2O87A

S. aureus thioredoxin p31s mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
AIVKVTDADFDSKVESGVQLVDFWATWCGSCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title The conserved active site proline determines the reducing power of Staphylococcus aureus thioredoxin
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Electron transport
total genus 27
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2o87A00
1FVJA 1XFLA 1M0UA 2FGXA 5DJLA 2L5OA 4K2DA 2K18A 3GKXA 3HJMA 2LKUA 1U3IA 1ERUA 3IAS2 1QXHA 2GT6A 1M2DA 1ERTA 2PWJA 1GSYA 5A4UA 1E2YA 5ELAA 5CO3A 1HQOA 2L57A 5ABRA 1QK8A 1BJXA 3ERGA 4POMA 3HD5A 5HFKA 5IQYA 1YKAA 1WOUA 2DJ0A 2OBIA 3FHKA 4ZXGA 4DSQA 4HS1A 3GSTA 3CTGA 1UN2A 4Q5FA 4Q5NA 2PVOC 2P5QA 2MZCA 3UBKA 3ZYWA 1OC3A 3VI5A 2R6KA 4PUFC 3TCOA 4EDZA 1UVZA 1LBKA 4XRAA 2AB6A 5B8AA 4OFMA 4YAPA 1AIUA 1VF3A 1TU7A 1A2LA 3G7IA 3M9JA 2LRNA 2LUSA 4ZBBA 1K0NA 1DSBA 5IPHA 3K8NA 3L78A 4FYUA 3EU3A 4LMWA 3P7XA 4PNFA 1SYRA 3FZ9A 1J0FA 2H75A 5F07A 2H1GA 4K7NA 1NSWA 4MJAA 3C1RA 4DSRA 1K0CA 3NIVA 1PMTA 4POBA 3Q74A 3TUEA 3FEUA 2HRNA 2L6CA 4IN0A 1X9MB 3QD9A 2LEGA 5HR3A 6GSTA 4LL4B 5GAPD 4FO5A 5ECNB 4PXOA 1TXXA 1GTAA 4XCSA 1B8XA 1GSQA 2LSTA 4ZILA 3EMXA 3F9UA 2VOCA 3GHAA 1TDIA 1YY7A 4KCAA 4EXJA 4TW5A 2FUG2 4MZCA 3ME7A 1TRUA 2YZHA 1EV9A 4G9HA 1WJKA 2PUKC 1K3OA 2GSQA 2O85A 5EL8A 4K8MA 2IIYA 1AQVA 5D9XA 3RHCA 3BCIA 4OO4A 4HZ4A 2F9SA 4NV5A 3VI7A 3TDGA 4ZL7A 1A0RP 2HSYA 5F0GA 3F4RA 2CVDA 5GSTA 1WIKA 5ECIB 5ECSA 2I81A 4IJ3A 1T3BA 1SYXA 2IMEA 2QC7A 3GYKA 2B7KA 2AJQB 4J57E 1GLPA 3HVVA 1GSDA 1FOVA 1TI3A 1ON4A 2H01A 3DYRA 2H73A 3U6VA 2OE0A 3S9FA 2C80A 2YJHA 3UEMA 3GV1A 2FCHA 1GULA 4TR0A 2FY6A 1JHBA 2B1KA 4GCIA 2DBCA 3A2WA 4ACSA 2HE3A 3FR3A 1U88A 3WGXA 3GN3A 2CX3A 2H6XA 5FWGA 2E2MA 4I2TA 5D93A 1TRSA 1GLQA 2V2GA 3EMPA 1ZMAA 1EOGA 2CAQA 5IMAA 1FB6A 1XWBA 2H1BA 1UC7A 4KW6A 4MDCA 1C72A 5AIXA 3TJGA 1ACVA 5J41A 5KEJA 4PGTA 3MDKA 1PD21 2VIMA 4KSMA 3WYWA 1Z3EA 1I9DA 5ECKB 7GSSA 2YANA 1A8LA 2WDUA 2NBSA 4KSOA 3FZ4A 4BA7A 1TK8B 1O73A 1FW1A 3IDVA 1FB0A 2V6KA 4J56E 2JZSA 5CNWA 2ON5A 1EOHA 3DRNA 1QMVA 3O3TA 4DSSB 3VPTA 3KEBA 3ZMLA 2BMXA 1M7TA 2NPBA 5HR1A 3C71A 2YP6A 5CAXA 2FHEA 4IS0A 2CVBA 3RAZA 1OE8A 3EE2A 3DVXA 3LYPA 4G19A 4WETA 2C0DA 1S3DA 3HYPA 3GKKA 4HQZA 2VL3A 3P90A 2VL9A 3LWAA 2M80A 3KGKA 1PL2A 5HR2A 2VAFA 1XWAA 1OKTA 1GNEA 1LJRA 4OWYA 3UIWA 9GSSA 3C1SA 1BEDA 4WF4A 3IE3A 5DDLA 1GTBA 4HOJA 2XPEA 2X8GA 2RM5A 2I3YA 4XHMA 2F3MA 3TKPA 2JSYA 4N0VA 5HFGA 4RI6A 2HZEB 3Q18A 16GSA 4YH2A 5ID2A 1YDKA 2IMIA 4BWSA 1JZRA 4ILFA 4K0GA 3FY7A 2C4JA 2GDRA 1I5GA 3KMOA 1R4WA 4WEYA 1M2AA 2IWTA 1K0AA 3QMXA 3MSZA 4KH7A 3D5JA 4JU5A 1KEBA 3RHBA 2OADA 1BYEA 2ZCTA 3IK9A 1GSUA 3WGEA 3UVHA 2KLXA 1FG4A 3P2AA 4NMUA 2XC2A 1LU4A 3Q19A 5F8BA 4KAEA 2C3TA 2CV4A 3TKSA 3GTUB 4TR3A 5DCHA 1F6MC 4CHSA 1PA3A 4EVMA 1EGRA 2V32A 4XS4A 3NZNA 2G2QA 2RLIA 4CDOA 1X5CA 18GSA 5JCWA 20GSA 3DXBA 2VCXA 1JZDA 1GH2A 4ECBA 3M8NA 2H74A 2NVLA 1XIYA 1SKWB 4MZWA 4HQSA 1GSFA 5IO0A 2K6VA 2ON7A 3F3RA 3AY8A 1YF1A 1T4ZA 2XBQA 5DCGA 2E2GA 5IOWA 1DE2A 1E6BA 3DVWA 5HR0A 2HI7A 1BQ7A 2A2SA 5AIVA 5JWQB 1NHYA 5CRDA 4ISDA 4HU7A 2GQKA 4N11A 4WBRD 3ZIJA 2L6DA 1JZWA 2IMDA 2PPTA 4Q5QA 3TRPA 1A0FA 2GQMA 4O5RA 2C0FA 3TOUA 2B1LA 1J08A 3QAGA 2JZTA 4HJMA 3I9V2 2LJAA 2JL4A 4L0WA 4AGSA 3VURA 4EUYA 2B5XA 5KN2A 5ECOB 1SK0A 2GS3A 5H5RA 3P8WA 1ZOFA 3ZLPA 5F06A 4ID0A 4WR5A 2H30A 5DQSA 4I8BA 1F37A 3FZAA 3DIEA 4I2UA 1OC8A 1B9XC 3QFBC 1M9AA 2A2RA 2ALBA 4GQCA 4ZL9A 1EEMA 1SD9A 2GSTA 4OD7A 2VL2A 1VF2A 1MEKA 1VF4A 2LNSA 1FVKA 1V40A 5G5FA 3EYTA 2LS5A 1GUHA 1QQ2A 2L4QA 2VD1A 3CRTA 3M1GA 4EF0A 2X64A 3F63A 1SJZA 4F0CA 1SJ6A 5G1KA 3Q6OA 2F8FA 3ZTLA 4OCEA 1R7HA 5JCGA 3ERFA 4MJEA 3RBTA 2AUVA 1MD3A 3I43A 3TJKA 4TR1B 2YWNA 5HQPA 3KM6A 4X43A 5JWOB 1OVNA 5ELGA 3GSSA 2C0EA 3RPNA 3GRXA 4TN8A 2XBIA 4JEDA 5JWRB 4MH2A 4P3YB 5FHIA 1CQGA 4EC0A 4IHUA 3D0ZA 1TRVA 1Z7RA 2M46A 5ECQB 3DMLA 1OAZA 4POLA 1NHOA 4YQUA 4MCUA 1XVWA 3F4SA 1GUMA 5LD0A 5ENUA 3D22A 2GTUA 4ZB8A 3F6DA 1Z6MA 1XVQA 1U87A 5J9CA 4MABA 3IXRA 1A2MA 2EIRA 2YN1A 5DVBA 1TRWA 4OO5A 1X5DA 3KTBA 3GFKA 2HLSA 3HCZA 2YPMA 2OE1A 3A5WA 4MP4A 4DEJA 1V9WA 3MAKA 2DLXA 2IMFA 2X8HA 4G10A 2IFQA 3SWLA 1QUWA 4F0BA 2VLTA 3EWLA 1FHEA 2YZUA 5ID2B 2VLUA 1BX9A 2WZ9A 3C73A 3EU4A 4FYBA 4GSTA 1XW9A 3IPZA 3HJOA 8GSSA 3ZITA 1K0BA 2PMTA 3LSZA 4GF0A 2CT6A 2D2ZA 5LNKe 2GZZA 3GX0A 3CSHA 1Z5YE 4MZBA 2Z9SA 1V98A 1W4VA 3HVXA 5INYA 1YQ1A 1IYIA 2WRTA 5AN1A 1URMA 3VWXA 5ECPB 4OCFA 4TXOA 3PR8A 3FRCA 1SKSB 5EVOA 2OE3A 4XS4B 2QKEA 2VCVA 1YJ6A 2WB9A 3GURA 1K0DA 2HYXA 1YZXA 4EL1A 2HZFA 3ZFLA 1TKDB 1OKDA 4RQRA 3QDNA 1N8JA 2H6YA 2FA4A 5ECRB 3DKSA 4K0NA 3KXOA 3MWHA 3J7Yk 4IQ1A 6GSVA 4ML1A 4D73A 3APOA 1A23A 2FWHA 2GVPA 5DALB 2FNOA 5IMFA 5G2ZA 4EDYA 4MPFA 3GKMA 2FWFA 4RI7A 3KH9A 1QFNA 1OC9B 1SD8A 2YV9A 2OKAA 3F6FA 4KX4A 3GKNA 5KN0A 1NW2A 1QGVA 4KB3A 1G7OA 1XXUA 3A2VA 3GMFA 4AJ7A 4BVYA 1RK4A 3ME8A 3TRQA 3TKQA 3TJJA 1XWKA 2BTOT 1SK1A 1EV4A 6GSXA 1ZL9A 3QAWA 2K8VA 3E3EA 1XWGA 2VCWA 4RQXA 3FZ5A 2OA7A 2C3QA 4BL7A 2L59A 2TRCP 2VO4A 4KDXA 5IIZA 2FWGA 1WPIA 1R26A 4I6XA 5CRWA 4K1FA 3PINA 2DSAA 13GSA 3JCML 2LTKA 2OJLA 4ZB6A 2HSHA 4IGJA 2RM6A 5EY6A 3U5RE 4FIWA 3L9VA 4V1Ap 3PGTA 1PN9A 5IMVA 4ML6A 1G7EA 4NHZA 3D4TA 1TJDA 1YEXA 3UVTA 2B3SA 5AISA 2I9HA 4XS1A 1TW9A 2P0GA 3D6IA 3HVSA 4TKYA 1ABAA 5D9WA 2HFDA 2R4VA 1PKZA 2YJ7A 3KJYA 3E9JB 5IPGA 1SL1B 3BOAA 1FAAA 3FW2A 3HY2A 1OE7A 4L0UA 4AJ6A 1XOBA 1GRXA 2LJKA 3LEFA 4V2MA 1AAZA 2LRTA 1M2BA 4AJ8A 3V1WA 2H0IA 1KTEA 3GA4A 4HUAA 3IC4A 1TU8A 4ULXA 5IMCA 1DBYA 3ZVJA 1GTIA 4HU9A 4F82A 4PX1A 1JFUA 1GL8A 4WBJA 11GSA 19GSA 3ZVJD 3W8SA 1UA5A 4WR4A 3TRXA 4MH3A 3HHVA 1HNBA 4O7HA 3IBHA 1BG5A 2DIYA 2H76A 3LJRA 12GSA 3H8QA 1VF1A 1KNGA 2DJKA 1SKRB 3KCMA 3LXZA 1ZZYA 1T4YA 6GSSA 1VRSD 3FKFA 2IFQB 5CRHA 4WKWA 2H19A 3LYKA 2CZ2A 2IL3A 4N10A 2F51A 3VK9A 2PBJA 5ECLB 1XPVA 4PQIA 1XW6A 1O8WA 2LJRA 2PU9C 1MD4A 2H70A 5A4WA 5G30A 1THXA 3UBLA 5B7CA 2JSZA 2GT5A 4PNGA 1XW5A 5IM9A 1VGLA 2GLRA 5E59A 1W89A 1M9BA 2L5LA 1G6YA 3WT2A 2K8SA 2DJJA 2JACA 4KE3A 2R5GA 4PURA 1TK5B 1TOFA 4NXIA 4KA0A 4JE1A 3QOUA 3ZRDA 3APSA 1EEJA 1PL1A 1SU9A 5HFIA 4MK3A 4F03A 4MJCA 3HJPA 17GSA 5H5QA 3TJFA 2VCTA 4IELA 5DAKA 1XZOA 3QFAC 5F05A 4IJIA 1Z7PA 4GRFA 1WE0A 2EIOA 4D73B 4PQ1A 4LLRA 4PUAA 1TP9A 4IBPA 4MF7A 2WFCA 2X8CA 3HZ4A 4YQMA 1GP1A 4DVCA 1YEPA 3N9JA 3HDCA 2HT9A 2FWEA 4ZBAA 4ECJA 4LA1A 3CTFA 4EKZA 2C3NA 2YNXA 4MF5A 4HJ2A 1X9SB 3FR6A 1XWCA 1B9YC 2FD3A 2J9HA 3O76A 5ECMB 1V58A 1KBNA 1XOAA 4N0ZA 4ZB9A 2DC5A 5J3RA 2KUCA 1G6WA 3DEXA 3GL5A 5GAND 3UL3A 3EURA 1ML6A 2LNTA 1X5EA 5CRGA 2J23A 1AC1A 1T7PB 1A8YA 3C7MA 4XS6A 2GGTA 3CSJA 5G31A 4FYCA 2O87A 6GSYA 5B6NA 1GWCA 5E4WA 1V2AA 1O6JA 4WF5A 1F2EA 2H1DA 5D9TA 3FR9A 1MDKA 1ZYQB 5GZZB 4E8HA 1PKWA 1PRXA 2H72A 4TOPA 4GTUA 2CAIA 2B5YA 2TIRA 4HI7A 3O6TA 3KP9A 2H66A 5CYYA 3GUSA 3M3MA 4DSSA 1EGOA 4E8EA 4L5OA 3KTLA 2KHPA 1HNAA 3HXSA 2C0GA 1F3BA 2R2JA 3I6AA 2H8LA 2GZPA 3GIXA 3GH6A 4MMMA 3HA9A 4KUNA 1F9MA 4MPGA 2B7JA 2NDOA 5IMZA 1HD2A 2O7KA 3A2XA 3ZZXA 2R37A 1CQHA 2N5AA 4OFNA 3CRUA 1GUKA 1U3AA 2JU5A 5C00A 4BWQA 2VCQA 2HNLA 3CMIA 3IOSA 3KH7A 1N2AA 4POKA 5J4UA 1YKCA 2P31A 4TXVA 1K3LA 2CX4A 2LV3A 3TKSC 4LL1B 1Y6EA 2HXKA 4CW9A 3WT1A 3G9BA 4Z7XA 3LXTA 1IYHA 2HZEA 2EIQA 3PH9A 3BJ5A 2H6ZA 3G7JA 3EINA 2M72A 4KCEA 3TKRA 3GX8A 4JR4A 1PX7A 2CVKA 4MLYA 2B5EA 2MMOA 4OFTA 3RPPA 3H93A 1EWXA 1NM3A 3TKSE 2N5FA 3SBCA 3N5OA 3QAVA 2QGVA 4PQHA 3BBYA 2CQ9A 2DJ2A 2DMLA 4IP1A 3GTUA 1Q98A 3D21A 3UARA 2ZUPA 1R5PA 2ES7A 5H5SA 5FT3A 2AHEA 1Q4JA 5J9BA 4JR6A 1GTUA 1SJIA 4NHWA 3DD3A 4JZQA 1ILOA 4YQVA 3ED3A 2MMNA 4MF6A 3IR4A 2O8VB 4K7IA 3CXGA 3QPMA 5DJMA 4QL9A 3A3TA 1DE1A 1ZGNA 1EP7A 1WWJA 6GSUA 5CREA 4O32A 2YV7A 4X0XA 1B4QA 1ERWA 2PN8A 2H0HA 4QL7A 3TOTA 2IN3A 2IPAA 2OBKA 2MYGA 1YF0A 2TRXA 3VWVA 2YWOA 2O89A 2P5RA 3EVIA 2VCZA 2PERA 4JRRA 2G0FA 4TVEA 3VWWA 1R5AA 5IOXA 2E0QA 5DBQA 1SL0B 3F8UA 5D96A 2KP1A 4IVFA 4ZL8A 1GNWA 5DAKB 2VL2C 2DJ3A 1F3AA 2V6OA 3IHQA 1H4OA 4GSNA 3W8JA 3C8EA 4IP6A 4KNDA 1JZOA 1JLVA 10GSA 3HKRA 3H1NA 1X0RA 1K3YA 1V57A 1PX6A 2YWMA 2A4VA 1TTZA 2N5BA 3TGZA 1Z6NA 2GQLA 1M99A 4F2IA 2VM2A 5ECHB 2WS2A 2FA8A 1PSQA 1AQWA 1O7UA 2C8UA 4Q5RA 3IV4A 3HZ8A 3VLNA 1MDJA 2K9FA 1AW9A 1AQXA 4I5QA 3ISOA 1GSSA 4TR4A 3VWUA 3CBUA 3MNGA 3US3A 2MMAA 3VPQA 4O92A 4V1Ag 2KOKA 5L71A 4KDYA 2AV4A 2XHFA 5A4VA 4K6XA 1USBA 2VM1A 4TR1A 2WGRA 1A24A 2RIIA 3ZL5A 2JADA 3ERWA 2C1YA 1EZKA 3UJ1A 1DUGA 2FLSA 4NWYA 4J2FA 4GXZA 5AGYA 4K9ZA 1K0MA 4GWRA 4I97A 3GNJA 2WJUA 3UMAA 1B48A 14GSA 3BCKA 4GSSA 1HNCA 2PVQA 2BJXA 2DMMA 3IK7A 4WXTA 3F0IA 4L5LA 2LQOA 1O8XA 1S3CA 3L4NA 1O85A 1SENA 3KZQA 5D8IA 3M0FA 2IJYA 4EO3A 4FH8A 5COHA 3LORA 3UAPA 4KGIA 3CYNA 4K7OA 1T00A 4IKHA 1RQMA 4KDUA 3ZFBA 3FYGA 2H1AA 2F8AA 2HRFA 3DWVA 4XIHA 5D73A 3IA1A 2NTOA 2WCIA 4TRXA 2CA8A 3WGDA 5A5KA 4GQFA 4LMVA 2VUPA 2KP2A 4MJBA 4XRDA 1XBSA 3TB2A 1H75A 3APQA 2REMA 3E0UA 4F9ZA 4IQAA 1AUCA 1O81A 3KP8A 4H86A 5D9VA 3LGCA 5G5EA 3BD2A 4V2NA 2YOIA 2OACA 2X99A 5B8BA 4NPBA 2B6MA 4ECIA 3H79A 2VD0A 4GLTA 5IO2A 5CP1A 4BVXA 5B6MA 4YAVA 1J9BA 4N30A 3DGQA 3WD6A 4XTSA 1XCCA 4HZ2A 2RUFA 1MDIA 3QCPA 4V2LA 4HEA2 1ZYEA 3W6GA 3LQ7A 5KN3A 4HDEA 4TXOB 1FO5A 1SL2B 2JZRA 5J5NA 2AAWA 1WP0A 4L8EA 1WRYA 3UOMA 2I4AA 1K0OA 2LQQA 3L9SA 4G2EA 2GSRA 2WULA 2GSSA 1OYJA 3ZREA 1A2JA 2AYTA 3F4TA 1T1VA 3TJBA 4EE0A 1TK0B 1Z9HA 2DJ1A 1THOA 2CZ3A 2YWIA 1WMJA 3CSIA 5DALA 2EC4A 1EP8A 1TI1A 2MBTA 3J7Yb 4X1UA 5C04A 1G0TA 3QR6A 1AXDA 4NV2A 2RUEA 2VLVA 4JBBA 5EPFA 1GSEA 4AF2A 1OC9A 2XPDA 3I69A 5LCZA 1JLWA 4ZIJA 1BAYA 3L9UA 3H4KA 4RUVA 1RW1A 2ZNMA 1SK2A 4BPYA 3LG6A 1S3AA 1ERVA 3ZIVA 2YCDA 3KMNA 1T8EB 2DIZA 1MTCA 3LFLA 22GSA 1PQNA 3GL3A 5KN1A 2IMKA 4ZBDA 2I1UA 3GH9A 1X9WB 3R2QA 5IMDA 1U6TA 2H0GA 3VFIA 1Y25A 3RDWA 2H71A 2QSIA 3OR5A 3D4MA 3L0HA 6GSWA 2V1MA 3ZMKA 3KIJA 4NAXA 2E7PA 4MA9A 2L4CA 1ST9A 5GSSA 1ZCPA 1B4PA 2LRCA 3EC3A 3IRAA 2GZYA 2MBSA 2R3XA 4OMVA 3F3QA 4ECCA 4QQ7A 1HYUA 5JCUA 3G7YA 5G1LA 3IAM2 2PGTA 1PGTA 2MMZA 5DQYA 2V41A 3FK8A 3NOFA 3M9KA 3KD0A 4IW9A
chains in the Genus database with same CATH superfamily
1FVJA 1XFLA 1M0UA 2FGXA 5DJLA 2L5OA 4K2DA 2K18A 3GKXA 3HJMA 2LKUA 1U3IA 1ERUA 3IAS2 1QXHA 2GT6A 1M2DA 1ERTA 2PWJA 1GSYA 5A4UA 1E2YA 5ELAA 5CO3A 1HQOA 2QA2A 2L57A 5ABRA 1QK8A 1BJXA 3ERGA 4POMA 3HD5A 5HFKA 3MIXA 5IQYA 1YKAA 1WOUA 2DJ0A 2OBIA 3FHKA 4ZXGA 4DSQA 4HS1A 3GSTA 3CTGA 1UN2A 4Q5FA 4Q5NA 2PVOC 2P5QA 2MZCA 3UBKA 3ZYWA 1OC3A 3VI5A 2R6KA 4PUFC 3TCOA 4EDZA 1UVZA 1LBKA 4XRAA 4USSA 2AB6A 5B8AA 4OFMA 4YAPA 1AIUA 1VF3A 1TU7A 1A2LA 3G7IA 3M9JA 2LRNA 2LUSA 4ZBBA 1K0NA 1DSBA 5IPHA 3K8NA 3L78A 4FYUA 3EU3A 4LMWA 3P7XA 4PNFA 1SYRA 3FZ9A 1J0FA 2H75A 5F07A 2H1GA 4K7NA 1NSWA 4MJAA 3C1RA 4DSRA 1K0CA 3NIVA 1PMTA 4POBA 3Q74A 3TUEA 3FEUA 2HRNA 2L6CA 4IN0A 1X9MB 3QD9A 2LEGA 5HR3A 6GSTA 4LL4B 3PPUA 5GAPD 4FO5A 5ECNB 4PXOA 1TXXA 3MYDA 1GTAA 4XCSA 1B8XA 1GSQA 2LSTA 4ZILA 3EMXA 3F9UA 4BVXB 2VOCA 3GHAA 1TDIA 1YY7A 4KCAA 4EXJA 4TW5A 2FUG2 4MZCA 3ME7A 1TRUA 2YZHA 1EV9A 4G9HA 1WJKA 4ICYA 2PUKC 1K3OA 2GSQA 2O85A 5EL8A 4K8MA 2IIYA 1AQVA 5D9XA 3RHCA 3BCIA 4OO4A 4HZ4A 2F9SA 4NV5A 3VI7A 3TDGA 4ZL7A 1A0RP 2HSYA 5F0GA 3F4RA 2CVDA 5GSTA 1WIKA 5ECIB 5ECSA 2I81A 4IJ3A 1T3BA 1SYXA 2IMEA 2QC7A 3GYKA 2B7KA 2AJQB 4J57E 1PN0A 1GLPA 3HVVA 1GSDA 1FOVA 1TI3A 1ON4A 2H01A 3DYRA 2H73A 3U6VA 2OE0A 3S9FA 2C80A 2YJHA 3UEMA 3GV1A 2FCHA 1GULA 4TR0A 2FY6A 1JHBA 2B1KA 4GCIA 2DBCA 3A2WA 4ACSA 2HE3A 3FR3A 1U88A 3WGXA 3GN3A 2CX3A 2H6XA 5FWGA 2E2MA 4I2TA 5D93A 1TRSA 1GLQA 2V2GA 3EMPA 1ZMAA 1EOGA 2CAQA 5IMAA 1FB6A 1XWBA 2H1BA 1UC7A 4KW6A 4MDCA 1C72A 5AIXA 5KOWA 3TJGA 4Z2UA 1ACVA 5J41A 5KEJA 4PGTA 3MDKA 1PD21 2VIMA 4KSMA 3WYWA 1Z3EA 1I9DA 5ECKB 7GSSA 2YANA 1A8LA 2WDUA 2NBSA 4KSOA 3FZ4A 4BA7A 1TK8B 1O73A 1FW1A 3IDVA 1FB0A 2V6KA 4J56E 2JZSA 5CNWA 2ON5A 1EOHA 3DRNA 1QMVA 3O3TA 4DSSB 3VPTA 3KEBA 3ZMLA 2BMXA 1M7TA 2NPBA 5HR1A 3C71A 2YP6A 5CAXA 2FHEA 4IS0A 2CVBA 3RAZA 1OE8A 3EE2A 3DVXA 3LYPA 4G19A 4WETA 2C0DA 4O5UA 1S3DA 3HYPA 3GKKA 4HQZA 2VL3A 3P90A 2VL9A 3LWAA 2M80A 3KGKA 1PL2A 5HR2A 2VAFA 1XWAA 1OKTA 1GNEA 1LJRA 4OWYA 3UIWA 9GSSA 3C1SA 1BEDA 4WF4A 3IE3A 5DDLA 1GTBA 4HOJA 2XPEA 2X8GA 2RM5A 2I3YA 4XHMA 2F3MA 3TKPA 2JSYA 4N0VA 5HFGA 4RI6A 2HZEB 3Q18A 16GSA 4YH2A 5ID2A 1YDKA 2IMIA 4BWSA 1JZRA 4ILFA 4K0GA 3FY7A 2C4JA 2GDRA 1I5GA 3KMOA 1R4WA 4WEYA 1M2AA 2IWTA 1K0AA 3QMXA 3MSZA 4KH7A 3D5JA 4JU5A 1KEBA 3RHBA 2OADA 1BYEA 2ZCTA 3IK9A 1GSUA 3WGEA 3UVHA 2KLXA 1FG4A 3P2AA 4NMUA 2XC2A 1LU4A 3Q19A 5F8BA 4KAEA 2C3TA 2CV4A 3TKSA 3GTUB 4TR3A 5DCHA 1F6MC 4CHSA 1PA3A 4EVMA 1EGRA 2V32A 4XS4A 3NZNA 2G2QA 2RLIA 4CDOA 1X5CA 18GSA 5JCWA 20GSA 3DXBA 2VCXA 1JZDA 1GH2A 4ECBA 3M8NA 2H74A 2NVLA 1XIYA 1SKWB 4MZWA 4HQSA 1GSFA 2HRAA 5IO0A 2K6VA 2ON7A 3F3RA 3AY8A 1YF1A 1T4ZA 2XBQA 5DCGA 2E2GA 5IOWA 1DE2A 1E6BA 3DVWA 5HR0A 2HI7A 1BQ7A 2A2SA 5AIVA 5JWQB 1NHYA 5CRDA 4ISDA 4HU7A 2GQKA 4N11A 4WBRD 3ZIJA 2L6DA 1JZWA 2IMDA 2PPTA 4Q5QA 3TRPA 1A0FA 2GQMA 4O5RA 2C0FA 3TOUA 2B1LA 1J08A 3QAGA 2JZTA 4HJMA 3I9V2 4A5PA 2LJAA 2JL4A 4L0WA 4AGSA 3VURA 4EUYA 2B5XA 4K2XA 5KN2A 5ECOB 3IHGA 1SK0A 2GS3A 5H5RA 3P8WA 1ZOFA 3ZLPA 5F06A 4ID0A 4WR5A 2H30A 5DQSA 4I8BA 1F37A 3FZAA 3DIEA 4I2UA 1OC8A 1B9XC 3QFBC 1M9AA 2A2RA 2ALBA 4GQCA 4ZL9A 1EEMA 1SD9A 2GSTA 4OD7A 2VL2A 1VF2A 1MEKA 1VF4A 2LNSA 1FVKA 1V40A 5G5FA 3EYTA 2LS5A 1GUHA 1QQ2A 2L4QA 2VD1A 3CRTA 3M1GA 4EF0A 2X64A 3F63A 1SJZA 4F0CA 1SJ6A 5G1KA 3Q6OA 2F8FA 3ZTLA 4OCEA 1R7HA 5JCGA 3ERFA 4MJEA 3RBTA 3R3EA 2AUVA 1MD3A 3I43A 3TJKA 2QA1A 4TR1B 2YWNA 5HQPA 2X4AA 3KM6A 4X43A 1M3IA 5JWOB 1OVNA 5ELGA 3GSSA 2C0EA 3RPNA 3GRXA 4TN8A 2XBIA 4JEDA 5JWRB 1ZYNA 4MH2A 4P3YB 5FHIA 1CQGA 4EC0A 4IHUA 3D0ZA 1TRVA 1Z7RA 2M46A 5ECQB 3DMLA 1OAZA 4POLA 1NHOA 4YQUA 4MCUA 1XVWA 3F4SA 1GUMA 5LD0A 5ENUA 3D22A 2GTUA 4ZB8A 3F6DA 1Z6MA 1XVQA 1U87A 5J9CA 4MABA 3IXRA 1A2MA 2EIRA 2YN1A 5DVBA 1TRWA 4OO5A 1X5DA 3KTBA 3GFKA 4EIQA 2HLSA 4YKFA 3HCZA 2YPMA 2OE1A 3A5WA 4MP4A 4DEJA 1V9WA 3MAKA 2DLXA 2IMFA 2X8HA 4G10A 2IFQA 3SWLA 1QUWA 4F0BA 2VLTA 3EWLA 1FHEA 2YZUA 5ID2B 2VLUA 1BX9A 2WZ9A 3C73A 3EU4A 4FYBA 4GSTA 1XW9A 3IPZA 3HJOA 8GSSA 3ZITA 2A4HA 1K0BA 2PMTA 3LSZA 4GF0A 2CT6A 2D2ZA 5LNKe 2GZZA 3GX0A 3CSHA 1Z5YE 4MZBA 2Z9SA 1V98A 1W4VA 3HVXA 5INYA 1YQ1A 1IYIA 2WRTA 5AN1A 1URMA 3VWXA 5ECPB 4OCFA 4TXOA 3PR8A 3FRCA 1SKSB 5EVOA 2OE3A 4XS4B 2QKEA 4YKGA 2VCVA 1YJ6A 2WB9A 3GURA 1K0DA 2HYXA 1YZXA 4EL1A 2HZFA 3ZFLA 1TKDB 1OKDA 4RQRA 3QDNA 1N8JA 2H6YA 2FA4A 5ECRB 3DKSA 4K0NA 3KXOA 3MWHA 3J7Yk 4IQ1A 6GSVA 4ML1A 4D73A 3APOA 1A23A 2FWHA 2GVPA 5DALB 2FNOA 5IMFA 5G2ZA 3HVNA 4EDYA 4MPFA 3GKMA 2FWFA 4RI7A 3KH9A 1QFNA 1OC9B 1SD8A 2YV9A 2OKAA 3F6FA 5BMUA 4KX4A 3GKNA 5KN0A 1NW2A 1QGVA 4KB3A 1G7OA 1XXUA 3A2VA 3GMFA 4AJ7A 4BVYA 1RK4A 3LW9A 3ME8A 3TRQA 3TKQA 3TJJA 1XWKA 2BTOT 1SK1A 1EV4A 6GSXA 1ZL9A 3QAWA 2K8VA 3E3EA 1XWGA 2VCWA 4RQXA 3FZ5A 2OA7A 2C3QA 4BL7A 2L59A 2TRCP 2VO4A 4KDXA 5IIZA 2FWGA 1WPIA 2DKHA 1R26A 4I6XA 5CRWA 4K1FA 3PINA 2DSAA 13GSA 3JCML 2LTKA 2OJLA 4ZB6A 2HSHA 4IGJA 2RM6A 5EY6A 2R0GA 3U5RE 4FIWA 3L9VA 4V1Ap 3PGTA 1PN9A 5IMVA 4ML6A 1G7EA 4NHZA 3D4TA 1TJDA 1YEXA 3UVTA 2B3SA 5AISA 2I9HA 4XS1A 1TW9A 2P0GA 3D6IA 3HVSA 4TKYA 1ABAA 5D9WA 2HFDA 2R4VA 1PKZA 2YJ7A 3KJYA 3E9JB 5IPGA 1SL1B 3BOAA 1FAAA 3FW2A 3HY2A 1OE7A 4L0UA 4AJ6A 1XOBA 1GRXA 2LJKA 3LEFA 4V2MA 1AAZA 2LRTA 1M2BA 4AJ8A 3V1WA 2H0IA 1KTEA 3GA4A 4HUAA 3IC4A 1TU8A 4FQUA 4ULXA 5IMCA 3ZVJA 1DBYA 1GTIA 4HU9A 4F82A 4PX1A 1JFUA 1GL8A 4WBJA 11GSA 19GSA 3ZVJD 3W8SA 1UA5A 4WR4A 3TRXA 4MH3A 3HHVA 1HNBA 4O7HA 3IBHA 1BG5A 2DIYA 2H76A 3LJRA 12GSA 3H8QA 1VF1A 1KNGA 4G0IA 2DJKA 1SKRB 3KCMA 3LXZA 1ZZYA 1T4YA 6GSSA 1VRSD 3FKFA 4Z2RA 2IFQB 5CRHA 4WKWA 2H19A 4BIKA 3LYKA 2CZ2A 2IL3A 3CQFA 2F51A 4N10A 3VK9A 2PBJA 5ECLB 1XPVA 4PQIA 1XW6A 1O8WA 2A2PA 2LJRA 2PU9C 1MD4A 2H70A 5A4WA 5G30A 1THXA 3UBLA 5B7CA 2JSZA 2GT5A 4PNGA 1XW5A 5IM9A 1VGLA 2GLRA 5E59A 1W89A 1M9BA 2L5LA 1G6YA 3WT2A 2K8SA 2DJJA 2JACA 4KE3A 2R5GA 4PURA 1TK5B 1TOFA 4NXIA 1XG8A 4KA0A 4JE1A 2R0PA 3QOUA 3ZRDA 3APSA 1EEJA 1PL1A 1SU9A 5HFIA 4MK3A 4F03A 4MJCA 3HJPA 17GSA 5H5QA 3TJFA 2VCTA 4IELA 5DAKA 1XZOA 3QFAC 5F05A 4IJIA 1Z7PA 4GRFA 1WE0A 2EIOA 4D73B 4G0LA 4PQ1A 4LLRA 4PUAA 1TP9A 4IBPA 4MF7A 2WFCA 2X8CA 3HZ4A 4YQMA 1GP1A 4DVCA 1YEPA 3N9JA 3HDCA 2HT9A 2FWEA 4ZBAA 4ECJA 4LA1A 3CTFA 4EKZA 2C3NA 2YNXA 4MF5A 4HJ2A 1X9SB 3FR6A 1XWCA 1B9YC 2DKIA 2FD3A 2J9HA 3O76A 5ECMB 1V58A 1KBNA 1XOAA 4N0ZA 4ZB9A 2DC5A 5J3RA 2KUCA 1G6WA 3DEXA 3GL5A 5GAND 3A5IA 3UL3A 4Z2TA 2R0CA 3EURA 1PFOA 1ML6A 2LNTA 1X5EA 5CRGA 2J23A 1AC1A 4BL7B 1T7PB 1A8YA 3C7MA 4XS6A 2GGTA 3CSJA 5G31A 4FYCA 2O87A 6GSYA 5B6NA 1GWCA 5E4WA 1V2AA 1O6JA 4WF5A 1F2EA 2H1DA 5D9TA 3FR9A 1MDKA 1ZYQB 5GZZB 4E8HA 1PKWA 1PRXA 2H72A 4TOPA 4GTUA 2CAIA 2B5YA 2TIRA 4HI7A 3O6TA 3KP9A 2H66A 4CY6A 5CYYA 3GUSA 3M3MA 4DSSA 1EGOA 4E8EA 4L5OA 3KTLA 2KHPA 4K5SA 1HNAA 3HXSA 2C0GA 1F3BA 2R2JA 3I6AA 2H8LA 2GZPA 3GIXA 3GH6A 4MMMA 3HA9A 4KUNA 1F9MA 4MPGA 2B7JA 2NDOA 5IMZA 1HD2A 2O7KA 3A2XA 3ZZXA 2R37A 1CQHA 2N5AA 4OFNA 3CRUA 1GUKA 1U3AA 2JU5A 5C00A 4BWQA 2VCQA 2HNLA 3CMIA 3IOSA 3KH7A 1N2AA 4POKA 5J4UA 1YKCA 2P31A 4TXVA 1K3LA 2CX4A 2LV3A 3TKSC 4LL1B 1Y6EA 2HXKA 4CW9A 3WT1A 3G9BA 4Z7XA 3LXTA 1IYHA 4EIPA 2HZEA 2EIQA 3PH9A 3BJ5A 2H6ZA 3G7JA 3EINA 2M72A 4KCEA 3TKRA 3GX8A 4JR4A 1PX7A 2CVKA 4MLYA 2B5EA 2MMOA 4OFTA 3RPPA 3H93A 1EWXA 1NM3A 3TKSE 2N5FA 3SBCA 3N5OA 3QAVA 2QGVA 4PQHA 3BBYA 2CQ9A 2DJ2A 2DMLA 4IP1A 3GTUA 1Q98A 3D21A 3UARA 2ZUPA 1R5PA 2ES7A 5H5SA 5FT3A 2AHEA 1Q4JA 5J9BA 4JR6A 1GTUA 1SJIA 4NHWA 3DD3A 4JZQA 1ILOA 4YQVA 3ED3A 2MMNA 4MF6A 3IR4A 2O8VB 4K7IA 3CXGA 3QPMA 5DJMA 4QL9A 3A3TA 1DE1A 5BRTA 1ZGNA 1EP7A 1WWJA 6GSUA 5CREA 2HRKA 4O32A 2YV7A 4X0XA 1B4QA 1ERWA 2PN8A 2H0HA 4QL7A 3TOTA 2IN3A 2IPAA 2OBKA 2MYGA 1YF0A 2TRXA 3VWVA 2YWOA 4K5RA 2O89A 2P5RA 3EVIA 2VCZA 2PERA 4JRRA 2G0FA 4TVEA 3VWWA 1R5AA 1S3RA 5IOXA 2E0QA 5DBQA 1SL0B 3F8UA 5D96A 2KP1A 4IVFA 4ZL8A 1GNWA 5DAKB 2VL2C 2DJ3A 1FOHA 1F3AA 2V6OA 3IHQA 1H4OA 4GSNA 3W8JA 3C8EA 4IP6A 4KNDA 1JZOA 1JLVA 10GSA 3HKRA 3H1NA 1X0RA 1K3YA 1V57A 1PX6A 2YWMA 2A4VA 1TTZA 2N5BA 3IC8A 3TGZA 1Z6NA 2GQLA 1M99A 4F2IA 2VM2A 5ECHB 2WS2A 2FA8A 4X4JA 1PSQA 1AQWA 1O7UA 2C8UA 4CY8A 4Q5RA 3IV4A 3HZ8A 3VLNA 1MDJA 2K9FA 1AW9A 1AQXA 4I5QA 3ISOA 1GSSA 4TR4A 3VWUA 3CBUA 3MNGA 3US3A 2MMAA 3VPQA 4O92A 4V1Ag 2KOKA 5L71A 4KDYA 2AV4A 2XHFA 5A4VA 4K6XA 1USBA 2VM1A 4TR1A 2WGRA 1A24A 2RIIA 3ZL5A 1ZYPA 2JADA 3ERWA 2C1YA 1EZKA 3UJ1A 1DUGA 2FLSA 4NWYA 4J2FA 4GXZA 5AGYA 4K9ZA 3FMWA 1K0MA 4GWRA 4I97A 3GNJA 2WJUA 3UMAA 1B48A 14GSA 3BCKA 4GSSA 1HNCA 2PVQA 2BJXA 2DMMA 3IK7A 4WXTA 3F0IA 4L5LA 2LQOA 1O8XA 1S3CA 3L4NA 1O85A 1SENA 3KZQA 5D8IA 3M0FA 2IJYA 4EO3A 4FH8A 5COHA 3LORA 3UAPA 4KGIA 3CYNA 4K7OA 1T00A 4IKHA 1RQMA 4KDUA 3ZFBA 3FYGA 2H1AA 2F8AA 2HRFA 3DWVA 4XIHA 5D73A 3IA1A 2NTOA 2WCIA 4MNNA 2X49A 4TRXA 1M3JA 2CA8A 3WGDA 5A5KA 4GQFA 4LMVA 2VUPA 2KP2A 4MJBA 4XRDA 1XBSA 3TB2A 1H75A 3APQA 2REMA 3E0UA 4F9ZA 4IQAA 1AUCA 1O81A 3KP8A 4H86A 5D9VA 3LGCA 5G5EA 3BD2A 4V2NA 2YOIA 2OACA 2X99A 5B8BA 5KOXA 4NPBA 2B6MA 4ECIA 3H79A 2VD0A 4GLTA 5IO2A 5CP1A 4BVXA 5B6MA 4YAVA 1J9BA 4N30A 3DGQA 3WD6A 4XTSA 1XCCA 4HZ2A 2RUFA 1MDIA 3QCPA 4V2LA 4HEA2 1ZYEA 3W6GA 3LQ7A 5KN3A 4HDEA 4TXOB 1FO5A 1SL2B 2JZRA 2UZ8A 2AAWA 1WP0A 5J5NA 4HSCX 4L8EA 1WRYA 3UOMA 2I4AA 1K0OA 2LQQA 3L9SA 4G2EA 2GSRA 2WULA 2GSSA 1OYJA 3ZREA 1A2JA 2AYTA 3F4TA 1T1VA 3TJBA 4EE0A 1TK0B 1Z9HA 2DJ1A 1THOA 2CZ3A 2YWIA 1WMJA 3CSIA 5DALA 2EC4A 1EP8A 1TI1A 2MBTA 3J7Yb 4X1UA 4PTSA 5C04A 1G0TA 3QR6A 1AXDA 4NV2A 2RUEA 2VLVA 4JBBA 5EPFA 1GSEA 4AF2A 1OC9A 2XPDA 3I69A 5LCZA 1JLWA 4ZIJA 4KF9A 1BAYA 3L9UA 3H4KA 4RUVA 1RW1A 2ZNMA 1SK2A 4BPYA 3LG6A 1S3AA 1ERVA 3ZIVA 2YCDA 3KMNA 1T8EB 2DIZA 1MTCA 3LFLA 22GSA 1PQNA 3GL3A 5KN1A 2IMKA 4ZBDA 2I1UA 3GH9A 4BVYB 1X9WB 3R2QA 5IMDA 1U6TA 2H0GA 3VFIA 1Y25A 2HSMA 3RDWA 2H71A 2QSIA 3OR5A 3D4MA 3L0HA 3EPTA 6GSWA 4G0KA 2V1MA 3ZMKA 3KIJA 4NAXA 2E7PA 4MA9A 2L4CA 1ST9A 5GSSA 1ZCPA 1B4PA 2LRCA 3EC3A 3IRAA 2GZYA 2MBSA 2R3XA 4OMVA 3F3QA 4ECCA 4QQ7A 1HYUA 5JCUA 4O5QA 3G7YA 5G1LA 3IAM2 2PGTA 1PGTA 2MMZA 5DQYA 2V41A 3FK8A 3NOFA 3M9KA 3KD0A 4IW9A
chains in the Genus database with same CATH topology
1FVJA 1XFLA 1M0UA 2FGXA 5DJLA 2L5OA 4K2DA 2K18A 3GKXA 3HJMA 2LKUA 1U3IA 1ERUA 3IAS2 1QXHA 2GT6A 1M2DA 1ERTA 2PWJA 1GSYA 5A4UA 1E2YA 5ELAA 5CO3A 1HQOA 2QA2A 2L57A 5ABRA 1QK8A 1BJXA 3ERGA 4POMA 3HD5A 5HFKA 3MIXA 5IQYA 1YKAA 1WOUA 2DJ0A 2OBIA 3FHKA 4ZXGA 4DSQA 4HS1A 3GSTA 3CTGA 1UN2A 4Q5FA 4Q5NA 2PVOC 2P5QA 2MZCA 3UBKA 3ZYWA 1OC3A 3VI5A 2R6KA 4PUFC 3TCOA 4EDZA 1UVZA 1LBKA 4XRAA 4USSA 2AB6A 5B8AA 4OFMA 4YAPA 1AIUA 1VF3A 1TU7A 1A2LA 3G7IA 3M9JA 2LRNA 2LUSA 4ZBBA 1K0NA 1DSBA 5IPHA 3K8NA 3L78A 4FYUA 3EU3A 4LMWA 3P7XA 4PNFA 1SYRA 3FZ9A 1J0FA 2H75A 5F07A 2H1GA 4K7NA 1NSWA 4MJAA 3C1RA 4DSRA 1K0CA 3NIVA 1PMTA 4POBA 3Q74A 3TUEA 3FEUA 2HRNA 2L6CA 4IN0A 1X9MB 3QD9A 2LEGA 5HR3A 6GSTA 4LL4B 3PPUA 5GAPD 4FO5A 5ECNB 4PXOA 1TXXA 3MYDA 1GTAA 4XCSA 1B8XA 1GSQA 2LSTA 4ZILA 3EMXA 3F9UA 4BVXB 2VOCA 3GHAA 1TDIA 1YY7A 4KCAA 4EXJA 4TW5A 2FUG2 4MZCA 3ME7A 1TRUA 2YZHA 1EV9A 4G9HA 1WJKA 4ICYA 2PUKC 1K3OA 2GSQA 2O85A 5EL8A 4K8MA 2IIYA 1AQVA 5D9XA 3RHCA 3BCIA 4OO4A 4HZ4A 2F9SA 4NV5A 3VI7A 3TDGA 4ZL7A 1A0RP 2HSYA 5F0GA 3F4RA 2CVDA 5GSTA 1WIKA 5ECIB 5ECSA 2I81A 4IJ3A 1T3BA 1SYXA 2IMEA 2QC7A 3GYKA 2B7KA 2AJQB 4J57E 1PN0A 1GLPA 3HVVA 1GSDA 1FOVA 1TI3A 1ON4A 2H01A 3DYRA 2H73A 3U6VA 2OE0A 3S9FA 2C80A 2YJHA 3UEMA 3GV1A 2FCHA 1GULA 4TR0A 2FY6A 1JHBA 2B1KA 4GCIA 2DBCA 3A2WA 4ACSA 2HE3A 3FR3A 1U88A 3WGXA 3GN3A 2CX3A 2H6XA 5FWGA 2E2MA 4I2TA 5D93A 1TRSA 1GLQA 2V2GA 3EMPA 1ZMAA 1EOGA 2CAQA 5IMAA 1FB6A 1XWBA 2H1BA 1UC7A 4KW6A 4MDCA 1C72A 5AIXA 5KOWA 3TJGA 4Z2UA 1ACVA 5J41A 5KEJA 4PGTA 3MDKA 1PD21 2VIMA 4KSMA 3WYWA 1Z3EA 1I9DA 5ECKB 7GSSA 2YANA 1A8LA 2WDUA 2NBSA 4KSOA 3FZ4A 4BA7A 1TK8B 1O73A 1FW1A 3IDVA 1FB0A 2V6KA 4J56E 2JZSA 5CNWA 2ON5A 1EOHA 3DRNA 1QMVA 3O3TA 4DSSB 3VPTA 3KEBA 3ZMLA 2BMXA 1M7TA 2NPBA 5HR1A 3C71A 2YP6A 5CAXA 2FHEA 4IS0A 2CVBA 3RAZA 1OE8A 3EE2A 3DVXA 3LYPA 4G19A 4WETA 2C0DA 4O5UA 1S3DA 3HYPA 3GKKA 4HQZA 2VL3A 3P90A 2VL9A 3LWAA 2M80A 3KGKA 1PL2A 5HR2A 2VAFA 1XWAA 1OKTA 1GNEA 1LJRA 4OWYA 3UIWA 9GSSA 3C1SA 1BEDA 4WF4A 3IE3A 5DDLA 1GTBA 4HOJA 2XPEA 2X8GA 2RM5A 2I3YA 4XHMA 2F3MA 3TKPA 2JSYA 4N0VA 5HFGA 4RI6A 2HZEB 3Q18A 16GSA 4YH2A 5ID2A 1YDKA 2IMIA 4BWSA 1JZRA 4ILFA 4K0GA 3FY7A 2C4JA 2GDRA 1I5GA 3KMOA 1R4WA 4WEYA 1M2AA 2IWTA 1K0AA 3QMXA 3MSZA 4KH7A 3D5JA 4JU5A 1KEBA 3RHBA 2OADA 1BYEA 2ZCTA 3IK9A 1GSUA 3WGEA 3UVHA 2KLXA 1FG4A 3P2AA 4NMUA 2XC2A 1LU4A 3Q19A 5F8BA 4KAEA 2C3TA 2CV4A 3TKSA 3GTUB 4TR3A 5DCHA 1F6MC 4CHSA 1PA3A 4EVMA 1EGRA 2V32A 4XS4A 3NZNA 2G2QA 2RLIA 4CDOA 1X5CA 18GSA 5JCWA 20GSA 3DXBA 2VCXA 1JZDA 1GH2A 4ECBA 3M8NA 2H74A 2NVLA 1XIYA 1SKWB 4MZWA 4HQSA 1GSFA 2HRAA 5IO0A 2K6VA 2ON7A 3F3RA 3AY8A 1YF1A 1T4ZA 2XBQA 5DCGA 2E2GA 5IOWA 1DE2A 1E6BA 3DVWA 5HR0A 2HI7A 1BQ7A 2A2SA 5AIVA 5JWQB 1NHYA 5CRDA 4ISDA 4HU7A 2GQKA 4N11A 4WBRD 3ZIJA 2L6DA 1JZWA 2IMDA 2PPTA 4Q5QA 3TRPA 1A0FA 2GQMA 4O5RA 2C0FA 3TOUA 2B1LA 1J08A 3QAGA 2JZTA 4HJMA 3I9V2 4A5PA 2LJAA 2JL4A 4L0WA 4AGSA 3VURA 4EUYA 2B5XA 4K2XA 5KN2A 5ECOB 3IHGA 1SK0A 2GS3A 5H5RA 3P8WA 1ZOFA 3ZLPA 5F06A 4ID0A 4WR5A 2H30A 5DQSA 4I8BA 1F37A 3FZAA 3DIEA 4I2UA 1OC8A 1B9XC 3QFBC 1M9AA 2A2RA 2ALBA 4GQCA 4ZL9A 1EEMA 1SD9A 2GSTA 4OD7A 2VL2A 1VF2A 1MEKA 1VF4A 2LNSA 1FVKA 1V40A 5G5FA 3EYTA 2LS5A 1GUHA 1QQ2A 2L4QA 2VD1A 3CRTA 3M1GA 4EF0A 2X64A 3F63A 1SJZA 4F0CA 1SJ6A 5G1KA 3Q6OA 2F8FA 3ZTLA 4OCEA 1R7HA 5JCGA 3ERFA 4MJEA 3RBTA 3R3EA 2AUVA 1MD3A 3I43A 3TJKA 2QA1A 4TR1B 2YWNA 5HQPA 2X4AA 3KM6A 4X43A 5JWOB 1OVNA 5ELGA 3GSSA 2C0EA 3RPNA 3GRXA 4TN8A 2XBIA 4JEDA 5JWRB 1ZYNA 4MH2A 4P3YB 5FHIA 1CQGA 4EC0A 4IHUA 3D0ZA 1TRVA 1Z7RA 2M46A 5ECQB 3DMLA 1OAZA 4POLA 1NHOA 4YQUA 4MCUA 1XVWA 3F4SA 1GUMA 5LD0A 5ENUA 3D22A 2GTUA 4ZB8A 3F6DA 1Z6MA 1XVQA 1U87A 5J9CA 4MABA 3IXRA 1A2MA 2EIRA 2YN1A 5DVBA 1TRWA 4OO5A 1X5DA 3KTBA 3GFKA 4EIQA 2HLSA 4YKFA 3HCZA 2YPMA 2OE1A 3A5WA 4MP4A 4DEJA 1V9WA 3MAKA 2DLXA 2IMFA 2X8HA 4G10A 2IFQA 3SWLA 1QUWA 4F0BA 2VLTA 3EWLA 1FHEA 2YZUA 5ID2B 2VLUA 1BX9A 2WZ9A 3C73A 3EU4A 4FYBA 4GSTA 1XW9A 3IPZA 3HJOA 8GSSA 3ZITA 2A4HA 1K0BA 2PMTA 3LSZA 4GF0A 2CT6A 2D2ZA 5LNKe 2GZZA 3GX0A 3CSHA 1Z5YE 4MZBA 2Z9SA 1V98A 1W4VA 3HVXA 5INYA 1YQ1A 1IYIA 2WRTA 5AN1A 1URMA 3VWXA 5ECPB 4OCFA 4TXOA 3PR8A 3FRCA 1SKSB 5EVOA 2OE3A 4XS4B 2QKEA 4YKGA 2VCVA 1YJ6A 2WB9A 3GURA 1K0DA 2HYXA 1YZXA 4EL1A 2HZFA 3ZFLA 1TKDB 1OKDA 4RQRA 3QDNA 1N8JA 2H6YA 2FA4A 5ECRB 3DKSA 4K0NA 3KXOA 3MWHA 3J7Yk 4IQ1A 6GSVA 4ML1A 4D73A 3APOA 1A23A 2FWHA 2GVPA 5DALB 2FNOA 5IMFA 5G2ZA 4EDYA 4MPFA 3GKMA 2FWFA 4RI7A 3KH9A 1QFNA 1OC9B 1SD8A 2YV9A 2OKAA 3F6FA 5BMUA 4KX4A 3GKNA 5KN0A 1NW2A 1QGVA 4KB3A 1G7OA 1XXUA 3A2VA 3GMFA 4AJ7A 4BVYA 1RK4A 3LW9A 3ME8A 3TRQA 3TKQA 3TJJA 1XWKA 2BTOT 1SK1A 1EV4A 6GSXA 1ZL9A 3QAWA 2K8VA 3E3EA 1XWGA 2VCWA 4RQXA 3FZ5A 2OA7A 2C3QA 4BL7A 2L59A 2TRCP 2VO4A 4KDXA 5IIZA 2FWGA 1WPIA 2DKHA 1R26A 4I6XA 5CRWA 4K1FA 3PINA 2DSAA 13GSA 3JCML 2LTKA 2OJLA 4ZB6A 2HSHA 4IGJA 2RM6A 5EY6A 2R0GA 3U5RE 4FIWA 3L9VA 4V1Ap 3PGTA 1PN9A 5IMVA 4ML6A 1G7EA 4NHZA 3D4TA 1TJDA 1YEXA 3UVTA 2B3SA 5AISA 2I9HA 4XS1A 1TW9A 2P0GA 3D6IA 3HVSA 4TKYA 1ABAA 5D9WA 2HFDA 2R4VA 1PKZA 2YJ7A 3KJYA 3E9JB 5IPGA 1SL1B 3BOAA 1FAAA 3FW2A 3HY2A 1OE7A 4L0UA 4AJ6A 1XOBA 1GRXA 2LJKA 3LEFA 4V2MA 1AAZA 2LRTA 1M2BA 4AJ8A 3V1WA 2H0IA 1KTEA 3GA4A 4HUAA 3IC4A 1TU8A 4FQUA 4ULXA 5IMCA 3ZVJA 1DBYA 1GTIA 4HU9A 4F82A 4PX1A 1JFUA 1GL8A 4WBJA 11GSA 19GSA 3ZVJD 3W8SA 1UA5A 4WR4A 3TRXA 4MH3A 3HHVA 1HNBA 4O7HA 3IBHA 1BG5A 2DIYA 2H76A 3LJRA 12GSA 3H8QA 1VF1A 1KNGA 4G0IA 2DJKA 1SKRB 3KCMA 3LXZA 1ZZYA 1T4YA 6GSSA 1VRSD 3FKFA 4Z2RA 2IFQB 5CRHA 4WKWA 2H19A 3LYKA 2CZ2A 2IL3A 4N10A 2F51A 3VK9A 2PBJA 5ECLB 1XPVA 4PQIA 1XW6A 1O8WA 2A2PA 2LJRA 2PU9C 1MD4A 2H70A 5A4WA 5G30A 1THXA 3UBLA 5B7CA 2JSZA 2GT5A 4PNGA 1XW5A 5IM9A 1VGLA 2GLRA 5E59A 1W89A 1M9BA 2L5LA 1G6YA 3WT2A 2K8SA 2DJJA 2JACA 4KE3A 2R5GA 4PURA 1TK5B 1TOFA 4NXIA 4KA0A 4JE1A 2R0PA 3QOUA 3ZRDA 3APSA 1EEJA 1PL1A 1SU9A 5HFIA 4MK3A 4F03A 4MJCA 3HJPA 17GSA 5H5QA 3TJFA 2VCTA 4IELA 5DAKA 1XZOA 3QFAC 5F05A 4IJIA 1Z7PA 4GRFA 1WE0A 2EIOA 4D73B 4G0LA 4PQ1A 4LLRA 4PUAA 1TP9A 4IBPA 4MF7A 2WFCA 2X8CA 3HZ4A 4YQMA 1GP1A 4DVCA 1YEPA 3N9JA 3HDCA 2HT9A 2FWEA 4ZBAA 4ECJA 4LA1A 3CTFA 4EKZA 2C3NA 2YNXA 4MF5A 4HJ2A 1X9SB 3FR6A 1XWCA 1B9YC 2DKIA 2FD3A 2J9HA 3O76A 5ECMB 1V58A 1KBNA 1XOAA 4N0ZA 4ZB9A 2DC5A 5J3RA 2KUCA 1G6WA 3DEXA 3GL5A 5GAND 3A5IA 3UL3A 4Z2TA 2R0CA 3EURA 1ML6A 2LNTA 1X5EA 5CRGA 2J23A 1AC1A 4BL7B 1T7PB 1A8YA 3C7MA 4XS6A 2GGTA 3CSJA 5G31A 4FYCA 2O87A 6GSYA 5B6NA 1GWCA 5E4WA 1V2AA 1O6JA 4WF5A 1F2EA 2H1DA 5D9TA 3FR9A 1MDKA 1ZYQB 5GZZB 4E8HA 1PKWA 1PRXA 2H72A 4TOPA 4GTUA 2CAIA 2B5YA 2TIRA 4HI7A 3O6TA 3KP9A 2H66A 4CY6A 5CYYA 3GUSA 3M3MA 4DSSA 1EGOA 4E8EA 4L5OA 3KTLA 2KHPA 4K5SA 1HNAA 3HXSA 2C0GA 1F3BA 2R2JA 3I6AA 2H8LA 2GZPA 3GIXA 3GH6A 4MMMA 3HA9A 4KUNA 1F9MA 4MPGA 2B7JA 2NDOA 5IMZA 1HD2A 2O7KA 3A2XA 3ZZXA 2R37A 1CQHA 2N5AA 4OFNA 3CRUA 1GUKA 1U3AA 2JU5A 5C00A 4BWQA 2VCQA 2HNLA 3CMIA 3IOSA 3KH7A 1N2AA 4POKA 5J4UA 1YKCA 2P31A 4TXVA 1K3LA 2CX4A 2LV3A 3TKSC 4LL1B 1Y6EA 2HXKA 4CW9A 3WT1A 3G9BA 4Z7XA 3LXTA 1IYHA 4EIPA 2HZEA 2EIQA 3PH9A 3BJ5A 2H6ZA 3G7JA 3EINA 2M72A 4KCEA 3TKRA 3GX8A 4JR4A 1PX7A 2CVKA 4MLYA 2B5EA 2MMOA 4OFTA 3RPPA 3H93A 1EWXA 1NM3A 3TKSE 2N5FA 3SBCA 3N5OA 3QAVA 2QGVA 4PQHA 3BBYA 2CQ9A 2DJ2A 2DMLA 4IP1A 3GTUA 1Q98A 3D21A 3UARA 2ZUPA 1R5PA 2ES7A 5H5SA 5FT3A 2AHEA 1Q4JA 5J9BA 4JR6A 1GTUA 1SJIA 4NHWA 3DD3A 4JZQA 1ILOA 4YQVA 3ED3A 2MMNA 4MF6A 3IR4A 2O8VB 4K7IA 3CXGA 3QPMA 5DJMA 4QL9A 3A3TA 1DE1A 5BRTA 1ZGNA 1EP7A 1WWJA 6GSUA 5CREA 2HRKA 4O32A 2YV7A 4X0XA 1B4QA 1ERWA 2PN8A 2H0HA 4QL7A 3TOTA 2IN3A 2IPAA 2OBKA 2MYGA 1YF0A 2TRXA 3VWVA 2YWOA 4K5RA 2O89A 2P5RA 3EVIA 2VCZA 2PERA 4JRRA 2G0FA 4TVEA 3VWWA 1R5AA 5IOXA 2E0QA 5DBQA 1SL0B 3F8UA 5D96A 2KP1A 4IVFA 4ZL8A 1GNWA 5DAKB 2VL2C 2DJ3A 1FOHA 1F3AA 2V6OA 3IHQA 1H4OA 4GSNA 3W8JA 3C8EA 4IP6A 4KNDA 1JZOA 1JLVA 10GSA 3HKRA 3H1NA 1X0RA 1K3YA 1V57A 1PX6A 2YWMA 2A4VA 1TTZA 2N5BA 3IC8A 3TGZA 1Z6NA 2GQLA 1M99A 4F2IA 2VM2A 5ECHB 2WS2A 2FA8A 4X4JA 1PSQA 1AQWA 1O7UA 2C8UA 4CY8A 4Q5RA 3IV4A 3HZ8A 3VLNA 1MDJA 2K9FA 1AW9A 1AQXA 4I5QA 3ISOA 1GSSA 4TR4A 3VWUA 3CBUA 3MNGA 3US3A 2MMAA 3VPQA 4O92A 4V1Ag 2KOKA 5L71A 4KDYA 2AV4A 2XHFA 5A4VA 4K6XA 1USBA 2VM1A 4TR1A 2WGRA 1A24A 2RIIA 3ZL5A 1ZYPA 2JADA 3ERWA 2C1YA 1EZKA 3UJ1A 1DUGA 2FLSA 4NWYA 4J2FA 4GXZA 5AGYA 4K9ZA 3FMWA 1K0MA 4GWRA 4I97A 3GNJA 2WJUA 3UMAA 1B48A 14GSA 3BCKA 4GSSA 1HNCA 2PVQA 2BJXA 2DMMA 3IK7A 4WXTA 3F0IA 4L5LA 2LQOA 1O8XA 1S3CA 3L4NA 1O85A 1SENA 3KZQA 5D8IA 3M0FA 2IJYA 4EO3A 4FH8A 5COHA 3LORA 3UAPA 4KGIA 3CYNA 4K7OA 1T00A 4IKHA 1RQMA 4KDUA 3ZFBA 3FYGA 2H1AA 2F8AA 2HRFA 3DWVA 4XIHA 5D73A 3IA1A 2NTOA 2WCIA 4MNNA 2X49A 4TRXA 2CA8A 3WGDA 5A5KA 4GQFA 4LMVA 2VUPA 2KP2A 4MJBA 4XRDA 1XBSA 3TB2A 1H75A 3APQA 2REMA 3E0UA 4F9ZA 4IQAA 1AUCA 1O81A 3KP8A 4H86A 5D9VA 3LGCA 5G5EA 3BD2A 4V2NA 2YOIA 2OACA 2X99A 5B8BA 5KOXA 4NPBA 2B6MA 4ECIA 3H79A 2VD0A 4GLTA 5IO2A 5CP1A 4BVXA 5B6MA 4YAVA 1J9BA 4N30A 3DGQA 3WD6A 4XTSA 1XCCA 4HZ2A 2RUFA 1MDIA 3QCPA 4V2LA 4HEA2 1ZYEA 3W6GA 3LQ7A 5KN3A 4HDEA 4TXOB 1FO5A 1SL2B 2JZRA 2UZ8A 2AAWA 1WP0A 5J5NA 4L8EA 1WRYA 3UOMA 2I4AA 1K0OA 2LQQA 3L9SA 4G2EA 2GSRA 2WULA 2GSSA 1OYJA 3ZREA 1A2JA 2AYTA 3F4TA 1T1VA 3TJBA 4EE0A 1TK0B 1Z9HA 2DJ1A 1THOA 2CZ3A 2YWIA 1WMJA 3CSIA 5DALA 2EC4A 1EP8A 1TI1A 2MBTA 3J7Yb 4X1UA 4PTSA 5C04A 1G0TA 3QR6A 1AXDA 4NV2A 2RUEA 2VLVA 4JBBA 5EPFA 1GSEA 4AF2A 1OC9A 2XPDA 3I69A 5LCZA 1JLWA 4ZIJA 4KF9A 1BAYA 3L9UA 3H4KA 4RUVA 1RW1A 2ZNMA 1SK2A 4BPYA 3LG6A 1S3AA 1ERVA 3ZIVA 2YCDA 3KMNA 1T8EB 2DIZA 1MTCA 3LFLA 22GSA 1PQNA 3GL3A 5KN1A 2IMKA 4ZBDA 2I1UA 3GH9A 4BVYB 1X9WB 3R2QA 5IMDA 1U6TA 2H0GA 3VFIA 1Y25A 2HSMA 3RDWA 2H71A 2QSIA 3OR5A 3D4MA 3L0HA 3EPTA 6GSWA 4G0KA 2V1MA 3ZMKA 3KIJA 4NAXA 2E7PA 4MA9A 2L4CA 1ST9A 5GSSA 1ZCPA 1B4PA 2LRCA 3EC3A 3IRAA 2GZYA 2MBSA 2R3XA 4OMVA 3F3QA 4ECCA 4QQ7A 1HYUA 5JCUA 4O5QA 3G7YA 5G1LA 3IAM2 2PGTA 1PGTA 2MMZA 5DQYA 2V41A 3FK8A 3NOFA 3M9KA 3KD0A 4IW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FVJ A;  1XFL A;  1M0U A;  2FGX A;  5DJL A;  2L5O A;  4K2D A;  2K18 A;  3GKX A;  3HJM A;  2LKU A;  1U3I A;  1ERU A;  3IAS 2;  1QXH A;  2GT6 A;  1M2D A;  1ERT A;  2PWJ A;  1GSY A;  5A4U A;  1E2Y A;  5ELA A;  5CO3 A;  1HQO A;  2L57 A;  5ABR A;  1QK8 A;  1BJX A;  3ERG A;  4POM A;  3HD5 A;  5HFK A;  5IQY A;  1YKA A;  1WOU A;  2DJ0 A;  2OBI A;  3FHK A;  4ZXG A;  4DSQ A;  4HS1 A;  3GST A;  3CTG A;  1UN2 A;  4Q5F A;  4Q5N A;  2PVO C;  2P5Q A;  2MZC A;  3UBK A;  3ZYW A;  1OC3 A;  3VI5 A;  2R6K A;  4PUF C;  3TCO A;  4EDZ A;  1UVZ A;  1LBK A;  4XRA A;  2AB6 A;  5B8A A;  4OFM A;  4YAP A;  1AIU A;  1VF3 A;  1TU7 A;  1A2L A;  3G7I A;  3M9J A;  2LRN A;  2LUS A;  4ZBB A;  1K0N A;  1DSB A;  5IPH A;  3K8N A;  3L78 A;  4FYU A;  3EU3 A;  4LMW A;  3P7X A;  4PNF A;  1SYR A;  3FZ9 A;  1J0F A;  2H75 A;  5F07 A;  2H1G A;  4K7N A;  1NSW A;  4MJA A;  3C1R A;  4DSR A;  1K0C A;  3NIV A;  1PMT A;  4POB A;  3Q74 A;  3TUE A;  3FEU A;  2HRN A;  2L6C A;  4IN0 A;  1X9M B;  3QD9 A;  2LEG A;  5HR3 A;  6GST A;  4LL4 B;  5GAP D;  4FO5 A;  5ECN B;  4PXO A;  1TXX A;  1GTA A;  4XCS A;  1B8X A;  1GSQ A;  2LST A;  4ZIL A;  3EMX A;  3F9U A;  2VOC A;  3GHA A;  1TDI A;  1YY7 A;  4KCA A;  4EXJ A;  4TW5 A;  2FUG 2;  4MZC A;  3ME7 A;  1TRU A;  2YZH A;  1EV9 A;  4G9H A;  1WJK A;  2PUK C;  1K3O A;  2GSQ A;  2O85 A;  5EL8 A;  4K8M A;  2IIY A;  1AQV A;  5D9X A;  3RHC A;  3BCI A;  4OO4 A;  4HZ4 A;  2F9S A;  4NV5 A;  3VI7 A;  3TDG A;  4ZL7 A;  1A0R P;  2HSY A;  5F0G A;  3F4R A;  2CVD A;  5GST A;  1WIK A;  5ECI B;  5ECS A;  2I81 A;  4IJ3 A;  1T3B A;  1SYX A;  2IME A;  2QC7 A;  3GYK A;  2B7K A;  2AJQ B;  4J57 E;  1GLP A;  3HVV A;  1GSD A;  1FOV A;  1TI3 A;  1ON4 A;  2H01 A;  3DYR A;  2H73 A;  3U6V A;  2OE0 A;  3S9F A;  2C80 A;  2YJH A;  3UEM A;  3GV1 A;  2FCH A;  1GUL A;  4TR0 A;  2FY6 A;  1JHB A;  2B1K A;  4GCI A;  2DBC A;  3A2W A;  4ACS A;  2HE3 A;  3FR3 A;  1U88 A;  3WGX A;  3GN3 A;  2CX3 A;  2H6X A;  5FWG A;  2E2M A;  4I2T A;  5D93 A;  1TRS A;  1GLQ A;  2V2G A;  3EMP A;  1ZMA A;  1EOG A;  2CAQ A;  5IMA A;  1FB6 A;  1XWB A;  2H1B A;  1UC7 A;  4KW6 A;  4MDC A;  1C72 A;  5AIX A;  3TJG A;  1ACV A;  5J41 A;  5KEJ A;  4PGT A;  3MDK A;  1PD2 1;  2VIM A;  4KSM A;  3WYW A;  1Z3E A;  1I9D A;  5ECK B;  7GSS A;  2YAN A;  1A8L A;  2WDU A;  2NBS A;  4KSO A;  3FZ4 A;  4BA7 A;  1TK8 B;  1O73 A;  1FW1 A;  3IDV A;  1FB0 A;  2V6K A;  4J56 E;  2JZS A;  5CNW A;  2ON5 A;  1EOH A;  3DRN A;  1QMV A;  3O3T A;  4DSS B;  3VPT A;  3KEB A;  3ZML A;  2BMX A;  1M7T A;  2NPB A;  5HR1 A;  3C71 A;  2YP6 A;  5CAX A;  2FHE A;  4IS0 A;  2CVB A;  3RAZ A;  1OE8 A;  3EE2 A;  3DVX A;  3LYP A;  4G19 A;  4WET A;  2C0D A;  1S3D A;  3HYP A;  3GKK A;  4HQZ A;  2VL3 A;  3P90 A;  2VL9 A;  3LWA A;  2M80 A;  3KGK A;  1PL2 A;  5HR2 A;  2VAF A;  1XWA A;  1OKT A;  1GNE A;  1LJR A;  4OWY A;  3UIW A;  9GSS A;  3C1S A;  1BED A;  4WF4 A;  3IE3 A;  5DDL A;  1GTB A;  4HOJ A;  2XPE A;  2X8G A;  2RM5 A;  2I3Y A;  4XHM A;  2F3M A;  3TKP A;  2JSY A;  4N0V A;  5HFG A;  4RI6 A;  2HZE B;  3Q18 A;  16GS A;  4YH2 A;  5ID2 A;  1YDK A;  2IMI A;  4BWS A;  1JZR A;  4ILF A;  4K0G A;  3FY7 A;  2C4J A;  2GDR A;  1I5G A;  3KMO A;  1R4W A;  4WEY A;  1M2A A;  2IWT A;  1K0A A;  3QMX A;  3MSZ A;  4KH7 A;  3D5J A;  4JU5 A;  1KEB A;  3RHB A;  2OAD A;  1BYE A;  2ZCT A;  3IK9 A;  1GSU A;  3WGE A;  3UVH A;  2KLX A;  1FG4 A;  3P2A A;  4NMU A;  2XC2 A;  1LU4 A;  3Q19 A;  5F8B A;  4KAE A;  2C3T A;  2CV4 A;  3TKS A;  3GTU B;  4TR3 A;  5DCH A;  1F6M C;  4CHS A;  1PA3 A;  4EVM A;  1EGR A;  2V32 A;  4XS4 A;  3NZN A;  2G2Q A;  2RLI A;  4CDO A;  1X5C A;  18GS A;  5JCW A;  20GS A;  3DXB A;  2VCX A;  1JZD A;  1GH2 A;  4ECB A;  3M8N A;  2H74 A;  2NVL A;  1XIY A;  1SKW B;  4MZW A;  4HQS A;  1GSF A;  5IO0 A;  2K6V A;  2ON7 A;  3F3R A;  3AY8 A;  1YF1 A;  1T4Z A;  2XBQ A;  5DCG A;  2E2G A;  5IOW A;  1DE2 A;  1E6B A;  3DVW A;  5HR0 A;  2HI7 A;  1BQ7 A;  2A2S A;  5AIV A;  5JWQ B;  1NHY A;  5CRD A;  4ISD A;  4HU7 A;  2GQK A;  4N11 A;  4WBR D;  3ZIJ A;  2L6D A;  1JZW A;  2IMD A;  2PPT A;  4Q5Q A;  3TRP A;  1A0F A;  2GQM A;  4O5R A;  2C0F A;  3TOU A;  2B1L A;  1J08 A;  3QAG A;  2JZT A;  4HJM A;  3I9V 2;  2LJA A;  2JL4 A;  4L0W A;  4AGS A;  3VUR A;  4EUY A;  2B5X A;  5KN2 A;  5ECO B;  1SK0 A;  2GS3 A;  5H5R A;  3P8W A;  1ZOF A;  3ZLP A;  5F06 A;  4ID0 A;  4WR5 A;  2H30 A;  5DQS A;  4I8B A;  1F37 A;  3FZA A;  3DIE A;  4I2U A;  1OC8 A;  1B9X C;  3QFB C;  1M9A A;  2A2R A;  2ALB A;  4GQC A;  4ZL9 A;  1EEM A;  1SD9 A;  2GST A;  4OD7 A;  2VL2 A;  1VF2 A;  1MEK A;  1VF4 A;  2LNS A;  1FVK A;  1V40 A;  5G5F A;  3EYT A;  2LS5 A;  1GUH A;  1QQ2 A;  2L4Q A;  2VD1 A;  3CRT A;  3M1G A;  4EF0 A;  2X64 A;  3F63 A;  1SJZ A;  4F0C A;  1SJ6 A;  5G1K A;  3Q6O A;  2F8F A;  3ZTL A;  4OCE A;  1R7H A;  5JCG A;  3ERF A;  4MJE A;  3RBT A;  2AUV A;  1MD3 A;  3I43 A;  3TJK A;  4TR1 B;  2YWN A;  5HQP A;  3KM6 A;  4X43 A;  5JWO B;  1OVN A;  5ELG A;  3GSS A;  2C0E A;  3RPN A;  3GRX A;  4TN8 A;  2XBI A;  4JED A;  5JWR B;  4MH2 A;  4P3Y B;  5FHI A;  1CQG A;  4EC0 A;  4IHU A;  3D0Z A;  1TRV A;  1Z7R A;  2M46 A;  5ECQ B;  3DML A;  1OAZ A;  4POL A;  1NHO A;  4YQU A;  4MCU A;  1XVW A;  3F4S A;  1GUM A;  5LD0 A;  5ENU A;  3D22 A;  2GTU A;  4ZB8 A;  3F6D A;  1Z6M A;  1XVQ A;  1U87 A;  5J9C A;  4MAB A;  3IXR A;  1A2M A;  2EIR A;  2YN1 A;  5DVB A;  1TRW A;  4OO5 A;  1X5D A;  3KTB A;  3GFK A;  2HLS A;  3HCZ A;  2YPM A;  2OE1 A;  3A5W A;  4MP4 A;  4DEJ A;  1V9W A;  3MAK A;  2DLX A;  2IMF A;  2X8H A;  4G10 A;  2IFQ A;  3SWL A;  1QUW A;  4F0B A;  2VLT A;  3EWL A;  1FHE A;  2YZU A;  5ID2 B;  2VLU A;  1BX9 A;  2WZ9 A;  3C73 A;  3EU4 A;  4FYB A;  4GST A;  1XW9 A;  3IPZ A;  3HJO A;  8GSS A;  3ZIT A;  1K0B A;  2PMT A;  3LSZ A;  4GF0 A;  2CT6 A;  2D2Z A;  5LNK e;  2GZZ A;  3GX0 A;  3CSH A;  1Z5Y E;  4MZB A;  2Z9S A;  1V98 A;  1W4V A;  3HVX A;  5INY A;  1YQ1 A;  1IYI A;  2WRT A;  5AN1 A;  1URM A;  3VWX A;  5ECP B;  4OCF A;  4TXO A;  3PR8 A;  3FRC A;  1SKS B;  5EVO A;  2OE3 A;  4XS4 B;  2QKE A;  2VCV A;  1YJ6 A;  2WB9 A;  3GUR A;  1K0D A;  2HYX A;  1YZX A;  4EL1 A;  2HZF A;  3ZFL A;  1TKD B;  1OKD A;  4RQR A;  3QDN A;  1N8J A;  2H6Y A;  2FA4 A;  5ECR B;  3DKS A;  4K0N A;  3KXO A;  3MWH A;  3J7Y k;  4IQ1 A;  6GSV A;  4ML1 A;  4D73 A;  3APO A;  1A23 A;  2FWH A;  2GVP A;  5DAL B;  2FNO A;  5IMF A;  5G2Z A;  4EDY A;  4MPF A;  3GKM A;  2FWF A;  4RI7 A;  3KH9 A;  1QFN A;  1OC9 B;  1SD8 A;  2YV9 A;  2OKA A;  3F6F A;  4KX4 A;  3GKN A;  5KN0 A;  1NW2 A;  1QGV A;  4KB3 A;  1G7O A;  1XXU A;  3A2V A;  3GMF A;  4AJ7 A;  4BVY A;  1RK4 A;  3ME8 A;  3TRQ A;  3TKQ A;  3TJJ A;  1XWK A;  2BTO T;  1SK1 A;  1EV4 A;  6GSX A;  1ZL9 A;  3QAW A;  2K8V A;  3E3E A;  1XWG A;  2VCW A;  4RQX A;  3FZ5 A;  2OA7 A;  2C3Q A;  4BL7 A;  2L59 A;  2TRC P;  2VO4 A;  4KDX A;  5IIZ A;  2FWG A;  1WPI A;  1R26 A;  4I6X A;  5CRW A;  4K1F A;  3PIN A;  2DSA A;  13GS A;  3JCM L;  2LTK A;  2OJL A;  4ZB6 A;  2HSH A;  4IGJ A;  2RM6 A;  5EY6 A;  3U5R E;  4FIW A;  3L9V A;  4V1A p;  3PGT A;  1PN9 A;  5IMV A;  4ML6 A;  1G7E A;  4NHZ A;  3D4T A;  1TJD A;  1YEX A;  3UVT A;  2B3S A;  5AIS A;  2I9H A;  4XS1 A;  1TW9 A;  2P0G A;  3D6I A;  3HVS A;  4TKY A;  1ABA A;  5D9W A;  2HFD A;  2R4V A;  1PKZ A;  2YJ7 A;  3KJY A;  3E9J B;  5IPG A;  1SL1 B;  3BOA A;  1FAA A;  3FW2 A;  3HY2 A;  1OE7 A;  4L0U A;  4AJ6 A;  1XOB A;  1GRX A;  2LJK A;  3LEF A;  4V2M A;  1AAZ A;  2LRT A;  1M2B A;  4AJ8 A;  3V1W A;  2H0I A;  1KTE A;  3GA4 A;  4HUA A;  3IC4 A;  1TU8 A;  4ULX A;  5IMC A;  1DBY A;  3ZVJ A;  1GTI A;  4HU9 A;  4F82 A;  4PX1 A;  1JFU A;  1GL8 A;  4WBJ A;  11GS A;  19GS A;  3ZVJ D;  3W8S A;  1UA5 A;  4WR4 A;  3TRX A;  4MH3 A;  3HHV A;  1HNB A;  4O7H A;  3IBH A;  1BG5 A;  2DIY A;  2H76 A;  3LJR A;  12GS A;  3H8Q A;  1VF1 A;  1KNG A;  2DJK A;  1SKR B;  3KCM A;  3LXZ A;  1ZZY A;  1T4Y A;  6GSS A;  1VRS D;  3FKF A;  2IFQ B;  5CRH A;  4WKW A;  2H19 A;  3LYK A;  2CZ2 A;  2IL3 A;  4N10 A;  2F51 A;  3VK9 A;  2PBJ A;  5ECL B;  1XPV A;  4PQI A;  1XW6 A;  1O8W A;  2LJR A;  2PU9 C;  1MD4 A;  2H70 A;  5A4W A;  5G30 A;  1THX A;  3UBL A;  5B7C A;  2JSZ A;  2GT5 A;  4PNG A;  1XW5 A;  5IM9 A;  1VGL A;  2GLR A;  5E59 A;  1W89 A;  1M9B A;  2L5L A;  1G6Y A;  3WT2 A;  2K8S A;  2DJJ A;  2JAC A;  4KE3 A;  2R5G A;  4PUR A;  1TK5 B;  1TOF A;  4NXI A;  4KA0 A;  4JE1 A;  3QOU A;  3ZRD A;  3APS A;  1EEJ A;  1PL1 A;  1SU9 A;  5HFI A;  4MK3 A;  4F03 A;  4MJC A;  3HJP A;  17GS A;  5H5Q A;  3TJF A;  2VCT A;  4IEL A;  5DAK A;  1XZO A;  3QFA C;  5F05 A;  4IJI A;  1Z7P A;  4GRF A;  1WE0 A;  2EIO A;  4D73 B;  4PQ1 A;  4LLR A;  4PUA A;  1TP9 A;  4IBP A;  4MF7 A;  2WFC A;  2X8C A;  3HZ4 A;  4YQM A;  1GP1 A;  4DVC A;  1YEP A;  3N9J A;  3HDC A;  2HT9 A;  2FWE A;  4ZBA A;  4ECJ A;  4LA1 A;  3CTF A;  4EKZ A;  2C3N A;  2YNX A;  4MF5 A;  4HJ2 A;  1X9S B;  3FR6 A;  1XWC A;  1B9Y C;  2FD3 A;  2J9H A;  3O76 A;  5ECM B;  1V58 A;  1KBN A;  1XOA A;  4N0Z A;  4ZB9 A;  2DC5 A;  5J3R A;  2KUC A;  1G6W A;  3DEX A;  3GL5 A;  5GAN D;  3UL3 A;  3EUR A;  1ML6 A;  2LNT A;  1X5E A;  5CRG A;  2J23 A;  1AC1 A;  1T7P B;  1A8Y A;  3C7M A;  4XS6 A;  2GGT A;  3CSJ A;  5G31 A;  4FYC A;  2O87 A;  6GSY A;  5B6N A;  1GWC A;  5E4W A;  1V2A A;  1O6J A;  4WF5 A;  1F2E A;  2H1D A;  5D9T A;  3FR9 A;  1MDK A;  1ZYQ B;  5GZZ B;  4E8H A;  1PKW A;  1PRX A;  2H72 A;  4TOP A;  4GTU A;  2CAI A;  2B5Y A;  2TIR A;  4HI7 A;  3O6T A;  3KP9 A;  2H66 A;  5CYY A;  3GUS A;  3M3M A;  4DSS A;  1EGO A;  4E8E A;  4L5O A;  3KTL A;  2KHP A;  1HNA A;  3HXS A;  2C0G A;  1F3B A;  2R2J A;  3I6A A;  2H8L A;  2GZP A;  3GIX A;  3GH6 A;  4MMM A;  3HA9 A;  4KUN A;  1F9M A;  4MPG A;  2B7J A;  2NDO A;  5IMZ A;  1HD2 A;  2O7K A;  3A2X A;  3ZZX A;  2R37 A;  1CQH A;  2N5A A;  4OFN A;  3CRU A;  1GUK A;  1U3A A;  2JU5 A;  5C00 A;  4BWQ A;  2VCQ A;  2HNL A;  3CMI A;  3IOS A;  3KH7 A;  1N2A A;  4POK A;  5J4U A;  1YKC A;  2P31 A;  4TXV A;  1K3L A;  2CX4 A;  2LV3 A;  3TKS C;  4LL1 B;  1Y6E A;  2HXK A;  4CW9 A;  3WT1 A;  3G9B A;  4Z7X A;  3LXT A;  1IYH A;  2HZE A;  2EIQ A;  3PH9 A;  3BJ5 A;  2H6Z A;  3G7J A;  3EIN A;  2M72 A;  4KCE A;  3TKR A;  3GX8 A;  4JR4 A;  1PX7 A;  2CVK A;  4MLY A;  2B5E A;  2MMO A;  4OFT A;  3RPP A;  3H93 A;  1EWX A;  1NM3 A;  3TKS E;  2N5F A;  3SBC A;  3N5O A;  3QAV A;  2QGV A;  4PQH A;  3BBY A;  2CQ9 A;  2DJ2 A;  2DML A;  4IP1 A;  3GTU A;  1Q98 A;  3D21 A;  3UAR A;  2ZUP A;  1R5P A;  2ES7 A;  5H5S A;  5FT3 A;  2AHE A;  1Q4J A;  5J9B A;  4JR6 A;  1GTU A;  1SJI A;  4NHW A;  3DD3 A;  4JZQ A;  1ILO A;  4YQV A;  3ED3 A;  2MMN A;  4MF6 A;  3IR4 A;  2O8V B;  4K7I A;  3CXG A;  3QPM A;  5DJM A;  4QL9 A;  3A3T A;  1DE1 A;  1ZGN A;  1EP7 A;  1WWJ A;  6GSU A;  5CRE A;  4O32 A;  2YV7 A;  4X0X A;  1B4Q A;  1ERW A;  2PN8 A;  2H0H A;  4QL7 A;  3TOT A;  2IN3 A;  2IPA A;  2OBK A;  2MYG A;  1YF0 A;  2TRX A;  3VWV A;  2YWO A;  2O89 A;  2P5R A;  3EVI A;  2VCZ A;  2PER A;  4JRR A;  2G0F A;  4TVE A;  3VWW A;  1R5A A;  5IOX A;  2E0Q A;  5DBQ A;  1SL0 B;  3F8U A;  5D96 A;  2KP1 A;  4IVF A;  4ZL8 A;  1GNW A;  5DAK B;  2VL2 C;  2DJ3 A;  1F3A A;  2V6O A;  3IHQ A;  1H4O A;  4GSN A;  3W8J A;  3C8E A;  4IP6 A;  4KND A;  1JZO A;  1JLV A;  10GS A;  3HKR A;  3H1N A;  1X0R A;  1K3Y A;  1V57 A;  1PX6 A;  2YWM A;  2A4V A;  1TTZ A;  2N5B A;  3TGZ A;  1Z6N A;  2GQL A;  1M99 A;  4F2I A;  2VM2 A;  5ECH B;  2WS2 A;  2FA8 A;  1PSQ A;  1AQW A;  1O7U A;  2C8U A;  4Q5R A;  3IV4 A;  3HZ8 A;  3VLN A;  1MDJ A;  2K9F A;  1AW9 A;  1AQX A;  4I5Q A;  3ISO A;  1GSS A;  4TR4 A;  3VWU A;  3CBU A;  3MNG A;  3US3 A;  2MMA A;  3VPQ A;  4O92 A;  4V1A g;  2KOK A;  5L71 A;  4KDY A;  2AV4 A;  2XHF A;  5A4V A;  4K6X A;  1USB A;  2VM1 A;  4TR1 A;  2WGR A;  1A24 A;  2RII A;  3ZL5 A;  2JAD A;  3ERW A;  2C1Y A;  1EZK A;  3UJ1 A;  1DUG A;  2FLS A;  4NWY A;  4J2F A;  4GXZ A;  5AGY A;  4K9Z A;  1K0M A;  4GWR A;  4I97 A;  3GNJ A;  2WJU A;  3UMA A;  1B48 A;  14GS A;  3BCK A;  4GSS A;  1HNC A;  2PVQ A;  2BJX A;  2DMM A;  3IK7 A;  4WXT A;  3F0I A;  4L5L A;  2LQO A;  1O8X A;  1S3C A;  3L4N A;  1O85 A;  1SEN A;  3KZQ A;  5D8I A;  3M0F A;  2IJY A;  4EO3 A;  4FH8 A;  5COH A;  3LOR A;  3UAP A;  4KGI A;  3CYN A;  4K7O A;  1T00 A;  4IKH A;  1RQM A;  4KDU A;  3ZFB A;  3FYG A;  2H1A A;  2F8A A;  2HRF A;  3DWV A;  4XIH A;  5D73 A;  3IA1 A;  2NTO A;  2WCI A;  4TRX A;  2CA8 A;  3WGD A;  5A5K A;  4GQF A;  4LMV A;  2VUP A;  2KP2 A;  4MJB A;  4XRD A;  1XBS A;  3TB2 A;  1H75 A;  3APQ A;  2REM A;  3E0U A;  4F9Z A;  4IQA A;  1AUC A;  1O81 A;  3KP8 A;  4H86 A;  5D9V A;  3LGC A;  5G5E A;  3BD2 A;  4V2N A;  2YOI A;  2OAC A;  2X99 A;  5B8B A;  4NPB A;  2B6M A;  4ECI A;  3H79 A;  2VD0 A;  4GLT A;  5IO2 A;  5CP1 A;  4BVX A;  5B6M A;  4YAV A;  1J9B A;  4N30 A;  3DGQ A;  3WD6 A;  4XTS A;  1XCC A;  4HZ2 A;  2RUF A;  1MDI A;  3QCP A;  4V2L A;  4HEA 2;  1ZYE A;  3W6G A;  3LQ7 A;  5KN3 A;  4HDE A;  4TXO B;  1FO5 A;  1SL2 B;  2JZR A;  5J5N A;  2AAW A;  1WP0 A;  4L8E A;  1WRY A;  3UOM A;  2I4A A;  1K0O A;  2LQQ A;  3L9S A;  4G2E A;  2GSR A;  2WUL A;  2GSS A;  1OYJ A;  3ZRE A;  1A2J A;  2AYT A;  3F4T A;  1T1V A;  3TJB A;  4EE0 A;  1TK0 B;  1Z9H A;  2DJ1 A;  1THO A;  2CZ3 A;  2YWI A;  1WMJ A;  3CSI A;  5DAL A;  2EC4 A;  1EP8 A;  1TI1 A;  2MBT A;  3J7Y b;  4X1U A;  5C04 A;  1G0T A;  3QR6 A;  1AXD A;  4NV2 A;  2RUE A;  2VLV A;  4JBB A;  5EPF A;  1GSE A;  4AF2 A;  1OC9 A;  2XPD A;  3I69 A;  5LCZ A;  1JLW A;  4ZIJ A;  1BAY A;  3L9U A;  3H4K A;  4RUV A;  1RW1 A;  2ZNM A;  1SK2 A;  4BPY A;  3LG6 A;  1S3A A;  1ERV A;  3ZIV A;  2YCD A;  3KMN A;  1T8E B;  2DIZ A;  1MTC A;  3LFL A;  22GS A;  1PQN A;  3GL3 A;  5KN1 A;  2IMK A;  4ZBD A;  2I1U A;  3GH9 A;  1X9W B;  3R2Q A;  5IMD A;  1U6T A;  2H0G A;  3VFI A;  1Y25 A;  3RDW A;  2H71 A;  2QSI A;  3OR5 A;  3D4M A;  3L0H A;  6GSW A;  2V1M A;  3ZMK A;  3KIJ A;  4NAX A;  2E7P A;  4MA9 A;  2L4C A;  1ST9 A;  5GSS A;  1ZCP A;  1B4P A;  2LRC A;  3EC3 A;  3IRA A;  2GZY A;  2MBS A;  2R3X A;  4OMV A;  3F3Q A;  4ECC A;  4QQ7 A;  1HYU A;  5JCU A;  3G7Y A;  5G1L A;  3IAM 2;  2PGT A;  1PGT A;  2MMZ A;  5DQY A;  2V41 A;  3FK8 A;  3NOF A;  3M9K A;  3KD0 A;  4IW9 A; 
#chains in the Genus database with same CATH topology
 1FVJ A;  1XFL A;  1M0U A;  2FGX A;  5DJL A;  2L5O A;  4K2D A;  2K18 A;  3GKX A;  3HJM A;  2LKU A;  1U3I A;  1ERU A;  3IAS 2;  1QXH A;  2GT6 A;  1M2D A;  1ERT A;  2PWJ A;  1GSY A;  5A4U A;  1E2Y A;  5ELA A;  5CO3 A;  1HQO A;  2QA2 A;  2L57 A;  5ABR A;  1QK8 A;  1BJX A;  3ERG A;  4POM A;  3HD5 A;  5HFK A;  3MIX A;  5IQY A;  1YKA A;  1WOU A;  2DJ0 A;  2OBI A;  3FHK A;  4ZXG A;  4DSQ A;  4HS1 A;  3GST A;  3CTG A;  1UN2 A;  4Q5F A;  4Q5N A;  2PVO C;  2P5Q A;  2MZC A;  3UBK A;  3ZYW A;  1OC3 A;  3VI5 A;  2R6K A;  4PUF C;  3TCO A;  4EDZ A;  1UVZ A;  1LBK A;  4XRA A;  4USS A;  2AB6 A;  5B8A A;  4OFM A;  4YAP A;  1AIU A;  1VF3 A;  1TU7 A;  1A2L A;  3G7I A;  3M9J A;  2LRN A;  2LUS A;  4ZBB A;  1K0N A;  1DSB A;  5IPH A;  3K8N A;  3L78 A;  4FYU A;  3EU3 A;  4LMW A;  3P7X A;  4PNF A;  1SYR A;  3FZ9 A;  1J0F A;  2H75 A;  5F07 A;  2H1G A;  4K7N A;  1NSW A;  4MJA A;  3C1R A;  4DSR A;  1K0C A;  3NIV A;  1PMT A;  4POB A;  3Q74 A;  3TUE A;  3FEU A;  2HRN A;  2L6C A;  4IN0 A;  1X9M B;  3QD9 A;  2LEG A;  5HR3 A;  6GST A;  4LL4 B;  3PPU A;  5GAP D;  4FO5 A;  5ECN B;  4PXO A;  1TXX A;  3MYD A;  1GTA A;  4XCS A;  1B8X A;  1GSQ A;  2LST A;  4ZIL A;  3EMX A;  3F9U A;  4BVX B;  2VOC A;  3GHA A;  1TDI A;  1YY7 A;  4KCA A;  4EXJ A;  4TW5 A;  2FUG 2;  4MZC A;  3ME7 A;  1TRU A;  2YZH A;  1EV9 A;  4G9H A;  1WJK A;  4ICY A;  2PUK C;  1K3O A;  2GSQ A;  2O85 A;  5EL8 A;  4K8M A;  2IIY A;  1AQV A;  5D9X A;  3RHC A;  3BCI A;  4OO4 A;  4HZ4 A;  2F9S A;  4NV5 A;  3VI7 A;  3TDG A;  4ZL7 A;  1A0R P;  2HSY A;  5F0G A;  3F4R A;  2CVD A;  5GST A;  1WIK A;  5ECI B;  5ECS A;  2I81 A;  4IJ3 A;  1T3B A;  1SYX A;  2IME A;  2QC7 A;  3GYK A;  2B7K A;  2AJQ B;  4J57 E;  1PN0 A;  1GLP A;  3HVV A;  1GSD A;  1FOV A;  1TI3 A;  1ON4 A;  2H01 A;  3DYR A;  2H73 A;  3U6V A;  2OE0 A;  3S9F A;  2C80 A;  2YJH A;  3UEM A;  3GV1 A;  2FCH A;  1GUL A;  4TR0 A;  2FY6 A;  1JHB A;  2B1K A;  4GCI A;  2DBC A;  3A2W A;  4ACS A;  2HE3 A;  3FR3 A;  1U88 A;  3WGX A;  3GN3 A;  2CX3 A;  2H6X A;  5FWG A;  2E2M A;  4I2T A;  5D93 A;  1TRS A;  1GLQ A;  2V2G A;  3EMP A;  1ZMA A;  1EOG A;  2CAQ A;  5IMA A;  1FB6 A;  1XWB A;  2H1B A;  1UC7 A;  4KW6 A;  4MDC A;  1C72 A;  5AIX A;  5KOW A;  3TJG A;  4Z2U A;  1ACV A;  5J41 A;  5KEJ A;  4PGT A;  3MDK A;  1PD2 1;  2VIM A;  4KSM A;  3WYW A;  1Z3E A;  1I9D A;  5ECK B;  7GSS A;  2YAN A;  1A8L A;  2WDU A;  2NBS A;  4KSO A;  3FZ4 A;  4BA7 A;  1TK8 B;  1O73 A;  1FW1 A;  3IDV A;  1FB0 A;  2V6K A;  4J56 E;  2JZS A;  5CNW A;  2ON5 A;  1EOH A;  3DRN A;  1QMV A;  3O3T A;  4DSS B;  3VPT A;  3KEB A;  3ZML A;  2BMX A;  1M7T A;  2NPB A;  5HR1 A;  3C71 A;  2YP6 A;  5CAX A;  2FHE A;  4IS0 A;  2CVB A;  3RAZ A;  1OE8 A;  3EE2 A;  3DVX A;  3LYP A;  4G19 A;  4WET A;  2C0D A;  4O5U A;  1S3D A;  3HYP A;  3GKK A;  4HQZ A;  2VL3 A;  3P90 A;  2VL9 A;  3LWA A;  2M80 A;  3KGK A;  1PL2 A;  5HR2 A;  2VAF A;  1XWA A;  1OKT A;  1GNE A;  1LJR A;  4OWY A;  3UIW A;  9GSS A;  3C1S A;  1BED A;  4WF4 A;  3IE3 A;  5DDL A;  1GTB A;  4HOJ A;  2XPE A;  2X8G A;  2RM5 A;  2I3Y A;  4XHM A;  2F3M A;  3TKP A;  2JSY A;  4N0V A;  5HFG A;  4RI6 A;  2HZE B;  3Q18 A;  16GS A;  4YH2 A;  5ID2 A;  1YDK A;  2IMI A;  4BWS A;  1JZR A;  4ILF A;  4K0G A;  3FY7 A;  2C4J A;  2GDR A;  1I5G A;  3KMO A;  1R4W A;  4WEY A;  1M2A A;  2IWT A;  1K0A A;  3QMX A;  3MSZ A;  4KH7 A;  3D5J A;  4JU5 A;  1KEB A;  3RHB A;  2OAD A;  1BYE A;  2ZCT A;  3IK9 A;  1GSU A;  3WGE A;  3UVH A;  2KLX A;  1FG4 A;  3P2A A;  4NMU A;  2XC2 A;  1LU4 A;  3Q19 A;  5F8B A;  4KAE A;  2C3T A;  2CV4 A;  3TKS A;  3GTU B;  4TR3 A;  5DCH A;  1F6M C;  4CHS A;  1PA3 A;  4EVM A;  1EGR A;  2V32 A;  4XS4 A;  3NZN A;  2G2Q A;  2RLI A;  4CDO A;  1X5C A;  18GS A;  5JCW A;  20GS A;  3DXB A;  2VCX A;  1JZD A;  1GH2 A;  4ECB A;  3M8N A;  2H74 A;  2NVL A;  1XIY A;  1SKW B;  4MZW A;  4HQS A;  1GSF A;  2HRA A;  5IO0 A;  2K6V A;  2ON7 A;  3F3R A;  3AY8 A;  1YF1 A;  1T4Z A;  2XBQ A;  5DCG A;  2E2G A;  5IOW A;  1DE2 A;  1E6B A;  3DVW A;  5HR0 A;  2HI7 A;  1BQ7 A;  2A2S A;  5AIV A;  5JWQ B;  1NHY A;  5CRD A;  4ISD A;  4HU7 A;  2GQK A;  4N11 A;  4WBR D;  3ZIJ A;  2L6D A;  1JZW A;  2IMD A;  2PPT A;  4Q5Q A;  3TRP A;  1A0F A;  2GQM A;  4O5R A;  2C0F A;  3TOU A;  2B1L A;  1J08 A;  3QAG A;  2JZT A;  4HJM A;  3I9V 2;  4A5P A;  2LJA A;  2JL4 A;  4L0W A;  4AGS A;  3VUR A;  4EUY A;  2B5X A;  4K2X A;  5KN2 A;  5ECO B;  3IHG A;  1SK0 A;  2GS3 A;  5H5R A;  3P8W A;  1ZOF A;  3ZLP A;  5F06 A;  4ID0 A;  4WR5 A;  2H30 A;  5DQS A;  4I8B A;  1F37 A;  3FZA A;  3DIE A;  4I2U A;  1OC8 A;  1B9X C;  3QFB C;  1M9A A;  2A2R A;  2ALB A;  4GQC A;  4ZL9 A;  1EEM A;  1SD9 A;  2GST A;  4OD7 A;  2VL2 A;  1VF2 A;  1MEK A;  1VF4 A;  2LNS A;  1FVK A;  1V40 A;  5G5F A;  3EYT A;  2LS5 A;  1GUH A;  1QQ2 A;  2L4Q A;  2VD1 A;  3CRT A;  3M1G A;  4EF0 A;  2X64 A;  3F63 A;  1SJZ A;  4F0C A;  1SJ6 A;  5G1K A;  3Q6O A;  2F8F A;  3ZTL A;  4OCE A;  1R7H A;  5JCG A;  3ERF A;  4MJE A;  3RBT A;  3R3E A;  2AUV A;  1MD3 A;  3I43 A;  3TJK A;  2QA1 A;  4TR1 B;  2YWN A;  5HQP A;  2X4A A;  3KM6 A;  4X43 A;  1M3I A;  5JWO B;  1OVN A;  5ELG A;  3GSS A;  2C0E A;  3RPN A;  3GRX A;  4TN8 A;  2XBI A;  4JED A;  5JWR B;  1ZYN A;  4MH2 A;  4P3Y B;  5FHI A;  1CQG A;  4EC0 A;  4IHU A;  3D0Z A;  1TRV A;  1Z7R A;  2M46 A;  5ECQ B;  3DML A;  1OAZ A;  4POL A;  1NHO A;  4YQU A;  4MCU A;  1XVW A;  3F4S A;  1GUM A;  5LD0 A;  5ENU A;  3D22 A;  2GTU A;  4ZB8 A;  3F6D A;  1Z6M A;  1XVQ A;  1U87 A;  5J9C A;  4MAB A;  3IXR A;  1A2M A;  2EIR A;  2YN1 A;  5DVB A;  1TRW A;  4OO5 A;  1X5D A;  3KTB A;  3GFK A;  4EIQ A;  2HLS A;  4YKF A;  3HCZ A;  2YPM A;  2OE1 A;  3A5W A;  4MP4 A;  4DEJ A;  1V9W A;  3MAK A;  2DLX A;  2IMF A;  2X8H A;  4G10 A;  2IFQ A;  3SWL A;  1QUW A;  4F0B A;  2VLT A;  3EWL A;  1FHE A;  2YZU A;  5ID2 B;  2VLU A;  1BX9 A;  2WZ9 A;  3C73 A;  3EU4 A;  4FYB A;  4GST A;  1XW9 A;  3IPZ A;  3HJO A;  8GSS A;  3ZIT A;  2A4H A;  1K0B A;  2PMT A;  3LSZ A;  4GF0 A;  2CT6 A;  2D2Z A;  5LNK e;  2GZZ A;  3GX0 A;  3CSH A;  1Z5Y E;  4MZB A;  2Z9S A;  1V98 A;  1W4V A;  3HVX A;  5INY A;  1YQ1 A;  1IYI A;  2WRT A;  5AN1 A;  1URM A;  3VWX A;  5ECP B;  4OCF A;  4TXO A;  3PR8 A;  3FRC A;  1SKS B;  5EVO A;  2OE3 A;  4XS4 B;  2QKE A;  4YKG A;  2VCV A;  1YJ6 A;  2WB9 A;  3GUR A;  1K0D A;  2HYX A;  1YZX A;  4EL1 A;  2HZF A;  3ZFL A;  1TKD B;  1OKD A;  4RQR A;  3QDN A;  1N8J A;  2H6Y A;  2FA4 A;  5ECR B;  3DKS A;  4K0N A;  3KXO A;  3MWH A;  3J7Y k;  4IQ1 A;  6GSV A;  4ML1 A;  4D73 A;  3APO A;  1A23 A;  2FWH A;  2GVP A;  5DAL B;  2FNO A;  5IMF A;  5G2Z A;  3HVN A;  4EDY A;  4MPF A;  3GKM A;  2FWF A;  4RI7 A;  3KH9 A;  1QFN A;  1OC9 B;  1SD8 A;  2YV9 A;  2OKA A;  3F6F A;  5BMU A;  4KX4 A;  3GKN A;  5KN0 A;  1NW2 A;  1QGV A;  4KB3 A;  1G7O A;  1XXU A;  3A2V A;  3GMF A;  4AJ7 A;  4BVY A;  1RK4 A;  3LW9 A;  3ME8 A;  3TRQ A;  3TKQ A;  3TJJ A;  1XWK A;  2BTO T;  1SK1 A;  1EV4 A;  6GSX A;  1ZL9 A;  3QAW A;  2K8V A;  3E3E A;  1XWG A;  2VCW A;  4RQX A;  3FZ5 A;  2OA7 A;  2C3Q A;  4BL7 A;  2L59 A;  2TRC P;  2VO4 A;  4KDX A;  5IIZ A;  2FWG A;  1WPI A;  2DKH A;  1R26 A;  4I6X A;  5CRW A;  4K1F A;  3PIN A;  2DSA A;  13GS A;  3JCM L;  2LTK A;  2OJL A;  4ZB6 A;  2HSH A;  4IGJ A;  2RM6 A;  5EY6 A;  2R0G A;  3U5R E;  4FIW A;  3L9V A;  4V1A p;  3PGT A;  1PN9 A;  5IMV A;  4ML6 A;  1G7E A;  4NHZ A;  3D4T A;  1TJD A;  1YEX A;  3UVT A;  2B3S A;  5AIS A;  2I9H A;  4XS1 A;  1TW9 A;  2P0G A;  3D6I A;  3HVS A;  4TKY A;  1ABA A;  5D9W A;  2HFD A;  2R4V A;  1PKZ A;  2YJ7 A;  3KJY A;  3E9J B;  5IPG A;  1SL1 B;  3BOA A;  1FAA A;  3FW2 A;  3HY2 A;  1OE7 A;  4L0U A;  4AJ6 A;  1XOB A;  1GRX A;  2LJK A;  3LEF A;  4V2M A;  1AAZ A;  2LRT A;  1M2B A;  4AJ8 A;  3V1W A;  2H0I A;  1KTE A;  3GA4 A;  4HUA A;  3IC4 A;  1TU8 A;  4FQU A;  4ULX A;  5IMC A;  3ZVJ A;  1DBY A;  1GTI A;  4HU9 A;  4F82 A;  4PX1 A;  1JFU A;  1GL8 A;  4WBJ A;  11GS A;  19GS A;  3ZVJ D;  3W8S A;  1UA5 A;  4WR4 A;  3TRX A;  4MH3 A;  3HHV A;  1HNB A;  4O7H A;  3IBH A;  1BG5 A;  2DIY A;  2H76 A;  3LJR A;  12GS A;  3H8Q A;  1VF1 A;  1KNG A;  4G0I A;  2DJK A;  1SKR B;  3KCM A;  3LXZ A;  1ZZY A;  1T4Y A;  6GSS A;  1VRS D;  3FKF A;  4Z2R A;  2IFQ B;  5CRH A;  4WKW A;  2H19 A;  4BIK A;  3LYK A;  2CZ2 A;  2IL3 A;  3CQF A;  2F51 A;  4N10 A;  3VK9 A;  2PBJ A;  5ECL B;  1XPV A;  4PQI A;  1XW6 A;  1O8W A;  2A2P A;  2LJR A;  2PU9 C;  1MD4 A;  2H70 A;  5A4W A;  5G30 A;  1THX A;  3UBL A;  5B7C A;  2JSZ A;  2GT5 A;  4PNG A;  1XW5 A;  5IM9 A;  1VGL A;  2GLR A;  5E59 A;  1W89 A;  1M9B A;  2L5L A;  1G6Y A;  3WT2 A;  2K8S A;  2DJJ A;  2JAC A;  4KE3 A;  2R5G A;  4PUR A;  1TK5 B;  1TOF A;  4NXI A;  1XG8 A;  4KA0 A;  4JE1 A;  2R0P A;  3QOU A;  3ZRD A;  3APS A;  1EEJ A;  1PL1 A;  1SU9 A;  5HFI A;  4MK3 A;  4F03 A;  4MJC A;  3HJP A;  17GS A;  5H5Q A;  3TJF A;  2VCT A;  4IEL A;  5DAK A;  1XZO A;  3QFA C;  5F05 A;  4IJI A;  1Z7P A;  4GRF A;  1WE0 A;  2EIO A;  4D73 B;  4G0L A;  4PQ1 A;  4LLR A;  4PUA A;  1TP9 A;  4IBP A;  4MF7 A;  2WFC A;  2X8C A;  3HZ4 A;  4YQM A;  1GP1 A;  4DVC A;  1YEP A;  3N9J A;  3HDC A;  2HT9 A;  2FWE A;  4ZBA A;  4ECJ A;  4LA1 A;  3CTF A;  4EKZ A;  2C3N A;  2YNX A;  4MF5 A;  4HJ2 A;  1X9S B;  3FR6 A;  1XWC A;  1B9Y C;  2DKI A;  2FD3 A;  2J9H A;  3O76 A;  5ECM B;  1V58 A;  1KBN A;  1XOA A;  4N0Z A;  4ZB9 A;  2DC5 A;  5J3R A;  2KUC A;  1G6W A;  3DEX A;  3GL5 A;  5GAN D;  3A5I A;  3UL3 A;  4Z2T A;  2R0C A;  3EUR A;  1PFO A;  1ML6 A;  2LNT A;  1X5E A;  5CRG A;  2J23 A;  1AC1 A;  4BL7 B;  1T7P B;  1A8Y A;  3C7M A;  4XS6 A;  2GGT A;  3CSJ A;  5G31 A;  4FYC A;  2O87 A;  6GSY A;  5B6N A;  1GWC A;  5E4W A;  1V2A A;  1O6J A;  4WF5 A;  1F2E A;  2H1D A;  5D9T A;  3FR9 A;  1MDK A;  1ZYQ B;  5GZZ B;  4E8H A;  1PKW A;  1PRX A;  2H72 A;  4TOP A;  4GTU A;  2CAI A;  2B5Y A;  2TIR A;  4HI7 A;  3O6T A;  3KP9 A;  2H66 A;  4CY6 A;  5CYY A;  3GUS A;  3M3M A;  4DSS A;  1EGO A;  4E8E A;  4L5O A;  3KTL A;  2KHP A;  4K5S A;  1HNA A;  3HXS A;  2C0G A;  1F3B A;  2R2J A;  3I6A A;  2H8L A;  2GZP A;  3GIX A;  3GH6 A;  4MMM A;  3HA9 A;  4KUN A;  1F9M A;  4MPG A;  2B7J A;  2NDO A;  5IMZ A;  1HD2 A;  2O7K A;  3A2X A;  3ZZX A;  2R37 A;  1CQH A;  2N5A A;  4OFN A;  3CRU A;  1GUK A;  1U3A A;  2JU5 A;  5C00 A;  4BWQ A;  2VCQ A;  2HNL A;  3CMI A;  3IOS A;  3KH7 A;  1N2A A;  4POK A;  5J4U A;  1YKC A;  2P31 A;  4TXV A;  1K3L A;  2CX4 A;  2LV3 A;  3TKS C;  4LL1 B;  1Y6E A;  2HXK A;  4CW9 A;  3WT1 A;  3G9B A;  4Z7X A;  3LXT A;  1IYH A;  4EIP A;  2HZE A;  2EIQ A;  3PH9 A;  3BJ5 A;  2H6Z A;  3G7J A;  3EIN A;  2M72 A;  4KCE A;  3TKR A;  3GX8 A;  4JR4 A;  1PX7 A;  2CVK A;  4MLY A;  2B5E A;  2MMO A;  4OFT A;  3RPP A;  3H93 A;  1EWX A;  1NM3 A;  3TKS E;  2N5F A;  3SBC A;  3N5O A;  3QAV A;  2QGV A;  4PQH A;  3BBY A;  2CQ9 A;  2DJ2 A;  2DML A;  4IP1 A;  3GTU A;  1Q98 A;  3D21 A;  3UAR A;  2ZUP A;  1R5P A;  2ES7 A;  5H5S A;  5FT3 A;  2AHE A;  1Q4J A;  5J9B A;  4JR6 A;  1GTU A;  1SJI A;  4NHW A;  3DD3 A;  4JZQ A;  1ILO A;  4YQV A;  3ED3 A;  2MMN A;  4MF6 A;  3IR4 A;  2O8V B;  4K7I A;  3CXG A;  3QPM A;  5DJM A;  4QL9 A;  3A3T A;  1DE1 A;  5BRT A;  1ZGN A;  1EP7 A;  1WWJ A;  6GSU A;  5CRE A;  2HRK A;  4O32 A;  2YV7 A;  4X0X A;  1B4Q A;  1ERW A;  2PN8 A;  2H0H A;  4QL7 A;  3TOT A;  2IN3 A;  2IPA A;  2OBK A;  2MYG A;  1YF0 A;  2TRX A;  3VWV A;  2YWO A;  4K5R A;  2O89 A;  2P5R A;  3EVI A;  2VCZ A;  2PER A;  4JRR A;  2G0F A;  4TVE A;  3VWW A;  1R5A A;  1S3R A;  5IOX A;  2E0Q A;  5DBQ A;  1SL0 B;  3F8U A;  5D96 A;  2KP1 A;  4IVF A;  4ZL8 A;  1GNW A;  5DAK B;  2VL2 C;  2DJ3 A;  1FOH A;  1F3A A;  2V6O A;  3IHQ A;  1H4O A;  4GSN A;  3W8J A;  3C8E A;  4IP6 A;  4KND A;  1JZO A;  1JLV A;  10GS A;  3HKR A;  3H1N A;  1X0R A;  1K3Y A;  1V57 A;  1PX6 A;  2YWM A;  2A4V A;  1TTZ A;  2N5B A;  3IC8 A;  3TGZ A;  1Z6N A;  2GQL A;  1M99 A;  4F2I A;  2VM2 A;  5ECH B;  2WS2 A;  2FA8 A;  4X4J A;  1PSQ A;  1AQW A;  1O7U A;  2C8U A;  4CY8 A;  4Q5R A;  3IV4 A;  3HZ8 A;  3VLN A;  1MDJ A;  2K9F A;  1AW9 A;  1AQX A;  4I5Q A;  3ISO A;  1GSS A;  4TR4 A;  3VWU A;  3CBU A;  3MNG A;  3US3 A;  2MMA A;  3VPQ A;  4O92 A;  4V1A g;  2KOK A;  5L71 A;  4KDY A;  2AV4 A;  2XHF A;  5A4V A;  4K6X A;  1USB A;  2VM1 A;  4TR1 A;  2WGR A;  1A24 A;  2RII A;  3ZL5 A;  1ZYP A;  2JAD A;  3ERW A;  2C1Y A;  1EZK A;  3UJ1 A;  1DUG A;  2FLS A;  4NWY A;  4J2F A;  4GXZ A;  5AGY A;  4K9Z A;  3FMW A;  1K0M A;  4GWR A;  4I97 A;  3GNJ A;  2WJU A;  3UMA A;  1B48 A;  14GS A;  3BCK A;  4GSS A;  1HNC A;  2PVQ A;  2BJX A;  2DMM A;  3IK7 A;  4WXT A;  3F0I A;  4L5L A;  2LQO A;  1O8X A;  1S3C A;  3L4N A;  1O85 A;  1SEN A;  3KZQ A;  5D8I A;  3M0F A;  2IJY A;  4EO3 A;  4FH8 A;  5COH A;  3LOR A;  3UAP A;  4KGI A;  3CYN A;  4K7O A;  1T00 A;  4IKH A;  1RQM A;  4KDU A;  3ZFB A;  3FYG A;  2H1A A;  2F8A A;  2HRF A;  3DWV A;  4XIH A;  5D73 A;  3IA1 A;  2NTO A;  2WCI A;  4MNN A;  2X49 A;  4TRX A;  1M3J A;  2CA8 A;  3WGD A;  5A5K A;  4GQF A;  4LMV A;  2VUP A;  2KP2 A;  4MJB A;  4XRD A;  1XBS A;  3TB2 A;  1H75 A;  3APQ A;  2REM A;  3E0U A;  4F9Z A;  4IQA A;  1AUC A;  1O81 A;  3KP8 A;  4H86 A;  5D9V A;  3LGC A;  5G5E A;  3BD2 A;  4V2N A;  2YOI A;  2OAC A;  2X99 A;  5B8B A;  5KOX A;  4NPB A;  2B6M A;  4ECI A;  3H79 A;  2VD0 A;  4GLT A;  5IO2 A;  5CP1 A;  4BVX A;  5B6M A;  4YAV A;  1J9B A;  4N30 A;  3DGQ A;  3WD6 A;  4XTS A;  1XCC A;  4HZ2 A;  2RUF A;  1MDI A;  3QCP A;  4V2L A;  4HEA 2;  1ZYE A;  3W6G A;  3LQ7 A;  5KN3 A;  4HDE A;  4TXO B;  1FO5 A;  1SL2 B;  2JZR A;  2UZ8 A;  2AAW A;  1WP0 A;  5J5N A;  4HSC X;  4L8E A;  1WRY A;  3UOM A;  2I4A A;  1K0O A;  2LQQ A;  3L9S A;  4G2E A;  2GSR A;  2WUL A;  2GSS A;  1OYJ A;  3ZRE A;  1A2J A;  2AYT A;  3F4T A;  1T1V A;  3TJB A;  4EE0 A;  1TK0 B;  1Z9H A;  2DJ1 A;  1THO A;  2CZ3 A;  2YWI A;  1WMJ A;  3CSI A;  5DAL A;  2EC4 A;  1EP8 A;  1TI1 A;  2MBT A;  3J7Y b;  4X1U A;  4PTS A;  5C04 A;  1G0T A;  3QR6 A;  1AXD A;  4NV2 A;  2RUE A;  2VLV A;  4JBB A;  5EPF A;  1GSE A;  4AF2 A;  1OC9 A;  2XPD A;  3I69 A;  5LCZ A;  1JLW A;  4ZIJ A;  4KF9 A;  1BAY A;  3L9U A;  3H4K A;  4RUV A;  1RW1 A;  2ZNM A;  1SK2 A;  4BPY A;  3LG6 A;  1S3A A;  1ERV A;  3ZIV A;  2YCD A;  3KMN A;  1T8E B;  2DIZ A;  1MTC A;  3LFL A;  22GS A;  1PQN A;  3GL3 A;  5KN1 A;  2IMK A;  4ZBD A;  2I1U A;  3GH9 A;  4BVY B;  1X9W B;  3R2Q A;  5IMD A;  1U6T A;  2H0G A;  3VFI A;  1Y25 A;  2HSM A;  3RDW A;  2H71 A;  2QSI A;  3OR5 A;  3D4M A;  3L0H A;  3EPT A;  6GSW A;  4G0K A;  2V1M A;  3ZMK A;  3KIJ A;  4NAX A;  2E7P A;  4MA9 A;  2L4C A;  1ST9 A;  5GSS A;  1ZCP A;  1B4P A;  2LRC A;  3EC3 A;  3IRA A;  2GZY A;  2MBS A;  2R3X A;  4OMV A;  3F3Q A;  4ECC A;  4QQ7 A;  1HYU A;  5JCU A;  4O5Q A;  3G7Y A;  5G1L A;  3IAM 2;  2PGT A;  1PGT A;  2MMZ A;  5DQY A;  2V41 A;  3FK8 A;  3NOF A;  3M9K A;  3KD0 A;  4IW9 A; 
#chains in the Genus database with same CATH homology
 1FVJ A;  1XFL A;  1M0U A;  2FGX A;  5DJL A;  2L5O A;  4K2D A;  2K18 A;  3GKX A;  3HJM A;  2LKU A;  1U3I A;  1ERU A;  3IAS 2;  1QXH A;  2GT6 A;  1M2D A;  1ERT A;  2PWJ A;  1GSY A;  5A4U A;  1E2Y A;  5ELA A;  5CO3 A;  1HQO A;  2QA2 A;  2L57 A;  5ABR A;  1QK8 A;  1BJX A;  3ERG A;  4POM A;  3HD5 A;  5HFK A;  3MIX A;  5IQY A;  1YKA A;  1WOU A;  2DJ0 A;  2OBI A;  3FHK A;  4ZXG A;  4DSQ A;  4HS1 A;  3GST A;  3CTG A;  1UN2 A;  4Q5F A;  4Q5N A;  2PVO C;  2P5Q A;  2MZC A;  3UBK A;  3ZYW A;  1OC3 A;  3VI5 A;  2R6K A;  4PUF C;  3TCO A;  4EDZ A;  1UVZ A;  1LBK A;  4XRA A;  4USS A;  2AB6 A;  5B8A A;  4OFM A;  4YAP A;  1AIU A;  1VF3 A;  1TU7 A;  1A2L A;  3G7I A;  3M9J A;  2LRN A;  2LUS A;  4ZBB A;  1K0N A;  1DSB A;  5IPH A;  3K8N A;  3L78 A;  4FYU A;  3EU3 A;  4LMW A;  3P7X A;  4PNF A;  1SYR A;  3FZ9 A;  1J0F A;  2H75 A;  5F07 A;  2H1G A;  4K7N A;  1NSW A;  4MJA A;  3C1R A;  4DSR A;  1K0C A;  3NIV A;  1PMT A;  4POB A;  3Q74 A;  3TUE A;  3FEU A;  2HRN A;  2L6C A;  4IN0 A;  1X9M B;  3QD9 A;  2LEG A;  5HR3 A;  6GST A;  4LL4 B;  3PPU A;  5GAP D;  4FO5 A;  5ECN B;  4PXO A;  1TXX A;  3MYD A;  1GTA A;  4XCS A;  1B8X A;  1GSQ A;  2LST A;  4ZIL A;  3EMX A;  3F9U A;  4BVX B;  2VOC A;  3GHA A;  1TDI A;  1YY7 A;  4KCA A;  4EXJ A;  4TW5 A;  2FUG 2;  4MZC A;  3ME7 A;  1TRU A;  2YZH A;  1EV9 A;  4G9H A;  1WJK A;  4ICY A;  2PUK C;  1K3O A;  2GSQ A;  2O85 A;  5EL8 A;  4K8M A;  2IIY A;  1AQV A;  5D9X A;  3RHC A;  3BCI A;  4OO4 A;  4HZ4 A;  2F9S A;  4NV5 A;  3VI7 A;  3TDG A;  4ZL7 A;  1A0R P;  2HSY A;  5F0G A;  3F4R A;  2CVD A;  5GST A;  1WIK A;  5ECI B;  5ECS A;  2I81 A;  4IJ3 A;  1T3B A;  1SYX A;  2IME A;  2QC7 A;  3GYK A;  2B7K A;  2AJQ B;  4J57 E;  1PN0 A;  1GLP A;  3HVV A;  1GSD A;  1FOV A;  1TI3 A;  1ON4 A;  2H01 A;  3DYR A;  2H73 A;  3U6V A;  2OE0 A;  3S9F A;  2C80 A;  2YJH A;  3UEM A;  3GV1 A;  2FCH A;  1GUL A;  4TR0 A;  2FY6 A;  1JHB A;  2B1K A;  4GCI A;  2DBC A;  3A2W A;  4ACS A;  2HE3 A;  3FR3 A;  1U88 A;  3WGX A;  3GN3 A;  2CX3 A;  2H6X A;  5FWG A;  2E2M A;  4I2T A;  5D93 A;  1TRS A;  1GLQ A;  2V2G A;  3EMP A;  1ZMA A;  1EOG A;  2CAQ A;  5IMA A;  1FB6 A;  1XWB A;  2H1B A;  1UC7 A;  4KW6 A;  4MDC A;  1C72 A;  5AIX A;  5KOW A;  3TJG A;  4Z2U A;  1ACV A;  5J41 A;  5KEJ A;  4PGT A;  3MDK A;  1PD2 1;  2VIM A;  4KSM A;  3WYW A;  1Z3E A;  1I9D A;  5ECK B;  7GSS A;  2YAN A;  1A8L A;  2WDU A;  2NBS A;  4KSO A;  3FZ4 A;  4BA7 A;  1TK8 B;  1O73 A;  1FW1 A;  3IDV A;  1FB0 A;  2V6K A;  4J56 E;  2JZS A;  5CNW A;  2ON5 A;  1EOH A;  3DRN A;  1QMV A;  3O3T A;  4DSS B;  3VPT A;  3KEB A;  3ZML A;  2BMX A;  1M7T A;  2NPB A;  5HR1 A;  3C71 A;  2YP6 A;  5CAX A;  2FHE A;  4IS0 A;  2CVB A;  3RAZ A;  1OE8 A;  3EE2 A;  3DVX A;  3LYP A;  4G19 A;  4WET A;  2C0D A;  4O5U A;  1S3D A;  3HYP A;  3GKK A;  4HQZ A;  2VL3 A;  3P90 A;  2VL9 A;  3LWA A;  2M80 A;  3KGK A;  1PL2 A;  5HR2 A;  2VAF A;  1XWA A;  1OKT A;  1GNE A;  1LJR A;  4OWY A;  3UIW A;  9GSS A;  3C1S A;  1BED A;  4WF4 A;  3IE3 A;  5DDL A;  1GTB A;  4HOJ A;  2XPE A;  2X8G A;  2RM5 A;  2I3Y A;  4XHM A;  2F3M A;  3TKP A;  2JSY A;  4N0V A;  5HFG A;  4RI6 A;  2HZE B;  3Q18 A;  16GS A;  4YH2 A;  5ID2 A;  1YDK A;  2IMI A;  4BWS A;  1JZR A;  4ILF A;  4K0G A;  3FY7 A;  2C4J A;  2GDR A;  1I5G A;  3KMO A;  1R4W A;  4WEY A;  1M2A A;  2IWT A;  1K0A A;  3QMX A;  3MSZ A;  4KH7 A;  3D5J A;  4JU5 A;  1KEB A;  3RHB A;  2OAD A;  1BYE A;  2ZCT A;  3IK9 A;  1GSU A;  3WGE A;  3UVH A;  2KLX A;  1FG4 A;  3P2A A;  4NMU A;  2XC2 A;  1LU4 A;  3Q19 A;  5F8B A;  4KAE A;  2C3T A;  2CV4 A;  3TKS A;  3GTU B;  4TR3 A;  5DCH A;  1F6M C;  4CHS A;  1PA3 A;  4EVM A;  1EGR A;  2V32 A;  4XS4 A;  3NZN A;  2G2Q A;  2RLI A;  4CDO A;  1X5C A;  18GS A;  5JCW A;  20GS A;  3DXB A;  2VCX A;  1JZD A;  1GH2 A;  4ECB A;  3M8N A;  2H74 A;  2NVL A;  1XIY A;  1SKW B;  4MZW A;  4HQS A;  1GSF A;  2HRA A;  5IO0 A;  2K6V A;  2ON7 A;  3F3R A;  3AY8 A;  1YF1 A;  1T4Z A;  2XBQ A;  5DCG A;  2E2G A;  5IOW A;  1DE2 A;  1E6B A;  3DVW A;  5HR0 A;  2HI7 A;  1BQ7 A;  2A2S A;  5AIV A;  5JWQ B;  1NHY A;  5CRD A;  4ISD A;  4HU7 A;  2GQK A;  4N11 A;  4WBR D;  3ZIJ A;  2L6D A;  1JZW A;  2IMD A;  2PPT A;  4Q5Q A;  3TRP A;  1A0F A;  2GQM A;  4O5R A;  2C0F A;  3TOU A;  2B1L A;  1J08 A;  3QAG A;  2JZT A;  4HJM A;  3I9V 2;  4A5P A;  2LJA A;  2JL4 A;  4L0W A;  4AGS A;  3VUR A;  4EUY A;  2B5X A;  4K2X A;  5KN2 A;  5ECO B;  3IHG A;  1SK0 A;  2GS3 A;  5H5R A;  3P8W A;  1ZOF A;  3ZLP A;  5F06 A;  4ID0 A;  4WR5 A;  2H30 A;  5DQS A;  4I8B A;  1F37 A;  3FZA A;  3DIE A;  4I2U A;  1OC8 A;  1B9X C;  3QFB C;  1M9A A;  2A2R A;  2ALB A;  4GQC A;  4ZL9 A;  1EEM A;  1SD9 A;  2GST A;  4OD7 A;  2VL2 A;  1VF2 A;  1MEK A;  1VF4 A;  2LNS A;  1FVK A;  1V40 A;  5G5F A;  3EYT A;  2LS5 A;  1GUH A;  1QQ2 A;  2L4Q A;  2VD1 A;  3CRT A;  3M1G A;  4EF0 A;  2X64 A;  3F63 A;  1SJZ A;  4F0C A;  1SJ6 A;  5G1K A;  3Q6O A;  2F8F A;  3ZTL A;  4OCE A;  1R7H A;  5JCG A;  3ERF A;  4MJE A;  3RBT A;  3R3E A;  2AUV A;  1MD3 A;  3I43 A;  3TJK A;  2QA1 A;  4TR1 B;  2YWN A;  5HQP A;  2X4A A;  3KM6 A;  4X43 A;  5JWO B;  1OVN A;  5ELG A;  3GSS A;  2C0E A;  3RPN A;  3GRX A;  4TN8 A;  2XBI A;  4JED A;  5JWR B;  1ZYN A;  4MH2 A;  4P3Y B;  5FHI A;  1CQG A;  4EC0 A;  4IHU A;  3D0Z A;  1TRV A;  1Z7R A;  2M46 A;  5ECQ B;  3DML A;  1OAZ A;  4POL A;  1NHO A;  4YQU A;  4MCU A;  1XVW A;  3F4S A;  1GUM A;  5LD0 A;  5ENU A;  3D22 A;  2GTU A;  4ZB8 A;  3F6D A;  1Z6M A;  1XVQ A;  1U87 A;  5J9C A;  4MAB A;  3IXR A;  1A2M A;  2EIR A;  2YN1 A;  5DVB A;  1TRW A;  4OO5 A;  1X5D A;  3KTB A;  3GFK A;  4EIQ A;  2HLS A;  4YKF A;  3HCZ A;  2YPM A;  2OE1 A;  3A5W A;  4MP4 A;  4DEJ A;  1V9W A;  3MAK A;  2DLX A;  2IMF A;  2X8H A;  4G10 A;  2IFQ A;  3SWL A;  1QUW A;  4F0B A;  2VLT A;  3EWL A;  1FHE A;  2YZU A;  5ID2 B;  2VLU A;  1BX9 A;  2WZ9 A;  3C73 A;  3EU4 A;  4FYB A;  4GST A;  1XW9 A;  3IPZ A;  3HJO A;  8GSS A;  3ZIT A;  2A4H A;  1K0B A;  2PMT A;  3LSZ A;  4GF0 A;  2CT6 A;  2D2Z A;  5LNK e;  2GZZ A;  3GX0 A;  3CSH A;  1Z5Y E;  4MZB A;  2Z9S A;  1V98 A;  1W4V A;  3HVX A;  5INY A;  1YQ1 A;  1IYI A;  2WRT A;  5AN1 A;  1URM A;  3VWX A;  5ECP B;  4OCF A;  4TXO A;  3PR8 A;  3FRC A;  1SKS B;  5EVO A;  2OE3 A;  4XS4 B;  2QKE A;  4YKG A;  2VCV A;  1YJ6 A;  2WB9 A;  3GUR A;  1K0D A;  2HYX A;  1YZX A;  4EL1 A;  2HZF A;  3ZFL A;  1TKD B;  1OKD A;  4RQR A;  3QDN A;  1N8J A;  2H6Y A;  2FA4 A;  5ECR B;  3DKS A;  4K0N A;  3KXO A;  3MWH A;  3J7Y k;  4IQ1 A;  6GSV A;  4ML1 A;  4D73 A;  3APO A;  1A23 A;  2FWH A;  2GVP A;  5DAL B;  2FNO A;  5IMF A;  5G2Z A;  4EDY A;  4MPF A;  3GKM A;  2FWF A;  4RI7 A;  3KH9 A;  1QFN A;  1OC9 B;  1SD8 A;  2YV9 A;  2OKA A;  3F6F A;  5BMU A;  4KX4 A;  3GKN A;  5KN0 A;  1NW2 A;  1QGV A;  4KB3 A;  1G7O A;  1XXU A;  3A2V A;  3GMF A;  4AJ7 A;  4BVY A;  1RK4 A;  3LW9 A;  3ME8 A;  3TRQ A;  3TKQ A;  3TJJ A;  1XWK A;  2BTO T;  1SK1 A;  1EV4 A;  6GSX A;  1ZL9 A;  3QAW A;  2K8V A;  3E3E A;  1XWG A;  2VCW A;  4RQX A;  3FZ5 A;  2OA7 A;  2C3Q A;  4BL7 A;  2L59 A;  2TRC P;  2VO4 A;  4KDX A;  5IIZ A;  2FWG A;  1WPI A;  2DKH A;  1R26 A;  4I6X A;  5CRW A;  4K1F A;  3PIN A;  2DSA A;  13GS A;  3JCM L;  2LTK A;  2OJL A;  4ZB6 A;  2HSH A;  4IGJ A;  2RM6 A;  5EY6 A;  2R0G A;  3U5R E;  4FIW A;  3L9V A;  4V1A p;  3PGT A;  1PN9 A;  5IMV A;  4ML6 A;  1G7E A;  4NHZ A;  3D4T A;  1TJD A;  1YEX A;  3UVT A;  2B3S A;  5AIS A;  2I9H A;  4XS1 A;  1TW9 A;  2P0G A;  3D6I A;  3HVS A;  4TKY A;  1ABA A;  5D9W A;  2HFD A;  2R4V A;  1PKZ A;  2YJ7 A;  3KJY A;  3E9J B;  5IPG A;  1SL1 B;  3BOA A;  1FAA A;  3FW2 A;  3HY2 A;  1OE7 A;  4L0U A;  4AJ6 A;  1XOB A;  1GRX A;  2LJK A;  3LEF A;  4V2M A;  1AAZ A;  2LRT A;  1M2B A;  4AJ8 A;  3V1W A;  2H0I A;  1KTE A;  3GA4 A;  4HUA A;  3IC4 A;  1TU8 A;  4FQU A;  4ULX A;  5IMC A;  3ZVJ A;  1DBY A;  1GTI A;  4HU9 A;  4F82 A;  4PX1 A;  1JFU A;  1GL8 A;  4WBJ A;  11GS A;  19GS A;  3ZVJ D;  3W8S A;  1UA5 A;  4WR4 A;  3TRX A;  4MH3 A;  3HHV A;  1HNB A;  4O7H A;  3IBH A;  1BG5 A;  2DIY A;  2H76 A;  3LJR A;  12GS A;  3H8Q A;  1VF1 A;  1KNG A;  4G0I A;  2DJK A;  1SKR B;  3KCM A;  3LXZ A;  1ZZY A;  1T4Y A;  6GSS A;  1VRS D;  3FKF A;  4Z2R A;  2IFQ B;  5CRH A;  4WKW A;  2H19 A;  3LYK A;  2CZ2 A;  2IL3 A;  4N10 A;  2F51 A;  3VK9 A;  2PBJ A;  5ECL B;  1XPV A;  4PQI A;  1XW6 A;  1O8W A;  2A2P A;  2LJR A;  2PU9 C;  1MD4 A;  2H70 A;  5A4W A;  5G30 A;  1THX A;  3UBL A;  5B7C A;  2JSZ A;  2GT5 A;  4PNG A;  1XW5 A;  5IM9 A;  1VGL A;  2GLR A;  5E59 A;  1W89 A;  1M9B A;  2L5L A;  1G6Y A;  3WT2 A;  2K8S A;  2DJJ A;  2JAC A;  4KE3 A;  2R5G A;  4PUR A;  1TK5 B;  1TOF A;  4NXI A;  4KA0 A;  4JE1 A;  2R0P A;  3QOU A;  3ZRD A;  3APS A;  1EEJ A;  1PL1 A;  1SU9 A;  5HFI A;  4MK3 A;  4F03 A;  4MJC A;  3HJP A;  17GS A;  5H5Q A;  3TJF A;  2VCT A;  4IEL A;  5DAK A;  1XZO A;  3QFA C;  5F05 A;  4IJI A;  1Z7P A;  4GRF A;  1WE0 A;  2EIO A;  4D73 B;  4G0L A;  4PQ1 A;  4LLR A;  4PUA A;  1TP9 A;  4IBP A;  4MF7 A;  2WFC A;  2X8C A;  3HZ4 A;  4YQM A;  1GP1 A;  4DVC A;  1YEP A;  3N9J A;  3HDC A;  2HT9 A;  2FWE A;  4ZBA A;  4ECJ A;  4LA1 A;  3CTF A;  4EKZ A;  2C3N A;  2YNX A;  4MF5 A;  4HJ2 A;  1X9S B;  3FR6 A;  1XWC A;  1B9Y C;  2DKI A;  2FD3 A;  2J9H A;  3O76 A;  5ECM B;  1V58 A;  1KBN A;  1XOA A;  4N0Z A;  4ZB9 A;  2DC5 A;  5J3R A;  2KUC A;  1G6W A;  3DEX A;  3GL5 A;  5GAN D;  3A5I A;  3UL3 A;  4Z2T A;  2R0C A;  3EUR A;  1ML6 A;  2LNT A;  1X5E A;  5CRG A;  2J23 A;  1AC1 A;  4BL7 B;  1T7P B;  1A8Y A;  3C7M A;  4XS6 A;  2GGT A;  3CSJ A;  5G31 A;  4FYC A;  2O87 A;  6GSY A;  5B6N A;  1GWC A;  5E4W A;  1V2A A;  1O6J A;  4WF5 A;  1F2E A;  2H1D A;  5D9T A;  3FR9 A;  1MDK A;  1ZYQ B;  5GZZ B;  4E8H A;  1PKW A;  1PRX A;  2H72 A;  4TOP A;  4GTU A;  2CAI A;  2B5Y A;  2TIR A;  4HI7 A;  3O6T A;  3KP9 A;  2H66 A;  4CY6 A;  5CYY A;  3GUS A;  3M3M A;  4DSS A;  1EGO A;  4E8E A;  4L5O A;  3KTL A;  2KHP A;  4K5S A;  1HNA A;  3HXS A;  2C0G A;  1F3B A;  2R2J A;  3I6A A;  2H8L A;  2GZP A;  3GIX A;  3GH6 A;  4MMM A;  3HA9 A;  4KUN A;  1F9M A;  4MPG A;  2B7J A;  2NDO A;  5IMZ A;  1HD2 A;  2O7K A;  3A2X A;  3ZZX A;  2R37 A;  1CQH A;  2N5A A;  4OFN A;  3CRU A;  1GUK A;  1U3A A;  2JU5 A;  5C00 A;  4BWQ A;  2VCQ A;  2HNL A;  3CMI A;  3IOS A;  3KH7 A;  1N2A A;  4POK A;  5J4U A;  1YKC A;  2P31 A;  4TXV A;  1K3L A;  2CX4 A;  2LV3 A;  3TKS C;  4LL1 B;  1Y6E A;  2HXK A;  4CW9 A;  3WT1 A;  3G9B A;  4Z7X A;  3LXT A;  1IYH A;  4EIP A;  2HZE A;  2EIQ A;  3PH9 A;  3BJ5 A;  2H6Z A;  3G7J A;  3EIN A;  2M72 A;  4KCE A;  3TKR A;  3GX8 A;  4JR4 A;  1PX7 A;  2CVK A;  4MLY A;  2B5E A;  2MMO A;  4OFT A;  3RPP A;  3H93 A;  1EWX A;  1NM3 A;  3TKS E;  2N5F A;  3SBC A;  3N5O A;  3QAV A;  2QGV A;  4PQH A;  3BBY A;  2CQ9 A;  2DJ2 A;  2DML A;  4IP1 A;  3GTU A;  1Q98 A;  3D21 A;  3UAR A;  2ZUP A;  1R5P A;  2ES7 A;  5H5S A;  5FT3 A;  2AHE A;  1Q4J A;  5J9B A;  4JR6 A;  1GTU A;  1SJI A;  4NHW A;  3DD3 A;  4JZQ A;  1ILO A;  4YQV A;  3ED3 A;  2MMN A;  4MF6 A;  3IR4 A;  2O8V B;  4K7I A;  3CXG A;  3QPM A;  5DJM A;  4QL9 A;  3A3T A;  1DE1 A;  5BRT A;  1ZGN A;  1EP7 A;  1WWJ A;  6GSU A;  5CRE A;  2HRK A;  4O32 A;  2YV7 A;  4X0X A;  1B4Q A;  1ERW A;  2PN8 A;  2H0H A;  4QL7 A;  3TOT A;  2IN3 A;  2IPA A;  2OBK A;  2MYG A;  1YF0 A;  2TRX A;  3VWV A;  2YWO A;  4K5R A;  2O89 A;  2P5R A;  3EVI A;  2VCZ A;  2PER A;  4JRR A;  2G0F A;  4TVE A;  3VWW A;  1R5A A;  5IOX A;  2E0Q A;  5DBQ A;  1SL0 B;  3F8U A;  5D96 A;  2KP1 A;  4IVF A;  4ZL8 A;  1GNW A;  5DAK B;  2VL2 C;  2DJ3 A;  1FOH A;  1F3A A;  2V6O A;  3IHQ A;  1H4O A;  4GSN A;  3W8J A;  3C8E A;  4IP6 A;  4KND A;  1JZO A;  1JLV A;  10GS A;  3HKR A;  3H1N A;  1X0R A;  1K3Y A;  1V57 A;  1PX6 A;  2YWM A;  2A4V A;  1TTZ A;  2N5B A;  3IC8 A;  3TGZ A;  1Z6N A;  2GQL A;  1M99 A;  4F2I A;  2VM2 A;  5ECH B;  2WS2 A;  2FA8 A;  4X4J A;  1PSQ A;  1AQW A;  1O7U A;  2C8U A;  4CY8 A;  4Q5R A;  3IV4 A;  3HZ8 A;  3VLN A;  1MDJ A;  2K9F A;  1AW9 A;  1AQX A;  4I5Q A;  3ISO A;  1GSS A;  4TR4 A;  3VWU A;  3CBU A;  3MNG A;  3US3 A;  2MMA A;  3VPQ A;  4O92 A;  4V1A g;  2KOK A;  5L71 A;  4KDY A;  2AV4 A;  2XHF A;  5A4V A;  4K6X A;  1USB A;  2VM1 A;  4TR1 A;  2WGR A;  1A24 A;  2RII A;  3ZL5 A;  1ZYP A;  2JAD A;  3ERW A;  2C1Y A;  1EZK A;  3UJ1 A;  1DUG A;  2FLS A;  4NWY A;  4J2F A;  4GXZ A;  5AGY A;  4K9Z A;  3FMW A;  1K0M A;  4GWR A;  4I97 A;  3GNJ A;  2WJU A;  3UMA A;  1B48 A;  14GS A;  3BCK A;  4GSS A;  1HNC A;  2PVQ A;  2BJX A;  2DMM A;  3IK7 A;  4WXT A;  3F0I A;  4L5L A;  2LQO A;  1O8X A;  1S3C A;  3L4N A;  1O85 A;  1SEN A;  3KZQ A;  5D8I A;  3M0F A;  2IJY A;  4EO3 A;  4FH8 A;  5COH A;  3LOR A;  3UAP A;  4KGI A;  3CYN A;  4K7O A;  1T00 A;  4IKH A;  1RQM A;  4KDU A;  3ZFB A;  3FYG A;  2H1A A;  2F8A A;  2HRF A;  3DWV A;  4XIH A;  5D73 A;  3IA1 A;  2NTO A;  2WCI A;  4MNN A;  2X49 A;  4TRX A;  2CA8 A;  3WGD A;  5A5K A;  4GQF A;  4LMV A;  2VUP A;  2KP2 A;  4MJB A;  4XRD A;  1XBS A;  3TB2 A;  1H75 A;  3APQ A;  2REM A;  3E0U A;  4F9Z A;  4IQA A;  1AUC A;  1O81 A;  3KP8 A;  4H86 A;  5D9V A;  3LGC A;  5G5E A;  3BD2 A;  4V2N A;  2YOI A;  2OAC A;  2X99 A;  5B8B A;  5KOX A;  4NPB A;  2B6M A;  4ECI A;  3H79 A;  2VD0 A;  4GLT A;  5IO2 A;  5CP1 A;  4BVX A;  5B6M A;  4YAV A;  1J9B A;  4N30 A;  3DGQ A;  3WD6 A;  4XTS A;  1XCC A;  4HZ2 A;  2RUF A;  1MDI A;  3QCP A;  4V2L A;  4HEA 2;  1ZYE A;  3W6G A;  3LQ7 A;  5KN3 A;  4HDE A;  4TXO B;  1FO5 A;  1SL2 B;  2JZR A;  2UZ8 A;  2AAW A;  1WP0 A;  5J5N A;  4L8E A;  1WRY A;  3UOM A;  2I4A A;  1K0O A;  2LQQ A;  3L9S A;  4G2E A;  2GSR A;  2WUL A;  2GSS A;  1OYJ A;  3ZRE A;  1A2J A;  2AYT A;  3F4T A;  1T1V A;  3TJB A;  4EE0 A;  1TK0 B;  1Z9H A;  2DJ1 A;  1THO A;  2CZ3 A;  2YWI A;  1WMJ A;  3CSI A;  5DAL A;  2EC4 A;  1EP8 A;  1TI1 A;  2MBT A;  3J7Y b;  4X1U A;  4PTS A;  5C04 A;  1G0T A;  3QR6 A;  1AXD A;  4NV2 A;  2RUE A;  2VLV A;  4JBB A;  5EPF A;  1GSE A;  4AF2 A;  1OC9 A;  2XPD A;  3I69 A;  5LCZ A;  1JLW A;  4ZIJ A;  4KF9 A;  1BAY A;  3L9U A;  3H4K A;  4RUV A;  1RW1 A;  2ZNM A;  1SK2 A;  4BPY A;  3LG6 A;  1S3A A;  1ERV A;  3ZIV A;  2YCD A;  3KMN A;  1T8E B;  2DIZ A;  1MTC A;  3LFL A;  22GS A;  1PQN A;  3GL3 A;  5KN1 A;  2IMK A;  4ZBD A;  2I1U A;  3GH9 A;  4BVY B;  1X9W B;  3R2Q A;  5IMD A;  1U6T A;  2H0G A;  3VFI A;  1Y25 A;  2HSM A;  3RDW A;  2H71 A;  2QSI A;  3OR5 A;  3D4M A;  3L0H A;  3EPT A;  6GSW A;  4G0K A;  2V1M A;  3ZMK A;  3KIJ A;  4NAX A;  2E7P A;  4MA9 A;  2L4C A;  1ST9 A;  5GSS A;  1ZCP A;  1B4P A;  2LRC A;  3EC3 A;  3IRA A;  2GZY A;  2MBS A;  2R3X A;  4OMV A;  3F3Q A;  4ECC A;  4QQ7 A;  1HYU A;  5JCU A;  4O5Q A;  3G7Y A;  5G1L A;  3IAM 2;  2PGT A;  1PGT A;  2MMZ A;  5DQY A;  2V41 A;  3FK8 A;  3NOF A;  3M9K A;  3KD0 A;  4IW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...