2XBQA

Crystal structure of reduced schistosoma mansoni thioredoxin pre- protein at 1.7 angstrom
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
105
structure length
105
Chain Sequence
SELIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKYDAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Structural and Functional Characterization of Schistosoma Mansoni Thioredoxin.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Oxidoreductase
total genus 32
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2010-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2xbqA00
4EL1A 2XBIA 5INYA 2GZZA 3DIEA 1PA3A 3DGQA 4ECIA 1A2LA 4HU7A 3V1WA 1T7PB 3GTUA 5J9BA 2EC4A 4MMMA 2IMFA 3F8UA 4HQZA 3J7Yb 1BG5A 1K3OA 2LJKA 3A2VA 3RPNA 4NHWA 1VGLA 1EV4A 5IO0A 5H5RA 1R7HA 1A23A 7GSSA 1ST9A 5IM9A 4NWYA 1QXHA 1VF2A 2J9HA 2LV3A 2V32A 3EYTA 5GAPD 4X1UA 4JR6A 5JWQB 4BVXA 1GSUA 5IPGA 4RI6A 1ACVA 4IKHA 5DALB 1JZDA 1LJRA 4IJIA 3APSA 5ECOB 3RHBA 2YV9A 2LSTA 2O85A 1IYHA 3EU4A 1ERUA 3FR9A 1K0AA 1WMJA 1KNGA 1PMTA 2TRCP 4KW6A 1GTAA 4G19A 2EIOA 2IMIA 4TR0A 2HRNA 4EC0A 2YN1A 2B7KA 4O5RA 5IMAA 2O7KA 3F6DA 1ZOFA 2REMA 1GSDA 4EXJA 4I2TA 2KP2A 1TI1A 3F9UA 18GSA 4EKZA 2WRTA 2HRFA 2HZEA 1GUMA 1XOBA 2F9SA 1GSFA 4ZL9A 4K8MA 5COHA 2B5XA 4JE1A 3TCOA 4MH3A 3IRAA 2R5GA 2HFDA 1GUKA 1YEPA 2RM6A 2CVDA 5IQYA 3UBLA 2LNTA 5EPFA 1O81A 2DC5A 5CAXA 1AAZA 1EGRA 3GFKA 3CSJA 1A2JA 1PD21 1YF0A 1BYEA 3FR3A 4JZQA 3C7MA 3GNJA 4OFTA 5GSTA 2IMDA 1B9YC 4I97A 2GLRA 4RI7A 5E59A 2CAIA 1Z7PA 2GSTA 4TOPA 1JLWA 5ELGA 2ZNMA 4EDYA 2TIRA 4AJ7A 4I2UA 3P7XA 4V2MA 3LORA 2LRCA 1DE1A 1PL1A 2H71A 4TXVA 6GSTA 1C72A 1AC1A 2CA8A 1U3IA 4N0ZA 4AJ6A 2CV4A 2DJ1A 3OR5A 4TR1A 3UARA 3M1GA 4QL7A 3ZVJA 2HZFA 4IS0A 4TXOA 3KGKA 5HR3A 5CYYA 1GL8A 3IC4A 4HZ4A 1K0CA 1EP8A 3GKXA 3HJMA 3IOSA 22GSA 1Z5YE 1OC8A 2DIZA 5AGYA 4MF5A 1PQNA 2KOKA 1GSYA 3ME8A 1PX6A 4OCFA 1R5AA 4GQFA 4KCAA 3U6VA 2WS2A 5IMVA 1DUGA 3E3EA 4EO3A 5DJLA 2H66A 1YKAA 2X8CA 4FYUA 2H1DA 4MP4A 5D9TA 3CRUA 1V57A 4CHSA 2YWMA 1S3CA 1SJ6A 3QAWA 1FW1A 4YQMA 3TJFA 4F9ZA 1G7OA 3MNGA 3ZVJD 3DXBA 3IAM2 1SYXA 5AIXA 2VL3A 3WGEA 4HU9A 1JHBA 3W8JA 1SL1B 4KE3A 4ECJA 1X9WB 2ZCTA 4MJBA 5LD0A 2RUEA 4N10A 5CO3A 2WB9A 2H1AA 3VPQA 3LFLA 5FHIA 1N8JA 1ERTA 1SK2A 5GAND 4DSSA 3PINA 2JSYA 1O8WA 1R5PA 4K0GA 1RQMA 3TUEA 4XS4B 1WPIA 2LUSA 1H75A 2OBKA 3CSIA 2F8AA 3LQ7A 2HI7A 2NTOA 5DVBA 1W89A 3RPPA 1RK4A 4BWQA 1UN2A 2E0QA 2VM2A 4G10A 1T4YA 3FZ5A 3TKSA 3MWHA 3H93A 3TDGA 1YJ6A 3ME7A 4OD7A 3EVIA 5DAKA 3LYPA 2LTKA 3WT1A 1K0BA 4WR4A 2RUFA 2LQOA 3U5RE 5KN2A 4NMUA 1QUWA 4KX4A 4WBRD 2A2RA 1V40A 2GGTA 2LEGA 1TW9A 2DJJA 1URMA 3EMXA 1GSEA 4KDUA 1R4WA 3L9VA 3EURA 4Q5NA 6GSYA 4ECCA 4ZBBA 2CAQA 2HXKA 1NHOA 1OAZA 4KCEA 1SL2B 4LMWA 3CYNA 2DJ3A 5IIZA 3TGZA 2YWIA 2VOCA 4AGSA 3C1SA 2VCXA 1YDKA 2H0GA 4KDYA 4BA7A 12GSA 4IQ1A 1N2AA 3LG6A 1XFLA 2G2QA 4CW9A 4P3YB 1NHYA 1VF4A 1TU8A 4OO4A 4PUFC 3FEUA 1XBSA 4IELA 1OC9A 2XBQA 1K3YA 4N30A 1ZCPA 4V2NA 3H79A 2FWGA 4EUYA 2V6OA 2MYGA 2VCTA 2FHEA 4ECBA 3JCML 4IP1A 3L4NA 4PQIA 3L9SA 4GTUA 5D73A 1GLQA 2K6VA 4POMA 1TRVA 1K0MA 3P8WA 2EIQA 3KH9A 4V1Ap 3A2WA 4F2IA 1EP7A 2R6KA 1GNEA 6GSSA 1XVWA 5H5QA 2L6DA 3LJRA 3NOFA 4JBBA 4WBJA 1GH2A 4XHMA 4NAXA 1GSQA 3LXTA 1Y6EA 3F4RA 3D6IA 1QGVA 4HS1A 3GIXA 3QPMA 5J4UA 2DIYA 1AQWA 1ERWA 4K7IA 5A4WA 3DWVA 1PKWA 6GSWA 3CXGA 1TKDB 4PUAA 1ERVA 4PQ1A 1X9SB 3FYGA 5FWGA 3GRXA 1TU7A 2PBJA 3FW2A 2LKUA 4MA9A 4KH7A 1MEKA 4QL9A 5G31A 4WF5A 3HYPA 3WGXA 5B7CA 3M0FA 2R37A 4KSMA 11GSA 3IDVA 3IK7A 1TRWA 1YQ1A 2WZ9A 3CRTA 2N5BA 2P31A 4PGTA 2H70A 2C4JA 1THXA 5ELAA 1EOGA 1EOHA 4FYBA 2H75A 2BMXA 5E4WA 3VWUA 4HJ2A 1GTBA 2DJKA 5LCZA 2C0FA 5D96A 1W4VA 3KTBA 1K0OA 2O89A 2DMMA 5HR1A 4AJ8A 2MBTA 5J5NA 3D22A 1Z7RA 2X8GA 3HZ4A 2QSIA 1ON4A 13GSA 2NPBA 2DSAA 3GKKA 3EE2A 3R2QA 2CX3A 1XW6A 1EV9A 2GQLA 1TRSA 1T1VA 3FR6A 3VFIA 1ZYEA 3DRNA 2X8HA 4MZWA 1NM3A 1A0FA 4YH2A 4EDZA 1YKCA 3BD2A 4D73B 3C71A 3QOUA 5J3RA 5IOXA 1J08A 4MJAA 2VCQA 4DEJA 5DCHA 4K0NA 2CVKA 2LRTA 2LNSA 1Q98A 1Q4JA 2FCHA 1X5CA 1V9WA 5L71A 2XHFA 1K3LA 2VAFA 2GSSA 4ZIJA 4ZBAA 4DSQA 2WFCA 2H8LA 4DSRA 5DQYA 2C0GA 1O6JA 3FZ9A 2HT9A 4I8BA 1KEBA 3GSTA 3HKRA 3EC3A 1OKDA 2B1LA 5D9WA 1F9MA 2YJHA 4EVMA 3F4SA 2Z9SA 3HZ8A 2FUG2 3TRXA 2ON5A 2RM5A 3GL3A 1A8LA 2PPTA 3GMFA 2HYXA 1USBA 4OFNA 5G1LA 3HJPA 4GLTA 1X5DA 3CBUA 4PNFA 2FGXA 4MF6A 2N5AA 4O32A 2VLTA 4MPFA 2C80A 1HQOA 4LMVA 4ID0A 1JZWA 2GSQA 3KH7A 5B6MA 3A5WA 2H6YA 2IMEA 1SKWB 2E2MA 2KP1A 6GSXA 2JZSA 1UVZA 1ZMAA 3S9FA 2YCDA 1V58A 4RQRA 2L4CA 3ERGA 2JL4A 2IFQA 4JRRA 4X0XA 4EE0A 4HJMA 5A4UA 2AUVA 1B4PA 4XRDA 2E7PA 4YAPA 4TRXA 4ZB8A 4MLYA 5D9VA 1XXUA 1XCCA 3ZITA 5ECMB 4TR4A 4MDCA 2CT6A 3GL5A 2RIIA 1FVKA 1HD2A 2WDUA 1YEXA 3UVTA 3LYKA 3J7Yk 3KP8A 3M8NA 5IMCA 1UC7A 3KEBA 5B8AA 3ISOA 1TI3A 3RHCA 4HUAA 2C0DA 3ZYWA 3F3RA 5G5FA 3DKSA 3G7YA 2FNOA 2IL3A 3M9KA 1BQ7A 3UAPA 3TJBA 1ILOA 1XWAA 4BPYA 2CVBA 4K7OA 4YAVA 3TJKA 4NV2A 2V6KA 5ID2B 4KUNA 4MZBA 1V98A 3KM6A 3DVWA 1I9DA 3VPTA 1PGTA 2H30A 3IE3A 5DJMA 1WRYA 1ZYQB 4KB3A 2WCIA 4LL1B 3QAGA 2GT5A 1SK0A 1XWGA 1OKTA 1DBYA 5ECRB 1XW5A 1EGOA 2X64A 2P5QA 1T3BA 2YNXA 1FB6A 2F3MA 1ML6A 2B6MA 2K18A 3FZAA 4IQAA 1HYUA 4NV5A 3BOAA 3CTFA 2PU9C 2B3SA 4I6XA 1X5EA 2YZHA 1GTUA 2CZ2A 1A2MA 4MZCA 2V1MA 3ZREA 4QQ7A 5CNWA 2P5RA 2VO4A 3UL3A 3TOUA 1WP0A 2OE0A 2OBIA 3ERWA 2VL2C 1XVQA 3IR4A 2CX4A 2RLIA 5KEJA 3HVXA 4IBPA 2QGVA 5LNKe 3BCIA 1G6YA 5HR2A 1FO5A 4ZL8A 1FAAA 3G9BA 3QD9A 3NZNA 1FB0A 1LBKA 2FWHA 4EF0A 5JWRB 4D73A 2DMLA 4FH8A 5EVOA 3N5OA 3QDNA 1OE7A 16GSA 3EWLA 2VLUA 4PX1A 3FZ4A 1A24A 3TRQA 3KMNA 4ZL7A 4Q5FA 4Z7XA 3VWXA 2PVQA 5DALA 3RAZA 5D93A 1M9AA 3D4TA 2OE3A 3L78A 5DBQA 2PWJA 2JADA 2X99A 5HFKA 2A4VA 3A3TA 5KN0A 3BCKA 2VD1A 5IO2A 2B7JA 3GA4A 1Z9HA 5G2ZA 2I81A 2BJXA 2C8UA 3C8EA 5JCWA 3Q74A 4PQHA 4GSSA 2I4AA 1EWXA 1R26A 2MMAA 5IOWA 3VK9A 2V2GA 1UA5A 3VWWA 5IPHA 1SK1A 1M9BA 1AQXA 1GUHA 5A5KA 5JCUA 1F3BA 2IWTA 2L5OA 3ZMLA 3MAKA 2L4QA 2YWOA 2VD0A 3LGCA 3IPZA 3KXOA 2HZEB 1B8XA 3LWAA 1H4OA 5CRGA 3F3QA 4V1Ag 5FT3A 5GZZB 4L8EA 2L59A 19GSA 3SBCA 4OFMA 5AN1A 9GSSA 1GTIA 1THOA 4PURA 4NXIA 4TN8A 4PNGA 1JZOA 2HLSA 1XIYA 4GXZA 4IVFA 2C0EA 3EU3A 4FYCA 4G9HA 3GUSA 1KTEA 2KLXA 4O7HA 1SD9A 5DQSA 1JLVA 2MMNA 20GSA 1GSSA 3TB2A 1HNCA 1AW9A 1JFUA 5AISA 2QKEA 4XCSA 4ML6A 3QR6A 2M80A 1TJDA 4GRFA 1CQGA 1J0FA 2PUKC 2FA4A 1Z6NA 1WWJA 3TKPA 5CREA 1IYIA 1X9MB 1YY7A 2WULA 1OYJA 4WKWA 1B9XC 1V2AA 5JWOB 1NSWA 4K1FA 2HE3A 3IXRA 1PRXA 2LJAA 3VWVA 3WYWA 4TR1B 4IW9A 2WJUA 1BX9A 1VRSD 3VLNA 3LSZA 2HSYA 1XW9A 1TXXA 1SENA 3FHKA 5CRWA 1FVJA 5C00A 1GWCA 3UOMA 3APQA 2P0GA 3VURA 2F51A 4L0WA 3O6TA 4ZXGA 2B1KA 14GSA 4XS1A 4WF4A 3FY7A 3PR8A 1XWKA 1E6BA 1U6TA 2H0HA 3GV1A 1TDIA 2QC7A 3CTGA 5J9CA 4H86A 4KSOA 3US3A 5GSSA 5CP1A 1FOVA 2JACA 2VUPA 3ZFBA 1DSBA 2ON7A 1TRUA 2OE1A 2VL9A 1M99A 4RQXA 4LL4B 3KTLA 3GN3A 3QAVA 3APOA 1NW2A 4J2FA 4KGIA 1QMVA 3UEMA 1M2BA 10GSA 2AAWA 3ZLPA 1AUCA 2R2JA 3Q19A 5IMFA 3H8QA 4YQUA 4DSSB 1G7EA 3H1NA 2MZCA 4TW5A 4XS4A 1QQ2A 4JR4A 3LEFA 2G0FA 5AIVA 1WIKA 4ZBDA 2AV4A 2YP6A 3RBTA 2YOIA 3IHQA 1J9BA 3ZRDA 4IGJA 2H74A 3IK9A 2GDRA 2H73A 1F37A 2C3QA 5HFIA 4LLRA 5ECLB 3I6AA 3QFBC 3UIWA 4MF7A 3WT2A 1TOFA 2CZ3A 4MJCA 2H1BA 3TJGA 2A2SA 5DAKB 3GX0A 2O8VB 4K9ZA 1Z3EA 4ISDA 4ZILA 2CQ9A 1EEMA 1AXDA 1SYRA 1XOAA 3HY2A 1O73A 5G30A 5B6NA 2IN3A 2GZPA 2LRNA 2HNLA 1T00A 1PL2A 4K6XA 4XS6A 5JCGA 1Z6MA 5EL8A 3PH9A 1XPVA 3IBHA 2VL2A 3GURA 1HNBA 1S3AA 2R4VA 1AQVA 1X0RA 2DBCA 5ECSA 4POKA 2C3TA 2FD3A 1F3AA 2L6CA 5ABRA 4FIWA 1YZXA 2IIYA 1I5GA 4ML1A 5A4VA 3I9V2 5HFGA 3HD5A 2NVLA 3HVSA 3GKMA 3O3TA 3ED3A 3BBYA 3CSHA 3F6FA 3IV4A 4E8HA 4DVCA 1F6MC 1GLPA 1Y25A 2JZRA 4V2LA 1MD3A 2K9FA 2GZYA 17GSA 1A8YA 4BWSA 2WGRA 3EMPA 4N0VA 4ULXA 3DVXA 2L57A 1B48A 2EIRA 1OC9B 1XWBA 3A2XA 3K8NA 4F0CA 3VI7A 1LU4A 2I1UA 5ECIB 2E2GA 4BL7A 3MDKA 4YQVA 1BJXA 1G0TA 3SWLA 4K2DA 1PX7A 6GSVA 3GH6A 2FY6A 2J23A 3FK8A 2C3NA 4ZB6A 5ECNB 2BTOT 3DMLA 1U3AA 1RW1A 2I3YA 4E8EA 1WOUA 4KAEA 4XTSA 3GKNA 2XC2A 3KMOA 2MMOA 4CDOA 3TOTA 5HQPA 4TVEA 5D9XA 4IN0A 2GTUA 5G1KA 2OKAA 4IJ3A 3VI5A 2MMZA 2M46A 3GH9A 5HR0A 4GSTA 5F05A 6GSUA 3IAS2 2VLVA 1XWCA 4HZ2A 4JEDA 1T8EB 4POBA 2YANA 3W6GA 2ZUPA 4ZB9A 1BAYA 5CRDA 2TRXA 4WEYA 5J41A 2YV7A 4RUVA 2YJ7A 3QFAC 2M72A 1QK8A 1WE0A 4G2EA 1S3DA 4F03A 4BVYA 2OADA 2K8SA 4L5LA 2DLXA 4NHZA 1XZOA 2OJLA 1HNAA 2PVOC 5CRHA 5IMDA 2F8FA 1M2AA 3MSZA 4KNDA 4OO5A 4AF2A 3M9JA 5B8BA 3KIJA 2HSHA 2R3XA 1PKZA 1EEJA 1ZL9A 3HCZA 3L0HA 1SKSB 2H01A 4WR5A 1MDJA 1A0RP 4NPBA 3DYRA 3ZZXA 2XPDA 3PGTA 3KCMA 3E0UA 5D8IA 1SU9A 2L5LA 2V41A 1KBNA 5F0GA 4GWRA 1YF1A 4OWYA 3E9JB 2FLSA 2FWFA 2H19A 5KN3A 1SJIA 4IHUA 2YPMA 4F0BA 3GTUB 1B4QA 5DDLA 3I69A 4Q5QA 5F07A 4GSNA 2PN8A 5ECKB 4PXOA 5KN1A 1SJZA 1JZRA 2IJYA 4TKYA 1ZZYA 3D5JA 2AJQB 5F06A 1K0DA 3GHAA 3NIVA 3O76A 1TK5B 4Q5RA 1EZKA 3ERFA 3GX8A 2I9HA 3HVVA 2H72A 2KUCA 2JSZA 4J57E 1DE2A 4MH2A 2LQQA 1GNWA 1MD4A 4GF0A 3DD3A 1U87A 2MBSA 2AB6A 3HXSA 3HJOA 3IA1A 1AIUA 1ZGNA 3ZTLA 3TKSE 4O92A 2OA7A 1ABAA 3F63A 1F2EA 5G5EA 3HA9A 2VM1A 2VCZA 2JZTA 3ZIVA 3TRPA 5IMZA 4MABA 3FKFA 2GQMA 4GQCA 1TK0B 1T4ZA 3ZL5A 5ECHB 4ACSA 4HQSA 2ALBA 2NDOA 4KA0A 1MTCA 4HDEA 2OACA 2PERA 2FWEA 4F82A 2B5YA 2PGTA 2K8VA 5ECQB 1OC3A 2YZUA 1TP9A 2H76A 1M0UA 3AY8A 4ILFA 3UMAA 4LA1A 1GULA 4HOJA 2KHPA 3D0ZA 5H5SA 3HDCA 3UBKA 3CMIA 1BEDA 4MPGA 5ENUA 1K0NA 1FG4A 2XPEA 3D21A 3HHVA 1SL0B 1OE8A 2GSRA 3QCPA 3WGDA 2IFQB 3QMXA 3W8SA 2DJ0A 1M2DA 2DJ2A 2GQKA 2O87A 3G7JA 3F0IA 3TJJA 1TK8B 1O7UA 1PSQA 3FRCA 1E2YA 4OMVA 2PMTA 3KZQA 3TKRA 3C1RA 4MK3A 5C04A 2YWNA 4XRAA 1O8XA 4HEA2 3Q6OA 2GVPA 3Q18A 5F8BA 3ZMKA 3D4MA 3UVHA 2GT6A 3KP9A 4KDXA 5EY6A 3WD6A 4HI7A 3N9JA 4WETA 4L0UA 2ES7A 2VCVA 3F4TA 2NBSA 4XIHA 4TXOB 4I5QA 1MDKA 3M3MA 4L5OA 4JU5A 4MJEA 4K7NA 2N5FA 2H0IA 2H1GA 4FO5A 3P2AA 3ZIJA 3UJ1A 1FHEA 2IMKA 4POLA 4TR3A 2VIMA 1PN9A 8GSSA 5ID2A 4X43A 4GCIA 2JU5A 1SD8A 5ECPB 3EINA 3L9UA 3G7IA 2C1YA 1SKRB 2VCWA 1GP1A 3GYKA 1GRXA 3GSSA 2H6XA 4N11A 1VF1A 3TKQA 3TKSC 2AHEA 1VF3A 1OVNA 3ZFLA 3RDWA 3LXZA 2H6ZA 3H4KA 1G6WA 1O85A 4MCUA 3DEXA 4WXTA 5DCGA 1TTZA 4OCEA 2B5EA 1M7TA 3I43A 1QFNA 3P90A 2LS5A 3C73A 2FA8A 2GS3A 3KD0A 1U88A 1CQHA 4IP6A 3KJYA 2D2ZA 1WJKA 3BJ5A 2AYTA 2LJRA 1MDIA 4J56E 2IPAA
chains in the Genus database with same CATH superfamily
4EL1A 2XBIA 5INYA 2GZZA 3DIEA 1PA3A 3DGQA 4ECIA 1A2LA 4HU7A 4MNNA 3V1WA 1T7PB 3GTUA 5J9BA 2EC4A 4MMMA 2IMFA 3F8UA 4HQZA 3J7Yb 1BG5A 1K3OA 2LJKA 3A2VA 3RPNA 4NHWA 1VGLA 1EV4A 5IO0A 5H5RA 1R7HA 1A23A 7GSSA 1ST9A 5IM9A 4NWYA 1QXHA 1VF2A 2J9HA 2LV3A 2V32A 3EYTA 5GAPD 4X1UA 4JR6A 5JWQB 4BVXA 1M3IA 1GSUA 5IPGA 4RI6A 1ACVA 4IKHA 5DALB 1JZDA 1LJRA 4IJIA 3APSA 5ECOB 3RHBA 2YV9A 2LSTA 2O85A 1IYHA 3EU4A 1ERUA 3FR9A 1K0AA 1WMJA 1KNGA 1PMTA 2TRCP 4KW6A 1GTAA 4G19A 2EIOA 2IMIA 4TR0A 2HRNA 4EC0A 2YN1A 2B7KA 4O5RA 5IMAA 2O7KA 3F6DA 1ZOFA 2REMA 1GSDA 4EXJA 4I2TA 2KP2A 1TI1A 3F9UA 18GSA 4EKZA 2WRTA 2HRFA 2HZEA 1GUMA 1XOBA 2F9SA 1GSFA 4ZL9A 4K8MA 5COHA 2B5XA 4JE1A 3TCOA 4MH3A 3IRAA 2R5GA 2HFDA 1GUKA 1YEPA 2RM6A 2CVDA 5IQYA 3UBLA 2LNTA 5EPFA 1O81A 2DC5A 5CAXA 1AAZA 1EGRA 3GFKA 3CSJA 1A2JA 1PD21 1YF0A 1BYEA 3FR3A 4JZQA 3C7MA 3GNJA 4OFTA 5GSTA 2IMDA 1B9YC 4I97A 2GLRA 4RI7A 5E59A 2CAIA 1Z7PA 2GSTA 4TOPA 1JLWA 5ELGA 2ZNMA 4EDYA 2TIRA 4AJ7A 4I2UA 3P7XA 4V2MA 3LORA 2LRCA 1DE1A 1PL1A 2H71A 4TXVA 6GSTA 1C72A 1AC1A 2CA8A 1U3IA 4N0ZA 1PFOA 4AJ6A 2CV4A 2DJ1A 3OR5A 3LW9A 4TR1A 3M1GA 3UARA 4QL7A 3ZVJA 2HZFA 4IS0A 4TXOA 3KGKA 5HR3A 5CYYA 1GL8A 3IC4A 4HZ4A 1K0CA 1EP8A 3GKXA 3HJMA 3IOSA 22GSA 1Z5YE 1OC8A 2DIZA 5AGYA 4MF5A 1PQNA 2KOKA 1GSYA 3ME8A 1PX6A 4OCFA 1R5AA 4GQFA 4KCAA 3U6VA 2WS2A 5IMVA 1DUGA 3E3EA 4EO3A 5DJLA 2H66A 4YKFA 1YKAA 2X8CA 4FYUA 2H1DA 4MP4A 5D9TA 3CRUA 1V57A 4CHSA 1ZYPA 2YWMA 1S3CA 1SJ6A 3QAWA 1FW1A 4YQMA 3TJFA 4F9ZA 1G7OA 3MNGA 3ZVJD 3DXBA 3IAM2 1SYXA 5AIXA 2VL3A 3WGEA 4HU9A 1JHBA 4USSA 3W8JA 1SL1B 4KE3A 4ECJA 1X9WB 2ZCTA 4MJBA 5LD0A 2RUEA 4N10A 5CO3A 2WB9A 2H1AA 3VPQA 3LFLA 5FHIA 1N8JA 1ERTA 1SK2A 5GAND 4DSSA 3PINA 2JSYA 1O8WA 1R5PA 4K0GA 1RQMA 3TUEA 4XS4B 1WPIA 2LUSA 1H75A 2OBKA 3CSIA 2F8AA 3LQ7A 3IHGA 2HI7A 2NTOA 5DVBA 1W89A 3RPPA 1RK4A 4BWQA 1UN2A 2E0QA 2VM2A 4G10A 1T4YA 3FZ5A 3TKSA 3MWHA 1XG8A 3H93A 3TDGA 1YJ6A 3ME7A 4OD7A 3EVIA 5DAKA 3LYPA 2LTKA 3WT1A 1K0BA 4WR4A 2RUFA 2LQOA 3U5RE 5KN2A 4NMUA 3IC8A 1QUWA 4KX4A 2R0GA 4WBRD 2A2RA 1V40A 2GGTA 2LEGA 1TW9A 2DJJA 1URMA 3EMXA 1GSEA 4KDUA 1R4WA 3L9VA 3EURA 4Q5NA 6GSYA 2DKHA 4ZBBA 4ECCA 2CAQA 2HXKA 1NHOA 1OAZA 4KCEA 1SL2B 4LMWA 3CYNA 2DJ3A 5IIZA 3TGZA 2YWIA 2VOCA 4AGSA 3C1SA 2VCXA 1YDKA 2H0GA 4KDYA 4BA7A 12GSA 4IQ1A 1N2AA 3LG6A 1XFLA 2G2QA 4CW9A 4P3YB 1NHYA 1VF4A 1TU8A 4OO4A 4PUFC 3FEUA 1XBSA 4IELA 1OC9A 2XBQA 1K3YA 4N30A 1ZCPA 4V2NA 3H79A 2FWGA 4EUYA 4K2XA 2V6OA 2MYGA 2VCTA 2FHEA 4ECBA 3JCML 4IP1A 3L4NA 4PQIA 3L9SA 4GTUA 5D73A 1GLQA 2K6VA 4POMA 1TRVA 1K0MA 3P8WA 2EIQA 3KH9A 4V1Ap 3A2WA 4F2IA 1EP7A 2R6KA 4EIPA 1GNEA 6GSSA 1XVWA 5H5QA 2L6DA 3LJRA 3NOFA 4Z2UA 4JBBA 4WBJA 1GH2A 4XHMA 4NAXA 1GSQA 3LXTA 1Y6EA 3F4RA 3D6IA 1QGVA 4HS1A 3GIXA 3QPMA 5J4UA 2DIYA 1AQWA 1ERWA 4K7IA 5A4WA 3DWVA 1PKWA 6GSWA 3CXGA 1TKDB 4PUAA 1ERVA 4PQ1A 1X9SB 3FYGA 5FWGA 3GRXA 1TU7A 2PBJA 3FW2A 2LKUA 4MA9A 4KH7A 1MEKA 4QL9A 5G31A 4WF5A 4BVYB 3HYPA 3WGXA 5B7CA 3M0FA 2R37A 4KSMA 11GSA 3IDVA 3IK7A 1TRWA 1YQ1A 2WZ9A 3CRTA 2N5BA 2P31A 4PGTA 2H70A 2C4JA 1THXA 5ELAA 1EOGA 1EOHA 4FYBA 2H75A 2BMXA 5E4WA 3VWUA 4HJ2A 1GTBA 2DJKA 5LCZA 2C0FA 5D96A 1W4VA 3KTBA 1K0OA 2O89A 2DMMA 5HR1A 4AJ8A 2MBTA 5J5NA 3D22A 1Z7RA 2X8GA 3HZ4A 2QSIA 1ON4A 13GSA 2NPBA 2DSAA 3GKKA 3EE2A 3R2QA 2CX3A 1XW6A 1EV9A 2GQLA 1TRSA 1T1VA 2DKIA 3FR6A 4K5SA 3VFIA 1ZYEA 3DRNA 2X8HA 4G0KA 1NM3A 4MZWA 1A0FA 4YH2A 4G0IA 4EDZA 1YKCA 3BD2A 4D73B 3C71A 3QOUA 5J3RA 5IOXA 1J08A 4MJAA 2VCQA 2A2PA 4DEJA 5DCHA 4K0NA 2CVKA 2LRTA 2LNSA 1Q98A 1Q4JA 2FCHA 1X5CA 1V9WA 5L71A 2XHFA 1K3LA 2VAFA 2GSSA 4ZIJA 2A4HA 4ZBAA 4DSQA 2WFCA 2H8LA 4DSRA 4Z2TA 5DQYA 2C0GA 1O6JA 3FZ9A 2HT9A 4I8BA 1KEBA 3GSTA 3HKRA 3EC3A 1OKDA 2B1LA 5D9WA 1F9MA 2YJHA 4EVMA 3F4SA 2Z9SA 3HZ8A 2FUG2 3TRXA 2ON5A 2RM5A 3GL3A 1A8LA 2PPTA 3GMFA 2HYXA 1USBA 3EPTA 4OFNA 5G1LA 3HJPA 4GLTA 1X5DA 3CBUA 4PNFA 2FGXA 4MF6A 2N5AA 4O32A 2VLTA 4MPFA 2C80A 1HQOA 4LMVA 4ID0A 1JZWA 2GSQA 3KH7A 5B6MA 3A5WA 2H6YA 2IMEA 1SKWB 2E2MA 2KP1A 6GSXA 2JZSA 1UVZA 1ZMAA 5BRTA 3S9FA 2YCDA 1V58A 4RQRA 2L4CA 3ERGA 2JL4A 2IFQA 4JRRA 4X0XA 4EE0A 4HJMA 5A4UA 2AUVA 1B4PA 4XRDA 2E7PA 4YAPA 4TRXA 4ZB8A 4MLYA 5D9VA 1XXUA 1XCCA 3ZITA 5ECMB 4TR4A 4MDCA 2CT6A 3GL5A 2RIIA 1FVKA 1HD2A 2WDUA 1YEXA 3UVTA 3LYKA 3J7Yk 3KP8A 3M8NA 5IMCA 1UC7A 3KEBA 5B8AA 3ISOA 1TI3A 3RHCA 4HUAA 2C0DA 3ZYWA 3F3RA 5G5FA 3DKSA 3G7YA 2FNOA 2IL3A 3M9KA 1BQ7A 3UAPA 3TJBA 1ILOA 1XWAA 4BPYA 2CVBA 4K7OA 4ICYA 4YAVA 4O5QA 3TJKA 4NV2A 2V6KA 5ID2B 4KUNA 3A5IA 4MZBA 1V98A 3KM6A 3DVWA 1I9DA 3VPTA 1PGTA 2H30A 3IE3A 5DJMA 1WRYA 1ZYQB 4KB3A 2WCIA 4LL1B 3QAGA 2GT5A 1SK0A 1XWGA 1OKTA 1DBYA 5ECRB 1XW5A 1EGOA 2X64A 2P5QA 1T3BA 2YNXA 1FB6A 2F3MA 1ML6A 2B6MA 2K18A 3FZAA 4IQAA 1HYUA 4NV5A 3BOAA 3CTFA 2PU9C 2B3SA 4I6XA 1X5EA 2YZHA 1GTUA 2CZ2A 1A2MA 4MZCA 2V1MA 3ZREA 4QQ7A 4KF9A 5CNWA 2P5RA 2VO4A 3UL3A 3TOUA 1WP0A 2OE0A 2OBIA 3ERWA 2VL2C 1XVQA 3IR4A 2CX4A 2RLIA 5KEJA 3HVXA 4IBPA 2QGVA 5LNKe 3BCIA 1G6YA 5HR2A 1FO5A 4ZL8A 4Z2RA 1FAAA 3G9BA 3QD9A 3NZNA 1FB0A 1LBKA 2FWHA 4EF0A 5JWRB 4D73A 2DMLA 4FH8A 5EVOA 3N5OA 3QDNA 1OE7A 16GSA 3EWLA 2VLUA 4PX1A 3FZ4A 1A24A 3TRQA 3KMNA 4ZL7A 4Q5FA 4YKGA 2HRKA 4Z7XA 3VWXA 2PVQA 5DALA 3RAZA 5D93A 1M9AA 3D4TA 2OE3A 3L78A 5DBQA 2PWJA 2JADA 2X99A 5HFKA 2A4VA 3A3TA 5KN0A 3BCKA 2VD1A 5IO2A 2B7JA 3GA4A 1Z9HA 5G2ZA 2I81A 2BJXA 2C8UA 3C8EA 5JCWA 3Q74A 4PQHA 4GSSA 4PTSA 2I4AA 1EWXA 1R26A 2MMAA 5IOWA 3VK9A 2V2GA 1UA5A 3VWWA 5IPHA 1SK1A 1M9BA 1AQXA 1GUHA 5A5KA 5JCUA 1F3BA 2IWTA 2L5OA 3ZMLA 2R0PA 3MAKA 2L4QA 2YWOA 2VD0A 2R0CA 3LGCA 3IPZA 3KXOA 2HZEB 1B8XA 3LWAA 1H4OA 5CRGA 3F3QA 4V1Ag 5FT3A 5GZZB 4L8EA 2L59A 19GSA 1S3RA 3SBCA 4OFMA 5AN1A 9GSSA 1GTIA 1THOA 4PURA 4NXIA 4TN8A 4PNGA 1JZOA 2HLSA 4BL7B 1XIYA 4GXZA 4IVFA 2C0EA 3EU3A 4FYCA 4G9HA 3GUSA 1KTEA 2KLXA 4O7HA 1SD9A 5DQSA 2QA1A 1JLVA 2MMNA 20GSA 1GSSA 3TB2A 1HNCA 1AW9A 3CQFA 1JFUA 5AISA 2QKEA 4XCSA 4ML6A 3QR6A 2M80A 1TJDA 4K5RA 5BMUA 4GRFA 1CQGA 1J0FA 2PUKC 2FA4A 1Z6NA 1WWJA 3TKPA 5CREA 1IYIA 1X9MB 1YY7A 4HSCX 2WULA 1OYJA 4WKWA 1B9XC 1V2AA 5JWOB 2HRAA 1NSWA 4K1FA 2HE3A 3IXRA 1PRXA 2LJAA 3VWVA 3WYWA 4TR1B 4IW9A 2WJUA 1BX9A 1VRSD 3VLNA 3LSZA 2HSYA 1XW9A 1TXXA 1SENA 3FHKA 5CRWA 1FVJA 5C00A 1GWCA 3UOMA 3APQA 2P0GA 3VURA 2F51A 4L0WA 3O6TA 4ZXGA 2B1KA 14GSA 4XS1A 4WF4A 3FY7A 3PR8A 1XWKA 1E6BA 1U6TA 2H0HA 2QA2A 3GV1A 1TDIA 2QC7A 3CTGA 5J9CA 4H86A 4A5PA 4KSOA 3US3A 5GSSA 5CP1A 1FOVA 2JACA 2VUPA 3ZFBA 1DSBA 2ON7A 1TRUA 2OE1A 2VL9A 1M99A 4RQXA 4LL4B 3KTLA 3GN3A 3QAVA 3APOA 1NW2A 4J2FA 4KGIA 1QMVA 3UEMA 1M2BA 10GSA 2AAWA 3ZLPA 1AUCA 2R2JA 3Q19A 5IMFA 3H8QA 4YQUA 4DSSB 1G7EA 3H1NA 2MZCA 4TW5A 4XS4A 1QQ2A 4JR4A 3LEFA 2G0FA 5KOXA 5AIVA 1WIKA 4ZBDA 2AV4A 2YP6A 3RBTA 2YOIA 3IHQA 1J9BA 3ZRDA 4IGJA 2H74A 3IK9A 2GDRA 2H73A 1F37A 2C3QA 4X4JA 5HFIA 4LLRA 5ECLB 3I6AA 3QFBC 3UIWA 4MF7A 3WT2A 1TOFA 2CZ3A 4MJCA 2H1BA 3TJGA 2A2SA 5DAKB 3GX0A 2O8VB 4K9ZA 1Z3EA 4ISDA 4ZILA 2CQ9A 1FOHA 1EEMA 1AXDA 1SYRA 1XOAA 3HY2A 1O73A 5G30A 5B6NA 2IN3A 2GZPA 2LRNA 2HNLA 1T00A 1PL2A 4K6XA 4XS6A 5JCGA 1Z6MA 5EL8A 3PH9A 1XPVA 3IBHA 2VL2A 3GURA 1HNBA 1S3AA 2R4VA 3PPUA 1AQVA 1X0RA 2DBCA 5ECSA 4POKA 2C3TA 2FD3A 1F3AA 2L6CA 5ABRA 4FIWA 1YZXA 3FMWA 2IIYA 1I5GA 4ML1A 5A4VA 3I9V2 5HFGA 3HD5A 2NVLA 3HVSA 3GKMA 3O3TA 3ED3A 5KOWA 3BBYA 3CSHA 3F6FA 3IV4A 4E8HA 4DVCA 1F6MC 1GLPA 1Y25A 2JZRA 4V2LA 1MD3A 2K9FA 2GZYA 17GSA 1A8YA 4BWSA 2WGRA 3EMPA 4N0VA 4ULXA 3DVXA 2L57A 1B48A 2EIRA 1OC9B 1XWBA 3A2XA 3K8NA 4F0CA 3VI7A 1LU4A 2I1UA 5ECIB 2E2GA 4BL7A 3MDKA 4YQVA 1BJXA 1G0TA 3SWLA 4K2DA 1PX7A 6GSVA 3GH6A 2FY6A 2J23A 3FK8A 2C3NA 4ZB6A 5ECNB 2BTOT 3DMLA 1U3AA 1RW1A 2I3YA 4E8EA 1WOUA 4KAEA 4CY6A 4XTSA 3GKNA 2XC2A 3KMOA 2MMOA 4CDOA 3TOTA 5HQPA 4TVEA 5D9XA 4IN0A 2GTUA 5G1KA 2OKAA 4IJ3A 3VI5A 2MMZA 2M46A 3GH9A 5HR0A 4GSTA 5F05A 6GSUA 3IAS2 2VLVA 1XWCA 4HZ2A 4JEDA 1T8EB 4POBA 4O5UA 2YANA 3W6GA 2ZUPA 4ZB9A 1BAYA 5CRDA 2TRXA 4WEYA 5J41A 2YV7A 4RUVA 2YJ7A 3QFAC 2M72A 1QK8A 1WE0A 4G2EA 1S3DA 4F03A 4BVYA 2OADA 2K8SA 4L5LA 2DLXA 2UZ8A 4NHZA 1XZOA 2OJLA 1HNAA 2PVOC 5CRHA 5IMDA 2F8FA 1M2AA 3MSZA 4KNDA 4OO5A 4AF2A 3M9JA 5B8BA 4CY8A 3KIJA 2HSHA 2R3XA 1PKZA 1EEJA 1ZL9A 3HCZA 3L0HA 1SKSB 2H01A 4WR5A 1MDJA 1A0RP 4NPBA 3DYRA 3ZZXA 2XPDA 3PGTA 3KCMA 3E0UA 5D8IA 1SU9A 2L5LA 2V41A 1KBNA 5F0GA 4GWRA 1YF1A 4OWYA 3E9JB 2FLSA 2FWFA 2H19A 5KN3A 1SJIA 4IHUA 2YPMA 4F0BA 3GTUB 1B4QA 5DDLA 3I69A 4Q5QA 4GSNA 5ECKB 2PN8A 5F07A 4PXOA 5KN1A 1SJZA 1JZRA 1PN0A 2IJYA 3MYDA 4TKYA 1ZZYA 3D5JA 2AJQB 4FQUA 5F06A 1K0DA 3GHAA 3NIVA 3O76A 1TK5B 4Q5RA 1EZKA 3ERFA 3GX8A 2I9HA 3HVVA 2H72A 2KUCA 2JSZA 4EIQA 4J57E 1DE2A 4MH2A 2LQQA 1GNWA 1MD4A 4GF0A 4BVXB 3DD3A 1U87A 2MBSA 2AB6A 3HXSA 3HJOA 3IA1A 1AIUA 1ZGNA 3ZTLA 3TKSE 4O92A 2OA7A 1ABAA 3F63A 1F2EA 5G5EA 3HA9A 2VM1A 2VCZA 2JZTA 3ZIVA 3TRPA 5IMZA 4MABA 3FKFA 2GQMA 4GQCA 1TK0B 1T4ZA 3ZL5A 5ECHB 4ACSA 4HQSA 2ALBA 2NDOA 4KA0A 1MTCA 4HDEA 2OACA 2PERA 2FWEA 3HVNA 4F82A 2B5YA 2PGTA 2K8VA 5ECQB 1OC3A 2YZUA 1TP9A 2H76A 1M0UA 1ZYNA 3AY8A 2HSMA 4BIKA 4ILFA 3UMAA 4LA1A 1GULA 4HOJA 2KHPA 3D0ZA 5H5SA 3HDCA 3UBKA 3CMIA 1BEDA 4MPGA 5ENUA 1K0NA 1FG4A 2XPEA 3D21A 3HHVA 1SL0B 1OE8A 2GSRA 3QCPA 3WGDA 2X4AA 2IFQB 3QMXA 3W8SA 2DJ0A 2X49A 1M2DA 2DJ2A 2GQKA 2O87A 3G7JA 3F0IA 3TJJA 1TK8B 1O7UA 1PSQA 3FRCA 1E2YA 4OMVA 2PMTA 3KZQA 3TKRA 3C1RA 4MK3A 5C04A 2YWNA 4XRAA 1O8XA 4HEA2 3Q6OA 2GVPA 3Q18A 5F8BA 3ZMKA 3D4MA 3UVHA 1M3JA 2GT6A 3KP9A 4KDXA 5EY6A 3WD6A 4HI7A 3N9JA 4WETA 4L0UA 2ES7A 2VCVA 3F4TA 2NBSA 4XIHA 4TXOB 4I5QA 1MDKA 3M3MA 4L5OA 3R3EA 4JU5A 4MJEA 4K7NA 2N5FA 2H0IA 2H1GA 4FO5A 3P2AA 3ZIJA 3UJ1A 1FHEA 2IMKA 4POLA 4TR3A 2VIMA 1PN9A 8GSSA 4G0LA 5ID2A 4X43A 4GCIA 2JU5A 1SD8A 5ECPB 3EINA 3L9UA 3G7IA 2C1YA 1SKRB 2VCWA 1GP1A 3GYKA 1GRXA 3GSSA 2H6XA 4N11A 1VF1A 3TKQA 3MIXA 3TKSC 2AHEA 1VF3A 1OVNA 3ZFLA 3RDWA 3LXZA 2H6ZA 3H4KA 1G6WA 1O85A 4MCUA 3DEXA 4WXTA 5DCGA 1TTZA 4OCEA 2B5EA 1M7TA 3I43A 1QFNA 3P90A 2LS5A 3C73A 2FA8A 2GS3A 3KD0A 1U88A 1CQHA 4IP6A 3KJYA 2D2ZA 1WJKA 3BJ5A 2AYTA 2LJRA 1MDIA 4J56E 2IPAA
chains in the Genus database with same CATH topology
4EL1A 2XBIA 5INYA 2GZZA 3DIEA 1PA3A 3DGQA 4ECIA 1A2LA 4HU7A 4MNNA 3V1WA 1T7PB 3GTUA 5J9BA 2EC4A 4MMMA 2IMFA 3F8UA 4HQZA 3J7Yb 1BG5A 1K3OA 2LJKA 3A2VA 3RPNA 4NHWA 1VGLA 1EV4A 5IO0A 5H5RA 1R7HA 1A23A 7GSSA 1ST9A 5IM9A 4NWYA 1QXHA 1VF2A 2J9HA 2LV3A 2V32A 3EYTA 5GAPD 4X1UA 4JR6A 5JWQB 4BVXA 1GSUA 5IPGA 4RI6A 1ACVA 4IKHA 5DALB 1JZDA 1LJRA 4IJIA 3APSA 5ECOB 3RHBA 2YV9A 2LSTA 2O85A 1IYHA 3EU4A 1ERUA 3FR9A 1K0AA 1WMJA 1KNGA 1PMTA 2TRCP 4KW6A 1GTAA 4G19A 2EIOA 2IMIA 4TR0A 2HRNA 4EC0A 2YN1A 2B7KA 4O5RA 5IMAA 2O7KA 3F6DA 1ZOFA 2REMA 1GSDA 4EXJA 4I2TA 2KP2A 1TI1A 3F9UA 18GSA 4EKZA 2WRTA 2HRFA 2HZEA 1GUMA 1XOBA 2F9SA 1GSFA 4ZL9A 4K8MA 5COHA 2B5XA 4JE1A 3TCOA 4MH3A 3IRAA 2R5GA 2HFDA 1GUKA 1YEPA 2RM6A 2CVDA 5IQYA 3UBLA 2LNTA 5EPFA 1O81A 2DC5A 5CAXA 1AAZA 1EGRA 3GFKA 3CSJA 1A2JA 1PD21 1YF0A 1BYEA 3FR3A 4JZQA 3C7MA 3GNJA 4OFTA 5GSTA 2IMDA 1B9YC 4I97A 2GLRA 4RI7A 5E59A 2CAIA 1Z7PA 2GSTA 4TOPA 1JLWA 5ELGA 2ZNMA 4EDYA 2TIRA 4AJ7A 4I2UA 3P7XA 4V2MA 3LORA 2LRCA 1DE1A 1PL1A 2H71A 4TXVA 6GSTA 1C72A 1AC1A 2CA8A 1U3IA 4N0ZA 4AJ6A 2CV4A 2DJ1A 3OR5A 3LW9A 4TR1A 3M1GA 3UARA 4QL7A 3ZVJA 2HZFA 4IS0A 4TXOA 3KGKA 5HR3A 5CYYA 1GL8A 3IC4A 4HZ4A 1K0CA 1EP8A 3GKXA 3HJMA 3IOSA 22GSA 1Z5YE 1OC8A 2DIZA 5AGYA 4MF5A 1PQNA 2KOKA 1GSYA 3ME8A 1PX6A 4OCFA 1R5AA 4GQFA 4KCAA 3U6VA 2WS2A 5IMVA 1DUGA 3E3EA 4EO3A 5DJLA 2H66A 4YKFA 1YKAA 2X8CA 4FYUA 2H1DA 4MP4A 5D9TA 3CRUA 1V57A 4CHSA 1ZYPA 2YWMA 1S3CA 1SJ6A 3QAWA 1FW1A 4YQMA 3TJFA 4F9ZA 1G7OA 3MNGA 3ZVJD 3DXBA 3IAM2 1SYXA 5AIXA 2VL3A 3WGEA 4HU9A 1JHBA 4USSA 3W8JA 1SL1B 4KE3A 4ECJA 1X9WB 2ZCTA 4MJBA 5LD0A 2RUEA 4N10A 5CO3A 2WB9A 2H1AA 3VPQA 3LFLA 5FHIA 1N8JA 1ERTA 1SK2A 5GAND 4DSSA 3PINA 2JSYA 1O8WA 1R5PA 4K0GA 1RQMA 3TUEA 4XS4B 1WPIA 2LUSA 1H75A 2OBKA 3CSIA 2F8AA 3LQ7A 3IHGA 2HI7A 2NTOA 5DVBA 1W89A 3RPPA 1RK4A 4BWQA 1UN2A 2E0QA 2VM2A 4G10A 1T4YA 3FZ5A 3TKSA 3MWHA 3H93A 3TDGA 1YJ6A 3ME7A 4OD7A 3EVIA 5DAKA 3LYPA 2LTKA 3WT1A 1K0BA 4WR4A 2RUFA 2LQOA 3U5RE 5KN2A 4NMUA 3IC8A 1QUWA 4KX4A 2R0GA 4WBRD 2A2RA 1V40A 2GGTA 2LEGA 1TW9A 2DJJA 1URMA 3EMXA 1GSEA 4KDUA 1R4WA 3L9VA 3EURA 4Q5NA 6GSYA 2DKHA 4ZBBA 4ECCA 2CAQA 2HXKA 1NHOA 1OAZA 4KCEA 1SL2B 4LMWA 3CYNA 2DJ3A 5IIZA 3TGZA 2YWIA 2VOCA 4AGSA 3C1SA 2VCXA 1YDKA 2H0GA 4KDYA 4BA7A 12GSA 4IQ1A 1N2AA 3LG6A 1XFLA 2G2QA 4CW9A 4P3YB 1NHYA 1VF4A 1TU8A 4OO4A 4PUFC 3FEUA 1XBSA 4IELA 1OC9A 2XBQA 1K3YA 4N30A 1ZCPA 4V2NA 3H79A 2FWGA 4EUYA 4K2XA 2V6OA 2MYGA 2VCTA 2FHEA 4ECBA 3JCML 4IP1A 3L4NA 4PQIA 3L9SA 4GTUA 5D73A 1GLQA 2K6VA 4POMA 1TRVA 1K0MA 3P8WA 2EIQA 3KH9A 4V1Ap 3A2WA 4F2IA 1EP7A 2R6KA 4EIPA 1GNEA 6GSSA 1XVWA 5H5QA 2L6DA 3LJRA 3NOFA 4Z2UA 4JBBA 4WBJA 1GH2A 4XHMA 4NAXA 1GSQA 3LXTA 1Y6EA 3F4RA 3D6IA 1QGVA 4HS1A 3GIXA 3QPMA 5J4UA 2DIYA 1AQWA 1ERWA 4K7IA 5A4WA 3DWVA 1PKWA 6GSWA 3CXGA 1TKDB 4PUAA 1ERVA 4PQ1A 1X9SB 3FYGA 5FWGA 3GRXA 1TU7A 2PBJA 3FW2A 2LKUA 4MA9A 4KH7A 1MEKA 4QL9A 5G31A 4WF5A 4BVYB 3HYPA 3WGXA 5B7CA 3M0FA 2R37A 4KSMA 11GSA 3IDVA 3IK7A 1TRWA 1YQ1A 2WZ9A 3CRTA 2N5BA 2P31A 4PGTA 2H70A 2C4JA 1THXA 5ELAA 1EOGA 1EOHA 4FYBA 2H75A 2BMXA 5E4WA 3VWUA 4HJ2A 1GTBA 2DJKA 5LCZA 2C0FA 5D96A 1W4VA 3KTBA 1K0OA 2O89A 2DMMA 5HR1A 4AJ8A 2MBTA 5J5NA 3D22A 1Z7RA 2X8GA 3HZ4A 2QSIA 1ON4A 13GSA 2NPBA 2DSAA 3GKKA 3EE2A 3R2QA 2CX3A 1XW6A 1EV9A 2GQLA 1TRSA 1T1VA 2DKIA 3FR6A 4K5SA 3VFIA 1ZYEA 3DRNA 2X8HA 4G0KA 1NM3A 4MZWA 1A0FA 4YH2A 4G0IA 4EDZA 1YKCA 3BD2A 4D73B 3C71A 3QOUA 5J3RA 5IOXA 1J08A 4MJAA 2VCQA 2A2PA 4DEJA 5DCHA 4K0NA 2CVKA 2LRTA 2LNSA 1Q98A 1Q4JA 2FCHA 1X5CA 1V9WA 5L71A 2XHFA 1K3LA 2VAFA 2GSSA 4ZIJA 2A4HA 4ZBAA 4DSQA 2WFCA 2H8LA 4DSRA 4Z2TA 5DQYA 2C0GA 1O6JA 3FZ9A 2HT9A 4I8BA 1KEBA 3GSTA 3HKRA 3EC3A 1OKDA 2B1LA 5D9WA 1F9MA 2YJHA 4EVMA 3F4SA 2Z9SA 3HZ8A 2FUG2 3TRXA 2ON5A 2RM5A 3GL3A 1A8LA 2PPTA 3GMFA 2HYXA 1USBA 3EPTA 4OFNA 5G1LA 3HJPA 4GLTA 1X5DA 3CBUA 4PNFA 2FGXA 4MF6A 2N5AA 4O32A 2VLTA 4MPFA 2C80A 1HQOA 4LMVA 4ID0A 1JZWA 2GSQA 3KH7A 5B6MA 3A5WA 2H6YA 2IMEA 1SKWB 2E2MA 2KP1A 6GSXA 2JZSA 1UVZA 1ZMAA 5BRTA 3S9FA 2YCDA 1V58A 4RQRA 2L4CA 3ERGA 2JL4A 2IFQA 4JRRA 4X0XA 4EE0A 4HJMA 5A4UA 2AUVA 1B4PA 4XRDA 2E7PA 4YAPA 4TRXA 4ZB8A 4MLYA 5D9VA 1XXUA 1XCCA 3ZITA 5ECMB 4TR4A 4MDCA 2CT6A 3GL5A 2RIIA 1FVKA 1HD2A 2WDUA 1YEXA 3UVTA 3LYKA 3J7Yk 3KP8A 3M8NA 5IMCA 1UC7A 3KEBA 5B8AA 3ISOA 1TI3A 3RHCA 4HUAA 2C0DA 3ZYWA 3F3RA 5G5FA 3DKSA 3G7YA 2FNOA 2IL3A 3M9KA 1BQ7A 3UAPA 3TJBA 1ILOA 1XWAA 4BPYA 2CVBA 4K7OA 4ICYA 4YAVA 4O5QA 3TJKA 4NV2A 2V6KA 5ID2B 4KUNA 3A5IA 4MZBA 1V98A 3KM6A 3DVWA 1I9DA 3VPTA 1PGTA 2H30A 3IE3A 5DJMA 1WRYA 1ZYQB 4KB3A 2WCIA 4LL1B 3QAGA 2GT5A 1SK0A 1XWGA 1OKTA 1DBYA 5ECRB 1XW5A 1EGOA 2X64A 2P5QA 1T3BA 2YNXA 1FB6A 2F3MA 1ML6A 2B6MA 2K18A 3FZAA 4IQAA 1HYUA 4NV5A 3BOAA 3CTFA 2PU9C 2B3SA 4I6XA 1X5EA 2YZHA 1GTUA 2CZ2A 1A2MA 4MZCA 2V1MA 3ZREA 4QQ7A 4KF9A 5CNWA 2P5RA 2VO4A 3UL3A 3TOUA 1WP0A 2OE0A 2OBIA 3ERWA 2VL2C 1XVQA 3IR4A 2CX4A 2RLIA 5KEJA 3HVXA 4IBPA 2QGVA 5LNKe 3BCIA 1G6YA 5HR2A 1FO5A 4ZL8A 4Z2RA 1FAAA 3G9BA 3QD9A 3NZNA 1FB0A 1LBKA 2FWHA 4EF0A 5JWRB 4D73A 2DMLA 4FH8A 5EVOA 3N5OA 3QDNA 1OE7A 16GSA 3EWLA 2VLUA 4PX1A 3FZ4A 1A24A 3TRQA 3KMNA 4ZL7A 4Q5FA 4YKGA 2HRKA 4Z7XA 3VWXA 2PVQA 5DALA 3RAZA 5D93A 1M9AA 3D4TA 2OE3A 3L78A 5DBQA 2PWJA 2JADA 2X99A 5HFKA 2A4VA 3A3TA 5KN0A 3BCKA 2VD1A 5IO2A 2B7JA 3GA4A 1Z9HA 5G2ZA 2I81A 2BJXA 2C8UA 3C8EA 5JCWA 3Q74A 4PQHA 4GSSA 4PTSA 2I4AA 1EWXA 1R26A 2MMAA 5IOWA 3VK9A 2V2GA 1UA5A 3VWWA 5IPHA 1SK1A 1M9BA 1AQXA 1GUHA 5A5KA 5JCUA 1F3BA 2IWTA 2L5OA 3ZMLA 2R0PA 3MAKA 2L4QA 2YWOA 2VD0A 2R0CA 3LGCA 3IPZA 3KXOA 2HZEB 1B8XA 3LWAA 1H4OA 5CRGA 3F3QA 4V1Ag 5FT3A 5GZZB 4L8EA 2L59A 19GSA 3SBCA 4OFMA 5AN1A 9GSSA 1GTIA 1THOA 4PURA 4NXIA 4TN8A 4PNGA 1JZOA 2HLSA 4BL7B 1XIYA 4GXZA 4IVFA 2C0EA 3EU3A 4FYCA 4G9HA 3GUSA 1KTEA 2KLXA 4O7HA 1SD9A 5DQSA 2QA1A 1JLVA 2MMNA 20GSA 1GSSA 3TB2A 1HNCA 1AW9A 1JFUA 5AISA 2QKEA 4XCSA 4ML6A 3QR6A 2M80A 1TJDA 4K5RA 5BMUA 4GRFA 1CQGA 1J0FA 2PUKC 2FA4A 1Z6NA 1WWJA 3TKPA 5CREA 1IYIA 1X9MB 1YY7A 2WULA 1OYJA 4WKWA 1B9XC 1V2AA 5JWOB 2HRAA 1NSWA 4K1FA 2HE3A 3IXRA 1PRXA 2LJAA 3VWVA 3WYWA 4TR1B 4IW9A 2WJUA 1BX9A 1VRSD 3VLNA 3LSZA 2HSYA 1XW9A 1TXXA 1SENA 3FHKA 5CRWA 1FVJA 5C00A 1GWCA 3UOMA 3APQA 2P0GA 3VURA 2F51A 4L0WA 3O6TA 4ZXGA 2B1KA 14GSA 4XS1A 4WF4A 3FY7A 3PR8A 1XWKA 1E6BA 1U6TA 2H0HA 2QA2A 3GV1A 1TDIA 2QC7A 3CTGA 5J9CA 4H86A 4A5PA 4KSOA 3US3A 5GSSA 5CP1A 1FOVA 2JACA 2VUPA 3ZFBA 1DSBA 2ON7A 1TRUA 2OE1A 2VL9A 1M99A 4RQXA 4LL4B 3KTLA 3GN3A 3QAVA 3APOA 1NW2A 4J2FA 4KGIA 1QMVA 3UEMA 1M2BA 10GSA 2AAWA 3ZLPA 1AUCA 2R2JA 3Q19A 5IMFA 3H8QA 4YQUA 4DSSB 1G7EA 3H1NA 2MZCA 4TW5A 4XS4A 1QQ2A 4JR4A 3LEFA 2G0FA 5KOXA 5AIVA 1WIKA 4ZBDA 2AV4A 2YP6A 3RBTA 2YOIA 3IHQA 1J9BA 3ZRDA 4IGJA 2H74A 3IK9A 2GDRA 2H73A 1F37A 2C3QA 4X4JA 5HFIA 4LLRA 5ECLB 3I6AA 3QFBC 3UIWA 4MF7A 3WT2A 1TOFA 2CZ3A 4MJCA 2H1BA 3TJGA 2A2SA 5DAKB 3GX0A 2O8VB 4K9ZA 1Z3EA 4ISDA 4ZILA 2CQ9A 1FOHA 1EEMA 1AXDA 1SYRA 1XOAA 3HY2A 1O73A 5G30A 5B6NA 2IN3A 2GZPA 2LRNA 2HNLA 1T00A 1PL2A 4K6XA 4XS6A 5JCGA 1Z6MA 5EL8A 3PH9A 1XPVA 3IBHA 2VL2A 3GURA 1HNBA 1S3AA 2R4VA 3PPUA 1AQVA 1X0RA 2DBCA 5ECSA 4POKA 2C3TA 2FD3A 1F3AA 2L6CA 5ABRA 4FIWA 1YZXA 3FMWA 2IIYA 1I5GA 4ML1A 5A4VA 3I9V2 5HFGA 3HD5A 2NVLA 3HVSA 3GKMA 3O3TA 3ED3A 5KOWA 3BBYA 3CSHA 3F6FA 3IV4A 4E8HA 4DVCA 1F6MC 1GLPA 1Y25A 2JZRA 4V2LA 1MD3A 2K9FA 2GZYA 17GSA 1A8YA 4BWSA 2WGRA 3EMPA 4N0VA 4ULXA 3DVXA 2L57A 1B48A 2EIRA 1OC9B 1XWBA 3A2XA 3K8NA 4F0CA 3VI7A 1LU4A 2I1UA 5ECIB 2E2GA 4BL7A 3MDKA 4YQVA 1BJXA 1G0TA 3SWLA 4K2DA 1PX7A 6GSVA 3GH6A 2FY6A 2J23A 3FK8A 2C3NA 4ZB6A 5ECNB 2BTOT 3DMLA 1U3AA 1RW1A 2I3YA 4E8EA 1WOUA 4KAEA 4CY6A 4XTSA 3GKNA 2XC2A 3KMOA 2MMOA 4CDOA 3TOTA 5HQPA 4TVEA 5D9XA 4IN0A 2GTUA 5G1KA 2OKAA 4IJ3A 3VI5A 2MMZA 2M46A 3GH9A 5HR0A 4GSTA 5F05A 6GSUA 3IAS2 2VLVA 1XWCA 4HZ2A 4JEDA 1T8EB 4POBA 4O5UA 2YANA 3W6GA 2ZUPA 4ZB9A 1BAYA 5CRDA 2TRXA 4WEYA 5J41A 2YV7A 4RUVA 2YJ7A 3QFAC 2M72A 1QK8A 1WE0A 4G2EA 1S3DA 4F03A 4BVYA 2OADA 2K8SA 4L5LA 2DLXA 2UZ8A 4NHZA 1XZOA 2OJLA 1HNAA 2PVOC 5CRHA 5IMDA 2F8FA 1M2AA 3MSZA 4KNDA 4OO5A 4AF2A 3M9JA 5B8BA 4CY8A 3KIJA 2HSHA 2R3XA 1PKZA 1EEJA 1ZL9A 3HCZA 3L0HA 1SKSB 2H01A 4WR5A 1MDJA 1A0RP 4NPBA 3DYRA 3ZZXA 2XPDA 3PGTA 3KCMA 3E0UA 5D8IA 1SU9A 2L5LA 2V41A 1KBNA 5F0GA 4GWRA 1YF1A 4OWYA 3E9JB 2FLSA 2FWFA 2H19A 5KN3A 1SJIA 4IHUA 2YPMA 4F0BA 3GTUB 1B4QA 5DDLA 3I69A 4Q5QA 4GSNA 5ECKB 2PN8A 5F07A 4PXOA 5KN1A 1SJZA 1JZRA 1PN0A 2IJYA 3MYDA 4TKYA 1ZZYA 3D5JA 2AJQB 4FQUA 5F06A 1K0DA 3GHAA 3NIVA 3O76A 1TK5B 4Q5RA 1EZKA 3ERFA 3GX8A 2I9HA 3HVVA 2H72A 2KUCA 2JSZA 4EIQA 4J57E 1DE2A 4MH2A 2LQQA 1GNWA 1MD4A 4GF0A 4BVXB 3DD3A 1U87A 2MBSA 2AB6A 3HXSA 3HJOA 3IA1A 1AIUA 1ZGNA 3ZTLA 3TKSE 4O92A 2OA7A 1ABAA 3F63A 1F2EA 5G5EA 3HA9A 2VM1A 2VCZA 2JZTA 3ZIVA 3TRPA 5IMZA 4MABA 3FKFA 2GQMA 4GQCA 1TK0B 1T4ZA 3ZL5A 5ECHB 4ACSA 4HQSA 2ALBA 2NDOA 4KA0A 1MTCA 4HDEA 2OACA 2PERA 2FWEA 4F82A 2B5YA 2PGTA 2K8VA 5ECQB 1OC3A 2YZUA 1TP9A 2H76A 1M0UA 1ZYNA 3AY8A 2HSMA 4ILFA 3UMAA 4LA1A 1GULA 4HOJA 2KHPA 3D0ZA 5H5SA 3HDCA 3UBKA 3CMIA 1BEDA 4MPGA 5ENUA 1K0NA 1FG4A 2XPEA 3D21A 3HHVA 1SL0B 1OE8A 2GSRA 3QCPA 3WGDA 2X4AA 2IFQB 3QMXA 3W8SA 2DJ0A 2X49A 1M2DA 2DJ2A 2GQKA 2O87A 3G7JA 3F0IA 3TJJA 1TK8B 1O7UA 1PSQA 3FRCA 1E2YA 4OMVA 2PMTA 3KZQA 3TKRA 3C1RA 4MK3A 5C04A 2YWNA 4XRAA 1O8XA 4HEA2 3Q6OA 2GVPA 3Q18A 5F8BA 3ZMKA 3D4MA 3UVHA 2GT6A 3KP9A 4KDXA 5EY6A 3WD6A 4HI7A 3N9JA 4WETA 4L0UA 2ES7A 2VCVA 3F4TA 2NBSA 4XIHA 4TXOB 4I5QA 1MDKA 3M3MA 4L5OA 3R3EA 4JU5A 4MJEA 4K7NA 2N5FA 2H0IA 2H1GA 4FO5A 3P2AA 3ZIJA 3UJ1A 1FHEA 2IMKA 4POLA 4TR3A 2VIMA 1PN9A 8GSSA 4G0LA 5ID2A 4X43A 4GCIA 2JU5A 1SD8A 5ECPB 3EINA 3L9UA 3G7IA 2C1YA 1SKRB 2VCWA 1GP1A 3GYKA 1GRXA 3GSSA 2H6XA 4N11A 1VF1A 3TKQA 3MIXA 3TKSC 2AHEA 1VF3A 1OVNA 3ZFLA 3RDWA 3LXZA 2H6ZA 3H4KA 1G6WA 1O85A 4MCUA 3DEXA 4WXTA 5DCGA 1TTZA 4OCEA 2B5EA 1M7TA 3I43A 1QFNA 3P90A 2LS5A 3C73A 2FA8A 2GS3A 3KD0A 1U88A 1CQHA 4IP6A 3KJYA 2D2ZA 1WJKA 3BJ5A 2AYTA 2LJRA 1MDIA 4J56E 2IPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EL1 A;  2XBI A;  5INY A;  2GZZ A;  3DIE A;  1PA3 A;  3DGQ A;  4ECI A;  1A2L A;  4HU7 A;  3V1W A;  1T7P B;  3GTU A;  5J9B A;  2EC4 A;  4MMM A;  2IMF A;  3F8U A;  4HQZ A;  3J7Y b;  1BG5 A;  1K3O A;  2LJK A;  3A2V A;  3RPN A;  4NHW A;  1VGL A;  1EV4 A;  5IO0 A;  5H5R A;  1R7H A;  1A23 A;  7GSS A;  1ST9 A;  5IM9 A;  4NWY A;  1QXH A;  1VF2 A;  2J9H A;  2LV3 A;  2V32 A;  3EYT A;  5GAP D;  4X1U A;  4JR6 A;  5JWQ B;  4BVX A;  1GSU A;  5IPG A;  4RI6 A;  1ACV A;  4IKH A;  5DAL B;  1JZD A;  1LJR A;  4IJI A;  3APS A;  5ECO B;  3RHB A;  2YV9 A;  2LST A;  2O85 A;  1IYH A;  3EU4 A;  1ERU A;  3FR9 A;  1K0A A;  1WMJ A;  1KNG A;  1PMT A;  2TRC P;  4KW6 A;  1GTA A;  4G19 A;  2EIO A;  2IMI A;  4TR0 A;  2HRN A;  4EC0 A;  2YN1 A;  2B7K A;  4O5R A;  5IMA A;  2O7K A;  3F6D A;  1ZOF A;  2REM A;  1GSD A;  4EXJ A;  4I2T A;  2KP2 A;  1TI1 A;  3F9U A;  18GS A;  4EKZ A;  2WRT A;  2HRF A;  2HZE A;  1GUM A;  1XOB A;  2F9S A;  1GSF A;  4ZL9 A;  4K8M A;  5COH A;  2B5X A;  4JE1 A;  3TCO A;  4MH3 A;  3IRA A;  2R5G A;  2HFD A;  1GUK A;  1YEP A;  2RM6 A;  2CVD A;  5IQY A;  3UBL A;  2LNT A;  5EPF A;  1O81 A;  2DC5 A;  5CAX A;  1AAZ A;  1EGR A;  3GFK A;  3CSJ A;  1A2J A;  1PD2 1;  1YF0 A;  1BYE A;  3FR3 A;  4JZQ A;  3C7M A;  3GNJ A;  4OFT A;  5GST A;  2IMD A;  1B9Y C;  4I97 A;  2GLR A;  4RI7 A;  5E59 A;  2CAI A;  1Z7P A;  2GST A;  4TOP A;  1JLW A;  5ELG A;  2ZNM A;  4EDY A;  2TIR A;  4AJ7 A;  4I2U A;  3P7X A;  4V2M A;  3LOR A;  2LRC A;  1DE1 A;  1PL1 A;  2H71 A;  4TXV A;  6GST A;  1C72 A;  1AC1 A;  2CA8 A;  1U3I A;  4N0Z A;  4AJ6 A;  2CV4 A;  2DJ1 A;  3OR5 A;  4TR1 A;  3UAR A;  3M1G A;  4QL7 A;  3ZVJ A;  2HZF A;  4IS0 A;  4TXO A;  3KGK A;  5HR3 A;  5CYY A;  1GL8 A;  3IC4 A;  4HZ4 A;  1K0C A;  1EP8 A;  3GKX A;  3HJM A;  3IOS A;  22GS A;  1Z5Y E;  1OC8 A;  2DIZ A;  5AGY A;  4MF5 A;  1PQN A;  2KOK A;  1GSY A;  3ME8 A;  1PX6 A;  4OCF A;  1R5A A;  4GQF A;  4KCA A;  3U6V A;  2WS2 A;  5IMV A;  1DUG A;  3E3E A;  4EO3 A;  5DJL A;  2H66 A;  1YKA A;  2X8C A;  4FYU A;  2H1D A;  4MP4 A;  5D9T A;  3CRU A;  1V57 A;  4CHS A;  2YWM A;  1S3C A;  1SJ6 A;  3QAW A;  1FW1 A;  4YQM A;  3TJF A;  4F9Z A;  1G7O A;  3MNG A;  3ZVJ D;  3DXB A;  3IAM 2;  1SYX A;  5AIX A;  2VL3 A;  3WGE A;  4HU9 A;  1JHB A;  3W8J A;  1SL1 B;  4KE3 A;  4ECJ A;  1X9W B;  2ZCT A;  4MJB A;  5LD0 A;  2RUE A;  4N10 A;  5CO3 A;  2WB9 A;  2H1A A;  3VPQ A;  3LFL A;  5FHI A;  1N8J A;  1ERT A;  1SK2 A;  5GAN D;  4DSS A;  3PIN A;  2JSY A;  1O8W A;  1R5P A;  4K0G A;  1RQM A;  3TUE A;  4XS4 B;  1WPI A;  2LUS A;  1H75 A;  2OBK A;  3CSI A;  2F8A A;  3LQ7 A;  2HI7 A;  2NTO A;  5DVB A;  1W89 A;  3RPP A;  1RK4 A;  4BWQ A;  1UN2 A;  2E0Q A;  2VM2 A;  4G10 A;  1T4Y A;  3FZ5 A;  3TKS A;  3MWH A;  3H93 A;  3TDG A;  1YJ6 A;  3ME7 A;  4OD7 A;  3EVI A;  5DAK A;  3LYP A;  2LTK A;  3WT1 A;  1K0B A;  4WR4 A;  2RUF A;  2LQO A;  3U5R E;  5KN2 A;  4NMU A;  1QUW A;  4KX4 A;  4WBR D;  2A2R A;  1V40 A;  2GGT A;  2LEG A;  1TW9 A;  2DJJ A;  1URM A;  3EMX A;  1GSE A;  4KDU A;  1R4W A;  3L9V A;  3EUR A;  4Q5N A;  6GSY A;  4ECC A;  4ZBB A;  2CAQ A;  2HXK A;  1NHO A;  1OAZ A;  4KCE A;  1SL2 B;  4LMW A;  3CYN A;  2DJ3 A;  5IIZ A;  3TGZ A;  2YWI A;  2VOC A;  4AGS A;  3C1S A;  2VCX A;  1YDK A;  2H0G A;  4KDY A;  4BA7 A;  12GS A;  4IQ1 A;  1N2A A;  3LG6 A;  1XFL A;  2G2Q A;  4CW9 A;  4P3Y B;  1NHY A;  1VF4 A;  1TU8 A;  4OO4 A;  4PUF C;  3FEU A;  1XBS A;  4IEL A;  1OC9 A;  2XBQ A;  1K3Y A;  4N30 A;  1ZCP A;  4V2N A;  3H79 A;  2FWG A;  4EUY A;  2V6O A;  2MYG A;  2VCT A;  2FHE A;  4ECB A;  3JCM L;  4IP1 A;  3L4N A;  4PQI A;  3L9S A;  4GTU A;  5D73 A;  1GLQ A;  2K6V A;  4POM A;  1TRV A;  1K0M A;  3P8W A;  2EIQ A;  3KH9 A;  4V1A p;  3A2W A;  4F2I A;  1EP7 A;  2R6K A;  1GNE A;  6GSS A;  1XVW A;  5H5Q A;  2L6D A;  3LJR A;  3NOF A;  4JBB A;  4WBJ A;  1GH2 A;  4XHM A;  4NAX A;  1GSQ A;  3LXT A;  1Y6E A;  3F4R A;  3D6I A;  1QGV A;  4HS1 A;  3GIX A;  3QPM A;  5J4U A;  2DIY A;  1AQW A;  1ERW A;  4K7I A;  5A4W A;  3DWV A;  1PKW A;  6GSW A;  3CXG A;  1TKD B;  4PUA A;  1ERV A;  4PQ1 A;  1X9S B;  3FYG A;  5FWG A;  3GRX A;  1TU7 A;  2PBJ A;  3FW2 A;  2LKU A;  4MA9 A;  4KH7 A;  1MEK A;  4QL9 A;  5G31 A;  4WF5 A;  3HYP A;  3WGX A;  5B7C A;  3M0F A;  2R37 A;  4KSM A;  11GS A;  3IDV A;  3IK7 A;  1TRW A;  1YQ1 A;  2WZ9 A;  3CRT A;  2N5B A;  2P31 A;  4PGT A;  2H70 A;  2C4J A;  1THX A;  5ELA A;  1EOG A;  1EOH A;  4FYB A;  2H75 A;  2BMX A;  5E4W A;  3VWU A;  4HJ2 A;  1GTB A;  2DJK A;  5LCZ A;  2C0F A;  5D96 A;  1W4V A;  3KTB A;  1K0O A;  2O89 A;  2DMM A;  5HR1 A;  4AJ8 A;  2MBT A;  5J5N A;  3D22 A;  1Z7R A;  2X8G A;  3HZ4 A;  2QSI A;  1ON4 A;  13GS A;  2NPB A;  2DSA A;  3GKK A;  3EE2 A;  3R2Q A;  2CX3 A;  1XW6 A;  1EV9 A;  2GQL A;  1TRS A;  1T1V A;  3FR6 A;  3VFI A;  1ZYE A;  3DRN A;  2X8H A;  4MZW A;  1NM3 A;  1A0F A;  4YH2 A;  4EDZ A;  1YKC A;  3BD2 A;  4D73 B;  3C71 A;  3QOU A;  5J3R A;  5IOX A;  1J08 A;  4MJA A;  2VCQ A;  4DEJ A;  5DCH A;  4K0N A;  2CVK A;  2LRT A;  2LNS A;  1Q98 A;  1Q4J A;  2FCH A;  1X5C A;  1V9W A;  5L71 A;  2XHF A;  1K3L A;  2VAF A;  2GSS A;  4ZIJ A;  4ZBA A;  4DSQ A;  2WFC A;  2H8L A;  4DSR A;  5DQY A;  2C0G A;  1O6J A;  3FZ9 A;  2HT9 A;  4I8B A;  1KEB A;  3GST A;  3HKR A;  3EC3 A;  1OKD A;  2B1L A;  5D9W A;  1F9M A;  2YJH A;  4EVM A;  3F4S A;  2Z9S A;  3HZ8 A;  2FUG 2;  3TRX A;  2ON5 A;  2RM5 A;  3GL3 A;  1A8L A;  2PPT A;  3GMF A;  2HYX A;  1USB A;  4OFN A;  5G1L A;  3HJP A;  4GLT A;  1X5D A;  3CBU A;  4PNF A;  2FGX A;  4MF6 A;  2N5A A;  4O32 A;  2VLT A;  4MPF A;  2C80 A;  1HQO A;  4LMV A;  4ID0 A;  1JZW A;  2GSQ A;  3KH7 A;  5B6M A;  3A5W A;  2H6Y A;  2IME A;  1SKW B;  2E2M A;  2KP1 A;  6GSX A;  2JZS A;  1UVZ A;  1ZMA A;  3S9F A;  2YCD A;  1V58 A;  4RQR A;  2L4C A;  3ERG A;  2JL4 A;  2IFQ A;  4JRR A;  4X0X A;  4EE0 A;  4HJM A;  5A4U A;  2AUV A;  1B4P A;  4XRD A;  2E7P A;  4YAP A;  4TRX A;  4ZB8 A;  4MLY A;  5D9V A;  1XXU A;  1XCC A;  3ZIT A;  5ECM B;  4TR4 A;  4MDC A;  2CT6 A;  3GL5 A;  2RII A;  1FVK A;  1HD2 A;  2WDU A;  1YEX A;  3UVT A;  3LYK A;  3J7Y k;  3KP8 A;  3M8N A;  5IMC A;  1UC7 A;  3KEB A;  5B8A A;  3ISO A;  1TI3 A;  3RHC A;  4HUA A;  2C0D A;  3ZYW A;  3F3R A;  5G5F A;  3DKS A;  3G7Y A;  2FNO A;  2IL3 A;  3M9K A;  1BQ7 A;  3UAP A;  3TJB A;  1ILO A;  1XWA A;  4BPY A;  2CVB A;  4K7O A;  4YAV A;  3TJK A;  4NV2 A;  2V6K A;  5ID2 B;  4KUN A;  4MZB A;  1V98 A;  3KM6 A;  3DVW A;  1I9D A;  3VPT A;  1PGT A;  2H30 A;  3IE3 A;  5DJM A;  1WRY A;  1ZYQ B;  4KB3 A;  2WCI A;  4LL1 B;  3QAG A;  2GT5 A;  1SK0 A;  1XWG A;  1OKT A;  1DBY A;  5ECR B;  1XW5 A;  1EGO A;  2X64 A;  2P5Q A;  1T3B A;  2YNX A;  1FB6 A;  2F3M A;  1ML6 A;  2B6M A;  2K18 A;  3FZA A;  4IQA A;  1HYU A;  4NV5 A;  3BOA A;  3CTF A;  2PU9 C;  2B3S A;  4I6X A;  1X5E A;  2YZH A;  1GTU A;  2CZ2 A;  1A2M A;  4MZC A;  2V1M A;  3ZRE A;  4QQ7 A;  5CNW A;  2P5R A;  2VO4 A;  3UL3 A;  3TOU A;  1WP0 A;  2OE0 A;  2OBI A;  3ERW A;  2VL2 C;  1XVQ A;  3IR4 A;  2CX4 A;  2RLI A;  5KEJ A;  3HVX A;  4IBP A;  2QGV A;  5LNK e;  3BCI A;  1G6Y A;  5HR2 A;  1FO5 A;  4ZL8 A;  1FAA A;  3G9B A;  3QD9 A;  3NZN A;  1FB0 A;  1LBK A;  2FWH A;  4EF0 A;  5JWR B;  4D73 A;  2DML A;  4FH8 A;  5EVO A;  3N5O A;  3QDN A;  1OE7 A;  16GS A;  3EWL A;  2VLU A;  4PX1 A;  3FZ4 A;  1A24 A;  3TRQ A;  3KMN A;  4ZL7 A;  4Q5F A;  4Z7X A;  3VWX A;  2PVQ A;  5DAL A;  3RAZ A;  5D93 A;  1M9A A;  3D4T A;  2OE3 A;  3L78 A;  5DBQ A;  2PWJ A;  2JAD A;  2X99 A;  5HFK A;  2A4V A;  3A3T A;  5KN0 A;  3BCK A;  2VD1 A;  5IO2 A;  2B7J A;  3GA4 A;  1Z9H A;  5G2Z A;  2I81 A;  2BJX A;  2C8U A;  3C8E A;  5JCW A;  3Q74 A;  4PQH A;  4GSS A;  2I4A A;  1EWX A;  1R26 A;  2MMA A;  5IOW A;  3VK9 A;  2V2G A;  1UA5 A;  3VWW A;  5IPH A;  1SK1 A;  1M9B A;  1AQX A;  1GUH A;  5A5K A;  5JCU A;  1F3B A;  2IWT A;  2L5O A;  3ZML A;  3MAK A;  2L4Q A;  2YWO A;  2VD0 A;  3LGC A;  3IPZ A;  3KXO A;  2HZE B;  1B8X A;  3LWA A;  1H4O A;  5CRG A;  3F3Q A;  4V1A g;  5FT3 A;  5GZZ B;  4L8E A;  2L59 A;  19GS A;  3SBC A;  4OFM A;  5AN1 A;  9GSS A;  1GTI A;  1THO A;  4PUR A;  4NXI A;  4TN8 A;  4PNG A;  1JZO A;  2HLS A;  1XIY A;  4GXZ A;  4IVF A;  2C0E A;  3EU3 A;  4FYC A;  4G9H A;  3GUS A;  1KTE A;  2KLX A;  4O7H A;  1SD9 A;  5DQS A;  1JLV A;  2MMN A;  20GS A;  1GSS A;  3TB2 A;  1HNC A;  1AW9 A;  1JFU A;  5AIS A;  2QKE A;  4XCS A;  4ML6 A;  3QR6 A;  2M80 A;  1TJD A;  4GRF A;  1CQG A;  1J0F A;  2PUK C;  2FA4 A;  1Z6N A;  1WWJ A;  3TKP A;  5CRE A;  1IYI A;  1X9M B;  1YY7 A;  2WUL A;  1OYJ A;  4WKW A;  1B9X C;  1V2A A;  5JWO B;  1NSW A;  4K1F A;  2HE3 A;  3IXR A;  1PRX A;  2LJA A;  3VWV A;  3WYW A;  4TR1 B;  4IW9 A;  2WJU A;  1BX9 A;  1VRS D;  3VLN A;  3LSZ A;  2HSY A;  1XW9 A;  1TXX A;  1SEN A;  3FHK A;  5CRW A;  1FVJ A;  5C00 A;  1GWC A;  3UOM A;  3APQ A;  2P0G A;  3VUR A;  2F51 A;  4L0W A;  3O6T A;  4ZXG A;  2B1K A;  14GS A;  4XS1 A;  4WF4 A;  3FY7 A;  3PR8 A;  1XWK A;  1E6B A;  1U6T A;  2H0H A;  3GV1 A;  1TDI A;  2QC7 A;  3CTG A;  5J9C A;  4H86 A;  4KSO A;  3US3 A;  5GSS A;  5CP1 A;  1FOV A;  2JAC A;  2VUP A;  3ZFB A;  1DSB A;  2ON7 A;  1TRU A;  2OE1 A;  2VL9 A;  1M99 A;  4RQX A;  4LL4 B;  3KTL A;  3GN3 A;  3QAV A;  3APO A;  1NW2 A;  4J2F A;  4KGI A;  1QMV A;  3UEM A;  1M2B A;  10GS A;  2AAW A;  3ZLP A;  1AUC A;  2R2J A;  3Q19 A;  5IMF A;  3H8Q A;  4YQU A;  4DSS B;  1G7E A;  3H1N A;  2MZC A;  4TW5 A;  4XS4 A;  1QQ2 A;  4JR4 A;  3LEF A;  2G0F A;  5AIV A;  1WIK A;  4ZBD A;  2AV4 A;  2YP6 A;  3RBT A;  2YOI A;  3IHQ A;  1J9B A;  3ZRD A;  4IGJ A;  2H74 A;  3IK9 A;  2GDR A;  2H73 A;  1F37 A;  2C3Q A;  5HFI A;  4LLR A;  5ECL B;  3I6A A;  3QFB C;  3UIW A;  4MF7 A;  3WT2 A;  1TOF A;  2CZ3 A;  4MJC A;  2H1B A;  3TJG A;  2A2S A;  5DAK B;  3GX0 A;  2O8V B;  4K9Z A;  1Z3E A;  4ISD A;  4ZIL A;  2CQ9 A;  1EEM A;  1AXD A;  1SYR A;  1XOA A;  3HY2 A;  1O73 A;  5G30 A;  5B6N A;  2IN3 A;  2GZP A;  2LRN A;  2HNL A;  1T00 A;  1PL2 A;  4K6X A;  4XS6 A;  5JCG A;  1Z6M A;  5EL8 A;  3PH9 A;  1XPV A;  3IBH A;  2VL2 A;  3GUR A;  1HNB A;  1S3A A;  2R4V A;  1AQV A;  1X0R A;  2DBC A;  5ECS A;  4POK A;  2C3T A;  2FD3 A;  1F3A A;  2L6C A;  5ABR A;  4FIW A;  1YZX A;  2IIY A;  1I5G A;  4ML1 A;  5A4V A;  3I9V 2;  5HFG A;  3HD5 A;  2NVL A;  3HVS A;  3GKM A;  3O3T A;  3ED3 A;  3BBY A;  3CSH A;  3F6F A;  3IV4 A;  4E8H A;  4DVC A;  1F6M C;  1GLP A;  1Y25 A;  2JZR A;  4V2L A;  1MD3 A;  2K9F A;  2GZY A;  17GS A;  1A8Y A;  4BWS A;  2WGR A;  3EMP A;  4N0V A;  4ULX A;  3DVX A;  2L57 A;  1B48 A;  2EIR A;  1OC9 B;  1XWB A;  3A2X A;  3K8N A;  4F0C A;  3VI7 A;  1LU4 A;  2I1U A;  5ECI B;  2E2G A;  4BL7 A;  3MDK A;  4YQV A;  1BJX A;  1G0T A;  3SWL A;  4K2D A;  1PX7 A;  6GSV A;  3GH6 A;  2FY6 A;  2J23 A;  3FK8 A;  2C3N A;  4ZB6 A;  5ECN B;  2BTO T;  3DML A;  1U3A A;  1RW1 A;  2I3Y A;  4E8E A;  1WOU A;  4KAE A;  4XTS A;  3GKN A;  2XC2 A;  3KMO A;  2MMO A;  4CDO A;  3TOT A;  5HQP A;  4TVE A;  5D9X A;  4IN0 A;  2GTU A;  5G1K A;  2OKA A;  4IJ3 A;  3VI5 A;  2MMZ A;  2M46 A;  3GH9 A;  5HR0 A;  4GST A;  5F05 A;  6GSU A;  3IAS 2;  2VLV A;  1XWC A;  4HZ2 A;  4JED A;  1T8E B;  4POB A;  2YAN A;  3W6G A;  2ZUP A;  4ZB9 A;  1BAY A;  5CRD A;  2TRX A;  4WEY A;  5J41 A;  2YV7 A;  4RUV A;  2YJ7 A;  3QFA C;  2M72 A;  1QK8 A;  1WE0 A;  4G2E A;  1S3D A;  4F03 A;  4BVY A;  2OAD A;  2K8S A;  4L5L A;  2DLX A;  4NHZ A;  1XZO A;  2OJL A;  1HNA A;  2PVO C;  5CRH A;  5IMD A;  2F8F A;  1M2A A;  3MSZ A;  4KND A;  4OO5 A;  4AF2 A;  3M9J A;  5B8B A;  3KIJ A;  2HSH A;  2R3X A;  1PKZ A;  1EEJ A;  1ZL9 A;  3HCZ A;  3L0H A;  1SKS B;  2H01 A;  4WR5 A;  1MDJ A;  1A0R P;  4NPB A;  3DYR A;  3ZZX A;  2XPD A;  3PGT A;  3KCM A;  3E0U A;  5D8I A;  1SU9 A;  2L5L A;  2V41 A;  1KBN A;  5F0G A;  4GWR A;  1YF1 A;  4OWY A;  3E9J B;  2FLS A;  2FWF A;  2H19 A;  5KN3 A;  1SJI A;  4IHU A;  2YPM A;  4F0B A;  3GTU B;  1B4Q A;  5DDL A;  3I69 A;  4Q5Q A;  5F07 A;  4GSN A;  2PN8 A;  5ECK B;  4PXO A;  5KN1 A;  1SJZ A;  1JZR A;  2IJY A;  4TKY A;  1ZZY A;  3D5J A;  2AJQ B;  5F06 A;  1K0D A;  3GHA A;  3NIV A;  3O76 A;  1TK5 B;  4Q5R A;  1EZK A;  3ERF A;  3GX8 A;  2I9H A;  3HVV A;  2H72 A;  2KUC A;  2JSZ A;  4J57 E;  1DE2 A;  4MH2 A;  2LQQ A;  1GNW A;  1MD4 A;  4GF0 A;  3DD3 A;  1U87 A;  2MBS A;  2AB6 A;  3HXS A;  3HJO A;  3IA1 A;  1AIU A;  1ZGN A;  3ZTL A;  3TKS E;  4O92 A;  2OA7 A;  1ABA A;  3F63 A;  1F2E A;  5G5E A;  3HA9 A;  2VM1 A;  2VCZ A;  2JZT A;  3ZIV A;  3TRP A;  5IMZ A;  4MAB A;  3FKF A;  2GQM A;  4GQC A;  1TK0 B;  1T4Z A;  3ZL5 A;  5ECH B;  4ACS A;  4HQS A;  2ALB A;  2NDO A;  4KA0 A;  1MTC A;  4HDE A;  2OAC A;  2PER A;  2FWE A;  4F82 A;  2B5Y A;  2PGT A;  2K8V A;  5ECQ B;  1OC3 A;  2YZU A;  1TP9 A;  2H76 A;  1M0U A;  3AY8 A;  4ILF A;  3UMA A;  4LA1 A;  1GUL A;  4HOJ A;  2KHP A;  3D0Z A;  5H5S A;  3HDC A;  3UBK A;  3CMI A;  1BED A;  4MPG A;  5ENU A;  1K0N A;  1FG4 A;  2XPE A;  3D21 A;  3HHV A;  1SL0 B;  1OE8 A;  2GSR A;  3QCP A;  3WGD A;  2IFQ B;  3QMX A;  3W8S A;  2DJ0 A;  1M2D A;  2DJ2 A;  2GQK A;  2O87 A;  3G7J A;  3F0I A;  3TJJ A;  1TK8 B;  1O7U A;  1PSQ A;  3FRC A;  1E2Y A;  4OMV A;  2PMT A;  3KZQ A;  3TKR A;  3C1R A;  4MK3 A;  5C04 A;  2YWN A;  4XRA A;  1O8X A;  4HEA 2;  3Q6O A;  2GVP A;  3Q18 A;  5F8B A;  3ZMK A;  3D4M A;  3UVH A;  2GT6 A;  3KP9 A;  4KDX A;  5EY6 A;  3WD6 A;  4HI7 A;  3N9J A;  4WET A;  4L0U A;  2ES7 A;  2VCV A;  3F4T A;  2NBS A;  4XIH A;  4TXO B;  4I5Q A;  1MDK A;  3M3M A;  4L5O A;  4JU5 A;  4MJE A;  4K7N A;  2N5F A;  2H0I A;  2H1G A;  4FO5 A;  3P2A A;  3ZIJ A;  3UJ1 A;  1FHE A;  2IMK A;  4POL A;  4TR3 A;  2VIM A;  1PN9 A;  8GSS A;  5ID2 A;  4X43 A;  4GCI A;  2JU5 A;  1SD8 A;  5ECP B;  3EIN A;  3L9U A;  3G7I A;  2C1Y A;  1SKR B;  2VCW A;  1GP1 A;  3GYK A;  1GRX A;  3GSS A;  2H6X A;  4N11 A;  1VF1 A;  3TKQ A;  3TKS C;  2AHE A;  1VF3 A;  1OVN A;  3ZFL A;  3RDW A;  3LXZ A;  2H6Z A;  3H4K A;  1G6W A;  1O85 A;  4MCU A;  3DEX A;  4WXT A;  5DCG A;  1TTZ A;  4OCE A;  2B5E A;  1M7T A;  3I43 A;  1QFN A;  3P90 A;  2LS5 A;  3C73 A;  2FA8 A;  2GS3 A;  3KD0 A;  1U88 A;  1CQH A;  4IP6 A;  3KJY A;  2D2Z A;  1WJK A;  3BJ5 A;  2AYT A;  2LJR A;  1MDI A;  4J56 E;  2IPA A; 
#chains in the Genus database with same CATH topology
 4EL1 A;  2XBI A;  5INY A;  2GZZ A;  3DIE A;  1PA3 A;  3DGQ A;  4ECI A;  1A2L A;  4HU7 A;  4MNN A;  3V1W A;  1T7P B;  3GTU A;  5J9B A;  2EC4 A;  4MMM A;  2IMF A;  3F8U A;  4HQZ A;  3J7Y b;  1BG5 A;  1K3O A;  2LJK A;  3A2V A;  3RPN A;  4NHW A;  1VGL A;  1EV4 A;  5IO0 A;  5H5R A;  1R7H A;  1A23 A;  7GSS A;  1ST9 A;  5IM9 A;  4NWY A;  1QXH A;  1VF2 A;  2J9H A;  2LV3 A;  2V32 A;  3EYT A;  5GAP D;  4X1U A;  4JR6 A;  5JWQ B;  4BVX A;  1M3I A;  1GSU A;  5IPG A;  4RI6 A;  1ACV A;  4IKH A;  5DAL B;  1JZD A;  1LJR A;  4IJI A;  3APS A;  5ECO B;  3RHB A;  2YV9 A;  2LST A;  2O85 A;  1IYH A;  3EU4 A;  1ERU A;  3FR9 A;  1K0A A;  1WMJ A;  1KNG A;  1PMT A;  2TRC P;  4KW6 A;  1GTA A;  4G19 A;  2EIO A;  2IMI A;  4TR0 A;  2HRN A;  4EC0 A;  2YN1 A;  2B7K A;  4O5R A;  5IMA A;  2O7K A;  3F6D A;  1ZOF A;  2REM A;  1GSD A;  4EXJ A;  4I2T A;  2KP2 A;  1TI1 A;  3F9U A;  18GS A;  4EKZ A;  2WRT A;  2HRF A;  2HZE A;  1GUM A;  1XOB A;  2F9S A;  1GSF A;  4ZL9 A;  4K8M A;  5COH A;  2B5X A;  4JE1 A;  3TCO A;  4MH3 A;  3IRA A;  2R5G A;  2HFD A;  1GUK A;  1YEP A;  2RM6 A;  2CVD A;  5IQY A;  3UBL A;  2LNT A;  5EPF A;  1O81 A;  2DC5 A;  5CAX A;  1AAZ A;  1EGR A;  3GFK A;  3CSJ A;  1A2J A;  1PD2 1;  1YF0 A;  1BYE A;  3FR3 A;  4JZQ A;  3C7M A;  3GNJ A;  4OFT A;  5GST A;  2IMD A;  1B9Y C;  4I97 A;  2GLR A;  4RI7 A;  5E59 A;  2CAI A;  1Z7P A;  2GST A;  4TOP A;  1JLW A;  5ELG A;  2ZNM A;  4EDY A;  2TIR A;  4AJ7 A;  4I2U A;  3P7X A;  4V2M A;  3LOR A;  2LRC A;  1DE1 A;  1PL1 A;  2H71 A;  4TXV A;  6GST A;  1C72 A;  1AC1 A;  2CA8 A;  1U3I A;  4N0Z A;  1PFO A;  4AJ6 A;  2CV4 A;  2DJ1 A;  3OR5 A;  3LW9 A;  4TR1 A;  3M1G A;  3UAR A;  4QL7 A;  3ZVJ A;  2HZF A;  4IS0 A;  4TXO A;  3KGK A;  5HR3 A;  5CYY A;  1GL8 A;  3IC4 A;  4HZ4 A;  1K0C A;  1EP8 A;  3GKX A;  3HJM A;  3IOS A;  22GS A;  1Z5Y E;  1OC8 A;  2DIZ A;  5AGY A;  4MF5 A;  1PQN A;  2KOK A;  1GSY A;  3ME8 A;  1PX6 A;  4OCF A;  1R5A A;  4GQF A;  4KCA A;  3U6V A;  2WS2 A;  5IMV A;  1DUG A;  3E3E A;  4EO3 A;  5DJL A;  2H66 A;  4YKF A;  1YKA A;  2X8C A;  4FYU A;  2H1D A;  4MP4 A;  5D9T A;  3CRU A;  1V57 A;  4CHS A;  1ZYP A;  2YWM A;  1S3C A;  1SJ6 A;  3QAW A;  1FW1 A;  4YQM A;  3TJF A;  4F9Z A;  1G7O A;  3MNG A;  3ZVJ D;  3DXB A;  3IAM 2;  1SYX A;  5AIX A;  2VL3 A;  3WGE A;  4HU9 A;  1JHB A;  4USS A;  3W8J A;  1SL1 B;  4KE3 A;  4ECJ A;  1X9W B;  2ZCT A;  4MJB A;  5LD0 A;  2RUE A;  4N10 A;  5CO3 A;  2WB9 A;  2H1A A;  3VPQ A;  3LFL A;  5FHI A;  1N8J A;  1ERT A;  1SK2 A;  5GAN D;  4DSS A;  3PIN A;  2JSY A;  1O8W A;  1R5P A;  4K0G A;  1RQM A;  3TUE A;  4XS4 B;  1WPI A;  2LUS A;  1H75 A;  2OBK A;  3CSI A;  2F8A A;  3LQ7 A;  3IHG A;  2HI7 A;  2NTO A;  5DVB A;  1W89 A;  3RPP A;  1RK4 A;  4BWQ A;  1UN2 A;  2E0Q A;  2VM2 A;  4G10 A;  1T4Y A;  3FZ5 A;  3TKS A;  3MWH A;  1XG8 A;  3H93 A;  3TDG A;  1YJ6 A;  3ME7 A;  4OD7 A;  3EVI A;  5DAK A;  3LYP A;  2LTK A;  3WT1 A;  1K0B A;  4WR4 A;  2RUF A;  2LQO A;  3U5R E;  5KN2 A;  4NMU A;  3IC8 A;  1QUW A;  4KX4 A;  2R0G A;  4WBR D;  2A2R A;  1V40 A;  2GGT A;  2LEG A;  1TW9 A;  2DJJ A;  1URM A;  3EMX A;  1GSE A;  4KDU A;  1R4W A;  3L9V A;  3EUR A;  4Q5N A;  6GSY A;  2DKH A;  4ZBB A;  4ECC A;  2CAQ A;  2HXK A;  1NHO A;  1OAZ A;  4KCE A;  1SL2 B;  4LMW A;  3CYN A;  2DJ3 A;  5IIZ A;  3TGZ A;  2YWI A;  2VOC A;  4AGS A;  3C1S A;  2VCX A;  1YDK A;  2H0G A;  4KDY A;  4BA7 A;  12GS A;  4IQ1 A;  1N2A A;  3LG6 A;  1XFL A;  2G2Q A;  4CW9 A;  4P3Y B;  1NHY A;  1VF4 A;  1TU8 A;  4OO4 A;  4PUF C;  3FEU A;  1XBS A;  4IEL A;  1OC9 A;  2XBQ A;  1K3Y A;  4N30 A;  1ZCP A;  4V2N A;  3H79 A;  2FWG A;  4EUY A;  4K2X A;  2V6O A;  2MYG A;  2VCT A;  2FHE A;  4ECB A;  3JCM L;  4IP1 A;  3L4N A;  4PQI A;  3L9S A;  4GTU A;  5D73 A;  1GLQ A;  2K6V A;  4POM A;  1TRV A;  1K0M A;  3P8W A;  2EIQ A;  3KH9 A;  4V1A p;  3A2W A;  4F2I A;  1EP7 A;  2R6K A;  4EIP A;  1GNE A;  6GSS A;  1XVW A;  5H5Q A;  2L6D A;  3LJR A;  3NOF A;  4Z2U A;  4JBB A;  4WBJ A;  1GH2 A;  4XHM A;  4NAX A;  1GSQ A;  3LXT A;  1Y6E A;  3F4R A;  3D6I A;  1QGV A;  4HS1 A;  3GIX A;  3QPM A;  5J4U A;  2DIY A;  1AQW A;  1ERW A;  4K7I A;  5A4W A;  3DWV A;  1PKW A;  6GSW A;  3CXG A;  1TKD B;  4PUA A;  1ERV A;  4PQ1 A;  1X9S B;  3FYG A;  5FWG A;  3GRX A;  1TU7 A;  2PBJ A;  3FW2 A;  2LKU A;  4MA9 A;  4KH7 A;  1MEK A;  4QL9 A;  5G31 A;  4WF5 A;  4BVY B;  3HYP A;  3WGX A;  5B7C A;  3M0F A;  2R37 A;  4KSM A;  11GS A;  3IDV A;  3IK7 A;  1TRW A;  1YQ1 A;  2WZ9 A;  3CRT A;  2N5B A;  2P31 A;  4PGT A;  2H70 A;  2C4J A;  1THX A;  5ELA A;  1EOG A;  1EOH A;  4FYB A;  2H75 A;  2BMX A;  5E4W A;  3VWU A;  4HJ2 A;  1GTB A;  2DJK A;  5LCZ A;  2C0F A;  5D96 A;  1W4V A;  3KTB A;  1K0O A;  2O89 A;  2DMM A;  5HR1 A;  4AJ8 A;  2MBT A;  5J5N A;  3D22 A;  1Z7R A;  2X8G A;  3HZ4 A;  2QSI A;  1ON4 A;  13GS A;  2NPB A;  2DSA A;  3GKK A;  3EE2 A;  3R2Q A;  2CX3 A;  1XW6 A;  1EV9 A;  2GQL A;  1TRS A;  1T1V A;  2DKI A;  3FR6 A;  4K5S A;  3VFI A;  1ZYE A;  3DRN A;  2X8H A;  4G0K A;  1NM3 A;  4MZW A;  1A0F A;  4YH2 A;  4G0I A;  4EDZ A;  1YKC A;  3BD2 A;  4D73 B;  3C71 A;  3QOU A;  5J3R A;  5IOX A;  1J08 A;  4MJA A;  2VCQ A;  2A2P A;  4DEJ A;  5DCH A;  4K0N A;  2CVK A;  2LRT A;  2LNS A;  1Q98 A;  1Q4J A;  2FCH A;  1X5C A;  1V9W A;  5L71 A;  2XHF A;  1K3L A;  2VAF A;  2GSS A;  4ZIJ A;  2A4H A;  4ZBA A;  4DSQ A;  2WFC A;  2H8L A;  4DSR A;  4Z2T A;  5DQY A;  2C0G A;  1O6J A;  3FZ9 A;  2HT9 A;  4I8B A;  1KEB A;  3GST A;  3HKR A;  3EC3 A;  1OKD A;  2B1L A;  5D9W A;  1F9M A;  2YJH A;  4EVM A;  3F4S A;  2Z9S A;  3HZ8 A;  2FUG 2;  3TRX A;  2ON5 A;  2RM5 A;  3GL3 A;  1A8L A;  2PPT A;  3GMF A;  2HYX A;  1USB A;  3EPT A;  4OFN A;  5G1L A;  3HJP A;  4GLT A;  1X5D A;  3CBU A;  4PNF A;  2FGX A;  4MF6 A;  2N5A A;  4O32 A;  2VLT A;  4MPF A;  2C80 A;  1HQO A;  4LMV A;  4ID0 A;  1JZW A;  2GSQ A;  3KH7 A;  5B6M A;  3A5W A;  2H6Y A;  2IME A;  1SKW B;  2E2M A;  2KP1 A;  6GSX A;  2JZS A;  1UVZ A;  1ZMA A;  5BRT A;  3S9F A;  2YCD A;  1V58 A;  4RQR A;  2L4C A;  3ERG A;  2JL4 A;  2IFQ A;  4JRR A;  4X0X A;  4EE0 A;  4HJM A;  5A4U A;  2AUV A;  1B4P A;  4XRD A;  2E7P A;  4YAP A;  4TRX A;  4ZB8 A;  4MLY A;  5D9V A;  1XXU A;  1XCC A;  3ZIT A;  5ECM B;  4TR4 A;  4MDC A;  2CT6 A;  3GL5 A;  2RII A;  1FVK A;  1HD2 A;  2WDU A;  1YEX A;  3UVT A;  3LYK A;  3J7Y k;  3KP8 A;  3M8N A;  5IMC A;  1UC7 A;  3KEB A;  5B8A A;  3ISO A;  1TI3 A;  3RHC A;  4HUA A;  2C0D A;  3ZYW A;  3F3R A;  5G5F A;  3DKS A;  3G7Y A;  2FNO A;  2IL3 A;  3M9K A;  1BQ7 A;  3UAP A;  3TJB A;  1ILO A;  1XWA A;  4BPY A;  2CVB A;  4K7O A;  4ICY A;  4YAV A;  4O5Q A;  3TJK A;  4NV2 A;  2V6K A;  5ID2 B;  4KUN A;  3A5I A;  4MZB A;  1V98 A;  3KM6 A;  3DVW A;  1I9D A;  3VPT A;  1PGT A;  2H30 A;  3IE3 A;  5DJM A;  1WRY A;  1ZYQ B;  4KB3 A;  2WCI A;  4LL1 B;  3QAG A;  2GT5 A;  1SK0 A;  1XWG A;  1OKT A;  1DBY A;  5ECR B;  1XW5 A;  1EGO A;  2X64 A;  2P5Q A;  1T3B A;  2YNX A;  1FB6 A;  2F3M A;  1ML6 A;  2B6M A;  2K18 A;  3FZA A;  4IQA A;  1HYU A;  4NV5 A;  3BOA A;  3CTF A;  2PU9 C;  2B3S A;  4I6X A;  1X5E A;  2YZH A;  1GTU A;  2CZ2 A;  1A2M A;  4MZC A;  2V1M A;  3ZRE A;  4QQ7 A;  4KF9 A;  5CNW A;  2P5R A;  2VO4 A;  3UL3 A;  3TOU A;  1WP0 A;  2OE0 A;  2OBI A;  3ERW A;  2VL2 C;  1XVQ A;  3IR4 A;  2CX4 A;  2RLI A;  5KEJ A;  3HVX A;  4IBP A;  2QGV A;  5LNK e;  3BCI A;  1G6Y A;  5HR2 A;  1FO5 A;  4ZL8 A;  4Z2R A;  1FAA A;  3G9B A;  3QD9 A;  3NZN A;  1FB0 A;  1LBK A;  2FWH A;  4EF0 A;  5JWR B;  4D73 A;  2DML A;  4FH8 A;  5EVO A;  3N5O A;  3QDN A;  1OE7 A;  16GS A;  3EWL A;  2VLU A;  4PX1 A;  3FZ4 A;  1A24 A;  3TRQ A;  3KMN A;  4ZL7 A;  4Q5F A;  4YKG A;  2HRK A;  4Z7X A;  3VWX A;  2PVQ A;  5DAL A;  3RAZ A;  5D93 A;  1M9A A;  3D4T A;  2OE3 A;  3L78 A;  5DBQ A;  2PWJ A;  2JAD A;  2X99 A;  5HFK A;  2A4V A;  3A3T A;  5KN0 A;  3BCK A;  2VD1 A;  5IO2 A;  2B7J A;  3GA4 A;  1Z9H A;  5G2Z A;  2I81 A;  2BJX A;  2C8U A;  3C8E A;  5JCW A;  3Q74 A;  4PQH A;  4GSS A;  4PTS A;  2I4A A;  1EWX A;  1R26 A;  2MMA A;  5IOW A;  3VK9 A;  2V2G A;  1UA5 A;  3VWW A;  5IPH A;  1SK1 A;  1M9B A;  1AQX A;  1GUH A;  5A5K A;  5JCU A;  1F3B A;  2IWT A;  2L5O A;  3ZML A;  2R0P A;  3MAK A;  2L4Q A;  2YWO A;  2VD0 A;  2R0C A;  3LGC A;  3IPZ A;  3KXO A;  2HZE B;  1B8X A;  3LWA A;  1H4O A;  5CRG A;  3F3Q A;  4V1A g;  5FT3 A;  5GZZ B;  4L8E A;  2L59 A;  19GS A;  1S3R A;  3SBC A;  4OFM A;  5AN1 A;  9GSS A;  1GTI A;  1THO A;  4PUR A;  4NXI A;  4TN8 A;  4PNG A;  1JZO A;  2HLS A;  4BL7 B;  1XIY A;  4GXZ A;  4IVF A;  2C0E A;  3EU3 A;  4FYC A;  4G9H A;  3GUS A;  1KTE A;  2KLX A;  4O7H A;  1SD9 A;  5DQS A;  2QA1 A;  1JLV A;  2MMN A;  20GS A;  1GSS A;  3TB2 A;  1HNC A;  1AW9 A;  3CQF A;  1JFU A;  5AIS A;  2QKE A;  4XCS A;  4ML6 A;  3QR6 A;  2M80 A;  1TJD A;  4K5R A;  5BMU A;  4GRF A;  1CQG A;  1J0F A;  2PUK C;  2FA4 A;  1Z6N A;  1WWJ A;  3TKP A;  5CRE A;  1IYI A;  1X9M B;  1YY7 A;  4HSC X;  2WUL A;  1OYJ A;  4WKW A;  1B9X C;  1V2A A;  5JWO B;  2HRA A;  1NSW A;  4K1F A;  2HE3 A;  3IXR A;  1PRX A;  2LJA A;  3VWV A;  3WYW A;  4TR1 B;  4IW9 A;  2WJU A;  1BX9 A;  1VRS D;  3VLN A;  3LSZ A;  2HSY A;  1XW9 A;  1TXX A;  1SEN A;  3FHK A;  5CRW A;  1FVJ A;  5C00 A;  1GWC A;  3UOM A;  3APQ A;  2P0G A;  3VUR A;  2F51 A;  4L0W A;  3O6T A;  4ZXG A;  2B1K A;  14GS A;  4XS1 A;  4WF4 A;  3FY7 A;  3PR8 A;  1XWK A;  1E6B A;  1U6T A;  2H0H A;  2QA2 A;  3GV1 A;  1TDI A;  2QC7 A;  3CTG A;  5J9C A;  4H86 A;  4A5P A;  4KSO A;  3US3 A;  5GSS A;  5CP1 A;  1FOV A;  2JAC A;  2VUP A;  3ZFB A;  1DSB A;  2ON7 A;  1TRU A;  2OE1 A;  2VL9 A;  1M99 A;  4RQX A;  4LL4 B;  3KTL A;  3GN3 A;  3QAV A;  3APO A;  1NW2 A;  4J2F A;  4KGI A;  1QMV A;  3UEM A;  1M2B A;  10GS A;  2AAW A;  3ZLP A;  1AUC A;  2R2J A;  3Q19 A;  5IMF A;  3H8Q A;  4YQU A;  4DSS B;  1G7E A;  3H1N A;  2MZC A;  4TW5 A;  4XS4 A;  1QQ2 A;  4JR4 A;  3LEF A;  2G0F A;  5KOX A;  5AIV A;  1WIK A;  4ZBD A;  2AV4 A;  2YP6 A;  3RBT A;  2YOI A;  3IHQ A;  1J9B A;  3ZRD A;  4IGJ A;  2H74 A;  3IK9 A;  2GDR A;  2H73 A;  1F37 A;  2C3Q A;  4X4J A;  5HFI A;  4LLR A;  5ECL B;  3I6A A;  3QFB C;  3UIW A;  4MF7 A;  3WT2 A;  1TOF A;  2CZ3 A;  4MJC A;  2H1B A;  3TJG A;  2A2S A;  5DAK B;  3GX0 A;  2O8V B;  4K9Z A;  1Z3E A;  4ISD A;  4ZIL A;  2CQ9 A;  1FOH A;  1EEM A;  1AXD A;  1SYR A;  1XOA A;  3HY2 A;  1O73 A;  5G30 A;  5B6N A;  2IN3 A;  2GZP A;  2LRN A;  2HNL A;  1T00 A;  1PL2 A;  4K6X A;  4XS6 A;  5JCG A;  1Z6M A;  5EL8 A;  3PH9 A;  1XPV A;  3IBH A;  2VL2 A;  3GUR A;  1HNB A;  1S3A A;  2R4V A;  3PPU A;  1AQV A;  1X0R A;  2DBC A;  5ECS A;  4POK A;  2C3T A;  2FD3 A;  1F3A A;  2L6C A;  5ABR A;  4FIW A;  1YZX A;  3FMW A;  2IIY A;  1I5G A;  4ML1 A;  5A4V A;  3I9V 2;  5HFG A;  3HD5 A;  2NVL A;  3HVS A;  3GKM A;  3O3T A;  3ED3 A;  5KOW A;  3BBY A;  3CSH A;  3F6F A;  3IV4 A;  4E8H A;  4DVC A;  1F6M C;  1GLP A;  1Y25 A;  2JZR A;  4V2L A;  1MD3 A;  2K9F A;  2GZY A;  17GS A;  1A8Y A;  4BWS A;  2WGR A;  3EMP A;  4N0V A;  4ULX A;  3DVX A;  2L57 A;  1B48 A;  2EIR A;  1OC9 B;  1XWB A;  3A2X A;  3K8N A;  4F0C A;  3VI7 A;  1LU4 A;  2I1U A;  5ECI B;  2E2G A;  4BL7 A;  3MDK A;  4YQV A;  1BJX A;  1G0T A;  3SWL A;  4K2D A;  1PX7 A;  6GSV A;  3GH6 A;  2FY6 A;  2J23 A;  3FK8 A;  2C3N A;  4ZB6 A;  5ECN B;  2BTO T;  3DML A;  1U3A A;  1RW1 A;  2I3Y A;  4E8E A;  1WOU A;  4KAE A;  4CY6 A;  4XTS A;  3GKN A;  2XC2 A;  3KMO A;  2MMO A;  4CDO A;  3TOT A;  5HQP A;  4TVE A;  5D9X A;  4IN0 A;  2GTU A;  5G1K A;  2OKA A;  4IJ3 A;  3VI5 A;  2MMZ A;  2M46 A;  3GH9 A;  5HR0 A;  4GST A;  5F05 A;  6GSU A;  3IAS 2;  2VLV A;  1XWC A;  4HZ2 A;  4JED A;  1T8E B;  4POB A;  4O5U A;  2YAN A;  3W6G A;  2ZUP A;  4ZB9 A;  1BAY A;  5CRD A;  2TRX A;  4WEY A;  5J41 A;  2YV7 A;  4RUV A;  2YJ7 A;  3QFA C;  2M72 A;  1QK8 A;  1WE0 A;  4G2E A;  1S3D A;  4F03 A;  4BVY A;  2OAD A;  2K8S A;  4L5L A;  2DLX A;  2UZ8 A;  4NHZ A;  1XZO A;  2OJL A;  1HNA A;  2PVO C;  5CRH A;  5IMD A;  2F8F A;  1M2A A;  3MSZ A;  4KND A;  4OO5 A;  4AF2 A;  3M9J A;  5B8B A;  4CY8 A;  3KIJ A;  2HSH A;  2R3X A;  1PKZ A;  1EEJ A;  1ZL9 A;  3HCZ A;  3L0H A;  1SKS B;  2H01 A;  4WR5 A;  1MDJ A;  1A0R P;  4NPB A;  3DYR A;  3ZZX A;  2XPD A;  3PGT A;  3KCM A;  3E0U A;  5D8I A;  1SU9 A;  2L5L A;  2V41 A;  1KBN A;  5F0G A;  4GWR A;  1YF1 A;  4OWY A;  3E9J B;  2FLS A;  2FWF A;  2H19 A;  5KN3 A;  1SJI A;  4IHU A;  2YPM A;  4F0B A;  3GTU B;  1B4Q A;  5DDL A;  3I69 A;  4Q5Q A;  4GSN A;  5ECK B;  2PN8 A;  5F07 A;  4PXO A;  5KN1 A;  1SJZ A;  1JZR A;  1PN0 A;  2IJY A;  3MYD A;  4TKY A;  1ZZY A;  3D5J A;  2AJQ B;  4FQU A;  5F06 A;  1K0D A;  3GHA A;  3NIV A;  3O76 A;  1TK5 B;  4Q5R A;  1EZK A;  3ERF A;  3GX8 A;  2I9H A;  3HVV A;  2H72 A;  2KUC A;  2JSZ A;  4EIQ A;  4J57 E;  1DE2 A;  4MH2 A;  2LQQ A;  1GNW A;  1MD4 A;  4GF0 A;  4BVX B;  3DD3 A;  1U87 A;  2MBS A;  2AB6 A;  3HXS A;  3HJO A;  3IA1 A;  1AIU A;  1ZGN A;  3ZTL A;  3TKS E;  4O92 A;  2OA7 A;  1ABA A;  3F63 A;  1F2E A;  5G5E A;  3HA9 A;  2VM1 A;  2VCZ A;  2JZT A;  3ZIV A;  3TRP A;  5IMZ A;  4MAB A;  3FKF A;  2GQM A;  4GQC A;  1TK0 B;  1T4Z A;  3ZL5 A;  5ECH B;  4ACS A;  4HQS A;  2ALB A;  2NDO A;  4KA0 A;  1MTC A;  4HDE A;  2OAC A;  2PER A;  2FWE A;  3HVN A;  4F82 A;  2B5Y A;  2PGT A;  2K8V A;  5ECQ B;  1OC3 A;  2YZU A;  1TP9 A;  2H76 A;  1M0U A;  1ZYN A;  3AY8 A;  2HSM A;  4BIK A;  4ILF A;  3UMA A;  4LA1 A;  1GUL A;  4HOJ A;  2KHP A;  3D0Z A;  5H5S A;  3HDC A;  3UBK A;  3CMI A;  1BED A;  4MPG A;  5ENU A;  1K0N A;  1FG4 A;  2XPE A;  3D21 A;  3HHV A;  1SL0 B;  1OE8 A;  2GSR A;  3QCP A;  3WGD A;  2X4A A;  2IFQ B;  3QMX A;  3W8S A;  2DJ0 A;  2X49 A;  1M2D A;  2DJ2 A;  2GQK A;  2O87 A;  3G7J A;  3F0I A;  3TJJ A;  1TK8 B;  1O7U A;  1PSQ A;  3FRC A;  1E2Y A;  4OMV A;  2PMT A;  3KZQ A;  3TKR A;  3C1R A;  4MK3 A;  5C04 A;  2YWN A;  4XRA A;  1O8X A;  4HEA 2;  3Q6O A;  2GVP A;  3Q18 A;  5F8B A;  3ZMK A;  3D4M A;  3UVH A;  1M3J A;  2GT6 A;  3KP9 A;  4KDX A;  5EY6 A;  3WD6 A;  4HI7 A;  3N9J A;  4WET A;  4L0U A;  2ES7 A;  2VCV A;  3F4T A;  2NBS A;  4XIH A;  4TXO B;  4I5Q A;  1MDK A;  3M3M A;  4L5O A;  3R3E A;  4JU5 A;  4MJE A;  4K7N A;  2N5F A;  2H0I A;  2H1G A;  4FO5 A;  3P2A A;  3ZIJ A;  3UJ1 A;  1FHE A;  2IMK A;  4POL A;  4TR3 A;  2VIM A;  1PN9 A;  8GSS A;  4G0L A;  5ID2 A;  4X43 A;  4GCI A;  2JU5 A;  1SD8 A;  5ECP B;  3EIN A;  3L9U A;  3G7I A;  2C1Y A;  1SKR B;  2VCW A;  1GP1 A;  3GYK A;  1GRX A;  3GSS A;  2H6X A;  4N11 A;  1VF1 A;  3TKQ A;  3MIX A;  3TKS C;  2AHE A;  1VF3 A;  1OVN A;  3ZFL A;  3RDW A;  3LXZ A;  2H6Z A;  3H4K A;  1G6W A;  1O85 A;  4MCU A;  3DEX A;  4WXT A;  5DCG A;  1TTZ A;  4OCE A;  2B5E A;  1M7T A;  3I43 A;  1QFN A;  3P90 A;  2LS5 A;  3C73 A;  2FA8 A;  2GS3 A;  3KD0 A;  1U88 A;  1CQH A;  4IP6 A;  3KJY A;  2D2Z A;  1WJK A;  3BJ5 A;  2AYT A;  2LJR A;  1MDI A;  4J56 E;  2IPA A; 
#chains in the Genus database with same CATH homology
 4EL1 A;  2XBI A;  5INY A;  2GZZ A;  3DIE A;  1PA3 A;  3DGQ A;  4ECI A;  1A2L A;  4HU7 A;  4MNN A;  3V1W A;  1T7P B;  3GTU A;  5J9B A;  2EC4 A;  4MMM A;  2IMF A;  3F8U A;  4HQZ A;  3J7Y b;  1BG5 A;  1K3O A;  2LJK A;  3A2V A;  3RPN A;  4NHW A;  1VGL A;  1EV4 A;  5IO0 A;  5H5R A;  1R7H A;  1A23 A;  7GSS A;  1ST9 A;  5IM9 A;  4NWY A;  1QXH A;  1VF2 A;  2J9H A;  2LV3 A;  2V32 A;  3EYT A;  5GAP D;  4X1U A;  4JR6 A;  5JWQ B;  4BVX A;  1GSU A;  5IPG A;  4RI6 A;  1ACV A;  4IKH A;  5DAL B;  1JZD A;  1LJR A;  4IJI A;  3APS A;  5ECO B;  3RHB A;  2YV9 A;  2LST A;  2O85 A;  1IYH A;  3EU4 A;  1ERU A;  3FR9 A;  1K0A A;  1WMJ A;  1KNG A;  1PMT A;  2TRC P;  4KW6 A;  1GTA A;  4G19 A;  2EIO A;  2IMI A;  4TR0 A;  2HRN A;  4EC0 A;  2YN1 A;  2B7K A;  4O5R A;  5IMA A;  2O7K A;  3F6D A;  1ZOF A;  2REM A;  1GSD A;  4EXJ A;  4I2T A;  2KP2 A;  1TI1 A;  3F9U A;  18GS A;  4EKZ A;  2WRT A;  2HRF A;  2HZE A;  1GUM A;  1XOB A;  2F9S A;  1GSF A;  4ZL9 A;  4K8M A;  5COH A;  2B5X A;  4JE1 A;  3TCO A;  4MH3 A;  3IRA A;  2R5G A;  2HFD A;  1GUK A;  1YEP A;  2RM6 A;  2CVD A;  5IQY A;  3UBL A;  2LNT A;  5EPF A;  1O81 A;  2DC5 A;  5CAX A;  1AAZ A;  1EGR A;  3GFK A;  3CSJ A;  1A2J A;  1PD2 1;  1YF0 A;  1BYE A;  3FR3 A;  4JZQ A;  3C7M A;  3GNJ A;  4OFT A;  5GST A;  2IMD A;  1B9Y C;  4I97 A;  2GLR A;  4RI7 A;  5E59 A;  2CAI A;  1Z7P A;  2GST A;  4TOP A;  1JLW A;  5ELG A;  2ZNM A;  4EDY A;  2TIR A;  4AJ7 A;  4I2U A;  3P7X A;  4V2M A;  3LOR A;  2LRC A;  1DE1 A;  1PL1 A;  2H71 A;  4TXV A;  6GST A;  1C72 A;  1AC1 A;  2CA8 A;  1U3I A;  4N0Z A;  4AJ6 A;  2CV4 A;  2DJ1 A;  3OR5 A;  3LW9 A;  4TR1 A;  3M1G A;  3UAR A;  4QL7 A;  3ZVJ A;  2HZF A;  4IS0 A;  4TXO A;  3KGK A;  5HR3 A;  5CYY A;  1GL8 A;  3IC4 A;  4HZ4 A;  1K0C A;  1EP8 A;  3GKX A;  3HJM A;  3IOS A;  22GS A;  1Z5Y E;  1OC8 A;  2DIZ A;  5AGY A;  4MF5 A;  1PQN A;  2KOK A;  1GSY A;  3ME8 A;  1PX6 A;  4OCF A;  1R5A A;  4GQF A;  4KCA A;  3U6V A;  2WS2 A;  5IMV A;  1DUG A;  3E3E A;  4EO3 A;  5DJL A;  2H66 A;  4YKF A;  1YKA A;  2X8C A;  4FYU A;  2H1D A;  4MP4 A;  5D9T A;  3CRU A;  1V57 A;  4CHS A;  1ZYP A;  2YWM A;  1S3C A;  1SJ6 A;  3QAW A;  1FW1 A;  4YQM A;  3TJF A;  4F9Z A;  1G7O A;  3MNG A;  3ZVJ D;  3DXB A;  3IAM 2;  1SYX A;  5AIX A;  2VL3 A;  3WGE A;  4HU9 A;  1JHB A;  4USS A;  3W8J A;  1SL1 B;  4KE3 A;  4ECJ A;  1X9W B;  2ZCT A;  4MJB A;  5LD0 A;  2RUE A;  4N10 A;  5CO3 A;  2WB9 A;  2H1A A;  3VPQ A;  3LFL A;  5FHI A;  1N8J A;  1ERT A;  1SK2 A;  5GAN D;  4DSS A;  3PIN A;  2JSY A;  1O8W A;  1R5P A;  4K0G A;  1RQM A;  3TUE A;  4XS4 B;  1WPI A;  2LUS A;  1H75 A;  2OBK A;  3CSI A;  2F8A A;  3LQ7 A;  3IHG A;  2HI7 A;  2NTO A;  5DVB A;  1W89 A;  3RPP A;  1RK4 A;  4BWQ A;  1UN2 A;  2E0Q A;  2VM2 A;  4G10 A;  1T4Y A;  3FZ5 A;  3TKS A;  3MWH A;  3H93 A;  3TDG A;  1YJ6 A;  3ME7 A;  4OD7 A;  3EVI A;  5DAK A;  3LYP A;  2LTK A;  3WT1 A;  1K0B A;  4WR4 A;  2RUF A;  2LQO A;  3U5R E;  5KN2 A;  4NMU A;  3IC8 A;  1QUW A;  4KX4 A;  2R0G A;  4WBR D;  2A2R A;  1V40 A;  2GGT A;  2LEG A;  1TW9 A;  2DJJ A;  1URM A;  3EMX A;  1GSE A;  4KDU A;  1R4W A;  3L9V A;  3EUR A;  4Q5N A;  6GSY A;  2DKH A;  4ZBB A;  4ECC A;  2CAQ A;  2HXK A;  1NHO A;  1OAZ A;  4KCE A;  1SL2 B;  4LMW A;  3CYN A;  2DJ3 A;  5IIZ A;  3TGZ A;  2YWI A;  2VOC A;  4AGS A;  3C1S A;  2VCX A;  1YDK A;  2H0G A;  4KDY A;  4BA7 A;  12GS A;  4IQ1 A;  1N2A A;  3LG6 A;  1XFL A;  2G2Q A;  4CW9 A;  4P3Y B;  1NHY A;  1VF4 A;  1TU8 A;  4OO4 A;  4PUF C;  3FEU A;  1XBS A;  4IEL A;  1OC9 A;  2XBQ A;  1K3Y A;  4N30 A;  1ZCP A;  4V2N A;  3H79 A;  2FWG A;  4EUY A;  4K2X A;  2V6O A;  2MYG A;  2VCT A;  2FHE A;  4ECB A;  3JCM L;  4IP1 A;  3L4N A;  4PQI A;  3L9S A;  4GTU A;  5D73 A;  1GLQ A;  2K6V A;  4POM A;  1TRV A;  1K0M A;  3P8W A;  2EIQ A;  3KH9 A;  4V1A p;  3A2W A;  4F2I A;  1EP7 A;  2R6K A;  4EIP A;  1GNE A;  6GSS A;  1XVW A;  5H5Q A;  2L6D A;  3LJR A;  3NOF A;  4Z2U A;  4JBB A;  4WBJ A;  1GH2 A;  4XHM A;  4NAX A;  1GSQ A;  3LXT A;  1Y6E A;  3F4R A;  3D6I A;  1QGV A;  4HS1 A;  3GIX A;  3QPM A;  5J4U A;  2DIY A;  1AQW A;  1ERW A;  4K7I A;  5A4W A;  3DWV A;  1PKW A;  6GSW A;  3CXG A;  1TKD B;  4PUA A;  1ERV A;  4PQ1 A;  1X9S B;  3FYG A;  5FWG A;  3GRX A;  1TU7 A;  2PBJ A;  3FW2 A;  2LKU A;  4MA9 A;  4KH7 A;  1MEK A;  4QL9 A;  5G31 A;  4WF5 A;  4BVY B;  3HYP A;  3WGX A;  5B7C A;  3M0F A;  2R37 A;  4KSM A;  11GS A;  3IDV A;  3IK7 A;  1TRW A;  1YQ1 A;  2WZ9 A;  3CRT A;  2N5B A;  2P31 A;  4PGT A;  2H70 A;  2C4J A;  1THX A;  5ELA A;  1EOG A;  1EOH A;  4FYB A;  2H75 A;  2BMX A;  5E4W A;  3VWU A;  4HJ2 A;  1GTB A;  2DJK A;  5LCZ A;  2C0F A;  5D96 A;  1W4V A;  3KTB A;  1K0O A;  2O89 A;  2DMM A;  5HR1 A;  4AJ8 A;  2MBT A;  5J5N A;  3D22 A;  1Z7R A;  2X8G A;  3HZ4 A;  2QSI A;  1ON4 A;  13GS A;  2NPB A;  2DSA A;  3GKK A;  3EE2 A;  3R2Q A;  2CX3 A;  1XW6 A;  1EV9 A;  2GQL A;  1TRS A;  1T1V A;  2DKI A;  3FR6 A;  4K5S A;  3VFI A;  1ZYE A;  3DRN A;  2X8H A;  4G0K A;  1NM3 A;  4MZW A;  1A0F A;  4YH2 A;  4G0I A;  4EDZ A;  1YKC A;  3BD2 A;  4D73 B;  3C71 A;  3QOU A;  5J3R A;  5IOX A;  1J08 A;  4MJA A;  2VCQ A;  2A2P A;  4DEJ A;  5DCH A;  4K0N A;  2CVK A;  2LRT A;  2LNS A;  1Q98 A;  1Q4J A;  2FCH A;  1X5C A;  1V9W A;  5L71 A;  2XHF A;  1K3L A;  2VAF A;  2GSS A;  4ZIJ A;  2A4H A;  4ZBA A;  4DSQ A;  2WFC A;  2H8L A;  4DSR A;  4Z2T A;  5DQY A;  2C0G A;  1O6J A;  3FZ9 A;  2HT9 A;  4I8B A;  1KEB A;  3GST A;  3HKR A;  3EC3 A;  1OKD A;  2B1L A;  5D9W A;  1F9M A;  2YJH A;  4EVM A;  3F4S A;  2Z9S A;  3HZ8 A;  2FUG 2;  3TRX A;  2ON5 A;  2RM5 A;  3GL3 A;  1A8L A;  2PPT A;  3GMF A;  2HYX A;  1USB A;  3EPT A;  4OFN A;  5G1L A;  3HJP A;  4GLT A;  1X5D A;  3CBU A;  4PNF A;  2FGX A;  4MF6 A;  2N5A A;  4O32 A;  2VLT A;  4MPF A;  2C80 A;  1HQO A;  4LMV A;  4ID0 A;  1JZW A;  2GSQ A;  3KH7 A;  5B6M A;  3A5W A;  2H6Y A;  2IME A;  1SKW B;  2E2M A;  2KP1 A;  6GSX A;  2JZS A;  1UVZ A;  1ZMA A;  5BRT A;  3S9F A;  2YCD A;  1V58 A;  4RQR A;  2L4C A;  3ERG A;  2JL4 A;  2IFQ A;  4JRR A;  4X0X A;  4EE0 A;  4HJM A;  5A4U A;  2AUV A;  1B4P A;  4XRD A;  2E7P A;  4YAP A;  4TRX A;  4ZB8 A;  4MLY A;  5D9V A;  1XXU A;  1XCC A;  3ZIT A;  5ECM B;  4TR4 A;  4MDC A;  2CT6 A;  3GL5 A;  2RII A;  1FVK A;  1HD2 A;  2WDU A;  1YEX A;  3UVT A;  3LYK A;  3J7Y k;  3KP8 A;  3M8N A;  5IMC A;  1UC7 A;  3KEB A;  5B8A A;  3ISO A;  1TI3 A;  3RHC A;  4HUA A;  2C0D A;  3ZYW A;  3F3R A;  5G5F A;  3DKS A;  3G7Y A;  2FNO A;  2IL3 A;  3M9K A;  1BQ7 A;  3UAP A;  3TJB A;  1ILO A;  1XWA A;  4BPY A;  2CVB A;  4K7O A;  4ICY A;  4YAV A;  4O5Q A;  3TJK A;  4NV2 A;  2V6K A;  5ID2 B;  4KUN A;  3A5I A;  4MZB A;  1V98 A;  3KM6 A;  3DVW A;  1I9D A;  3VPT A;  1PGT A;  2H30 A;  3IE3 A;  5DJM A;  1WRY A;  1ZYQ B;  4KB3 A;  2WCI A;  4LL1 B;  3QAG A;  2GT5 A;  1SK0 A;  1XWG A;  1OKT A;  1DBY A;  5ECR B;  1XW5 A;  1EGO A;  2X64 A;  2P5Q A;  1T3B A;  2YNX A;  1FB6 A;  2F3M A;  1ML6 A;  2B6M A;  2K18 A;  3FZA A;  4IQA A;  1HYU A;  4NV5 A;  3BOA A;  3CTF A;  2PU9 C;  2B3S A;  4I6X A;  1X5E A;  2YZH A;  1GTU A;  2CZ2 A;  1A2M A;  4MZC A;  2V1M A;  3ZRE A;  4QQ7 A;  4KF9 A;  5CNW A;  2P5R A;  2VO4 A;  3UL3 A;  3TOU A;  1WP0 A;  2OE0 A;  2OBI A;  3ERW A;  2VL2 C;  1XVQ A;  3IR4 A;  2CX4 A;  2RLI A;  5KEJ A;  3HVX A;  4IBP A;  2QGV A;  5LNK e;  3BCI A;  1G6Y A;  5HR2 A;  1FO5 A;  4ZL8 A;  4Z2R A;  1FAA A;  3G9B A;  3QD9 A;  3NZN A;  1FB0 A;  1LBK A;  2FWH A;  4EF0 A;  5JWR B;  4D73 A;  2DML A;  4FH8 A;  5EVO A;  3N5O A;  3QDN A;  1OE7 A;  16GS A;  3EWL A;  2VLU A;  4PX1 A;  3FZ4 A;  1A24 A;  3TRQ A;  3KMN A;  4ZL7 A;  4Q5F A;  4YKG A;  2HRK A;  4Z7X A;  3VWX A;  2PVQ A;  5DAL A;  3RAZ A;  5D93 A;  1M9A A;  3D4T A;  2OE3 A;  3L78 A;  5DBQ A;  2PWJ A;  2JAD A;  2X99 A;  5HFK A;  2A4V A;  3A3T A;  5KN0 A;  3BCK A;  2VD1 A;  5IO2 A;  2B7J A;  3GA4 A;  1Z9H A;  5G2Z A;  2I81 A;  2BJX A;  2C8U A;  3C8E A;  5JCW A;  3Q74 A;  4PQH A;  4GSS A;  4PTS A;  2I4A A;  1EWX A;  1R26 A;  2MMA A;  5IOW A;  3VK9 A;  2V2G A;  1UA5 A;  3VWW A;  5IPH A;  1SK1 A;  1M9B A;  1AQX A;  1GUH A;  5A5K A;  5JCU A;  1F3B A;  2IWT A;  2L5O A;  3ZML A;  2R0P A;  3MAK A;  2L4Q A;  2YWO A;  2VD0 A;  2R0C A;  3LGC A;  3IPZ A;  3KXO A;  2HZE B;  1B8X A;  3LWA A;  1H4O A;  5CRG A;  3F3Q A;  4V1A g;  5FT3 A;  5GZZ B;  4L8E A;  2L59 A;  19GS A;  3SBC A;  4OFM A;  5AN1 A;  9GSS A;  1GTI A;  1THO A;  4PUR A;  4NXI A;  4TN8 A;  4PNG A;  1JZO A;  2HLS A;  4BL7 B;  1XIY A;  4GXZ A;  4IVF A;  2C0E A;  3EU3 A;  4FYC A;  4G9H A;  3GUS A;  1KTE A;  2KLX A;  4O7H A;  1SD9 A;  5DQS A;  2QA1 A;  1JLV A;  2MMN A;  20GS A;  1GSS A;  3TB2 A;  1HNC A;  1AW9 A;  1JFU A;  5AIS A;  2QKE A;  4XCS A;  4ML6 A;  3QR6 A;  2M80 A;  1TJD A;  4K5R A;  5BMU A;  4GRF A;  1CQG A;  1J0F A;  2PUK C;  2FA4 A;  1Z6N A;  1WWJ A;  3TKP A;  5CRE A;  1IYI A;  1X9M B;  1YY7 A;  2WUL A;  1OYJ A;  4WKW A;  1B9X C;  1V2A A;  5JWO B;  2HRA A;  1NSW A;  4K1F A;  2HE3 A;  3IXR A;  1PRX A;  2LJA A;  3VWV A;  3WYW A;  4TR1 B;  4IW9 A;  2WJU A;  1BX9 A;  1VRS D;  3VLN A;  3LSZ A;  2HSY A;  1XW9 A;  1TXX A;  1SEN A;  3FHK A;  5CRW A;  1FVJ A;  5C00 A;  1GWC A;  3UOM A;  3APQ A;  2P0G A;  3VUR A;  2F51 A;  4L0W A;  3O6T A;  4ZXG A;  2B1K A;  14GS A;  4XS1 A;  4WF4 A;  3FY7 A;  3PR8 A;  1XWK A;  1E6B A;  1U6T A;  2H0H A;  2QA2 A;  3GV1 A;  1TDI A;  2QC7 A;  3CTG A;  5J9C A;  4H86 A;  4A5P A;  4KSO A;  3US3 A;  5GSS A;  5CP1 A;  1FOV A;  2JAC A;  2VUP A;  3ZFB A;  1DSB A;  2ON7 A;  1TRU A;  2OE1 A;  2VL9 A;  1M99 A;  4RQX A;  4LL4 B;  3KTL A;  3GN3 A;  3QAV A;  3APO A;  1NW2 A;  4J2F A;  4KGI A;  1QMV A;  3UEM A;  1M2B A;  10GS A;  2AAW A;  3ZLP A;  1AUC A;  2R2J A;  3Q19 A;  5IMF A;  3H8Q A;  4YQU A;  4DSS B;  1G7E A;  3H1N A;  2MZC A;  4TW5 A;  4XS4 A;  1QQ2 A;  4JR4 A;  3LEF A;  2G0F A;  5KOX A;  5AIV A;  1WIK A;  4ZBD A;  2AV4 A;  2YP6 A;  3RBT A;  2YOI A;  3IHQ A;  1J9B A;  3ZRD A;  4IGJ A;  2H74 A;  3IK9 A;  2GDR A;  2H73 A;  1F37 A;  2C3Q A;  4X4J A;  5HFI A;  4LLR A;  5ECL B;  3I6A A;  3QFB C;  3UIW A;  4MF7 A;  3WT2 A;  1TOF A;  2CZ3 A;  4MJC A;  2H1B A;  3TJG A;  2A2S A;  5DAK B;  3GX0 A;  2O8V B;  4K9Z A;  1Z3E A;  4ISD A;  4ZIL A;  2CQ9 A;  1FOH A;  1EEM A;  1AXD A;  1SYR A;  1XOA A;  3HY2 A;  1O73 A;  5G30 A;  5B6N A;  2IN3 A;  2GZP A;  2LRN A;  2HNL A;  1T00 A;  1PL2 A;  4K6X A;  4XS6 A;  5JCG A;  1Z6M A;  5EL8 A;  3PH9 A;  1XPV A;  3IBH A;  2VL2 A;  3GUR A;  1HNB A;  1S3A A;  2R4V A;  3PPU A;  1AQV A;  1X0R A;  2DBC A;  5ECS A;  4POK A;  2C3T A;  2FD3 A;  1F3A A;  2L6C A;  5ABR A;  4FIW A;  1YZX A;  3FMW A;  2IIY A;  1I5G A;  4ML1 A;  5A4V A;  3I9V 2;  5HFG A;  3HD5 A;  2NVL A;  3HVS A;  3GKM A;  3O3T A;  3ED3 A;  5KOW A;  3BBY A;  3CSH A;  3F6F A;  3IV4 A;  4E8H A;  4DVC A;  1F6M C;  1GLP A;  1Y25 A;  2JZR A;  4V2L A;  1MD3 A;  2K9F A;  2GZY A;  17GS A;  1A8Y A;  4BWS A;  2WGR A;  3EMP A;  4N0V A;  4ULX A;  3DVX A;  2L57 A;  1B48 A;  2EIR A;  1OC9 B;  1XWB A;  3A2X A;  3K8N A;  4F0C A;  3VI7 A;  1LU4 A;  2I1U A;  5ECI B;  2E2G A;  4BL7 A;  3MDK A;  4YQV A;  1BJX A;  1G0T A;  3SWL A;  4K2D A;  1PX7 A;  6GSV A;  3GH6 A;  2FY6 A;  2J23 A;  3FK8 A;  2C3N A;  4ZB6 A;  5ECN B;  2BTO T;  3DML A;  1U3A A;  1RW1 A;  2I3Y A;  4E8E A;  1WOU A;  4KAE A;  4CY6 A;  4XTS A;  3GKN A;  2XC2 A;  3KMO A;  2MMO A;  4CDO A;  3TOT A;  5HQP A;  4TVE A;  5D9X A;  4IN0 A;  2GTU A;  5G1K A;  2OKA A;  4IJ3 A;  3VI5 A;  2MMZ A;  2M46 A;  3GH9 A;  5HR0 A;  4GST A;  5F05 A;  6GSU A;  3IAS 2;  2VLV A;  1XWC A;  4HZ2 A;  4JED A;  1T8E B;  4POB A;  4O5U A;  2YAN A;  3W6G A;  2ZUP A;  4ZB9 A;  1BAY A;  5CRD A;  2TRX A;  4WEY A;  5J41 A;  2YV7 A;  4RUV A;  2YJ7 A;  3QFA C;  2M72 A;  1QK8 A;  1WE0 A;  4G2E A;  1S3D A;  4F03 A;  4BVY A;  2OAD A;  2K8S A;  4L5L A;  2DLX A;  2UZ8 A;  4NHZ A;  1XZO A;  2OJL A;  1HNA A;  2PVO C;  5CRH A;  5IMD A;  2F8F A;  1M2A A;  3MSZ A;  4KND A;  4OO5 A;  4AF2 A;  3M9J A;  5B8B A;  4CY8 A;  3KIJ A;  2HSH A;  2R3X A;  1PKZ A;  1EEJ A;  1ZL9 A;  3HCZ A;  3L0H A;  1SKS B;  2H01 A;  4WR5 A;  1MDJ A;  1A0R P;  4NPB A;  3DYR A;  3ZZX A;  2XPD A;  3PGT A;  3KCM A;  3E0U A;  5D8I A;  1SU9 A;  2L5L A;  2V41 A;  1KBN A;  5F0G A;  4GWR A;  1YF1 A;  4OWY A;  3E9J B;  2FLS A;  2FWF A;  2H19 A;  5KN3 A;  1SJI A;  4IHU A;  2YPM A;  4F0B A;  3GTU B;  1B4Q A;  5DDL A;  3I69 A;  4Q5Q A;  4GSN A;  5ECK B;  2PN8 A;  5F07 A;  4PXO A;  5KN1 A;  1SJZ A;  1JZR A;  1PN0 A;  2IJY A;  3MYD A;  4TKY A;  1ZZY A;  3D5J A;  2AJQ B;  4FQU A;  5F06 A;  1K0D A;  3GHA A;  3NIV A;  3O76 A;  1TK5 B;  4Q5R A;  1EZK A;  3ERF A;  3GX8 A;  2I9H A;  3HVV A;  2H72 A;  2KUC A;  2JSZ A;  4EIQ A;  4J57 E;  1DE2 A;  4MH2 A;  2LQQ A;  1GNW A;  1MD4 A;  4GF0 A;  4BVX B;  3DD3 A;  1U87 A;  2MBS A;  2AB6 A;  3HXS A;  3HJO A;  3IA1 A;  1AIU A;  1ZGN A;  3ZTL A;  3TKS E;  4O92 A;  2OA7 A;  1ABA A;  3F63 A;  1F2E A;  5G5E A;  3HA9 A;  2VM1 A;  2VCZ A;  2JZT A;  3ZIV A;  3TRP A;  5IMZ A;  4MAB A;  3FKF A;  2GQM A;  4GQC A;  1TK0 B;  1T4Z A;  3ZL5 A;  5ECH B;  4ACS A;  4HQS A;  2ALB A;  2NDO A;  4KA0 A;  1MTC A;  4HDE A;  2OAC A;  2PER A;  2FWE A;  4F82 A;  2B5Y A;  2PGT A;  2K8V A;  5ECQ B;  1OC3 A;  2YZU A;  1TP9 A;  2H76 A;  1M0U A;  1ZYN A;  3AY8 A;  2HSM A;  4ILF A;  3UMA A;  4LA1 A;  1GUL A;  4HOJ A;  2KHP A;  3D0Z A;  5H5S A;  3HDC A;  3UBK A;  3CMI A;  1BED A;  4MPG A;  5ENU A;  1K0N A;  1FG4 A;  2XPE A;  3D21 A;  3HHV A;  1SL0 B;  1OE8 A;  2GSR A;  3QCP A;  3WGD A;  2X4A A;  2IFQ B;  3QMX A;  3W8S A;  2DJ0 A;  2X49 A;  1M2D A;  2DJ2 A;  2GQK A;  2O87 A;  3G7J A;  3F0I A;  3TJJ A;  1TK8 B;  1O7U A;  1PSQ A;  3FRC A;  1E2Y A;  4OMV A;  2PMT A;  3KZQ A;  3TKR A;  3C1R A;  4MK3 A;  5C04 A;  2YWN A;  4XRA A;  1O8X A;  4HEA 2;  3Q6O A;  2GVP A;  3Q18 A;  5F8B A;  3ZMK A;  3D4M A;  3UVH A;  2GT6 A;  3KP9 A;  4KDX A;  5EY6 A;  3WD6 A;  4HI7 A;  3N9J A;  4WET A;  4L0U A;  2ES7 A;  2VCV A;  3F4T A;  2NBS A;  4XIH A;  4TXO B;  4I5Q A;  1MDK A;  3M3M A;  4L5O A;  3R3E A;  4JU5 A;  4MJE A;  4K7N A;  2N5F A;  2H0I A;  2H1G A;  4FO5 A;  3P2A A;  3ZIJ A;  3UJ1 A;  1FHE A;  2IMK A;  4POL A;  4TR3 A;  2VIM A;  1PN9 A;  8GSS A;  4G0L A;  5ID2 A;  4X43 A;  4GCI A;  2JU5 A;  1SD8 A;  5ECP B;  3EIN A;  3L9U A;  3G7I A;  2C1Y A;  1SKR B;  2VCW A;  1GP1 A;  3GYK A;  1GRX A;  3GSS A;  2H6X A;  4N11 A;  1VF1 A;  3TKQ A;  3MIX A;  3TKS C;  2AHE A;  1VF3 A;  1OVN A;  3ZFL A;  3RDW A;  3LXZ A;  2H6Z A;  3H4K A;  1G6W A;  1O85 A;  4MCU A;  3DEX A;  4WXT A;  5DCG A;  1TTZ A;  4OCE A;  2B5E A;  1M7T A;  3I43 A;  1QFN A;  3P90 A;  2LS5 A;  3C73 A;  2FA8 A;  2GS3 A;  3KD0 A;  1U88 A;  1CQH A;  4IP6 A;  3KJY A;  2D2Z A;  1WJK A;  3BJ5 A;  2AYT A;  2LJR A;  1MDI A;  4J56 E;  2IPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...