4DSSB

Crystal structure of peroxiredoxin ahp1 from saccharomyces cerevisiae in complex with thioredoxin trx2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
MVTQLKSASEYDSALASGDKLVVVDFFATWCGPSKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/transport protein
molecule keywords Peroxiredoxin type-2
publication title Structural Snapshots of Yeast Alkyl Hydroperoxide Reductase Ahp1 Peroxiredoxin Reveal a Novel Two-cysteine Mechanism of Electron Transfer to Eliminate Reactive Oxygen Species.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 29
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4dssB00
4J56E 1ST9A 2CAQA 3M9KA 3ZIJA 2H75A 3GIXA 3HD5A 3MAKA 1RW1A 3VPTA 3F9UA 3BCKA 4KB3A 2DSAA 5ENUA 4PUFC 2XPDA 3MDKA 2PPTA 2VOCA 2PGTA 3FR6A 3GMFA 2OBIA 2C0GA 5L71A 4OMVA 1B8XA 4KDUA 2JZRA 1AQXA 5F0GA 1WJKA 1AW9A 3KGKA 4YQUA 5EL8A 1A0RP 1QFNA 3FZAA 4MCUA 3KEBA 5D8IA 2GZZA 1EEJA 3L9SA 1R26A 2HLSA 2DLXA 4D73A 2HSYA 1DBYA 1HQOA 4POKA 1FW1A 3D4MA 2DJ3A 2PERA 2JZTA 4TKYA 4RQRA 1K0CA 5A4UA 2HFDA 1GTAA 4HQSA 4KNDA 4L0WA 2MBSA 1IYHA 1ZOFA 4MLYA 1ERWA 5D96A 2DJ1A 2YN1A 1XVQA 1NHOA 3UOMA 3U5RE 4PQHA 1A23A 3D0ZA 3CMIA 1G0TA 1EGRA 1K3LA 2VCVA 4ECIA 5H5SA 1OE7A 5F8BA 3L9UA 1AC1A 1PGTA 5IO2A 4OD7A 3F3RA 3TCOA 3PGTA 2VIMA 3PINA 1TP9A 3FW2A 4IHUA 4OCEA 4GF0A 2KUCA 1AQWA 2YZUA 3HKRA 1MDJA 4GSTA 2I9HA 4IVFA 2H1DA 1KBNA 4KX4A 3N5OA 5D9WA 2V6KA 3A3TA 4TW5A 1SL0B 2GSSA 2LQOA 1SENA 1UN2A 5CRHA 4TRXA 2YNXA 4GWRA 4AGSA 3FK8A 2WRTA 1XFLA 3BD2A 2WZ9A 4ISDA 2LQQA 3IA1A 3W8SA 4KDYA 2X8HA 4V2NA 3SBCA 2L6CA 2AB6A 3RHBA 5A4WA 3S9FA 3Q74A 4NV2A 2B5EA 6GSXA 2YCDA 4JR4A 1K3OA 3DMLA 1X5EA 3TKSE 5IIZA 1QK8A 1X5CA 3MWHA 4JR6A 1YKAA 2X8GA 5ECHB 5LCZA 1W89A 1BEDA 4E8HA 3KH9A 1PRXA 3HJOA 3IAS2 6GSWA 1Z6MA 3F4SA 2R4VA 2AJQB 1S3AA 4L5LA 2IL3A 4J2FA 2GT5A 3FZ4A 1TI3A 3C1RA 2IIYA 3DD3A 5B6MA 4WEYA 2OJLA 2C0DA 5LD0A 4ILFA 4O32A 1WOUA 1MEKA 2B6MA 4MZBA 1RQMA 4ECCA 5G1LA 1PKZA 3C1SA 1FHEA 1USBA 1MD4A 5KN0A 3I69A 1J0FA 3ZFLA 2I1UA 2K9FA 3APSA 5D9TA 2H73A 4PUAA 3IRAA 3E3EA 1I9DA 2IWTA 4JBBA 2LJRA 1BYEA 4NAXA 1XWBA 3FY7A 1HNAA 3KM6A 5IQYA 2HRNA 3QFAC 4IGJA 1GULA 5FT3A 5A4VA 1CQGA 3TJKA 4MZCA 3A2VA 2DMLA 4MJCA 1FOVA 1UVZA 3EC3A 3QFBC 4XHMA 1OC9B 2VUPA 2CX3A 4BVYA 2JL4A 4AJ7A 3O6TA 2L6DA 3ZREA 1DSBA 5CRWA 1FAAA 1E2YA 2RIIA 4X43A 2M80A 2REMA 3VLNA 4ZL8A 1GLPA 5G31A 4O7HA 3A2XA 3WT2A 4O5RA 2PMTA 3GL5A 1K0AA 3RDWA 3LG6A 4L5OA 2CVKA 3QAVA 5ECPB 3M9JA 1S3CA 1Z9HA 3W6GA 3QD9A 1EP8A 2M46A 5HFKA 4BWSA 3E9JB 4MA9A 4TXOB 5JCWA 1EOHA 2D2ZA 5J3RA 2FA8A 3I9V2 3WT1A 4EO3A 4FYBA 5GZZB 1R5AA 2NTOA 3UBKA 1OC9A 2FWFA 5HR3A 2DC5A 5DAKB 4K1FA 1TJDA 2LRNA 3CBUA 4TR1B 2H0IA 3LSZA 4PX1A 3LQ7A 2K18A 3DVXA 1VF1A 3TDGA 2G2QA 3RPNA 4WETA 1XWGA 4XS1A 2LNTA 2PVQA 4QL9A 4ZXGA 2LS5A 3C71A 3GYKA 5AN1A 4OFMA 1ML6A 1UA5A 3FRCA 3RBTA 1R5PA 4KCAA 2LRCA 2HZFA 4WBRD 2HSHA 4TXOA 1M7TA 1GSFA 4JRRA 5AIVA 4IP1A 3WYWA 4Q5RA 1SU9A 1Q4JA 4IQAA 1G6WA 2KOKA 5KN1A 3L78A 22GSA 4TR1A 3GKNA 4EC0A 1TRSA 2GT6A 1ILOA 1K3YA 1GLQA 3HY2A 2M72A 3IPZA 1TI1A 3KMOA 3CTGA 1OYJA 3G7IA 2H71A 4HEA2 2ZCTA 1YY7A 3Q6OA 2GS3A 1FB0A 3O76A 2VCZA 4TN8A 1JFUA 4NHZA 1UC7A 2YP6A 4V1Ag 3H8QA 4PNGA 1FB6A 1TK0B 1EGOA 4Q5NA 4MF5A 3HZ4A 1ERVA 2VCWA 1XVWA 2AYTA 5J41A 20GSA 1VRSD 1S3DA 1ERTA 4IKHA 1YJ6A 2YANA 2O8VB 2IMIA 2F8FA 1ABAA 2YWMA 2FHEA 4ID0A 2H6XA 2RUFA 3NZNA 4KGIA 1N8JA 3CYNA 2GDRA 2RM6A 2OA7A 4DSQA 1WMJA 3KD0A 4ZIJA 4I5QA 1SJ6A 4DVCA 3VWWA 5D9VA 3EMXA 5G30A 19GSA 2H1AA 1SKRB 2LJAA 3IAM2 3V1WA 1VF2A 1TRUA 5KN2A 3QPMA 4GXZA 2GZPA 4GTUA 4LL1B 4YH2A 2P5QA 2B3SA 3EU3A 4EUYA 3A5WA 4OWYA 4HZ4A 1SK0A 4WF5A 4KCEA 4P3YB 4KDXA 1T4ZA 2YZHA 2NBSA 5HR2A 2PU9C 4JEDA 4BPYA 2G0FA 2JU5A 2VD1A 2C3NA 4ZILA 1TTZA 2JZSA 2OKAA 5E4WA 1SJIA 2FWGA 5GSSA 4XIHA 3TKQA 1Y25A 4XRAA 1GSDA 1ACVA 1JZRA 2JSZA 2E2GA 2R2JA 4OFNA 4IJIA 3EYTA 4K7NA 2X8CA 3OR5A 4YAPA 2DIZA 2XBQA 5CREA 3TRQA 5G1KA 4N11A 1X0RA 4GSSA 1YKCA 1WE0A 2VCXA 1TOFA 1U3AA 1Z5YE 4GLTA 2OE1A 3MNGA 1K0NA 11GSA 1EV4A 5HQPA 4XS4B 3LWAA 3ZIVA 2E7PA 3JCML 1NM3A 1WRYA 1TW9A 2ZNMA 2HXKA 4LMVA 7GSSA 2B5XA 3VWXA 3F63A 4IN0A 5J9CA 4YQMA 2YV9A 3TB2A 1K0MA 3GX0A 1XOAA 3RPPA 1XOBA 3KP9A 3LORA 5CAXA 1K0BA 2KLXA 3BJ5A 4MPFA 3GSSA 4EDZA 2CZ2A 3BCIA 5F06A 4PGTA 1F6MC 1U3IA 1Z3EA 5DJMA 3TJJA 3TUEA 2FGXA 3ZVJA 5IOWA 4WXTA 1FG4A 1GSEA 1X9WB 3M0FA 1Q98A 2WGRA 2YOIA 5IMZA 1AXDA 3ISOA 2L5LA 2H76A 4XS4A 17GSA 2TRXA 3HVVA 1TU8A 2CA8A 3G7JA 2LNSA 4POMA 4F2IA 4G9HA 1U6TA 4RQXA 4ZBAA 4N30A 3SWLA 1PL2A 5J5NA 2V1MA 1O8WA 3HHVA 3I6AA 3IK7A 4OFTA 1B4QA 4XCSA 2H1BA 2P31A 2H8LA 1A2JA 1OAZA 2N5BA 5J9BA 1EOGA 1VF4A 5CYYA 4HI7A 3F3QA 2FD3A 3BOAA 3VI7A 1NSWA 2QSIA 1SL2B 2WS2A 1WP0A 5HFGA 4TR0A 1A24A 2XBIA 2I3YA 3DVWA 1BG5A 2E2MA 3UJ1A 3DXBA 1BAYA 2CX4A 1TK5B 4K2DA 2KP1A 2VCQA 3H93A 1YEPA 3FEUA 1LJRA 4BVXA 2EIRA 4WR5A 3J7Yk 3HCZA 2GGTA 2MMZA 4L0UA 1T1VA 2BTOT 3M3MA 2VO4A 3TGZA 4NHWA 3G7YA 1K0OA 3UVHA 2V6OA 2FLSA 1XXUA 2I4AA 2LV3A 3PH9A 5IPGA 2P5RA 5D9XA 3F4RA 1B9XC 6GSSA 2PUKC 4F03A 3GNJA 2YV7A 1XW6A 4EE0A 1AAZA 2IMDA 3ZTLA 2DJJA 4MH2A 3P7XA 3CRUA 3QDNA 5F07A 1YDKA 2GTUA 3HJMA 3L0HA 3LXTA 1AUCA 1HD2A 2WB9A 3GH6A 2H66A 3EWLA 1QGVA 1ZZYA 2FY6A 3H79A 1B48A 2XC2A 1T00A 5D73A 3P90A 5C04A 2IMFA 5ABRA 1W4VA 4XS6A 3EMPA 3CXGA 3UAPA 1O85A 4CW9A 1HNCA 3IC4A 1MDKA 1WIKA 3F6FA 2YPMA 2H0HA 2NPBA 1PN9A 3IOSA 3KMNA 2VLTA 3GN3A 2YJHA 1PA3A 1JHBA 2DJ2A 5EVOA 4I2TA 3FR3A 5A5KA 2J23A 4IQ1A 4ULXA 2LUSA 5JCGA 5G5FA 1VGLA 2ON7A 4N10A 2OE0A 1HNBA 5HR1A 4K7OA 2RM5A 4LL4B 1LBKA 1URMA 3KZQA 4POLA 2CZ3A 2BJXA 3VI5A 3EU4A 3LJRA 4PQ1A 4ECBA 2C4JA 2DIYA 3KCMA 10GSA 2LKUA 2PWJA 3CTFA 3CRTA 2O85A 3KTBA 2EC4A 3DIEA 2AHEA 2VL2A 3N9JA 2CVDA 5EY6A 1G7EA 1PX6A 4L8EA 1ZCPA 4IP6A 2H30A 1V40A 1XWKA 3LYKA 4RUVA 18GSA 4OO5A 3C7MA 3FKFA 5GAND 5ELAA 2IMKA 1F3AA 4ML1A 1F3BA 2DJ0A 1OVNA 2VAFA 5CP1A 2GVPA 1J08A 1TRWA 4KA0A 2YWIA 3DGQA 13GSA 1RK4A 3RHCA 3HXSA 1ZL9A 2OADA 3HZ8A 5ECMB 1MD3A 5C00A 2B7KA 4KSMA 2DMMA 4FIWA 3UL3A 1EWXA 1O8XA 2GQLA 5CRDA 5ECLB 5ECQB 5DBQA 3ZLPA 1K0DA 5DALB 5G2ZA 1GTIA 3HVSA 4AJ6A 2C1YA 1XPVA 1CQHA 2FWHA 2H1GA 2X99A 2WJUA 5IMVA 1T3BA 4MMMA 5IMFA 4MJAA 5JWQB 2B7JA 1V2AA 5JWRB 1GUMA 5DAKA 2I81A 2C0FA 3CSJA 4LA1A 1M99A 2F8AA 2RUEA 2C80A 3APQA 3H1NA 4ZB8A 1M2DA 2L57A 1YF0A 3ZVJD 4N0VA 3WD6A 3D21A 1SYRA 1E6BA 1V98A 1T7PB 5LNKe 1YEXA 2VL3A 4MF6A 4TVEA 1TXXA 1EEMA 5DALA 3D22A 5D93A 3IV4A 2MBTA 2IN3A 1KTEA 3ME8A 4MJEA 3UARA 1M9AA 2NDOA 1F9MA 2GSTA 4OCFA 4X1UA 1SL1B 3VWVA 4KSOA 3DRNA 1GRXA 1AIUA 5CRGA 5JWOB 2IJYA 3KXOA 2QKEA 5H5RA 2Z9SA 1TRVA 2L5OA 3ZZXA 2J9HA 3VFIA 2A4VA 2GZYA 1QXHA 2YWNA 3P8WA 3FR9A 2WFCA 3KJYA 1H4OA 3GA4A 4KE3A 4ZBBA 3TOUA 4FYCA 4IS0A 2TRCP 3ZYWA 4DSSB 4JZQA 1MTCA 5CO3A 3GFKA 2O89A 4EKZA 2QGVA 5IPHA 3AY8A 5ECSA 5JCUA 4MK3A 2FUG2 2GLRA 1JLVA 5HR0A 3UBLA 3TJBA 2HRFA 2XPEA 1U87A 3R2QA 4HS1A 3GL3A 2FNOA 1XIYA 2WULA 1YZXA 2LEGA 3RAZA 5DJLA 5DVBA 3TKRA 1WPIA 1YQ1A 4MABA 3C8EA 1EV9A 4GQFA 1GTUA 1O7UA 1GNWA 2B5YA 2JADA 2YWOA 4GRFA 3PR8A 1SK2A 4I8BA 1XW9A 2FCHA 4NXIA 1SYXA 4IBPA 4EF0A 4IJ3A 4ACSA 3HA9A 1GUHA 2OACA 1GL8A 1SKWB 5COHA 5IMAA 1PSQA 2B1LA 2BMXA 3EINA 3HVXA 3EVIA 4DSSA 2GQMA 4V1Ap 4IELA 3IK9A 1PKWA 3KTLA 4HOJA 5GSTA 2VLUA 3GUSA 2R5GA 3LEFA 2QC7A 2KP2A 1G6YA 4MP4A 2H6ZA 4HU9A 5ECRB 3KIJA 1O81A 2EIQA 4K8MA 5CNWA 1BQ7A 5B6NA 1R7HA 4NMUA 4G10A 1B9YC 5IMDA 4NV5A 4BL7A 3KP8A 1B4PA 2F3MA 5EPFA 2AUVA 2K8VA 3IBHA 1F2EA 4ECJA 2H74A 4KUNA 3TKPA 3F6DA 3ED3A 5DQSA 2O7KA 2MZCA 3GV1A 4EXJA 4LLRA 1FVKA 2GSRA 3UMAA 3GH9A 5KN3A 2AV4A 5B7CA 1OE8A 1PL1A 1M0UA 5DCGA 1GNEA 3LXZA 4XTSA 2H6YA 1XZOA 3FZ5A 4CHSA 3IR4A 1GP1A 3A2WA 2VL2C 8GSSA 1IYIA 4BA7A 2V32A 2DBCA 3QCPA 3ZL5A 4G2EA 4NWYA 4ZL9A 5ECIB 1G7OA 5IMCA 1GSSA 1Y6EA 4DSRA 3DKSA 2LJKA 4MZWA 1SKSB 2KHPA 2AAWA 5IOXA 1Z6NA 2FWEA 1WWJA 4ZB6A 1PX7A 2LTKA 3UIWA 4MDCA 4I97A 3TOTA 5B8AA 1PQNA 2PBJA 2N5AA 3LFLA 2VM1A 1GUKA 4TR3A 1A0FA 1U88A 2L4QA 4F82A 2K8SA 2WDUA 3ERFA 1SK1A 1A8YA 3LGCA 3QAWA 4K0NA 1A2MA 14GSA 3Q18A 2YJ7A 4WKWA 9GSSA 3I43A 5HFIA 4PQIA 1M9BA 1A8LA 1OKTA 4F9ZA 4MJBA 1J9BA 6GSUA 4HQZA 3KH7A 4HUAA 3CSHA 5ELGA 1XWCA 3W8JA 3WGXA 1PMTA 5H5QA 3NOFA 1ZYQB 2R37A 3TKSA 3C73A 4FO5A 3F4TA 3IDVA 3D6IA 3APOA 1OC8A 1X9SB 4IW9A 4XRDA 3GKXA 2XHFA 1GH2A 3FHKA 3U6VA 1ZGNA 3VURA 4HU7A 1OC3A 3QR6A 1LU4A 2HYXA 4QQ7A 3ME7A 3GKKA 4PNFA 1QMVA 3HDCA 5J4UA 3GHAA 1JZWA 3WGDA 4E8EA 3FYGA 1VF3A 2HT9A 2F51A 3O3TA 4MH3A 5ECOB 4EL1A 2HZEB 1R4WA 1XWAA 3P2AA 2VD0A 3IE3A 3GSTA 4DEJA 2PVOC 2C3TA 3GRXA 2MMAA 4V2MA 2HI7A 3US3A 2CT6A 4N0ZA 3H4KA 6GSVA 1A2LA 2IFQB 4O92A 4FH8A 1ERUA 5ECKB 3VK9A 3ZITA 2HNLA 2MMNA 1OKDA 1M2BA 4K6XA 1FO5A 2A2RA 5F05A 1TKDB 4ML6A 1EP7A 2IMEA 4KH7A 1V57A 3EE2A 2JACA 1HYUA 2VCTA 4JU5A 1FVJA 3FZ9A 4K7IA 4AF2A 5B8BA 3D5JA 6GSYA 1ZMAA 4MF7A 4EDYA 4I2UA 4NPBA 1TK8B 1X9MB 2H01A 2H72A 3QMXA 2HZEA 4RI7A 1JZOA 2K6VA 1DUGA 4PURA 4WR4A 2FA4A 3NIVA 4I6XA 4ZB9A 4YQVA 1XCCA 4YAVA 5E59A 4H86A 3IXRA 1THOA 1H75A 4F0BA 1DE1A 16GSA 2VL9A 1JZDA 2NVLA 1NHYA 2IFQA 5AISA 4TOPA 4JE1A 3VWUA 1SJZA 3Q19A 1M2AA 1N2AA 1BJXA 2OBKA 3F0IA 2R3XA 3QOUA 1ZYEA 4KW6A 4HDEA 1GSQA 2E0QA 1NW2A 2VM2A 5FWGA 2TIRA 3GTUB 2WCIA 3HJPA 4TR4A 3G9BA 3BBYA 3GX8A 2V2GA 2X64A 5IM9A 1DE2A 2CAIA 1TU7A 2A2SA 4ZBDA 3WGEA 4F0CA 4V2LA 4HJ2A 1Z7PA 2L4CA 5DCHA 4WF4A 2EIOA 3L9VA 4OO4A 3UVTA 1F37A 2B1KA 5ID2B 1Z7RA 3DEXA 2ES7A 4K0GA 3EURA 5IO0A 3ZRDA 2F9SA 2N5FA 1KEBA 4K9ZA 3ERGA 2C8UA 4WBJA 1BX9A 2CV4A 4Q5FA 2CVBA 4EVMA 5KEJA 2V41A 4CDOA 5AGYA 1O73A 3F8UA 4RI6A 5INYA 2C3QA 4GCIA 1GSYA 5GAPD 3GTUA 1SD9A 3MSZA 2VLVA 3IHQA 3VPQA 3ZFBA 3E0UA 4TXVA 1JLWA 3LYPA 3J7Yb 4LMWA 3ZMKA 1PD21 5G5EA 2LRTA 1EZKA 4POBA 5ID2A 2H19A 1AQVA 4ZL7A 4Z7XA 5AIXA 4G19A 1THXA 5FHIA 1MDIA 3DYRA 12GSA 3M8NA 1GWCA 1O6JA 3GKMA 4BWQA 1TDIA 3TJGA 3GURA 3ERWA 4J57E 1XBSA 2MYGA 2H0GA 1YF1A 3TRXA 2L59A 3UEMA 3ZMLA 3CSIA 4KAEA 3DWVA 3HYPA 4MPGA 2ON5A 5ECNB 4X0XA 2OE3A 2GQKA 5DDLA 2IPAA 3QAGA 1GSUA 4GQCA 2PN8A 3D4TA 4QL7A 2JSYA 2LSTA 4HZ2A 2RLIA 1QQ2A 4GSNA 2P0GA 5DQYA 2R6KA 2C0EA 1SD8A 2MMOA 2O87A 2GSQA 4AJ8A 4Q5QA 1XW5A 4HJMA 3TRPA 1X5DA 3L4NA 2H70A 1I5GA 3M1GA 1KNGA 1QUWA 6GSTA 2HE3A 1V58A 2CQ9A 2DJKA 2ZUPA 1C72A 1GTBA 4FYUA 1T4YA 2ALBA 4D73B 1V9WA 4PXOA 3K8NA 1T8EB 3TJFA 1ON4A 3TKSC
chains in the Genus database with same CATH superfamily
4J56E 1ST9A 2CAQA 3M9KA 3ZIJA 2H75A 3GIXA 3HD5A 3MAKA 1RW1A 3VPTA 3F9UA 3BCKA 4KB3A 2DSAA 5ENUA 4PUFC 2XPDA 3MDKA 2PPTA 2VOCA 2PGTA 3FR6A 3GMFA 2OBIA 2C0GA 5L71A 4OMVA 1B8XA 4KDUA 2JZRA 1AQXA 5F0GA 1WJKA 1M3JA 1AW9A 3KGKA 4YQUA 5EL8A 1A0RP 1QFNA 3FZAA 4MCUA 3KEBA 5D8IA 2GZZA 4FQUA 1EEJA 3L9SA 1R26A 2HLSA 2DLXA 4D73A 2HSYA 1DBYA 1HQOA 4POKA 1FW1A 3D4MA 2DJ3A 2PERA 2JZTA 4TKYA 4RQRA 1K0CA 5A4UA 2HFDA 1GTAA 4HQSA 4KNDA 4L0WA 2MBSA 1IYHA 1ZOFA 4MLYA 1ERWA 5D96A 2DJ1A 2YN1A 1XVQA 1NHOA 3UOMA 1PN0A 3U5RE 4PQHA 1A23A 3D0ZA 3CMIA 1G0TA 1EGRA 1K3LA 2VCVA 4ECIA 5H5SA 1OE7A 5F8BA 3L9UA 1AC1A 1PGTA 5IO2A 4OD7A 3F3RA 3TCOA 3PGTA 2VIMA 3PINA 1TP9A 3FW2A 4IHUA 4OCEA 4GF0A 2KUCA 1AQWA 4G0IA 2YZUA 3HKRA 1MDJA 4GSTA 2I9HA 4IVFA 2H1DA 1KBNA 4KX4A 3N5OA 5D9WA 2V6KA 3A3TA 4TW5A 1SL0B 2GSSA 2LQOA 1SENA 1UN2A 5CRHA 4TRXA 2YNXA 4GWRA 4AGSA 3FK8A 2WRTA 1XFLA 3BD2A 2WZ9A 4ISDA 2LQQA 3IA1A 3W8SA 4KDYA 2X8HA 4V2NA 3SBCA 2L6CA 2AB6A 3RHBA 3PPUA 5A4WA 3S9FA 3Q74A 4NV2A 2B5EA 6GSXA 2YCDA 4JR4A 1K3OA 3DMLA 1X5EA 3TKSE 5IIZA 2R0CA 1QK8A 1X5CA 3MWHA 4JR6A 1YKAA 2X8GA 5ECHB 5LCZA 1W89A 1BEDA 4E8HA 3KH9A 1PRXA 3HJOA 3IAS2 6GSWA 1Z6MA 3F4SA 2R4VA 2AJQB 1S3AA 4L5LA 2IL3A 4J2FA 2GT5A 3FZ4A 1TI3A 3C1RA 2IIYA 3DD3A 5B6MA 4WEYA 2OJLA 2C0DA 5LD0A 4ILFA 4O32A 1WOUA 1MEKA 2B6MA 4MZBA 1RQMA 4ECCA 5G1LA 1PKZA 3C1SA 1FHEA 1USBA 1MD4A 5KN0A 3I69A 1J0FA 3ZFLA 2I1UA 2K9FA 3APSA 5D9TA 2H73A 4PUAA 3IRAA 3E3EA 1I9DA 2IWTA 4Z2RA 4JBBA 2LJRA 1BYEA 4NAXA 1XWBA 3FY7A 1HNAA 3KM6A 5IQYA 2HRNA 3QFAC 4IGJA 1GULA 5FT3A 5A4VA 1CQGA 3TJKA 4MZCA 3A2VA 2DMLA 4MJCA 1FOVA 1UVZA 3EC3A 3QFBC 4XHMA 1OC9B 2VUPA 2CX3A 4BVYA 2JL4A 4AJ7A 3O6TA 2L6DA 3ZREA 1DSBA 5CRWA 1FAAA 1E2YA 2RIIA 4X43A 2M80A 2REMA 3VLNA 4ZL8A 1GLPA 5G31A 4O7HA 3A2XA 3WT2A 4O5RA 2PMTA 3GL5A 1K0AA 3RDWA 3LG6A 4L5OA 2CVKA 3QAVA 5ECPB 3M9JA 1S3CA 1Z9HA 3W6GA 3QD9A 1EP8A 2M46A 5HFKA 4BWSA 3E9JB 4MA9A 4TXOB 5JCWA 1EOHA 2D2ZA 5J3RA 2FA8A 3I9V2 3WT1A 4EO3A 4FYBA 5GZZB 1R5AA 2NTOA 3UBKA 1OC9A 2FWFA 5HR3A 2DC5A 5DAKB 4K1FA 1TJDA 2LRNA 3CBUA 4TR1B 2H0IA 3LSZA 4PX1A 3LQ7A 2K18A 3DVXA 1VF1A 3TDGA 2G2QA 3RPNA 4WETA 1XWGA 4XS1A 2LNTA 2PVQA 3CQFA 4QL9A 4ZXGA 2LS5A 3C71A 3GYKA 5AN1A 4OFMA 1ML6A 1UA5A 3FRCA 3RBTA 1R5PA 4KCAA 2LRCA 2HZFA 4WBRD 2HSHA 4TXOA 4K2XA 1M7TA 1GSFA 4JRRA 1XG8A 5AIVA 4IP1A 3WYWA 4Q5RA 2X49A 1SU9A 1Q4JA 4IQAA 1G6WA 2KOKA 5KN1A 3L78A 22GSA 4TR1A 3GKNA 4EC0A 1TRSA 2GT6A 1ILOA 1K3YA 1GLQA 3HY2A 2M72A 3IPZA 1TI1A 3KMOA 3CTGA 1OYJA 3G7IA 2H71A 4HEA2 2ZCTA 1YY7A 3Q6OA 4O5UA 2GS3A 1FB0A 3O76A 2VCZA 4TN8A 1JFUA 4NHZA 1UC7A 2YP6A 3IC8A 4V1Ag 3H8QA 4PNGA 1FB6A 1TK0B 1EGOA 4Q5NA 4MF5A 3HZ4A 1ERVA 2VCWA 3IHGA 1XVWA 4O5QA 2AYTA 5J41A 20GSA 1VRSD 1S3DA 1ERTA 4IKHA 1YJ6A 2YANA 2O8VB 2IMIA 2F8FA 1ABAA 2YWMA 2FHEA 4ID0A 2H6XA 2RUFA 3NZNA 4KGIA 1N8JA 3CYNA 2GDRA 2RM6A 2OA7A 4DSQA 1WMJA 3KD0A 2HRAA 4ZIJA 4I5QA 1SJ6A 4DVCA 3VWWA 5D9VA 3EMXA 5G30A 19GSA 2H1AA 1SKRB 2LJAA 3IAM2 3V1WA 1VF2A 1TRUA 5KN2A 3QPMA 4GXZA 2GZPA 4GTUA 4LL1B 4YH2A 2P5QA 2B3SA 3EU3A 4EUYA 3A5WA 4OWYA 4HZ4A 1SK0A 4WF5A 4KCEA 4P3YB 4KDXA 1T4ZA 2YZHA 2NBSA 5HR2A 2PU9C 4JEDA 4BPYA 2G0FA 2JU5A 2VD1A 2C3NA 4ZILA 1TTZA 2JZSA 2OKAA 5E4WA 1SJIA 2FWGA 5GSSA 4XIHA 3TKQA 1Y25A 4XRAA 1GSDA 1ACVA 1JZRA 2JSZA 4OFNA 2E2GA 2R2JA 4IJIA 3EYTA 4K7NA 2X8CA 3OR5A 4YAPA 2DIZA 2XBQA 5CREA 3TRQA 4USSA 2UZ8A 5G1KA 4N11A 1X0RA 4GSSA 1YKCA 1WE0A 2VCXA 1TOFA 1U3AA 1Z5YE 4GLTA 2OE1A 3MNGA 1K0NA 11GSA 1EV4A 5HQPA 4XS4B 3LWAA 3ZIVA 2E7PA 3JCML 1NM3A 1WRYA 1TW9A 2ZNMA 2HXKA 4LMVA 7GSSA 4K5RA 2B5XA 3VWXA 3F63A 4IN0A 5J9CA 4YQMA 2YV9A 3TB2A 1K0MA 3GX0A 1XOAA 3RPPA 1XOBA 3KP9A 3LORA 5CAXA 1K0BA 2KLXA 3BJ5A 4MPFA 3GSSA 4EDZA 2CZ2A 3BCIA 5F06A 4PGTA 1F6MC 1U3IA 1Z3EA 5DJMA 3TJJA 3TUEA 2FGXA 3ZVJA 4G0KA 5IOWA 4WXTA 1FG4A 1GSEA 1X9WB 3M0FA 1Q98A 2WGRA 2YOIA 5IMZA 1AXDA 3ISOA 2L5LA 2H76A 4XS4A 4BVXB 17GSA 2TRXA 3HVVA 1TU8A 2CA8A 3G7JA 2LNSA 4POMA 4F2IA 4G9HA 1U6TA 4RQXA 4ZBAA 4N30A 3SWLA 1PL2A 5J5NA 2V1MA 1O8WA 3HHVA 4Z2UA 3I6AA 3IK7A 4YKGA 4OFTA 1B4QA 4XCSA 2H1BA 2P31A 2H8LA 1A2JA 1OAZA 2N5BA 5J9BA 1EOGA 1VF4A 5CYYA 4HI7A 3F3QA 2FD3A 3BOAA 1ZYNA 3VI7A 1NSWA 2QSIA 1SL2B 2WS2A 1WP0A 5HFGA 4TR0A 1A24A 2XBIA 2I3YA 3DVWA 1BG5A 2E2MA 3UJ1A 3DXBA 1BAYA 2CX4A 1TK5B 4K2DA 2KP1A 2VCQA 3H93A 1YEPA 3FEUA 1LJRA 4BVXA 2EIRA 4WR5A 3J7Yk 3HCZA 2GGTA 3R3EA 2MMZA 4L0UA 1T1VA 2DKHA 2BTOT 3M3MA 2VO4A 3TGZA 4NHWA 3G7YA 1K0OA 3UVHA 2V6OA 2FLSA 1XXUA 2I4AA 2LV3A 3PH9A 5IPGA 2P5RA 5D9XA 3F4RA 1B9XC 6GSSA 2PUKC 4F03A 3GNJA 2YV7A 1XW6A 4KF9A 4EE0A 1AAZA 2IMDA 3ZTLA 2DJJA 4MH2A 3P7XA 3CRUA 2HSMA 3QDNA 5F07A 1YDKA 2GTUA 3HJMA 3L0HA 3LXTA 1AUCA 1HD2A 2WB9A 3GH6A 2H66A 3EWLA 1QGVA 1ZZYA 2FY6A 3H79A 1B48A 2XC2A 1T00A 5D73A 3P90A 5C04A 2IMFA 5ABRA 1W4VA 4XS6A 3EMPA 3CXGA 3UAPA 1O85A 4CW9A 1HNCA 3IC4A 1MDKA 1WIKA 3F6FA 2YPMA 2H0HA 2NPBA 1PN9A 3IOSA 3KMNA 2VLTA 3GN3A 2YJHA 1PA3A 1JHBA 2DJ2A 4ICYA 5EVOA 4I2TA 3FR3A 5A5KA 2J23A 4IQ1A 4ULXA 2LUSA 5JCGA 5G5FA 1S3RA 1VGLA 2ON7A 4N10A 2OE0A 1HNBA 5HR1A 4K7OA 2RM5A 4LL4B 1LBKA 1URMA 3KZQA 4POLA 2CZ3A 2BJXA 3VI5A 3EU4A 3LJRA 4PQ1A 4ECBA 2C4JA 2DIYA 3KCMA 10GSA 2LKUA 2PWJA 3CTFA 3CRTA 2O85A 3KTBA 2EC4A 3DIEA 2AHEA 2VL2A 3N9JA 2CVDA 5EY6A 1G7EA 1PX6A 4L8EA 1ZCPA 4IP6A 2H30A 1V40A 1XWKA 3LYKA 4RUVA 18GSA 4OO5A 3C7MA 3FKFA 5GAND 5ELAA 2IMKA 1F3AA 4ML1A 2X4AA 1F3BA 2DJ0A 1OVNA 2VAFA 5CP1A 2GVPA 1J08A 1TRWA 4KA0A 2YWIA 3HVNA 3DGQA 13GSA 2QA2A 1RK4A 3RHCA 2A4HA 3HXSA 1ZL9A 2OADA 3LW9A 3HZ8A 5ECMB 1MD3A 5C00A 2B7KA 4KSMA 4A5PA 3FMWA 2DMMA 4FIWA 1M3IA 1EWXA 1O8XA 2GQLA 5CRDA 5ECLB 5ECQB 3UL3A 5DBQA 3ZLPA 3MYDA 1K0DA 5DALB 5G2ZA 1GTIA 3HVSA 4AJ6A 2C1YA 1XPVA 1CQHA 2FWHA 2H1GA 2X99A 2WJUA 5IMVA 1T3BA 4MMMA 5IMFA 4MJAA 5JWQB 2B7JA 1V2AA 5JWRB 1GUMA 5DAKA 2I81A 2C0FA 3CSJA 4LA1A 1M99A 2F8AA 2RUEA 2C80A 3APQA 3H1NA 4ZB8A 1M2DA 2L57A 1YF0A 3ZVJD 4N0VA 3WD6A 3D21A 1SYRA 1E6BA 1V98A 1T7PB 2DKIA 5LNKe 1YEXA 2VL3A 4MF6A 4PTSA 4TVEA 1TXXA 1EEMA 5DALA 3D22A 3IV4A 5D93A 2MBTA 2IN3A 1KTEA 3ME8A 4MJEA 3UARA 1M9AA 2NDOA 1F9MA 2GSTA 4OCFA 2A2PA 3A5IA 4HSCX 4X1UA 1SL1B 3VWVA 4KSOA 3DRNA 1GRXA 1AIUA 5CRGA 5JWOB 2IJYA 3KXOA 2QKEA 5H5RA 2Z9SA 1TRVA 2L5OA 3ZZXA 2J9HA 3VFIA 2A4VA 2GZYA 1QXHA 2YWNA 3P8WA 3FR9A 2WFCA 3KJYA 1H4OA 3GA4A 4KE3A 4ZBBA 3TOUA 4FYCA 4IS0A 2TRCP 3ZYWA 4DSSB 4JZQA 1MTCA 5CO3A 3GFKA 2O89A 4EKZA 2QGVA 5IPHA 3AY8A 5ECSA 5JCUA 4MK3A 2FUG2 2GLRA 1JLVA 5HR0A 3UBLA 3TJBA 2HRFA 2XPEA 1U87A 3R2QA 4HS1A 3GL3A 2FNOA 1XIYA 2WULA 1YZXA 2LEGA 3RAZA 5DJLA 5DVBA 3TKRA 1WPIA 1YQ1A 4MABA 3C8EA 1EV9A 4GQFA 1GTUA 4BL7B 1O7UA 1GNWA 2B5YA 2JADA 2YWOA 4GRFA 3PR8A 1SK2A 4I8BA 1XW9A 2FCHA 4NXIA 1SYXA 4IBPA 4EF0A 4IJ3A 4ACSA 1FOHA 3HA9A 1GUHA 2OACA 1GL8A 1SKWB 5COHA 5IMAA 1PSQA 2B1LA 2BMXA 3EINA 3HVXA 3EVIA 4DSSA 2GQMA 4V1Ap 4IELA 3IK9A 1PKWA 3KTLA 4HOJA 5GSTA 2VLUA 3GUSA 2R5GA 3LEFA 2QC7A 2KP2A 1G6YA 4MP4A 2H6ZA 4HU9A 5ECRB 3KIJA 1O81A 4EIPA 2EIQA 4K8MA 5CNWA 1BQ7A 5B6NA 1R7HA 4NMUA 4G10A 1B9YC 5IMDA 4NV5A 4BL7A 4EIQA 3KP8A 1B4PA 2F3MA 5EPFA 2AUVA 2K8VA 3IBHA 1F2EA 4ECJA 5BMUA 4CY8A 2H74A 4KUNA 3TKPA 3F6DA 3ED3A 5DQSA 2O7KA 2R0GA 2MZCA 3GV1A 4EXJA 4LLRA 1FVKA 2GSRA 3UMAA 3GH9A 5KN3A 2AV4A 5B7CA 1OE8A 1PL1A 1M0UA 5DCGA 1GNEA 3LXZA 4XTSA 2H6YA 1XZOA 3FZ5A 4CHSA 3IR4A 1GP1A 3A2WA 2VL2C 8GSSA 1IYIA 4BA7A 2V32A 2DBCA 3QCPA 3ZL5A 4G2EA 4NWYA 4ZL9A 5ECIB 1G7OA 5IMCA 1GSSA 1Y6EA 4DSRA 3DKSA 2LJKA 4MZWA 1SKSB 2KHPA 2AAWA 5IOXA 1Z6NA 2FWEA 1WWJA 4ZB6A 1PX7A 2LTKA 3UIWA 4MDCA 4I97A 3TOTA 5B8AA 1PQNA 2PBJA 2N5AA 3LFLA 2VM1A 1GUKA 4TR3A 2R0PA 1A0FA 1U88A 2L4QA 4F82A 2K8SA 2WDUA 3ERFA 1SK1A 1A8YA 3LGCA 3QAWA 4K0NA 1A2MA 14GSA 4K5SA 3Q18A 2YJ7A 4WKWA 9GSSA 3I43A 5HFIA 4PQIA 1M9BA 1A8LA 3MIXA 5KOWA 1OKTA 4F9ZA 4MJBA 1J9BA 6GSUA 4HQZA 3KH7A 4HUAA 3CSHA 5ELGA 1XWCA 3W8JA 3WGXA 1PMTA 4CY6A 5H5QA 3NOFA 1ZYQB 2R37A 3TKSA 3C73A 4FO5A 3F4TA 3IDVA 3D6IA 3APOA 1OC8A 4G0LA 1X9SB 4IW9A 4XRDA 3GKXA 2XHFA 1GH2A 3FHKA 3U6VA 1ZGNA 3VURA 4BIKA 4HU7A 1OC3A 3QR6A 1LU4A 2HYXA 4QQ7A 3ME7A 3GKKA 4PNFA 4BVYB 1QMVA 3HDCA 5J4UA 3GHAA 1JZWA 3WGDA 4E8EA 3FYGA 1VF3A 1PFOA 2HT9A 2F51A 3O3TA 4MH3A 5ECOB 4EL1A 2HZEB 1R4WA 1XWAA 3P2AA 2VD0A 3IE3A 3GSTA 4DEJA 2PVOC 2C3TA 3GRXA 2MMAA 4V2MA 2HI7A 3US3A 2CT6A 4N0ZA 3H4KA 6GSVA 1A2LA 2IFQB 4O92A 4FH8A 1ERUA 2QA1A 5ECKB 3VK9A 3ZITA 2HNLA 2MMNA 1OKDA 2HRKA 1M2BA 4K6XA 1FO5A 2A2RA 5F05A 1TKDB 4ML6A 1EP7A 2IMEA 4KH7A 4Z2TA 1V57A 3EE2A 2JACA 1HYUA 2VCTA 4JU5A 1FVJA 3FZ9A 4K7IA 4AF2A 5B8BA 3D5JA 6GSYA 1ZMAA 4MF7A 4EDYA 4I2UA 4NPBA 1TK8B 1X9MB 2H01A 2H72A 3QMXA 2HZEA 4RI7A 1JZOA 3EPTA 2K6VA 1DUGA 4PURA 4WR4A 4MNNA 2FA4A 3NIVA 4I6XA 4ZB9A 4YQVA 1XCCA 4YAVA 5E59A 4H86A 3IXRA 1THOA 1H75A 4F0BA 1DE1A 16GSA 2VL9A 1JZDA 2NVLA 1NHYA 2IFQA 5AISA 4TOPA 4JE1A 3VWUA 1SJZA 3Q19A 1M2AA 1N2AA 1BJXA 2OBKA 3F0IA 2R3XA 3QOUA 1ZYEA 5BRTA 4KW6A 4HDEA 1GSQA 2E0QA 1NW2A 2VM2A 5FWGA 2TIRA 3GTUB 2WCIA 3HJPA 4TR4A 3G9BA 3BBYA 3GX8A 2V2GA 2X64A 4YKFA 5IM9A 1DE2A 2CAIA 1TU7A 2A2SA 4ZBDA 3WGEA 4F0CA 4V2LA 4HJ2A 1Z7PA 2L4CA 5DCHA 4WF4A 2EIOA 3L9VA 4OO4A 3UVTA 1F37A 2B1KA 5ID2B 1Z7RA 3DEXA 2ES7A 4K0GA 3EURA 5IO0A 3ZRDA 2F9SA 2N5FA 1KEBA 4K9ZA 3ERGA 2C8UA 4WBJA 1BX9A 2CV4A 5KOXA 4Q5FA 2CVBA 4EVMA 5KEJA 2V41A 4CDOA 5AGYA 1O73A 3F8UA 4RI6A 5INYA 2C3QA 4GCIA 1GSYA 5GAPD 3GTUA 1SD9A 3MSZA 2VLVA 3IHQA 3VPQA 3ZFBA 3E0UA 4TXVA 1JLWA 3LYPA 3J7Yb 4LMWA 3ZMKA 1PD21 5G5EA 2LRTA 1EZKA 4POBA 5ID2A 2H19A 1AQVA 4ZL7A 4Z7XA 4X4JA 5AIXA 4G19A 1THXA 5FHIA 1MDIA 3DYRA 12GSA 3M8NA 1GWCA 1O6JA 3GKMA 4BWQA 1TDIA 3TJGA 3GURA 3ERWA 4J57E 1XBSA 2MYGA 2H0GA 1YF1A 3TRXA 2L59A 3UEMA 3ZMLA 3CSIA 4KAEA 3DWVA 1ZYPA 3HYPA 4MPGA 2ON5A 5ECNB 4X0XA 2OE3A 2GQKA 5DDLA 2IPAA 3QAGA 1GSUA 4GQCA 2PN8A 3D4TA 4QL7A 2JSYA 2LSTA 4HZ2A 2RLIA 1QQ2A 4GSNA 2P0GA 5DQYA 2R6KA 2C0EA 1SD8A 2MMOA 2O87A 2GSQA 4AJ8A 4Q5QA 1XW5A 4HJMA 3TRPA 1X5DA 3L4NA 2H70A 1I5GA 3M1GA 1KNGA 1QUWA 6GSTA 2HE3A 1V58A 2CQ9A 2DJKA 2ZUPA 1C72A 1GTBA 4FYUA 1T4YA 2ALBA 4D73B 1V9WA 4PXOA 3K8NA 1T8EB 3TJFA 1ON4A 3TKSC
chains in the Genus database with same CATH topology
4J56E 1ST9A 2CAQA 3M9KA 3ZIJA 2H75A 3GIXA 3HD5A 3MAKA 1RW1A 3VPTA 3F9UA 3BCKA 4KB3A 2DSAA 5ENUA 4PUFC 2XPDA 3MDKA 2PPTA 2VOCA 2PGTA 3FR6A 3GMFA 2OBIA 2C0GA 5L71A 4OMVA 1B8XA 4KDUA 2JZRA 1AQXA 5F0GA 1WJKA 1AW9A 3KGKA 4YQUA 5EL8A 1A0RP 1QFNA 3FZAA 4MCUA 3KEBA 5D8IA 2GZZA 4FQUA 1EEJA 3L9SA 1R26A 2HLSA 2DLXA 4D73A 2HSYA 1DBYA 1HQOA 4POKA 1FW1A 3D4MA 2DJ3A 2PERA 2JZTA 4TKYA 4RQRA 1K0CA 5A4UA 2HFDA 1GTAA 4HQSA 4KNDA 4L0WA 2MBSA 1IYHA 1ZOFA 4MLYA 1ERWA 5D96A 2DJ1A 2YN1A 1XVQA 1NHOA 3UOMA 1PN0A 3U5RE 4PQHA 1A23A 3D0ZA 3CMIA 1G0TA 1EGRA 1K3LA 2VCVA 4ECIA 5H5SA 1OE7A 5F8BA 3L9UA 1AC1A 1PGTA 5IO2A 4OD7A 3F3RA 3TCOA 3PGTA 2VIMA 3PINA 1TP9A 3FW2A 4IHUA 4OCEA 4GF0A 2KUCA 1AQWA 4G0IA 2YZUA 3HKRA 1MDJA 4GSTA 2I9HA 4IVFA 2H1DA 1KBNA 4KX4A 3N5OA 5D9WA 2V6KA 3A3TA 4TW5A 1SL0B 2GSSA 2LQOA 1SENA 1UN2A 5CRHA 4TRXA 2YNXA 4GWRA 4AGSA 3FK8A 2WRTA 1XFLA 3BD2A 2WZ9A 4ISDA 2LQQA 3IA1A 3W8SA 4KDYA 2X8HA 4V2NA 3SBCA 2L6CA 2AB6A 3RHBA 3PPUA 5A4WA 3S9FA 3Q74A 4NV2A 2B5EA 6GSXA 2YCDA 4JR4A 1K3OA 3DMLA 1X5EA 3TKSE 5IIZA 2R0CA 1QK8A 1X5CA 3MWHA 4JR6A 1YKAA 2X8GA 5ECHB 5LCZA 1W89A 1BEDA 4E8HA 3KH9A 1PRXA 3HJOA 3IAS2 6GSWA 1Z6MA 3F4SA 2R4VA 2AJQB 1S3AA 4L5LA 2IL3A 4J2FA 2GT5A 3FZ4A 1TI3A 3C1RA 2IIYA 3DD3A 5B6MA 4WEYA 2OJLA 2C0DA 5LD0A 4ILFA 4O32A 1WOUA 1MEKA 2B6MA 4MZBA 1RQMA 4ECCA 5G1LA 1PKZA 3C1SA 1FHEA 1USBA 1MD4A 5KN0A 3I69A 1J0FA 3ZFLA 2I1UA 2K9FA 3APSA 5D9TA 2H73A 4PUAA 3IRAA 3E3EA 1I9DA 2IWTA 4Z2RA 4JBBA 2LJRA 1BYEA 4NAXA 1XWBA 3FY7A 1HNAA 3KM6A 5IQYA 2HRNA 3QFAC 4IGJA 1GULA 5FT3A 5A4VA 1CQGA 3TJKA 4MZCA 3A2VA 2DMLA 4MJCA 1FOVA 1UVZA 3EC3A 3QFBC 4XHMA 1OC9B 2VUPA 2CX3A 4BVYA 2JL4A 4AJ7A 3O6TA 2L6DA 3ZREA 1DSBA 5CRWA 1FAAA 1E2YA 2RIIA 4X43A 2M80A 2REMA 3VLNA 4ZL8A 1GLPA 5G31A 4O7HA 3A2XA 3WT2A 4O5RA 2PMTA 3GL5A 1K0AA 3RDWA 3LG6A 4L5OA 2CVKA 3QAVA 5ECPB 3M9JA 1S3CA 1Z9HA 3W6GA 3QD9A 1EP8A 2M46A 5HFKA 4BWSA 3E9JB 4MA9A 4TXOB 5JCWA 1EOHA 2D2ZA 5J3RA 2FA8A 3I9V2 3WT1A 4EO3A 4FYBA 5GZZB 1R5AA 2NTOA 3UBKA 1OC9A 2FWFA 5HR3A 2DC5A 5DAKB 4K1FA 1TJDA 2LRNA 3CBUA 4TR1B 2H0IA 3LSZA 4PX1A 3LQ7A 2K18A 3DVXA 1VF1A 3TDGA 2G2QA 3RPNA 4WETA 1XWGA 4XS1A 2LNTA 2PVQA 4QL9A 4ZXGA 2LS5A 3C71A 3GYKA 5AN1A 4OFMA 1ML6A 1UA5A 3FRCA 3RBTA 1R5PA 4KCAA 2LRCA 2HZFA 4WBRD 2HSHA 4TXOA 4K2XA 1M7TA 1GSFA 4JRRA 5AIVA 4IP1A 3WYWA 4Q5RA 2X49A 1SU9A 1Q4JA 4IQAA 1G6WA 2KOKA 5KN1A 3L78A 22GSA 4TR1A 3GKNA 4EC0A 1TRSA 2GT6A 1ILOA 1K3YA 1GLQA 3HY2A 2M72A 3IPZA 1TI1A 3KMOA 3CTGA 1OYJA 3G7IA 2H71A 4HEA2 2ZCTA 1YY7A 3Q6OA 4O5UA 2GS3A 1FB0A 3O76A 2VCZA 4TN8A 1JFUA 4NHZA 1UC7A 2YP6A 3IC8A 4V1Ag 3H8QA 4PNGA 1FB6A 1TK0B 1EGOA 4Q5NA 4MF5A 3HZ4A 1ERVA 2VCWA 3IHGA 1XVWA 4O5QA 2AYTA 5J41A 20GSA 1VRSD 1S3DA 1ERTA 4IKHA 1YJ6A 2YANA 2O8VB 2IMIA 2F8FA 1ABAA 2YWMA 2FHEA 4ID0A 2H6XA 2RUFA 3NZNA 4KGIA 1N8JA 3CYNA 2GDRA 2RM6A 2OA7A 4DSQA 1WMJA 3KD0A 2HRAA 4ZIJA 4I5QA 1SJ6A 4DVCA 3VWWA 5D9VA 3EMXA 5G30A 19GSA 2H1AA 1SKRB 2LJAA 3IAM2 3V1WA 1VF2A 1TRUA 5KN2A 3QPMA 4GXZA 2GZPA 4GTUA 4LL1B 4YH2A 2P5QA 2B3SA 3EU3A 4EUYA 3A5WA 4OWYA 4HZ4A 1SK0A 4WF5A 4KCEA 4P3YB 4KDXA 1T4ZA 2YZHA 2NBSA 5HR2A 2PU9C 4JEDA 4BPYA 2G0FA 2JU5A 2VD1A 2C3NA 4ZILA 1TTZA 2JZSA 2OKAA 5E4WA 1SJIA 2FWGA 5GSSA 4XIHA 3TKQA 1Y25A 4XRAA 1GSDA 1ACVA 1JZRA 2JSZA 4OFNA 2E2GA 2R2JA 4IJIA 3EYTA 4K7NA 2X8CA 3OR5A 4YAPA 2DIZA 2XBQA 5CREA 3TRQA 4USSA 2UZ8A 5G1KA 4N11A 1X0RA 4GSSA 1YKCA 1WE0A 2VCXA 1TOFA 1U3AA 1Z5YE 4GLTA 2OE1A 3MNGA 1K0NA 11GSA 1EV4A 5HQPA 4XS4B 3LWAA 3ZIVA 2E7PA 3JCML 1NM3A 1WRYA 1TW9A 2ZNMA 2HXKA 4LMVA 7GSSA 4K5RA 2B5XA 3VWXA 3F63A 4IN0A 5J9CA 4YQMA 2YV9A 3TB2A 1K0MA 3GX0A 1XOAA 3RPPA 1XOBA 3KP9A 3LORA 5CAXA 1K0BA 2KLXA 3BJ5A 4MPFA 3GSSA 4EDZA 2CZ2A 3BCIA 5F06A 4PGTA 1F6MC 1U3IA 1Z3EA 5DJMA 3TJJA 3TUEA 2FGXA 3ZVJA 4G0KA 5IOWA 4WXTA 1FG4A 1GSEA 1X9WB 3M0FA 1Q98A 2WGRA 2YOIA 5IMZA 1AXDA 3ISOA 2L5LA 2H76A 4XS4A 4BVXB 17GSA 2TRXA 3HVVA 1TU8A 2CA8A 3G7JA 2LNSA 4POMA 4F2IA 4G9HA 1U6TA 4RQXA 4ZBAA 4N30A 3SWLA 1PL2A 5J5NA 2V1MA 1O8WA 3HHVA 4Z2UA 3I6AA 3IK7A 4YKGA 4OFTA 1B4QA 4XCSA 2H1BA 2P31A 2H8LA 1A2JA 1OAZA 2N5BA 5J9BA 1EOGA 1VF4A 5CYYA 4HI7A 3F3QA 2FD3A 3BOAA 1ZYNA 3VI7A 1NSWA 2QSIA 1SL2B 2WS2A 1WP0A 5HFGA 4TR0A 1A24A 2XBIA 2I3YA 3DVWA 1BG5A 2E2MA 3UJ1A 3DXBA 1BAYA 2CX4A 1TK5B 4K2DA 2KP1A 2VCQA 3H93A 1YEPA 3FEUA 1LJRA 4BVXA 2EIRA 4WR5A 3J7Yk 3HCZA 2GGTA 3R3EA 2MMZA 4L0UA 1T1VA 2DKHA 2BTOT 3M3MA 2VO4A 3TGZA 4NHWA 3G7YA 1K0OA 3UVHA 2V6OA 2FLSA 1XXUA 2I4AA 2LV3A 3PH9A 5IPGA 2P5RA 5D9XA 3F4RA 1B9XC 6GSSA 2PUKC 4F03A 3GNJA 2YV7A 1XW6A 4KF9A 4EE0A 1AAZA 2IMDA 3ZTLA 2DJJA 4MH2A 3P7XA 3CRUA 2HSMA 3QDNA 5F07A 1YDKA 2GTUA 3HJMA 3L0HA 3LXTA 1AUCA 1HD2A 2WB9A 3GH6A 2H66A 3EWLA 1QGVA 1ZZYA 2FY6A 3H79A 1B48A 2XC2A 1T00A 5D73A 3P90A 5C04A 2IMFA 5ABRA 1W4VA 4XS6A 3EMPA 3CXGA 3UAPA 1O85A 4CW9A 1HNCA 3IC4A 1MDKA 1WIKA 3F6FA 2YPMA 2H0HA 2NPBA 1PN9A 3IOSA 3KMNA 2VLTA 3GN3A 2YJHA 1PA3A 1JHBA 2DJ2A 4ICYA 5EVOA 4I2TA 3FR3A 5A5KA 2J23A 4IQ1A 4ULXA 2LUSA 5JCGA 5G5FA 1VGLA 2ON7A 4N10A 2OE0A 1HNBA 5HR1A 4K7OA 2RM5A 4LL4B 1LBKA 1URMA 3KZQA 4POLA 2CZ3A 2BJXA 3VI5A 3EU4A 3LJRA 4PQ1A 4ECBA 2C4JA 2DIYA 3KCMA 10GSA 2LKUA 2PWJA 3CTFA 3CRTA 2O85A 3KTBA 2EC4A 3DIEA 2AHEA 2VL2A 3N9JA 2CVDA 5EY6A 1G7EA 1PX6A 4L8EA 1ZCPA 4IP6A 2H30A 1V40A 1XWKA 3LYKA 4RUVA 18GSA 4OO5A 3C7MA 3FKFA 5GAND 5ELAA 2IMKA 1F3AA 4ML1A 2X4AA 1F3BA 2DJ0A 1OVNA 2VAFA 5CP1A 2GVPA 1J08A 1TRWA 4KA0A 2YWIA 3DGQA 13GSA 2QA2A 1RK4A 3RHCA 2A4HA 3HXSA 1ZL9A 2OADA 3LW9A 3HZ8A 5ECMB 1MD3A 5C00A 2B7KA 4KSMA 4A5PA 3FMWA 2DMMA 4FIWA 3UL3A 1EWXA 1O8XA 2GQLA 5CRDA 5ECLB 5ECQB 5DBQA 3ZLPA 3MYDA 1K0DA 5DALB 5G2ZA 1GTIA 3HVSA 4AJ6A 2C1YA 1XPVA 1CQHA 2FWHA 2H1GA 2X99A 2WJUA 5IMVA 1T3BA 4MMMA 5IMFA 4MJAA 5JWQB 2B7JA 1V2AA 5JWRB 1GUMA 5DAKA 2I81A 2C0FA 3CSJA 4LA1A 1M99A 2F8AA 2RUEA 2C80A 3APQA 3H1NA 4ZB8A 1M2DA 2L57A 1YF0A 3ZVJD 4N0VA 3WD6A 3D21A 1SYRA 1E6BA 1V98A 1T7PB 2DKIA 5LNKe 1YEXA 2VL3A 4MF6A 4PTSA 4TVEA 1TXXA 1EEMA 5DALA 3D22A 3IV4A 5D93A 2MBTA 2IN3A 1KTEA 3ME8A 4MJEA 3UARA 1M9AA 2NDOA 1F9MA 2GSTA 4OCFA 2A2PA 3A5IA 4X1UA 1SL1B 3VWVA 4KSOA 3DRNA 1GRXA 1AIUA 5CRGA 5JWOB 2IJYA 3KXOA 2QKEA 5H5RA 2Z9SA 1TRVA 2L5OA 3ZZXA 2J9HA 3VFIA 2A4VA 2GZYA 1QXHA 2YWNA 3P8WA 3FR9A 2WFCA 3KJYA 1H4OA 3GA4A 4KE3A 4ZBBA 3TOUA 4FYCA 4IS0A 2TRCP 3ZYWA 4DSSB 4JZQA 1MTCA 5CO3A 3GFKA 2O89A 4EKZA 2QGVA 5IPHA 3AY8A 5ECSA 5JCUA 4MK3A 2FUG2 2GLRA 1JLVA 5HR0A 3UBLA 3TJBA 2HRFA 2XPEA 1U87A 3R2QA 4HS1A 3GL3A 2FNOA 1XIYA 2WULA 1YZXA 2LEGA 3RAZA 5DJLA 5DVBA 3TKRA 1WPIA 1YQ1A 4MABA 3C8EA 1EV9A 4GQFA 1GTUA 4BL7B 1O7UA 1GNWA 2B5YA 2JADA 2YWOA 4GRFA 3PR8A 1SK2A 4I8BA 1XW9A 2FCHA 4NXIA 1SYXA 4IBPA 4EF0A 4IJ3A 4ACSA 1FOHA 3HA9A 1GUHA 2OACA 1GL8A 1SKWB 5COHA 5IMAA 1PSQA 2B1LA 2BMXA 3EINA 3HVXA 3EVIA 4DSSA 2GQMA 4V1Ap 4IELA 3IK9A 1PKWA 3KTLA 4HOJA 5GSTA 2VLUA 3GUSA 2R5GA 3LEFA 2QC7A 2KP2A 1G6YA 4MP4A 2H6ZA 4HU9A 5ECRB 3KIJA 1O81A 4EIPA 2EIQA 4K8MA 5CNWA 1BQ7A 5B6NA 1R7HA 4NMUA 4G10A 1B9YC 5IMDA 4NV5A 4BL7A 4EIQA 3KP8A 1B4PA 2F3MA 5EPFA 2AUVA 2K8VA 3IBHA 1F2EA 4ECJA 5BMUA 4CY8A 2H74A 4KUNA 3TKPA 3F6DA 3ED3A 5DQSA 2O7KA 2R0GA 2MZCA 3GV1A 4EXJA 4LLRA 1FVKA 2GSRA 3UMAA 3GH9A 5KN3A 2AV4A 5B7CA 1OE8A 1PL1A 1M0UA 5DCGA 1GNEA 3LXZA 4XTSA 2H6YA 1XZOA 3FZ5A 4CHSA 3IR4A 1GP1A 3A2WA 2VL2C 8GSSA 1IYIA 4BA7A 2V32A 2DBCA 3QCPA 3ZL5A 4G2EA 4NWYA 4ZL9A 5ECIB 1G7OA 5IMCA 1GSSA 1Y6EA 4DSRA 3DKSA 2LJKA 4MZWA 1SKSB 2KHPA 2AAWA 5IOXA 1Z6NA 2FWEA 1WWJA 4ZB6A 1PX7A 2LTKA 3UIWA 4MDCA 4I97A 3TOTA 5B8AA 1PQNA 2PBJA 2N5AA 3LFLA 2VM1A 1GUKA 4TR3A 2R0PA 1A0FA 1U88A 2L4QA 4F82A 2K8SA 2WDUA 3ERFA 1SK1A 1A8YA 3LGCA 3QAWA 4K0NA 1A2MA 14GSA 4K5SA 3Q18A 2YJ7A 4WKWA 9GSSA 3I43A 5HFIA 4PQIA 1M9BA 1A8LA 3MIXA 5KOWA 1OKTA 4F9ZA 4MJBA 1J9BA 6GSUA 4HQZA 3KH7A 4HUAA 3CSHA 5ELGA 1XWCA 3W8JA 3WGXA 1PMTA 4CY6A 5H5QA 3NOFA 1ZYQB 2R37A 3TKSA 3C73A 4FO5A 3F4TA 3IDVA 3D6IA 3APOA 1OC8A 4G0LA 1X9SB 4IW9A 4XRDA 3GKXA 2XHFA 1GH2A 3FHKA 3U6VA 1ZGNA 3VURA 4HU7A 1OC3A 3QR6A 1LU4A 2HYXA 4QQ7A 3ME7A 3GKKA 4PNFA 4BVYB 1QMVA 3HDCA 5J4UA 3GHAA 1JZWA 3WGDA 4E8EA 3FYGA 1VF3A 2HT9A 2F51A 3O3TA 4MH3A 5ECOB 4EL1A 2HZEB 1R4WA 1XWAA 3P2AA 2VD0A 3IE3A 3GSTA 4DEJA 2PVOC 2C3TA 3GRXA 2MMAA 4V2MA 2HI7A 3US3A 2CT6A 4N0ZA 3H4KA 6GSVA 1A2LA 2IFQB 4O92A 4FH8A 1ERUA 2QA1A 5ECKB 3VK9A 3ZITA 2HNLA 2MMNA 1OKDA 2HRKA 1M2BA 4K6XA 1FO5A 2A2RA 5F05A 1TKDB 4ML6A 1EP7A 2IMEA 4KH7A 4Z2TA 1V57A 3EE2A 2JACA 1HYUA 2VCTA 4JU5A 1FVJA 3FZ9A 4K7IA 4AF2A 5B8BA 3D5JA 6GSYA 1ZMAA 4MF7A 4EDYA 4I2UA 4NPBA 1TK8B 1X9MB 2H01A 2H72A 3QMXA 2HZEA 4RI7A 1JZOA 3EPTA 2K6VA 1DUGA 4PURA 4WR4A 4MNNA 2FA4A 3NIVA 4I6XA 4ZB9A 4YQVA 1XCCA 4YAVA 5E59A 4H86A 3IXRA 1THOA 1H75A 4F0BA 1DE1A 16GSA 2VL9A 1JZDA 2NVLA 1NHYA 2IFQA 5AISA 4TOPA 4JE1A 3VWUA 1SJZA 3Q19A 1M2AA 1N2AA 1BJXA 2OBKA 3F0IA 2R3XA 3QOUA 1ZYEA 5BRTA 4KW6A 4HDEA 1GSQA 2E0QA 1NW2A 2VM2A 5FWGA 2TIRA 3GTUB 2WCIA 3HJPA 4TR4A 3G9BA 3BBYA 3GX8A 2V2GA 2X64A 4YKFA 5IM9A 1DE2A 2CAIA 1TU7A 2A2SA 4ZBDA 3WGEA 4F0CA 4V2LA 4HJ2A 1Z7PA 2L4CA 5DCHA 4WF4A 2EIOA 3L9VA 4OO4A 3UVTA 1F37A 2B1KA 5ID2B 1Z7RA 3DEXA 2ES7A 4K0GA 3EURA 5IO0A 3ZRDA 2F9SA 2N5FA 1KEBA 4K9ZA 3ERGA 2C8UA 4WBJA 1BX9A 2CV4A 5KOXA 4Q5FA 2CVBA 4EVMA 5KEJA 2V41A 4CDOA 5AGYA 1O73A 3F8UA 4RI6A 5INYA 2C3QA 4GCIA 1GSYA 5GAPD 3GTUA 1SD9A 3MSZA 2VLVA 3IHQA 3VPQA 3ZFBA 3E0UA 4TXVA 1JLWA 3LYPA 3J7Yb 4LMWA 3ZMKA 1PD21 5G5EA 2LRTA 1EZKA 4POBA 5ID2A 2H19A 1AQVA 4ZL7A 4Z7XA 4X4JA 5AIXA 4G19A 1THXA 5FHIA 1MDIA 3DYRA 12GSA 3M8NA 1GWCA 1O6JA 3GKMA 4BWQA 1TDIA 3TJGA 3GURA 3ERWA 4J57E 1XBSA 2MYGA 2H0GA 1YF1A 3TRXA 2L59A 3UEMA 3ZMLA 3CSIA 4KAEA 3DWVA 1ZYPA 3HYPA 4MPGA 2ON5A 5ECNB 4X0XA 2OE3A 2GQKA 5DDLA 2IPAA 3QAGA 1GSUA 4GQCA 2PN8A 3D4TA 4QL7A 2JSYA 2LSTA 4HZ2A 2RLIA 1QQ2A 4GSNA 2P0GA 5DQYA 2R6KA 2C0EA 1SD8A 2MMOA 2O87A 2GSQA 4AJ8A 4Q5QA 1XW5A 4HJMA 3TRPA 1X5DA 3L4NA 2H70A 1I5GA 3M1GA 1KNGA 1QUWA 6GSTA 2HE3A 1V58A 2CQ9A 2DJKA 2ZUPA 1C72A 1GTBA 4FYUA 1T4YA 2ALBA 4D73B 1V9WA 4PXOA 3K8NA 1T8EB 3TJFA 1ON4A 3TKSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J56 E;  1ST9 A;  2CAQ A;  3M9K A;  3ZIJ A;  2H75 A;  3GIX A;  3HD5 A;  3MAK A;  1RW1 A;  3VPT A;  3F9U A;  3BCK A;  4KB3 A;  2DSA A;  5ENU A;  4PUF C;  2XPD A;  3MDK A;  2PPT A;  2VOC A;  2PGT A;  3FR6 A;  3GMF A;  2OBI A;  2C0G A;  5L71 A;  4OMV A;  1B8X A;  4KDU A;  2JZR A;  1AQX A;  5F0G A;  1WJK A;  1AW9 A;  3KGK A;  4YQU A;  5EL8 A;  1A0R P;  1QFN A;  3FZA A;  4MCU A;  3KEB A;  5D8I A;  2GZZ A;  1EEJ A;  3L9S A;  1R26 A;  2HLS A;  2DLX A;  4D73 A;  2HSY A;  1DBY A;  1HQO A;  4POK A;  1FW1 A;  3D4M A;  2DJ3 A;  2PER A;  2JZT A;  4TKY A;  4RQR A;  1K0C A;  5A4U A;  2HFD A;  1GTA A;  4HQS A;  4KND A;  4L0W A;  2MBS A;  1IYH A;  1ZOF A;  4MLY A;  1ERW A;  5D96 A;  2DJ1 A;  2YN1 A;  1XVQ A;  1NHO A;  3UOM A;  3U5R E;  4PQH A;  1A23 A;  3D0Z A;  3CMI A;  1G0T A;  1EGR A;  1K3L A;  2VCV A;  4ECI A;  5H5S A;  1OE7 A;  5F8B A;  3L9U A;  1AC1 A;  1PGT A;  5IO2 A;  4OD7 A;  3F3R A;  3TCO A;  3PGT A;  2VIM A;  3PIN A;  1TP9 A;  3FW2 A;  4IHU A;  4OCE A;  4GF0 A;  2KUC A;  1AQW A;  2YZU A;  3HKR A;  1MDJ A;  4GST A;  2I9H A;  4IVF A;  2H1D A;  1KBN A;  4KX4 A;  3N5O A;  5D9W A;  2V6K A;  3A3T A;  4TW5 A;  1SL0 B;  2GSS A;  2LQO A;  1SEN A;  1UN2 A;  5CRH A;  4TRX A;  2YNX A;  4GWR A;  4AGS A;  3FK8 A;  2WRT A;  1XFL A;  3BD2 A;  2WZ9 A;  4ISD A;  2LQQ A;  3IA1 A;  3W8S A;  4KDY A;  2X8H A;  4V2N A;  3SBC A;  2L6C A;  2AB6 A;  3RHB A;  5A4W A;  3S9F A;  3Q74 A;  4NV2 A;  2B5E A;  6GSX A;  2YCD A;  4JR4 A;  1K3O A;  3DML A;  1X5E A;  3TKS E;  5IIZ A;  1QK8 A;  1X5C A;  3MWH A;  4JR6 A;  1YKA A;  2X8G A;  5ECH B;  5LCZ A;  1W89 A;  1BED A;  4E8H A;  3KH9 A;  1PRX A;  3HJO A;  3IAS 2;  6GSW A;  1Z6M A;  3F4S A;  2R4V A;  2AJQ B;  1S3A A;  4L5L A;  2IL3 A;  4J2F A;  2GT5 A;  3FZ4 A;  1TI3 A;  3C1R A;  2IIY A;  3DD3 A;  5B6M A;  4WEY A;  2OJL A;  2C0D A;  5LD0 A;  4ILF A;  4O32 A;  1WOU A;  1MEK A;  2B6M A;  4MZB A;  1RQM A;  4ECC A;  5G1L A;  1PKZ A;  3C1S A;  1FHE A;  1USB A;  1MD4 A;  5KN0 A;  3I69 A;  1J0F A;  3ZFL A;  2I1U A;  2K9F A;  3APS A;  5D9T A;  2H73 A;  4PUA A;  3IRA A;  3E3E A;  1I9D A;  2IWT A;  4JBB A;  2LJR A;  1BYE A;  4NAX A;  1XWB A;  3FY7 A;  1HNA A;  3KM6 A;  5IQY A;  2HRN A;  3QFA C;  4IGJ A;  1GUL A;  5FT3 A;  5A4V A;  1CQG A;  3TJK A;  4MZC A;  3A2V A;  2DML A;  4MJC A;  1FOV A;  1UVZ A;  3EC3 A;  3QFB C;  4XHM A;  1OC9 B;  2VUP A;  2CX3 A;  4BVY A;  2JL4 A;  4AJ7 A;  3O6T A;  2L6D A;  3ZRE A;  1DSB A;  5CRW A;  1FAA A;  1E2Y A;  2RII A;  4X43 A;  2M80 A;  2REM A;  3VLN A;  4ZL8 A;  1GLP A;  5G31 A;  4O7H A;  3A2X A;  3WT2 A;  4O5R A;  2PMT A;  3GL5 A;  1K0A A;  3RDW A;  3LG6 A;  4L5O A;  2CVK A;  3QAV A;  5ECP B;  3M9J A;  1S3C A;  1Z9H A;  3W6G A;  3QD9 A;  1EP8 A;  2M46 A;  5HFK A;  4BWS A;  3E9J B;  4MA9 A;  4TXO B;  5JCW A;  1EOH A;  2D2Z A;  5J3R A;  2FA8 A;  3I9V 2;  3WT1 A;  4EO3 A;  4FYB A;  5GZZ B;  1R5A A;  2NTO A;  3UBK A;  1OC9 A;  2FWF A;  5HR3 A;  2DC5 A;  5DAK B;  4K1F A;  1TJD A;  2LRN A;  3CBU A;  4TR1 B;  2H0I A;  3LSZ A;  4PX1 A;  3LQ7 A;  2K18 A;  3DVX A;  1VF1 A;  3TDG A;  2G2Q A;  3RPN A;  4WET A;  1XWG A;  4XS1 A;  2LNT A;  2PVQ A;  4QL9 A;  4ZXG A;  2LS5 A;  3C71 A;  3GYK A;  5AN1 A;  4OFM A;  1ML6 A;  1UA5 A;  3FRC A;  3RBT A;  1R5P A;  4KCA A;  2LRC A;  2HZF A;  4WBR D;  2HSH A;  4TXO A;  1M7T A;  1GSF A;  4JRR A;  5AIV A;  4IP1 A;  3WYW A;  4Q5R A;  1SU9 A;  1Q4J A;  4IQA A;  1G6W A;  2KOK A;  5KN1 A;  3L78 A;  22GS A;  4TR1 A;  3GKN A;  4EC0 A;  1TRS A;  2GT6 A;  1ILO A;  1K3Y A;  1GLQ A;  3HY2 A;  2M72 A;  3IPZ A;  1TI1 A;  3KMO A;  3CTG A;  1OYJ A;  3G7I A;  2H71 A;  4HEA 2;  2ZCT A;  1YY7 A;  3Q6O A;  2GS3 A;  1FB0 A;  3O76 A;  2VCZ A;  4TN8 A;  1JFU A;  4NHZ A;  1UC7 A;  2YP6 A;  4V1A g;  3H8Q A;  4PNG A;  1FB6 A;  1TK0 B;  1EGO A;  4Q5N A;  4MF5 A;  3HZ4 A;  1ERV A;  2VCW A;  1XVW A;  2AYT A;  5J41 A;  20GS A;  1VRS D;  1S3D A;  1ERT A;  4IKH A;  1YJ6 A;  2YAN A;  2O8V B;  2IMI A;  2F8F A;  1ABA A;  2YWM A;  2FHE A;  4ID0 A;  2H6X A;  2RUF A;  3NZN A;  4KGI A;  1N8J A;  3CYN A;  2GDR A;  2RM6 A;  2OA7 A;  4DSQ A;  1WMJ A;  3KD0 A;  4ZIJ A;  4I5Q A;  1SJ6 A;  4DVC A;  3VWW A;  5D9V A;  3EMX A;  5G30 A;  19GS A;  2H1A A;  1SKR B;  2LJA A;  3IAM 2;  3V1W A;  1VF2 A;  1TRU A;  5KN2 A;  3QPM A;  4GXZ A;  2GZP A;  4GTU A;  4LL1 B;  4YH2 A;  2P5Q A;  2B3S A;  3EU3 A;  4EUY A;  3A5W A;  4OWY A;  4HZ4 A;  1SK0 A;  4WF5 A;  4KCE A;  4P3Y B;  4KDX A;  1T4Z A;  2YZH A;  2NBS A;  5HR2 A;  2PU9 C;  4JED A;  4BPY A;  2G0F A;  2JU5 A;  2VD1 A;  2C3N A;  4ZIL A;  1TTZ A;  2JZS A;  2OKA A;  5E4W A;  1SJI A;  2FWG A;  5GSS A;  4XIH A;  3TKQ A;  1Y25 A;  4XRA A;  1GSD A;  1ACV A;  1JZR A;  2JSZ A;  2E2G A;  2R2J A;  4OFN A;  4IJI A;  3EYT A;  4K7N A;  2X8C A;  3OR5 A;  4YAP A;  2DIZ A;  2XBQ A;  5CRE A;  3TRQ A;  5G1K A;  4N11 A;  1X0R A;  4GSS A;  1YKC A;  1WE0 A;  2VCX A;  1TOF A;  1U3A A;  1Z5Y E;  4GLT A;  2OE1 A;  3MNG A;  1K0N A;  11GS A;  1EV4 A;  5HQP A;  4XS4 B;  3LWA A;  3ZIV A;  2E7P A;  3JCM L;  1NM3 A;  1WRY A;  1TW9 A;  2ZNM A;  2HXK A;  4LMV A;  7GSS A;  2B5X A;  3VWX A;  3F63 A;  4IN0 A;  5J9C A;  4YQM A;  2YV9 A;  3TB2 A;  1K0M A;  3GX0 A;  1XOA A;  3RPP A;  1XOB A;  3KP9 A;  3LOR A;  5CAX A;  1K0B A;  2KLX A;  3BJ5 A;  4MPF A;  3GSS A;  4EDZ A;  2CZ2 A;  3BCI A;  5F06 A;  4PGT A;  1F6M C;  1U3I A;  1Z3E A;  5DJM A;  3TJJ A;  3TUE A;  2FGX A;  3ZVJ A;  5IOW A;  4WXT A;  1FG4 A;  1GSE A;  1X9W B;  3M0F A;  1Q98 A;  2WGR A;  2YOI A;  5IMZ A;  1AXD A;  3ISO A;  2L5L A;  2H76 A;  4XS4 A;  17GS A;  2TRX A;  3HVV A;  1TU8 A;  2CA8 A;  3G7J A;  2LNS A;  4POM A;  4F2I A;  4G9H A;  1U6T A;  4RQX A;  4ZBA A;  4N30 A;  3SWL A;  1PL2 A;  5J5N A;  2V1M A;  1O8W A;  3HHV A;  3I6A A;  3IK7 A;  4OFT A;  1B4Q A;  4XCS A;  2H1B A;  2P31 A;  2H8L A;  1A2J A;  1OAZ A;  2N5B A;  5J9B A;  1EOG A;  1VF4 A;  5CYY A;  4HI7 A;  3F3Q A;  2FD3 A;  3BOA A;  3VI7 A;  1NSW A;  2QSI A;  1SL2 B;  2WS2 A;  1WP0 A;  5HFG A;  4TR0 A;  1A24 A;  2XBI A;  2I3Y A;  3DVW A;  1BG5 A;  2E2M A;  3UJ1 A;  3DXB A;  1BAY A;  2CX4 A;  1TK5 B;  4K2D A;  2KP1 A;  2VCQ A;  3H93 A;  1YEP A;  3FEU A;  1LJR A;  4BVX A;  2EIR A;  4WR5 A;  3J7Y k;  3HCZ A;  2GGT A;  2MMZ A;  4L0U A;  1T1V A;  2BTO T;  3M3M A;  2VO4 A;  3TGZ A;  4NHW A;  3G7Y A;  1K0O A;  3UVH A;  2V6O A;  2FLS A;  1XXU A;  2I4A A;  2LV3 A;  3PH9 A;  5IPG A;  2P5R A;  5D9X A;  3F4R A;  1B9X C;  6GSS A;  2PUK C;  4F03 A;  3GNJ A;  2YV7 A;  1XW6 A;  4EE0 A;  1AAZ A;  2IMD A;  3ZTL A;  2DJJ A;  4MH2 A;  3P7X A;  3CRU A;  3QDN A;  5F07 A;  1YDK A;  2GTU A;  3HJM A;  3L0H A;  3LXT A;  1AUC A;  1HD2 A;  2WB9 A;  3GH6 A;  2H66 A;  3EWL A;  1QGV A;  1ZZY A;  2FY6 A;  3H79 A;  1B48 A;  2XC2 A;  1T00 A;  5D73 A;  3P90 A;  5C04 A;  2IMF A;  5ABR A;  1W4V A;  4XS6 A;  3EMP A;  3CXG A;  3UAP A;  1O85 A;  4CW9 A;  1HNC A;  3IC4 A;  1MDK A;  1WIK A;  3F6F A;  2YPM A;  2H0H A;  2NPB A;  1PN9 A;  3IOS A;  3KMN A;  2VLT A;  3GN3 A;  2YJH A;  1PA3 A;  1JHB A;  2DJ2 A;  5EVO A;  4I2T A;  3FR3 A;  5A5K A;  2J23 A;  4IQ1 A;  4ULX A;  2LUS A;  5JCG A;  5G5F A;  1VGL A;  2ON7 A;  4N10 A;  2OE0 A;  1HNB A;  5HR1 A;  4K7O A;  2RM5 A;  4LL4 B;  1LBK A;  1URM A;  3KZQ A;  4POL A;  2CZ3 A;  2BJX A;  3VI5 A;  3EU4 A;  3LJR A;  4PQ1 A;  4ECB A;  2C4J A;  2DIY A;  3KCM A;  10GS A;  2LKU A;  2PWJ A;  3CTF A;  3CRT A;  2O85 A;  3KTB A;  2EC4 A;  3DIE A;  2AHE A;  2VL2 A;  3N9J A;  2CVD A;  5EY6 A;  1G7E A;  1PX6 A;  4L8E A;  1ZCP A;  4IP6 A;  2H30 A;  1V40 A;  1XWK A;  3LYK A;  4RUV A;  18GS A;  4OO5 A;  3C7M A;  3FKF A;  5GAN D;  5ELA A;  2IMK A;  1F3A A;  4ML1 A;  1F3B A;  2DJ0 A;  1OVN A;  2VAF A;  5CP1 A;  2GVP A;  1J08 A;  1TRW A;  4KA0 A;  2YWI A;  3DGQ A;  13GS A;  1RK4 A;  3RHC A;  3HXS A;  1ZL9 A;  2OAD A;  3HZ8 A;  5ECM B;  1MD3 A;  5C00 A;  2B7K A;  4KSM A;  2DMM A;  4FIW A;  3UL3 A;  1EWX A;  1O8X A;  2GQL A;  5CRD A;  5ECL B;  5ECQ B;  5DBQ A;  3ZLP A;  1K0D A;  5DAL B;  5G2Z A;  1GTI A;  3HVS A;  4AJ6 A;  2C1Y A;  1XPV A;  1CQH A;  2FWH A;  2H1G A;  2X99 A;  2WJU A;  5IMV A;  1T3B A;  4MMM A;  5IMF A;  4MJA A;  5JWQ B;  2B7J A;  1V2A A;  5JWR B;  1GUM A;  5DAK A;  2I81 A;  2C0F A;  3CSJ A;  4LA1 A;  1M99 A;  2F8A A;  2RUE A;  2C80 A;  3APQ A;  3H1N A;  4ZB8 A;  1M2D A;  2L57 A;  1YF0 A;  3ZVJ D;  4N0V A;  3WD6 A;  3D21 A;  1SYR A;  1E6B A;  1V98 A;  1T7P B;  5LNK e;  1YEX A;  2VL3 A;  4MF6 A;  4TVE A;  1TXX A;  1EEM A;  5DAL A;  3D22 A;  5D93 A;  3IV4 A;  2MBT A;  2IN3 A;  1KTE A;  3ME8 A;  4MJE A;  3UAR A;  1M9A A;  2NDO A;  1F9M A;  2GST A;  4OCF A;  4X1U A;  1SL1 B;  3VWV A;  4KSO A;  3DRN A;  1GRX A;  1AIU A;  5CRG A;  5JWO B;  2IJY A;  3KXO A;  2QKE A;  5H5R A;  2Z9S A;  1TRV A;  2L5O A;  3ZZX A;  2J9H A;  3VFI A;  2A4V A;  2GZY A;  1QXH A;  2YWN A;  3P8W A;  3FR9 A;  2WFC A;  3KJY A;  1H4O A;  3GA4 A;  4KE3 A;  4ZBB A;  3TOU A;  4FYC A;  4IS0 A;  2TRC P;  3ZYW A;  4DSS B;  4JZQ A;  1MTC A;  5CO3 A;  3GFK A;  2O89 A;  4EKZ A;  2QGV A;  5IPH A;  3AY8 A;  5ECS A;  5JCU A;  4MK3 A;  2FUG 2;  2GLR A;  1JLV A;  5HR0 A;  3UBL A;  3TJB A;  2HRF A;  2XPE A;  1U87 A;  3R2Q A;  4HS1 A;  3GL3 A;  2FNO A;  1XIY A;  2WUL A;  1YZX A;  2LEG A;  3RAZ A;  5DJL A;  5DVB A;  3TKR A;  1WPI A;  1YQ1 A;  4MAB A;  3C8E A;  1EV9 A;  4GQF A;  1GTU A;  1O7U A;  1GNW A;  2B5Y A;  2JAD A;  2YWO A;  4GRF A;  3PR8 A;  1SK2 A;  4I8B A;  1XW9 A;  2FCH A;  4NXI A;  1SYX A;  4IBP A;  4EF0 A;  4IJ3 A;  4ACS A;  3HA9 A;  1GUH A;  2OAC A;  1GL8 A;  1SKW B;  5COH A;  5IMA A;  1PSQ A;  2B1L A;  2BMX A;  3EIN A;  3HVX A;  3EVI A;  4DSS A;  2GQM A;  4V1A p;  4IEL A;  3IK9 A;  1PKW A;  3KTL A;  4HOJ A;  5GST A;  2VLU A;  3GUS A;  2R5G A;  3LEF A;  2QC7 A;  2KP2 A;  1G6Y A;  4MP4 A;  2H6Z A;  4HU9 A;  5ECR B;  3KIJ A;  1O81 A;  2EIQ A;  4K8M A;  5CNW A;  1BQ7 A;  5B6N A;  1R7H A;  4NMU A;  4G10 A;  1B9Y C;  5IMD A;  4NV5 A;  4BL7 A;  3KP8 A;  1B4P A;  2F3M A;  5EPF A;  2AUV A;  2K8V A;  3IBH A;  1F2E A;  4ECJ A;  2H74 A;  4KUN A;  3TKP A;  3F6D A;  3ED3 A;  5DQS A;  2O7K A;  2MZC A;  3GV1 A;  4EXJ A;  4LLR A;  1FVK A;  2GSR A;  3UMA A;  3GH9 A;  5KN3 A;  2AV4 A;  5B7C A;  1OE8 A;  1PL1 A;  1M0U A;  5DCG A;  1GNE A;  3LXZ A;  4XTS A;  2H6Y A;  1XZO A;  3FZ5 A;  4CHS A;  3IR4 A;  1GP1 A;  3A2W A;  2VL2 C;  8GSS A;  1IYI A;  4BA7 A;  2V32 A;  2DBC A;  3QCP A;  3ZL5 A;  4G2E A;  4NWY A;  4ZL9 A;  5ECI B;  1G7O A;  5IMC A;  1GSS A;  1Y6E A;  4DSR A;  3DKS A;  2LJK A;  4MZW A;  1SKS B;  2KHP A;  2AAW A;  5IOX A;  1Z6N A;  2FWE A;  1WWJ A;  4ZB6 A;  1PX7 A;  2LTK A;  3UIW A;  4MDC A;  4I97 A;  3TOT A;  5B8A A;  1PQN A;  2PBJ A;  2N5A A;  3LFL A;  2VM1 A;  1GUK A;  4TR3 A;  1A0F A;  1U88 A;  2L4Q A;  4F82 A;  2K8S A;  2WDU A;  3ERF A;  1SK1 A;  1A8Y A;  3LGC A;  3QAW A;  4K0N A;  1A2M A;  14GS A;  3Q18 A;  2YJ7 A;  4WKW A;  9GSS A;  3I43 A;  5HFI A;  4PQI A;  1M9B A;  1A8L A;  1OKT A;  4F9Z A;  4MJB A;  1J9B A;  6GSU A;  4HQZ A;  3KH7 A;  4HUA A;  3CSH A;  5ELG A;  1XWC A;  3W8J A;  3WGX A;  1PMT A;  5H5Q A;  3NOF A;  1ZYQ B;  2R37 A;  3TKS A;  3C73 A;  4FO5 A;  3F4T A;  3IDV A;  3D6I A;  3APO A;  1OC8 A;  1X9S B;  4IW9 A;  4XRD A;  3GKX A;  2XHF A;  1GH2 A;  3FHK A;  3U6V A;  1ZGN A;  3VUR A;  4HU7 A;  1OC3 A;  3QR6 A;  1LU4 A;  2HYX A;  4QQ7 A;  3ME7 A;  3GKK A;  4PNF A;  1QMV A;  3HDC A;  5J4U A;  3GHA A;  1JZW A;  3WGD A;  4E8E A;  3FYG A;  1VF3 A;  2HT9 A;  2F51 A;  3O3T A;  4MH3 A;  5ECO B;  4EL1 A;  2HZE B;  1R4W A;  1XWA A;  3P2A A;  2VD0 A;  3IE3 A;  3GST A;  4DEJ A;  2PVO C;  2C3T A;  3GRX A;  2MMA A;  4V2M A;  2HI7 A;  3US3 A;  2CT6 A;  4N0Z A;  3H4K A;  6GSV A;  1A2L A;  2IFQ B;  4O92 A;  4FH8 A;  1ERU A;  5ECK B;  3VK9 A;  3ZIT A;  2HNL A;  2MMN A;  1OKD A;  1M2B A;  4K6X A;  1FO5 A;  2A2R A;  5F05 A;  1TKD B;  4ML6 A;  1EP7 A;  2IME A;  4KH7 A;  1V57 A;  3EE2 A;  2JAC A;  1HYU A;  2VCT A;  4JU5 A;  1FVJ A;  3FZ9 A;  4K7I A;  4AF2 A;  5B8B A;  3D5J A;  6GSY A;  1ZMA A;  4MF7 A;  4EDY A;  4I2U A;  4NPB A;  1TK8 B;  1X9M B;  2H01 A;  2H72 A;  3QMX A;  2HZE A;  4RI7 A;  1JZO A;  2K6V A;  1DUG A;  4PUR A;  4WR4 A;  2FA4 A;  3NIV A;  4I6X A;  4ZB9 A;  4YQV A;  1XCC A;  4YAV A;  5E59 A;  4H86 A;  3IXR A;  1THO A;  1H75 A;  4F0B A;  1DE1 A;  16GS A;  2VL9 A;  1JZD A;  2NVL A;  1NHY A;  2IFQ A;  5AIS A;  4TOP A;  4JE1 A;  3VWU A;  1SJZ A;  3Q19 A;  1M2A A;  1N2A A;  1BJX A;  2OBK A;  3F0I A;  2R3X A;  3QOU A;  1ZYE A;  4KW6 A;  4HDE A;  1GSQ A;  2E0Q A;  1NW2 A;  2VM2 A;  5FWG A;  2TIR A;  3GTU B;  2WCI A;  3HJP A;  4TR4 A;  3G9B A;  3BBY A;  3GX8 A;  2V2G A;  2X64 A;  5IM9 A;  1DE2 A;  2CAI A;  1TU7 A;  2A2S A;  4ZBD A;  3WGE A;  4F0C A;  4V2L A;  4HJ2 A;  1Z7P A;  2L4C A;  5DCH A;  4WF4 A;  2EIO A;  3L9V A;  4OO4 A;  3UVT A;  1F37 A;  2B1K A;  5ID2 B;  1Z7R A;  3DEX A;  2ES7 A;  4K0G A;  3EUR A;  5IO0 A;  3ZRD A;  2F9S A;  2N5F A;  1KEB A;  4K9Z A;  3ERG A;  2C8U A;  4WBJ A;  1BX9 A;  2CV4 A;  4Q5F A;  2CVB A;  4EVM A;  5KEJ A;  2V41 A;  4CDO A;  5AGY A;  1O73 A;  3F8U A;  4RI6 A;  5INY A;  2C3Q A;  4GCI A;  1GSY A;  5GAP D;  3GTU A;  1SD9 A;  3MSZ A;  2VLV A;  3IHQ A;  3VPQ A;  3ZFB A;  3E0U A;  4TXV A;  1JLW A;  3LYP A;  3J7Y b;  4LMW A;  3ZMK A;  1PD2 1;  5G5E A;  2LRT A;  1EZK A;  4POB A;  5ID2 A;  2H19 A;  1AQV A;  4ZL7 A;  4Z7X A;  5AIX A;  4G19 A;  1THX A;  5FHI A;  1MDI A;  3DYR A;  12GS A;  3M8N A;  1GWC A;  1O6J A;  3GKM A;  4BWQ A;  1TDI A;  3TJG A;  3GUR A;  3ERW A;  4J57 E;  1XBS A;  2MYG A;  2H0G A;  1YF1 A;  3TRX A;  2L59 A;  3UEM A;  3ZML A;  3CSI A;  4KAE A;  3DWV A;  3HYP A;  4MPG A;  2ON5 A;  5ECN B;  4X0X A;  2OE3 A;  2GQK A;  5DDL A;  2IPA A;  3QAG A;  1GSU A;  4GQC A;  2PN8 A;  3D4T A;  4QL7 A;  2JSY A;  2LST A;  4HZ2 A;  2RLI A;  1QQ2 A;  4GSN A;  2P0G A;  5DQY A;  2R6K A;  2C0E A;  1SD8 A;  2MMO A;  2O87 A;  2GSQ A;  4AJ8 A;  4Q5Q A;  1XW5 A;  4HJM A;  3TRP A;  1X5D A;  3L4N A;  2H70 A;  1I5G A;  3M1G A;  1KNG A;  1QUW A;  6GST A;  2HE3 A;  1V58 A;  2CQ9 A;  2DJK A;  2ZUP A;  1C72 A;  1GTB A;  4FYU A;  1T4Y A;  2ALB A;  4D73 B;  1V9W A;  4PXO A;  3K8N A;  1T8E B;  3TJF A;  1ON4 A;  3TKS C; 
#chains in the Genus database with same CATH topology
 4J56 E;  1ST9 A;  2CAQ A;  3M9K A;  3ZIJ A;  2H75 A;  3GIX A;  3HD5 A;  3MAK A;  1RW1 A;  3VPT A;  3F9U A;  3BCK A;  4KB3 A;  2DSA A;  5ENU A;  4PUF C;  2XPD A;  3MDK A;  2PPT A;  2VOC A;  2PGT A;  3FR6 A;  3GMF A;  2OBI A;  2C0G A;  5L71 A;  4OMV A;  1B8X A;  4KDU A;  2JZR A;  1AQX A;  5F0G A;  1WJK A;  1M3J A;  1AW9 A;  3KGK A;  4YQU A;  5EL8 A;  1A0R P;  1QFN A;  3FZA A;  4MCU A;  3KEB A;  5D8I A;  2GZZ A;  4FQU A;  1EEJ A;  3L9S A;  1R26 A;  2HLS A;  2DLX A;  4D73 A;  2HSY A;  1DBY A;  1HQO A;  4POK A;  1FW1 A;  3D4M A;  2DJ3 A;  2PER A;  2JZT A;  4TKY A;  4RQR A;  1K0C A;  5A4U A;  2HFD A;  1GTA A;  4HQS A;  4KND A;  4L0W A;  2MBS A;  1IYH A;  1ZOF A;  4MLY A;  1ERW A;  5D96 A;  2DJ1 A;  2YN1 A;  1XVQ A;  1NHO A;  3UOM A;  1PN0 A;  3U5R E;  4PQH A;  1A23 A;  3D0Z A;  3CMI A;  1G0T A;  1EGR A;  1K3L A;  2VCV A;  4ECI A;  5H5S A;  1OE7 A;  5F8B A;  3L9U A;  1AC1 A;  1PGT A;  5IO2 A;  4OD7 A;  3F3R A;  3TCO A;  3PGT A;  2VIM A;  3PIN A;  1TP9 A;  3FW2 A;  4IHU A;  4OCE A;  4GF0 A;  2KUC A;  1AQW A;  4G0I A;  2YZU A;  3HKR A;  1MDJ A;  4GST A;  2I9H A;  4IVF A;  2H1D A;  1KBN A;  4KX4 A;  3N5O A;  5D9W A;  2V6K A;  3A3T A;  4TW5 A;  1SL0 B;  2GSS A;  2LQO A;  1SEN A;  1UN2 A;  5CRH A;  4TRX A;  2YNX A;  4GWR A;  4AGS A;  3FK8 A;  2WRT A;  1XFL A;  3BD2 A;  2WZ9 A;  4ISD A;  2LQQ A;  3IA1 A;  3W8S A;  4KDY A;  2X8H A;  4V2N A;  3SBC A;  2L6C A;  2AB6 A;  3RHB A;  3PPU A;  5A4W A;  3S9F A;  3Q74 A;  4NV2 A;  2B5E A;  6GSX A;  2YCD A;  4JR4 A;  1K3O A;  3DML A;  1X5E A;  3TKS E;  5IIZ A;  2R0C A;  1QK8 A;  1X5C A;  3MWH A;  4JR6 A;  1YKA A;  2X8G A;  5ECH B;  5LCZ A;  1W89 A;  1BED A;  4E8H A;  3KH9 A;  1PRX A;  3HJO A;  3IAS 2;  6GSW A;  1Z6M A;  3F4S A;  2R4V A;  2AJQ B;  1S3A A;  4L5L A;  2IL3 A;  4J2F A;  2GT5 A;  3FZ4 A;  1TI3 A;  3C1R A;  2IIY A;  3DD3 A;  5B6M A;  4WEY A;  2OJL A;  2C0D A;  5LD0 A;  4ILF A;  4O32 A;  1WOU A;  1MEK A;  2B6M A;  4MZB A;  1RQM A;  4ECC A;  5G1L A;  1PKZ A;  3C1S A;  1FHE A;  1USB A;  1MD4 A;  5KN0 A;  3I69 A;  1J0F A;  3ZFL A;  2I1U A;  2K9F A;  3APS A;  5D9T A;  2H73 A;  4PUA A;  3IRA A;  3E3E A;  1I9D A;  2IWT A;  4Z2R A;  4JBB A;  2LJR A;  1BYE A;  4NAX A;  1XWB A;  3FY7 A;  1HNA A;  3KM6 A;  5IQY A;  2HRN A;  3QFA C;  4IGJ A;  1GUL A;  5FT3 A;  5A4V A;  1CQG A;  3TJK A;  4MZC A;  3A2V A;  2DML A;  4MJC A;  1FOV A;  1UVZ A;  3EC3 A;  3QFB C;  4XHM A;  1OC9 B;  2VUP A;  2CX3 A;  4BVY A;  2JL4 A;  4AJ7 A;  3O6T A;  2L6D A;  3ZRE A;  1DSB A;  5CRW A;  1FAA A;  1E2Y A;  2RII A;  4X43 A;  2M80 A;  2REM A;  3VLN A;  4ZL8 A;  1GLP A;  5G31 A;  4O7H A;  3A2X A;  3WT2 A;  4O5R A;  2PMT A;  3GL5 A;  1K0A A;  3RDW A;  3LG6 A;  4L5O A;  2CVK A;  3QAV A;  5ECP B;  3M9J A;  1S3C A;  1Z9H A;  3W6G A;  3QD9 A;  1EP8 A;  2M46 A;  5HFK A;  4BWS A;  3E9J B;  4MA9 A;  4TXO B;  5JCW A;  1EOH A;  2D2Z A;  5J3R A;  2FA8 A;  3I9V 2;  3WT1 A;  4EO3 A;  4FYB A;  5GZZ B;  1R5A A;  2NTO A;  3UBK A;  1OC9 A;  2FWF A;  5HR3 A;  2DC5 A;  5DAK B;  4K1F A;  1TJD A;  2LRN A;  3CBU A;  4TR1 B;  2H0I A;  3LSZ A;  4PX1 A;  3LQ7 A;  2K18 A;  3DVX A;  1VF1 A;  3TDG A;  2G2Q A;  3RPN A;  4WET A;  1XWG A;  4XS1 A;  2LNT A;  2PVQ A;  3CQF A;  4QL9 A;  4ZXG A;  2LS5 A;  3C71 A;  3GYK A;  5AN1 A;  4OFM A;  1ML6 A;  1UA5 A;  3FRC A;  3RBT A;  1R5P A;  4KCA A;  2LRC A;  2HZF A;  4WBR D;  2HSH A;  4TXO A;  4K2X A;  1M7T A;  1GSF A;  4JRR A;  1XG8 A;  5AIV A;  4IP1 A;  3WYW A;  4Q5R A;  2X49 A;  1SU9 A;  1Q4J A;  4IQA A;  1G6W A;  2KOK A;  5KN1 A;  3L78 A;  22GS A;  4TR1 A;  3GKN A;  4EC0 A;  1TRS A;  2GT6 A;  1ILO A;  1K3Y A;  1GLQ A;  3HY2 A;  2M72 A;  3IPZ A;  1TI1 A;  3KMO A;  3CTG A;  1OYJ A;  3G7I A;  2H71 A;  4HEA 2;  2ZCT A;  1YY7 A;  3Q6O A;  4O5U A;  2GS3 A;  1FB0 A;  3O76 A;  2VCZ A;  4TN8 A;  1JFU A;  4NHZ A;  1UC7 A;  2YP6 A;  3IC8 A;  4V1A g;  3H8Q A;  4PNG A;  1FB6 A;  1TK0 B;  1EGO A;  4Q5N A;  4MF5 A;  3HZ4 A;  1ERV A;  2VCW A;  3IHG A;  1XVW A;  4O5Q A;  2AYT A;  5J41 A;  20GS A;  1VRS D;  1S3D A;  1ERT A;  4IKH A;  1YJ6 A;  2YAN A;  2O8V B;  2IMI A;  2F8F A;  1ABA A;  2YWM A;  2FHE A;  4ID0 A;  2H6X A;  2RUF A;  3NZN A;  4KGI A;  1N8J A;  3CYN A;  2GDR A;  2RM6 A;  2OA7 A;  4DSQ A;  1WMJ A;  3KD0 A;  2HRA A;  4ZIJ A;  4I5Q A;  1SJ6 A;  4DVC A;  3VWW A;  5D9V A;  3EMX A;  5G30 A;  19GS A;  2H1A A;  1SKR B;  2LJA A;  3IAM 2;  3V1W A;  1VF2 A;  1TRU A;  5KN2 A;  3QPM A;  4GXZ A;  2GZP A;  4GTU A;  4LL1 B;  4YH2 A;  2P5Q A;  2B3S A;  3EU3 A;  4EUY A;  3A5W A;  4OWY A;  4HZ4 A;  1SK0 A;  4WF5 A;  4KCE A;  4P3Y B;  4KDX A;  1T4Z A;  2YZH A;  2NBS A;  5HR2 A;  2PU9 C;  4JED A;  4BPY A;  2G0F A;  2JU5 A;  2VD1 A;  2C3N A;  4ZIL A;  1TTZ A;  2JZS A;  2OKA A;  5E4W A;  1SJI A;  2FWG A;  5GSS A;  4XIH A;  3TKQ A;  1Y25 A;  4XRA A;  1GSD A;  1ACV A;  1JZR A;  2JSZ A;  4OFN A;  2E2G A;  2R2J A;  4IJI A;  3EYT A;  4K7N A;  2X8C A;  3OR5 A;  4YAP A;  2DIZ A;  2XBQ A;  5CRE A;  3TRQ A;  4USS A;  2UZ8 A;  5G1K A;  4N11 A;  1X0R A;  4GSS A;  1YKC A;  1WE0 A;  2VCX A;  1TOF A;  1U3A A;  1Z5Y E;  4GLT A;  2OE1 A;  3MNG A;  1K0N A;  11GS A;  1EV4 A;  5HQP A;  4XS4 B;  3LWA A;  3ZIV A;  2E7P A;  3JCM L;  1NM3 A;  1WRY A;  1TW9 A;  2ZNM A;  2HXK A;  4LMV A;  7GSS A;  4K5R A;  2B5X A;  3VWX A;  3F63 A;  4IN0 A;  5J9C A;  4YQM A;  2YV9 A;  3TB2 A;  1K0M A;  3GX0 A;  1XOA A;  3RPP A;  1XOB A;  3KP9 A;  3LOR A;  5CAX A;  1K0B A;  2KLX A;  3BJ5 A;  4MPF A;  3GSS A;  4EDZ A;  2CZ2 A;  3BCI A;  5F06 A;  4PGT A;  1F6M C;  1U3I A;  1Z3E A;  5DJM A;  3TJJ A;  3TUE A;  2FGX A;  3ZVJ A;  4G0K A;  5IOW A;  4WXT A;  1FG4 A;  1GSE A;  1X9W B;  3M0F A;  1Q98 A;  2WGR A;  2YOI A;  5IMZ A;  1AXD A;  3ISO A;  2L5L A;  2H76 A;  4XS4 A;  4BVX B;  17GS A;  2TRX A;  3HVV A;  1TU8 A;  2CA8 A;  3G7J A;  2LNS A;  4POM A;  4F2I A;  4G9H A;  1U6T A;  4RQX A;  4ZBA A;  4N30 A;  3SWL A;  1PL2 A;  5J5N A;  2V1M A;  1O8W A;  3HHV A;  4Z2U A;  3I6A A;  3IK7 A;  4YKG A;  4OFT A;  1B4Q A;  4XCS A;  2H1B A;  2P31 A;  2H8L A;  1A2J A;  1OAZ A;  2N5B A;  5J9B A;  1EOG A;  1VF4 A;  5CYY A;  4HI7 A;  3F3Q A;  2FD3 A;  3BOA A;  1ZYN A;  3VI7 A;  1NSW A;  2QSI A;  1SL2 B;  2WS2 A;  1WP0 A;  5HFG A;  4TR0 A;  1A24 A;  2XBI A;  2I3Y A;  3DVW A;  1BG5 A;  2E2M A;  3UJ1 A;  3DXB A;  1BAY A;  2CX4 A;  1TK5 B;  4K2D A;  2KP1 A;  2VCQ A;  3H93 A;  1YEP A;  3FEU A;  1LJR A;  4BVX A;  2EIR A;  4WR5 A;  3J7Y k;  3HCZ A;  2GGT A;  3R3E A;  2MMZ A;  4L0U A;  1T1V A;  2DKH A;  2BTO T;  3M3M A;  2VO4 A;  3TGZ A;  4NHW A;  3G7Y A;  1K0O A;  3UVH A;  2V6O A;  2FLS A;  1XXU A;  2I4A A;  2LV3 A;  3PH9 A;  5IPG A;  2P5R A;  5D9X A;  3F4R A;  1B9X C;  6GSS A;  2PUK C;  4F03 A;  3GNJ A;  2YV7 A;  1XW6 A;  4KF9 A;  4EE0 A;  1AAZ A;  2IMD A;  3ZTL A;  2DJJ A;  4MH2 A;  3P7X A;  3CRU A;  2HSM A;  3QDN A;  5F07 A;  1YDK A;  2GTU A;  3HJM A;  3L0H A;  3LXT A;  1AUC A;  1HD2 A;  2WB9 A;  3GH6 A;  2H66 A;  3EWL A;  1QGV A;  1ZZY A;  2FY6 A;  3H79 A;  1B48 A;  2XC2 A;  1T00 A;  5D73 A;  3P90 A;  5C04 A;  2IMF A;  5ABR A;  1W4V A;  4XS6 A;  3EMP A;  3CXG A;  3UAP A;  1O85 A;  4CW9 A;  1HNC A;  3IC4 A;  1MDK A;  1WIK A;  3F6F A;  2YPM A;  2H0H A;  2NPB A;  1PN9 A;  3IOS A;  3KMN A;  2VLT A;  3GN3 A;  2YJH A;  1PA3 A;  1JHB A;  2DJ2 A;  4ICY A;  5EVO A;  4I2T A;  3FR3 A;  5A5K A;  2J23 A;  4IQ1 A;  4ULX A;  2LUS A;  5JCG A;  5G5F A;  1S3R A;  1VGL A;  2ON7 A;  4N10 A;  2OE0 A;  1HNB A;  5HR1 A;  4K7O A;  2RM5 A;  4LL4 B;  1LBK A;  1URM A;  3KZQ A;  4POL A;  2CZ3 A;  2BJX A;  3VI5 A;  3EU4 A;  3LJR A;  4PQ1 A;  4ECB A;  2C4J A;  2DIY A;  3KCM A;  10GS A;  2LKU A;  2PWJ A;  3CTF A;  3CRT A;  2O85 A;  3KTB A;  2EC4 A;  3DIE A;  2AHE A;  2VL2 A;  3N9J A;  2CVD A;  5EY6 A;  1G7E A;  1PX6 A;  4L8E A;  1ZCP A;  4IP6 A;  2H30 A;  1V40 A;  1XWK A;  3LYK A;  4RUV A;  18GS A;  4OO5 A;  3C7M A;  3FKF A;  5GAN D;  5ELA A;  2IMK A;  1F3A A;  4ML1 A;  2X4A A;  1F3B A;  2DJ0 A;  1OVN A;  2VAF A;  5CP1 A;  2GVP A;  1J08 A;  1TRW A;  4KA0 A;  2YWI A;  3HVN A;  3DGQ A;  13GS A;  2QA2 A;  1RK4 A;  3RHC A;  2A4H A;  3HXS A;  1ZL9 A;  2OAD A;  3LW9 A;  3HZ8 A;  5ECM B;  1MD3 A;  5C00 A;  2B7K A;  4KSM A;  4A5P A;  3FMW A;  2DMM A;  4FIW A;  1M3I A;  1EWX A;  1O8X A;  2GQL A;  5CRD A;  5ECL B;  5ECQ B;  3UL3 A;  5DBQ A;  3ZLP A;  3MYD A;  1K0D A;  5DAL B;  5G2Z A;  1GTI A;  3HVS A;  4AJ6 A;  2C1Y A;  1XPV A;  1CQH A;  2FWH A;  2H1G A;  2X99 A;  2WJU A;  5IMV A;  1T3B A;  4MMM A;  5IMF A;  4MJA A;  5JWQ B;  2B7J A;  1V2A A;  5JWR B;  1GUM A;  5DAK A;  2I81 A;  2C0F A;  3CSJ A;  4LA1 A;  1M99 A;  2F8A A;  2RUE A;  2C80 A;  3APQ A;  3H1N A;  4ZB8 A;  1M2D A;  2L57 A;  1YF0 A;  3ZVJ D;  4N0V A;  3WD6 A;  3D21 A;  1SYR A;  1E6B A;  1V98 A;  1T7P B;  2DKI A;  5LNK e;  1YEX A;  2VL3 A;  4MF6 A;  4PTS A;  4TVE A;  1TXX A;  1EEM A;  5DAL A;  3D22 A;  3IV4 A;  5D93 A;  2MBT A;  2IN3 A;  1KTE A;  3ME8 A;  4MJE A;  3UAR A;  1M9A A;  2NDO A;  1F9M A;  2GST A;  4OCF A;  2A2P A;  3A5I A;  4HSC X;  4X1U A;  1SL1 B;  3VWV A;  4KSO A;  3DRN A;  1GRX A;  1AIU A;  5CRG A;  5JWO B;  2IJY A;  3KXO A;  2QKE A;  5H5R A;  2Z9S A;  1TRV A;  2L5O A;  3ZZX A;  2J9H A;  3VFI A;  2A4V A;  2GZY A;  1QXH A;  2YWN A;  3P8W A;  3FR9 A;  2WFC A;  3KJY A;  1H4O A;  3GA4 A;  4KE3 A;  4ZBB A;  3TOU A;  4FYC A;  4IS0 A;  2TRC P;  3ZYW A;  4DSS B;  4JZQ A;  1MTC A;  5CO3 A;  3GFK A;  2O89 A;  4EKZ A;  2QGV A;  5IPH A;  3AY8 A;  5ECS A;  5JCU A;  4MK3 A;  2FUG 2;  2GLR A;  1JLV A;  5HR0 A;  3UBL A;  3TJB A;  2HRF A;  2XPE A;  1U87 A;  3R2Q A;  4HS1 A;  3GL3 A;  2FNO A;  1XIY A;  2WUL A;  1YZX A;  2LEG A;  3RAZ A;  5DJL A;  5DVB A;  3TKR A;  1WPI A;  1YQ1 A;  4MAB A;  3C8E A;  1EV9 A;  4GQF A;  1GTU A;  4BL7 B;  1O7U A;  1GNW A;  2B5Y A;  2JAD A;  2YWO A;  4GRF A;  3PR8 A;  1SK2 A;  4I8B A;  1XW9 A;  2FCH A;  4NXI A;  1SYX A;  4IBP A;  4EF0 A;  4IJ3 A;  4ACS A;  1FOH A;  3HA9 A;  1GUH A;  2OAC A;  1GL8 A;  1SKW B;  5COH A;  5IMA A;  1PSQ A;  2B1L A;  2BMX A;  3EIN A;  3HVX A;  3EVI A;  4DSS A;  2GQM A;  4V1A p;  4IEL A;  3IK9 A;  1PKW A;  3KTL A;  4HOJ A;  5GST A;  2VLU A;  3GUS A;  2R5G A;  3LEF A;  2QC7 A;  2KP2 A;  1G6Y A;  4MP4 A;  2H6Z A;  4HU9 A;  5ECR B;  3KIJ A;  1O81 A;  4EIP A;  2EIQ A;  4K8M A;  5CNW A;  1BQ7 A;  5B6N A;  1R7H A;  4NMU A;  4G10 A;  1B9Y C;  5IMD A;  4NV5 A;  4BL7 A;  4EIQ A;  3KP8 A;  1B4P A;  2F3M A;  5EPF A;  2AUV A;  2K8V A;  3IBH A;  1F2E A;  4ECJ A;  5BMU A;  4CY8 A;  2H74 A;  4KUN A;  3TKP A;  3F6D A;  3ED3 A;  5DQS A;  2O7K A;  2R0G A;  2MZC A;  3GV1 A;  4EXJ A;  4LLR A;  1FVK A;  2GSR A;  3UMA A;  3GH9 A;  5KN3 A;  2AV4 A;  5B7C A;  1OE8 A;  1PL1 A;  1M0U A;  5DCG A;  1GNE A;  3LXZ A;  4XTS A;  2H6Y A;  1XZO A;  3FZ5 A;  4CHS A;  3IR4 A;  1GP1 A;  3A2W A;  2VL2 C;  8GSS A;  1IYI A;  4BA7 A;  2V32 A;  2DBC A;  3QCP A;  3ZL5 A;  4G2E A;  4NWY A;  4ZL9 A;  5ECI B;  1G7O A;  5IMC A;  1GSS A;  1Y6E A;  4DSR A;  3DKS A;  2LJK A;  4MZW A;  1SKS B;  2KHP A;  2AAW A;  5IOX A;  1Z6N A;  2FWE A;  1WWJ A;  4ZB6 A;  1PX7 A;  2LTK A;  3UIW A;  4MDC A;  4I97 A;  3TOT A;  5B8A A;  1PQN A;  2PBJ A;  2N5A A;  3LFL A;  2VM1 A;  1GUK A;  4TR3 A;  2R0P A;  1A0F A;  1U88 A;  2L4Q A;  4F82 A;  2K8S A;  2WDU A;  3ERF A;  1SK1 A;  1A8Y A;  3LGC A;  3QAW A;  4K0N A;  1A2M A;  14GS A;  4K5S A;  3Q18 A;  2YJ7 A;  4WKW A;  9GSS A;  3I43 A;  5HFI A;  4PQI A;  1M9B A;  1A8L A;  3MIX A;  5KOW A;  1OKT A;  4F9Z A;  4MJB A;  1J9B A;  6GSU A;  4HQZ A;  3KH7 A;  4HUA A;  3CSH A;  5ELG A;  1XWC A;  3W8J A;  3WGX A;  1PMT A;  4CY6 A;  5H5Q A;  3NOF A;  1ZYQ B;  2R37 A;  3TKS A;  3C73 A;  4FO5 A;  3F4T A;  3IDV A;  3D6I A;  3APO A;  1OC8 A;  4G0L A;  1X9S B;  4IW9 A;  4XRD A;  3GKX A;  2XHF A;  1GH2 A;  3FHK A;  3U6V A;  1ZGN A;  3VUR A;  4BIK A;  4HU7 A;  1OC3 A;  3QR6 A;  1LU4 A;  2HYX A;  4QQ7 A;  3ME7 A;  3GKK A;  4PNF A;  4BVY B;  1QMV A;  3HDC A;  5J4U A;  3GHA A;  1JZW A;  3WGD A;  4E8E A;  3FYG A;  1VF3 A;  1PFO A;  2HT9 A;  2F51 A;  3O3T A;  4MH3 A;  5ECO B;  4EL1 A;  2HZE B;  1R4W A;  1XWA A;  3P2A A;  2VD0 A;  3IE3 A;  3GST A;  4DEJ A;  2PVO C;  2C3T A;  3GRX A;  2MMA A;  4V2M A;  2HI7 A;  3US3 A;  2CT6 A;  4N0Z A;  3H4K A;  6GSV A;  1A2L A;  2IFQ B;  4O92 A;  4FH8 A;  1ERU A;  2QA1 A;  5ECK B;  3VK9 A;  3ZIT A;  2HNL A;  2MMN A;  1OKD A;  2HRK A;  1M2B A;  4K6X A;  1FO5 A;  2A2R A;  5F05 A;  1TKD B;  4ML6 A;  1EP7 A;  2IME A;  4KH7 A;  4Z2T A;  1V57 A;  3EE2 A;  2JAC A;  1HYU A;  2VCT A;  4JU5 A;  1FVJ A;  3FZ9 A;  4K7I A;  4AF2 A;  5B8B A;  3D5J A;  6GSY A;  1ZMA A;  4MF7 A;  4EDY A;  4I2U A;  4NPB A;  1TK8 B;  1X9M B;  2H01 A;  2H72 A;  3QMX A;  2HZE A;  4RI7 A;  1JZO A;  3EPT A;  2K6V A;  1DUG A;  4PUR A;  4WR4 A;  4MNN A;  2FA4 A;  3NIV A;  4I6X A;  4ZB9 A;  4YQV A;  1XCC A;  4YAV A;  5E59 A;  4H86 A;  3IXR A;  1THO A;  1H75 A;  4F0B A;  1DE1 A;  16GS A;  2VL9 A;  1JZD A;  2NVL A;  1NHY A;  2IFQ A;  5AIS A;  4TOP A;  4JE1 A;  3VWU A;  1SJZ A;  3Q19 A;  1M2A A;  1N2A A;  1BJX A;  2OBK A;  3F0I A;  2R3X A;  3QOU A;  1ZYE A;  5BRT A;  4KW6 A;  4HDE A;  1GSQ A;  2E0Q A;  1NW2 A;  2VM2 A;  5FWG A;  2TIR A;  3GTU B;  2WCI A;  3HJP A;  4TR4 A;  3G9B A;  3BBY A;  3GX8 A;  2V2G A;  2X64 A;  4YKF A;  5IM9 A;  1DE2 A;  2CAI A;  1TU7 A;  2A2S A;  4ZBD A;  3WGE A;  4F0C A;  4V2L A;  4HJ2 A;  1Z7P A;  2L4C A;  5DCH A;  4WF4 A;  2EIO A;  3L9V A;  4OO4 A;  3UVT A;  1F37 A;  2B1K A;  5ID2 B;  1Z7R A;  3DEX A;  2ES7 A;  4K0G A;  3EUR A;  5IO0 A;  3ZRD A;  2F9S A;  2N5F A;  1KEB A;  4K9Z A;  3ERG A;  2C8U A;  4WBJ A;  1BX9 A;  2CV4 A;  5KOX A;  4Q5F A;  2CVB A;  4EVM A;  5KEJ A;  2V41 A;  4CDO A;  5AGY A;  1O73 A;  3F8U A;  4RI6 A;  5INY A;  2C3Q A;  4GCI A;  1GSY A;  5GAP D;  3GTU A;  1SD9 A;  3MSZ A;  2VLV A;  3IHQ A;  3VPQ A;  3ZFB A;  3E0U A;  4TXV A;  1JLW A;  3LYP A;  3J7Y b;  4LMW A;  3ZMK A;  1PD2 1;  5G5E A;  2LRT A;  1EZK A;  4POB A;  5ID2 A;  2H19 A;  1AQV A;  4ZL7 A;  4Z7X A;  4X4J A;  5AIX A;  4G19 A;  1THX A;  5FHI A;  1MDI A;  3DYR A;  12GS A;  3M8N A;  1GWC A;  1O6J A;  3GKM A;  4BWQ A;  1TDI A;  3TJG A;  3GUR A;  3ERW A;  4J57 E;  1XBS A;  2MYG A;  2H0G A;  1YF1 A;  3TRX A;  2L59 A;  3UEM A;  3ZML A;  3CSI A;  4KAE A;  3DWV A;  1ZYP A;  3HYP A;  4MPG A;  2ON5 A;  5ECN B;  4X0X A;  2OE3 A;  2GQK A;  5DDL A;  2IPA A;  3QAG A;  1GSU A;  4GQC A;  2PN8 A;  3D4T A;  4QL7 A;  2JSY A;  2LST A;  4HZ2 A;  2RLI A;  1QQ2 A;  4GSN A;  2P0G A;  5DQY A;  2R6K A;  2C0E A;  1SD8 A;  2MMO A;  2O87 A;  2GSQ A;  4AJ8 A;  4Q5Q A;  1XW5 A;  4HJM A;  3TRP A;  1X5D A;  3L4N A;  2H70 A;  1I5G A;  3M1G A;  1KNG A;  1QUW A;  6GST A;  2HE3 A;  1V58 A;  2CQ9 A;  2DJK A;  2ZUP A;  1C72 A;  1GTB A;  4FYU A;  1T4Y A;  2ALB A;  4D73 B;  1V9W A;  4PXO A;  3K8N A;  1T8E B;  3TJF A;  1ON4 A;  3TKS C; 
#chains in the Genus database with same CATH homology
 4J56 E;  1ST9 A;  2CAQ A;  3M9K A;  3ZIJ A;  2H75 A;  3GIX A;  3HD5 A;  3MAK A;  1RW1 A;  3VPT A;  3F9U A;  3BCK A;  4KB3 A;  2DSA A;  5ENU A;  4PUF C;  2XPD A;  3MDK A;  2PPT A;  2VOC A;  2PGT A;  3FR6 A;  3GMF A;  2OBI A;  2C0G A;  5L71 A;  4OMV A;  1B8X A;  4KDU A;  2JZR A;  1AQX A;  5F0G A;  1WJK A;  1AW9 A;  3KGK A;  4YQU A;  5EL8 A;  1A0R P;  1QFN A;  3FZA A;  4MCU A;  3KEB A;  5D8I A;  2GZZ A;  4FQU A;  1EEJ A;  3L9S A;  1R26 A;  2HLS A;  2DLX A;  4D73 A;  2HSY A;  1DBY A;  1HQO A;  4POK A;  1FW1 A;  3D4M A;  2DJ3 A;  2PER A;  2JZT A;  4TKY A;  4RQR A;  1K0C A;  5A4U A;  2HFD A;  1GTA A;  4HQS A;  4KND A;  4L0W A;  2MBS A;  1IYH A;  1ZOF A;  4MLY A;  1ERW A;  5D96 A;  2DJ1 A;  2YN1 A;  1XVQ A;  1NHO A;  3UOM A;  1PN0 A;  3U5R E;  4PQH A;  1A23 A;  3D0Z A;  3CMI A;  1G0T A;  1EGR A;  1K3L A;  2VCV A;  4ECI A;  5H5S A;  1OE7 A;  5F8B A;  3L9U A;  1AC1 A;  1PGT A;  5IO2 A;  4OD7 A;  3F3R A;  3TCO A;  3PGT A;  2VIM A;  3PIN A;  1TP9 A;  3FW2 A;  4IHU A;  4OCE A;  4GF0 A;  2KUC A;  1AQW A;  4G0I A;  2YZU A;  3HKR A;  1MDJ A;  4GST A;  2I9H A;  4IVF A;  2H1D A;  1KBN A;  4KX4 A;  3N5O A;  5D9W A;  2V6K A;  3A3T A;  4TW5 A;  1SL0 B;  2GSS A;  2LQO A;  1SEN A;  1UN2 A;  5CRH A;  4TRX A;  2YNX A;  4GWR A;  4AGS A;  3FK8 A;  2WRT A;  1XFL A;  3BD2 A;  2WZ9 A;  4ISD A;  2LQQ A;  3IA1 A;  3W8S A;  4KDY A;  2X8H A;  4V2N A;  3SBC A;  2L6C A;  2AB6 A;  3RHB A;  3PPU A;  5A4W A;  3S9F A;  3Q74 A;  4NV2 A;  2B5E A;  6GSX A;  2YCD A;  4JR4 A;  1K3O A;  3DML A;  1X5E A;  3TKS E;  5IIZ A;  2R0C A;  1QK8 A;  1X5C A;  3MWH A;  4JR6 A;  1YKA A;  2X8G A;  5ECH B;  5LCZ A;  1W89 A;  1BED A;  4E8H A;  3KH9 A;  1PRX A;  3HJO A;  3IAS 2;  6GSW A;  1Z6M A;  3F4S A;  2R4V A;  2AJQ B;  1S3A A;  4L5L A;  2IL3 A;  4J2F A;  2GT5 A;  3FZ4 A;  1TI3 A;  3C1R A;  2IIY A;  3DD3 A;  5B6M A;  4WEY A;  2OJL A;  2C0D A;  5LD0 A;  4ILF A;  4O32 A;  1WOU A;  1MEK A;  2B6M A;  4MZB A;  1RQM A;  4ECC A;  5G1L A;  1PKZ A;  3C1S A;  1FHE A;  1USB A;  1MD4 A;  5KN0 A;  3I69 A;  1J0F A;  3ZFL A;  2I1U A;  2K9F A;  3APS A;  5D9T A;  2H73 A;  4PUA A;  3IRA A;  3E3E A;  1I9D A;  2IWT A;  4Z2R A;  4JBB A;  2LJR A;  1BYE A;  4NAX A;  1XWB A;  3FY7 A;  1HNA A;  3KM6 A;  5IQY A;  2HRN A;  3QFA C;  4IGJ A;  1GUL A;  5FT3 A;  5A4V A;  1CQG A;  3TJK A;  4MZC A;  3A2V A;  2DML A;  4MJC A;  1FOV A;  1UVZ A;  3EC3 A;  3QFB C;  4XHM A;  1OC9 B;  2VUP A;  2CX3 A;  4BVY A;  2JL4 A;  4AJ7 A;  3O6T A;  2L6D A;  3ZRE A;  1DSB A;  5CRW A;  1FAA A;  1E2Y A;  2RII A;  4X43 A;  2M80 A;  2REM A;  3VLN A;  4ZL8 A;  1GLP A;  5G31 A;  4O7H A;  3A2X A;  3WT2 A;  4O5R A;  2PMT A;  3GL5 A;  1K0A A;  3RDW A;  3LG6 A;  4L5O A;  2CVK A;  3QAV A;  5ECP B;  3M9J A;  1S3C A;  1Z9H A;  3W6G A;  3QD9 A;  1EP8 A;  2M46 A;  5HFK A;  4BWS A;  3E9J B;  4MA9 A;  4TXO B;  5JCW A;  1EOH A;  2D2Z A;  5J3R A;  2FA8 A;  3I9V 2;  3WT1 A;  4EO3 A;  4FYB A;  5GZZ B;  1R5A A;  2NTO A;  3UBK A;  1OC9 A;  2FWF A;  5HR3 A;  2DC5 A;  5DAK B;  4K1F A;  1TJD A;  2LRN A;  3CBU A;  4TR1 B;  2H0I A;  3LSZ A;  4PX1 A;  3LQ7 A;  2K18 A;  3DVX A;  1VF1 A;  3TDG A;  2G2Q A;  3RPN A;  4WET A;  1XWG A;  4XS1 A;  2LNT A;  2PVQ A;  4QL9 A;  4ZXG A;  2LS5 A;  3C71 A;  3GYK A;  5AN1 A;  4OFM A;  1ML6 A;  1UA5 A;  3FRC A;  3RBT A;  1R5P A;  4KCA A;  2LRC A;  2HZF A;  4WBR D;  2HSH A;  4TXO A;  4K2X A;  1M7T A;  1GSF A;  4JRR A;  5AIV A;  4IP1 A;  3WYW A;  4Q5R A;  2X49 A;  1SU9 A;  1Q4J A;  4IQA A;  1G6W A;  2KOK A;  5KN1 A;  3L78 A;  22GS A;  4TR1 A;  3GKN A;  4EC0 A;  1TRS A;  2GT6 A;  1ILO A;  1K3Y A;  1GLQ A;  3HY2 A;  2M72 A;  3IPZ A;  1TI1 A;  3KMO A;  3CTG A;  1OYJ A;  3G7I A;  2H71 A;  4HEA 2;  2ZCT A;  1YY7 A;  3Q6O A;  4O5U A;  2GS3 A;  1FB0 A;  3O76 A;  2VCZ A;  4TN8 A;  1JFU A;  4NHZ A;  1UC7 A;  2YP6 A;  3IC8 A;  4V1A g;  3H8Q A;  4PNG A;  1FB6 A;  1TK0 B;  1EGO A;  4Q5N A;  4MF5 A;  3HZ4 A;  1ERV A;  2VCW A;  3IHG A;  1XVW A;  4O5Q A;  2AYT A;  5J41 A;  20GS A;  1VRS D;  1S3D A;  1ERT A;  4IKH A;  1YJ6 A;  2YAN A;  2O8V B;  2IMI A;  2F8F A;  1ABA A;  2YWM A;  2FHE A;  4ID0 A;  2H6X A;  2RUF A;  3NZN A;  4KGI A;  1N8J A;  3CYN A;  2GDR A;  2RM6 A;  2OA7 A;  4DSQ A;  1WMJ A;  3KD0 A;  2HRA A;  4ZIJ A;  4I5Q A;  1SJ6 A;  4DVC A;  3VWW A;  5D9V A;  3EMX A;  5G30 A;  19GS A;  2H1A A;  1SKR B;  2LJA A;  3IAM 2;  3V1W A;  1VF2 A;  1TRU A;  5KN2 A;  3QPM A;  4GXZ A;  2GZP A;  4GTU A;  4LL1 B;  4YH2 A;  2P5Q A;  2B3S A;  3EU3 A;  4EUY A;  3A5W A;  4OWY A;  4HZ4 A;  1SK0 A;  4WF5 A;  4KCE A;  4P3Y B;  4KDX A;  1T4Z A;  2YZH A;  2NBS A;  5HR2 A;  2PU9 C;  4JED A;  4BPY A;  2G0F A;  2JU5 A;  2VD1 A;  2C3N A;  4ZIL A;  1TTZ A;  2JZS A;  2OKA A;  5E4W A;  1SJI A;  2FWG A;  5GSS A;  4XIH A;  3TKQ A;  1Y25 A;  4XRA A;  1GSD A;  1ACV A;  1JZR A;  2JSZ A;  4OFN A;  2E2G A;  2R2J A;  4IJI A;  3EYT A;  4K7N A;  2X8C A;  3OR5 A;  4YAP A;  2DIZ A;  2XBQ A;  5CRE A;  3TRQ A;  4USS A;  2UZ8 A;  5G1K A;  4N11 A;  1X0R A;  4GSS A;  1YKC A;  1WE0 A;  2VCX A;  1TOF A;  1U3A A;  1Z5Y E;  4GLT A;  2OE1 A;  3MNG A;  1K0N A;  11GS A;  1EV4 A;  5HQP A;  4XS4 B;  3LWA A;  3ZIV A;  2E7P A;  3JCM L;  1NM3 A;  1WRY A;  1TW9 A;  2ZNM A;  2HXK A;  4LMV A;  7GSS A;  4K5R A;  2B5X A;  3VWX A;  3F63 A;  4IN0 A;  5J9C A;  4YQM A;  2YV9 A;  3TB2 A;  1K0M A;  3GX0 A;  1XOA A;  3RPP A;  1XOB A;  3KP9 A;  3LOR A;  5CAX A;  1K0B A;  2KLX A;  3BJ5 A;  4MPF A;  3GSS A;  4EDZ A;  2CZ2 A;  3BCI A;  5F06 A;  4PGT A;  1F6M C;  1U3I A;  1Z3E A;  5DJM A;  3TJJ A;  3TUE A;  2FGX A;  3ZVJ A;  4G0K A;  5IOW A;  4WXT A;  1FG4 A;  1GSE A;  1X9W B;  3M0F A;  1Q98 A;  2WGR A;  2YOI A;  5IMZ A;  1AXD A;  3ISO A;  2L5L A;  2H76 A;  4XS4 A;  4BVX B;  17GS A;  2TRX A;  3HVV A;  1TU8 A;  2CA8 A;  3G7J A;  2LNS A;  4POM A;  4F2I A;  4G9H A;  1U6T A;  4RQX A;  4ZBA A;  4N30 A;  3SWL A;  1PL2 A;  5J5N A;  2V1M A;  1O8W A;  3HHV A;  4Z2U A;  3I6A A;  3IK7 A;  4YKG A;  4OFT A;  1B4Q A;  4XCS A;  2H1B A;  2P31 A;  2H8L A;  1A2J A;  1OAZ A;  2N5B A;  5J9B A;  1EOG A;  1VF4 A;  5CYY A;  4HI7 A;  3F3Q A;  2FD3 A;  3BOA A;  1ZYN A;  3VI7 A;  1NSW A;  2QSI A;  1SL2 B;  2WS2 A;  1WP0 A;  5HFG A;  4TR0 A;  1A24 A;  2XBI A;  2I3Y A;  3DVW A;  1BG5 A;  2E2M A;  3UJ1 A;  3DXB A;  1BAY A;  2CX4 A;  1TK5 B;  4K2D A;  2KP1 A;  2VCQ A;  3H93 A;  1YEP A;  3FEU A;  1LJR A;  4BVX A;  2EIR A;  4WR5 A;  3J7Y k;  3HCZ A;  2GGT A;  3R3E A;  2MMZ A;  4L0U A;  1T1V A;  2DKH A;  2BTO T;  3M3M A;  2VO4 A;  3TGZ A;  4NHW A;  3G7Y A;  1K0O A;  3UVH A;  2V6O A;  2FLS A;  1XXU A;  2I4A A;  2LV3 A;  3PH9 A;  5IPG A;  2P5R A;  5D9X A;  3F4R A;  1B9X C;  6GSS A;  2PUK C;  4F03 A;  3GNJ A;  2YV7 A;  1XW6 A;  4KF9 A;  4EE0 A;  1AAZ A;  2IMD A;  3ZTL A;  2DJJ A;  4MH2 A;  3P7X A;  3CRU A;  2HSM A;  3QDN A;  5F07 A;  1YDK A;  2GTU A;  3HJM A;  3L0H A;  3LXT A;  1AUC A;  1HD2 A;  2WB9 A;  3GH6 A;  2H66 A;  3EWL A;  1QGV A;  1ZZY A;  2FY6 A;  3H79 A;  1B48 A;  2XC2 A;  1T00 A;  5D73 A;  3P90 A;  5C04 A;  2IMF A;  5ABR A;  1W4V A;  4XS6 A;  3EMP A;  3CXG A;  3UAP A;  1O85 A;  4CW9 A;  1HNC A;  3IC4 A;  1MDK A;  1WIK A;  3F6F A;  2YPM A;  2H0H A;  2NPB A;  1PN9 A;  3IOS A;  3KMN A;  2VLT A;  3GN3 A;  2YJH A;  1PA3 A;  1JHB A;  2DJ2 A;  4ICY A;  5EVO A;  4I2T A;  3FR3 A;  5A5K A;  2J23 A;  4IQ1 A;  4ULX A;  2LUS A;  5JCG A;  5G5F A;  1VGL A;  2ON7 A;  4N10 A;  2OE0 A;  1HNB A;  5HR1 A;  4K7O A;  2RM5 A;  4LL4 B;  1LBK A;  1URM A;  3KZQ A;  4POL A;  2CZ3 A;  2BJX A;  3VI5 A;  3EU4 A;  3LJR A;  4PQ1 A;  4ECB A;  2C4J A;  2DIY A;  3KCM A;  10GS A;  2LKU A;  2PWJ A;  3CTF A;  3CRT A;  2O85 A;  3KTB A;  2EC4 A;  3DIE A;  2AHE A;  2VL2 A;  3N9J A;  2CVD A;  5EY6 A;  1G7E A;  1PX6 A;  4L8E A;  1ZCP A;  4IP6 A;  2H30 A;  1V40 A;  1XWK A;  3LYK A;  4RUV A;  18GS A;  4OO5 A;  3C7M A;  3FKF A;  5GAN D;  5ELA A;  2IMK A;  1F3A A;  4ML1 A;  2X4A A;  1F3B A;  2DJ0 A;  1OVN A;  2VAF A;  5CP1 A;  2GVP A;  1J08 A;  1TRW A;  4KA0 A;  2YWI A;  3DGQ A;  13GS A;  2QA2 A;  1RK4 A;  3RHC A;  2A4H A;  3HXS A;  1ZL9 A;  2OAD A;  3LW9 A;  3HZ8 A;  5ECM B;  1MD3 A;  5C00 A;  2B7K A;  4KSM A;  4A5P A;  3FMW A;  2DMM A;  4FIW A;  3UL3 A;  1EWX A;  1O8X A;  2GQL A;  5CRD A;  5ECL B;  5ECQ B;  5DBQ A;  3ZLP A;  3MYD A;  1K0D A;  5DAL B;  5G2Z A;  1GTI A;  3HVS A;  4AJ6 A;  2C1Y A;  1XPV A;  1CQH A;  2FWH A;  2H1G A;  2X99 A;  2WJU A;  5IMV A;  1T3B A;  4MMM A;  5IMF A;  4MJA A;  5JWQ B;  2B7J A;  1V2A A;  5JWR B;  1GUM A;  5DAK A;  2I81 A;  2C0F A;  3CSJ A;  4LA1 A;  1M99 A;  2F8A A;  2RUE A;  2C80 A;  3APQ A;  3H1N A;  4ZB8 A;  1M2D A;  2L57 A;  1YF0 A;  3ZVJ D;  4N0V A;  3WD6 A;  3D21 A;  1SYR A;  1E6B A;  1V98 A;  1T7P B;  2DKI A;  5LNK e;  1YEX A;  2VL3 A;  4MF6 A;  4PTS A;  4TVE A;  1TXX A;  1EEM A;  5DAL A;  3D22 A;  3IV4 A;  5D93 A;  2MBT A;  2IN3 A;  1KTE A;  3ME8 A;  4MJE A;  3UAR A;  1M9A A;  2NDO A;  1F9M A;  2GST A;  4OCF A;  2A2P A;  3A5I A;  4X1U A;  1SL1 B;  3VWV A;  4KSO A;  3DRN A;  1GRX A;  1AIU A;  5CRG A;  5JWO B;  2IJY A;  3KXO A;  2QKE A;  5H5R A;  2Z9S A;  1TRV A;  2L5O A;  3ZZX A;  2J9H A;  3VFI A;  2A4V A;  2GZY A;  1QXH A;  2YWN A;  3P8W A;  3FR9 A;  2WFC A;  3KJY A;  1H4O A;  3GA4 A;  4KE3 A;  4ZBB A;  3TOU A;  4FYC A;  4IS0 A;  2TRC P;  3ZYW A;  4DSS B;  4JZQ A;  1MTC A;  5CO3 A;  3GFK A;  2O89 A;  4EKZ A;  2QGV A;  5IPH A;  3AY8 A;  5ECS A;  5JCU A;  4MK3 A;  2FUG 2;  2GLR A;  1JLV A;  5HR0 A;  3UBL A;  3TJB A;  2HRF A;  2XPE A;  1U87 A;  3R2Q A;  4HS1 A;  3GL3 A;  2FNO A;  1XIY A;  2WUL A;  1YZX A;  2LEG A;  3RAZ A;  5DJL A;  5DVB A;  3TKR A;  1WPI A;  1YQ1 A;  4MAB A;  3C8E A;  1EV9 A;  4GQF A;  1GTU A;  4BL7 B;  1O7U A;  1GNW A;  2B5Y A;  2JAD A;  2YWO A;  4GRF A;  3PR8 A;  1SK2 A;  4I8B A;  1XW9 A;  2FCH A;  4NXI A;  1SYX A;  4IBP A;  4EF0 A;  4IJ3 A;  4ACS A;  1FOH A;  3HA9 A;  1GUH A;  2OAC A;  1GL8 A;  1SKW B;  5COH A;  5IMA A;  1PSQ A;  2B1L A;  2BMX A;  3EIN A;  3HVX A;  3EVI A;  4DSS A;  2GQM A;  4V1A p;  4IEL A;  3IK9 A;  1PKW A;  3KTL A;  4HOJ A;  5GST A;  2VLU A;  3GUS A;  2R5G A;  3LEF A;  2QC7 A;  2KP2 A;  1G6Y A;  4MP4 A;  2H6Z A;  4HU9 A;  5ECR B;  3KIJ A;  1O81 A;  4EIP A;  2EIQ A;  4K8M A;  5CNW A;  1BQ7 A;  5B6N A;  1R7H A;  4NMU A;  4G10 A;  1B9Y C;  5IMD A;  4NV5 A;  4BL7 A;  4EIQ A;  3KP8 A;  1B4P A;  2F3M A;  5EPF A;  2AUV A;  2K8V A;  3IBH A;  1F2E A;  4ECJ A;  5BMU A;  4CY8 A;  2H74 A;  4KUN A;  3TKP A;  3F6D A;  3ED3 A;  5DQS A;  2O7K A;  2R0G A;  2MZC A;  3GV1 A;  4EXJ A;  4LLR A;  1FVK A;  2GSR A;  3UMA A;  3GH9 A;  5KN3 A;  2AV4 A;  5B7C A;  1OE8 A;  1PL1 A;  1M0U A;  5DCG A;  1GNE A;  3LXZ A;  4XTS A;  2H6Y A;  1XZO A;  3FZ5 A;  4CHS A;  3IR4 A;  1GP1 A;  3A2W A;  2VL2 C;  8GSS A;  1IYI A;  4BA7 A;  2V32 A;  2DBC A;  3QCP A;  3ZL5 A;  4G2E A;  4NWY A;  4ZL9 A;  5ECI B;  1G7O A;  5IMC A;  1GSS A;  1Y6E A;  4DSR A;  3DKS A;  2LJK A;  4MZW A;  1SKS B;  2KHP A;  2AAW A;  5IOX A;  1Z6N A;  2FWE A;  1WWJ A;  4ZB6 A;  1PX7 A;  2LTK A;  3UIW A;  4MDC A;  4I97 A;  3TOT A;  5B8A A;  1PQN A;  2PBJ A;  2N5A A;  3LFL A;  2VM1 A;  1GUK A;  4TR3 A;  2R0P A;  1A0F A;  1U88 A;  2L4Q A;  4F82 A;  2K8S A;  2WDU A;  3ERF A;  1SK1 A;  1A8Y A;  3LGC A;  3QAW A;  4K0N A;  1A2M A;  14GS A;  4K5S A;  3Q18 A;  2YJ7 A;  4WKW A;  9GSS A;  3I43 A;  5HFI A;  4PQI A;  1M9B A;  1A8L A;  3MIX A;  5KOW A;  1OKT A;  4F9Z A;  4MJB A;  1J9B A;  6GSU A;  4HQZ A;  3KH7 A;  4HUA A;  3CSH A;  5ELG A;  1XWC A;  3W8J A;  3WGX A;  1PMT A;  4CY6 A;  5H5Q A;  3NOF A;  1ZYQ B;  2R37 A;  3TKS A;  3C73 A;  4FO5 A;  3F4T A;  3IDV A;  3D6I A;  3APO A;  1OC8 A;  4G0L A;  1X9S B;  4IW9 A;  4XRD A;  3GKX A;  2XHF A;  1GH2 A;  3FHK A;  3U6V A;  1ZGN A;  3VUR A;  4HU7 A;  1OC3 A;  3QR6 A;  1LU4 A;  2HYX A;  4QQ7 A;  3ME7 A;  3GKK A;  4PNF A;  4BVY B;  1QMV A;  3HDC A;  5J4U A;  3GHA A;  1JZW A;  3WGD A;  4E8E A;  3FYG A;  1VF3 A;  2HT9 A;  2F51 A;  3O3T A;  4MH3 A;  5ECO B;  4EL1 A;  2HZE B;  1R4W A;  1XWA A;  3P2A A;  2VD0 A;  3IE3 A;  3GST A;  4DEJ A;  2PVO C;  2C3T A;  3GRX A;  2MMA A;  4V2M A;  2HI7 A;  3US3 A;  2CT6 A;  4N0Z A;  3H4K A;  6GSV A;  1A2L A;  2IFQ B;  4O92 A;  4FH8 A;  1ERU A;  2QA1 A;  5ECK B;  3VK9 A;  3ZIT A;  2HNL A;  2MMN A;  1OKD A;  2HRK A;  1M2B A;  4K6X A;  1FO5 A;  2A2R A;  5F05 A;  1TKD B;  4ML6 A;  1EP7 A;  2IME A;  4KH7 A;  4Z2T A;  1V57 A;  3EE2 A;  2JAC A;  1HYU A;  2VCT A;  4JU5 A;  1FVJ A;  3FZ9 A;  4K7I A;  4AF2 A;  5B8B A;  3D5J A;  6GSY A;  1ZMA A;  4MF7 A;  4EDY A;  4I2U A;  4NPB A;  1TK8 B;  1X9M B;  2H01 A;  2H72 A;  3QMX A;  2HZE A;  4RI7 A;  1JZO A;  3EPT A;  2K6V A;  1DUG A;  4PUR A;  4WR4 A;  4MNN A;  2FA4 A;  3NIV A;  4I6X A;  4ZB9 A;  4YQV A;  1XCC A;  4YAV A;  5E59 A;  4H86 A;  3IXR A;  1THO A;  1H75 A;  4F0B A;  1DE1 A;  16GS A;  2VL9 A;  1JZD A;  2NVL A;  1NHY A;  2IFQ A;  5AIS A;  4TOP A;  4JE1 A;  3VWU A;  1SJZ A;  3Q19 A;  1M2A A;  1N2A A;  1BJX A;  2OBK A;  3F0I A;  2R3X A;  3QOU A;  1ZYE A;  5BRT A;  4KW6 A;  4HDE A;  1GSQ A;  2E0Q A;  1NW2 A;  2VM2 A;  5FWG A;  2TIR A;  3GTU B;  2WCI A;  3HJP A;  4TR4 A;  3G9B A;  3BBY A;  3GX8 A;  2V2G A;  2X64 A;  4YKF A;  5IM9 A;  1DE2 A;  2CAI A;  1TU7 A;  2A2S A;  4ZBD A;  3WGE A;  4F0C A;  4V2L A;  4HJ2 A;  1Z7P A;  2L4C A;  5DCH A;  4WF4 A;  2EIO A;  3L9V A;  4OO4 A;  3UVT A;  1F37 A;  2B1K A;  5ID2 B;  1Z7R A;  3DEX A;  2ES7 A;  4K0G A;  3EUR A;  5IO0 A;  3ZRD A;  2F9S A;  2N5F A;  1KEB A;  4K9Z A;  3ERG A;  2C8U A;  4WBJ A;  1BX9 A;  2CV4 A;  5KOX A;  4Q5F A;  2CVB A;  4EVM A;  5KEJ A;  2V41 A;  4CDO A;  5AGY A;  1O73 A;  3F8U A;  4RI6 A;  5INY A;  2C3Q A;  4GCI A;  1GSY A;  5GAP D;  3GTU A;  1SD9 A;  3MSZ A;  2VLV A;  3IHQ A;  3VPQ A;  3ZFB A;  3E0U A;  4TXV A;  1JLW A;  3LYP A;  3J7Y b;  4LMW A;  3ZMK A;  1PD2 1;  5G5E A;  2LRT A;  1EZK A;  4POB A;  5ID2 A;  2H19 A;  1AQV A;  4ZL7 A;  4Z7X A;  4X4J A;  5AIX A;  4G19 A;  1THX A;  5FHI A;  1MDI A;  3DYR A;  12GS A;  3M8N A;  1GWC A;  1O6J A;  3GKM A;  4BWQ A;  1TDI A;  3TJG A;  3GUR A;  3ERW A;  4J57 E;  1XBS A;  2MYG A;  2H0G A;  1YF1 A;  3TRX A;  2L59 A;  3UEM A;  3ZML A;  3CSI A;  4KAE A;  3DWV A;  1ZYP A;  3HYP A;  4MPG A;  2ON5 A;  5ECN B;  4X0X A;  2OE3 A;  2GQK A;  5DDL A;  2IPA A;  3QAG A;  1GSU A;  4GQC A;  2PN8 A;  3D4T A;  4QL7 A;  2JSY A;  2LST A;  4HZ2 A;  2RLI A;  1QQ2 A;  4GSN A;  2P0G A;  5DQY A;  2R6K A;  2C0E A;  1SD8 A;  2MMO A;  2O87 A;  2GSQ A;  4AJ8 A;  4Q5Q A;  1XW5 A;  4HJM A;  3TRP A;  1X5D A;  3L4N A;  2H70 A;  1I5G A;  3M1G A;  1KNG A;  1QUW A;  6GST A;  2HE3 A;  1V58 A;  2CQ9 A;  2DJK A;  2ZUP A;  1C72 A;  1GTB A;  4FYU A;  1T4Y A;  2ALB A;  4D73 B;  1V9W A;  4PXO A;  3K8N A;  1T8E B;  3TJF A;  1ON4 A;  3TKS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...