5A4W A;  3RBT A;  4Q5N A;  4I5Q A;  1XFL A;  2VCT A;  4FO5 A;  2FWH A;  2P5Q A;  2PUK C;  4BPY A;  1PSQ A;  2LS5 A;  1O81 A;  2PWJ A;  4OO4 A;  5F07 A;  2FCH A;  1B8X A;  1GSD A;  1EP8 A;  4HU9 A;  3CSH A;  1NHY A;  1PN9 A;  4ZB9 A;  3VPT A;  1E6B A;  1EOH A;  5DDL A;  3H79 A;  4TVE A;  2C8U A;  2ON5 A;  1O8X A;  5L71 A;  3HZ4 A;  4YAP A;  3PR8 A;  5HFI A;  2FWE A;  1MD4 A;  4K7N A;  2X8G A;  3M9K A;  3US3 A;  3FHK A;  2WRT A;  4K7O A;  2XBQ A;  1YZX A;  3RHB A;  5LD0 A;  5FWG A;  3HCZ A;  1VF2 A;  4ZIJ A;  1GUM A;  2OAC A;  8GSS A;  2VM2 A;  2DML A;  3UAR A;  3BCI A;  3UL3 A;  2HE3 A;  4N11 A;  2X8H A;  2YP6 A;  3LYP A;  3GV1 A;  1H4O A;  1G7E A;  5IMZ A;  2YWN A;  5EPF A;  2VIM A;  4HJ2 A;  1HD2 A;  1Z9H A;  2CV4 A;  4OFN A;  1Q98 A;  1PQN A;  2DIZ A;  1PX6 A;  1AQW A;  1YDK A;  3TKS C;  2YWO A;  4N30 A;  4V1A g;  3A5W A;  1UVZ A;  2VAF A;  3APO A;  2HFD A;  1NW2 A;  1OC9 A;  2GSR A;  5CRE A;  3HY2 A;  5ID2 B;  3I6A A;  4ZBB A;  1TRV A;  4KCA A;  4NV2 A;  3VK9 A;  1GUL A;  1QMV A;  1U3A A;  2V32 A;  1NM3 A;  4BVX A;  1ERW A;  4NXI A;  3NIV A;  5KN3 A;  1F6M C;  4MJC A;  2IJY A;  4GST A;  1M2B A;  1V57 A;  1PKW A;  3CMI A;  1PL2 A;  5D96 A;  5COH A;  3Q74 A;  4ECC A;  3VWU A;  2LJR A;  2KP1 A;  3N5O A;  4CW9 A;  2AYT A;  2NTO A;  4MP4 A;  2IME A;  4FYB A;  4TOP A;  1DE2 A;  3WGD A;  4OCF A;  3L9S A;  3BJ5 A;  5JWO B;  1HNC A;  4TR0 A;  4GQF A;  4JBB A;  2AUV A;  2BTO T;  4IJI A;  1VGL A;  3D0Z A;  3GL3 A;  5IMF A;  3ZLP A;  5HQP A;  2O89 A;  3QR6 A;  2IMI A;  4HQZ A;  5J9C A;  3UOM A;  4LL4 B;  2MMA A;  4MMM A;  3EC3 A;  1F3B A;  3GUR A;  2H1G A;  2GSQ A;  1Z7R A;  3L78 A;  3QOU A;  1MDK A;  2G0F A;  1A2J A;  1LBK A;  2IMD A;  2LTK A;  2ES7 A;  3H1N A;  18GS A;  1TJD A;  5F0G A;  2L5L A;  3I43 A;  3TOU A;  3QFB C;  3FW2 A;  3U5R E;  2CVB A;  4K9Z A;  1ABA A;  3MNG A;  22GS A;  3QPM A;  1EV4 A;  1SJ6 A;  1FG4 A;  2OA7 A;  2V41 A;  3BBY A;  2LEG A;  5DCH A;  4MJB A;  2XBI A;  5G1L A;  2CZ3 A;  5DAK A;  4O7H A;  3MDK A;  4IGJ A;  1THX A;  1ZYQ B;  1R26 A;  4YQM A;  1BAY A;  1B9X C;  3P2A A;  4IKH A;  2CAQ A;  2ZNM A;  3F6F A;  1MDI A;  1X5E A;  3UIW A;  3IAS 2;  2HRF A;  4RI7 A;  3CTG A;  1FAA A;  5B6N A;  2K8S A;  2FGX A;  1KEB A;  2XC2 A;  2L5O A;  4HS1 A;  1PRX A;  3GKM A;  4NMU A;  3GSS A;  4L8E A;  5ECR B;  3DML A;  2OJL A;  1WE0 A;  1O85 A;  3M8N A;  1AQV A;  3LXT A;  1YY7 A;  4F2I A;  1S3C A;  2DBC A;  1BJX A;  3UEM A;  3DWV A;  1K0M A;  4IHU A;  4IS0 A;  3MSZ A;  5GAN D;  2GGT A;  1GWC A;  3V1W A;  1I5G A;  3UAP A;  4NAX A;  2F51 A;  1RQM A;  4YQV A;  4XS4 B;  5DQS A;  3WGX A;  2KLX A;  2I4A A;  2H0G A;  3GST A;  4ZL9 A;  1Q4J A;  2VCZ A;  2K9F A;  4V2M A;  4GSN A;  2JAC A;  4ACS A;  5AIV A;  3FR6 A;  4MPF A;  3EWL A;  2H6Y A;  3HJP A;  3C1S A;  2GST A;  3CYN A;  4BL7 A;  2F8F A;  3G7I A;  5IMC A;  4DVC A;  1J9B A;  4TR1 B;  5C04 A;  2YPM A;  3CXG A;  3GKN A;  3LJR A;  1F3A A;  4IP6 A;  4YH2 A;  2K18 A;  6GSS A;  1DSB A;  1G6Y A;  3VWV A;  4PQI A;  2ZCT A;  5FHI A;  3DXB A;  3KMN A;  4G19 A;  5C00 A;  3TJK A;  2B5Y A;  4AJ7 A;  4IJ3 A;  2O85 A;  16GS A;  2B6M A;  4DSQ A;  4MF7 A;  3A2V A;  5IOX A;  1K3O A;  3GRX A;  2B3S A;  4IW9 A;  1XWC A;  2F3M A;  3GL5 A;  4ZL7 A;  1EGR A;  3PH9 A;  4EVM A;  5G5E A;  5GZZ B;  5IMV A;  2O87 A;  1MD3 A;  4ZB6 A;  1G0T A;  3LOR A;  3M3M A;  2VM1 A;  4HJM A;  2FUG 2;  1NHO A;  3MWH A;  3QDN A;  2E0Q A;  4K0G A;  4PNG A;  1THO A;  1VF3 A;  1ZCP A;  3IAM 2;  3TKQ A;  1TXX A;  3ZRE A;  3GMF A;  1ZZY A;  1QUW A;  2PPT A;  1YF0 A;  3F6D A;  4NHW A;  3DD3 A;  1K0N A;  4PQ1 A;  4TXO B;  1IYH A;  2R4V A;  3TJG A;  1CQH A;  1GTA A;  1OE7 A;  3LGC A;  4F82 A;  17GS A;  2HXK A;  3D4M A;  3TRX A;  1FO5 A;  1GLP A;  1DBY A;  3TRP A;  4GSS A;  1HNB A;  4QL7 A;  1EGO A;  4WF5 A;  3FZA A;  1PKZ A;  2VL2 C;  4GQC A;  3QAG A;  1XXU A;  1SEN A;  4MZC A;  2ZUP A;  2LRN A;  1XOA A;  1EZK A;  3CBU A;  2MBS A;  1BG5 A;  1TK0 B;  4K1F A;  1GSS A;  1E2Y A;  3KTL A;  4TXV A;  3TJJ A;  1GTI A;  4TN8 A;  5DAL A;  4EO3 A;  3L0H A;  4PXO A;  1X9M B;  1ZMA A;  2H66 A;  2ALB A;  4KSO A;  2V1M A;  2AV4 A;  3KP8 A;  4EKZ A;  1FOV A;  1ML6 A;  1OVN A;  2DC5 A;  4F0C A;  1QQ2 A;  2JZS A;  3RDW A;  5B8B A;  1A8L A;  3GYK A;  1G6W A;  1F37 A;  2LUS A;  2C3Q A;  1ZYE A;  5D8I A;  4JZQ A;  1QFN A;  1JZR A;  1W89 A;  5A4V A;  2WCI A;  3U6V A;  2PGT A;  5HR3 A;  1JFU A;  4EF0 A;  4N0V A;  5IIZ A;  1EWX A;  2NVL A;  5INY A;  3HYP A;  1BYE A;  3QAV A;  2BMX A;  5G1K A;  3GX8 A;  6GSV A;  2HZE B;  4YAV A;  2H1B A;  4PNF A;  5JWQ B;  3D22 A;  5ECP B;  3TOT A;  2JU5 A;  5DJL A;  3I9V 2;  3R2Q A;  2H0I A;  1SL0 B;  3F4S A;  4GLT A;  3D5J A;  5J4U A;  2I1U A;  1U88 A;  3A3T A;  5IO2 A;  1A24 A;  3TKS A;  3M0F A;  1YKA A;  1SKR B;  2B1L A;  1XWB A;  2QSI A;  3VWW A;  1Z6N A;  5CYY A;  3EIN A;  2LKU A;  3JCM L;  4D73 A;  1V98 A;  1Z6M A;  5ECK B;  2AB6 A;  4KUN A;  3F4R A;  2JZT A;  2FY6 A;  4FYU A;  1A23 A;  3W8J A;  1V40 A;  1R5P A;  3QCP A;  2YZH A;  3DKS A;  4L0U A;  1M99 A;  1K3Y A;  3HD5 A;  2H1D A;  5EVO A;  2L57 A;  6GSY A;  3VUR A;  1R5A A;  3GUS A;  4GTU A;  3E0U A;  4Q5Q A;  1XWA A;  1ILO A;  3L4N A;  1BQ7 A;  2VLU A;  4KSM A;  3F0I A;  5HR1 A;  1XWK A;  2H73 A;  2VD0 A;  2WJU A;  3F63 A;  2X64 A;  5B7C A;  2QKE A;  2EC4 A;  4ECB A;  3GN3 A;  5GSS A;  3SBC A;  3EMP A;  4ZBA A;  1ZL9 A;  3M1G A;  1JLW A;  4MPG A;  3ZVJ A;  2TIR A;  4DSS A;  1NSW A;  1ACV A;  4IQ1 A;  1GSU A;  1TRS A;  1YF1 A;  3HA9 A;  3UMA A;  2B7K A;  3VPQ A;  1GNW A;  4EDY A;  4O32 A;  1K3L A;  4I2T A;  2VUP A;  3DVW A;  3FR3 A;  2J9H A;  5DCG A;  5DJM A;  4XS1 A;  1XW6 A;  3P8W A;  3VLN A;  2WZ9 A;  2MMN A;  3IC4 A;  4GF0 A;  2LQQ A;  4GWR A;  3APQ A;  4KE3 A;  2B7J A;  4F9Z A;  1GSF A;  4MJA A;  5GAP D;  3ISO A;  2HRN A;  5G2Z A;  1M9B A;  1U6T A;  2P31 A;  5F06 A;  4GCI A;  2DJ3 A;  1T4Z A;  5A4U A;  3D4T A;  3ERF A;  4OFT A;  2H6X A;  5IQY A;  3ZVJ D;  4ML1 A;  4TR3 A;  4POB A;  4EXJ A;  2K6V A;  5D9V A;  2GT6 A;  3G7Y A;  4ZL8 A;  1MEK A;  2DJ0 A;  1O6J A;  3TJB A;  1A0F A;  1GTB A;  1ERU A;  4PGT A;  4IP1 A;  3GFK A;  2H6Z A;  3J7Y k;  3EE2 A;  1EEJ A;  3EVI A;  2YWI A;  5H5Q A;  3TRQ A;  5CRW A;  4GRF A;  4WET A;  5LNK e;  2LNT A;  2YNX A;  2DJJ A;  4EUY A;  1OE8 A;  4N10 A;  3AY8 A;  4XTS A;  3ERW A;  2R37 A;  1B48 A;  2FA4 A;  2IL3 A;  1TU7 A;  1CQG A;  1YJ6 A;  3FEU A;  2JL4 A;  1N2A A;  2DIY A;  2OE3 A;  4HI7 A;  3CRU A;  4WBJ A;  5HR0 A;  4BWS A;  5B6M A;  2F8A A;  1M0U A;  1UC7 A;  1WMJ A;  2LRC A;  4J57 E;  2P0G A;  5DVB A;  2DJK A;  1JZD A;  3KM6 A;  4ZB8 A;  4HDE A;  1M9A A;  1KTE A;  1SD8 A;  3IBH A;  5EY6 A;  1TP9 A;  4BVY A;  2GQM A;  4HOJ A;  2X8C A;  2V6O A;  5CRG A;  3KTB A;  1EP7 A;  3LWA A;  4ZIL A;  2R2J A;  11GS A;  1SL1 B;  4OMV A;  1MDJ A;  3GTU B;  2IN3 A;  3Q6O A;  5E4W A;  5IMD A;  2HT9 A;  5G5F A;  1Z3E A;  1WRY A;  3EU3 A;  2H71 A;  3ZL5 A;  4WKW A;  3BD2 A;  3DIE A;  3ZIT A;  1JZW A;  2NDO A;  1GSE A;  2O7K A;  2Z9S A;  3PGT A;  1J08 A;  1X0R A;  2PER A;  2V6K A;  4FH8 A;  4LA1 A;  4V2N A;  2RM5 A;  2VCV A;  3H4K A;  4MH2 A;  3ZMK A;  4H86 A;  2CZ2 A;  3UVH A;  2X99 A;  1VRS D;  4HU7 A;  1WJK A;  1QXH A;  2MMO A;  3VI5 A;  1TOF A;  2IMF A;  3BOA A;  2WUL A;  1A0R P;  1GP1 A;  1PA3 A;  5CP1 A;  2CAI A;  4TR4 A;  3ERG A;  2I3Y A;  1XVW A;  2VOC A;  3QD9 A;  1S3D A;  1EOG A;  3HZ8 A;  3CRT A;  1XPV A;  2QGV A;  2YJH A;  1T00 A;  1V58 A;  4I2U A;  1K0B A;  1TI3 A;  3FK8 A;  2C4J A;  4F03 A;  3E9J B;  1USB A;  5ENU A;  3MAK A;  3ZYW A;  2CT6 A;  4L5L A;  2H70 A;  2IMK A;  2RLI A;  3W6G A;  2AHE A;  4EDZ A;  1XVQ A;  5ID2 A;  2HLS A;  14GS A;  3D6I A;  4ILF A;  4QL9 A;  2ON7 A;  1DE1 A;  2MZC A;  2RUF A;  3LEF A;  2GZP A;  5IM9 A;  3FR9 A;  2NBS A;  5ELA A;  1AUC A;  3ZFB A;  2VL2 A;  1RK4 A;  3A2X A;  3RPP A;  4RUV A;  1UN2 A;  4KA0 A;  2NPB A;  1UA5 A;  4MH3 A;  6GST A;  3DVX A;  4O92 A;  4XS6 A;  3HJM A;  10GS A;  3GX0 A;  5CAX A;  5CNW A;  2VO4 A;  1MTC A;  1AC1 A;  2YWM A;  4NV5 A;  1F9M A;  3KIJ A;  1FVK A;  3C73 A;  3N9J A;  4TKY A;  2GQK A;  4LL1 B;  2VD1 A;  5A5K A;  3S9F A;  2HZF A;  1XWG A;  2LV3 A;  1ERV A;  3CSJ A;  2WB9 A;  5HR2 A;  1GL8 A;  4KDX A;  1OKD A;  2GQL A;  2H75 A;  2N5F A;  1Z7P A;  2DJ1 A;  6GSU A;  3OR5 A;  3EUR A;  1K0D A;  4HZ2 A;  2N5B A;  2CVD A;  1TRU A;  5AN1 A;  5CRD A;  5F05 A;  3KEB A;  4KGI A;  2C0G A;  2R5G A;  3D21 A;  1ON4 A;  1FB0 A;  4JE1 A;  1GRX A;  1R4W A;  3G9B A;  2C0F A;  4V2L A;  2A2S A;  1B4Q A;  3RAZ A;  1Z5Y E;  2LST A;  3IDV A;  3KZQ A;  4DSR A;  4KX4 A;  2FD3 A;  3WT2 A;  4PUR A;  1G7O A;  5DBQ A;  4MF6 A;  1VF1 A;  1XIY A;  2H8L A;  4X1U A;  2P5R A;  4POM A;  2PN8 A;  2PMT A;  2LNS A;  2H19 A;  1ST9 A;  1X5C A;  1XZO A;  3ME8 A;  1FHE A;  2DMM A;  2L4C A;  1EEM A;  4HZ4 A;  3EYT A;  4G10 A;  3F4T A;  4DEJ A;  1B4P A;  1V9W A;  2OBI A;  2YN1 A;  5J9B A;  1JZO A;  3L9U A;  3DGQ A;  3QFA C;  5ECH B;  1A8Y A;  2CA8 A;  1GTU A;  5KN1 A;  1GH2 A;  2HNL A;  2E2G A;  1AAZ A;  1LJR A;  2H1A A;  4WXT A;  5IOW A;  2IFQ B;  1GUK A;  1TK8 B;  3ZIV A;  1TKD B;  4PUA A;  4K2D A;  2GS3 A;  1SJI A;  3GKK A;  2EIO A;  4LMV A;  4EL1 A;  3GH6 A;  2IIY A;  2EIQ A;  2L6C A;  4XCS A;  4JR4 A;  1U3I A;  2GSS A;  3LXZ A;  5ECN B;  1SJZ A;  2YCD A;  1M2D A;  1PX7 A;  5IMA A;  3TGZ A;  4ISD A;  4BA7 A;  5IO0 A;  2C0D A;  3C71 A;  1HQO A;  4MK3 A;  2XPE A;  2KP2 A;  1AIU A;  3APS A;  4XS4 A;  2I9H A;  3HJO A;  3LYK A;  4G2E A;  4HEA 2;  1K0O A;  4AJ8 A;  2EIR A;  2M80 A;  2JAD A;  4YQU A;  2RM6 A;  4X43 A;  4TRX A;  1PGT A;  1X5D A;  4J2F A;  1LU4 A;  3VFI A;  2GZZ A;  4NWY A;  4I8B A;  4TR1 A;  5DAK B;  2L4Q A;  4K8M A;  2C0E A;  3TDG A;  4Z7X A;  2WFC A;  5H5R A;  4ML6 A;  2B1K A;  19GS A;  4HUA A;  1X9W B;  4E8H A;  1HYU A;  7GSS A;  3VWX A;  1WIK A;  2HSH A;  4OD7 A;  3FZ4 A;  4PQH A;  1SYX A;  1RW1 A;  2YJ7 A;  2H0H A;  4RI6 A;  1XW5 A;  3IE3 A;  2PBJ A;  4O5R A;  3Q18 A;  4CDO A;  3ZIJ A;  1GLQ A;  2GTU A;  4ECI A;  1Y6E A;  4MLY A;  2H30 A;  2MYG A;  3P7X A;  1FW1 A;  1GSY A;  2C3T A;  5ELG A;  1C72 A;  2CX4 A;  2VLT A;  1TW9 A;  3IK9 A;  1WOU A;  1OC3 A;  3IRA A;  3CTF A;  4RQR A;  3NOF A;  1H75 A;  3F8U A;  1SYR A;  5EL8 A;  4MF5 A;  3IK7 A;  3TUE A;  5HFG A;  1M7T A;  3KD0 A;  4LMW A;  12GS A;  1EV9 A;  4WR5 A;  3J7Y b;  5HFK A;  1KNG A;  2H76 A;  1QGV A;  2CQ9 A;  3TB2 A;  4TXO A;  1W4V A;  5ECQ B;  1VF4 A;  2PU9 C;  2PVQ A;  1BX9 A;  3KGK A;  2YOI A;  13GS A;  2HI7 A;  4MAB A;  2OE1 A;  5ECL B;  2GT5 A;  5ECS A;  4EC0 A;  1XW9 A;  1GNE A;  3HVS A;  2LJA A;  3UBK A;  1TRW A;  3CSI A;  4POK A;  5H5S A;  4L0W A;  2VCX A;  2KOK A;  3BCK A;  3WGE A;  1OYJ A;  4AF2 A;  3LFL A;  5AGY A;  4ZXG A;  3PIN A;  3IA1 A;  4BWQ A;  2MMZ A;  2D2Z A;  1N8J A;  4HQS A;  3A2W A;  1PD2 1;  2FLS A;  3C7M A;  4F0B A;  3F3R A;  3HVX A;  2K8V A;  4MDC A;  1ERT A;  1O73 A;  3P90 A;  5GST A;  5AIS A;  3C8E A;  3VI7 A;  4FIW A;  4K7I A;  5LCZ A;  2VCQ A;  1XOB A;  3WYW A;  3C1R A;  4FYC A;  2L6D A;  2FNO A;  1GSQ A;  5D9W A;  5G30 A;  1YQ1 A;  2XHF A;  1M2A A;  2OAD A;  4Q5R A;  9GSS A;  2GZY A;  3W8S A;  3HHV A;  4NHZ A;  5JCU A;  5J41 A;  3RHC A;  1T4Y A;  1I9D A;  5JCG A;  2IFQ A;  4WBR D;  2FWF A;  1K0A A;  2RII A;  1QK8 A;  3FKF A;  4XRA A;  2RUE A;  1TU8 A;  1F2E A;  2REM A;  1S3A A;  3FRC A;  4E8E A;  5G31 A;  1B9Y C;  5ECO B;  1SKS B;  2YV9 A;  1Y25 A;  1T7P B;  2E2M A;  4N0Z A;  2HZE A;  3GHA A;  2H72 A;  3EMX A;  1TI1 A;  4KCE A;  4POL A;  4KB3 A;  2IWT A;  1A2M A;  2M46 A;  5F8B A;  1WP0 A;  2FA8 A;  5ECM B;  2YZU A;  3RPN A;  4MJE A;  3GNJ A;  4NPB A;  3ED3 A;  2JSZ A;  1OC8 A;  4KDY A;  5DAL B;  2G2Q A;  4RQX A;  1A2L A;  2N5A A;  2R3X A;  4QQ7 A;  1R7H A;  20GS A;  4K0N A;  5CRH A;  1JLV A;  3KXO A;  1X9S B;  4OO5 A;  5KN2 A;  1SK1 A;  2DJ2 A;  3O76 A;  5D93 A;  3QAW A;  2QC7 A;  4V1A p;  4GXZ A;  1ZGN A;  4XRD A;  4PUF C;  3NZN A;  2GLR A;  4WR4 A;  2R6K A;  2H01 A;  2C80 A;  4KND A;  5AIX A;  5JWR B;  1OKT A;  1AXD A;  3LSZ A;  3WD6 A;  2LJK A;  1DUG A;  3WT1 A;  1AQX A;  3F3Q A;  2YAN A;  2C3N A;  4MZW A;  3FZ9 A;  2OBK A;  3KJY A;  1AW9 A;  3Q19 A;  4KW6 A;  1K0C A;  1T8E B;  1YKC A;  4P3Y B;  3TJF A;  4OWY A;  3HVV A;  4ULX A;  3DYR A;  4J56 E;  3GH9 A;  1SK0 A;  4AGS A;  2B5X A;  1O8W A;  1SL2 B;  4JR6 A;  1SK2 A;  2DSA A;  1IYI A;  3ZML A;  3ZRD A;  5B8A A;  4KAE A;  3IOS A;  3F9U A;  2AAW A;  4D73 B;  5D73 A;  4X0X A;  5D9T A;  1GUH A;  1WPI A;  3TKP A; 
#chains in the Genus database with same CATH topology
 3DRN A;  3IHQ A;  3IV4 A;  1TTZ A;  1HNA A;  2E7P A;  1TDI A;  3FY7 A;  3O6T A;  5IPH A;  3HKR A;  3QMX A;  2LQO A;  2L59 A;  2YV7 A;  4XIH A;  3EU4 A;  1BED A;  1FVJ A;  2KHP A;  4MZB A;  1PFO A;  1URM A;  1V2A A;  2MBT A;  2V2G A;  4K6X A;  4PX1 A;  6GSX A;  2O8V B;  2VL3 A;  3FZ5 A;  4ECJ A;  4OCE A;  3KMO A;  1SU9 A;  2CX3 A;  2FWG A;  4Q5F A;  4JRR A;  3UJ1 A;  4CHS A;  5KEJ A;  1KBN A;  3IR4 A;  4DSS B;  3G7J A;  1SD9 A;  3GIX A;  4ID0 A;  1OAZ A;  4IQA A;  4WF4 A;  1TK5 B;  2J23 A;  2A4V A;  4MA9 A;  2WS2 A;  4XHM A;  2CVK A;  3IXR A;  5CO3 A;  3O3T A;  1T3B A;  2VL9 A;  1OC9 B;  5ABR A;  1T1V A;  2VCW A;  1PMT A;  5D9X A;  5ECI B;  4KDU A;  5J3R A;  2OKA A;  4IEL A;  1FB6 A;  3IPZ A;  1PL1 A;  2OE0 A;  3DEX A;  3LQ7 A;  6GSW A;  2KUC A;  2FHE A;  2F9S A;  3L9V A;  4EE0 A;  5FT3 A;  3HXS A;  2M72 A;  4JU5 A;  3ZFL A;  3ME7 A;  2TRX A;  3H8Q A;  3IC8 A;  1YEX A;  3ZZX A;  1O7U A;  3M9J A;  4IN0 A;  4IBP A;  2WDU A;  1U87 A;  4K5R A;  3I69 A;  2DLX A;  2BJX A;  1XBS A;  2A2R A;  4IVF A;  2HYX A;  4OFM A;  2TRC P;  1YEP A;  3KCM A;  1ZOF A;  3KH7 A;  4WEY A;  4I97 A;  4I6X A;  3E3E A;  3H93 A;  4KH7 A;  2I81 A;  5JCW A;  1SKW B;  2AJQ B;  1WWJ A;  2LRT A;  2JSY A;  3HDC A;  2GVP A;  5E59 A;  3GTU A;  2WGR A;  1XCC A;  3GKX A;  4G9H A;  3GA4 A;  4TW5 A;  5KN0 A;  2JZR A;  3ZTL A;  2VLV A;  4L5O A;  3LG6 A;  3KH9 A;  2HSY A;  2HRK A;  2IPA A;  4ZBD A;  3EPT A;  3SWL A;  3UBL A;  4LLR A;  4MCU A;  1J0F A;  3KP9 A;  3FYG A;  2C1Y A;  5J5N A;  1JHB A;  3K8N A;  2PVO C;  2B5E A;  2H74 A;  5DQY A;  3TKR A;  2GDR A;  2XPD A;  3TKS E;  3TCO A;  4AJ6 A;  4JED A;  5IPG A;  3UVT A;  5A4W A;  3RBT A;  2R0C A;  4Q5N A;  4I5Q A;  1XFL A;  2VCT A;  4FO5 A;  2FWH A;  2P5Q A;  2PUK C;  4BPY A;  1PSQ A;  2LS5 A;  4BVY B;  1O81 A;  2PWJ A;  4OO4 A;  5F07 A;  2FCH A;  1B8X A;  1GSD A;  1EP8 A;  4HU9 A;  3CSH A;  1NHY A;  1PN9 A;  4ZB9 A;  3VPT A;  1E6B A;  1EOH A;  5DDL A;  3H79 A;  4TVE A;  2C8U A;  2ON5 A;  1O8X A;  5L71 A;  3HZ4 A;  4YAP A;  3PR8 A;  5HFI A;  2FWE A;  1MD4 A;  4K7N A;  2X8G A;  3M9K A;  3US3 A;  3FHK A;  2WRT A;  4K7O A;  2XBQ A;  1YZX A;  3PPU A;  3RHB A;  5LD0 A;  5FWG A;  3HCZ A;  1VF2 A;  4ZIJ A;  1GUM A;  2OAC A;  8GSS A;  2VM2 A;  2DML A;  3UAR A;  3BCI A;  3UL3 A;  2HE3 A;  4N11 A;  2X8H A;  2YP6 A;  3LYP A;  3GV1 A;  1H4O A;  1G7E A;  5IMZ A;  2YWN A;  5EPF A;  2VIM A;  4HJ2 A;  1HD2 A;  1Z9H A;  2CV4 A;  4OFN A;  1Q98 A;  1PQN A;  2DIZ A;  1PX6 A;  1AQW A;  5KOW A;  1YDK A;  3TKS C;  2YWO A;  4N30 A;  4V1A g;  3A5W A;  1UVZ A;  2VAF A;  3APO A;  2HFD A;  1NW2 A;  1OC9 A;  2GSR A;  5CRE A;  3HY2 A;  5ID2 B;  3I6A A;  4ZBB A;  1TRV A;  4KCA A;  1FOH A;  4NV2 A;  3VK9 A;  1GUL A;  1QMV A;  1U3A A;  2V32 A;  1NM3 A;  4BVX A;  1ERW A;  4NXI A;  3NIV A;  5KN3 A;  1F6M C;  4MJC A;  2IJY A;  4GST A;  2R0G A;  1M2B A;  1V57 A;  1PKW A;  3CMI A;  1PL2 A;  5D96 A;  1M3I A;  5COH A;  3Q74 A;  4ECC A;  3VWU A;  2LJR A;  2KP1 A;  3N5O A;  4CW9 A;  4Z2T A;  2AYT A;  2NTO A;  4MP4 A;  2IME A;  4FYB A;  4TOP A;  1DE2 A;  4BIK A;  3WGD A;  4OCF A;  3L9S A;  3BJ5 A;  5JWO B;  1HNC A;  4TR0 A;  4GQF A;  4JBB A;  2AUV A;  2BTO T;  4IJI A;  1VGL A;  3D0Z A;  3GL3 A;  4K2X A;  5IMF A;  3ZLP A;  5HQP A;  2O89 A;  3QR6 A;  2IMI A;  4HQZ A;  5J9C A;  3UOM A;  4LL4 B;  2MMA A;  4MMM A;  3EC3 A;  1F3B A;  3GUR A;  4K5S A;  2H1G A;  4MNN A;  2GSQ A;  1Z7R A;  3L78 A;  3QOU A;  1MDK A;  1XG8 A;  2G0F A;  1A2J A;  1LBK A;  2QA2 A;  2IMD A;  2LTK A;  2ES7 A;  3H1N A;  18GS A;  1TJD A;  5F0G A;  2L5L A;  3I43 A;  4PTS A;  3TOU A;  3QFB C;  3FW2 A;  3U5R E;  2CVB A;  4K9Z A;  1ABA A;  3MNG A;  3HVN A;  22GS A;  3QPM A;  1EV4 A;  1SJ6 A;  1FG4 A;  2OA7 A;  2V41 A;  3BBY A;  2LEG A;  5DCH A;  4MJB A;  2XBI A;  5G1L A;  2CZ3 A;  5DAK A;  4O7H A;  3MDK A;  4IGJ A;  1THX A;  1ZYQ B;  1R26 A;  4YQM A;  1BAY A;  1B9X C;  4CY8 A;  3P2A A;  4IKH A;  2CAQ A;  2ZNM A;  3F6F A;  1MDI A;  1X5E A;  3UIW A;  3IAS 2;  2HRF A;  3LW9 A;  4RI7 A;  3CTG A;  1FAA A;  5B6N A;  2K8S A;  2FGX A;  1KEB A;  2XC2 A;  2L5O A;  4HS1 A;  1PRX A;  3GKM A;  4NMU A;  3GSS A;  4L8E A;  5ECR B;  3DML A;  2OJL A;  1WE0 A;  1O85 A;  3M8N A;  1AQV A;  3LXT A;  1YY7 A;  4F2I A;  1S3C A;  2DBC A;  1BJX A;  3UEM A;  3DWV A;  1K0M A;  4IHU A;  4IS0 A;  3MSZ A;  5GAN D;  2GGT A;  1GWC A;  3V1W A;  1I5G A;  3UAP A;  4NAX A;  2F51 A;  1RQM A;  4YQV A;  4XS4 B;  5DQS A;  3WGX A;  2KLX A;  2I4A A;  2H0G A;  3GST A;  4ZL9 A;  1Q4J A;  2VCZ A;  2K9F A;  4V2M A;  4GSN A;  2JAC A;  4ACS A;  5AIV A;  3FR6 A;  4MPF A;  3EWL A;  2H6Y A;  3HJP A;  3C1S A;  2GST A;  3CYN A;  4BL7 A;  2F8F A;  3G7I A;  5IMC A;  4DVC A;  1J9B A;  4TR1 B;  5C04 A;  2YPM A;  3CXG A;  3GKN A;  3LJR A;  1F3A A;  4IP6 A;  4YH2 A;  2K18 A;  6GSS A;  1DSB A;  1G6Y A;  3VWV A;  4PQI A;  3A5I A;  2ZCT A;  5FHI A;  3DXB A;  3KMN A;  4G19 A;  5C00 A;  3TJK A;  2B5Y A;  4AJ7 A;  4IJ3 A;  2O85 A;  16GS A;  2B6M A;  4DSQ A;  4MF7 A;  3A2V A;  5IOX A;  1K3O A;  3GRX A;  2B3S A;  4IW9 A;  1XWC A;  2F3M A;  3GL5 A;  4ZL7 A;  1EGR A;  3PH9 A;  4EVM A;  5G5E A;  5GZZ B;  5IMV A;  2O87 A;  1MD3 A;  4ZB6 A;  1G0T A;  3LOR A;  3M3M A;  2VM1 A;  4HJM A;  2FUG 2;  1NHO A;  3MWH A;  3QDN A;  2E0Q A;  4K0G A;  4PNG A;  1THO A;  1VF3 A;  1ZCP A;  3IAM 2;  3TKQ A;  1TXX A;  3ZRE A;  3GMF A;  1ZZY A;  1QUW A;  2PPT A;  1YF0 A;  3F6D A;  4NHW A;  3DD3 A;  1K0N A;  4PQ1 A;  4TXO B;  1IYH A;  2R4V A;  3TJG A;  4YKG A;  1CQH A;  1GTA A;  1OE7 A;  3LGC A;  4F82 A;  17GS A;  2HXK A;  3D4M A;  3TRX A;  1FO5 A;  1GLP A;  1DBY A;  3TRP A;  4GSS A;  3R3E A;  1HNB A;  4QL7 A;  1EGO A;  4WF5 A;  3FZA A;  1PKZ A;  2VL2 C;  4GQC A;  3QAG A;  1XXU A;  1SEN A;  4MZC A;  2ZUP A;  2LRN A;  1XOA A;  1EZK A;  3CBU A;  2MBS A;  1BG5 A;  1TK0 B;  4K1F A;  1GSS A;  1E2Y A;  3KTL A;  4TXV A;  3TJJ A;  1GTI A;  4TN8 A;  5DAL A;  4EO3 A;  3L0H A;  4PXO A;  1X9M B;  1ZMA A;  2H66 A;  4YKF A;  2ALB A;  4KSO A;  2V1M A;  2AV4 A;  3KP8 A;  4EKZ A;  1FOV A;  1ML6 A;  1OVN A;  2DC5 A;  4F0C A;  1QQ2 A;  2JZS A;  3RDW A;  5B8B A;  1A8L A;  3GYK A;  1G6W A;  1F37 A;  2LUS A;  2C3Q A;  1ZYE A;  5D8I A;  4JZQ A;  1QFN A;  1JZR A;  1W89 A;  5A4V A;  2WCI A;  3U6V A;  2PGT A;  5HR3 A;  1JFU A;  4EF0 A;  4N0V A;  5IIZ A;  1EWX A;  2NVL A;  5INY A;  3HYP A;  1BYE A;  3QAV A;  2BMX A;  2X49 A;  3GX8 A;  5G1K A;  6GSV A;  2HZE B;  4YAV A;  2H1B A;  2UZ8 A;  4PNF A;  5JWQ B;  3D22 A;  5ECP B;  3TOT A;  2JU5 A;  5DJL A;  3I9V 2;  3R2Q A;  2H0I A;  1SL0 B;  3F4S A;  4GLT A;  3D5J A;  5J4U A;  2I1U A;  1U88 A;  3A3T A;  5IO2 A;  1A24 A;  3TKS A;  3M0F A;  1YKA A;  1SKR B;  2B1L A;  2DKH A;  3FMW A;  1XWB A;  2QSI A;  3VWW A;  1Z6N A;  5CYY A;  3EIN A;  2LKU A;  3JCM L;  4D73 A;  1V98 A;  1Z6M A;  5ECK B;  2AB6 A;  4KUN A;  3F4R A;  2JZT A;  2FY6 A;  4FYU A;  1A23 A;  3W8J A;  1V40 A;  1R5P A;  3QCP A;  2YZH A;  3DKS A;  4L0U A;  1M99 A;  1K3Y A;  3HD5 A;  2H1D A;  5EVO A;  2L57 A;  6GSY A;  3VUR A;  1R5A A;  3GUS A;  4GTU A;  3E0U A;  4Q5Q A;  1XWA A;  1ILO A;  3L4N A;  1BQ7 A;  2VLU A;  4KSM A;  3F0I A;  5HR1 A;  1XWK A;  2H73 A;  2VD0 A;  2WJU A;  3F63 A;  2X64 A;  4O5Q A;  5B7C A;  2QKE A;  2EC4 A;  4ECB A;  3GN3 A;  5GSS A;  3SBC A;  3EMP A;  4ZBA A;  1ZL9 A;  3M1G A;  1JLW A;  4MPG A;  3ZVJ A;  2TIR A;  4USS A;  4DSS A;  5BRT A;  1NSW A;  1ACV A;  4IQ1 A;  1GSU A;  1TRS A;  1YF1 A;  3HA9 A;  3UMA A;  2B7K A;  3VPQ A;  1GNW A;  4EDY A;  4O32 A;  1K3L A;  4I2T A;  2VUP A;  3DVW A;  3FR3 A;  2J9H A;  5DCG A;  4XS1 A;  5DJM A;  1XW6 A;  3P8W A;  3VLN A;  2WZ9 A;  2MMN A;  3IC4 A;  4GF0 A;  2LQQ A;  4GWR A;  3APQ A;  4KE3 A;  2B7J A;  4F9Z A;  1GSF A;  4MJA A;  5GAP D;  3ISO A;  2HRN A;  5G2Z A;  1M9B A;  1U6T A;  2P31 A;  5F06 A;  4GCI A;  2DJ3 A;  1T4Z A;  5A4U A;  3D4T A;  3ERF A;  4OFT A;  2H6X A;  5IQY A;  3ZVJ D;  4ML1 A;  4TR3 A;  4POB A;  4EXJ A;  2K6V A;  5D9V A;  2GT6 A;  3G7Y A;  4ZL8 A;  1MEK A;  2DJ0 A;  1O6J A;  3TJB A;  1A0F A;  1GTB A;  1ERU A;  4PGT A;  4ICY A;  4IP1 A;  3GFK A;  2H6Z A;  3J7Y k;  3EE2 A;  1EEJ A;  3EVI A;  2YWI A;  5H5Q A;  3TRQ A;  5CRW A;  4GRF A;  4WET A;  5LNK e;  2LNT A;  2YNX A;  2DJJ A;  1M3J A;  4EUY A;  1OE8 A;  4N10 A;  3AY8 A;  4XTS A;  3ERW A;  2R37 A;  1B48 A;  2FA4 A;  2IL3 A;  1TU7 A;  1CQG A;  1YJ6 A;  3FEU A;  2JL4 A;  1N2A A;  2DIY A;  2OE3 A;  4HI7 A;  3CRU A;  4WBJ A;  5HR0 A;  4BWS A;  5B6M A;  2F8A A;  3MYD A;  1M0U A;  1UC7 A;  1WMJ A;  2LRC A;  4J57 E;  2P0G A;  5DVB A;  2DJK A;  1JZD A;  3KM6 A;  4ZB8 A;  4HDE A;  1M9A A;  1KTE A;  1SD8 A;  3IBH A;  5EY6 A;  1TP9 A;  4BVY A;  2GQM A;  4HOJ A;  1PN0 A;  2X8C A;  2V6O A;  5CRG A;  3KTB A;  1EP7 A;  3IHG A;  3LWA A;  4ZIL A;  2R2J A;  11GS A;  1SL1 B;  4OMV A;  4EIP A;  1MDJ A;  3GTU B;  2IN3 A;  3Q6O A;  5E4W A;  5IMD A;  2HT9 A;  5G5F A;  1Z3E A;  1WRY A;  3EU3 A;  2H71 A;  3ZL5 A;  4WKW A;  3BD2 A;  3DIE A;  1S3R A;  3ZIT A;  1JZW A;  2NDO A;  5BMU A;  1GSE A;  2O7K A;  2Z9S A;  3PGT A;  1J08 A;  1X0R A;  2PER A;  2V6K A;  4FH8 A;  4LA1 A;  4V2N A;  2RM5 A;  2VCV A;  3H4K A;  4MH2 A;  3ZMK A;  4H86 A;  2CZ2 A;  3UVH A;  2X99 A;  1VRS D;  4HU7 A;  1WJK A;  1QXH A;  2MMO A;  3VI5 A;  1TOF A;  2IMF A;  3BOA A;  2WUL A;  1A0R P;  1GP1 A;  1PA3 A;  5CP1 A;  2CAI A;  4TR4 A;  3ERG A;  2I3Y A;  1XVW A;  2VOC A;  3QD9 A;  1S3D A;  1EOG A;  3HZ8 A;  3CRT A;  1XPV A;  2QGV A;  2YJH A;  1T00 A;  1V58 A;  4I2U A;  1K0B A;  1TI3 A;  3FK8 A;  2C4J A;  4F03 A;  3E9J B;  1USB A;  5ENU A;  3MAK A;  3ZYW A;  2CT6 A;  4L5L A;  2H70 A;  2IMK A;  2RLI A;  3W6G A;  2AHE A;  4EDZ A;  1XVQ A;  5ID2 A;  2HLS A;  14GS A;  3D6I A;  4ILF A;  4QL9 A;  2ON7 A;  1DE1 A;  2MZC A;  2RUF A;  3LEF A;  2GZP A;  5IM9 A;  3FR9 A;  2NBS A;  5ELA A;  1AUC A;  3ZFB A;  2VL2 A;  1RK4 A;  3A2X A;  3RPP A;  4RUV A;  1UN2 A;  4KA0 A;  2NPB A;  1UA5 A;  4MH3 A;  2HRA A;  6GST A;  3DVX A;  4O92 A;  4XS6 A;  3HJM A;  10GS A;  3GX0 A;  5CAX A;  5CNW A;  2VO4 A;  1MTC A;  1AC1 A;  2YWM A;  4NV5 A;  1F9M A;  3KIJ A;  1FVK A;  3C73 A;  3N9J A;  3MIX A;  4TKY A;  2DKI A;  2GQK A;  4LL1 B;  2VD1 A;  5A5K A;  3S9F A;  2HZF A;  1XWG A;  2LV3 A;  1ERV A;  3CSJ A;  2WB9 A;  5HR2 A;  1GL8 A;  4KDX A;  1OKD A;  1ZYP A;  2GQL A;  2H75 A;  2N5F A;  1Z7P A;  2DJ1 A;  6GSU A;  3OR5 A;  3EUR A;  1K0D A;  4HZ2 A;  2N5B A;  2CVD A;  1TRU A;  5AN1 A;  5CRD A;  5F05 A;  3KEB A;  4KGI A;  2C0G A;  2R5G A;  3D21 A;  1ON4 A;  1FB0 A;  4Z2R A;  4JE1 A;  1GRX A;  1R4W A;  3G9B A;  2C0F A;  4V2L A;  2A2S A;  1B4Q A;  3RAZ A;  1Z5Y E;  2LST A;  3IDV A;  3KZQ A;  4DSR A;  4KX4 A;  2FD3 A;  4BVX B;  3WT2 A;  4PUR A;  5KOX A;  1G7O A;  5DBQ A;  4MF6 A;  1VF1 A;  1XIY A;  2H8L A;  4X1U A;  2P5R A;  4POM A;  2PN8 A;  2PMT A;  2LNS A;  2H19 A;  1ST9 A;  1X5C A;  1XZO A;  3ME8 A;  1FHE A;  2DMM A;  4HSC X;  2L4C A;  1EEM A;  4HZ4 A;  3EYT A;  4G10 A;  3F4T A;  4DEJ A;  1B4P A;  1V9W A;  2OBI A;  2YN1 A;  5J9B A;  1JZO A;  4G0L A;  3L9U A;  3DGQ A;  3QFA C;  5ECH B;  1A8Y A;  2CA8 A;  1GTU A;  5KN1 A;  1GH2 A;  2HNL A;  4KF9 A;  2E2G A;  1AAZ A;  1LJR A;  2H1A A;  4WXT A;  5IOW A;  2IFQ B;  1GUK A;  1TK8 B;  3ZIV A;  1TKD B;  4PUA A;  4K2D A;  2GS3 A;  1SJI A;  3GKK A;  2EIO A;  4LMV A;  4EL1 A;  3GH6 A;  2IIY A;  2EIQ A;  2L6C A;  4XCS A;  4JR4 A;  1U3I A;  2GSS A;  3LXZ A;  5ECN B;  1SJZ A;  2YCD A;  1M2D A;  1PX7 A;  5IMA A;  3TGZ A;  4ISD A;  4BA7 A;  5IO0 A;  2C0D A;  3C71 A;  1HQO A;  4MK3 A;  2XPE A;  2KP2 A;  1AIU A;  3APS A;  4XS4 A;  2I9H A;  3HJO A;  3LYK A;  4G2E A;  4HEA 2;  1K0O A;  4AJ8 A;  2EIR A;  2M80 A;  2JAD A;  4YQU A;  2RM6 A;  4X43 A;  4TRX A;  1PGT A;  1X5D A;  4J2F A;  1LU4 A;  3VFI A;  2GZZ A;  4NWY A;  4I8B A;  4TR1 A;  5DAK B;  4FQU A;  2L4Q A;  4K8M A;  2C0E A;  3TDG A;  4Z7X A;  2WFC A;  5H5R A;  4ML6 A;  2B1K A;  19GS A;  4HUA A;  1X9W B;  4E8H A;  4X4J A;  1HYU A;  7GSS A;  2X4A A;  3VWX A;  1WIK A;  2HSH A;  4OD7 A;  3FZ4 A;  4PQH A;  1SYX A;  1RW1 A;  2YJ7 A;  2H0H A;  4RI6 A;  1XW5 A;  4A5P A;  3IE3 A;  2PBJ A;  4O5R A;  3Q18 A;  4CDO A;  3ZIJ A;  1GLQ A;  2GTU A;  4ECI A;  1Y6E A;  4MLY A;  2H30 A;  2MYG A;  3P7X A;  1FW1 A;  1GSY A;  2C3T A;  5ELG A;  1C72 A;  2CX4 A;  2VLT A;  1TW9 A;  3IK9 A;  1WOU A;  1OC3 A;  3IRA A;  3CTF A;  4RQR A;  3NOF A;  1H75 A;  3F8U A;  1SYR A;  2A2P A;  5EL8 A;  4MF5 A;  3IK7 A;  3TUE A;  5HFG A;  4BL7 B;  1M7T A;  3KD0 A;  3CQF A;  4LMW A;  4CY6 A;  12GS A;  1EV9 A;  4WR5 A;  3J7Y b;  5HFK A;  1KNG A;  2H76 A;  1QGV A;  2CQ9 A;  3TB2 A;  4TXO A;  1W4V A;  5ECQ B;  1VF4 A;  2PU9 C;  2PVQ A;  1BX9 A;  3KGK A;  2YOI A;  13GS A;  4EIQ A;  2HI7 A;  4MAB A;  2OE1 A;  5ECL B;  2GT5 A;  5ECS A;  4EC0 A;  1XW9 A;  1GNE A;  3HVS A;  2LJA A;  3UBK A;  1TRW A;  3CSI A;  4POK A;  5H5S A;  4L0W A;  2VCX A;  2KOK A;  3BCK A;  3WGE A;  1OYJ A;  4AF2 A;  3LFL A;  5AGY A;  4ZXG A;  3PIN A;  3IA1 A;  4BWQ A;  2MMZ A;  2D2Z A;  1N8J A;  4HQS A;  3A2W A;  1PD2 1;  2FLS A;  3C7M A;  4F0B A;  3F3R A;  3HVX A;  2K8V A;  4MDC A;  1ERT A;  1O73 A;  3P90 A;  5GST A;  5AIS A;  3C8E A;  3VI7 A;  4FIW A;  2R0P A;  2QA1 A;  4K7I A;  5LCZ A;  2VCQ A;  1XOB A;  3WYW A;  3C1R A;  4FYC A;  2L6D A;  2FNO A;  1GSQ A;  5D9W A;  5G30 A;  1YQ1 A;  2XHF A;  1M2A A;  2OAD A;  4Q5R A;  9GSS A;  2GZY A;  3W8S A;  3HHV A;  4NHZ A;  5JCU A;  5J41 A;  3RHC A;  1T4Y A;  1I9D A;  5JCG A;  2IFQ A;  4WBR D;  2FWF A;  1K0A A;  2RII A;  1QK8 A;  3FKF A;  4XRA A;  2RUE A;  1TU8 A;  1F2E A;  2REM A;  1S3A A;  3FRC A;  4E8E A;  5G31 A;  1B9Y C;  5ECO B;  1ZYN A;  1SKS B;  2YV9 A;  1Y25 A;  1T7P B;  2E2M A;  4N0Z A;  2HZE A;  3GHA A;  2H72 A;  3EMX A;  1TI1 A;  4KCE A;  4POL A;  4KB3 A;  2IWT A;  1A2M A;  2M46 A;  5F8B A;  1WP0 A;  4G0K A;  2FA8 A;  5ECM B;  2YZU A;  3RPN A;  4MJE A;  3GNJ A;  4NPB A;  3ED3 A;  2JSZ A;  1OC8 A;  4KDY A;  5DAL B;  4G0I A;  2G2Q A;  4RQX A;  1A2L A;  2N5A A;  2R3X A;  4QQ7 A;  4Z2U A;  1R7H A;  20GS A;  4K0N A;  5CRH A;  1JLV A;  3KXO A;  1X9S B;  4OO5 A;  5KN2 A;  1SK1 A;  2DJ2 A;  3O76 A;  5D93 A;  3QAW A;  2QC7 A;  4V1A p;  2A4H A;  4GXZ A;  1ZGN A;  4XRD A;  4PUF C;  3NZN A;  2GLR A;  4WR4 A;  2R6K A;  2H01 A;  2C80 A;  4KND A;  5AIX A;  5JWR B;  1OKT A;  1AXD A;  3LSZ A;  3WD6 A;  2LJK A;  1DUG A;  3WT1 A;  1AQX A;  3F3Q A;  2YAN A;  2C3N A;  4MZW A;  3FZ9 A;  2OBK A;  3KJY A;  1AW9 A;  3Q19 A;  4KW6 A;  1K0C A;  1T8E B;  1YKC A;  4P3Y B;  3TJF A;  4OWY A;  3HVV A;  4ULX A;  3DYR A;  4J56 E;  3GH9 A;  1SK0 A;  4AGS A;  2B5X A;  1O8W A;  1SL2 B;  4JR6 A;  4O5U A;  1SK2 A;  2DSA A;  1IYI A;  3ZML A;  3ZRD A;  5B8A A;  4KAE A;  3IOS A;  3F9U A;  2AAW A;  4D73 B;  5D73 A;  2HSM A;  4X0X A;  5D9T A;  1GUH A;  1WPI A;  3TKP A; 
#chains in the Genus database with same CATH homology
 3DRN A;  3IHQ A;  3IV4 A;  1TTZ A;  1HNA A;  2E7P A;  1TDI A;  3FY7 A;  3O6T A;  5IPH A;  3HKR A;  3QMX A;  2LQO A;  2L59 A;  2YV7 A;  4XIH A;  3EU4 A;  1BED A;  1FVJ A;  2KHP A;  4MZB A;  1URM A;  1V2A A;  2MBT A;  2V2G A;  4K6X A;  4PX1 A;  6GSX A;  2O8V B;  2VL3 A;  3FZ5 A;  4ECJ A;  4OCE A;  3KMO A;  1SU9 A;  2CX3 A;  2FWG A;  4Q5F A;  4JRR A;  3UJ1 A;  4CHS A;  5KEJ A;  1KBN A;  3IR4 A;  4DSS B;  3G7J A;  1SD9 A;  3GIX A;  4ID0 A;  1OAZ A;  4IQA A;  4WF4 A;  1TK5 B;  2J23 A;  2A4V A;  4MA9 A;  2WS2 A;  4XHM A;  2CVK A;  3IXR A;  5CO3 A;  3O3T A;  1T3B A;  2VL9 A;  1OC9 B;  5ABR A;  1T1V A;  2VCW A;  1PMT A;  5D9X A;  5ECI B;  4KDU A;  5J3R A;  2OKA A;  4IEL A;  1FB6 A;  3IPZ A;  1PL1 A;  2OE0 A;  3DEX A;  3LQ7 A;  6GSW A;  2KUC A;  2FHE A;  2F9S A;  3L9V A;  4EE0 A;  5FT3 A;  3HXS A;  2M72 A;  4JU5 A;  3ZFL A;  3ME7 A;  2TRX A;  3H8Q A;  3IC8 A;  1YEX A;  3ZZX A;  1O7U A;  3M9J A;  4IN0 A;  4IBP A;  2WDU A;  1U87 A;  4K5R A;  3I69 A;  2DLX A;  2BJX A;  1XBS A;  2A2R A;  4IVF A;  2HYX A;  4OFM A;  2TRC P;  1YEP A;  3KCM A;  1ZOF A;  3KH7 A;  4WEY A;  4I97 A;  4I6X A;  3E3E A;  3H93 A;  4KH7 A;  2I81 A;  5JCW A;  1SKW B;  2AJQ B;  1WWJ A;  2LRT A;  2JSY A;  3HDC A;  2GVP A;  5E59 A;  3GTU A;  2WGR A;  1XCC A;  3GKX A;  4G9H A;  3GA4 A;  4TW5 A;  5KN0 A;  2JZR A;  3ZTL A;  2VLV A;  4L5O A;  3LG6 A;  3KH9 A;  2HSY A;  2HRK A;  2IPA A;  4ZBD A;  3EPT A;  3SWL A;  3UBL A;  4LLR A;  4MCU A;  1J0F A;  3KP9 A;  3FYG A;  2C1Y A;  5J5N A;  1JHB A;  3K8N A;  2PVO C;  2B5E A;  2H74 A;  5DQY A;  3TKR A;  2GDR A;  2XPD A;  3TKS E;  3TCO A;  4AJ6 A;  4JED A;  5IPG A;  3UVT A;  5A4W A;  3RBT A;  2R0C A;  4Q5N A;  4I5Q A;  1XFL A;  2VCT A;  4FO5 A;  2FWH A;  2P5Q A;  2PUK C;  4BPY A;  1PSQ A;  2LS5 A;  4BVY B;  1O81 A;  2PWJ A;  4OO4 A;  5F07 A;  2FCH A;  1B8X A;  1GSD A;  1EP8 A;  4HU9 A;  3CSH A;  1NHY A;  1PN9 A;  4ZB9 A;  3VPT A;  1E6B A;  1EOH A;  5DDL A;  3H79 A;  4TVE A;  2C8U A;  2ON5 A;  1O8X A;  5L71 A;  3HZ4 A;  4YAP A;  3PR8 A;  5HFI A;  2FWE A;  1MD4 A;  4K7N A;  2X8G A;  3M9K A;  3US3 A;  3FHK A;  2WRT A;  4K7O A;  2XBQ A;  1YZX A;  3PPU A;  3RHB A;  5LD0 A;  5FWG A;  3HCZ A;  1VF2 A;  4ZIJ A;  1GUM A;  2OAC A;  8GSS A;  2VM2 A;  2DML A;  3UAR A;  3BCI A;  3UL3 A;  2HE3 A;  4N11 A;  2X8H A;  2YP6 A;  3LYP A;  3GV1 A;  1H4O A;  1G7E A;  5IMZ A;  2YWN A;  5EPF A;  2VIM A;  4HJ2 A;  1HD2 A;  1Z9H A;  2CV4 A;  4OFN A;  1Q98 A;  1PQN A;  2DIZ A;  1PX6 A;  1AQW A;  5KOW A;  1YDK A;  3TKS C;  2YWO A;  4N30 A;  4V1A g;  3A5W A;  1UVZ A;  2VAF A;  3APO A;  2HFD A;  1NW2 A;  1OC9 A;  2GSR A;  5CRE A;  3HY2 A;  5ID2 B;  3I6A A;  4ZBB A;  1TRV A;  4KCA A;  1FOH A;  4NV2 A;  3VK9 A;  1GUL A;  1QMV A;  1U3A A;  2V32 A;  1NM3 A;  4BVX A;  1ERW A;  4NXI A;  3NIV A;  5KN3 A;  1F6M C;  4MJC A;  2IJY A;  4GST A;  2R0G A;  1M2B A;  1V57 A;  1PKW A;  3CMI A;  1PL2 A;  5D96 A;  5COH A;  3Q74 A;  4ECC A;  3VWU A;  2LJR A;  2KP1 A;  3N5O A;  4CW9 A;  4Z2T A;  2AYT A;  2NTO A;  4MP4 A;  2IME A;  4FYB A;  4TOP A;  1DE2 A;  3WGD A;  4OCF A;  3L9S A;  3BJ5 A;  5JWO B;  1HNC A;  4TR0 A;  4GQF A;  4JBB A;  2AUV A;  2BTO T;  4IJI A;  1VGL A;  3D0Z A;  3GL3 A;  4K2X A;  5IMF A;  3ZLP A;  5HQP A;  2O89 A;  3QR6 A;  2IMI A;  4HQZ A;  5J9C A;  3UOM A;  4LL4 B;  2MMA A;  4MMM A;  3EC3 A;  1F3B A;  3GUR A;  4K5S A;  2H1G A;  4MNN A;  2GSQ A;  1Z7R A;  3L78 A;  3QOU A;  1MDK A;  2G0F A;  1A2J A;  1LBK A;  2QA2 A;  2IMD A;  2LTK A;  2ES7 A;  3H1N A;  18GS A;  1TJD A;  5F0G A;  2L5L A;  3I43 A;  4PTS A;  3TOU A;  3QFB C;  3FW2 A;  3U5R E;  2CVB A;  4K9Z A;  1ABA A;  3MNG A;  22GS A;  3QPM A;  1EV4 A;  1SJ6 A;  1FG4 A;  2OA7 A;  2V41 A;  3BBY A;  2LEG A;  5DCH A;  4MJB A;  2XBI A;  5G1L A;  2CZ3 A;  5DAK A;  4O7H A;  3MDK A;  4IGJ A;  1THX A;  1ZYQ B;  1R26 A;  4YQM A;  1BAY A;  1B9X C;  4CY8 A;  3P2A A;  4IKH A;  2CAQ A;  2ZNM A;  3F6F A;  1MDI A;  1X5E A;  3UIW A;  3IAS 2;  2HRF A;  3LW9 A;  4RI7 A;  3CTG A;  1FAA A;  5B6N A;  2K8S A;  2FGX A;  1KEB A;  2XC2 A;  2L5O A;  4HS1 A;  1PRX A;  3GKM A;  4NMU A;  3GSS A;  4L8E A;  5ECR B;  3DML A;  2OJL A;  1WE0 A;  1O85 A;  3M8N A;  1AQV A;  3LXT A;  1YY7 A;  4F2I A;  1S3C A;  2DBC A;  1BJX A;  3UEM A;  3DWV A;  1K0M A;  4IHU A;  4IS0 A;  3MSZ A;  5GAN D;  2GGT A;  1GWC A;  3V1W A;  1I5G A;  3UAP A;  4NAX A;  2F51 A;  1RQM A;  4YQV A;  4XS4 B;  5DQS A;  3WGX A;  2KLX A;  2I4A A;  2H0G A;  3GST A;  4ZL9 A;  1Q4J A;  2VCZ A;  2K9F A;  4V2M A;  4GSN A;  2JAC A;  4ACS A;  5AIV A;  3FR6 A;  4MPF A;  3EWL A;  2H6Y A;  3HJP A;  3C1S A;  2GST A;  3CYN A;  4BL7 A;  2F8F A;  3G7I A;  5IMC A;  4DVC A;  1J9B A;  4TR1 B;  5C04 A;  2YPM A;  3CXG A;  3GKN A;  3LJR A;  1F3A A;  4IP6 A;  4YH2 A;  2K18 A;  6GSS A;  1DSB A;  1G6Y A;  3VWV A;  4PQI A;  3A5I A;  2ZCT A;  5FHI A;  3DXB A;  3KMN A;  4G19 A;  5C00 A;  3TJK A;  2B5Y A;  4AJ7 A;  4IJ3 A;  2O85 A;  16GS A;  2B6M A;  4DSQ A;  4MF7 A;  3A2V A;  5IOX A;  1K3O A;  3GRX A;  2B3S A;  4IW9 A;  1XWC A;  2F3M A;  3GL5 A;  4ZL7 A;  1EGR A;  3PH9 A;  4EVM A;  5G5E A;  5GZZ B;  5IMV A;  2O87 A;  1MD3 A;  4ZB6 A;  1G0T A;  3LOR A;  3M3M A;  2VM1 A;  4HJM A;  2FUG 2;  1NHO A;  3MWH A;  3QDN A;  2E0Q A;  4K0G A;  4PNG A;  1THO A;  1VF3 A;  1ZCP A;  3IAM 2;  3TKQ A;  1TXX A;  3ZRE A;  3GMF A;  1ZZY A;  1QUW A;  2PPT A;  1YF0 A;  3F6D A;  4NHW A;  3DD3 A;  1K0N A;  4PQ1 A;  4TXO B;  1IYH A;  2R4V A;  3TJG A;  4YKG A;  1CQH A;  1GTA A;  1OE7 A;  3LGC A;  4F82 A;  17GS A;  2HXK A;  3D4M A;  3TRX A;  1FO5 A;  1GLP A;  1DBY A;  3TRP A;  4GSS A;  3R3E A;  1HNB A;  4QL7 A;  1EGO A;  4WF5 A;  3FZA A;  1PKZ A;  2VL2 C;  4GQC A;  3QAG A;  1XXU A;  1SEN A;  4MZC A;  2ZUP A;  2LRN A;  1XOA A;  1EZK A;  3CBU A;  2MBS A;  1BG5 A;  1TK0 B;  4K1F A;  1GSS A;  1E2Y A;  3KTL A;  4TXV A;  3TJJ A;  1GTI A;  4TN8 A;  5DAL A;  4EO3 A;  3L0H A;  4PXO A;  1X9M B;  1ZMA A;  2H66 A;  4YKF A;  2ALB A;  4KSO A;  2V1M A;  2AV4 A;  3KP8 A;  4EKZ A;  1FOV A;  1ML6 A;  1OVN A;  2DC5 A;  4F0C A;  1QQ2 A;  2JZS A;  3RDW A;  5B8B A;  1A8L A;  3GYK A;  1G6W A;  1F37 A;  2LUS A;  2C3Q A;  1ZYE A;  5D8I A;  4JZQ A;  1QFN A;  1JZR A;  1W89 A;  5A4V A;  2WCI A;  3U6V A;  2PGT A;  5HR3 A;  1JFU A;  4EF0 A;  4N0V A;  5IIZ A;  1EWX A;  2NVL A;  5INY A;  3HYP A;  1BYE A;  3QAV A;  2BMX A;  2X49 A;  3GX8 A;  5G1K A;  6GSV A;  2HZE B;  4YAV A;  2H1B A;  2UZ8 A;  4PNF A;  5JWQ B;  3D22 A;  5ECP B;  3TOT A;  2JU5 A;  5DJL A;  3I9V 2;  3R2Q A;  2H0I A;  1SL0 B;  3F4S A;  4GLT A;  3D5J A;  5J4U A;  2I1U A;  1U88 A;  3A3T A;  5IO2 A;  1A24 A;  3TKS A;  3M0F A;  1YKA A;  1SKR B;  2B1L A;  2DKH A;  3FMW A;  1XWB A;  2QSI A;  3VWW A;  1Z6N A;  5CYY A;  3EIN A;  2LKU A;  3JCM L;  4D73 A;  1V98 A;  1Z6M A;  5ECK B;  2AB6 A;  4KUN A;  3F4R A;  2JZT A;  2FY6 A;  4FYU A;  1A23 A;  3W8J A;  1V40 A;  1R5P A;  3QCP A;  2YZH A;  3DKS A;  4L0U A;  1M99 A;  1K3Y A;  3HD5 A;  2H1D A;  5EVO A;  2L57 A;  6GSY A;  3VUR A;  1R5A A;  3GUS A;  4GTU A;  3E0U A;  4Q5Q A;  1XWA A;  1ILO A;  3L4N A;  1BQ7 A;  2VLU A;  4KSM A;  3F0I A;  5HR1 A;  1XWK A;  2H73 A;  2VD0 A;  2WJU A;  3F63 A;  2X64 A;  4O5Q A;  5B7C A;  2QKE A;  2EC4 A;  4ECB A;  3GN3 A;  5GSS A;  3SBC A;  3EMP A;  4ZBA A;  1ZL9 A;  3M1G A;  1JLW A;  4MPG A;  3ZVJ A;  2TIR A;  4USS A;  4DSS A;  5BRT A;  1NSW A;  1ACV A;  4IQ1 A;  1GSU A;  1TRS A;  1YF1 A;  3HA9 A;  3UMA A;  2B7K A;  3VPQ A;  1GNW A;  4EDY A;  4O32 A;  1K3L A;  4I2T A;  2VUP A;  3DVW A;  3FR3 A;  2J9H A;  5DCG A;  4XS1 A;  5DJM A;  1XW6 A;  3P8W A;  3VLN A;  2WZ9 A;  2MMN A;  3IC4 A;  4GF0 A;  2LQQ A;  4GWR A;  3APQ A;  4KE3 A;  2B7J A;  4F9Z A;  1GSF A;  4MJA A;  5GAP D;  3ISO A;  2HRN A;  5G2Z A;  1M9B A;  1U6T A;  2P31 A;  5F06 A;  4GCI A;  2DJ3 A;  1T4Z A;  5A4U A;  3D4T A;  3ERF A;  4OFT A;  2H6X A;  5IQY A;  3ZVJ D;  4ML1 A;  4TR3 A;  4POB A;  4EXJ A;  2K6V A;  5D9V A;  2GT6 A;  3G7Y A;  4ZL8 A;  1MEK A;  2DJ0 A;  1O6J A;  3TJB A;  1A0F A;  1GTB A;  1ERU A;  4PGT A;  4ICY A;  4IP1 A;  3GFK A;  2H6Z A;  3J7Y k;  3EE2 A;  1EEJ A;  3EVI A;  2YWI A;  5H5Q A;  3TRQ A;  5CRW A;  4GRF A;  4WET A;  5LNK e;  2LNT A;  2YNX A;  2DJJ A;  4EUY A;  1OE8 A;  4N10 A;  3AY8 A;  4XTS A;  3ERW A;  2R37 A;  1B48 A;  2FA4 A;  2IL3 A;  1TU7 A;  1CQG A;  1YJ6 A;  3FEU A;  2JL4 A;  1N2A A;  2DIY A;  2OE3 A;  4HI7 A;  3CRU A;  4WBJ A;  5HR0 A;  4BWS A;  5B6M A;  2F8A A;  3MYD A;  1M0U A;  1UC7 A;  1WMJ A;  2LRC A;  4J57 E;  2P0G A;  5DVB A;  2DJK A;  1JZD A;  3KM6 A;  4ZB8 A;  4HDE A;  1M9A A;  1KTE A;  1SD8 A;  3IBH A;  5EY6 A;  1TP9 A;  4BVY A;  2GQM A;  4HOJ A;  1PN0 A;  2X8C A;  2V6O A;  5CRG A;  3KTB A;  1EP7 A;  3IHG A;  3LWA A;  4ZIL A;  2R2J A;  11GS A;  1SL1 B;  4OMV A;  4EIP A;  1MDJ A;  3GTU B;  2IN3 A;  3Q6O A;  5E4W A;  5IMD A;  2HT9 A;  5G5F A;  1Z3E A;  1WRY A;  3EU3 A;  2H71 A;  3ZL5 A;  4WKW A;  3BD2 A;  3DIE A;  3ZIT A;  1JZW A;  2NDO A;  5BMU A;  1GSE A;  2O7K A;  2Z9S A;  3PGT A;  1J08 A;  1X0R A;  2PER A;  2V6K A;  4FH8 A;  4LA1 A;  4V2N A;  2RM5 A;  2VCV A;  3H4K A;  4MH2 A;  3ZMK A;  4H86 A;  2CZ2 A;  3UVH A;  2X99 A;  1VRS D;  4HU7 A;  1WJK A;  1QXH A;  2MMO A;  3VI5 A;  1TOF A;  2IMF A;  3BOA A;  2WUL A;  1A0R P;  1GP1 A;  1PA3 A;  5CP1 A;  2CAI A;  4TR4 A;  3ERG A;  2I3Y A;  1XVW A;  2VOC A;  3QD9 A;  1S3D A;  1EOG A;  3HZ8 A;  3CRT A;  1XPV A;  2QGV A;  2YJH A;  1T00 A;  1V58 A;  4I2U A;  1K0B A;  1TI3 A;  3FK8 A;  2C4J A;  4F03 A;  3E9J B;  1USB A;  5ENU A;  3MAK A;  3ZYW A;  2CT6 A;  4L5L A;  2H70 A;  2IMK A;  2RLI A;  3W6G A;  2AHE A;  4EDZ A;  1XVQ A;  5ID2 A;  2HLS A;  14GS A;  3D6I A;  4ILF A;  4QL9 A;  2ON7 A;  1DE1 A;  2MZC A;  2RUF A;  3LEF A;  2GZP A;  5IM9 A;  3FR9 A;  2NBS A;  5ELA A;  1AUC A;  3ZFB A;  2VL2 A;  1RK4 A;  3A2X A;  3RPP A;  4RUV A;  1UN2 A;  4KA0 A;  2NPB A;  1UA5 A;  4MH3 A;  2HRA A;  6GST A;  3DVX A;  4O92 A;  4XS6 A;  3HJM A;  10GS A;  3GX0 A;  5CAX A;  5CNW A;  2VO4 A;  1MTC A;  1AC1 A;  2YWM A;  4NV5 A;  1F9M A;  3KIJ A;  1FVK A;  3C73 A;  3N9J A;  3MIX A;  4TKY A;  2DKI A;  2GQK A;  4LL1 B;  2VD1 A;  5A5K A;  3S9F A;  2HZF A;  1XWG A;  2LV3 A;  1ERV A;  3CSJ A;  2WB9 A;  5HR2 A;  1GL8 A;  4KDX A;  1OKD A;  1ZYP A;  2GQL A;  2H75 A;  2N5F A;  1Z7P A;  2DJ1 A;  6GSU A;  3OR5 A;  3EUR A;  1K0D A;  4HZ2 A;  2N5B A;  2CVD A;  1TRU A;  5AN1 A;  5CRD A;  5F05 A;  3KEB A;  4KGI A;  2C0G A;  2R5G A;  3D21 A;  1ON4 A;  1FB0 A;  4Z2R A;  4JE1 A;  1GRX A;  1R4W A;  3G9B A;  2C0F A;  4V2L A;  2A2S A;  1B4Q A;  3RAZ A;  1Z5Y E;  2LST A;  3IDV A;  3KZQ A;  4DSR A;  4KX4 A;  2FD3 A;  4BVX B;  3WT2 A;  4PUR A;  5KOX A;  1G7O A;  5DBQ A;  4MF6 A;  1VF1 A;  1XIY A;  2H8L A;  4X1U A;  2P5R A;  4POM A;  2PN8 A;  2PMT A;  2LNS A;  2H19 A;  1ST9 A;  1X5C A;  1XZO A;  3ME8 A;  1FHE A;  2DMM A;  2L4C A;  1EEM A;  4HZ4 A;  3EYT A;  4G10 A;  3F4T A;  4DEJ A;  1B4P A;  1V9W A;  2OBI A;  2YN1 A;  5J9B A;  1JZO A;  4G0L A;  3L9U A;  3DGQ A;  3QFA C;  5ECH B;  1A8Y A;  2CA8 A;  1GTU A;  5KN1 A;  1GH2 A;  2HNL A;  4KF9 A;  2E2G A;  1AAZ A;  1LJR A;  2H1A A;  4WXT A;  5IOW A;  2IFQ B;  1GUK A;  1TK8 B;  3ZIV A;  1TKD B;  4PUA A;  4K2D A;  2GS3 A;  1SJI A;  3GKK A;  2EIO A;  4LMV A;  4EL1 A;  3GH6 A;  2IIY A;  2EIQ A;  2L6C A;  4XCS A;  4JR4 A;  1U3I A;  2GSS A;  3LXZ A;  5ECN B;  1SJZ A;  2YCD A;  1M2D A;  1PX7 A;  5IMA A;  3TGZ A;  4ISD A;  4BA7 A;  5IO0 A;  2C0D A;  3C71 A;  1HQO A;  4MK3 A;  2XPE A;  2KP2 A;  1AIU A;  3APS A;  4XS4 A;  2I9H A;  3HJO A;  3LYK A;  4G2E A;  4HEA 2;  1K0O A;  4AJ8 A;  2EIR A;  2M80 A;  2JAD A;  4YQU A;  2RM6 A;  4X43 A;  4TRX A;  1PGT A;  1X5D A;  4J2F A;  1LU4 A;  3VFI A;  2GZZ A;  4NWY A;  4I8B A;  4TR1 A;  5DAK B;  4FQU A;  2L4Q A;  4K8M A;  2C0E A;  3TDG A;  4Z7X A;  2WFC A;  5H5R A;  4ML6 A;  2B1K A;  19GS A;  4HUA A;  1X9W B;  4E8H A;  4X4J A;  1HYU A;  7GSS A;  2X4A A;  3VWX A;  1WIK A;  2HSH A;  4OD7 A;  3FZ4 A;  4PQH A;  1SYX A;  1RW1 A;  2YJ7 A;  2H0H A;  4RI6 A;  1XW5 A;  4A5P A;  3IE3 A;  2PBJ A;  4O5R A;  3Q18 A;  4CDO A;  3ZIJ A;  1GLQ A;  2GTU A;  4ECI A;  1Y6E A;  4MLY A;  2H30 A;  2MYG A;  3P7X A;  1FW1 A;  1GSY A;  2C3T A;  5ELG A;  1C72 A;  2CX4 A;  2VLT A;  1TW9 A;  3IK9 A;  1WOU A;  1OC3 A;  3IRA A;  3CTF A;  4RQR A;  3NOF A;  1H75 A;  3F8U A;  1SYR A;  2A2P A;  5EL8 A;  4MF5 A;  3IK7 A;  3TUE A;  5HFG A;  4BL7 B;  1M7T A;  3KD0 A;  4LMW A;  4CY6 A;  12GS A;  1EV9 A;  4WR5 A;  3J7Y b;  5HFK A;  1KNG A;  2H76 A;  1QGV A;  2CQ9 A;  3TB2 A;  4TXO A;  1W4V A;  5ECQ B;  1VF4 A;  2PU9 C;  2PVQ A;  1BX9 A;  3KGK A;  2YOI A;  13GS A;  4EIQ A;  2HI7 A;  4MAB A;  2OE1 A;  5ECL B;  2GT5 A;  5ECS A;  4EC0 A;  1XW9 A;  1GNE A;  3HVS A;  2LJA A;  3UBK A;  1TRW A;  3CSI A;  4POK A;  5H5S A;  4L0W A;  2VCX A;  2KOK A;  3BCK A;  3WGE A;  1OYJ A;  4AF2 A;  3LFL A;  5AGY A;  4ZXG A;  3PIN A;  3IA1 A;  4BWQ A;  2MMZ A;  2D2Z A;  1N8J A;  4HQS A;  3A2W A;  1PD2 1;  2FLS A;  3C7M A;  4F0B A;  3F3R A;  3HVX A;  2K8V A;  4MDC A;  1ERT A;  1O73 A;  3P90 A;  5GST A;  5AIS A;  3C8E A;  3VI7 A;  4FIW A;  2R0P A;  2QA1 A;  4K7I A;  5LCZ A;  2VCQ A;  1XOB A;  3WYW A;  3C1R A;  4FYC A;  2L6D A;  2FNO A;  1GSQ A;  5D9W A;  5G30 A;  1YQ1 A;  2XHF A;  1M2A A;  2OAD A;  4Q5R A;  9GSS A;  2GZY A;  3W8S A;  3HHV A;  4NHZ A;  5JCU A;  5J41 A;  3RHC A;  1T4Y A;  1I9D A;  5JCG A;  2IFQ A;  4WBR D;  2FWF A;  1K0A A;  2RII A;  1QK8 A;  3FKF A;  4XRA A;  2RUE A;  1TU8 A;  1F2E A;  2REM A;  1S3A A;  3FRC A;  4E8E A;  5G31 A;  1B9Y C;  5ECO B;  1ZYN A;  1SKS B;  2YV9 A;  1Y25 A;  1T7P B;  2E2M A;  4N0Z A;  2HZE A;  3GHA A;  2H72 A;  3EMX A;  1TI1 A;  4KCE A;  4POL A;  4KB3 A;  2IWT A;  1A2M A;  2M46 A;  5F8B A;  1WP0 A;  4G0K A;  2FA8 A;  5ECM B;  2YZU A;  3RPN A;  4MJE A;  3GNJ A;  4NPB A;  3ED3 A;  2JSZ A;  1OC8 A;  4KDY A;  5DAL B;  4G0I A;  2G2Q A;  4RQX A;  1A2L A;  2N5A A;  2R3X A;  4QQ7 A;  4Z2U A;  1R7H A;  20GS A;  4K0N A;  5CRH A;  1JLV A;  3KXO A;  1X9S B;  4OO5 A;  5KN2 A;  1SK1 A;  2DJ2 A;  3O76 A;  5D93 A;  3QAW A;  2QC7 A;  4V1A p;  2A4H A;  4GXZ A;  1ZGN A;  4XRD A;  4PUF C;  3NZN A;  2GLR A;  4WR4 A;  2R6K A;  2H01 A;  2C80 A;  4KND A;  5AIX A;  5JWR B;  1OKT A;  1AXD A;  3LSZ A;  3WD6 A;  2LJK A;  1DUG A;  3WT1 A;  1AQX A;  3F3Q A;  2YAN A;  2C3N A;  4MZW A;  3FZ9 A;  2OBK A;  3KJY A;  1AW9 A;  3Q19 A;  4KW6 A;  1K0C A;  1T8E B;  1YKC A;  4P3Y B;  3TJF A;  4OWY A;  3HVV A;  4ULX A;  3DYR A;  4J56 E;  3GH9 A;  1SK0 A;  4AGS A;  2B5X A;  1O8W A;  1SL2 B;  4JR6 A;  4O5U A;  1SK2 A;  2DSA A;  1IYI A;  3ZML A;  3ZRD A;  5B8A A;  4KAE A;  3IOS A;  3F9U A;  2AAW A;  4D73 B;  5D73 A;  2HSM A;  4X0X A;  5D9T A;  1GUH A;  1WPI A;  3TKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...