2O87A

S. aureus thioredoxin p31s mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
b'AIVKVTDADFDSKVESGVQLVDFWATWCGSCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title The conserved active site proline determines the reducing power of Staphylococcus aureus thioredoxin
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Electron transport
total genus 27
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2o87A00
3P8WA 1JHBA 3KGKA 2HI7A 4FH8A 3IC4A 4N0ZA 4O32A 5G5FA 4KSMA 4TR0A 2WJUA 4MJCA 3DXBA 1HNAA 3EMXA 4E8HA 4DSSA 3ISOA 1R4WA 3ZMKA 1YEXA 1SK2A 3HZ8A 1O73A 2CAIA 2YN1A 5IOXA 3A2XA 5GZZB 4BVXA 2FA8A 2HYXA 1VF2A 4Q5FA 2R4VA 4NMUA 2X8HA 2QGVA 2HSYA 2YZHA 4KSOA 4OFNA 3V1WA 4XS4B 2H70A 3FR3A 5DJMA 1AIUA 3IR4A 4K0GA 1K0AA 2B6MA 2I1UA 5IM9A 3KM6A 4KDUA 4WEYA 4JBBA 4ULXA 4OCFA 3TKRA 1MDKA 4NV5A 4YAVA 2IWTA 2X64A 2L4CA 19GSA 2VCZA 2VO4A 2E0QA 5DALA 2GZYA 1BG5A 2C80A 2OE0A 3JCML 1TRUA 2L6DA 3FZ4A 2AB6A 4PQIA 2R6KA 4D73B 1NM3A 1GULA 4ML6A 5LD0A 5A4VA 3M3MA 3TCOA 2V6OA 4O5RA 2P31A 4J2FA 1SD9A 2R2JA 2OADA 1K0OA 3W8JA 1TK8B 4POBA 5D9TA 3EU4A 2LQQA 3GX8A 3TKSC 3EU3A 2OBIA 4N11A 1CQHA 2DC5A 1JFUA 4GQCA 2GT5A 3KIJA 3ED3A 3LORA 4KE3A 1TU8A 4NHWA 1WJKA 1EV4A 4K0NA 3IXRA 3UBKA 4PGTA 1SK1A 1EWXA 1KBNA 2AHEA 5IOWA 3CRUA 1B9XC 3L4NA 3VURA 2H30A 1GSYA 4EKZA 5FT3A 1QMVA 4EO3A 1U87A 2EIOA 3ZIJA 1PL1A 4MMMA 3BD2A 2AJQB 1V98A 2V6KA 1ERWA 2LUSA 5GSSA 3HJMA 1TTZA 1V57A 3TJGA 1N2AA 2VOCA 3AY8A 5E59A 3RAZA 5J5NA 3Q74A 2HT9A 3HZ4A 1ZOFA 4GXZA 4OO5A 4XRDA 2CAQA 2DJKA 4AF2A 1SKWB 3U5RE 5G1KA 5CRGA 1MTCA 3DRNA 1B9YC 2PBJA 3GKNA 3UEMA 4HZ2A 1DE2A 1WIKA 1OE8A 4MZWA 2H73A 3CYNA 5ECKB 3UBLA 1YKCA 2VLVA 2GQMA 2WZ9A 1VGLA 1OVNA 3D4MA 4PQHA 2XBQA 1V2AA 4MF6A 1NHOA 1XW6A 1PX6A 2IPAA 3P7XA 5ENUA 1OC9A 4PURA 1F3BA 3GNJA 1F37A 2FY6A 3IPZA 4EDYA 4ZILA 2VL2C 2FWGA 3EVIA 2GZZA 4KB3A 4NHZA 2PGTA 2FLSA 1O8XA 1FVKA 3TUEA 5B8AA 7GSSA 1AAZA 1M9BA 2RM5A 4Z7XA 4GSSA 3E3EA 2JU5A 2MYGA 2E2GA 4HU9A 1USBA 1EOGA 4WR5A 1A23A 1FHEA 4BVYA 4HJMA 3A3TA 4IQAA 1M0UA 3TKSA 1PN9A 4TR1B 4XIHA 4IQ1A 2GZPA 5JCGA 2QC7A 3EYTA 1WOUA 2G0FA 4RUVA 1XWGA 3FHKA 1W4VA 5ABRA 5G31A 3PINA 2KP1A 1GH2A 1ERUA 3ERFA 2DLXA 3E0UA 1BJXA 1GSFA 3GKKA 4TR4A 4MF7A 1GUMA 4J56E 3CXGA 2TRXA 2QKEA 3LEFA 3IHQA 3GL5A 1NSWA 2LJRA 1GTAA 3RHBA 4MJBA 4EVMA 1WMJA 3DIEA 3C73A 2L57A 3ME7A 2H6YA 1F2EA 2DIYA 1Z7PA 4LA1A 2XHFA 4OFMA 3EINA 1YKAA 1O8WA 2HE3A 5F8BA 2B5XA 2DMLA 1TDIA 2B7JA 2H6XA 3TKQA 1YZXA 1DBYA 5CYYA 2I3YA 2DJ0A 4TXOB 4I8BA 3CSHA 1GSEA 4G19A 5DQSA 1GNWA 4TKYA 4X43A 2FNOA 2GSTA 4AGSA 3TGZA 4BA7A 2H71A 4JE1A 3DEXA 1TW9A 18GSA 2G2QA 4WETA 3DYRA 3FW2A 1O7UA 2FUG2 2HLSA 3QOUA 4L0WA 1OC8A 2H0GA 4JR6A 4F0CA 5DBQA 2HXKA 2XPEA 1LBKA 2F9SA 2FWHA 5DJLA 2VL2A 3UVTA 1MDJA 4WBJA 5G5EA 2YV7A 5IMDA 1PMTA 4GQFA 2H1DA 3QDNA 2M46A 4GLTA 1QUWA 2P5QA 3O3TA 2FHEA 2I9HA 2GSRA 1BEDA 2VLTA 4XS4A 1GL8A 3HVVA 3VLNA 1XVQA 4EC0A 1K0DA 1M99A 1M2DA 1O81A 3E9JB 2MBTA 4MDCA 5LNKe 2B1LA 5J4UA 2TIRA 1YF0A 1IYHA 3ME8A 5DAKB 4POMA 5IMZA 3MNGA 2M80A 5C04A 4GWRA 4PUFC 2P5RA 3KMOA 5HFGA 3UL3A 3HDCA 22GSA 1THXA 4D73A 2DJ1A 3F6DA 1WRYA 2HRFA 4MZCA 3MWHA 1SENA 4L0UA 3A2WA 3GKMA 2B5EA 20GSA 3GSTA 4V1Ag 1R5AA 2CT6A 3EWLA 4HQZA 3GIXA 1OKDA 5KN1A 5ECSA 1ST9A 1E6BA 1K0BA 1B48A 4N0VA 2VD1A 2YWOA 2LRCA 1ZMAA 4ZBAA 2FWEA 3IK7A 4IS0A 1A8YA 3RDWA 2IL3A 3LXTA 1TU7A 2PU9C 3GA4A 1QGVA 4BWQA 3GH9A 2DMMA 3K8NA 6GSXA 4CHSA 3PH9A 3EMPA 4ECBA 2B1KA 2R3XA 1T3BA 5D9XA 2V32A 2ALBA 5IO0A 2IIYA 4KDXA 2I4AA 3KEBA 4MPFA 4WBRD 3D0ZA 3ZRDA 1JLVA 2YWIA 3CSJA 4FIWA 1X5EA 1VF3A 2IFQB 1AXDA 4LL4B 1Z9HA 5D8IA 3KTBA 5B6NA 3P2AA 3TJFA 5HR2A 4WR4A 1J9BA 4OO4A 1EP7A 4V1Ap 1UVZA 4WXTA 3ZLPA 2OJLA 3FYGA 2IJYA 1RQMA 2AUVA 5JWRB 1XXUA 3UAPA 5CAXA 3I6AA 3GSSA 1QQ2A 2CZ2A 2H74A 2N5AA 2F3MA 3DVXA 1UA5A 1G7OA 1DE1A 2JZRA 1SD8A 2GT6A 5H5RA 2C1YA 4LL1B 1GLQA 3ERWA 3UOMA 1M2BA 3BCIA 3D6IA 1SK0A 2H1GA 1W89A 2IMKA 1T4YA 2H66A 2YWNA 3GMFA 3VI7A 3QCPA 2PMTA 2B3SA 6GSVA 2VCTA 2HZEB 2HNLA 4FYBA 2K8VA 1BYEA 5B6MA 2AAWA 3D4TA 4J57E 4F0BA 4HEA2 3ZFLA 2H75A 3WT1A 2RLIA 3GH6A 1VRSD 3HD5A 3IBHA 4GRFA 3ZTLA 3F4TA 4V2MA 5F06A 2C0FA 2YANA 4ILFA 1A0FA 4MCUA 4TR1A 2DSAA 4HJ2A 2EC4A 2R5GA 1KEBA 2DJJA 2VM1A 2OBKA 3O6TA 3UVHA 1ABAA 1GTIA 3GUSA 5KEJA 5GAPD 2C4JA 1X5DA 1MD3A 1B4QA 4GSTA 4HOJA 2VCWA 2WGRA 2K9FA 3I9V2 3TDGA 3QFBC 1GUKA 2X99A 3QD9A 1RK4A 4AJ6A 5A5KA 2O85A 5IQYA 1OYJA 1H4OA 4WKWA 1OC3A 3EURA 4XTSA 1FB0A 2GTUA 4F82A 3MSZA 4G2EA 5IMAA 2ZUPA 3I43A 2HFDA 4CDOA 3G9BA 6GSUA 2GGTA 2PUKC 2X8CA 3ZFBA 14GSA 3IA1A 4NWYA 3TJBA 5IMVA 3HXSA 4F03A 2OKAA 5IO2A 3WT2A 3C7MA 4MJAA 1SL1B 4K7OA 1Y6EA 4KX4A 3P90A 2LJKA 2KHPA 2KOKA 1C72A 4DSQA 4HU7A 3F8UA 3WGEA 5ECRB 2DBCA 1EP8A 3G7JA 2H19A 4ECCA 2ZNMA 5ECIB 5KN3A 3HCZA 1VF1A 1GTBA 3GX0A 3FY7A 4K2DA 3KH9A 1SJ6A 4IELA 1X5CA 5KN2A 2JACA 3M8NA 4JRRA 3SWLA 1XBSA 1ON4A 3FZAA 3ZMLA 1YDKA 3IAM2 2MMAA 5CO3A 3F4SA 5EPFA 1Q98A 4L5LA 2VD0A 1HNCA 1EZKA 3CTFA 4OMVA 1T00A 4I5QA 3M9JA 3IDVA 4YQMA 2HRNA 1XWKA 1Z7RA 3GL3A 5DAKA 2PWJA 3FRCA 3GRXA 4IJIA 5CP1A 4PUAA 1T4ZA 1XPVA 3Q6OA 5FWGA 3QAWA 2CA8A 3FK8A 4XS1A 5AIVA 4ECIA 2JZTA 4ZB9A 3C1SA 5DALB 4QL9A 3DKSA 1XIYA 1A8LA 3QFAC 4PXOA 4KAEA 2YWMA 3DGQA 4IP6A 2O89A 2VUPA 1U3IA 2HSHA 4IN0A 2VAFA 2NDOA 1SL0B 2CVKA 2M72A 1J08A 2L5OA 3F9UA 1GWCA 2PVQA 4XHMA 3GKXA 4F2IA 2L59A 2WFCA 1X9SB 3LQ7A 4GCIA 3TKSE 1TJDA 1XOAA 1GTUA 5L71A 4POKA 2H0HA 4TN8A 1R7HA 1PL2A 2RUFA 2OACA 3VWUA 3RHCA 2C0GA 3DMLA 1ZYEA 17GSA 2EIRA 2MMZA 4IP1A 1F6MC 4ZB8A 2X8GA 4O7HA 1SKSB 4KH7A 2LS5A 3HHVA 3HKRA 4TXVA 3LYKA 1TXXA 1FO5A 1XW9A 5D9WA 3FR9A 1XWAA 5B8BA 2LEGA 2JL4A 4BWSA 1V58A 4I2UA 3QAGA 4OD7A 2WS2A 1BQ7A 2D2ZA 2YPMA 4XRAA 2FCHA 3N9JA 4NXIA 2YCDA 4X0XA 3VFIA 1YQ1A 5AISA 3LSZA 3G7YA 1X0RA 2MZCA 1EOHA 2Z9SA 4TOPA 4BL7A 5G1LA 4K1FA 2VCQA 5FHIA 3DWVA 1XWBA 4HQSA 3US3A 1T8EB 2LRTA 1SU9A 1MD4A 2F8FA 3H79A 2V2GA 4N30A 3Q18A 1ERTA 1FG4A 2GLRA 1UC7A 2C0DA 5C00A 1SKRB 2V1MA 2ES7A 2NPBA 1TOFA 1X9MB 4MH3A 2FWFA 2GQLA 2WCIA 1AQXA 1M7TA 4N10A 3FZ9A 1BAYA 1PKZA 1ZGNA 5CRDA 1Z6NA 2HZEA 5LCZA 3UIWA 5EY6A 2C3QA 2GSSA 3FKFA 2PN8A 4NAXA 2OE1A 3RPNA 5HFIA 2A4VA 5EL8A 2YOIA 2CZ3A 1KNGA 2H1AA 3CTGA 5DCHA 5J41A 2MBSA 2JSYA 1THOA 4WF4A 5DCGA 2CVDA 3HVSA 1HQOA 4ZXGA 2VL9A 11GSA 3HJOA 3IE3A 1A2MA 1A0RP 3I69A 4ZIJA 4EUYA 1G6YA 2CQ9A 3GV1A 5IMCA 1SYXA 2FGXA 5CREA 5KN0A 5G30A 1K3OA 1TRSA 4MPGA 4K7IA 1EEJA 3EE2A 2GDRA 3LG6A 4RI6A 1OKTA 5ID2B 3KD0A 5ECHB 1ILOA 5ELAA 2HZFA 3IK9A 1A24A 4FYCA 2LQOA 2E2MA 4MF5A 1TK5B 4V2LA 4XCSA 4KUNA 2BMXA 4Q5NA 4E8EA 4IHUA 3SBCA 3L9VA 2FA4A 2MMNA 4IGJA 2DJ3A 2N5BA 3HY2A 1EV9A 2AYTA 1MDIA 2QSIA 5J9BA 2CX3A 3LJRA 3TRQA 2H1BA 16GSA 4GSNA 2K18A 4V2NA 2H72A 4RI7A 2PERA 3HJPA 3KZQA 1Z5YE 1B8XA 4HUAA 3VWWA 1BX9A 2C0EA 12GSA 2FD3A 2VCXA 3BCKA 3L0HA 6GSSA 5D73A 2IMIA 2ON5A 2J9HA 1RW1A 4FYUA 1ZZYA 1GRXA 1PA3A 4EF0A 1EGRA 1K0MA 1U6TA 4MH2A 3ZL5A 5D9VA 3C8EA 1Z6MA 4TVEA 1AQWA 1K3LA 1M9AA 3ZITA 1G0TA 2I81A 2LNSA 3UARA 1AUCA 1JZOA 4G10A 4EE0A 5JWQB 4ZL9A 3D21A 3WGDA 5ECPB 2YP6A 3LWAA 1PSQA 2RUEA 1ML6A 6GSTA 3TJJA 3QR6A 2H01A 5D93A 3OR5A 1TKDB 3M9KA 2C3TA 5F07A 3APSA 3NZNA 1K3YA 4JEDA 5JCUA 3L9SA 1M2AA 2VCVA 1DUGA 2LTKA 4DEJA 4G9HA 1ZCPA 3D5JA 1YJ6A 4MABA 3APQA 3HVXA 4GTUA 2VLUA 1YEPA 4IW9A 1UN2A 2OA7A 4I2TA 3F63A 2YJHA 1J0FA 3KP8A 1B4PA 4PX1A 4RQXA 3IOSA 1JZWA 5INYA 3ZVJD 3A5WA 4IBPA 4Q5QA 2TRCP 5AGYA 3CRTA 5DDLA 3GTUB 1XCCA 1S3DA 3GFKA 3VK9A 1NHYA 3FZ5A 5E4WA 5DVBA 1XZOA 13GSA 4ID0A 4JZQA 2K6VA 5D96A 1TP9A 4LLRA 1X9WB 3TRXA 4KA0A 4HDEA 2EIQA 5AIXA 2ON7A 1ACVA 2LSTA 2L5LA 3IAS2 1PKWA 4ECJA 1HNBA 4DSRA 1I5GA 2F51A 3F3QA 3A2VA 5ECNB 4GF0A 3J7Yb 3H93A 1URMA 2P0GA 1T7PB 1Q4JA 3HA9A 4FO5A 4IVFA 1EEMA 1O85A 4HS1A 4IJ3A 4ML1A 4TXOA 3ZIVA 1K0NA 5G2ZA 3VPQA 2GQKA 2KUCA 4K8MA 1FVJA 2CX4A 4CW9A 2GVPA 1OAZA 2H8LA 2WRTA 1N8JA 3WYWA 1R5PA 3GURA 3TJKA 1PGTA 3H1NA 5CRWA 2DIZA 5B7CA 3CBUA 3DVWA 2IMEA 3ZVJA 4LMVA 2KLXA 4X1UA 4L5OA 3WD6A 3GYKA 3RPPA 4DVCA 2IMDA 3FEUA 3F6FA 2L4QA 1FAAA 5COHA 2H0IA 4DSSB 3PGTA 2GS3A 1GSDA 3QAVA 3LFLA 3ZZXA 5HFKA 2MMOA 4QL7A 5CNWA 2F8AA 1ERVA 1HYUA 1YF1A 3M0FA 4ACSA 4F9ZA 4ISDA 4RQRA 3VWXA 3APOA 4OWYA 3H4KA 6GSYA 2YZUA 3CSIA 2IN3A 1XOBA 1PRXA 4HZ4A 5EVOA 3TB2A 3NIVA 4K9ZA 3L9UA 3VWVA 4ZBDA 4HI7A 3HYPA 3BBYA 3MAKA 4QQ7A 5ECMB 3PR8A 1QK8A 1K0CA 1AC1A 3LGCA 5IIZA 3BOAA 1U3AA 1CQGA 1HD2A 5J9CA 3KH7A 3D22A 3F0IA 3GHAA 4LMWA 1AW9A 1IYIA 4JU5A 1U88A 4KCAA 2VIMA 1A2JA 1R26A 1WPIA 3RBTA 2WDUA 2LKUA 4OFTA 2VM2A 4NPBA 2B7KA 6GSWA 1QXHA 4MZBA 3VPTA 1S3AA 3BJ5A 4OCEA 5ID2A 2RM6A 3CMIA 1KTEA 1QFNA 1A2LA 1SJZA 2B5YA 4NV2A 3MDKA 3KXOA 2NBSA 5ECOB 1JLWA 4YQUA 3EC3A 2YJ7A 3IRAA 2BJXA 5IMFA 1WWJA 2LNTA 1Y25A 1XVWA 5GAND 1GUHA 1AQVA 2BTOT 3U6VA 3W6GA 3FR6A 1FOVA 3M1GA 4MK3A 1H75A 1PD21 4TRXA 1V9WA 2IFQA 2IMFA 4WF5A 4MP4A 3F3RA 4KCEA 4O92A 1TRVA 3DD3A 4KGIA 2VL3A 1JZRA 4I6XA 2XC2A 4AJ7A 4AJ8A 1E2YA 10GSA 3WGXA 3QPMA 1ZYQB 4MJEA 3KTLA 4K6XA 5JCWA 2WULA 2O87A 2C3NA 2DJ2A 1GSQA 1O6JA 2WB9A 5DQYA 1SJIA 3ZREA 1XWCA 3UJ1A 2C8UA 3C71A 2RIIA 1FB6A 2R37A 4MA9A 3TRPA 2NVLA 5F0GA 4ZBBA 1XW5A 4I97A 3UMAA 5A4WA 3ERGA 2CV4A 2JZSA 1DSBA 5ELGA 4TW5A 1GNEA 2XBIA 4IKHA 4EDZA 2E7PA 5JWOB 4KNDA 5HR1A 4YQVA 2L6CA 3KCMA 4TR3A 4YH2A 3J7Yk 2XPDA 3O76A 2H76A 3W8SA 2PVOC 5ECLB 1OC9B 2CVBA 4K7NA 5HR3A 1LU4A 2H6ZA 1G6WA 2O8VB 4JR4A 1JZDA 4YAPA 2LJAA 4PNGA 2KP2A 1GSSA 2A2SA 1GSUA 3C1RA 3ZYWA 8GSSA 5AN1A 4ZL8A 5HQPA 3G7IA 1G7EA 2J23A 4BPYA 3R2QA 5HR0A 2JSZA 4ZL7A 3VI5A 4H86A 1I9DA 1MEKA 4L8EA 1PX7A 3N5OA 2LV3A 5ECQB 3TKPA 2LRNA 1WP0A 1GP1A 4P3YB 5GSTA 3KP9A 2YNXA 2JADA 4PQ1A 4ZB6A 4EL1A 1Z3EA 1F3AA 5F05A 1WE0A 2A2RA 2K8SA 9GSSA 3S9FA 3GTUA 5A4UA 1SL2B 2YV9A 2GSQA 1S3CA 1XFLA 5CRHA 1NW2A 1T1VA 3TOTA 3KJYA 4PNFA 1FW1A 2ZCTA 2PPTA 5IPGA 1VF4A 1F9MA 3LXZA 1V40A 4XS6A 5J3RA 3GN3A 1PQNA 3F4RA 1SYRA 1TRWA 1LJRA 3KMNA 3QMXA 3Q19A 2AV4A 4KDYA 3TOUA 3LYPA 1TI3A 2V41A 1YY7A 1EGOA 2NTOA 1OE7A 2OE3A 3H8QA 4Q5RA 4EXJA 2O7KA 3NOFA 5IPHA 3IV4A 1ZL9A 3L78A 5H5QA 2REMA 5H5SA 4MLYA 1GLPA 4POLA 1TI1A 4KW6A 2N5FA 1TK0B
chains in the Genus database with same CATH superfamily
3P8WA 1JHBA 3KGKA 2HI7A 4FH8A 3IC4A 4N0ZA 4O32A 5G5FA 4KSMA 4TR0A 2WJUA 4MJCA 3DXBA 1HNAA 3EMXA 4E8HA 4DSSA 3ISOA 1R4WA 3ZMKA 1YEXA 1SK2A 3HZ8A 1O73A 2CAIA 2YN1A 5IOXA 3A2XA 5GZZB 4BVXA 2FA8A 2HYXA 1VF2A 4Q5FA 2R4VA 4NMUA 2X8HA 2QGVA 2HSYA 2YZHA 4KSOA 4OFNA 3V1WA 4XS4B 2H70A 3FR3A 5DJMA 1AIUA 3IR4A 4K0GA 1K0AA 2B6MA 2I1UA 5IM9A 3KM6A 4KDUA 4WEYA 4JBBA 4ULXA 4OCFA 3TKRA 1MDKA 4NV5A 4YAVA 2IWTA 2X64A 2L4CA 19GSA 2VCZA 2VO4A 2E0QA 5DALA 2GZYA 1BG5A 2C80A 2OE0A 3JCML 1TRUA 2L6DA 3FZ4A 2AB6A 4PQIA 2R6KA 4D73B 1NM3A 1GULA 4ML6A 5LD0A 5A4VA 3M3MA 3TCOA 2V6OA 4O5RA 2P31A 4J2FA 1SD9A 2R2JA 2OADA 1K0OA 3W8JA 1TK8B 4POBA 5D9TA 3EU4A 2LQQA 3GX8A 3TKSC 3EU3A 2OBIA 4N11A 1CQHA 4PTSA 2DC5A 1JFUA 4GQCA 2GT5A 3KIJA 3ED3A 3LORA 4KE3A 1TU8A 4NHWA 1WJKA 1EV4A 4K0NA 3IXRA 3UBKA 4PGTA 1SK1A 1EWXA 1KBNA 2AHEA 5IOWA 3CRUA 1B9XC 3L4NA 1PFOA 3VURA 2H30A 1GSYA 4EKZA 4Z2UA 2UZ8A 5FT3A 1QMVA 4EO3A 1U87A 2EIOA 3ZIJA 1PL1A 4MMMA 3BD2A 2AJQB 1V98A 2V6KA 1ERWA 2LUSA 5GSSA 3HJMA 1TTZA 1V57A 3TJGA 1N2AA 2VOCA 3AY8A 5E59A 3RAZA 5J5NA 3Q74A 2HT9A 3HZ4A 1ZOFA 4GXZA 4OO5A 4XRDA 2CAQA 2DJKA 4AF2A 1SKWB 3U5RE 5G1KA 5CRGA 1MTCA 3DRNA 1B9YC 2PBJA 3GKNA 4G0IA 3UEMA 4HZ2A 1DE2A 1WIKA 3HVNA 1OE8A 4MZWA 2H73A 3CYNA 5ECKB 3UBLA 1YKCA 2VLVA 2GQMA 2WZ9A 1VGLA 1OVNA 3D4MA 4PQHA 2XBQA 1V2AA 4MF6A 1NHOA 1XW6A 1PX6A 2IPAA 3P7XA 5ENUA 1OC9A 4PURA 1F3BA 3GNJA 1F37A 2FY6A 3IPZA 4EDYA 4ZILA 2VL2C 2FWGA 3EVIA 2GZZA 4KB3A 4NHZA 2PGTA 2FLSA 1O8XA 1FVKA 3TUEA 5B8AA 7GSSA 1AAZA 1M9BA 2RM5A 4Z7XA 4GSSA 3E3EA 2JU5A 2MYGA 2E2GA 4HU9A 1USBA 1EOGA 4WR5A 1A23A 1FHEA 4BVYA 4HJMA 3A3TA 4IQAA 1M0UA 3TKSA 1PN9A 4TR1B 4XIHA 4IQ1A 2GZPA 5JCGA 2QC7A 2QA1A 3EYTA 1WOUA 2G0FA 4RUVA 1XWGA 3FHKA 1W4VA 5ABRA 5G31A 3PINA 2KP1A 1GH2A 1ERUA 3ERFA 2DLXA 3E0UA 1BJXA 1GSFA 3GKKA 4TR4A 4MF7A 1GUMA 4J56E 3CXGA 2TRXA 2QKEA 4Z2RA 3LEFA 3IHQA 3GL5A 1NSWA 2LJRA 1GTAA 4ICYA 3RHBA 4MJBA 4EVMA 1WMJA 3DIEA 3C73A 2L57A 3ME7A 2H6YA 1F2EA 2DIYA 1Z7PA 4LA1A 2XHFA 4OFMA 3EINA 4YKGA 1YKAA 1O8WA 2HE3A 5F8BA 2B5XA 2DMLA 3MYDA 1TDIA 2B7JA 2H6XA 3TKQA 1FOHA 3A5IA 1YZXA 1DBYA 5CYYA 2I3YA 2DJ0A 4TXOB 4I8BA 3CSHA 1GSEA 4G19A 5DQSA 1GNWA 4TKYA 4X43A 2FNOA 2GSTA 4AGSA 3TGZA 4BA7A 2H71A 4JE1A 3DEXA 1TW9A 18GSA 2G2QA 4WETA 4X4JA 3DYRA 3FW2A 3CQFA 1O7UA 2FUG2 2HLSA 3QOUA 4L0WA 1OC8A 2H0GA 4JR6A 4F0CA 5DBQA 2HXKA 2XPEA 1LBKA 2F9SA 2FWHA 5DJLA 2VL2A 3UVTA 1MDJA 4WBJA 5G5EA 2YV7A 4G0LA 5IMDA 1PMTA 4GQFA 4HSCX 2X49A 2H1DA 3QDNA 2M46A 4GLTA 1QUWA 2P5QA 3O3TA 2FHEA 2I9HA 2GSRA 1BEDA 2VLTA 4XS4A 1GL8A 3HVVA 3VLNA 1XVQA 4EC0A 1K0DA 1M99A 1M2DA 1O81A 3E9JB 2MBTA 4MDCA 5LNKe 2B1LA 5J4UA 2TIRA 1YF0A 1IYHA 3ME8A 5DAKB 4POMA 5IMZA 3MNGA 2M80A 5C04A 4GWRA 4PUFC 2P5RA 3KMOA 5HFGA 3UL3A 3HDCA 22GSA 1THXA 4D73A 2DJ1A 1ZYNA 2DKIA 3F6DA 1WRYA 2HRFA 4K2XA 4MZCA 3MWHA 1SENA 4L0UA 3A2WA 3GKMA 2B5EA 20GSA 3GSTA 4V1Ag 1R5AA 2CT6A 3EWLA 4HQZA 3GIXA 1OKDA 5KN1A 5ECSA 1ST9A 1E6BA 1K0BA 1B48A 4N0VA 2VD1A 2YWOA 2LRCA 1ZMAA 5BMUA 4ZBAA 2FWEA 3IK7A 4IS0A 1A8YA 3RDWA 2IL3A 3LXTA 1TU7A 2PU9C 3GA4A 1QGVA 4BWQA 3GH9A 2DMMA 3K8NA 6GSXA 4CHSA 3PH9A 3EMPA 4ECBA 2B1KA 2R3XA 1T3BA 5D9XA 2V32A 2ALBA 5IO0A 2IIYA 4KDXA 2I4AA 3KEBA 4MPFA 4WBRD 3D0ZA 3ZRDA 1JLVA 2YWIA 3CSJA 4FIWA 1X5EA 1VF3A 2IFQB 1AXDA 4LL4B 1Z9HA 5D8IA 3KTBA 5B6NA 3P2AA 3PPUA 3TJFA 5HR2A 4WR4A 1J9BA 4OO4A 1EP7A 4V1Ap 1UVZA 4WXTA 3ZLPA 2OJLA 3FYGA 2IJYA 1RQMA 2AUVA 5JWRB 1XXUA 3UAPA 5CAXA 3I6AA 3GSSA 1QQ2A 2CZ2A 2H74A 2N5AA 2F3MA 3DVXA 1UA5A 1G7OA 1DE1A 2JZRA 1SD8A 2GT6A 4BL7B 5H5RA 2C1YA 4LL1B 1GLQA 3ERWA 3UOMA 1M2BA 3BCIA 3D6IA 1SK0A 2H1GA 1W89A 2IMKA 1T4YA 2H66A 2YWNA 3GMFA 3VI7A 3QCPA 2PMTA 2B3SA 6GSVA 2VCTA 4O5UA 2HZEB 2HNLA 4FYBA 2K8VA 1BYEA 5B6MA 2AAWA 3D4TA 4J57E 4F0BA 4HEA2 3ZFLA 2H75A 3WT1A 2RLIA 3GH6A 1VRSD 3HD5A 3IBHA 4GRFA 3ZTLA 3F4TA 4V2MA 5F06A 2C0FA 2YANA 4ILFA 1A0FA 4MCUA 4TR1A 2DSAA 4HJ2A 2EC4A 2R5GA 1KEBA 2DJJA 2VM1A 4CY6A 2OBKA 3O6TA 3UVHA 1ABAA 1GTIA 4EIPA 3GUSA 5KEJA 5GAPD 2C4JA 1X5DA 1MD3A 1B4QA 2DKHA 1M3IA 4GSTA 4HOJA 2VCWA 2WGRA 2K9FA 3I9V2 3TDGA 3QFBC 1GUKA 2X99A 3QD9A 1RK4A 4AJ6A 5A5KA 2O85A 5IQYA 1OYJA 1H4OA 4WKWA 1OC3A 3EURA 4XTSA 1FB0A 2GTUA 4F82A 3MSZA 4G2EA 5IMAA 2ZUPA 3I43A 2HFDA 4CDOA 3G9BA 6GSUA 2GGTA 2PUKC 2X8CA 3ZFBA 14GSA 3IA1A 4NWYA 3TJBA 5IMVA 3HXSA 4F03A 2OKAA 5IO2A 3WT2A 3C7MA 4MJAA 1SL1B 4K7OA 1Y6EA 4KX4A 3P90A 2LJKA 2KHPA 2KOKA 4YKFA 1C72A 4DSQA 4HU7A 3F8UA 3WGEA 5ECRB 2DBCA 1EP8A 3G7JA 2H19A 4ECCA 2ZNMA 5ECIB 5KN3A 3HCZA 1VF1A 1GTBA 3GX0A 3FY7A 4K2DA 3KH9A 1SJ6A 4IELA 1X5CA 5KN2A 2JACA 3M8NA 4JRRA 3SWLA 1XBSA 1ON4A 3FZAA 3ZMLA 1YDKA 3IAM2 2MMAA 5CO3A 3F4SA 5EPFA 1Q98A 4L5LA 2VD0A 1HNCA 1EZKA 3CTFA 4OMVA 1T00A 4I5QA 3M9JA 3IDVA 4YQMA 2HRNA 1XWKA 1Z7RA 3GL3A 2PWJA 3FRCA 3GRXA 4IJIA 5DAKA 5CP1A 4PUAA 1T4ZA 1XPVA 3Q6OA 5FWGA 3QAWA 2CA8A 3FK8A 4K5SA 4XS1A 5AIVA 4ECIA 2JZTA 4ZB9A 3C1SA 5DALB 4QL9A 3DKSA 1XIYA 1A8LA 3QFAC 4PXOA 4KAEA 2YWMA 3DGQA 4IP6A 2O89A 2VUPA 4O5QA 1U3IA 4KF9A 2HSHA 4IN0A 2VAFA 2NDOA 1SL0B 2CVKA 2M72A 1J08A 2L5OA 3F9UA 1GWCA 2PVQA 4XHMA 3GKXA 4Z2TA 4F2IA 2L59A 2WFCA 1X9SB 3LQ7A 4GCIA 3TKSE 1TJDA 1XOAA 1GTUA 5L71A 4POKA 2H0HA 4TN8A 1R7HA 1PL2A 2RUFA 2OACA 3VWUA 3RHCA 2C0GA 3DMLA 1ZYEA 17GSA 2EIRA 2MMZA 4IP1A 1F6MC 4ZB8A 2X8GA 4O7HA 3FMWA 1SKSB 4KH7A 2LS5A 3HHVA 3HKRA 4TXVA 3LYKA 1TXXA 1FO5A 1XW9A 5D9WA 3FR9A 1XWAA 5B8BA 2LEGA 2JL4A 4BWSA 1V58A 4I2UA 3QAGA 4OD7A 2WS2A 1BQ7A 2D2ZA 1XG8A 2YPMA 4XRAA 2FCHA 3N9JA 4NXIA 2YCDA 4X0XA 3VFIA 1YQ1A 5AISA 3LSZA 3G7YA 1X0RA 2MZCA 1EOHA 1M3JA 2Z9SA 4TOPA 4BL7A 5G1LA 4K1FA 2VCQA 5FHIA 3DWVA 1XWBA 4HQSA 3US3A 1T8EB 2LRTA 1SU9A 1MD4A 2F8FA 3H79A 2V2GA 4N30A 3Q18A 1ERTA 1FG4A 2GLRA 1UC7A 2C0DA 5C00A 1SKRB 2V1MA 2ES7A 2NPBA 1TOFA 1X9MB 4MH3A 2FWFA 2GQLA 2WCIA 1AQXA 1M7TA 4N10A 3FZ9A 1BAYA 1PKZA 1ZGNA 3R3EA 5CRDA 1Z6NA 2HZEA 5LCZA 3UIWA 5EY6A 2C3QA 2GSSA 3FKFA 2PN8A 4NAXA 2OE1A 3RPNA 5HFIA 2A4VA 2YOIA 5EL8A 2CZ3A 1KNGA 2H1AA 3CTGA 5DCHA 5J41A 2MBSA 2JSYA 1THOA 4WF4A 5DCGA 2CVDA 3HVSA 1HQOA 4CY8A 4ZXGA 2VL9A 11GSA 3HJOA 4USSA 3IE3A 1A2MA 1A0RP 3I69A 4ZIJA 4EUYA 1G6YA 2CQ9A 3GV1A 5IMCA 1SYXA 2FGXA 5KOXA 5CREA 5KN0A 5G30A 1K3OA 1TRSA 4MPGA 4K7IA 1EEJA 3EE2A 2GDRA 3LG6A 4RI6A 1OKTA 5ID2B 3KD0A 5ECHB 1ILOA 5ELAA 2HZFA 3IK9A 1A24A 4FYCA 2LQOA 4EIQA 2E2MA 4MF5A 4MNNA 1TK5B 4V2LA 4XCSA 4KUNA 2BMXA 4Q5NA 4E8EA 2QA2A 4IHUA 3SBCA 3L9VA 2FA4A 3LW9A 2MMNA 4IGJA 2DJ3A 2N5BA 3HY2A 1EV9A 2AYTA 1MDIA 2QSIA 5J9BA 2CX3A 3LJRA 3TRQA 2H1BA 16GSA 4GSNA 2K18A 4V2NA 1S3RA 2H72A 4RI7A 2PERA 3HJPA 3KZQA 1Z5YE 1B8XA 4HUAA 3VWWA 1BX9A 2C0EA 12GSA 2FD3A 2VCXA 3BCKA 3L0HA 6GSSA 5D73A 2IMIA 2ON5A 2J9HA 1RW1A 4FYUA 1ZZYA 1GRXA 1PA3A 4EF0A 1EGRA 1K0MA 1U6TA 4MH2A 3ZL5A 5D9VA 3C8EA 3IHGA 1Z6MA 4TVEA 1AQWA 1K3LA 1M9AA 3ZITA 2R0CA 1G0TA 2I81A 2LNSA 3UARA 1AUCA 1JZOA 4G10A 4EE0A 5JWQB 4ZL9A 3D21A 3WGDA 5ECPB 2YP6A 3LWAA 1PSQA 2RUEA 1ML6A 6GSTA 3TJJA 3QR6A 2H01A 5D93A 3OR5A 1TKDB 3M9KA 2C3TA 5F07A 3APSA 3NZNA 1K3YA 4JEDA 5JCUA 3L9SA 1M2AA 2VCVA 1DUGA 2LTKA 4DEJA 4G9HA 1ZCPA 3D5JA 1YJ6A 4MABA 3APQA 3HVXA 4GTUA 2VLUA 1YEPA 4IW9A 1UN2A 2OA7A 4I2TA 3F63A 2YJHA 1J0FA 3KP8A 1B4PA 4PX1A 4RQXA 3IOSA 1JZWA 5INYA 3ZVJD 3A5WA 4IBPA 4Q5QA 2TRCP 5AGYA 2HRAA 3CRTA 5DDLA 3GTUB 1XCCA 1S3DA 3GFKA 3VK9A 1NHYA 3FZ5A 5E4WA 5DVBA 1XZOA 13GSA 4ID0A 4JZQA 2K6VA 5D96A 1TP9A 4LLRA 1X9WB 3EPTA 3TRXA 4KA0A 4HDEA 2EIQA 5AIXA 2ON7A 1ACVA 2X4AA 2LSTA 2L5LA 3IAS2 1PKWA 4ECJA 1HNBA 4DSRA 1I5GA 2F51A 3F3QA 3A2VA 5ECNB 4GF0A 3J7Yb 3H93A 1URMA 2P0GA 1T7PB 1Q4JA 3HA9A 4FO5A 4IVFA 1EEMA 1O85A 4HS1A 4IJ3A 4ML1A 4TXOA 3ZIVA 1K0NA 5G2ZA 3VPQA 2GQKA 2KUCA 4K8MA 1FVJA 2CX4A 4CW9A 2GVPA 1OAZA 2H8LA 2HRKA 2WRTA 1N8JA 3WYWA 1R5PA 3GURA 3TJKA 1PGTA 3H1NA 5CRWA 2DIZA 5B7CA 3CBUA 3DVWA 2IMEA 3ZVJA 4LMVA 2KLXA 4X1UA 4L5OA 3WD6A 3GYKA 3RPPA 4DVCA 2IMDA 3FEUA 3F6FA 2L4QA 1FAAA 5COHA 2H0IA 4DSSB 3PGTA 2GS3A 1GSDA 1ZYPA 3QAVA 3LFLA 3ZZXA 5HFKA 2MMOA 2HSMA 4QL7A 5CNWA 2F8AA 4BVXB 1ERVA 1HYUA 1YF1A 3M0FA 4ACSA 4F9ZA 2A4HA 4ISDA 4RQRA 3VWXA 3APOA 4OWYA 3H4KA 6GSYA 2YZUA 3CSIA 2IN3A 1XOBA 1PRXA 4HZ4A 5EVOA 3TB2A 3NIVA 4K9ZA 3L9UA 3VWVA 4ZBDA 4HI7A 3HYPA 3BBYA 3MAKA 4QQ7A 5ECMB 3PR8A 1QK8A 1K0CA 1AC1A 3LGCA 5IIZA 3BOAA 1U3AA 1CQGA 1HD2A 5J9CA 3KH7A 3D22A 3F0IA 3GHAA 4LMWA 1AW9A 1IYIA 4JU5A 1U88A 4KCAA 2R0PA 2VIMA 1A2JA 4BIKA 1R26A 1WPIA 3RBTA 2WDUA 2LKUA 4OFTA 2VM2A 4NPBA 2B7KA 6GSWA 1QXHA 4MZBA 3VPTA 1S3AA 3BJ5A 4OCEA 5ID2A 2RM6A 3CMIA 4A5PA 1KTEA 1QFNA 1A2LA 1SJZA 2B5YA 4NV2A 3MDKA 3KXOA 2NBSA 5ECOB 1JLWA 4YQUA 3EC3A 2YJ7A 3IRAA 2BJXA 5IMFA 1WWJA 2LNTA 1Y25A 1XVWA 5GAND 1GUHA 1AQVA 2BTOT 3U6VA 3W6GA 3FR6A 1FOVA 3M1GA 4MK3A 1H75A 1PD21 4TRXA 1V9WA 2IFQA 2IMFA 4WF5A 2R0GA 4MP4A 3F3RA 4KCEA 4O92A 1TRVA 3DD3A 4KGIA 2VL3A 1JZRA 4I6XA 2XC2A 4AJ7A 4AJ8A 1E2YA 10GSA 3WGXA 3QPMA 1ZYQB 4MJEA 3KTLA 4K6XA 5JCWA 2WULA 2O87A 2C3NA 2DJ2A 1GSQA 1O6JA 2WB9A 5DQYA 1SJIA 3ZREA 1XWCA 3UJ1A 2C8UA 3C71A 2RIIA 1FB6A 2R37A 4MA9A 3TRPA 2NVLA 2A2PA 5F0GA 4ZBBA 1XW5A 4I97A 3UMAA 5A4WA 3ERGA 2CV4A 2JZSA 1DSBA 5ELGA 4TW5A 1GNEA 2XBIA 4IKHA 4EDZA 2E7PA 5JWOB 4KNDA 5HR1A 4YQVA 2L6CA 3KCMA 4TR3A 4YH2A 3J7Yk 2XPDA 3O76A 2H76A 3W8SA 2PVOC 5ECLB 1OC9B 2CVBA 4K7NA 5HR3A 1LU4A 2H6ZA 3IC8A 1G6WA 2O8VB 4JR4A 4FQUA 1JZDA 4YAPA 2LJAA 4PNGA 2KP2A 1GSSA 2A2SA 1GSUA 3C1RA 3ZYWA 8GSSA 5AN1A 4ZL8A 5HQPA 3G7IA 1G7EA 2J23A 4BPYA 3R2QA 5HR0A 2JSZA 4ZL7A 3VI5A 4H86A 1I9DA 1MEKA 4L8EA 1PX7A 3N5OA 3MIXA 2LV3A 4BVYB 5ECQB 1PN0A 3TKPA 2LRNA 1WP0A 1GP1A 5KOWA 4P3YB 5GSTA 3KP9A 2YNXA 2JADA 4PQ1A 4ZB6A 4EL1A 1Z3EA 1F3AA 5F05A 1WE0A 2A2RA 2K8SA 9GSSA 3S9FA 3GTUA 5A4UA 1SL2B 2YV9A 2GSQA 1S3CA 1XFLA 5BRTA 5CRHA 1NW2A 1T1VA 3TOTA 3KJYA 4PNFA 1FW1A 2ZCTA 2PPTA 5IPGA 1VF4A 1F9MA 3LXZA 1V40A 4XS6A 5J3RA 3GN3A 1PQNA 3F4RA 1SYRA 1TRWA 4G0KA 1LJRA 3KMNA 3QMXA 3Q19A 2AV4A 4KDYA 3TOUA 3LYPA 1TI3A 2V41A 1YY7A 1EGOA 2NTOA 1OE7A 2OE3A 3H8QA 4Q5RA 4EXJA 2O7KA 3NOFA 5IPHA 3IV4A 1ZL9A 3L78A 5H5QA 2REMA 5H5SA 4MLYA 1GLPA 4K5RA 4POLA 1TI1A 4KW6A 2N5FA 1TK0B
chains in the Genus database with same CATH topology
3P8WA 1JHBA 3KGKA 2HI7A 4FH8A 3IC4A 4N0ZA 4O32A 5G5FA 4KSMA 4TR0A 2WJUA 4MJCA 3DXBA 1HNAA 3EMXA 4E8HA 4DSSA 3ISOA 1R4WA 3ZMKA 1YEXA 1SK2A 3HZ8A 1O73A 2CAIA 2YN1A 5IOXA 3A2XA 5GZZB 4BVXA 2FA8A 2HYXA 1VF2A 4Q5FA 2R4VA 4NMUA 2X8HA 2QGVA 2HSYA 2YZHA 4KSOA 4OFNA 3V1WA 4XS4B 2H70A 3FR3A 5DJMA 1AIUA 3IR4A 4K0GA 1K0AA 2B6MA 2I1UA 5IM9A 3KM6A 4KDUA 4WEYA 4JBBA 4ULXA 4OCFA 3TKRA 1MDKA 4NV5A 4YAVA 2IWTA 2X64A 2L4CA 19GSA 2VCZA 2VO4A 2E0QA 5DALA 2GZYA 1BG5A 2C80A 2OE0A 3JCML 1TRUA 2L6DA 3FZ4A 2AB6A 4PQIA 2R6KA 4D73B 1NM3A 1GULA 4ML6A 5LD0A 5A4VA 3M3MA 3TCOA 2V6OA 4O5RA 2P31A 4J2FA 1SD9A 2R2JA 2OADA 1K0OA 3W8JA 1TK8B 4POBA 5D9TA 3EU4A 2LQQA 3GX8A 3TKSC 3EU3A 2OBIA 4N11A 1CQHA 4PTSA 2DC5A 1JFUA 4GQCA 2GT5A 3KIJA 3ED3A 3LORA 4KE3A 1TU8A 4NHWA 1WJKA 1EV4A 4K0NA 3IXRA 3UBKA 4PGTA 1SK1A 1EWXA 1KBNA 2AHEA 5IOWA 3CRUA 1B9XC 3L4NA 3VURA 2H30A 1GSYA 4EKZA 4Z2UA 2UZ8A 5FT3A 1QMVA 4EO3A 1U87A 2EIOA 3ZIJA 1PL1A 4MMMA 3BD2A 2AJQB 1V98A 2V6KA 1ERWA 2LUSA 5GSSA 3HJMA 1TTZA 1V57A 3TJGA 1N2AA 2VOCA 3AY8A 5E59A 3RAZA 5J5NA 3Q74A 2HT9A 3HZ4A 1ZOFA 4GXZA 4OO5A 4XRDA 2CAQA 2DJKA 4AF2A 1SKWB 3U5RE 5G1KA 5CRGA 1MTCA 3DRNA 1B9YC 2PBJA 3GKNA 4G0IA 3UEMA 4HZ2A 1DE2A 1WIKA 1OE8A 4MZWA 2H73A 3CYNA 5ECKB 3UBLA 1YKCA 2VLVA 2GQMA 2WZ9A 1VGLA 1OVNA 3D4MA 4PQHA 2XBQA 1V2AA 4MF6A 1NHOA 1XW6A 1PX6A 2IPAA 3P7XA 5ENUA 1OC9A 4PURA 1F3BA 3GNJA 1F37A 2FY6A 3IPZA 4EDYA 4ZILA 2VL2C 2FWGA 3EVIA 2GZZA 4KB3A 4NHZA 2PGTA 2FLSA 1O8XA 1FVKA 3TUEA 5B8AA 7GSSA 1AAZA 1M9BA 2RM5A 4Z7XA 4GSSA 3E3EA 2JU5A 2MYGA 2E2GA 4HU9A 1USBA 1EOGA 4WR5A 1A23A 1FHEA 4BVYA 4HJMA 3A3TA 4IQAA 1M0UA 3TKSA 1PN9A 4TR1B 4XIHA 4IQ1A 2GZPA 5JCGA 2QC7A 2QA1A 3EYTA 1WOUA 2G0FA 4RUVA 1XWGA 3FHKA 1W4VA 5ABRA 5G31A 3PINA 2KP1A 1GH2A 1ERUA 3ERFA 2DLXA 3E0UA 1BJXA 1GSFA 3GKKA 4TR4A 4MF7A 1GUMA 4J56E 3CXGA 2TRXA 2QKEA 4Z2RA 3LEFA 3IHQA 3GL5A 1NSWA 2LJRA 1GTAA 4ICYA 3RHBA 4MJBA 4EVMA 1WMJA 3DIEA 3C73A 2L57A 3ME7A 2H6YA 1F2EA 2DIYA 1Z7PA 4LA1A 2XHFA 4OFMA 3EINA 4YKGA 1YKAA 1O8WA 2HE3A 5F8BA 2B5XA 2DMLA 3MYDA 1TDIA 2B7JA 2H6XA 3TKQA 1FOHA 3A5IA 1YZXA 1DBYA 5CYYA 2I3YA 2DJ0A 4TXOB 4I8BA 3CSHA 1GSEA 4G19A 5DQSA 1GNWA 4TKYA 4X43A 2FNOA 2GSTA 4AGSA 3TGZA 4BA7A 2H71A 4JE1A 3DEXA 1TW9A 18GSA 2G2QA 4WETA 4X4JA 3DYRA 3FW2A 1O7UA 2FUG2 2HLSA 3QOUA 4L0WA 1OC8A 2H0GA 4JR6A 4F0CA 5DBQA 2HXKA 2XPEA 1LBKA 2F9SA 2FWHA 5DJLA 2VL2A 3UVTA 1MDJA 4WBJA 5G5EA 2YV7A 4G0LA 5IMDA 1PMTA 4GQFA 2X49A 2H1DA 3QDNA 2M46A 4GLTA 1QUWA 2P5QA 3O3TA 2FHEA 2I9HA 2GSRA 1BEDA 2VLTA 4XS4A 1GL8A 3HVVA 3VLNA 1XVQA 4EC0A 1K0DA 1M99A 1M2DA 1O81A 3E9JB 2MBTA 4MDCA 5LNKe 2B1LA 5J4UA 2TIRA 1YF0A 1IYHA 3ME8A 5DAKB 4POMA 5IMZA 3MNGA 2M80A 5C04A 4GWRA 4PUFC 2P5RA 3KMOA 5HFGA 3UL3A 3HDCA 22GSA 1THXA 4D73A 2DJ1A 1ZYNA 2DKIA 3F6DA 1WRYA 2HRFA 4K2XA 4MZCA 3MWHA 1SENA 4L0UA 3A2WA 3GKMA 2B5EA 20GSA 3GSTA 4V1Ag 1R5AA 2CT6A 3EWLA 4HQZA 3GIXA 1OKDA 5KN1A 5ECSA 1ST9A 1E6BA 1K0BA 1B48A 4N0VA 2VD1A 2YWOA 2LRCA 1ZMAA 5BMUA 4ZBAA 2FWEA 3IK7A 4IS0A 1A8YA 3RDWA 2IL3A 3LXTA 1TU7A 2PU9C 3GA4A 1QGVA 4BWQA 3GH9A 2DMMA 3K8NA 6GSXA 4CHSA 3PH9A 3EMPA 4ECBA 2B1KA 2R3XA 1T3BA 5D9XA 2V32A 2ALBA 5IO0A 2IIYA 4KDXA 2I4AA 3KEBA 4MPFA 4WBRD 3D0ZA 3ZRDA 1JLVA 2YWIA 3CSJA 4FIWA 1X5EA 1VF3A 2IFQB 1AXDA 4LL4B 1Z9HA 5D8IA 3KTBA 5B6NA 3P2AA 3PPUA 3TJFA 5HR2A 4WR4A 1J9BA 4OO4A 1EP7A 4V1Ap 1UVZA 4WXTA 3ZLPA 2OJLA 3FYGA 2IJYA 1RQMA 2AUVA 5JWRB 1XXUA 3UAPA 5CAXA 3I6AA 3GSSA 1QQ2A 2CZ2A 2H74A 2N5AA 2F3MA 3DVXA 1UA5A 1G7OA 1DE1A 2JZRA 1SD8A 2GT6A 4BL7B 5H5RA 2C1YA 4LL1B 1GLQA 3ERWA 3UOMA 1M2BA 3BCIA 3D6IA 1SK0A 2H1GA 1W89A 2IMKA 1T4YA 2H66A 2YWNA 3GMFA 3VI7A 3QCPA 2PMTA 2B3SA 6GSVA 2VCTA 4O5UA 2HZEB 2HNLA 4FYBA 2K8VA 1BYEA 5B6MA 2AAWA 3D4TA 4J57E 4F0BA 4HEA2 3ZFLA 2H75A 3WT1A 2RLIA 3GH6A 1VRSD 3HD5A 3IBHA 4GRFA 3ZTLA 3F4TA 4V2MA 5F06A 2C0FA 2YANA 4ILFA 1A0FA 4MCUA 4TR1A 2DSAA 4HJ2A 2EC4A 2R5GA 1KEBA 2DJJA 2VM1A 4CY6A 2OBKA 3O6TA 3UVHA 1ABAA 1GTIA 4EIPA 3GUSA 5KEJA 5GAPD 2C4JA 1X5DA 1MD3A 1B4QA 2DKHA 4GSTA 4HOJA 2VCWA 2WGRA 2K9FA 3I9V2 3TDGA 3QFBC 1GUKA 2X99A 3QD9A 1RK4A 4AJ6A 5A5KA 2O85A 5IQYA 1OYJA 1H4OA 4WKWA 1OC3A 3EURA 4XTSA 1FB0A 2GTUA 4F82A 3MSZA 4G2EA 5IMAA 2ZUPA 3I43A 2HFDA 4CDOA 3G9BA 6GSUA 2GGTA 2PUKC 2X8CA 3ZFBA 14GSA 3IA1A 4NWYA 3TJBA 5IMVA 3HXSA 4F03A 2OKAA 5IO2A 3WT2A 3C7MA 4MJAA 1SL1B 4K7OA 1Y6EA 4KX4A 3P90A 2LJKA 2KHPA 2KOKA 4YKFA 1C72A 4DSQA 4HU7A 3F8UA 3WGEA 5ECRB 2DBCA 1EP8A 3G7JA 2H19A 4ECCA 2ZNMA 5ECIB 5KN3A 3HCZA 1VF1A 1GTBA 3GX0A 3FY7A 4K2DA 3KH9A 1SJ6A 4IELA 1X5CA 5KN2A 2JACA 3M8NA 4JRRA 3SWLA 1XBSA 1ON4A 3FZAA 3ZMLA 1YDKA 3IAM2 2MMAA 5CO3A 3F4SA 5EPFA 1Q98A 4L5LA 2VD0A 1HNCA 1EZKA 3CTFA 4OMVA 1T00A 4I5QA 3M9JA 3IDVA 4YQMA 2HRNA 1XWKA 1Z7RA 3GL3A 2PWJA 3FRCA 3GRXA 4IJIA 5DAKA 5CP1A 4PUAA 1T4ZA 1XPVA 3Q6OA 5FWGA 3QAWA 2CA8A 3FK8A 4K5SA 4XS1A 5AIVA 4ECIA 2JZTA 4ZB9A 3C1SA 5DALB 4QL9A 3DKSA 1XIYA 1A8LA 3QFAC 4PXOA 4KAEA 2YWMA 3DGQA 4IP6A 2O89A 2VUPA 4O5QA 1U3IA 4KF9A 2HSHA 4IN0A 2VAFA 2NDOA 1SL0B 2CVKA 2M72A 1J08A 2L5OA 3F9UA 1GWCA 2PVQA 4XHMA 3GKXA 4Z2TA 4F2IA 2L59A 2WFCA 1X9SB 3LQ7A 4GCIA 3TKSE 1TJDA 1XOAA 1GTUA 5L71A 4POKA 2H0HA 4TN8A 1R7HA 1PL2A 2RUFA 2OACA 3VWUA 3RHCA 2C0GA 3DMLA 1ZYEA 17GSA 2EIRA 2MMZA 4IP1A 1F6MC 4ZB8A 2X8GA 4O7HA 3FMWA 1SKSB 4KH7A 2LS5A 3HHVA 3HKRA 4TXVA 3LYKA 1TXXA 1FO5A 1XW9A 5D9WA 3FR9A 1XWAA 5B8BA 2LEGA 2JL4A 4BWSA 1V58A 4I2UA 3QAGA 4OD7A 2WS2A 1BQ7A 2D2ZA 2YPMA 4XRAA 2FCHA 3N9JA 4NXIA 2YCDA 4X0XA 3VFIA 1YQ1A 5AISA 3LSZA 3G7YA 1X0RA 2MZCA 1EOHA 2Z9SA 4TOPA 4BL7A 5G1LA 4K1FA 2VCQA 5FHIA 3DWVA 1XWBA 4HQSA 3US3A 1T8EB 2LRTA 1SU9A 1MD4A 2F8FA 3H79A 2V2GA 4N30A 3Q18A 1ERTA 1FG4A 2GLRA 1UC7A 2C0DA 5C00A 1SKRB 2V1MA 2ES7A 2NPBA 1TOFA 1X9MB 4MH3A 2FWFA 2GQLA 2WCIA 1AQXA 1M7TA 4N10A 3FZ9A 1BAYA 1PKZA 1ZGNA 3R3EA 5CRDA 1Z6NA 2HZEA 5LCZA 3UIWA 5EY6A 2C3QA 2GSSA 3FKFA 2PN8A 4NAXA 2OE1A 3RPNA 5HFIA 2A4VA 2YOIA 5EL8A 2CZ3A 1KNGA 2H1AA 3CTGA 5DCHA 5J41A 2MBSA 2JSYA 1THOA 4WF4A 5DCGA 2CVDA 3HVSA 1HQOA 4CY8A 4ZXGA 2VL9A 11GSA 3HJOA 4USSA 3IE3A 1A2MA 1A0RP 3I69A 4ZIJA 4EUYA 1G6YA 2CQ9A 3GV1A 5IMCA 1SYXA 2FGXA 5KOXA 5CREA 5KN0A 5G30A 1K3OA 1TRSA 4MPGA 4K7IA 1EEJA 3EE2A 2GDRA 3LG6A 4RI6A 1OKTA 5ID2B 3KD0A 5ECHB 1ILOA 5ELAA 2HZFA 3IK9A 1A24A 4FYCA 2LQOA 4EIQA 2E2MA 4MF5A 4MNNA 1TK5B 4V2LA 4XCSA 4KUNA 2BMXA 4Q5NA 4E8EA 2QA2A 4IHUA 3SBCA 3L9VA 2FA4A 3LW9A 2MMNA 4IGJA 2DJ3A 2N5BA 3HY2A 1EV9A 2AYTA 1MDIA 2QSIA 5J9BA 2CX3A 3LJRA 3TRQA 2H1BA 16GSA 4GSNA 2K18A 4V2NA 2H72A 4RI7A 2PERA 3HJPA 3KZQA 1Z5YE 1B8XA 4HUAA 3VWWA 1BX9A 2C0EA 12GSA 2FD3A 2VCXA 3BCKA 3L0HA 6GSSA 5D73A 2IMIA 2ON5A 2J9HA 1RW1A 4FYUA 1ZZYA 1GRXA 1PA3A 4EF0A 1EGRA 1K0MA 1U6TA 4MH2A 3ZL5A 5D9VA 3C8EA 3IHGA 1Z6MA 4TVEA 1AQWA 1K3LA 1M9AA 3ZITA 2R0CA 1G0TA 2I81A 2LNSA 3UARA 1AUCA 1JZOA 4G10A 4EE0A 5JWQB 4ZL9A 3D21A 3WGDA 5ECPB 2YP6A 3LWAA 1PSQA 2RUEA 1ML6A 6GSTA 3TJJA 3QR6A 2H01A 5D93A 3OR5A 1TKDB 3M9KA 2C3TA 5F07A 3APSA 3NZNA 1K3YA 4JEDA 5JCUA 3L9SA 1M2AA 2VCVA 1DUGA 2LTKA 4DEJA 4G9HA 1ZCPA 3D5JA 1YJ6A 4MABA 3APQA 3HVXA 4GTUA 2VLUA 1YEPA 4IW9A 1UN2A 2OA7A 4I2TA 3F63A 2YJHA 1J0FA 3KP8A 1B4PA 4PX1A 4RQXA 3IOSA 1JZWA 5INYA 3ZVJD 3A5WA 4IBPA 4Q5QA 2TRCP 5AGYA 2HRAA 3CRTA 5DDLA 3GTUB 1XCCA 1S3DA 3GFKA 3VK9A 1NHYA 3FZ5A 5E4WA 5DVBA 1XZOA 13GSA 4ID0A 4JZQA 2K6VA 5D96A 1TP9A 4LLRA 1X9WB 3EPTA 3TRXA 4KA0A 4HDEA 2EIQA 5AIXA 2ON7A 1ACVA 2X4AA 2LSTA 2L5LA 3IAS2 1PKWA 4ECJA 1HNBA 4DSRA 1I5GA 2F51A 3F3QA 3A2VA 5ECNB 4GF0A 3J7Yb 3H93A 1URMA 2P0GA 1T7PB 1Q4JA 3HA9A 4FO5A 4IVFA 1EEMA 1O85A 4HS1A 4IJ3A 4ML1A 4TXOA 3ZIVA 1K0NA 5G2ZA 3VPQA 2GQKA 2KUCA 4K8MA 1FVJA 2CX4A 4CW9A 2GVPA 1OAZA 2H8LA 2HRKA 2WRTA 1N8JA 3WYWA 1R5PA 3GURA 3TJKA 1PGTA 3H1NA 5CRWA 2DIZA 5B7CA 3CBUA 3DVWA 2IMEA 3ZVJA 4LMVA 2KLXA 4X1UA 4L5OA 3WD6A 3GYKA 3RPPA 4DVCA 2IMDA 3FEUA 3F6FA 2L4QA 1FAAA 5COHA 2H0IA 4DSSB 3PGTA 2GS3A 1GSDA 1ZYPA 3QAVA 3LFLA 3ZZXA 5HFKA 2MMOA 2HSMA 4QL7A 5CNWA 2F8AA 4BVXB 1ERVA 1HYUA 1YF1A 3M0FA 4ACSA 4F9ZA 2A4HA 4ISDA 4RQRA 3VWXA 3APOA 4OWYA 3H4KA 6GSYA 2YZUA 3CSIA 2IN3A 1XOBA 1PRXA 4HZ4A 5EVOA 3TB2A 3NIVA 4K9ZA 3L9UA 3VWVA 4ZBDA 4HI7A 3HYPA 3BBYA 3MAKA 4QQ7A 5ECMB 3PR8A 1QK8A 1K0CA 1AC1A 3LGCA 5IIZA 3BOAA 1U3AA 1CQGA 1HD2A 5J9CA 3KH7A 3D22A 3F0IA 3GHAA 4LMWA 1AW9A 1IYIA 4JU5A 1U88A 4KCAA 2R0PA 2VIMA 1A2JA 1R26A 1WPIA 3RBTA 2WDUA 2LKUA 4OFTA 2VM2A 4NPBA 2B7KA 6GSWA 1QXHA 4MZBA 3VPTA 1S3AA 3BJ5A 4OCEA 5ID2A 2RM6A 3CMIA 4A5PA 1KTEA 1QFNA 1A2LA 1SJZA 2B5YA 4NV2A 3MDKA 3KXOA 2NBSA 5ECOB 1JLWA 4YQUA 3EC3A 2YJ7A 3IRAA 2BJXA 5IMFA 1WWJA 2LNTA 1Y25A 1XVWA 5GAND 1GUHA 1AQVA 2BTOT 3U6VA 3W6GA 3FR6A 1FOVA 3M1GA 4MK3A 1H75A 1PD21 4TRXA 1V9WA 2IFQA 2IMFA 4WF5A 2R0GA 4MP4A 3F3RA 4KCEA 4O92A 1TRVA 3DD3A 4KGIA 2VL3A 1JZRA 4I6XA 2XC2A 4AJ7A 4AJ8A 1E2YA 10GSA 3WGXA 3QPMA 1ZYQB 4MJEA 3KTLA 4K6XA 5JCWA 2WULA 2O87A 2C3NA 2DJ2A 1GSQA 1O6JA 2WB9A 5DQYA 1SJIA 3ZREA 1XWCA 3UJ1A 2C8UA 3C71A 2RIIA 1FB6A 2R37A 4MA9A 3TRPA 2NVLA 2A2PA 5F0GA 4ZBBA 1XW5A 4I97A 3UMAA 5A4WA 3ERGA 2CV4A 2JZSA 1DSBA 5ELGA 4TW5A 1GNEA 2XBIA 4IKHA 4EDZA 2E7PA 5JWOB 4KNDA 5HR1A 4YQVA 2L6CA 3KCMA 4TR3A 4YH2A 3J7Yk 2XPDA 3O76A 2H76A 3W8SA 2PVOC 5ECLB 1OC9B 2CVBA 4K7NA 5HR3A 1LU4A 2H6ZA 3IC8A 1G6WA 2O8VB 4JR4A 4FQUA 1JZDA 4YAPA 2LJAA 4PNGA 2KP2A 1GSSA 2A2SA 1GSUA 3C1RA 3ZYWA 8GSSA 5AN1A 4ZL8A 5HQPA 3G7IA 1G7EA 2J23A 4BPYA 3R2QA 5HR0A 2JSZA 4ZL7A 3VI5A 4H86A 1I9DA 1MEKA 4L8EA 1PX7A 3N5OA 3MIXA 2LV3A 4BVYB 5ECQB 1PN0A 3TKPA 2LRNA 1WP0A 1GP1A 5KOWA 4P3YB 5GSTA 3KP9A 2YNXA 2JADA 4PQ1A 4ZB6A 4EL1A 1Z3EA 1F3AA 5F05A 1WE0A 2A2RA 2K8SA 9GSSA 3S9FA 3GTUA 5A4UA 1SL2B 2YV9A 2GSQA 1S3CA 1XFLA 5BRTA 5CRHA 1NW2A 1T1VA 3TOTA 3KJYA 4PNFA 1FW1A 2ZCTA 2PPTA 5IPGA 1VF4A 1F9MA 3LXZA 1V40A 4XS6A 5J3RA 3GN3A 1PQNA 3F4RA 1SYRA 1TRWA 4G0KA 1LJRA 3KMNA 3QMXA 3Q19A 2AV4A 4KDYA 3TOUA 3LYPA 1TI3A 2V41A 1YY7A 1EGOA 2NTOA 1OE7A 2OE3A 3H8QA 4Q5RA 4EXJA 2O7KA 3NOFA 5IPHA 3IV4A 1ZL9A 3L78A 5H5QA 2REMA 5H5SA 4MLYA 1GLPA 4K5RA 4POLA 1TI1A 4KW6A 2N5FA 1TK0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P8W A;  1JHB A;  3KGK A;  2HI7 A;  4FH8 A;  3IC4 A;  4N0Z A;  4O32 A;  5G5F A;  4KSM A;  4TR0 A;  2WJU A;  4MJC A;  3DXB A;  1HNA A;  3EMX A;  4E8H A;  4DSS A;  3ISO A;  1R4W A;  3ZMK A;  1YEX A;  1SK2 A;  3HZ8 A;  1O73 A;  2CAI A;  2YN1 A;  5IOX A;  3A2X A;  5GZZ B;  4BVX A;  2FA8 A;  2HYX A;  1VF2 A;  4Q5F A;  2R4V A;  4NMU A;  2X8H A;  2QGV A;  2HSY A;  2YZH A;  4KSO A;  4OFN A;  3V1W A;  4XS4 B;  2H70 A;  3FR3 A;  5DJM A;  1AIU A;  3IR4 A;  4K0G A;  1K0A A;  2B6M A;  2I1U A;  5IM9 A;  3KM6 A;  4KDU A;  4WEY A;  4JBB A;  4ULX A;  4OCF A;  3TKR A;  1MDK A;  4NV5 A;  4YAV A;  2IWT A;  2X64 A;  2L4C A;  19GS A;  2VCZ A;  2VO4 A;  2E0Q A;  5DAL A;  2GZY A;  1BG5 A;  2C80 A;  2OE0 A;  3JCM L;  1TRU A;  2L6D A;  3FZ4 A;  2AB6 A;  4PQI A;  2R6K A;  4D73 B;  1NM3 A;  1GUL A;  4ML6 A;  5LD0 A;  5A4V A;  3M3M A;  3TCO A;  2V6O A;  4O5R A;  2P31 A;  4J2F A;  1SD9 A;  2R2J A;  2OAD A;  1K0O A;  3W8J A;  1TK8 B;  4POB A;  5D9T A;  3EU4 A;  2LQQ A;  3GX8 A;  3TKS C;  3EU3 A;  2OBI A;  4N11 A;  1CQH A;  2DC5 A;  1JFU A;  4GQC A;  2GT5 A;  3KIJ A;  3ED3 A;  3LOR A;  4KE3 A;  1TU8 A;  4NHW A;  1WJK A;  1EV4 A;  4K0N A;  3IXR A;  3UBK A;  4PGT A;  1SK1 A;  1EWX A;  1KBN A;  2AHE A;  5IOW A;  3CRU A;  1B9X C;  3L4N A;  3VUR A;  2H30 A;  1GSY A;  4EKZ A;  5FT3 A;  1QMV A;  4EO3 A;  1U87 A;  2EIO A;  3ZIJ A;  1PL1 A;  4MMM A;  3BD2 A;  2AJQ B;  1V98 A;  2V6K A;  1ERW A;  2LUS A;  5GSS A;  3HJM A;  1TTZ A;  1V57 A;  3TJG A;  1N2A A;  2VOC A;  3AY8 A;  5E59 A;  3RAZ A;  5J5N A;  3Q74 A;  2HT9 A;  3HZ4 A;  1ZOF A;  4GXZ A;  4OO5 A;  4XRD A;  2CAQ A;  2DJK A;  4AF2 A;  1SKW B;  3U5R E;  5G1K A;  5CRG A;  1MTC A;  3DRN A;  1B9Y C;  2PBJ A;  3GKN A;  3UEM A;  4HZ2 A;  1DE2 A;  1WIK A;  1OE8 A;  4MZW A;  2H73 A;  3CYN A;  5ECK B;  3UBL A;  1YKC A;  2VLV A;  2GQM A;  2WZ9 A;  1VGL A;  1OVN A;  3D4M A;  4PQH A;  2XBQ A;  1V2A A;  4MF6 A;  1NHO A;  1XW6 A;  1PX6 A;  2IPA A;  3P7X A;  5ENU A;  1OC9 A;  4PUR A;  1F3B A;  3GNJ A;  1F37 A;  2FY6 A;  3IPZ A;  4EDY A;  4ZIL A;  2VL2 C;  2FWG A;  3EVI A;  2GZZ A;  4KB3 A;  4NHZ A;  2PGT A;  2FLS A;  1O8X A;  1FVK A;  3TUE A;  5B8A A;  7GSS A;  1AAZ A;  1M9B A;  2RM5 A;  4Z7X A;  4GSS A;  3E3E A;  2JU5 A;  2MYG A;  2E2G A;  4HU9 A;  1USB A;  1EOG A;  4WR5 A;  1A23 A;  1FHE A;  4BVY A;  4HJM A;  3A3T A;  4IQA A;  1M0U A;  3TKS A;  1PN9 A;  4TR1 B;  4XIH A;  4IQ1 A;  2GZP A;  5JCG A;  2QC7 A;  3EYT A;  1WOU A;  2G0F A;  4RUV A;  1XWG A;  3FHK A;  1W4V A;  5ABR A;  5G31 A;  3PIN A;  2KP1 A;  1GH2 A;  1ERU A;  3ERF A;  2DLX A;  3E0U A;  1BJX A;  1GSF A;  3GKK A;  4TR4 A;  4MF7 A;  1GUM A;  4J56 E;  3CXG A;  2TRX A;  2QKE A;  3LEF A;  3IHQ A;  3GL5 A;  1NSW A;  2LJR A;  1GTA A;  3RHB A;  4MJB A;  4EVM A;  1WMJ A;  3DIE A;  3C73 A;  2L57 A;  3ME7 A;  2H6Y A;  1F2E A;  2DIY A;  1Z7P A;  4LA1 A;  2XHF A;  4OFM A;  3EIN A;  1YKA A;  1O8W A;  2HE3 A;  5F8B A;  2B5X A;  2DML A;  1TDI A;  2B7J A;  2H6X A;  3TKQ A;  1YZX A;  1DBY A;  5CYY A;  2I3Y A;  2DJ0 A;  4TXO B;  4I8B A;  3CSH A;  1GSE A;  4G19 A;  5DQS A;  1GNW A;  4TKY A;  4X43 A;  2FNO A;  2GST A;  4AGS A;  3TGZ A;  4BA7 A;  2H71 A;  4JE1 A;  3DEX A;  1TW9 A;  18GS A;  2G2Q A;  4WET A;  3DYR A;  3FW2 A;  1O7U A;  2FUG 2;  2HLS A;  3QOU A;  4L0W A;  1OC8 A;  2H0G A;  4JR6 A;  4F0C A;  5DBQ A;  2HXK A;  2XPE A;  1LBK A;  2F9S A;  2FWH A;  5DJL A;  2VL2 A;  3UVT A;  1MDJ A;  4WBJ A;  5G5E A;  2YV7 A;  5IMD A;  1PMT A;  4GQF A;  2H1D A;  3QDN A;  2M46 A;  4GLT A;  1QUW A;  2P5Q A;  3O3T A;  2FHE A;  2I9H A;  2GSR A;  1BED A;  2VLT A;  4XS4 A;  1GL8 A;  3HVV A;  3VLN A;  1XVQ A;  4EC0 A;  1K0D A;  1M99 A;  1M2D A;  1O81 A;  3E9J B;  2MBT A;  4MDC A;  5LNK e;  2B1L A;  5J4U A;  2TIR A;  1YF0 A;  1IYH A;  3ME8 A;  5DAK B;  4POM A;  5IMZ A;  3MNG A;  2M80 A;  5C04 A;  4GWR A;  4PUF C;  2P5R A;  3KMO A;  5HFG A;  3UL3 A;  3HDC A;  22GS A;  1THX A;  4D73 A;  2DJ1 A;  3F6D A;  1WRY A;  2HRF A;  4MZC A;  3MWH A;  1SEN A;  4L0U A;  3A2W A;  3GKM A;  2B5E A;  20GS A;  3GST A;  4V1A g;  1R5A A;  2CT6 A;  3EWL A;  4HQZ A;  3GIX A;  1OKD A;  5KN1 A;  5ECS A;  1ST9 A;  1E6B A;  1K0B A;  1B48 A;  4N0V A;  2VD1 A;  2YWO A;  2LRC A;  1ZMA A;  4ZBA A;  2FWE A;  3IK7 A;  4IS0 A;  1A8Y A;  3RDW A;  2IL3 A;  3LXT A;  1TU7 A;  2PU9 C;  3GA4 A;  1QGV A;  4BWQ A;  3GH9 A;  2DMM A;  3K8N A;  6GSX A;  4CHS A;  3PH9 A;  3EMP A;  4ECB A;  2B1K A;  2R3X A;  1T3B A;  5D9X A;  2V32 A;  2ALB A;  5IO0 A;  2IIY A;  4KDX A;  2I4A A;  3KEB A;  4MPF A;  4WBR D;  3D0Z A;  3ZRD A;  1JLV A;  2YWI A;  3CSJ A;  4FIW A;  1X5E A;  1VF3 A;  2IFQ B;  1AXD A;  4LL4 B;  1Z9H A;  5D8I A;  3KTB A;  5B6N A;  3P2A A;  3TJF A;  5HR2 A;  4WR4 A;  1J9B A;  4OO4 A;  1EP7 A;  4V1A p;  1UVZ A;  4WXT A;  3ZLP A;  2OJL A;  3FYG A;  2IJY A;  1RQM A;  2AUV A;  5JWR B;  1XXU A;  3UAP A;  5CAX A;  3I6A A;  3GSS A;  1QQ2 A;  2CZ2 A;  2H74 A;  2N5A A;  2F3M A;  3DVX A;  1UA5 A;  1G7O A;  1DE1 A;  2JZR A;  1SD8 A;  2GT6 A;  5H5R A;  2C1Y A;  4LL1 B;  1GLQ A;  3ERW A;  3UOM A;  1M2B A;  3BCI A;  3D6I A;  1SK0 A;  2H1G A;  1W89 A;  2IMK A;  1T4Y A;  2H66 A;  2YWN A;  3GMF A;  3VI7 A;  3QCP A;  2PMT A;  2B3S A;  6GSV A;  2VCT A;  2HZE B;  2HNL A;  4FYB A;  2K8V A;  1BYE A;  5B6M A;  2AAW A;  3D4T A;  4J57 E;  4F0B A;  4HEA 2;  3ZFL A;  2H75 A;  3WT1 A;  2RLI A;  3GH6 A;  1VRS D;  3HD5 A;  3IBH A;  4GRF A;  3ZTL A;  3F4T A;  4V2M A;  5F06 A;  2C0F A;  2YAN A;  4ILF A;  1A0F A;  4MCU A;  4TR1 A;  2DSA A;  4HJ2 A;  2EC4 A;  2R5G A;  1KEB A;  2DJJ A;  2VM1 A;  2OBK A;  3O6T A;  3UVH A;  1ABA A;  1GTI A;  3GUS A;  5KEJ A;  5GAP D;  2C4J A;  1X5D A;  1MD3 A;  1B4Q A;  4GST A;  4HOJ A;  2VCW A;  2WGR A;  2K9F A;  3I9V 2;  3TDG A;  3QFB C;  1GUK A;  2X99 A;  3QD9 A;  1RK4 A;  4AJ6 A;  5A5K A;  2O85 A;  5IQY A;  1OYJ A;  1H4O A;  4WKW A;  1OC3 A;  3EUR A;  4XTS A;  1FB0 A;  2GTU A;  4F82 A;  3MSZ A;  4G2E A;  5IMA A;  2ZUP A;  3I43 A;  2HFD A;  4CDO A;  3G9B A;  6GSU A;  2GGT A;  2PUK C;  2X8C A;  3ZFB A;  14GS A;  3IA1 A;  4NWY A;  3TJB A;  5IMV A;  3HXS A;  4F03 A;  2OKA A;  5IO2 A;  3WT2 A;  3C7M A;  4MJA A;  1SL1 B;  4K7O A;  1Y6E A;  4KX4 A;  3P90 A;  2LJK A;  2KHP A;  2KOK A;  1C72 A;  4DSQ A;  4HU7 A;  3F8U A;  3WGE A;  5ECR B;  2DBC A;  1EP8 A;  3G7J A;  2H19 A;  4ECC A;  2ZNM A;  5ECI B;  5KN3 A;  3HCZ A;  1VF1 A;  1GTB A;  3GX0 A;  3FY7 A;  4K2D A;  3KH9 A;  1SJ6 A;  4IEL A;  1X5C A;  5KN2 A;  2JAC A;  3M8N A;  4JRR A;  3SWL A;  1XBS A;  1ON4 A;  3FZA A;  3ZML A;  1YDK A;  3IAM 2;  2MMA A;  5CO3 A;  3F4S A;  5EPF A;  1Q98 A;  4L5L A;  2VD0 A;  1HNC A;  1EZK A;  3CTF A;  4OMV A;  1T00 A;  4I5Q A;  3M9J A;  3IDV A;  4YQM A;  2HRN A;  1XWK A;  1Z7R A;  3GL3 A;  5DAK A;  2PWJ A;  3FRC A;  3GRX A;  4IJI A;  5CP1 A;  4PUA A;  1T4Z A;  1XPV A;  3Q6O A;  5FWG A;  3QAW A;  2CA8 A;  3FK8 A;  4XS1 A;  5AIV A;  4ECI A;  2JZT A;  4ZB9 A;  3C1S A;  5DAL B;  4QL9 A;  3DKS A;  1XIY A;  1A8L A;  3QFA C;  4PXO A;  4KAE A;  2YWM A;  3DGQ A;  4IP6 A;  2O89 A;  2VUP A;  1U3I A;  2HSH A;  4IN0 A;  2VAF A;  2NDO A;  1SL0 B;  2CVK A;  2M72 A;  1J08 A;  2L5O A;  3F9U A;  1GWC A;  2PVQ A;  4XHM A;  3GKX A;  4F2I A;  2L59 A;  2WFC A;  1X9S B;  3LQ7 A;  4GCI A;  3TKS E;  1TJD A;  1XOA A;  1GTU A;  5L71 A;  4POK A;  2H0H A;  4TN8 A;  1R7H A;  1PL2 A;  2RUF A;  2OAC A;  3VWU A;  3RHC A;  2C0G A;  3DML A;  1ZYE A;  17GS A;  2EIR A;  2MMZ A;  4IP1 A;  1F6M C;  4ZB8 A;  2X8G A;  4O7H A;  1SKS B;  4KH7 A;  2LS5 A;  3HHV A;  3HKR A;  4TXV A;  3LYK A;  1TXX A;  1FO5 A;  1XW9 A;  5D9W A;  3FR9 A;  1XWA A;  5B8B A;  2LEG A;  2JL4 A;  4BWS A;  1V58 A;  4I2U A;  3QAG A;  4OD7 A;  2WS2 A;  1BQ7 A;  2D2Z A;  2YPM A;  4XRA A;  2FCH A;  3N9J A;  4NXI A;  2YCD A;  4X0X A;  3VFI A;  1YQ1 A;  5AIS A;  3LSZ A;  3G7Y A;  1X0R A;  2MZC A;  1EOH A;  2Z9S A;  4TOP A;  4BL7 A;  5G1L A;  4K1F A;  2VCQ A;  5FHI A;  3DWV A;  1XWB A;  4HQS A;  3US3 A;  1T8E B;  2LRT A;  1SU9 A;  1MD4 A;  2F8F A;  3H79 A;  2V2G A;  4N30 A;  3Q18 A;  1ERT A;  1FG4 A;  2GLR A;  1UC7 A;  2C0D A;  5C00 A;  1SKR B;  2V1M A;  2ES7 A;  2NPB A;  1TOF A;  1X9M B;  4MH3 A;  2FWF A;  2GQL A;  2WCI A;  1AQX A;  1M7T A;  4N10 A;  3FZ9 A;  1BAY A;  1PKZ A;  1ZGN A;  5CRD A;  1Z6N A;  2HZE A;  5LCZ A;  3UIW A;  5EY6 A;  2C3Q A;  2GSS A;  3FKF A;  2PN8 A;  4NAX A;  2OE1 A;  3RPN A;  5HFI A;  2A4V A;  5EL8 A;  2YOI A;  2CZ3 A;  1KNG A;  2H1A A;  3CTG A;  5DCH A;  5J41 A;  2MBS A;  2JSY A;  1THO A;  4WF4 A;  5DCG A;  2CVD A;  3HVS A;  1HQO A;  4ZXG A;  2VL9 A;  11GS A;  3HJO A;  3IE3 A;  1A2M A;  1A0R P;  3I69 A;  4ZIJ A;  4EUY A;  1G6Y A;  2CQ9 A;  3GV1 A;  5IMC A;  1SYX A;  2FGX A;  5CRE A;  5KN0 A;  5G30 A;  1K3O A;  1TRS A;  4MPG A;  4K7I A;  1EEJ A;  3EE2 A;  2GDR A;  3LG6 A;  4RI6 A;  1OKT A;  5ID2 B;  3KD0 A;  5ECH B;  1ILO A;  5ELA A;  2HZF A;  3IK9 A;  1A24 A;  4FYC A;  2LQO A;  2E2M A;  4MF5 A;  1TK5 B;  4V2L A;  4XCS A;  4KUN A;  2BMX A;  4Q5N A;  4E8E A;  4IHU A;  3SBC A;  3L9V A;  2FA4 A;  2MMN A;  4IGJ A;  2DJ3 A;  2N5B A;  3HY2 A;  1EV9 A;  2AYT A;  1MDI A;  2QSI A;  5J9B A;  2CX3 A;  3LJR A;  3TRQ A;  2H1B A;  16GS A;  4GSN A;  2K18 A;  4V2N A;  2H72 A;  4RI7 A;  2PER A;  3HJP A;  3KZQ A;  1Z5Y E;  1B8X A;  4HUA A;  3VWW A;  1BX9 A;  2C0E A;  12GS A;  2FD3 A;  2VCX A;  3BCK A;  3L0H A;  6GSS A;  5D73 A;  2IMI A;  2ON5 A;  2J9H A;  1RW1 A;  4FYU A;  1ZZY A;  1GRX A;  1PA3 A;  4EF0 A;  1EGR A;  1K0M A;  1U6T A;  4MH2 A;  3ZL5 A;  5D9V A;  3C8E A;  1Z6M A;  4TVE A;  1AQW A;  1K3L A;  1M9A A;  3ZIT A;  1G0T A;  2I81 A;  2LNS A;  3UAR A;  1AUC A;  1JZO A;  4G10 A;  4EE0 A;  5JWQ B;  4ZL9 A;  3D21 A;  3WGD A;  5ECP B;  2YP6 A;  3LWA A;  1PSQ A;  2RUE A;  1ML6 A;  6GST A;  3TJJ A;  3QR6 A;  2H01 A;  5D93 A;  3OR5 A;  1TKD B;  3M9K A;  2C3T A;  5F07 A;  3APS A;  3NZN A;  1K3Y A;  4JED A;  5JCU A;  3L9S A;  1M2A A;  2VCV A;  1DUG A;  2LTK A;  4DEJ A;  4G9H A;  1ZCP A;  3D5J A;  1YJ6 A;  4MAB A;  3APQ A;  3HVX A;  4GTU A;  2VLU A;  1YEP A;  4IW9 A;  1UN2 A;  2OA7 A;  4I2T A;  3F63 A;  2YJH A;  1J0F A;  3KP8 A;  1B4P A;  4PX1 A;  4RQX A;  3IOS A;  1JZW A;  5INY A;  3ZVJ D;  3A5W A;  4IBP A;  4Q5Q A;  2TRC P;  5AGY A;  3CRT A;  5DDL A;  3GTU B;  1XCC A;  1S3D A;  3GFK A;  3VK9 A;  1NHY A;  3FZ5 A;  5E4W A;  5DVB A;  1XZO A;  13GS A;  4ID0 A;  4JZQ A;  2K6V A;  5D96 A;  1TP9 A;  4LLR A;  1X9W B;  3TRX A;  4KA0 A;  4HDE A;  2EIQ A;  5AIX A;  2ON7 A;  1ACV A;  2LST A;  2L5L A;  3IAS 2;  1PKW A;  4ECJ A;  1HNB A;  4DSR A;  1I5G A;  2F51 A;  3F3Q A;  3A2V A;  5ECN B;  4GF0 A;  3J7Y b;  3H93 A;  1URM A;  2P0G A;  1T7P B;  1Q4J A;  3HA9 A;  4FO5 A;  4IVF A;  1EEM A;  1O85 A;  4HS1 A;  4IJ3 A;  4ML1 A;  4TXO A;  3ZIV A;  1K0N A;  5G2Z A;  3VPQ A;  2GQK A;  2KUC A;  4K8M A;  1FVJ A;  2CX4 A;  4CW9 A;  2GVP A;  1OAZ A;  2H8L A;  2WRT A;  1N8J A;  3WYW A;  1R5P A;  3GUR A;  3TJK A;  1PGT A;  3H1N A;  5CRW A;  2DIZ A;  5B7C A;  3CBU A;  3DVW A;  2IME A;  3ZVJ A;  4LMV A;  2KLX A;  4X1U A;  4L5O A;  3WD6 A;  3GYK A;  3RPP A;  4DVC A;  2IMD A;  3FEU A;  3F6F A;  2L4Q A;  1FAA A;  5COH A;  2H0I A;  4DSS B;  3PGT A;  2GS3 A;  1GSD A;  3QAV A;  3LFL A;  3ZZX A;  5HFK A;  2MMO A;  4QL7 A;  5CNW A;  2F8A A;  1ERV A;  1HYU A;  1YF1 A;  3M0F A;  4ACS A;  4F9Z A;  4ISD A;  4RQR A;  3VWX A;  3APO A;  4OWY A;  3H4K A;  6GSY A;  2YZU A;  3CSI A;  2IN3 A;  1XOB A;  1PRX A;  4HZ4 A;  5EVO A;  3TB2 A;  3NIV A;  4K9Z A;  3L9U A;  3VWV A;  4ZBD A;  4HI7 A;  3HYP A;  3BBY A;  3MAK A;  4QQ7 A;  5ECM B;  3PR8 A;  1QK8 A;  1K0C A;  1AC1 A;  3LGC A;  5IIZ A;  3BOA A;  1U3A A;  1CQG A;  1HD2 A;  5J9C A;  3KH7 A;  3D22 A;  3F0I A;  3GHA A;  4LMW A;  1AW9 A;  1IYI A;  4JU5 A;  1U88 A;  4KCA A;  2VIM A;  1A2J A;  1R26 A;  1WPI A;  3RBT A;  2WDU A;  2LKU A;  4OFT A;  2VM2 A;  4NPB A;  2B7K A;  6GSW A;  1QXH A;  4MZB A;  3VPT A;  1S3A A;  3BJ5 A;  4OCE A;  5ID2 A;  2RM6 A;  3CMI A;  1KTE A;  1QFN A;  1A2L A;  1SJZ A;  2B5Y A;  4NV2 A;  3MDK A;  3KXO A;  2NBS A;  5ECO B;  1JLW A;  4YQU A;  3EC3 A;  2YJ7 A;  3IRA A;  2BJX A;  5IMF A;  1WWJ A;  2LNT A;  1Y25 A;  1XVW A;  5GAN D;  1GUH A;  1AQV A;  2BTO T;  3U6V A;  3W6G A;  3FR6 A;  1FOV A;  3M1G A;  4MK3 A;  1H75 A;  1PD2 1;  4TRX A;  1V9W A;  2IFQ A;  2IMF A;  4WF5 A;  4MP4 A;  3F3R A;  4KCE A;  4O92 A;  1TRV A;  3DD3 A;  4KGI A;  2VL3 A;  1JZR A;  4I6X A;  2XC2 A;  4AJ7 A;  4AJ8 A;  1E2Y A;  10GS A;  3WGX A;  3QPM A;  1ZYQ B;  4MJE A;  3KTL A;  4K6X A;  5JCW A;  2WUL A;  2O87 A;  2C3N A;  2DJ2 A;  1GSQ A;  1O6J A;  2WB9 A;  5DQY A;  1SJI A;  3ZRE A;  1XWC A;  3UJ1 A;  2C8U A;  3C71 A;  2RII A;  1FB6 A;  2R37 A;  4MA9 A;  3TRP A;  2NVL A;  5F0G A;  4ZBB A;  1XW5 A;  4I97 A;  3UMA A;  5A4W A;  3ERG A;  2CV4 A;  2JZS A;  1DSB A;  5ELG A;  4TW5 A;  1GNE A;  2XBI A;  4IKH A;  4EDZ A;  2E7P A;  5JWO B;  4KND A;  5HR1 A;  4YQV A;  2L6C A;  3KCM A;  4TR3 A;  4YH2 A;  3J7Y k;  2XPD A;  3O76 A;  2H76 A;  3W8S A;  2PVO C;  5ECL B;  1OC9 B;  2CVB A;  4K7N A;  5HR3 A;  1LU4 A;  2H6Z A;  1G6W A;  2O8V B;  4JR4 A;  1JZD A;  4YAP A;  2LJA A;  4PNG A;  2KP2 A;  1GSS A;  2A2S A;  1GSU A;  3C1R A;  3ZYW A;  8GSS A;  5AN1 A;  4ZL8 A;  5HQP A;  3G7I A;  1G7E A;  2J23 A;  4BPY A;  3R2Q A;  5HR0 A;  2JSZ A;  4ZL7 A;  3VI5 A;  4H86 A;  1I9D A;  1MEK A;  4L8E A;  1PX7 A;  3N5O A;  2LV3 A;  5ECQ B;  3TKP A;  2LRN A;  1WP0 A;  1GP1 A;  4P3Y B;  5GST A;  3KP9 A;  2YNX A;  2JAD A;  4PQ1 A;  4ZB6 A;  4EL1 A;  1Z3E A;  1F3A A;  5F05 A;  1WE0 A;  2A2R A;  2K8S A;  9GSS A;  3S9F A;  3GTU A;  5A4U A;  1SL2 B;  2YV9 A;  2GSQ A;  1S3C A;  1XFL A;  5CRH A;  1NW2 A;  1T1V A;  3TOT A;  3KJY A;  4PNF A;  1FW1 A;  2ZCT A;  2PPT A;  5IPG A;  1VF4 A;  1F9M A;  3LXZ A;  1V40 A;  4XS6 A;  5J3R A;  3GN3 A;  1PQN A;  3F4R A;  1SYR A;  1TRW A;  1LJR A;  3KMN A;  3QMX A;  3Q19 A;  2AV4 A;  4KDY A;  3TOU A;  3LYP A;  1TI3 A;  2V41 A;  1YY7 A;  1EGO A;  2NTO A;  1OE7 A;  2OE3 A;  3H8Q A;  4Q5R A;  4EXJ A;  2O7K A;  3NOF A;  5IPH A;  3IV4 A;  1ZL9 A;  3L78 A;  5H5Q A;  2REM A;  5H5S A;  4MLY A;  1GLP A;  4POL A;  1TI1 A;  4KW6 A;  2N5F A;  1TK0 B; 
#chains in the Genus database with same CATH topology
 3P8W A;  1JHB A;  3KGK A;  2HI7 A;  4FH8 A;  3IC4 A;  4N0Z A;  4O32 A;  5G5F A;  4KSM A;  4TR0 A;  2WJU A;  4MJC A;  3DXB A;  1HNA A;  3EMX A;  4E8H A;  4DSS A;  3ISO A;  1R4W A;  3ZMK A;  1YEX A;  1SK2 A;  3HZ8 A;  1O73 A;  2CAI A;  2YN1 A;  5IOX A;  3A2X A;  5GZZ B;  4BVX A;  2FA8 A;  2HYX A;  1VF2 A;  4Q5F A;  2R4V A;  4NMU A;  2X8H A;  2QGV A;  2HSY A;  2YZH A;  4KSO A;  4OFN A;  3V1W A;  4XS4 B;  2H70 A;  3FR3 A;  5DJM A;  1AIU A;  3IR4 A;  4K0G A;  1K0A A;  2B6M A;  2I1U A;  5IM9 A;  3KM6 A;  4KDU A;  4WEY A;  4JBB A;  4ULX A;  4OCF A;  3TKR A;  1MDK A;  4NV5 A;  4YAV A;  2IWT A;  2X64 A;  2L4C A;  19GS A;  2VCZ A;  2VO4 A;  2E0Q A;  5DAL A;  2GZY A;  1BG5 A;  2C80 A;  2OE0 A;  3JCM L;  1TRU A;  2L6D A;  3FZ4 A;  2AB6 A;  4PQI A;  2R6K A;  4D73 B;  1NM3 A;  1GUL A;  4ML6 A;  5LD0 A;  5A4V A;  3M3M A;  3TCO A;  2V6O A;  4O5R A;  2P31 A;  4J2F A;  1SD9 A;  2R2J A;  2OAD A;  1K0O A;  3W8J A;  1TK8 B;  4POB A;  5D9T A;  3EU4 A;  2LQQ A;  3GX8 A;  3TKS C;  3EU3 A;  2OBI A;  4N11 A;  1CQH A;  4PTS A;  2DC5 A;  1JFU A;  4GQC A;  2GT5 A;  3KIJ A;  3ED3 A;  3LOR A;  4KE3 A;  1TU8 A;  4NHW A;  1WJK A;  1EV4 A;  4K0N A;  3IXR A;  3UBK A;  4PGT A;  1SK1 A;  1EWX A;  1KBN A;  2AHE A;  5IOW A;  3CRU A;  1B9X C;  3L4N A;  1PFO A;  3VUR A;  2H30 A;  1GSY A;  4EKZ A;  4Z2U A;  2UZ8 A;  5FT3 A;  1QMV A;  4EO3 A;  1U87 A;  2EIO A;  3ZIJ A;  1PL1 A;  4MMM A;  3BD2 A;  2AJQ B;  1V98 A;  2V6K A;  1ERW A;  2LUS A;  5GSS A;  3HJM A;  1TTZ A;  1V57 A;  3TJG A;  1N2A A;  2VOC A;  3AY8 A;  5E59 A;  3RAZ A;  5J5N A;  3Q74 A;  2HT9 A;  3HZ4 A;  1ZOF A;  4GXZ A;  4OO5 A;  4XRD A;  2CAQ A;  2DJK A;  4AF2 A;  1SKW B;  3U5R E;  5G1K A;  5CRG A;  1MTC A;  3DRN A;  1B9Y C;  2PBJ A;  3GKN A;  4G0I A;  3UEM A;  4HZ2 A;  1DE2 A;  1WIK A;  3HVN A;  1OE8 A;  4MZW A;  2H73 A;  3CYN A;  5ECK B;  3UBL A;  1YKC A;  2VLV A;  2GQM A;  2WZ9 A;  1VGL A;  1OVN A;  3D4M A;  4PQH A;  2XBQ A;  1V2A A;  4MF6 A;  1NHO A;  1XW6 A;  1PX6 A;  2IPA A;  3P7X A;  5ENU A;  1OC9 A;  4PUR A;  1F3B A;  3GNJ A;  1F37 A;  2FY6 A;  3IPZ A;  4EDY A;  4ZIL A;  2VL2 C;  2FWG A;  3EVI A;  2GZZ A;  4KB3 A;  4NHZ A;  2PGT A;  2FLS A;  1O8X A;  1FVK A;  3TUE A;  5B8A A;  7GSS A;  1AAZ A;  1M9B A;  2RM5 A;  4Z7X A;  4GSS A;  3E3E A;  2JU5 A;  2MYG A;  2E2G A;  4HU9 A;  1USB A;  1EOG A;  4WR5 A;  1A23 A;  1FHE A;  4BVY A;  4HJM A;  3A3T A;  4IQA A;  1M0U A;  3TKS A;  1PN9 A;  4TR1 B;  4XIH A;  4IQ1 A;  2GZP A;  5JCG A;  2QC7 A;  2QA1 A;  3EYT A;  1WOU A;  2G0F A;  4RUV A;  1XWG A;  3FHK A;  1W4V A;  5ABR A;  5G31 A;  3PIN A;  2KP1 A;  1GH2 A;  1ERU A;  3ERF A;  2DLX A;  3E0U A;  1BJX A;  1GSF A;  3GKK A;  4TR4 A;  4MF7 A;  1GUM A;  4J56 E;  3CXG A;  2TRX A;  2QKE A;  4Z2R A;  3LEF A;  3IHQ A;  3GL5 A;  1NSW A;  2LJR A;  1GTA A;  4ICY A;  3RHB A;  4MJB A;  4EVM A;  1WMJ A;  3DIE A;  3C73 A;  2L57 A;  3ME7 A;  2H6Y A;  1F2E A;  2DIY A;  1Z7P A;  4LA1 A;  2XHF A;  4OFM A;  3EIN A;  4YKG A;  1YKA A;  1O8W A;  2HE3 A;  5F8B A;  2B5X A;  2DML A;  3MYD A;  1TDI A;  2B7J A;  2H6X A;  3TKQ A;  1FOH A;  3A5I A;  1YZX A;  1DBY A;  5CYY A;  2I3Y A;  2DJ0 A;  4TXO B;  4I8B A;  3CSH A;  1GSE A;  4G19 A;  5DQS A;  1GNW A;  4TKY A;  4X43 A;  2FNO A;  2GST A;  4AGS A;  3TGZ A;  4BA7 A;  2H71 A;  4JE1 A;  3DEX A;  1TW9 A;  18GS A;  2G2Q A;  4WET A;  4X4J A;  3DYR A;  3FW2 A;  3CQF A;  1O7U A;  2FUG 2;  2HLS A;  3QOU A;  4L0W A;  1OC8 A;  2H0G A;  4JR6 A;  4F0C A;  5DBQ A;  2HXK A;  2XPE A;  1LBK A;  2F9S A;  2FWH A;  5DJL A;  2VL2 A;  3UVT A;  1MDJ A;  4WBJ A;  5G5E A;  2YV7 A;  4G0L A;  5IMD A;  1PMT A;  4GQF A;  4HSC X;  2X49 A;  2H1D A;  3QDN A;  2M46 A;  4GLT A;  1QUW A;  2P5Q A;  3O3T A;  2FHE A;  2I9H A;  2GSR A;  1BED A;  2VLT A;  4XS4 A;  1GL8 A;  3HVV A;  3VLN A;  1XVQ A;  4EC0 A;  1K0D A;  1M99 A;  1M2D A;  1O81 A;  3E9J B;  2MBT A;  4MDC A;  5LNK e;  2B1L A;  5J4U A;  2TIR A;  1YF0 A;  1IYH A;  3ME8 A;  5DAK B;  4POM A;  5IMZ A;  3MNG A;  2M80 A;  5C04 A;  4GWR A;  4PUF C;  2P5R A;  3KMO A;  5HFG A;  3UL3 A;  3HDC A;  22GS A;  1THX A;  4D73 A;  2DJ1 A;  1ZYN A;  2DKI A;  3F6D A;  1WRY A;  2HRF A;  4K2X A;  4MZC A;  3MWH A;  1SEN A;  4L0U A;  3A2W A;  3GKM A;  2B5E A;  20GS A;  3GST A;  4V1A g;  1R5A A;  2CT6 A;  3EWL A;  4HQZ A;  3GIX A;  1OKD A;  5KN1 A;  5ECS A;  1ST9 A;  1E6B A;  1K0B A;  1B48 A;  4N0V A;  2VD1 A;  2YWO A;  2LRC A;  1ZMA A;  5BMU A;  4ZBA A;  2FWE A;  3IK7 A;  4IS0 A;  1A8Y A;  3RDW A;  2IL3 A;  3LXT A;  1TU7 A;  2PU9 C;  3GA4 A;  1QGV A;  4BWQ A;  3GH9 A;  2DMM A;  3K8N A;  6GSX A;  4CHS A;  3PH9 A;  3EMP A;  4ECB A;  2B1K A;  2R3X A;  1T3B A;  5D9X A;  2V32 A;  2ALB A;  5IO0 A;  2IIY A;  4KDX A;  2I4A A;  3KEB A;  4MPF A;  4WBR D;  3D0Z A;  3ZRD A;  1JLV A;  2YWI A;  3CSJ A;  4FIW A;  1X5E A;  1VF3 A;  2IFQ B;  1AXD A;  4LL4 B;  1Z9H A;  5D8I A;  3KTB A;  5B6N A;  3P2A A;  3PPU A;  3TJF A;  5HR2 A;  4WR4 A;  1J9B A;  4OO4 A;  1EP7 A;  4V1A p;  1UVZ A;  4WXT A;  3ZLP A;  2OJL A;  3FYG A;  2IJY A;  1RQM A;  2AUV A;  5JWR B;  1XXU A;  3UAP A;  5CAX A;  3I6A A;  3GSS A;  1QQ2 A;  2CZ2 A;  2H74 A;  2N5A A;  2F3M A;  3DVX A;  1UA5 A;  1G7O A;  1DE1 A;  2JZR A;  1SD8 A;  2GT6 A;  4BL7 B;  5H5R A;  2C1Y A;  4LL1 B;  1GLQ A;  3ERW A;  3UOM A;  1M2B A;  3BCI A;  3D6I A;  1SK0 A;  2H1G A;  1W89 A;  2IMK A;  1T4Y A;  2H66 A;  2YWN A;  3GMF A;  3VI7 A;  3QCP A;  2PMT A;  2B3S A;  6GSV A;  2VCT A;  4O5U A;  2HZE B;  2HNL A;  4FYB A;  2K8V A;  1BYE A;  5B6M A;  2AAW A;  3D4T A;  4J57 E;  4F0B A;  4HEA 2;  3ZFL A;  2H75 A;  3WT1 A;  2RLI A;  3GH6 A;  1VRS D;  3HD5 A;  3IBH A;  4GRF A;  3ZTL A;  3F4T A;  4V2M A;  5F06 A;  2C0F A;  2YAN A;  4ILF A;  1A0F A;  4MCU A;  4TR1 A;  2DSA A;  4HJ2 A;  2EC4 A;  2R5G A;  1KEB A;  2DJJ A;  2VM1 A;  4CY6 A;  2OBK A;  3O6T A;  3UVH A;  1ABA A;  1GTI A;  4EIP A;  3GUS A;  5KEJ A;  5GAP D;  2C4J A;  1X5D A;  1MD3 A;  1B4Q A;  2DKH A;  1M3I A;  4GST A;  4HOJ A;  2VCW A;  2WGR A;  2K9F A;  3I9V 2;  3TDG A;  3QFB C;  1GUK A;  2X99 A;  3QD9 A;  1RK4 A;  4AJ6 A;  5A5K A;  2O85 A;  5IQY A;  1OYJ A;  1H4O A;  4WKW A;  1OC3 A;  3EUR A;  4XTS A;  1FB0 A;  2GTU A;  4F82 A;  3MSZ A;  4G2E A;  5IMA A;  2ZUP A;  3I43 A;  2HFD A;  4CDO A;  3G9B A;  6GSU A;  2GGT A;  2PUK C;  2X8C A;  3ZFB A;  14GS A;  3IA1 A;  4NWY A;  3TJB A;  5IMV A;  3HXS A;  4F03 A;  2OKA A;  5IO2 A;  3WT2 A;  3C7M A;  4MJA A;  1SL1 B;  4K7O A;  1Y6E A;  4KX4 A;  3P90 A;  2LJK A;  2KHP A;  2KOK A;  4YKF A;  1C72 A;  4DSQ A;  4HU7 A;  3F8U A;  3WGE A;  5ECR B;  2DBC A;  1EP8 A;  3G7J A;  2H19 A;  4ECC A;  2ZNM A;  5ECI B;  5KN3 A;  3HCZ A;  1VF1 A;  1GTB A;  3GX0 A;  3FY7 A;  4K2D A;  3KH9 A;  1SJ6 A;  4IEL A;  1X5C A;  5KN2 A;  2JAC A;  3M8N A;  4JRR A;  3SWL A;  1XBS A;  1ON4 A;  3FZA A;  3ZML A;  1YDK A;  3IAM 2;  2MMA A;  5CO3 A;  3F4S A;  5EPF A;  1Q98 A;  4L5L A;  2VD0 A;  1HNC A;  1EZK A;  3CTF A;  4OMV A;  1T00 A;  4I5Q A;  3M9J A;  3IDV A;  4YQM A;  2HRN A;  1XWK A;  1Z7R A;  3GL3 A;  2PWJ A;  3FRC A;  3GRX A;  4IJI A;  5DAK A;  5CP1 A;  4PUA A;  1T4Z A;  1XPV A;  3Q6O A;  5FWG A;  3QAW A;  2CA8 A;  3FK8 A;  4K5S A;  4XS1 A;  5AIV A;  4ECI A;  2JZT A;  4ZB9 A;  3C1S A;  5DAL B;  4QL9 A;  3DKS A;  1XIY A;  1A8L A;  3QFA C;  4PXO A;  4KAE A;  2YWM A;  3DGQ A;  4IP6 A;  2O89 A;  2VUP A;  4O5Q A;  1U3I A;  4KF9 A;  2HSH A;  4IN0 A;  2VAF A;  2NDO A;  1SL0 B;  2CVK A;  2M72 A;  1J08 A;  2L5O A;  3F9U A;  1GWC A;  2PVQ A;  4XHM A;  3GKX A;  4Z2T A;  4F2I A;  2L59 A;  2WFC A;  1X9S B;  3LQ7 A;  4GCI A;  3TKS E;  1TJD A;  1XOA A;  1GTU A;  5L71 A;  4POK A;  2H0H A;  4TN8 A;  1R7H A;  1PL2 A;  2RUF A;  2OAC A;  3VWU A;  3RHC A;  2C0G A;  3DML A;  1ZYE A;  17GS A;  2EIR A;  2MMZ A;  4IP1 A;  1F6M C;  4ZB8 A;  2X8G A;  4O7H A;  3FMW A;  1SKS B;  4KH7 A;  2LS5 A;  3HHV A;  3HKR A;  4TXV A;  3LYK A;  1TXX A;  1FO5 A;  1XW9 A;  5D9W A;  3FR9 A;  1XWA A;  5B8B A;  2LEG A;  2JL4 A;  4BWS A;  1V58 A;  4I2U A;  3QAG A;  4OD7 A;  2WS2 A;  1BQ7 A;  2D2Z A;  1XG8 A;  2YPM A;  4XRA A;  2FCH A;  3N9J A;  4NXI A;  2YCD A;  4X0X A;  3VFI A;  1YQ1 A;  5AIS A;  3LSZ A;  3G7Y A;  1X0R A;  2MZC A;  1EOH A;  1M3J A;  2Z9S A;  4TOP A;  4BL7 A;  5G1L A;  4K1F A;  2VCQ A;  5FHI A;  3DWV A;  1XWB A;  4HQS A;  3US3 A;  1T8E B;  2LRT A;  1SU9 A;  1MD4 A;  2F8F A;  3H79 A;  2V2G A;  4N30 A;  3Q18 A;  1ERT A;  1FG4 A;  2GLR A;  1UC7 A;  2C0D A;  5C00 A;  1SKR B;  2V1M A;  2ES7 A;  2NPB A;  1TOF A;  1X9M B;  4MH3 A;  2FWF A;  2GQL A;  2WCI A;  1AQX A;  1M7T A;  4N10 A;  3FZ9 A;  1BAY A;  1PKZ A;  1ZGN A;  3R3E A;  5CRD A;  1Z6N A;  2HZE A;  5LCZ A;  3UIW A;  5EY6 A;  2C3Q A;  2GSS A;  3FKF A;  2PN8 A;  4NAX A;  2OE1 A;  3RPN A;  5HFI A;  2A4V A;  2YOI A;  5EL8 A;  2CZ3 A;  1KNG A;  2H1A A;  3CTG A;  5DCH A;  5J41 A;  2MBS A;  2JSY A;  1THO A;  4WF4 A;  5DCG A;  2CVD A;  3HVS A;  1HQO A;  4CY8 A;  4ZXG A;  2VL9 A;  11GS A;  3HJO A;  4USS A;  3IE3 A;  1A2M A;  1A0R P;  3I69 A;  4ZIJ A;  4EUY A;  1G6Y A;  2CQ9 A;  3GV1 A;  5IMC A;  1SYX A;  2FGX A;  5KOX A;  5CRE A;  5KN0 A;  5G30 A;  1K3O A;  1TRS A;  4MPG A;  4K7I A;  1EEJ A;  3EE2 A;  2GDR A;  3LG6 A;  4RI6 A;  1OKT A;  5ID2 B;  3KD0 A;  5ECH B;  1ILO A;  5ELA A;  2HZF A;  3IK9 A;  1A24 A;  4FYC A;  2LQO A;  4EIQ A;  2E2M A;  4MF5 A;  4MNN A;  1TK5 B;  4V2L A;  4XCS A;  4KUN A;  2BMX A;  4Q5N A;  4E8E A;  2QA2 A;  4IHU A;  3SBC A;  3L9V A;  2FA4 A;  3LW9 A;  2MMN A;  4IGJ A;  2DJ3 A;  2N5B A;  3HY2 A;  1EV9 A;  2AYT A;  1MDI A;  2QSI A;  5J9B A;  2CX3 A;  3LJR A;  3TRQ A;  2H1B A;  16GS A;  4GSN A;  2K18 A;  4V2N A;  1S3R A;  2H72 A;  4RI7 A;  2PER A;  3HJP A;  3KZQ A;  1Z5Y E;  1B8X A;  4HUA A;  3VWW A;  1BX9 A;  2C0E A;  12GS A;  2FD3 A;  2VCX A;  3BCK A;  3L0H A;  6GSS A;  5D73 A;  2IMI A;  2ON5 A;  2J9H A;  1RW1 A;  4FYU A;  1ZZY A;  1GRX A;  1PA3 A;  4EF0 A;  1EGR A;  1K0M A;  1U6T A;  4MH2 A;  3ZL5 A;  5D9V A;  3C8E A;  3IHG A;  1Z6M A;  4TVE A;  1AQW A;  1K3L A;  1M9A A;  3ZIT A;  2R0C A;  1G0T A;  2I81 A;  2LNS A;  3UAR A;  1AUC A;  1JZO A;  4G10 A;  4EE0 A;  5JWQ B;  4ZL9 A;  3D21 A;  3WGD A;  5ECP B;  2YP6 A;  3LWA A;  1PSQ A;  2RUE A;  1ML6 A;  6GST A;  3TJJ A;  3QR6 A;  2H01 A;  5D93 A;  3OR5 A;  1TKD B;  3M9K A;  2C3T A;  5F07 A;  3APS A;  3NZN A;  1K3Y A;  4JED A;  5JCU A;  3L9S A;  1M2A A;  2VCV A;  1DUG A;  2LTK A;  4DEJ A;  4G9H A;  1ZCP A;  3D5J A;  1YJ6 A;  4MAB A;  3APQ A;  3HVX A;  4GTU A;  2VLU A;  1YEP A;  4IW9 A;  1UN2 A;  2OA7 A;  4I2T A;  3F63 A;  2YJH A;  1J0F A;  3KP8 A;  1B4P A;  4PX1 A;  4RQX A;  3IOS A;  1JZW A;  5INY A;  3ZVJ D;  3A5W A;  4IBP A;  4Q5Q A;  2TRC P;  5AGY A;  2HRA A;  3CRT A;  5DDL A;  3GTU B;  1XCC A;  1S3D A;  3GFK A;  3VK9 A;  1NHY A;  3FZ5 A;  5E4W A;  5DVB A;  1XZO A;  13GS A;  4ID0 A;  4JZQ A;  2K6V A;  5D96 A;  1TP9 A;  4LLR A;  1X9W B;  3EPT A;  3TRX A;  4KA0 A;  4HDE A;  2EIQ A;  5AIX A;  2ON7 A;  1ACV A;  2X4A A;  2LST A;  2L5L A;  3IAS 2;  1PKW A;  4ECJ A;  1HNB A;  4DSR A;  1I5G A;  2F51 A;  3F3Q A;  3A2V A;  5ECN B;  4GF0 A;  3J7Y b;  3H93 A;  1URM A;  2P0G A;  1T7P B;  1Q4J A;  3HA9 A;  4FO5 A;  4IVF A;  1EEM A;  1O85 A;  4HS1 A;  4IJ3 A;  4ML1 A;  4TXO A;  3ZIV A;  1K0N A;  5G2Z A;  3VPQ A;  2GQK A;  2KUC A;  4K8M A;  1FVJ A;  2CX4 A;  4CW9 A;  2GVP A;  1OAZ A;  2H8L A;  2HRK A;  2WRT A;  1N8J A;  3WYW A;  1R5P A;  3GUR A;  3TJK A;  1PGT A;  3H1N A;  5CRW A;  2DIZ A;  5B7C A;  3CBU A;  3DVW A;  2IME A;  3ZVJ A;  4LMV A;  2KLX A;  4X1U A;  4L5O A;  3WD6 A;  3GYK A;  3RPP A;  4DVC A;  2IMD A;  3FEU A;  3F6F A;  2L4Q A;  1FAA A;  5COH A;  2H0I A;  4DSS B;  3PGT A;  2GS3 A;  1GSD A;  1ZYP A;  3QAV A;  3LFL A;  3ZZX A;  5HFK A;  2MMO A;  2HSM A;  4QL7 A;  5CNW A;  2F8A A;  4BVX B;  1ERV A;  1HYU A;  1YF1 A;  3M0F A;  4ACS A;  4F9Z A;  2A4H A;  4ISD A;  4RQR A;  3VWX A;  3APO A;  4OWY A;  3H4K A;  6GSY A;  2YZU A;  3CSI A;  2IN3 A;  1XOB A;  1PRX A;  4HZ4 A;  5EVO A;  3TB2 A;  3NIV A;  4K9Z A;  3L9U A;  3VWV A;  4ZBD A;  4HI7 A;  3HYP A;  3BBY A;  3MAK A;  4QQ7 A;  5ECM B;  3PR8 A;  1QK8 A;  1K0C A;  1AC1 A;  3LGC A;  5IIZ A;  3BOA A;  1U3A A;  1CQG A;  1HD2 A;  5J9C A;  3KH7 A;  3D22 A;  3F0I A;  3GHA A;  4LMW A;  1AW9 A;  1IYI A;  4JU5 A;  1U88 A;  4KCA A;  2R0P A;  2VIM A;  1A2J A;  4BIK A;  1R26 A;  1WPI A;  3RBT A;  2WDU A;  2LKU A;  4OFT A;  2VM2 A;  4NPB A;  2B7K A;  6GSW A;  1QXH A;  4MZB A;  3VPT A;  1S3A A;  3BJ5 A;  4OCE A;  5ID2 A;  2RM6 A;  3CMI A;  4A5P A;  1KTE A;  1QFN A;  1A2L A;  1SJZ A;  2B5Y A;  4NV2 A;  3MDK A;  3KXO A;  2NBS A;  5ECO B;  1JLW A;  4YQU A;  3EC3 A;  2YJ7 A;  3IRA A;  2BJX A;  5IMF A;  1WWJ A;  2LNT A;  1Y25 A;  1XVW A;  5GAN D;  1GUH A;  1AQV A;  2BTO T;  3U6V A;  3W6G A;  3FR6 A;  1FOV A;  3M1G A;  4MK3 A;  1H75 A;  1PD2 1;  4TRX A;  1V9W A;  2IFQ A;  2IMF A;  4WF5 A;  2R0G A;  4MP4 A;  3F3R A;  4KCE A;  4O92 A;  1TRV A;  3DD3 A;  4KGI A;  2VL3 A;  1JZR A;  4I6X A;  2XC2 A;  4AJ7 A;  4AJ8 A;  1E2Y A;  10GS A;  3WGX A;  3QPM A;  1ZYQ B;  4MJE A;  3KTL A;  4K6X A;  5JCW A;  2WUL A;  2O87 A;  2C3N A;  2DJ2 A;  1GSQ A;  1O6J A;  2WB9 A;  5DQY A;  1SJI A;  3ZRE A;  1XWC A;  3UJ1 A;  2C8U A;  3C71 A;  2RII A;  1FB6 A;  2R37 A;  4MA9 A;  3TRP A;  2NVL A;  2A2P A;  5F0G A;  4ZBB A;  1XW5 A;  4I97 A;  3UMA A;  5A4W A;  3ERG A;  2CV4 A;  2JZS A;  1DSB A;  5ELG A;  4TW5 A;  1GNE A;  2XBI A;  4IKH A;  4EDZ A;  2E7P A;  5JWO B;  4KND A;  5HR1 A;  4YQV A;  2L6C A;  3KCM A;  4TR3 A;  4YH2 A;  3J7Y k;  2XPD A;  3O76 A;  2H76 A;  3W8S A;  2PVO C;  5ECL B;  1OC9 B;  2CVB A;  4K7N A;  5HR3 A;  1LU4 A;  2H6Z A;  3IC8 A;  1G6W A;  2O8V B;  4JR4 A;  4FQU A;  1JZD A;  4YAP A;  2LJA A;  4PNG A;  2KP2 A;  1GSS A;  2A2S A;  1GSU A;  3C1R A;  3ZYW A;  8GSS A;  5AN1 A;  4ZL8 A;  5HQP A;  3G7I A;  1G7E A;  2J23 A;  4BPY A;  3R2Q A;  5HR0 A;  2JSZ A;  4ZL7 A;  3VI5 A;  4H86 A;  1I9D A;  1MEK A;  4L8E A;  1PX7 A;  3N5O A;  3MIX A;  2LV3 A;  4BVY B;  5ECQ B;  1PN0 A;  3TKP A;  2LRN A;  1WP0 A;  1GP1 A;  5KOW A;  4P3Y B;  5GST A;  3KP9 A;  2YNX A;  2JAD A;  4PQ1 A;  4ZB6 A;  4EL1 A;  1Z3E A;  1F3A A;  5F05 A;  1WE0 A;  2A2R A;  2K8S A;  9GSS A;  3S9F A;  3GTU A;  5A4U A;  1SL2 B;  2YV9 A;  2GSQ A;  1S3C A;  1XFL A;  5BRT A;  5CRH A;  1NW2 A;  1T1V A;  3TOT A;  3KJY A;  4PNF A;  1FW1 A;  2ZCT A;  2PPT A;  5IPG A;  1VF4 A;  1F9M A;  3LXZ A;  1V40 A;  4XS6 A;  5J3R A;  3GN3 A;  1PQN A;  3F4R A;  1SYR A;  1TRW A;  4G0K A;  1LJR A;  3KMN A;  3QMX A;  3Q19 A;  2AV4 A;  4KDY A;  3TOU A;  3LYP A;  1TI3 A;  2V41 A;  1YY7 A;  1EGO A;  2NTO A;  1OE7 A;  2OE3 A;  3H8Q A;  4Q5R A;  4EXJ A;  2O7K A;  3NOF A;  5IPH A;  3IV4 A;  1ZL9 A;  3L78 A;  5H5Q A;  2REM A;  5H5S A;  4MLY A;  1GLP A;  4K5R A;  4POL A;  1TI1 A;  4KW6 A;  2N5F A;  1TK0 B; 
#chains in the Genus database with same CATH homology
 3P8W A;  1JHB A;  3KGK A;  2HI7 A;  4FH8 A;  3IC4 A;  4N0Z A;  4O32 A;  5G5F A;  4KSM A;  4TR0 A;  2WJU A;  4MJC A;  3DXB A;  1HNA A;  3EMX A;  4E8H A;  4DSS A;  3ISO A;  1R4W A;  3ZMK A;  1YEX A;  1SK2 A;  3HZ8 A;  1O73 A;  2CAI A;  2YN1 A;  5IOX A;  3A2X A;  5GZZ B;  4BVX A;  2FA8 A;  2HYX A;  1VF2 A;  4Q5F A;  2R4V A;  4NMU A;  2X8H A;  2QGV A;  2HSY A;  2YZH A;  4KSO A;  4OFN A;  3V1W A;  4XS4 B;  2H70 A;  3FR3 A;  5DJM A;  1AIU A;  3IR4 A;  4K0G A;  1K0A A;  2B6M A;  2I1U A;  5IM9 A;  3KM6 A;  4KDU A;  4WEY A;  4JBB A;  4ULX A;  4OCF A;  3TKR A;  1MDK A;  4NV5 A;  4YAV A;  2IWT A;  2X64 A;  2L4C A;  19GS A;  2VCZ A;  2VO4 A;  2E0Q A;  5DAL A;  2GZY A;  1BG5 A;  2C80 A;  2OE0 A;  3JCM L;  1TRU A;  2L6D A;  3FZ4 A;  2AB6 A;  4PQI A;  2R6K A;  4D73 B;  1NM3 A;  1GUL A;  4ML6 A;  5LD0 A;  5A4V A;  3M3M A;  3TCO A;  2V6O A;  4O5R A;  2P31 A;  4J2F A;  1SD9 A;  2R2J A;  2OAD A;  1K0O A;  3W8J A;  1TK8 B;  4POB A;  5D9T A;  3EU4 A;  2LQQ A;  3GX8 A;  3TKS C;  3EU3 A;  2OBI A;  4N11 A;  1CQH A;  4PTS A;  2DC5 A;  1JFU A;  4GQC A;  2GT5 A;  3KIJ A;  3ED3 A;  3LOR A;  4KE3 A;  1TU8 A;  4NHW A;  1WJK A;  1EV4 A;  4K0N A;  3IXR A;  3UBK A;  4PGT A;  1SK1 A;  1EWX A;  1KBN A;  2AHE A;  5IOW A;  3CRU A;  1B9X C;  3L4N A;  3VUR A;  2H30 A;  1GSY A;  4EKZ A;  4Z2U A;  2UZ8 A;  5FT3 A;  1QMV A;  4EO3 A;  1U87 A;  2EIO A;  3ZIJ A;  1PL1 A;  4MMM A;  3BD2 A;  2AJQ B;  1V98 A;  2V6K A;  1ERW A;  2LUS A;  5GSS A;  3HJM A;  1TTZ A;  1V57 A;  3TJG A;  1N2A A;  2VOC A;  3AY8 A;  5E59 A;  3RAZ A;  5J5N A;  3Q74 A;  2HT9 A;  3HZ4 A;  1ZOF A;  4GXZ A;  4OO5 A;  4XRD A;  2CAQ A;  2DJK A;  4AF2 A;  1SKW B;  3U5R E;  5G1K A;  5CRG A;  1MTC A;  3DRN A;  1B9Y C;  2PBJ A;  3GKN A;  4G0I A;  3UEM A;  4HZ2 A;  1DE2 A;  1WIK A;  1OE8 A;  4MZW A;  2H73 A;  3CYN A;  5ECK B;  3UBL A;  1YKC A;  2VLV A;  2GQM A;  2WZ9 A;  1VGL A;  1OVN A;  3D4M A;  4PQH A;  2XBQ A;  1V2A A;  4MF6 A;  1NHO A;  1XW6 A;  1PX6 A;  2IPA A;  3P7X A;  5ENU A;  1OC9 A;  4PUR A;  1F3B A;  3GNJ A;  1F37 A;  2FY6 A;  3IPZ A;  4EDY A;  4ZIL A;  2VL2 C;  2FWG A;  3EVI A;  2GZZ A;  4KB3 A;  4NHZ A;  2PGT A;  2FLS A;  1O8X A;  1FVK A;  3TUE A;  5B8A A;  7GSS A;  1AAZ A;  1M9B A;  2RM5 A;  4Z7X A;  4GSS A;  3E3E A;  2JU5 A;  2MYG A;  2E2G A;  4HU9 A;  1USB A;  1EOG A;  4WR5 A;  1A23 A;  1FHE A;  4BVY A;  4HJM A;  3A3T A;  4IQA A;  1M0U A;  3TKS A;  1PN9 A;  4TR1 B;  4XIH A;  4IQ1 A;  2GZP A;  5JCG A;  2QC7 A;  2QA1 A;  3EYT A;  1WOU A;  2G0F A;  4RUV A;  1XWG A;  3FHK A;  1W4V A;  5ABR A;  5G31 A;  3PIN A;  2KP1 A;  1GH2 A;  1ERU A;  3ERF A;  2DLX A;  3E0U A;  1BJX A;  1GSF A;  3GKK A;  4TR4 A;  4MF7 A;  1GUM A;  4J56 E;  3CXG A;  2TRX A;  2QKE A;  4Z2R A;  3LEF A;  3IHQ A;  3GL5 A;  1NSW A;  2LJR A;  1GTA A;  4ICY A;  3RHB A;  4MJB A;  4EVM A;  1WMJ A;  3DIE A;  3C73 A;  2L57 A;  3ME7 A;  2H6Y A;  1F2E A;  2DIY A;  1Z7P A;  4LA1 A;  2XHF A;  4OFM A;  3EIN A;  4YKG A;  1YKA A;  1O8W A;  2HE3 A;  5F8B A;  2B5X A;  2DML A;  3MYD A;  1TDI A;  2B7J A;  2H6X A;  3TKQ A;  1FOH A;  3A5I A;  1YZX A;  1DBY A;  5CYY A;  2I3Y A;  2DJ0 A;  4TXO B;  4I8B A;  3CSH A;  1GSE A;  4G19 A;  5DQS A;  1GNW A;  4TKY A;  4X43 A;  2FNO A;  2GST A;  4AGS A;  3TGZ A;  4BA7 A;  2H71 A;  4JE1 A;  3DEX A;  1TW9 A;  18GS A;  2G2Q A;  4WET A;  4X4J A;  3DYR A;  3FW2 A;  1O7U A;  2FUG 2;  2HLS A;  3QOU A;  4L0W A;  1OC8 A;  2H0G A;  4JR6 A;  4F0C A;  5DBQ A;  2HXK A;  2XPE A;  1LBK A;  2F9S A;  2FWH A;  5DJL A;  2VL2 A;  3UVT A;  1MDJ A;  4WBJ A;  5G5E A;  2YV7 A;  4G0L A;  5IMD A;  1PMT A;  4GQF A;  2X49 A;  2H1D A;  3QDN A;  2M46 A;  4GLT A;  1QUW A;  2P5Q A;  3O3T A;  2FHE A;  2I9H A;  2GSR A;  1BED A;  2VLT A;  4XS4 A;  1GL8 A;  3HVV A;  3VLN A;  1XVQ A;  4EC0 A;  1K0D A;  1M99 A;  1M2D A;  1O81 A;  3E9J B;  2MBT A;  4MDC A;  5LNK e;  2B1L A;  5J4U A;  2TIR A;  1YF0 A;  1IYH A;  3ME8 A;  5DAK B;  4POM A;  5IMZ A;  3MNG A;  2M80 A;  5C04 A;  4GWR A;  4PUF C;  2P5R A;  3KMO A;  5HFG A;  3UL3 A;  3HDC A;  22GS A;  1THX A;  4D73 A;  2DJ1 A;  1ZYN A;  2DKI A;  3F6D A;  1WRY A;  2HRF A;  4K2X A;  4MZC A;  3MWH A;  1SEN A;  4L0U A;  3A2W A;  3GKM A;  2B5E A;  20GS A;  3GST A;  4V1A g;  1R5A A;  2CT6 A;  3EWL A;  4HQZ A;  3GIX A;  1OKD A;  5KN1 A;  5ECS A;  1ST9 A;  1E6B A;  1K0B A;  1B48 A;  4N0V A;  2VD1 A;  2YWO A;  2LRC A;  1ZMA A;  5BMU A;  4ZBA A;  2FWE A;  3IK7 A;  4IS0 A;  1A8Y A;  3RDW A;  2IL3 A;  3LXT A;  1TU7 A;  2PU9 C;  3GA4 A;  1QGV A;  4BWQ A;  3GH9 A;  2DMM A;  3K8N A;  6GSX A;  4CHS A;  3PH9 A;  3EMP A;  4ECB A;  2B1K A;  2R3X A;  1T3B A;  5D9X A;  2V32 A;  2ALB A;  5IO0 A;  2IIY A;  4KDX A;  2I4A A;  3KEB A;  4MPF A;  4WBR D;  3D0Z A;  3ZRD A;  1JLV A;  2YWI A;  3CSJ A;  4FIW A;  1X5E A;  1VF3 A;  2IFQ B;  1AXD A;  4LL4 B;  1Z9H A;  5D8I A;  3KTB A;  5B6N A;  3P2A A;  3PPU A;  3TJF A;  5HR2 A;  4WR4 A;  1J9B A;  4OO4 A;  1EP7 A;  4V1A p;  1UVZ A;  4WXT A;  3ZLP A;  2OJL A;  3FYG A;  2IJY A;  1RQM A;  2AUV A;  5JWR B;  1XXU A;  3UAP A;  5CAX A;  3I6A A;  3GSS A;  1QQ2 A;  2CZ2 A;  2H74 A;  2N5A A;  2F3M A;  3DVX A;  1UA5 A;  1G7O A;  1DE1 A;  2JZR A;  1SD8 A;  2GT6 A;  4BL7 B;  5H5R A;  2C1Y A;  4LL1 B;  1GLQ A;  3ERW A;  3UOM A;  1M2B A;  3BCI A;  3D6I A;  1SK0 A;  2H1G A;  1W89 A;  2IMK A;  1T4Y A;  2H66 A;  2YWN A;  3GMF A;  3VI7 A;  3QCP A;  2PMT A;  2B3S A;  6GSV A;  2VCT A;  4O5U A;  2HZE B;  2HNL A;  4FYB A;  2K8V A;  1BYE A;  5B6M A;  2AAW A;  3D4T A;  4J57 E;  4F0B A;  4HEA 2;  3ZFL A;  2H75 A;  3WT1 A;  2RLI A;  3GH6 A;  1VRS D;  3HD5 A;  3IBH A;  4GRF A;  3ZTL A;  3F4T A;  4V2M A;  5F06 A;  2C0F A;  2YAN A;  4ILF A;  1A0F A;  4MCU A;  4TR1 A;  2DSA A;  4HJ2 A;  2EC4 A;  2R5G A;  1KEB A;  2DJJ A;  2VM1 A;  4CY6 A;  2OBK A;  3O6T A;  3UVH A;  1ABA A;  1GTI A;  4EIP A;  3GUS A;  5KEJ A;  5GAP D;  2C4J A;  1X5D A;  1MD3 A;  1B4Q A;  2DKH A;  4GST A;  4HOJ A;  2VCW A;  2WGR A;  2K9F A;  3I9V 2;  3TDG A;  3QFB C;  1GUK A;  2X99 A;  3QD9 A;  1RK4 A;  4AJ6 A;  5A5K A;  2O85 A;  5IQY A;  1OYJ A;  1H4O A;  4WKW A;  1OC3 A;  3EUR A;  4XTS A;  1FB0 A;  2GTU A;  4F82 A;  3MSZ A;  4G2E A;  5IMA A;  2ZUP A;  3I43 A;  2HFD A;  4CDO A;  3G9B A;  6GSU A;  2GGT A;  2PUK C;  2X8C A;  3ZFB A;  14GS A;  3IA1 A;  4NWY A;  3TJB A;  5IMV A;  3HXS A;  4F03 A;  2OKA A;  5IO2 A;  3WT2 A;  3C7M A;  4MJA A;  1SL1 B;  4K7O A;  1Y6E A;  4KX4 A;  3P90 A;  2LJK A;  2KHP A;  2KOK A;  4YKF A;  1C72 A;  4DSQ A;  4HU7 A;  3F8U A;  3WGE A;  5ECR B;  2DBC A;  1EP8 A;  3G7J A;  2H19 A;  4ECC A;  2ZNM A;  5ECI B;  5KN3 A;  3HCZ A;  1VF1 A;  1GTB A;  3GX0 A;  3FY7 A;  4K2D A;  3KH9 A;  1SJ6 A;  4IEL A;  1X5C A;  5KN2 A;  2JAC A;  3M8N A;  4JRR A;  3SWL A;  1XBS A;  1ON4 A;  3FZA A;  3ZML A;  1YDK A;  3IAM 2;  2MMA A;  5CO3 A;  3F4S A;  5EPF A;  1Q98 A;  4L5L A;  2VD0 A;  1HNC A;  1EZK A;  3CTF A;  4OMV A;  1T00 A;  4I5Q A;  3M9J A;  3IDV A;  4YQM A;  2HRN A;  1XWK A;  1Z7R A;  3GL3 A;  2PWJ A;  3FRC A;  3GRX A;  4IJI A;  5DAK A;  5CP1 A;  4PUA A;  1T4Z A;  1XPV A;  3Q6O A;  5FWG A;  3QAW A;  2CA8 A;  3FK8 A;  4K5S A;  4XS1 A;  5AIV A;  4ECI A;  2JZT A;  4ZB9 A;  3C1S A;  5DAL B;  4QL9 A;  3DKS A;  1XIY A;  1A8L A;  3QFA C;  4PXO A;  4KAE A;  2YWM A;  3DGQ A;  4IP6 A;  2O89 A;  2VUP A;  4O5Q A;  1U3I A;  4KF9 A;  2HSH A;  4IN0 A;  2VAF A;  2NDO A;  1SL0 B;  2CVK A;  2M72 A;  1J08 A;  2L5O A;  3F9U A;  1GWC A;  2PVQ A;  4XHM A;  3GKX A;  4Z2T A;  4F2I A;  2L59 A;  2WFC A;  1X9S B;  3LQ7 A;  4GCI A;  3TKS E;  1TJD A;  1XOA A;  1GTU A;  5L71 A;  4POK A;  2H0H A;  4TN8 A;  1R7H A;  1PL2 A;  2RUF A;  2OAC A;  3VWU A;  3RHC A;  2C0G A;  3DML A;  1ZYE A;  17GS A;  2EIR A;  2MMZ A;  4IP1 A;  1F6M C;  4ZB8 A;  2X8G A;  4O7H A;  3FMW A;  1SKS B;  4KH7 A;  2LS5 A;  3HHV A;  3HKR A;  4TXV A;  3LYK A;  1TXX A;  1FO5 A;  1XW9 A;  5D9W A;  3FR9 A;  1XWA A;  5B8B A;  2LEG A;  2JL4 A;  4BWS A;  1V58 A;  4I2U A;  3QAG A;  4OD7 A;  2WS2 A;  1BQ7 A;  2D2Z A;  2YPM A;  4XRA A;  2FCH A;  3N9J A;  4NXI A;  2YCD A;  4X0X A;  3VFI A;  1YQ1 A;  5AIS A;  3LSZ A;  3G7Y A;  1X0R A;  2MZC A;  1EOH A;  2Z9S A;  4TOP A;  4BL7 A;  5G1L A;  4K1F A;  2VCQ A;  5FHI A;  3DWV A;  1XWB A;  4HQS A;  3US3 A;  1T8E B;  2LRT A;  1SU9 A;  1MD4 A;  2F8F A;  3H79 A;  2V2G A;  4N30 A;  3Q18 A;  1ERT A;  1FG4 A;  2GLR A;  1UC7 A;  2C0D A;  5C00 A;  1SKR B;  2V1M A;  2ES7 A;  2NPB A;  1TOF A;  1X9M B;  4MH3 A;  2FWF A;  2GQL A;  2WCI A;  1AQX A;  1M7T A;  4N10 A;  3FZ9 A;  1BAY A;  1PKZ A;  1ZGN A;  3R3E A;  5CRD A;  1Z6N A;  2HZE A;  5LCZ A;  3UIW A;  5EY6 A;  2C3Q A;  2GSS A;  3FKF A;  2PN8 A;  4NAX A;  2OE1 A;  3RPN A;  5HFI A;  2A4V A;  2YOI A;  5EL8 A;  2CZ3 A;  1KNG A;  2H1A A;  3CTG A;  5DCH A;  5J41 A;  2MBS A;  2JSY A;  1THO A;  4WF4 A;  5DCG A;  2CVD A;  3HVS A;  1HQO A;  4CY8 A;  4ZXG A;  2VL9 A;  11GS A;  3HJO A;  4USS A;  3IE3 A;  1A2M A;  1A0R P;  3I69 A;  4ZIJ A;  4EUY A;  1G6Y A;  2CQ9 A;  3GV1 A;  5IMC A;  1SYX A;  2FGX A;  5KOX A;  5CRE A;  5KN0 A;  5G30 A;  1K3O A;  1TRS A;  4MPG A;  4K7I A;  1EEJ A;  3EE2 A;  2GDR A;  3LG6 A;  4RI6 A;  1OKT A;  5ID2 B;  3KD0 A;  5ECH B;  1ILO A;  5ELA A;  2HZF A;  3IK9 A;  1A24 A;  4FYC A;  2LQO A;  4EIQ A;  2E2M A;  4MF5 A;  4MNN A;  1TK5 B;  4V2L A;  4XCS A;  4KUN A;  2BMX A;  4Q5N A;  4E8E A;  2QA2 A;  4IHU A;  3SBC A;  3L9V A;  2FA4 A;  3LW9 A;  2MMN A;  4IGJ A;  2DJ3 A;  2N5B A;  3HY2 A;  1EV9 A;  2AYT A;  1MDI A;  2QSI A;  5J9B A;  2CX3 A;  3LJR A;  3TRQ A;  2H1B A;  16GS A;  4GSN A;  2K18 A;  4V2N A;  2H72 A;  4RI7 A;  2PER A;  3HJP A;  3KZQ A;  1Z5Y E;  1B8X A;  4HUA A;  3VWW A;  1BX9 A;  2C0E A;  12GS A;  2FD3 A;  2VCX A;  3BCK A;  3L0H A;  6GSS A;  5D73 A;  2IMI A;  2ON5 A;  2J9H A;  1RW1 A;  4FYU A;  1ZZY A;  1GRX A;  1PA3 A;  4EF0 A;  1EGR A;  1K0M A;  1U6T A;  4MH2 A;  3ZL5 A;  5D9V A;  3C8E A;  3IHG A;  1Z6M A;  4TVE A;  1AQW A;  1K3L A;  1M9A A;  3ZIT A;  2R0C A;  1G0T A;  2I81 A;  2LNS A;  3UAR A;  1AUC A;  1JZO A;  4G10 A;  4EE0 A;  5JWQ B;  4ZL9 A;  3D21 A;  3WGD A;  5ECP B;  2YP6 A;  3LWA A;  1PSQ A;  2RUE A;  1ML6 A;  6GST A;  3TJJ A;  3QR6 A;  2H01 A;  5D93 A;  3OR5 A;  1TKD B;  3M9K A;  2C3T A;  5F07 A;  3APS A;  3NZN A;  1K3Y A;  4JED A;  5JCU A;  3L9S A;  1M2A A;  2VCV A;  1DUG A;  2LTK A;  4DEJ A;  4G9H A;  1ZCP A;  3D5J A;  1YJ6 A;  4MAB A;  3APQ A;  3HVX A;  4GTU A;  2VLU A;  1YEP A;  4IW9 A;  1UN2 A;  2OA7 A;  4I2T A;  3F63 A;  2YJH A;  1J0F A;  3KP8 A;  1B4P A;  4PX1 A;  4RQX A;  3IOS A;  1JZW A;  5INY A;  3ZVJ D;  3A5W A;  4IBP A;  4Q5Q A;  2TRC P;  5AGY A;  2HRA A;  3CRT A;  5DDL A;  3GTU B;  1XCC A;  1S3D A;  3GFK A;  3VK9 A;  1NHY A;  3FZ5 A;  5E4W A;  5DVB A;  1XZO A;  13GS A;  4ID0 A;  4JZQ A;  2K6V A;  5D96 A;  1TP9 A;  4LLR A;  1X9W B;  3EPT A;  3TRX A;  4KA0 A;  4HDE A;  2EIQ A;  5AIX A;  2ON7 A;  1ACV A;  2X4A A;  2LST A;  2L5L A;  3IAS 2;  1PKW A;  4ECJ A;  1HNB A;  4DSR A;  1I5G A;  2F51 A;  3F3Q A;  3A2V A;  5ECN B;  4GF0 A;  3J7Y b;  3H93 A;  1URM A;  2P0G A;  1T7P B;  1Q4J A;  3HA9 A;  4FO5 A;  4IVF A;  1EEM A;  1O85 A;  4HS1 A;  4IJ3 A;  4ML1 A;  4TXO A;  3ZIV A;  1K0N A;  5G2Z A;  3VPQ A;  2GQK A;  2KUC A;  4K8M A;  1FVJ A;  2CX4 A;  4CW9 A;  2GVP A;  1OAZ A;  2H8L A;  2HRK A;  2WRT A;  1N8J A;  3WYW A;  1R5P A;  3GUR A;  3TJK A;  1PGT A;  3H1N A;  5CRW A;  2DIZ A;  5B7C A;  3CBU A;  3DVW A;  2IME A;  3ZVJ A;  4LMV A;  2KLX A;  4X1U A;  4L5O A;  3WD6 A;  3GYK A;  3RPP A;  4DVC A;  2IMD A;  3FEU A;  3F6F A;  2L4Q A;  1FAA A;  5COH A;  2H0I A;  4DSS B;  3PGT A;  2GS3 A;  1GSD A;  1ZYP A;  3QAV A;  3LFL A;  3ZZX A;  5HFK A;  2MMO A;  2HSM A;  4QL7 A;  5CNW A;  2F8A A;  4BVX B;  1ERV A;  1HYU A;  1YF1 A;  3M0F A;  4ACS A;  4F9Z A;  2A4H A;  4ISD A;  4RQR A;  3VWX A;  3APO A;  4OWY A;  3H4K A;  6GSY A;  2YZU A;  3CSI A;  2IN3 A;  1XOB A;  1PRX A;  4HZ4 A;  5EVO A;  3TB2 A;  3NIV A;  4K9Z A;  3L9U A;  3VWV A;  4ZBD A;  4HI7 A;  3HYP A;  3BBY A;  3MAK A;  4QQ7 A;  5ECM B;  3PR8 A;  1QK8 A;  1K0C A;  1AC1 A;  3LGC A;  5IIZ A;  3BOA A;  1U3A A;  1CQG A;  1HD2 A;  5J9C A;  3KH7 A;  3D22 A;  3F0I A;  3GHA A;  4LMW A;  1AW9 A;  1IYI A;  4JU5 A;  1U88 A;  4KCA A;  2R0P A;  2VIM A;  1A2J A;  1R26 A;  1WPI A;  3RBT A;  2WDU A;  2LKU A;  4OFT A;  2VM2 A;  4NPB A;  2B7K A;  6GSW A;  1QXH A;  4MZB A;  3VPT A;  1S3A A;  3BJ5 A;  4OCE A;  5ID2 A;  2RM6 A;  3CMI A;  4A5P A;  1KTE A;  1QFN A;  1A2L A;  1SJZ A;  2B5Y A;  4NV2 A;  3MDK A;  3KXO A;  2NBS A;  5ECO B;  1JLW A;  4YQU A;  3EC3 A;  2YJ7 A;  3IRA A;  2BJX A;  5IMF A;  1WWJ A;  2LNT A;  1Y25 A;  1XVW A;  5GAN D;  1GUH A;  1AQV A;  2BTO T;  3U6V A;  3W6G A;  3FR6 A;  1FOV A;  3M1G A;  4MK3 A;  1H75 A;  1PD2 1;  4TRX A;  1V9W A;  2IFQ A;  2IMF A;  4WF5 A;  2R0G A;  4MP4 A;  3F3R A;  4KCE A;  4O92 A;  1TRV A;  3DD3 A;  4KGI A;  2VL3 A;  1JZR A;  4I6X A;  2XC2 A;  4AJ7 A;  4AJ8 A;  1E2Y A;  10GS A;  3WGX A;  3QPM A;  1ZYQ B;  4MJE A;  3KTL A;  4K6X A;  5JCW A;  2WUL A;  2O87 A;  2C3N A;  2DJ2 A;  1GSQ A;  1O6J A;  2WB9 A;  5DQY A;  1SJI A;  3ZRE A;  1XWC A;  3UJ1 A;  2C8U A;  3C71 A;  2RII A;  1FB6 A;  2R37 A;  4MA9 A;  3TRP A;  2NVL A;  2A2P A;  5F0G A;  4ZBB A;  1XW5 A;  4I97 A;  3UMA A;  5A4W A;  3ERG A;  2CV4 A;  2JZS A;  1DSB A;  5ELG A;  4TW5 A;  1GNE A;  2XBI A;  4IKH A;  4EDZ A;  2E7P A;  5JWO B;  4KND A;  5HR1 A;  4YQV A;  2L6C A;  3KCM A;  4TR3 A;  4YH2 A;  3J7Y k;  2XPD A;  3O76 A;  2H76 A;  3W8S A;  2PVO C;  5ECL B;  1OC9 B;  2CVB A;  4K7N A;  5HR3 A;  1LU4 A;  2H6Z A;  3IC8 A;  1G6W A;  2O8V B;  4JR4 A;  4FQU A;  1JZD A;  4YAP A;  2LJA A;  4PNG A;  2KP2 A;  1GSS A;  2A2S A;  1GSU A;  3C1R A;  3ZYW A;  8GSS A;  5AN1 A;  4ZL8 A;  5HQP A;  3G7I A;  1G7E A;  2J23 A;  4BPY A;  3R2Q A;  5HR0 A;  2JSZ A;  4ZL7 A;  3VI5 A;  4H86 A;  1I9D A;  1MEK A;  4L8E A;  1PX7 A;  3N5O A;  3MIX A;  2LV3 A;  4BVY B;  5ECQ B;  1PN0 A;  3TKP A;  2LRN A;  1WP0 A;  1GP1 A;  5KOW A;  4P3Y B;  5GST A;  3KP9 A;  2YNX A;  2JAD A;  4PQ1 A;  4ZB6 A;  4EL1 A;  1Z3E A;  1F3A A;  5F05 A;  1WE0 A;  2A2R A;  2K8S A;  9GSS A;  3S9F A;  3GTU A;  5A4U A;  1SL2 B;  2YV9 A;  2GSQ A;  1S3C A;  1XFL A;  5BRT A;  5CRH A;  1NW2 A;  1T1V A;  3TOT A;  3KJY A;  4PNF A;  1FW1 A;  2ZCT A;  2PPT A;  5IPG A;  1VF4 A;  1F9M A;  3LXZ A;  1V40 A;  4XS6 A;  5J3R A;  3GN3 A;  1PQN A;  3F4R A;  1SYR A;  1TRW A;  4G0K A;  1LJR A;  3KMN A;  3QMX A;  3Q19 A;  2AV4 A;  4KDY A;  3TOU A;  3LYP A;  1TI3 A;  2V41 A;  1YY7 A;  1EGO A;  2NTO A;  1OE7 A;  2OE3 A;  3H8Q A;  4Q5R A;  4EXJ A;  2O7K A;  3NOF A;  5IPH A;  3IV4 A;  1ZL9 A;  3L78 A;  5H5Q A;  2REM A;  5H5S A;  4MLY A;  1GLP A;  4K5R A;  4POL A;  1TI1 A;  4KW6 A;  2N5F A;  1TK0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...