2O87A

S. aureus thioredoxin p31s mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
AIVKVTDADFDSKVESGVQLVDFWATWCGSCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin
publication title The conserved active site proline determines the reducing power of Staphylococcus aureus thioredoxin
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 27
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2o87A00
4F2IA 2AV4A 2FHEA 2AUVA 2IIYA 5HR2A 1PA3A 5ECLB 4WBJA 2PU9C 2GSQA 1Z7PA 1YKCA 1XWCA 5HFKA 3FKFA 5F8BA 3IE3A 2HRNA 1B8XA 2VLUA 5F0GA 2K8VA 2PN8A 1WMJA 4IS0A 3UBLA 2H66A 4BVYA 3TJJA 1ZYEA 5DALB 2VO4A 6GSUA 1K3YA 5DAKA 4L5LA 3K8NA 1BX9A 4KSMA 1W4VA 3GSTA 1MDIA 3FW2A 5ECHB 4K9ZA 4BA7A 1OYJA 2OE3A 1K0DA 3A2VA 2DSAA 2FNOA 4IN0A 3UBKA 4ZB8A 5AISA 3L9VA 3IBHA 1THOA 5J3RA 5IO2A 1T00A 1BG5A 4IGJA 3FEUA 3U6VA 2B3SA 5G30A 2PMTA 3HVSA 1QUWA 4X1UA 4DSSB 2V2GA 4EO3A 1MEKA 3UMAA 5CYYA 5D96A 2RIIA 2H0GA 2H6XA 5G31A 2B6MA 3L9UA 3MWHA 5D73A 1E2YA 3VLNA 4BPYA 1SD9A 4K8MA 3QPMA 3EC3A 1TRSA 3FY7A 5COHA 3QFAC 2DJ0A 4TRXA 2CZ3A 5J9CA 5E59A 2XBIA 2QC7A 3IXRA 5A4VA 1O8XA 3KMOA 1K3OA 2DJJA 2C0DA 2VL2C 1SK2A 1J08A 2VCVA 3LXZA 3RPNA 3FR6A 4TR0A 4CW9A 3FRCA 1A8LA 5HQPA 1UN2A 2AAWA 4JBBA 3E3EA 11GSA 2A2SA 5EPFA 1FAAA 5ECRB 3L4NA 2O7KA 2O8VB 5HR1A 2N5FA 4TXOB 2YP6A 4MP4A 3C1SA 1QGVA 3H4KA 2NTOA 4KAEA 4AF2A 3CTGA 1YKAA 3TKPA 4V2NA 2IMFA 1GUMA 2CV4A 4PXOA 22GSA 3QD9A 3EMPA 5KN0A 2GT6A 1SJZA 4TW5A 4POMA 1TK0B 3D0ZA 3HHVA 1GTAA 5ECNB 4JRRA 3VWVA 3MAKA 3GRXA 2H1GA 4LMVA 3SWLA 5GAND 5A4UA 1RQMA 1FOVA 3RBTA 1Z3EA 2H1AA 3TKSC 2WFCA 3UL3A 6GSSA 5J5NA 1EEMA 4X0XA 2MMOA 1FG4A 2VD1A 3ZZXA 3HDCA 3CXGA 2RLIA 3E0UA 2YWIA 3DWVA 2NDOA 4G2EA 1GUKA 2KP2A 2X8HA 3H8QA 1TW9A 4LA1A 1PRXA 1VF1A 4BWSA 4KCAA 3VWUA 1B4QA 2HLSA 4KSOA 1YQ1A 1OE7A 2VCWA 3HJMA 2PUKC 1Z5YE 5IM9A 3ZYWA 3HY2A 5C00A 1V98A 1F2EA 4F9ZA 1N8JA 4TVEA 5HR3A 1SJIA 9GSSA 2IJYA 4N30A 3GH6A 3O3TA 2H01A 1M99A 2CVDA 1I9DA 2F3MA 5CNWA 3C8EA 5KN3A 2WGRA 1ERWA 3KXOA 2OKAA 1EGRA 5J4UA 2P5QA 3M1GA 1TRUA 3U5RE 5IMAA 2MMNA 2WJUA 4DSQA 4PNGA 4LL4B 4TR3A 3EVIA 2CA8A 4KDYA 4MDCA 1XXUA 4F0CA 3J7Yk 4OMVA 4ZL8A 2C3TA 3ZVJA 5IMDA 3P7XA 2X8CA 3DMLA 2H74A 4GSSA 1TOFA 1TK8B 1PSQA 1KNGA 2J9HA 5CREA 1YEPA 1SL0B 3BCKA 2H1BA 4QL9A 4QL7A 1GP1A 2YPMA 1I5GA 2RM5A 3L0HA 1JZRA 3KP9A 3GSSA 3D4TA 1SK1A 4L8EA 3KM6A 3VI7A 1F6MC 2VCZA 2VLTA 2CT6A 1X0RA 4WR4A 3LYPA 1GNWA 3EINA 2YWNA 3TGZA 3VWWA 3V1WA 3G7IA 4GXZA 3WGEA 1MD3A 4EE0A 2B7JA 1DE2A 2X99A 1AXDA 1U87A 3P90A 1B9YC 2FWHA 2ES7A 3LWAA 1KEBA 3CSIA 5DJLA 2OE0A 2C3NA 1AAZA 4ECJA 2AJQB 1ZGNA 3KIJA 4V1Ap 3EMXA 3HCZA 1OKDA 4XRAA 1XW5A 4ILFA 4XCSA 3DKSA 5A4WA 1HD2A 4I5QA 2DJ2A 3C1RA 4MH2A 5DCHA 2B1KA 1PL2A 3UOMA 4EKZA 3TUEA 2R4VA 3LQ7A 4V1Ag 1G0TA 1HNAA 2VAFA 5IPHA 5B8AA 1URMA 2B5YA 5KN1A 5AIXA 2LS5A 2IMDA 3C71A 4EF0A 4XS1A 2X8GA 4JZQA 4K6XA 4N0VA 2MZCA 4OFTA 2DIYA 5FWGA 3IR4A 3EE2A 4O32A 3GUSA 2CZ2A 4PURA 5CO3A 1WIKA 5CRGA 5G5EA 2FA8A 4KA0A 1V40A 1GSDA 3FR3A 2I81A 3WT2A 1BAYA 3WD6A 16GSA 3ZL5A 10GSA 2YJHA 3HVXA 1BJXA 5JCGA 2JADA 4JR4A 4WF5A 1OKTA 2LQOA 1F37A 1XWGA 1AQXA 2I9HA 3EU3A 2OA7A 3M3MA 5IMFA 3ZVJD 2L4CA 2ON5A 5E4WA 1A0RP 1GH2A 4TR1B 1Y6EA 1XCCA 1GSYA 3WGDA 4FYUA 2PERA 3FR9A 4F82A 1G6WA 4EDZA 4AJ6A 1PX6A 3TJKA 2EC4A 13GSA 1Z9HA 2FLSA 2HSYA 3GNJA 5DJMA 2KUCA 2QSIA 5B7CA 2L59A 3ZRDA 2BJXA 3UIWA 4KW6A 14GSA 1WPIA 2GVPA 3LGCA 4IVFA 1U3AA 2YN1A 5ABRA 4IP6A 1A0FA 5EL8A 1XWBA 3G9BA 1QMVA 5HFIA 3TRQA 1T8EB 1TI1A 3GN3A 1WRYA 1GLQA 2PGTA 1JHBA 1JLVA 1OC9A 4J56E 1T1VA 3MDKA 2CVKA 3BD2A 5CRHA 4HU9A 2DMMA 1K0OA 4OD7A 3IDVA 3GKKA 4I6XA 1A2JA 2O87A 2C4JA 1LJRA 4K1FA 1X9MB 1PN9A 4HEA2 4KE3A 2H75A 4WR5A 1GSEA 1NW2A 1O85A 2E7PA 2IWTA 4KGIA 1HNCA 1AQWA 4OCEA 4OWYA 5ENUA 2CAQA 3E9JB 3CYNA 5H5RA 3TRXA 3F4SA 4ECBA 1CQHA 3FYGA 1V58A 4N0ZA 3CSHA 3TKRA 2EIRA 4MJCA 1ILOA 4AGSA 3M8NA 4NV5A 3W8SA 1O7UA 1HQOA 4XS6A 4POKA 2LNSA 5GSSA 3BOAA 3HYPA 3QAGA 2JZSA 5FHIA 1EV4A 5CRWA 3KH7A 4K7OA 2IMIA 4MZWA 2GZPA 2XPDA 1SYRA 2XC2A 4G19A 4JR6A 4ISDA 1GL8A 2LSTA 2B5EA 1ZZYA 1BEDA 2PWJA 5DALA 5JCUA 4POLA 5CP1A 3LORA 2LEGA 4MCUA 2QKEA 5LNKe 3FZ5A 1K0NA 2H1DA 3NIVA 3ME7A 1GSQA 1XWKA 3GKNA 5B6MA 2LQQA 1VRSD 4P3YB 7GSSA 4MF5A 2H0IA 4IP1A 1M9BA 4Z7XA 3DEXA 2VIMA 3DD3A 1OAZA 3KH9A 3A3TA 3CRUA 4ZL7A 5C04A 2C0EA 4YQMA 2YZHA 2K9FA 3C7MA 4TOPA 4TXVA 5ECSA 5DVBA 4JEDA 2VCTA 1EP7A 2R37A 4DSSA 3L9SA 2M80A 1V57A 2HT9A 3HA9A 2YWOA 1HYUA 3IC4A 2WCIA 3RPPA 5IOXA 2K8SA 1C72A 3QAWA 5INYA 2VL3A 1XOAA 1TRWA 4DSRA 2VD0A 3GHAA 3GMFA 4ZB6A 3WGXA 3MNGA 3GX0A 2HZEB 5DQSA 3TJFA 3IOSA 4ECIA 2HNLA 1KTEA 4Q5QA 5LD0A 2LRCA 1B4PA 5D9TA 2GQLA 3C73A 3I69A 4L5OA 4QQ7A 1H75A 1ABAA 2L5LA 4KDXA 1SKWB 1TP9A 2JSZA 4BVXA 4I2TA 1RK4A 2CQ9A 3ZIJA 4PNFA 3GL3A 3QDNA 2FCHA 5ECIB 3SBCA 3PGTA 1OE8A 4I2UA 4TXOA 3CTFA 2TRCP 1EGOA 4H86A 4JE1A 4FIWA 3A5WA 1NHOA 4GSTA 5GAPD 4K0NA 1F9MA 1CQGA 1R5AA 3HZ8A 4WBRD 2ON7A 3FZAA 2YCDA 5CAXA 3F8UA 1F3BA 2ALBA 3TKSE 5EY6A 4EUYA 2OACA 5DBQA 5GSTA 5H5QA 2JZRA 2VCQA 2H30A 5H5SA 3FZ4A 1QK8A 5KN2A 2H76A 4FO5A 4MLYA 2R5GA 2GSRA 3N9JA 3LG6A 1EOGA 1J0FA 3NOFA 3LJRA 2M46A 3ZFBA 1YDKA 2BMXA 4CDOA 2HYXA 2JU5A 1XW9A 4HQZA 1TXXA 2H71A 5ECMB 2YV9A 1R26A 1K0CA 2DLXA 1O8WA 2HRFA 5IMVA 1W89A 1XFLA 2PVQA 2YNXA 3I6AA 5F06A 3A2XA 5IPGA 2LUSA 1QXHA 3VURA 2AYTA 2LJKA 3RHCA 2F8AA 3VPTA 5F05A 1H4OA 1SKSB 3CBUA 1WP0A 2FGXA 4MJAA 1JZDA 3PR8A 3GKMA 3BBYA 2CAIA 4GWRA 1TKDB 2H19A 3GA4A 2IPAA 2DIZA 3HJOA 1NM3A 1Q4JA 4D73B 4KCEA 1K0MA 3GKXA 4XIHA 4GQFA 4RI7A 3IHQA 4EXJA 6GSVA 1OVNA 4IJ3A 2OBIA 5LCZA 4ZXGA 1GULA 2IL3A 3MSZA 3KZQA 4KDUA 2LRTA 4RUVA 2WDUA 4WEYA 2H6ZA 3Q19A 3F3QA 1A8YA 2BTOT 1QFNA 4KNDA 1FHEA 2R3XA 4KH7A 1XOBA 4MABA 1S3AA 1YZXA 3UJ1A 3FK8A 3W6GA 3KMNA 4YAVA 1GTIA 3VK9A 2P31A 4ZL9A 1XVQA 2FY6A 5F07A 1YF1A 4XTSA 1PQNA 3RHBA 3GL5A 2ZNMA 1SL1B 2VOCA 2A2RA 4OCFA 1R4WA 5G1LA 3QFBC 2YWMA 1YJ6A 4HZ4A 1SENA 1VGLA 1SYXA 2FWFA 2PPTA 1ZOFA 5B6NA 2E0QA 3W8JA 2C3QA 4ID0A 3UVHA 3KJYA 3D4MA 4XS4B 2R2JA 3QMXA 3S9FA 1BYEA 4ACSA 2MYGA 4O92A 2D2ZA 4O7HA 1EEJA 2GS3A 1TU8A 2E2MA 1EWXA 1WE0A 2MBSA 1ERTA 4ZILA 4EL1A 5ECOB 1XW6A 4IQAA 1BQ7A 2DJ1A 2EIQA 2N5AA 3F4TA 5JWOB 4LLRA 3ED3A 3D21A 3ISOA 4WXTA 1PGTA 3Q6OA 3M9JA 3LXTA 5ID2B 3I43A 4V2LA 3ZITA 3G7JA 3Q74A 5IMCA 1VF4A 2HE3A 4MPFA 2MBTA 5IQYA 1TK5B 2GZZA 3APOA 2H70A 2J23A 1EP8A 4I97A 1HNBA 1XWAA 2IMEA 4HI7A 3DYRA 4MJBA 1MDKA 4RQXA 1MTCA 5J9BA 4ZBAA 3GURA 1X5DA 4XRDA 4PUFC 3M9KA 3H79A 1U88A 1TI3A 4ECCA 4GLTA 2DJ3A 2LKUA 1B48A 2A4VA 3I9V2 1SKRB 3QOUA 1A2MA 2XHFA 2L6DA 4MK3A 5D9XA 1X9WB 4HJMA 4ZBDA 3DRNA 5ECQB 3GFKA 3NZNA 2KHPA 1FVKA 4XHMA 3ZMKA 3GTUB 1EZKA 4LL1B 4EC0A 1R5PA 3UARA 4WF4A 4IELA 3HZ4A 2EIOA 1WWJA 5AN1A 3RDWA 1FW1A 2YANA 3ZIVA 1O81A 2REMA 3GYKA 20GSA 3CMIA 2V1MA 3WYWA 4TR1A 3KEBA 2I4AA 2NBSA 3J7Yb 1QQ2A 4K7NA 3F6DA 4O5RA 4FYBA 1GSFA 1YEXA 4AJ7A 4HOJA 2HFDA 1PL1A 5HFGA 3ZFLA 2LNTA 1J9BA 1JZWA 3IV4A 4GSNA 2Z9SA 3GX8A 8GSSA 2JACA 2F9SA 1LU4A 1M7TA 1S3CA 4Q5NA 2B5XA 1M2AA 2YOIA 3L78A 1XZOA 4J57E 3OR5A 1SL2B 1ZMAA 3HVVA 2F8FA 4RI6A 2I3YA 1G7OA 1GNEA 2H73A 4F03A 1G6YA 3EU4A 4BWQA 2L5OA 2VM1A 3DXBA 2YV7A 3LEFA 1ST9A 5ELAA 2M72A 1PMTA 2GTUA 3TB2A 3H93A 3N5OA 2I1UA 2C80A 4NMUA 1IYHA 3D22A 3WT1A 3F0IA 4PQ1A 4TN8A 3D5JA 1T4ZA 2GSSA 4NPBA 5DCGA 5D9VA 1K0AA 1GTBA 3IK7A 3KD0A 2DJKA 4PX1A 4I8BA 1Y25A 2E2GA 2V6KA 4HJ2A 2K18A 2C0FA 4PUAA 5L71A 2WS2A 4MJEA 2FUG2 3ERGA 1FVJA 1FB0A 1LBKA 5DQYA 3DGQA 3DVWA 3APSA 5G2ZA 2YZUA 4PQIA 1M9AA 3AY8A 3HXSA 2GLRA 3Q18A 5FT3A 1TDIA 2PVOC 5D9WA 4Q5FA 1PX7A 3QR6A 1OC3A 4EDYA 1U3IA 3QCPA 4YQVA 3EWLA 3US3A 1IYIA 3FHKA 5B8BA 2VLVA 2K6VA 1M2BA 2DC5A 4YQUA 2FD3A 3DVXA 2PBJA 2VL2A 2X64A 2LJAA 1THXA 1X5EA 1Z6MA 3ZLPA 3GIXA 2IFQB 5JCWA 3R2QA 3IPZA 17GSA 4POBA 3HJPA 2IN3A 4NHZA 5GZZB 4N10A 4E8EA 5A5KA 3LYKA 2KLXA 4EVMA 3PH9A 2TRXA 1MD4A 1JLWA 4OFNA 1PD21 3ZMLA 1E6BA 4ZBBA 2WRTA 4V2MA 4TR4A 3TJBA 1PKWA 4IJIA 5IMZA 4MH3A 4NHWA 4FH8A 2G0FA 4E8HA 4N11A 2OE1A 3G7YA 2F51A 1X9SB 1O73A 2GSTA 1ACVA 3QAVA 3TKSA 2IFQA 1TU7A 2HZEA 4ZB9A 5EVOA 3O6TA 1Z7RA 2H6YA 2V6OA 4IBPA 4WKWA 3TOUA 1Z6NA 3HD5A 4JU5A 2YJ7A 4GQCA 4HS1A 4OO4A 4ML6A 2FWEA 3TRPA 3F63A 1G7EA 4OO5A 3EURA 2C0GA 5IIZA 4KX4A 2CX4A 4IHUA 2O85A 3PINA 4IQ1A 4MPGA 4IW9A 2OJLA 3LFLA 3UVTA 5JWQB 3CRTA 1Q98A 3KCMA 4KUNA 2LV3A 1A2LA 2B7KA 5KEJA 1S3DA 1FO5A 1GTUA 3BJ5A 4DVCA 1EV9A 1AIUA 4ULXA 4AJ8A 2B1LA 4K2DA 2XBQA 1UC7A 4L0WA 1ZL9A 4MMMA 3GV1A 4BL7A 1JZOA 1TJDA 1KBNA 4MZCA 3IAM2 2FWGA 5IO0A 1B9XC 1GLPA 1OC8A 1U6TA 1DE1A 4TKYA 3VI5A 2VL9A 2L6CA 3ME8A 2HSHA 1A24A 4CHSA 2JZTA 4YH2A 1T7PB 3ZTLA 1XVWA 3P2AA 4F0BA 2R6KA 3F6FA 3JCML 1GSSA 2AB6A 3A2WA 2H0HA 6GSWA 1DBYA 1VF3A 3TOTA 2DMLA 2L4QA 3EYTA 5ECPB 4MF6A 1AQVA 1K0BA 3O76A 1T3BA 4DEJA 5CRDA 2H72A 2MMZA 4HU7A 3P8WA 4NWYA 5ELGA 2OADA 5G5FA 1GRXA 5ECKB 3IAS2 1F3AA 18GSA 4D73A 1WOUA 2VUPA 1RW1A 1VF2A 2G2QA 2DBCA 5AIVA 3TKQA 2KOKA 1N2AA 5AGYA 3HKRA 3IRAA 2FA4A 1V2AA 4GTUA 2C1YA 1SJ6A 1SU9A 3APQA 2IMKA 3VFIA 1ML6A 2P5RA 2NPBA 2RUEA 4PGTA 1PKZA 2H8LA 1GSUA 1M2DA 1ZYQB 4Q5RA 3H1NA 3ERFA 4NAXA 4PQHA 1ERVA 2V32A 2GGTA 2NVLA 3M0FA 1NSWA 4LMWA 1YF0A 3VWXA 2HXKA 6GSTA 4RQRA 5JWRB 2JSYA 5D93A 2RM6A 19GSA 2C8UA 1SD8A 4GF0A 1AC1A 4ML1A 2HZFA 4ZIJA 1TTZA 4OFMA 5G1KA 2GDRA 4XS4A 2MMAA 3CSJA 4J2FA 3KP8A 3GH9A 4HUAA 2O89A 5DDLA 1XIYA 2HI7A 2LJRA 1K3LA 3RAZA 2L57A 3VPQA 1JFUA 1XBSA 2LTKA 2WULA 2GZYA 3TDGA 1X5CA 1TRVA 4WETA 2KP1A 3IK9A 2V41A 2WB9A 4IKHA 3IA1A 2P0GA 3LSZA 5HR0A 3KTBA 1AW9A 3UAPA 5D8IA 1SK0A 5ID2A 1XPVA 1OC9B 1T4YA 4G9HA 1USBA 4HQSA 3ZREA 2ZCTA 3KTLA 1R7HA 4G10A 4NXIA 2JL4A 1DSBA 1YY7A 4MZBA 6GSXA 3ERWA 1ON4A 2TIRA 1M0UA 4GCIA 4K0GA 4GRFA 2ZUPA 1FB6A 3FZ9A 3TCOA 2VCXA 4L0UA 4NV2A 12GSA 2GQKA 1DUGA 3KGKA 2WZ9A 2CVBA 1A23A 5J41A 2XPEA 3F9UA 2GQMA 1EOHA 4KB3A 3UEMA 1ZCPA 4MF7A 1AUCA 1O6JA 5DAKB 1ERUA 3F4RA 4FYCA 1MDJA 1NHYA 4K7IA 6GSYA 2AHEA 4HDEA 4X43A 2QGVA 3F3RA 2VM2A 3D6IA 2RUFA 1V9WA 1GUHA 3BCIA 1UVZA 5IOWA 4YAPA 1WJKA 2N5BA 3TJGA 2CX3A 4HZ2A 1GWCA 1UA5A 2LRNA 2OBKA 4MA9A 2GT5A 3GTUA 3DIEA
chains in the Genus database with same CATH superfamily
4F2IA 2AV4A 2FHEA 2AUVA 2IIYA 5HR2A 1PA3A 5ECLB 4WBJA 2PU9C 2GSQA 1Z7PA 1YKCA 1XWCA 5HFKA 3FKFA 5F8BA 3IE3A 2HRNA 1B8XA 2VLUA 5F0GA 2K8VA 2PN8A 1WMJA 4FQUA 4IS0A 3UBLA 2H66A 4BVYA 3TJJA 1ZYEA 5DALB 2VO4A 6GSUA 1K3YA 5DAKA 4L5LA 3K8NA 1BX9A 4KSMA 1W4VA 3GSTA 1MDIA 3FW2A 5ECHB 4K9ZA 4BA7A 1OYJA 2OE3A 1K0DA 3A2VA 2DSAA 2FNOA 4IN0A 3UBKA 4ZB8A 5AISA 3L9VA 3IBHA 1THOA 5J3RA 5IO2A 1T00A 1BG5A 4IGJA 3FEUA 3U6VA 2B3SA 5G30A 2PMTA 3HVSA 1QUWA 4X1UA 4DSSB 2V2GA 5BMUA 4EO3A 1MEKA 3UMAA 5CYYA 5D96A 2RIIA 2H0GA 2H6XA 5G31A 2B6MA 3L9UA 3MWHA 5D73A 1E2YA 3VLNA 4BPYA 1SD9A 4K8MA 3EPTA 3QPMA 3EC3A 1TRSA 3FY7A 5COHA 3QFAC 2DJ0A 4TRXA 2CZ3A 5J9CA 5E59A 2XBIA 5KOXA 2QC7A 3IXRA 5A4VA 1O8XA 3KMOA 1K3OA 2DJJA 4BVXB 2C0DA 2VL2C 1SK2A 1J08A 2VCVA 3LXZA 3RPNA 3FR6A 4TR0A 1PN0A 4CW9A 3FRCA 1A8LA 5HQPA 1UN2A 2AAWA 4JBBA 3E3EA 11GSA 2A2SA 5EPFA 1FAAA 5ECRB 3L4NA 2O7KA 2O8VB 5HR1A 2N5FA 4TXOB 2YP6A 4MP4A 3C1SA 1QGVA 3H4KA 2NTOA 4KAEA 4AF2A 3CTGA 1YKAA 3TKPA 4ICYA 4V2NA 2IMFA 1GUMA 2CV4A 4PXOA 22GSA 3QD9A 3EMPA 5KN0A 2GT6A 1SJZA 4TW5A 4POMA 1TK0B 3D0ZA 3HHVA 1GTAA 5ECNB 4JRRA 3VWVA 3MAKA 3GRXA 2H1GA 4LMVA 3SWLA 5GAND 5A4UA 1RQMA 1FOVA 3RBTA 1Z3EA 2H1AA 3TKSC 2WFCA 3UL3A 6GSSA 5J5NA 1EEMA 4X0XA 2MMOA 1FG4A 2VD1A 3ZZXA 3HDCA 3CXGA 2RLIA 3E0UA 4YKFA 2YWIA 3DWVA 2NDOA 4G2EA 1GUKA 2KP2A 2X8HA 3H8QA 1TW9A 4LA1A 1PRXA 1VF1A 4BWSA 4KCAA 3VWUA 1B4QA 2HLSA 4KSOA 1YQ1A 1OE7A 2VCWA 3HJMA 2A4HA 2PUKC 1Z5YE 5IM9A 3ZYWA 3HY2A 5C00A 1V98A 4K5SA 1F2EA 4F9ZA 1N8JA 4TVEA 5HR3A 1SJIA 9GSSA 2IJYA 4N30A 3GH6A 3O3TA 2H01A 1M99A 2CVDA 1I9DA 2F3MA 4EIPA 5CNWA 3C8EA 5KN3A 2WGRA 1ERWA 3KXOA 2OKAA 1EGRA 5J4UA 2P5QA 3M1GA 1TRUA 3U5RE 5IMAA 2MMNA 2WJUA 4DSQA 4PNGA 4LL4B 4TR3A 3EVIA 2CA8A 4KDYA 4MDCA 1XXUA 4F0CA 3J7Yk 4OMVA 4ZL8A 2C3TA 3ZVJA 5IMDA 3P7XA 2X8CA 3DMLA 2H74A 4GSSA 1TOFA 1TK8B 1PSQA 1KNGA 2J9HA 5CREA 1YEPA 1SL0B 3BCKA 2H1BA 4QL9A 4QL7A 1GP1A 2YPMA 1I5GA 2RM5A 3L0HA 1JZRA 3KP9A 3GSSA 3D4TA 1SK1A 4L8EA 3KM6A 3VI7A 1F6MC 2VCZA 2VLTA 2CT6A 1X0RA 4WR4A 3LYPA 1GNWA 3EINA 2YWNA 3TGZA 1ZYPA 3VWWA 3V1WA 3G7IA 4GXZA 3WGEA 1MD3A 4EE0A 2B7JA 1DE2A 2X99A 2UZ8A 1AXDA 1U87A 2DKIA 3P90A 1B9YC 2FWHA 2ES7A 3LWAA 1KEBA 3CSIA 5DJLA 2OE0A 2C3NA 1AAZA 4ECJA 2AJQB 1ZGNA 3KIJA 4V1Ap 3EMXA 3HCZA 1OKDA 4XRAA 1XW5A 4ILFA 4XCSA 3DKSA 5A4WA 1HD2A 4I5QA 2DJ2A 3C1RA 4MH2A 5DCHA 2B1KA 1PL2A 3UOMA 4EKZA 3TUEA 2R4VA 3LQ7A 4V1Ag 1G0TA 1HNAA 2VAFA 5IPHA 5B8AA 1URMA 2B5YA 3FMWA 5KN1A 5AIXA 2LS5A 2IMDA 3C71A 4EF0A 1FOHA 4XS1A 2X8GA 4JZQA 4K6XA 4N0VA 2MZCA 4OFTA 2DIYA 5FWGA 3IR4A 3EE2A 4O32A 3GUSA 2CZ2A 4PURA 5CO3A 1WIKA 5CRGA 5G5EA 2FA8A 4KA0A 1V40A 1GSDA 4O5QA 3FR3A 2I81A 3WT2A 1BAYA 3WD6A 16GSA 3ZL5A 10GSA 2YJHA 3HVXA 1BJXA 5JCGA 2JADA 4JR4A 4WF5A 1OKTA 2LQOA 1F37A 1XWGA 4MNNA 1AQXA 2I9HA 3EU3A 3IC8A 2OA7A 3M3MA 5IMFA 3ZVJD 2L4CA 2ON5A 5E4WA 1A0RP 1GH2A 4TR1B 1Y6EA 1XCCA 1GSYA 3WGDA 4FYUA 4YKGA 2PERA 4X4JA 3FR9A 4F82A 1G6WA 4EDZA 4AJ6A 1PX6A 3TJKA 2EC4A 13GSA 1Z9HA 2FLSA 2HSYA 3GNJA 5DJMA 2KUCA 2QSIA 5B7CA 2L59A 3ZRDA 2BJXA 3UIWA 4KW6A 14GSA 1WPIA 2GVPA 3LGCA 4IVFA 1U3AA 2YN1A 5ABRA 4IP6A 1A0FA 5EL8A 1XWBA 3G9BA 1QMVA 5HFIA 3TRQA 1T8EB 1TI1A 3GN3A 1WRYA 1GLQA 2PGTA 1JHBA 1JLVA 1OC9A 4J56E 1T1VA 2HRAA 3MDKA 2CVKA 3BD2A 5CRHA 4HU9A 2DMMA 1K0OA 4OD7A 3IDVA 3GKKA 4I6XA 1A2JA 2O87A 2X4AA 2C4JA 1LJRA 4K1FA 1X9MB 1PN9A 4USSA 4HEA2 4PTSA 4KE3A 2H75A 4WR5A 1GSEA 1NW2A 1O85A 2E7PA 2IWTA 4KGIA 1HNCA 1AQWA 4OCEA 4OWYA 5ENUA 2CAQA 3E9JB 3CYNA 5H5RA 3TRXA 3F4SA 4ECBA 1CQHA 3FYGA 1V58A 4N0ZA 3CSHA 3TKRA 2EIRA 4MJCA 1ILOA 4AGSA 3M8NA 4NV5A 3W8SA 1O7UA 1HQOA 4XS6A 4POKA 2LNSA 5GSSA 3BOAA 3HYPA 3QAGA 2JZSA 5FHIA 1EV4A 5CRWA 3KH7A 4K7OA 2IMIA 4MZWA 2GZPA 2XPDA 1SYRA 2XC2A 4G19A 4JR6A 4ISDA 1GL8A 2LSTA 2B5EA 1ZZYA 1BEDA 2PWJA 5DALA 5JCUA 4POLA 5CP1A 3LORA 2LEGA 4MCUA 2QKEA 5LNKe 3FZ5A 1K0NA 2H1DA 3NIVA 3ME7A 1GSQA 1XWKA 3GKNA 5B6MA 2LQQA 1VRSD 4P3YB 7GSSA 4MF5A 2H0IA 4IP1A 4Z2TA 1M9BA 4Z7XA 3DEXA 2VIMA 3DD3A 1OAZA 3KH9A 3A3TA 3CRUA 4ZL7A 5C04A 2C0EA 4YQMA 2YZHA 2K9FA 3C7MA 4TOPA 4TXVA 5ECSA 5DVBA 4JEDA 2VCTA 1EP7A 2R37A 4DSSA 3L9SA 2M80A 1V57A 2HT9A 3HA9A 2YWOA 4G0KA 1HYUA 3IC4A 2WCIA 3RPPA 5IOXA 2K8SA 1C72A 3QAWA 5INYA 2VL3A 1XOAA 1TRWA 4DSRA 2VD0A 3GHAA 3GMFA 4ZB6A 3WGXA 3MNGA 4BIKA 3GX0A 2HZEB 5DQSA 3TJFA 3IOSA 4ECIA 2HNLA 1KTEA 4Q5QA 5LD0A 2LRCA 1B4PA 5D9TA 2GQLA 3C73A 3I69A 4L5OA 4QQ7A 1H75A 1ABAA 2L5LA 4KDXA 1SKWB 1TP9A 2JSZA 4BVXA 4I2TA 1RK4A 2CQ9A 3ZIJA 4K2XA 4KF9A 4PNFA 3GL3A 3QDNA 2FCHA 5ECIB 3SBCA 3PGTA 1OE8A 4I2UA 4TXOA 4Z2RA 3CTFA 2TRCP 4G0LA 1EGOA 4JE1A 4H86A 4FIWA 3A5WA 1NHOA 4GSTA 5GAPD 4K0NA 1F9MA 1CQGA 1R5AA 4EIQA 3HZ8A 4WBRD 2ON7A 3FZAA 2YCDA 5CAXA 3F8UA 1F3BA 2ALBA 3TKSE 5EY6A 4EUYA 2OACA 5DBQA 5GSTA 5H5QA 2JZRA 2VCQA 2H30A 5H5SA 3FZ4A 1QK8A 5KN2A 2H76A 4FO5A 4MLYA 2R5GA 2GSRA 3N9JA 4BL7B 3LG6A 1EOGA 1J0FA 3NOFA 3LJRA 2M46A 3ZFBA 1YDKA 2BMXA 4CDOA 2HYXA 2JU5A 2X49A 1XW9A 4HQZA 1TXXA 2H71A 5ECMB 2YV9A 1R26A 1K0CA 2DLXA 1O8WA 2HRFA 5IMVA 1W89A 1XFLA 2PVQA 2YNXA 3I6AA 5F06A 3A2XA 5IPGA 2LUSA 1QXHA 3VURA 2AYTA 2LJKA 3RHCA 2F8AA 3VPTA 5F05A 1H4OA 1SKSB 3CBUA 1WP0A 2FGXA 4MJAA 1JZDA 3MIXA 3PR8A 3GKMA 3BBYA 2CAIA 4GWRA 4K5RA 1TKDB 2H19A 3GA4A 2IPAA 2DIZA 3HJOA 1NM3A 1Q4JA 4D73B 4KCEA 1K0MA 3GKXA 4XIHA 4GQFA 4RI7A 3IHQA 4EXJA 6GSVA 1OVNA 4IJ3A 2OBIA 5LCZA 4ZXGA 1GULA 2IL3A 3MSZA 3KZQA 4KDUA 2LRTA 4RUVA 2WDUA 2QA1A 4WEYA 2H6ZA 3Q19A 3F3QA 1A8YA 2BTOT 1QFNA 4KNDA 1FHEA 2R3XA 4KH7A 1XOBA 4MABA 1S3AA 1YZXA 3UJ1A 3FK8A 3W6GA 3KMNA 4YAVA 1GTIA 3VK9A 2P31A 3CQFA 4ZL9A 1XVQA 2FY6A 5F07A 1YF1A 4XTSA 1PQNA 3RHBA 3PPUA 3GL5A 2ZNMA 1SL1B 2VOCA 2A2RA 4OCFA 1R4WA 5G1LA 3QFBC 2YWMA 1YJ6A 4HZ4A 1SENA 1VGLA 1SYXA 2FWFA 2PPTA 1ZOFA 5B6NA 2E0QA 3W8JA 2C3QA 4ID0A 3UVHA 3KJYA 3D4MA 4XS4B 2R2JA 3QMXA 3S9FA 1BYEA 3LW9A 4ACSA 2MYGA 4O92A 2D2ZA 4O7HA 1EEJA 2GS3A 1TU8A 2E2MA 1EWXA 1WE0A 2MBSA 1ERTA 4ZILA 4EL1A 5ECOB 1XW6A 4IQAA 1BQ7A 2DJ1A 2EIQA 2N5AA 3F4TA 5JWOB 4LLRA 3ED3A 3D21A 3ISOA 4WXTA 1PGTA 3Q6OA 3M9JA 3LXTA 5ID2B 3I43A 4V2LA 3ZITA 3G7JA 3Q74A 2A2PA 5IMCA 1VF4A 2HE3A 5BRTA 4MPFA 2MBTA 5IQYA 1TK5B 2GZZA 3APOA 2H70A 2J23A 1EP8A 4I97A 1HNBA 1XWAA 2IMEA 4HI7A 3DYRA 4MJBA 1MDKA 4RQXA 1MTCA 5J9BA 4ZBAA 3GURA 1X5DA 4XRDA 4PUFC 3M9KA 3H79A 1U88A 1TI3A 4ECCA 4GLTA 2DJ3A 2LKUA 1B48A 2A4VA 3I9V2 1SKRB 3QOUA 1A2MA 2XHFA 2L6DA 2QA2A 4MK3A 5D9XA 1X9WB 4HJMA 4ZBDA 3DRNA 5ECQB 3GFKA 3NZNA 2KHPA 1FVKA 4XHMA 3ZMKA 3GTUB 1EZKA 4LL1B 1M3JA 4EC0A 1R5PA 3UARA 4WF4A 4IELA 3HZ4A 2EIOA 1WWJA 5AN1A 3RDWA 1FW1A 2YANA 3ZIVA 1O81A 2REMA 3GYKA 20GSA 3CMIA 4BVYB 2V1MA 3WYWA 4TR1A 5KOWA 3KEBA 2I4AA 3MYDA 2NBSA 3J7Yb 1QQ2A 4K7NA 3F6DA 4O5RA 4FYBA 1GSFA 1YEXA 4AJ7A 4HOJA 2HFDA 3HVNA 1PL1A 5HFGA 3ZFLA 2LNTA 1J9BA 1JZWA 3IV4A 4GSNA 2Z9SA 3GX8A 8GSSA 2JACA 2F9SA 1LU4A 1M7TA 1S3CA 4Q5NA 2B5XA 1M2AA 2YOIA 3L78A 1XZOA 4J57E 3OR5A 1SL2B 1ZMAA 3HVVA 2F8FA 4RI6A 2I3YA 1G7OA 1GNEA 2H73A 4F03A 1G6YA 3EU4A 4BWQA 2L5OA 2VM1A 3DXBA 2YV7A 3LEFA 1ST9A 5ELAA 2M72A 1PMTA 2GTUA 3TB2A 3H93A 3N5OA 2I1UA 2C80A 4NMUA 1IYHA 3D22A 3WT1A 3F0IA 4PQ1A 4TN8A 3D5JA 1T4ZA 2GSSA 4NPBA 2R0GA 5D9VA 5DCGA 1K0AA 1GTBA 3IK7A 1M3IA 3KD0A 2DJKA 4PX1A 4I8BA 1Y25A 2E2GA 2V6KA 4HJ2A 2K18A 2C0FA 4PUAA 5L71A 2WS2A 2R0PA 4MJEA 2FUG2 3ERGA 1FVJA 1FB0A 1LBKA 5DQYA 3DGQA 3DVWA 3APSA 5G2ZA 2YZUA 4PQIA 1M9AA 3AY8A 3HXSA 2GLRA 3Q18A 5FT3A 1TDIA 2PVOC 5D9WA 4Q5FA 1PX7A 3QR6A 1OC3A 4EDYA 1U3IA 3QCPA 4YQVA 3EWLA 3US3A 1IYIA 2R0CA 3FHKA 5B8BA 2VLVA 2K6VA 1M2BA 2DC5A 4YQUA 2FD3A 3DVXA 2PBJA 2VL2A 2X64A 2LJAA 1THXA 1S3RA 1X5EA 1Z6MA 3ZLPA 2HRKA 3GIXA 2IFQB 5JCWA 3R2QA 3IPZA 17GSA 4POBA 3HJPA 2IN3A 4NHZA 5GZZB 4N10A 4E8EA 5A5KA 3LYKA 2KLXA 4EVMA 3PH9A 2TRXA 1MD4A 1JLWA 4OFNA 1PD21 3ZMLA 1E6BA 4ZBBA 3IHGA 2WRTA 4V2MA 4TR4A 3TJBA 1PKWA 4IJIA 5IMZA 4MH3A 4NHWA 4FH8A 2G0FA 4E8HA 3R3EA 4N11A 2OE1A 3G7YA 2F51A 1X9SB 1O73A 2GSTA 1ACVA 3QAVA 3TKSA 2IFQA 1TU7A 2HZEA 4ZB9A 5EVOA 3O6TA 1Z7RA 2H6YA 2V6OA 4IBPA 4WKWA 2HSMA 3TOUA 1Z6NA 3HD5A 4JU5A 2YJ7A 4GQCA 4HS1A 4OO4A 4ML6A 2FWEA 3TRPA 3F63A 1G7EA 4OO5A 3EURA 2C0GA 5IIZA 4KX4A 2CX4A 4IHUA 2O85A 3PINA 4IQ1A 4MPGA 4IW9A 2OJLA 3LFLA 3UVTA 5JWQB 4CY8A 3CRTA 1Q98A 3KCMA 4KUNA 2LV3A 1A2LA 2B7KA 5KEJA 1S3DA 1FO5A 1GTUA 3BJ5A 4DVCA 1EV9A 4A5PA 1AIUA 4ULXA 4AJ8A 2B1LA 4K2DA 2XBQA 1UC7A 4L0WA 1ZL9A 4MMMA 3GV1A 4BL7A 1XG8A 1JZOA 1TJDA 1KBNA 4MZCA 3IAM2 2FWGA 5IO0A 1B9XC 1GLPA 4HSCX 1OC8A 1U6TA 1DE1A 4TKYA 3VI5A 2VL9A 2L6CA 3ME8A 2HSHA 1A24A 4CHSA 2JZTA 4YH2A 1T7PB 3ZTLA 1XVWA 3P2AA 4F0BA 2R6KA 3F6FA 3JCML 1GSSA 2AB6A 3A2WA 2H0HA 6GSWA 1DBYA 1VF3A 3TOTA 2DMLA 2L4QA 3EYTA 5ECPB 4MF6A 1AQVA 1K0BA 3O76A 1T3BA 4DEJA 5CRDA 2H72A 2MMZA 4HU7A 3P8WA 4NWYA 5ELGA 2OADA 5G5FA 1GRXA 5ECKB 3IAS2 1F3AA 18GSA 4D73A 1WOUA 2VUPA 1RW1A 1VF2A 2G2QA 2DBCA 5AIVA 3TKQA 2KOKA 1N2AA 5AGYA 3HKRA 3IRAA 2FA4A 1V2AA 2DKHA 4GTUA 2C1YA 1SJ6A 1SU9A 3APQA 4O5UA 2IMKA 3VFIA 1ML6A 2P5RA 2NPBA 2RUEA 4PGTA 1PKZA 2H8LA 1GSUA 1M2DA 1ZYQB 4Q5RA 3H1NA 3ERFA 4NAXA 4PQHA 1ERVA 2V32A 2GGTA 2NVLA 3M0FA 1NSWA 4LMWA 1YF0A 3VWXA 2HXKA 6GSTA 4RQRA 5JWRB 2JSYA 5D93A 2RM6A 19GSA 2C8UA 1SD8A 4GF0A 1AC1A 4ML1A 2HZFA 4ZIJA 1TTZA 4OFMA 5G1KA 4CY6A 2GDRA 4XS4A 2MMAA 3CSJA 4J2FA 3KP8A 3GH9A 4HUAA 2O89A 5DDLA 1XIYA 2HI7A 2LJRA 1ZYNA 1K3LA 3RAZA 2L57A 3VPQA 1JFUA 1XBSA 2LTKA 2WULA 2GZYA 3TDGA 1X5CA 1TRVA 4WETA 2KP1A 3IK9A 2V41A 2WB9A 4IKHA 3IA1A 2P0GA 3LSZA 5HR0A 3KTBA 1AW9A 3UAPA 5D8IA 1SK0A 5ID2A 1XPVA 4G0IA 1OC9B 1T4YA 4G9HA 1USBA 4HQSA 3ZREA 2ZCTA 3KTLA 1R7HA 4G10A 4NXIA 2JL4A 1DSBA 1YY7A 4MZBA 6GSXA 3ERWA 1ON4A 2TIRA 1M0UA 4GCIA 4K0GA 4GRFA 3A5IA 2ZUPA 1FB6A 3FZ9A 3TCOA 2VCXA 4L0UA 4NV2A 12GSA 2GQKA 1DUGA 3KGKA 2WZ9A 2CVBA 1A23A 5J41A 2XPEA 3F9UA 2GQMA 1EOHA 4KB3A 3UEMA 1ZCPA 4MF7A 1AUCA 1O6JA 5DAKB 1ERUA 3F4RA 4FYCA 1MDJA 1NHYA 4K7IA 6GSYA 2AHEA 4HDEA 4X43A 2QGVA 3F3RA 2VM2A 3D6IA 2RUFA 1V9WA 1GUHA 3BCIA 1UVZA 5IOWA 4Z2UA 4YAPA 1WJKA 2N5BA 3TJGA 1PFOA 2CX3A 4HZ2A 1GWCA 1UA5A 2LRNA 2OBKA 4MA9A 2GT5A 3GTUA 3DIEA
chains in the Genus database with same CATH topology
4F2IA 2AV4A 2FHEA 2AUVA 2IIYA 5HR2A 1PA3A 5ECLB 4WBJA 2PU9C 2GSQA 1Z7PA 1YKCA 1XWCA 5HFKA 3FKFA 5F8BA 3IE3A 2HRNA 1B8XA 2VLUA 5F0GA 2K8VA 2PN8A 1WMJA 4FQUA 4IS0A 3UBLA 2H66A 4BVYA 3TJJA 1ZYEA 5DALB 2VO4A 6GSUA 1K3YA 5DAKA 4L5LA 3K8NA 1BX9A 4KSMA 1W4VA 3GSTA 1MDIA 3FW2A 5ECHB 4K9ZA 4BA7A 1OYJA 2OE3A 1K0DA 3A2VA 2DSAA 2FNOA 4IN0A 3UBKA 4ZB8A 5AISA 3L9VA 3IBHA 1THOA 5J3RA 5IO2A 1T00A 1BG5A 4IGJA 3FEUA 3U6VA 2B3SA 5G30A 2PMTA 3HVSA 1QUWA 4X1UA 4DSSB 2V2GA 5BMUA 4EO3A 1MEKA 3UMAA 5CYYA 5D96A 2RIIA 2H0GA 2H6XA 5G31A 2B6MA 3L9UA 3MWHA 5D73A 1E2YA 3VLNA 4BPYA 1SD9A 4K8MA 3EPTA 3QPMA 3EC3A 1TRSA 3FY7A 5COHA 3QFAC 2DJ0A 4TRXA 2CZ3A 5J9CA 5E59A 2XBIA 5KOXA 2QC7A 3IXRA 5A4VA 1O8XA 3KMOA 1K3OA 2DJJA 4BVXB 2C0DA 2VL2C 1SK2A 1J08A 2VCVA 3LXZA 3RPNA 3FR6A 4TR0A 1PN0A 4CW9A 3FRCA 1A8LA 5HQPA 1UN2A 2AAWA 4JBBA 3E3EA 11GSA 2A2SA 5EPFA 1FAAA 5ECRB 3L4NA 2O7KA 2O8VB 5HR1A 2N5FA 4TXOB 2YP6A 4MP4A 3C1SA 1QGVA 3H4KA 2NTOA 4KAEA 4AF2A 3CTGA 1YKAA 3TKPA 4ICYA 4V2NA 2IMFA 1GUMA 2CV4A 4PXOA 22GSA 3QD9A 3EMPA 5KN0A 2GT6A 1SJZA 4TW5A 4POMA 1TK0B 3D0ZA 3HHVA 1GTAA 5ECNB 4JRRA 3VWVA 3MAKA 3GRXA 2H1GA 4LMVA 3SWLA 5GAND 5A4UA 1RQMA 1FOVA 3RBTA 1Z3EA 2H1AA 3TKSC 2WFCA 3UL3A 6GSSA 5J5NA 1EEMA 4X0XA 2MMOA 1FG4A 2VD1A 3ZZXA 3HDCA 3CXGA 2RLIA 3E0UA 4YKFA 2YWIA 3DWVA 2NDOA 4G2EA 1GUKA 2KP2A 2X8HA 3H8QA 1TW9A 4LA1A 1PRXA 1VF1A 4BWSA 4KCAA 3VWUA 1B4QA 2HLSA 4KSOA 1YQ1A 1OE7A 2VCWA 3HJMA 2A4HA 2PUKC 1Z5YE 5IM9A 3ZYWA 3HY2A 5C00A 1V98A 4K5SA 1F2EA 4F9ZA 1N8JA 4TVEA 5HR3A 1SJIA 9GSSA 2IJYA 4N30A 3GH6A 3O3TA 2H01A 1M99A 2CVDA 1I9DA 2F3MA 4EIPA 5CNWA 3C8EA 5KN3A 2WGRA 1ERWA 3KXOA 2OKAA 1EGRA 5J4UA 2P5QA 3M1GA 1TRUA 3U5RE 5IMAA 2MMNA 2WJUA 4DSQA 4PNGA 4LL4B 4TR3A 3EVIA 2CA8A 4KDYA 4MDCA 1XXUA 4F0CA 3J7Yk 4OMVA 4ZL8A 2C3TA 3ZVJA 5IMDA 3P7XA 2X8CA 3DMLA 2H74A 4GSSA 1TOFA 1TK8B 1PSQA 1KNGA 2J9HA 5CREA 1YEPA 1SL0B 3BCKA 2H1BA 4QL9A 4QL7A 1GP1A 2YPMA 1I5GA 2RM5A 3L0HA 1JZRA 3KP9A 3GSSA 3D4TA 1SK1A 4L8EA 3KM6A 3VI7A 1F6MC 2VCZA 2VLTA 2CT6A 1X0RA 4WR4A 3LYPA 1GNWA 3EINA 2YWNA 3TGZA 1ZYPA 3VWWA 3V1WA 3G7IA 4GXZA 3WGEA 1MD3A 4EE0A 2B7JA 1DE2A 2X99A 2UZ8A 1AXDA 1U87A 2DKIA 3P90A 1B9YC 2FWHA 2ES7A 3LWAA 1KEBA 3CSIA 5DJLA 2OE0A 2C3NA 1AAZA 4ECJA 2AJQB 1ZGNA 3KIJA 4V1Ap 3EMXA 3HCZA 1OKDA 4XRAA 1XW5A 4ILFA 4XCSA 3DKSA 5A4WA 1HD2A 4I5QA 2DJ2A 3C1RA 4MH2A 5DCHA 2B1KA 1PL2A 3UOMA 4EKZA 3TUEA 2R4VA 3LQ7A 4V1Ag 1G0TA 1HNAA 2VAFA 5IPHA 5B8AA 1URMA 2B5YA 3FMWA 5KN1A 5AIXA 2LS5A 2IMDA 3C71A 4EF0A 1FOHA 4XS1A 2X8GA 4JZQA 4K6XA 4N0VA 2MZCA 4OFTA 2DIYA 5FWGA 3IR4A 3EE2A 4O32A 3GUSA 2CZ2A 4PURA 5CO3A 1WIKA 5CRGA 5G5EA 2FA8A 4KA0A 1V40A 1GSDA 4O5QA 3FR3A 2I81A 3WT2A 1BAYA 3WD6A 16GSA 3ZL5A 10GSA 2YJHA 3HVXA 1BJXA 5JCGA 2JADA 4JR4A 4WF5A 1OKTA 2LQOA 1F37A 1XWGA 4MNNA 1AQXA 2I9HA 3EU3A 3IC8A 2OA7A 3M3MA 5IMFA 3ZVJD 2L4CA 2ON5A 5E4WA 1A0RP 1GH2A 4TR1B 1Y6EA 1XCCA 1GSYA 3WGDA 4FYUA 4YKGA 2PERA 4X4JA 3FR9A 4F82A 1G6WA 4EDZA 4AJ6A 1PX6A 3TJKA 2EC4A 13GSA 1Z9HA 2FLSA 2HSYA 3GNJA 5DJMA 2KUCA 2QSIA 5B7CA 2L59A 3ZRDA 2BJXA 3UIWA 4KW6A 14GSA 1WPIA 2GVPA 3LGCA 4IVFA 1U3AA 2YN1A 5ABRA 4IP6A 1A0FA 5EL8A 1XWBA 3G9BA 1QMVA 5HFIA 3TRQA 1T8EB 1TI1A 3GN3A 1WRYA 1GLQA 2PGTA 1JHBA 1JLVA 1OC9A 4J56E 1T1VA 2HRAA 3MDKA 2CVKA 3BD2A 5CRHA 4HU9A 2DMMA 1K0OA 4OD7A 3IDVA 3GKKA 4I6XA 1A2JA 2O87A 2X4AA 2C4JA 1LJRA 4K1FA 1X9MB 1PN9A 4USSA 4HEA2 4PTSA 4KE3A 2H75A 4WR5A 1GSEA 1NW2A 1O85A 2E7PA 2IWTA 4KGIA 1HNCA 1AQWA 4OCEA 4OWYA 5ENUA 2CAQA 3E9JB 3CYNA 5H5RA 3TRXA 3F4SA 4ECBA 1CQHA 3FYGA 1V58A 4N0ZA 3CSHA 3TKRA 2EIRA 4MJCA 1ILOA 4AGSA 3M8NA 4NV5A 3W8SA 1O7UA 1HQOA 4XS6A 4POKA 2LNSA 5GSSA 3BOAA 3HYPA 3QAGA 2JZSA 5FHIA 1EV4A 5CRWA 3KH7A 4K7OA 2IMIA 4MZWA 2GZPA 2XPDA 1SYRA 2XC2A 4G19A 4JR6A 4ISDA 1GL8A 2LSTA 2B5EA 1ZZYA 1BEDA 2PWJA 5DALA 5JCUA 4POLA 5CP1A 3LORA 2LEGA 4MCUA 2QKEA 5LNKe 3FZ5A 1K0NA 2H1DA 3NIVA 3ME7A 1GSQA 1XWKA 3GKNA 5B6MA 2LQQA 1VRSD 4P3YB 7GSSA 4MF5A 2H0IA 4IP1A 4Z2TA 1M9BA 4Z7XA 3DEXA 2VIMA 3DD3A 1OAZA 3KH9A 3A3TA 3CRUA 4ZL7A 5C04A 2C0EA 4YQMA 2YZHA 2K9FA 3C7MA 4TOPA 4TXVA 5ECSA 5DVBA 4JEDA 2VCTA 1EP7A 2R37A 4DSSA 3L9SA 2M80A 1V57A 2HT9A 3HA9A 2YWOA 4G0KA 1HYUA 3IC4A 2WCIA 3RPPA 5IOXA 2K8SA 1C72A 3QAWA 5INYA 2VL3A 1XOAA 1TRWA 4DSRA 2VD0A 3GHAA 3GMFA 4ZB6A 3WGXA 3MNGA 3GX0A 2HZEB 5DQSA 3TJFA 3IOSA 4ECIA 2HNLA 1KTEA 4Q5QA 5LD0A 2LRCA 1B4PA 5D9TA 2GQLA 3C73A 3I69A 4L5OA 4QQ7A 1H75A 1ABAA 2L5LA 4KDXA 1SKWB 1TP9A 2JSZA 4BVXA 4I2TA 1RK4A 2CQ9A 3ZIJA 4K2XA 4KF9A 4PNFA 3GL3A 3QDNA 2FCHA 5ECIB 3SBCA 3PGTA 1OE8A 4I2UA 4TXOA 4Z2RA 3CTFA 2TRCP 4G0LA 1EGOA 4JE1A 4H86A 4FIWA 3A5WA 1NHOA 4GSTA 5GAPD 4K0NA 1F9MA 1CQGA 1R5AA 4EIQA 3HZ8A 4WBRD 2ON7A 3FZAA 2YCDA 5CAXA 3F8UA 1F3BA 2ALBA 3TKSE 5EY6A 4EUYA 2OACA 5DBQA 5GSTA 5H5QA 2JZRA 2VCQA 2H30A 5H5SA 3FZ4A 1QK8A 5KN2A 2H76A 4FO5A 4MLYA 2R5GA 2GSRA 3N9JA 4BL7B 3LG6A 1EOGA 1J0FA 3NOFA 3LJRA 2M46A 3ZFBA 1YDKA 2BMXA 4CDOA 2HYXA 2JU5A 2X49A 1XW9A 4HQZA 1TXXA 2H71A 5ECMB 2YV9A 1R26A 1K0CA 2DLXA 1O8WA 2HRFA 5IMVA 1W89A 1XFLA 2PVQA 2YNXA 3I6AA 5F06A 3A2XA 5IPGA 2LUSA 1QXHA 3VURA 2AYTA 2LJKA 3RHCA 2F8AA 3VPTA 5F05A 1H4OA 1SKSB 3CBUA 1WP0A 2FGXA 4MJAA 1JZDA 3MIXA 3PR8A 3GKMA 3BBYA 2CAIA 4GWRA 4K5RA 1TKDB 2H19A 3GA4A 2IPAA 2DIZA 3HJOA 1NM3A 1Q4JA 4D73B 4KCEA 1K0MA 3GKXA 4XIHA 4GQFA 4RI7A 3IHQA 4EXJA 6GSVA 1OVNA 4IJ3A 2OBIA 5LCZA 4ZXGA 1GULA 2IL3A 3MSZA 3KZQA 4KDUA 2LRTA 4RUVA 2WDUA 2QA1A 4WEYA 2H6ZA 3Q19A 3F3QA 1A8YA 2BTOT 1QFNA 4KNDA 1FHEA 2R3XA 4KH7A 1XOBA 4MABA 1S3AA 1YZXA 3UJ1A 3FK8A 3W6GA 3KMNA 4YAVA 1GTIA 3VK9A 2P31A 4ZL9A 1XVQA 2FY6A 5F07A 1YF1A 4XTSA 1PQNA 3RHBA 3PPUA 3GL5A 2ZNMA 1SL1B 2VOCA 2A2RA 4OCFA 1R4WA 5G1LA 3QFBC 2YWMA 1YJ6A 4HZ4A 1SENA 1VGLA 1SYXA 2FWFA 2PPTA 1ZOFA 5B6NA 2E0QA 3W8JA 2C3QA 4ID0A 3UVHA 3KJYA 3D4MA 4XS4B 2R2JA 3QMXA 3S9FA 1BYEA 3LW9A 4ACSA 2MYGA 4O92A 2D2ZA 4O7HA 1EEJA 2GS3A 1TU8A 2E2MA 1EWXA 1WE0A 2MBSA 1ERTA 4ZILA 4EL1A 5ECOB 1XW6A 4IQAA 1BQ7A 2DJ1A 2EIQA 2N5AA 3F4TA 5JWOB 4LLRA 3ED3A 3D21A 3ISOA 4WXTA 1PGTA 3Q6OA 3M9JA 3LXTA 5ID2B 3I43A 4V2LA 3ZITA 3G7JA 3Q74A 2A2PA 5IMCA 1VF4A 2HE3A 5BRTA 4MPFA 2MBTA 5IQYA 1TK5B 2GZZA 3APOA 2H70A 2J23A 1EP8A 4I97A 1HNBA 1XWAA 2IMEA 4HI7A 3DYRA 4MJBA 1MDKA 4RQXA 1MTCA 5J9BA 4ZBAA 3GURA 1X5DA 4XRDA 4PUFC 3M9KA 3H79A 1U88A 1TI3A 4ECCA 4GLTA 2DJ3A 2LKUA 1B48A 2A4VA 3I9V2 1SKRB 3QOUA 1A2MA 2XHFA 2L6DA 2QA2A 4MK3A 5D9XA 1X9WB 4HJMA 4ZBDA 3DRNA 5ECQB 3GFKA 3NZNA 2KHPA 1FVKA 4XHMA 3ZMKA 3GTUB 1EZKA 4LL1B 4EC0A 1R5PA 3UARA 4WF4A 4IELA 3HZ4A 2EIOA 1WWJA 5AN1A 3RDWA 1FW1A 2YANA 3ZIVA 1O81A 2REMA 3GYKA 20GSA 3CMIA 4BVYB 2V1MA 3WYWA 4TR1A 5KOWA 3KEBA 2I4AA 3MYDA 2NBSA 3J7Yb 1QQ2A 4K7NA 3F6DA 4O5RA 4FYBA 1GSFA 1YEXA 4AJ7A 4HOJA 2HFDA 1PL1A 5HFGA 3ZFLA 2LNTA 1J9BA 1JZWA 3IV4A 4GSNA 2Z9SA 3GX8A 8GSSA 2JACA 2F9SA 1LU4A 1M7TA 1S3CA 4Q5NA 2B5XA 1M2AA 2YOIA 3L78A 1XZOA 4J57E 3OR5A 1SL2B 1ZMAA 3HVVA 2F8FA 4RI6A 2I3YA 1G7OA 1GNEA 2H73A 4F03A 1G6YA 3EU4A 4BWQA 2L5OA 2VM1A 3DXBA 2YV7A 3LEFA 1ST9A 5ELAA 2M72A 1PMTA 2GTUA 3TB2A 3H93A 3N5OA 2I1UA 2C80A 4NMUA 1IYHA 3D22A 3WT1A 3F0IA 4PQ1A 4TN8A 3D5JA 1T4ZA 2GSSA 4NPBA 2R0GA 5D9VA 5DCGA 1K0AA 1GTBA 3IK7A 3KD0A 2DJKA 4PX1A 4I8BA 1Y25A 2E2GA 2V6KA 4HJ2A 2K18A 2C0FA 4PUAA 5L71A 2WS2A 2R0PA 4MJEA 2FUG2 3ERGA 1FVJA 1FB0A 1LBKA 5DQYA 3DGQA 3DVWA 3APSA 5G2ZA 2YZUA 4PQIA 1M9AA 3AY8A 3HXSA 2GLRA 3Q18A 5FT3A 1TDIA 2PVOC 5D9WA 4Q5FA 1PX7A 3QR6A 1OC3A 4EDYA 1U3IA 3QCPA 4YQVA 3EWLA 3US3A 1IYIA 2R0CA 3FHKA 5B8BA 2VLVA 2K6VA 1M2BA 2DC5A 4YQUA 2FD3A 3DVXA 2PBJA 2VL2A 2X64A 2LJAA 1THXA 1X5EA 1Z6MA 3ZLPA 2HRKA 3GIXA 2IFQB 5JCWA 3R2QA 3IPZA 17GSA 4POBA 3HJPA 2IN3A 4NHZA 5GZZB 4N10A 4E8EA 5A5KA 3LYKA 2KLXA 4EVMA 3PH9A 2TRXA 1MD4A 1JLWA 4OFNA 1PD21 3ZMLA 1E6BA 4ZBBA 3IHGA 2WRTA 4V2MA 4TR4A 3TJBA 1PKWA 4IJIA 5IMZA 4MH3A 4NHWA 4FH8A 2G0FA 4E8HA 3R3EA 4N11A 2OE1A 3G7YA 2F51A 1X9SB 1O73A 2GSTA 1ACVA 3QAVA 3TKSA 2IFQA 1TU7A 2HZEA 4ZB9A 5EVOA 3O6TA 1Z7RA 2H6YA 2V6OA 4IBPA 4WKWA 2HSMA 3TOUA 1Z6NA 3HD5A 4JU5A 2YJ7A 4GQCA 4HS1A 4OO4A 4ML6A 2FWEA 3TRPA 3F63A 1G7EA 4OO5A 3EURA 2C0GA 5IIZA 4KX4A 2CX4A 4IHUA 2O85A 3PINA 4IQ1A 4MPGA 4IW9A 2OJLA 3LFLA 3UVTA 5JWQB 4CY8A 3CRTA 1Q98A 3KCMA 4KUNA 2LV3A 1A2LA 2B7KA 5KEJA 1S3DA 1FO5A 1GTUA 3BJ5A 4DVCA 1EV9A 4A5PA 1AIUA 4ULXA 4AJ8A 2B1LA 4K2DA 2XBQA 1UC7A 4L0WA 1ZL9A 4MMMA 3GV1A 4BL7A 1JZOA 1TJDA 1KBNA 4MZCA 3IAM2 2FWGA 5IO0A 1B9XC 1GLPA 1OC8A 1U6TA 1DE1A 4TKYA 3VI5A 2VL9A 2L6CA 3ME8A 2HSHA 1A24A 4CHSA 2JZTA 4YH2A 1T7PB 3ZTLA 1XVWA 3P2AA 4F0BA 2R6KA 3F6FA 3JCML 1GSSA 2AB6A 3A2WA 2H0HA 6GSWA 1DBYA 1VF3A 3TOTA 2DMLA 2L4QA 3EYTA 5ECPB 4MF6A 1AQVA 1K0BA 3O76A 1T3BA 4DEJA 5CRDA 2H72A 2MMZA 4HU7A 3P8WA 4NWYA 5ELGA 2OADA 5G5FA 1GRXA 5ECKB 3IAS2 1F3AA 18GSA 4D73A 1WOUA 2VUPA 1RW1A 1VF2A 2G2QA 2DBCA 5AIVA 3TKQA 2KOKA 1N2AA 5AGYA 3HKRA 3IRAA 2FA4A 1V2AA 2DKHA 4GTUA 2C1YA 1SJ6A 1SU9A 3APQA 4O5UA 2IMKA 3VFIA 1ML6A 2P5RA 2NPBA 2RUEA 4PGTA 1PKZA 2H8LA 1GSUA 1M2DA 1ZYQB 4Q5RA 3H1NA 3ERFA 4NAXA 4PQHA 1ERVA 2V32A 2GGTA 2NVLA 3M0FA 1NSWA 4LMWA 1YF0A 3VWXA 2HXKA 6GSTA 4RQRA 5JWRB 2JSYA 5D93A 2RM6A 19GSA 2C8UA 1SD8A 4GF0A 1AC1A 4ML1A 2HZFA 4ZIJA 1TTZA 4OFMA 5G1KA 4CY6A 2GDRA 4XS4A 2MMAA 3CSJA 4J2FA 3KP8A 3GH9A 4HUAA 2O89A 5DDLA 1XIYA 2HI7A 2LJRA 1ZYNA 1K3LA 3RAZA 2L57A 3VPQA 1JFUA 1XBSA 2LTKA 2WULA 2GZYA 3TDGA 1X5CA 1TRVA 4WETA 2KP1A 3IK9A 2V41A 2WB9A 4IKHA 3IA1A 2P0GA 3LSZA 5HR0A 3KTBA 1AW9A 3UAPA 5D8IA 1SK0A 5ID2A 1XPVA 4G0IA 1OC9B 1T4YA 4G9HA 1USBA 4HQSA 3ZREA 2ZCTA 3KTLA 1R7HA 4G10A 4NXIA 2JL4A 1DSBA 1YY7A 4MZBA 6GSXA 3ERWA 1ON4A 2TIRA 1M0UA 4GCIA 4K0GA 4GRFA 3A5IA 2ZUPA 1FB6A 3FZ9A 3TCOA 2VCXA 4L0UA 4NV2A 12GSA 2GQKA 1DUGA 3KGKA 2WZ9A 2CVBA 1A23A 5J41A 2XPEA 3F9UA 2GQMA 1EOHA 4KB3A 3UEMA 1ZCPA 4MF7A 1AUCA 1O6JA 5DAKB 1ERUA 3F4RA 4FYCA 1MDJA 1NHYA 4K7IA 6GSYA 2AHEA 4HDEA 4X43A 2QGVA 3F3RA 2VM2A 3D6IA 2RUFA 1V9WA 1GUHA 3BCIA 1UVZA 5IOWA 4Z2UA 4YAPA 1WJKA 2N5BA 3TJGA 2CX3A 4HZ2A 1GWCA 1UA5A 2LRNA 2OBKA 4MA9A 2GT5A 3GTUA 3DIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F2I A;  2AV4 A;  2FHE A;  2AUV A;  2IIY A;  5HR2 A;  1PA3 A;  5ECL B;  4WBJ A;  2PU9 C;  2GSQ A;  1Z7P A;  1YKC A;  1XWC A;  5HFK A;  3FKF A;  5F8B A;  3IE3 A;  2HRN A;  1B8X A;  2VLU A;  5F0G A;  2K8V A;  2PN8 A;  1WMJ A;  4IS0 A;  3UBL A;  2H66 A;  4BVY A;  3TJJ A;  1ZYE A;  5DAL B;  2VO4 A;  6GSU A;  1K3Y A;  5DAK A;  4L5L A;  3K8N A;  1BX9 A;  4KSM A;  1W4V A;  3GST A;  1MDI A;  3FW2 A;  5ECH B;  4K9Z A;  4BA7 A;  1OYJ A;  2OE3 A;  1K0D A;  3A2V A;  2DSA A;  2FNO A;  4IN0 A;  3UBK A;  4ZB8 A;  5AIS A;  3L9V A;  3IBH A;  1THO A;  5J3R A;  5IO2 A;  1T00 A;  1BG5 A;  4IGJ A;  3FEU A;  3U6V A;  2B3S A;  5G30 A;  2PMT A;  3HVS A;  1QUW A;  4X1U A;  4DSS B;  2V2G A;  4EO3 A;  1MEK A;  3UMA A;  5CYY A;  5D96 A;  2RII A;  2H0G A;  2H6X A;  5G31 A;  2B6M A;  3L9U A;  3MWH A;  5D73 A;  1E2Y A;  3VLN A;  4BPY A;  1SD9 A;  4K8M A;  3QPM A;  3EC3 A;  1TRS A;  3FY7 A;  5COH A;  3QFA C;  2DJ0 A;  4TRX A;  2CZ3 A;  5J9C A;  5E59 A;  2XBI A;  2QC7 A;  3IXR A;  5A4V A;  1O8X A;  3KMO A;  1K3O A;  2DJJ A;  2C0D A;  2VL2 C;  1SK2 A;  1J08 A;  2VCV A;  3LXZ A;  3RPN A;  3FR6 A;  4TR0 A;  4CW9 A;  3FRC A;  1A8L A;  5HQP A;  1UN2 A;  2AAW A;  4JBB A;  3E3E A;  11GS A;  2A2S A;  5EPF A;  1FAA A;  5ECR B;  3L4N A;  2O7K A;  2O8V B;  5HR1 A;  2N5F A;  4TXO B;  2YP6 A;  4MP4 A;  3C1S A;  1QGV A;  3H4K A;  2NTO A;  4KAE A;  4AF2 A;  3CTG A;  1YKA A;  3TKP A;  4V2N A;  2IMF A;  1GUM A;  2CV4 A;  4PXO A;  22GS A;  3QD9 A;  3EMP A;  5KN0 A;  2GT6 A;  1SJZ A;  4TW5 A;  4POM A;  1TK0 B;  3D0Z A;  3HHV A;  1GTA A;  5ECN B;  4JRR A;  3VWV A;  3MAK A;  3GRX A;  2H1G A;  4LMV A;  3SWL A;  5GAN D;  5A4U A;  1RQM A;  1FOV A;  3RBT A;  1Z3E A;  2H1A A;  3TKS C;  2WFC A;  3UL3 A;  6GSS A;  5J5N A;  1EEM A;  4X0X A;  2MMO A;  1FG4 A;  2VD1 A;  3ZZX A;  3HDC A;  3CXG A;  2RLI A;  3E0U A;  2YWI A;  3DWV A;  2NDO A;  4G2E A;  1GUK A;  2KP2 A;  2X8H A;  3H8Q A;  1TW9 A;  4LA1 A;  1PRX A;  1VF1 A;  4BWS A;  4KCA A;  3VWU A;  1B4Q A;  2HLS A;  4KSO A;  1YQ1 A;  1OE7 A;  2VCW A;  3HJM A;  2PUK C;  1Z5Y E;  5IM9 A;  3ZYW A;  3HY2 A;  5C00 A;  1V98 A;  1F2E A;  4F9Z A;  1N8J A;  4TVE A;  5HR3 A;  1SJI A;  9GSS A;  2IJY A;  4N30 A;  3GH6 A;  3O3T A;  2H01 A;  1M99 A;  2CVD A;  1I9D A;  2F3M A;  5CNW A;  3C8E A;  5KN3 A;  2WGR A;  1ERW A;  3KXO A;  2OKA A;  1EGR A;  5J4U A;  2P5Q A;  3M1G A;  1TRU A;  3U5R E;  5IMA A;  2MMN A;  2WJU A;  4DSQ A;  4PNG A;  4LL4 B;  4TR3 A;  3EVI A;  2CA8 A;  4KDY A;  4MDC A;  1XXU A;  4F0C A;  3J7Y k;  4OMV A;  4ZL8 A;  2C3T A;  3ZVJ A;  5IMD A;  3P7X A;  2X8C A;  3DML A;  2H74 A;  4GSS A;  1TOF A;  1TK8 B;  1PSQ A;  1KNG A;  2J9H A;  5CRE A;  1YEP A;  1SL0 B;  3BCK A;  2H1B A;  4QL9 A;  4QL7 A;  1GP1 A;  2YPM A;  1I5G A;  2RM5 A;  3L0H A;  1JZR A;  3KP9 A;  3GSS A;  3D4T A;  1SK1 A;  4L8E A;  3KM6 A;  3VI7 A;  1F6M C;  2VCZ A;  2VLT A;  2CT6 A;  1X0R A;  4WR4 A;  3LYP A;  1GNW A;  3EIN A;  2YWN A;  3TGZ A;  3VWW A;  3V1W A;  3G7I A;  4GXZ A;  3WGE A;  1MD3 A;  4EE0 A;  2B7J A;  1DE2 A;  2X99 A;  1AXD A;  1U87 A;  3P90 A;  1B9Y C;  2FWH A;  2ES7 A;  3LWA A;  1KEB A;  3CSI A;  5DJL A;  2OE0 A;  2C3N A;  1AAZ A;  4ECJ A;  2AJQ B;  1ZGN A;  3KIJ A;  4V1A p;  3EMX A;  3HCZ A;  1OKD A;  4XRA A;  1XW5 A;  4ILF A;  4XCS A;  3DKS A;  5A4W A;  1HD2 A;  4I5Q A;  2DJ2 A;  3C1R A;  4MH2 A;  5DCH A;  2B1K A;  1PL2 A;  3UOM A;  4EKZ A;  3TUE A;  2R4V A;  3LQ7 A;  4V1A g;  1G0T A;  1HNA A;  2VAF A;  5IPH A;  5B8A A;  1URM A;  2B5Y A;  5KN1 A;  5AIX A;  2LS5 A;  2IMD A;  3C71 A;  4EF0 A;  4XS1 A;  2X8G A;  4JZQ A;  4K6X A;  4N0V A;  2MZC A;  4OFT A;  2DIY A;  5FWG A;  3IR4 A;  3EE2 A;  4O32 A;  3GUS A;  2CZ2 A;  4PUR A;  5CO3 A;  1WIK A;  5CRG A;  5G5E A;  2FA8 A;  4KA0 A;  1V40 A;  1GSD A;  3FR3 A;  2I81 A;  3WT2 A;  1BAY A;  3WD6 A;  16GS A;  3ZL5 A;  10GS A;  2YJH A;  3HVX A;  1BJX A;  5JCG A;  2JAD A;  4JR4 A;  4WF5 A;  1OKT A;  2LQO A;  1F37 A;  1XWG A;  1AQX A;  2I9H A;  3EU3 A;  2OA7 A;  3M3M A;  5IMF A;  3ZVJ D;  2L4C A;  2ON5 A;  5E4W A;  1A0R P;  1GH2 A;  4TR1 B;  1Y6E A;  1XCC A;  1GSY A;  3WGD A;  4FYU A;  2PER A;  3FR9 A;  4F82 A;  1G6W A;  4EDZ A;  4AJ6 A;  1PX6 A;  3TJK A;  2EC4 A;  13GS A;  1Z9H A;  2FLS A;  2HSY A;  3GNJ A;  5DJM A;  2KUC A;  2QSI A;  5B7C A;  2L59 A;  3ZRD A;  2BJX A;  3UIW A;  4KW6 A;  14GS A;  1WPI A;  2GVP A;  3LGC A;  4IVF A;  1U3A A;  2YN1 A;  5ABR A;  4IP6 A;  1A0F A;  5EL8 A;  1XWB A;  3G9B A;  1QMV A;  5HFI A;  3TRQ A;  1T8E B;  1TI1 A;  3GN3 A;  1WRY A;  1GLQ A;  2PGT A;  1JHB A;  1JLV A;  1OC9 A;  4J56 E;  1T1V A;  3MDK A;  2CVK A;  3BD2 A;  5CRH A;  4HU9 A;  2DMM A;  1K0O A;  4OD7 A;  3IDV A;  3GKK A;  4I6X A;  1A2J A;  2O87 A;  2C4J A;  1LJR A;  4K1F A;  1X9M B;  1PN9 A;  4HEA 2;  4KE3 A;  2H75 A;  4WR5 A;  1GSE A;  1NW2 A;  1O85 A;  2E7P A;  2IWT A;  4KGI A;  1HNC A;  1AQW A;  4OCE A;  4OWY A;  5ENU A;  2CAQ A;  3E9J B;  3CYN A;  5H5R A;  3TRX A;  3F4S A;  4ECB A;  1CQH A;  3FYG A;  1V58 A;  4N0Z A;  3CSH A;  3TKR A;  2EIR A;  4MJC A;  1ILO A;  4AGS A;  3M8N A;  4NV5 A;  3W8S A;  1O7U A;  1HQO A;  4XS6 A;  4POK A;  2LNS A;  5GSS A;  3BOA A;  3HYP A;  3QAG A;  2JZS A;  5FHI A;  1EV4 A;  5CRW A;  3KH7 A;  4K7O A;  2IMI A;  4MZW A;  2GZP A;  2XPD A;  1SYR A;  2XC2 A;  4G19 A;  4JR6 A;  4ISD A;  1GL8 A;  2LST A;  2B5E A;  1ZZY A;  1BED A;  2PWJ A;  5DAL A;  5JCU A;  4POL A;  5CP1 A;  3LOR A;  2LEG A;  4MCU A;  2QKE A;  5LNK e;  3FZ5 A;  1K0N A;  2H1D A;  3NIV A;  3ME7 A;  1GSQ A;  1XWK A;  3GKN A;  5B6M A;  2LQQ A;  1VRS D;  4P3Y B;  7GSS A;  4MF5 A;  2H0I A;  4IP1 A;  1M9B A;  4Z7X A;  3DEX A;  2VIM A;  3DD3 A;  1OAZ A;  3KH9 A;  3A3T A;  3CRU A;  4ZL7 A;  5C04 A;  2C0E A;  4YQM A;  2YZH A;  2K9F A;  3C7M A;  4TOP A;  4TXV A;  5ECS A;  5DVB A;  4JED A;  2VCT A;  1EP7 A;  2R37 A;  4DSS A;  3L9S A;  2M80 A;  1V57 A;  2HT9 A;  3HA9 A;  2YWO A;  1HYU A;  3IC4 A;  2WCI A;  3RPP A;  5IOX A;  2K8S A;  1C72 A;  3QAW A;  5INY A;  2VL3 A;  1XOA A;  1TRW A;  4DSR A;  2VD0 A;  3GHA A;  3GMF A;  4ZB6 A;  3WGX A;  3MNG A;  3GX0 A;  2HZE B;  5DQS A;  3TJF A;  3IOS A;  4ECI A;  2HNL A;  1KTE A;  4Q5Q A;  5LD0 A;  2LRC A;  1B4P A;  5D9T A;  2GQL A;  3C73 A;  3I69 A;  4L5O A;  4QQ7 A;  1H75 A;  1ABA A;  2L5L A;  4KDX A;  1SKW B;  1TP9 A;  2JSZ A;  4BVX A;  4I2T A;  1RK4 A;  2CQ9 A;  3ZIJ A;  4PNF A;  3GL3 A;  3QDN A;  2FCH A;  5ECI B;  3SBC A;  3PGT A;  1OE8 A;  4I2U A;  4TXO A;  3CTF A;  2TRC P;  1EGO A;  4H86 A;  4JE1 A;  4FIW A;  3A5W A;  1NHO A;  4GST A;  5GAP D;  4K0N A;  1F9M A;  1CQG A;  1R5A A;  3HZ8 A;  4WBR D;  2ON7 A;  3FZA A;  2YCD A;  5CAX A;  3F8U A;  1F3B A;  2ALB A;  3TKS E;  5EY6 A;  4EUY A;  2OAC A;  5DBQ A;  5GST A;  5H5Q A;  2JZR A;  2VCQ A;  2H30 A;  5H5S A;  3FZ4 A;  1QK8 A;  5KN2 A;  2H76 A;  4FO5 A;  4MLY A;  2R5G A;  2GSR A;  3N9J A;  3LG6 A;  1EOG A;  1J0F A;  3NOF A;  3LJR A;  2M46 A;  3ZFB A;  1YDK A;  2BMX A;  4CDO A;  2HYX A;  2JU5 A;  1XW9 A;  4HQZ A;  1TXX A;  2H71 A;  5ECM B;  2YV9 A;  1R26 A;  1K0C A;  2DLX A;  1O8W A;  2HRF A;  5IMV A;  1W89 A;  1XFL A;  2PVQ A;  2YNX A;  3I6A A;  5F06 A;  3A2X A;  5IPG A;  2LUS A;  1QXH A;  3VUR A;  2AYT A;  2LJK A;  3RHC A;  2F8A A;  3VPT A;  5F05 A;  1H4O A;  1SKS B;  3CBU A;  1WP0 A;  2FGX A;  4MJA A;  1JZD A;  3PR8 A;  3GKM A;  3BBY A;  2CAI A;  4GWR A;  1TKD B;  2H19 A;  3GA4 A;  2IPA A;  2DIZ A;  3HJO A;  1NM3 A;  1Q4J A;  4D73 B;  4KCE A;  1K0M A;  3GKX A;  4XIH A;  4GQF A;  4RI7 A;  3IHQ A;  4EXJ A;  6GSV A;  1OVN A;  4IJ3 A;  2OBI A;  5LCZ A;  4ZXG A;  1GUL A;  2IL3 A;  3MSZ A;  3KZQ A;  4KDU A;  2LRT A;  4RUV A;  2WDU A;  4WEY A;  2H6Z A;  3Q19 A;  3F3Q A;  1A8Y A;  2BTO T;  1QFN A;  4KND A;  1FHE A;  2R3X A;  4KH7 A;  1XOB A;  4MAB A;  1S3A A;  1YZX A;  3UJ1 A;  3FK8 A;  3W6G A;  3KMN A;  4YAV A;  1GTI A;  3VK9 A;  2P31 A;  4ZL9 A;  1XVQ A;  2FY6 A;  5F07 A;  1YF1 A;  4XTS A;  1PQN A;  3RHB A;  3GL5 A;  2ZNM A;  1SL1 B;  2VOC A;  2A2R A;  4OCF A;  1R4W A;  5G1L A;  3QFB C;  2YWM A;  1YJ6 A;  4HZ4 A;  1SEN A;  1VGL A;  1SYX A;  2FWF A;  2PPT A;  1ZOF A;  5B6N A;  2E0Q A;  3W8J A;  2C3Q A;  4ID0 A;  3UVH A;  3KJY A;  3D4M A;  4XS4 B;  2R2J A;  3QMX A;  3S9F A;  1BYE A;  4ACS A;  2MYG A;  4O92 A;  2D2Z A;  4O7H A;  1EEJ A;  2GS3 A;  1TU8 A;  2E2M A;  1EWX A;  1WE0 A;  2MBS A;  1ERT A;  4ZIL A;  4EL1 A;  5ECO B;  1XW6 A;  4IQA A;  1BQ7 A;  2DJ1 A;  2EIQ A;  2N5A A;  3F4T A;  5JWO B;  4LLR A;  3ED3 A;  3D21 A;  3ISO A;  4WXT A;  1PGT A;  3Q6O A;  3M9J A;  3LXT A;  5ID2 B;  3I43 A;  4V2L A;  3ZIT A;  3G7J A;  3Q74 A;  5IMC A;  1VF4 A;  2HE3 A;  4MPF A;  2MBT A;  5IQY A;  1TK5 B;  2GZZ A;  3APO A;  2H70 A;  2J23 A;  1EP8 A;  4I97 A;  1HNB A;  1XWA A;  2IME A;  4HI7 A;  3DYR A;  4MJB A;  1MDK A;  4RQX A;  1MTC A;  5J9B A;  4ZBA A;  3GUR A;  1X5D A;  4XRD A;  4PUF C;  3M9K A;  3H79 A;  1U88 A;  1TI3 A;  4ECC A;  4GLT A;  2DJ3 A;  2LKU A;  1B48 A;  2A4V A;  3I9V 2;  1SKR B;  3QOU A;  1A2M A;  2XHF A;  2L6D A;  4MK3 A;  5D9X A;  1X9W B;  4HJM A;  4ZBD A;  3DRN A;  5ECQ B;  3GFK A;  3NZN A;  2KHP A;  1FVK A;  4XHM A;  3ZMK A;  3GTU B;  1EZK A;  4LL1 B;  4EC0 A;  1R5P A;  3UAR A;  4WF4 A;  4IEL A;  3HZ4 A;  2EIO A;  1WWJ A;  5AN1 A;  3RDW A;  1FW1 A;  2YAN A;  3ZIV A;  1O81 A;  2REM A;  3GYK A;  20GS A;  3CMI A;  2V1M A;  3WYW A;  4TR1 A;  3KEB A;  2I4A A;  2NBS A;  3J7Y b;  1QQ2 A;  4K7N A;  3F6D A;  4O5R A;  4FYB A;  1GSF A;  1YEX A;  4AJ7 A;  4HOJ A;  2HFD A;  1PL1 A;  5HFG A;  3ZFL A;  2LNT A;  1J9B A;  1JZW A;  3IV4 A;  4GSN A;  2Z9S A;  3GX8 A;  8GSS A;  2JAC A;  2F9S A;  1LU4 A;  1M7T A;  1S3C A;  4Q5N A;  2B5X A;  1M2A A;  2YOI A;  3L78 A;  1XZO A;  4J57 E;  3OR5 A;  1SL2 B;  1ZMA A;  3HVV A;  2F8F A;  4RI6 A;  2I3Y A;  1G7O A;  1GNE A;  2H73 A;  4F03 A;  1G6Y A;  3EU4 A;  4BWQ A;  2L5O A;  2VM1 A;  3DXB A;  2YV7 A;  3LEF A;  1ST9 A;  5ELA A;  2M72 A;  1PMT A;  2GTU A;  3TB2 A;  3H93 A;  3N5O A;  2I1U A;  2C80 A;  4NMU A;  1IYH A;  3D22 A;  3WT1 A;  3F0I A;  4PQ1 A;  4TN8 A;  3D5J A;  1T4Z A;  2GSS A;  4NPB A;  5DCG A;  5D9V A;  1K0A A;  1GTB A;  3IK7 A;  3KD0 A;  2DJK A;  4PX1 A;  4I8B A;  1Y25 A;  2E2G A;  2V6K A;  4HJ2 A;  2K18 A;  2C0F A;  4PUA A;  5L71 A;  2WS2 A;  4MJE A;  2FUG 2;  3ERG A;  1FVJ A;  1FB0 A;  1LBK A;  5DQY A;  3DGQ A;  3DVW A;  3APS A;  5G2Z A;  2YZU A;  4PQI A;  1M9A A;  3AY8 A;  3HXS A;  2GLR A;  3Q18 A;  5FT3 A;  1TDI A;  2PVO C;  5D9W A;  4Q5F A;  1PX7 A;  3QR6 A;  1OC3 A;  4EDY A;  1U3I A;  3QCP A;  4YQV A;  3EWL A;  3US3 A;  1IYI A;  3FHK A;  5B8B A;  2VLV A;  2K6V A;  1M2B A;  2DC5 A;  4YQU A;  2FD3 A;  3DVX A;  2PBJ A;  2VL2 A;  2X64 A;  2LJA A;  1THX A;  1X5E A;  1Z6M A;  3ZLP A;  3GIX A;  2IFQ B;  5JCW A;  3R2Q A;  3IPZ A;  17GS A;  4POB A;  3HJP A;  2IN3 A;  4NHZ A;  5GZZ B;  4N10 A;  4E8E A;  5A5K A;  3LYK A;  2KLX A;  4EVM A;  3PH9 A;  2TRX A;  1MD4 A;  1JLW A;  4OFN A;  1PD2 1;  3ZML A;  1E6B A;  4ZBB A;  2WRT A;  4V2M A;  4TR4 A;  3TJB A;  1PKW A;  4IJI A;  5IMZ A;  4MH3 A;  4NHW A;  4FH8 A;  2G0F A;  4E8H A;  4N11 A;  2OE1 A;  3G7Y A;  2F51 A;  1X9S B;  1O73 A;  2GST A;  1ACV A;  3QAV A;  3TKS A;  2IFQ A;  1TU7 A;  2HZE A;  4ZB9 A;  5EVO A;  3O6T A;  1Z7R A;  2H6Y A;  2V6O A;  4IBP A;  4WKW A;  3TOU A;  1Z6N A;  3HD5 A;  4JU5 A;  2YJ7 A;  4GQC A;  4HS1 A;  4OO4 A;  4ML6 A;  2FWE A;  3TRP A;  3F63 A;  1G7E A;  4OO5 A;  3EUR A;  2C0G A;  5IIZ A;  4KX4 A;  2CX4 A;  4IHU A;  2O85 A;  3PIN A;  4IQ1 A;  4MPG A;  4IW9 A;  2OJL A;  3LFL A;  3UVT A;  5JWQ B;  3CRT A;  1Q98 A;  3KCM A;  4KUN A;  2LV3 A;  1A2L A;  2B7K A;  5KEJ A;  1S3D A;  1FO5 A;  1GTU A;  3BJ5 A;  4DVC A;  1EV9 A;  1AIU A;  4ULX A;  4AJ8 A;  2B1L A;  4K2D A;  2XBQ A;  1UC7 A;  4L0W A;  1ZL9 A;  4MMM A;  3GV1 A;  4BL7 A;  1JZO A;  1TJD A;  1KBN A;  4MZC A;  3IAM 2;  2FWG A;  5IO0 A;  1B9X C;  1GLP A;  1OC8 A;  1U6T A;  1DE1 A;  4TKY A;  3VI5 A;  2VL9 A;  2L6C A;  3ME8 A;  2HSH A;  1A24 A;  4CHS A;  2JZT A;  4YH2 A;  1T7P B;  3ZTL A;  1XVW A;  3P2A A;  4F0B A;  2R6K A;  3F6F A;  3JCM L;  1GSS A;  2AB6 A;  3A2W A;  2H0H A;  6GSW A;  1DBY A;  1VF3 A;  3TOT A;  2DML A;  2L4Q A;  3EYT A;  5ECP B;  4MF6 A;  1AQV A;  1K0B A;  3O76 A;  1T3B A;  4DEJ A;  5CRD A;  2H72 A;  2MMZ A;  4HU7 A;  3P8W A;  4NWY A;  5ELG A;  2OAD A;  5G5F A;  1GRX A;  5ECK B;  3IAS 2;  1F3A A;  18GS A;  4D73 A;  1WOU A;  2VUP A;  1RW1 A;  1VF2 A;  2G2Q A;  2DBC A;  5AIV A;  3TKQ A;  2KOK A;  1N2A A;  5AGY A;  3HKR A;  3IRA A;  2FA4 A;  1V2A A;  4GTU A;  2C1Y A;  1SJ6 A;  1SU9 A;  3APQ A;  2IMK A;  3VFI A;  1ML6 A;  2P5R A;  2NPB A;  2RUE A;  4PGT A;  1PKZ A;  2H8L A;  1GSU A;  1M2D A;  1ZYQ B;  4Q5R A;  3H1N A;  3ERF A;  4NAX A;  4PQH A;  1ERV A;  2V32 A;  2GGT A;  2NVL A;  3M0F A;  1NSW A;  4LMW A;  1YF0 A;  3VWX A;  2HXK A;  6GST A;  4RQR A;  5JWR B;  2JSY A;  5D93 A;  2RM6 A;  19GS A;  2C8U A;  1SD8 A;  4GF0 A;  1AC1 A;  4ML1 A;  2HZF A;  4ZIJ A;  1TTZ A;  4OFM A;  5G1K A;  2GDR A;  4XS4 A;  2MMA A;  3CSJ A;  4J2F A;  3KP8 A;  3GH9 A;  4HUA A;  2O89 A;  5DDL A;  1XIY A;  2HI7 A;  2LJR A;  1K3L A;  3RAZ A;  2L57 A;  3VPQ A;  1JFU A;  1XBS A;  2LTK A;  2WUL A;  2GZY A;  3TDG A;  1X5C A;  1TRV A;  4WET A;  2KP1 A;  3IK9 A;  2V41 A;  2WB9 A;  4IKH A;  3IA1 A;  2P0G A;  3LSZ A;  5HR0 A;  3KTB A;  1AW9 A;  3UAP A;  5D8I A;  1SK0 A;  5ID2 A;  1XPV A;  1OC9 B;  1T4Y A;  4G9H A;  1USB A;  4HQS A;  3ZRE A;  2ZCT A;  3KTL A;  1R7H A;  4G10 A;  4NXI A;  2JL4 A;  1DSB A;  1YY7 A;  4MZB A;  6GSX A;  3ERW A;  1ON4 A;  2TIR A;  1M0U A;  4GCI A;  4K0G A;  4GRF A;  2ZUP A;  1FB6 A;  3FZ9 A;  3TCO A;  2VCX A;  4L0U A;  4NV2 A;  12GS A;  2GQK A;  1DUG A;  3KGK A;  2WZ9 A;  2CVB A;  1A23 A;  5J41 A;  2XPE A;  3F9U A;  2GQM A;  1EOH A;  4KB3 A;  3UEM A;  1ZCP A;  4MF7 A;  1AUC A;  1O6J A;  5DAK B;  1ERU A;  3F4R A;  4FYC A;  1MDJ A;  1NHY A;  4K7I A;  6GSY A;  2AHE A;  4HDE A;  4X43 A;  2QGV A;  3F3R A;  2VM2 A;  3D6I A;  2RUF A;  1V9W A;  1GUH A;  3BCI A;  1UVZ A;  5IOW A;  4YAP A;  1WJK A;  2N5B A;  3TJG A;  2CX3 A;  4HZ2 A;  1GWC A;  1UA5 A;  2LRN A;  2OBK A;  4MA9 A;  2GT5 A;  3GTU A;  3DIE A; 
#chains in the Genus database with same CATH topology
 4F2I A;  2AV4 A;  2FHE A;  2AUV A;  2IIY A;  5HR2 A;  1PA3 A;  5ECL B;  4WBJ A;  2PU9 C;  2GSQ A;  1Z7P A;  1YKC A;  1XWC A;  5HFK A;  3FKF A;  5F8B A;  3IE3 A;  2HRN A;  1B8X A;  2VLU A;  5F0G A;  2K8V A;  2PN8 A;  1WMJ A;  4FQU A;  4IS0 A;  3UBL A;  2H66 A;  4BVY A;  3TJJ A;  1ZYE A;  5DAL B;  2VO4 A;  6GSU A;  1K3Y A;  5DAK A;  4L5L A;  3K8N A;  1BX9 A;  4KSM A;  1W4V A;  3GST A;  1MDI A;  3FW2 A;  5ECH B;  4K9Z A;  4BA7 A;  1OYJ A;  2OE3 A;  1K0D A;  3A2V A;  2DSA A;  2FNO A;  4IN0 A;  3UBK A;  4ZB8 A;  5AIS A;  3L9V A;  3IBH A;  1THO A;  5J3R A;  5IO2 A;  1T00 A;  1BG5 A;  4IGJ A;  3FEU A;  3U6V A;  2B3S A;  5G30 A;  2PMT A;  3HVS A;  1QUW A;  4X1U A;  4DSS B;  2V2G A;  5BMU A;  4EO3 A;  1MEK A;  3UMA A;  5CYY A;  5D96 A;  2RII A;  2H0G A;  2H6X A;  5G31 A;  2B6M A;  3L9U A;  3MWH A;  5D73 A;  1E2Y A;  3VLN A;  4BPY A;  1SD9 A;  4K8M A;  3EPT A;  3QPM A;  3EC3 A;  1TRS A;  3FY7 A;  5COH A;  3QFA C;  2DJ0 A;  4TRX A;  2CZ3 A;  5J9C A;  5E59 A;  2XBI A;  5KOX A;  2QC7 A;  3IXR A;  5A4V A;  1O8X A;  3KMO A;  1K3O A;  2DJJ A;  4BVX B;  2C0D A;  2VL2 C;  1SK2 A;  1J08 A;  2VCV A;  3LXZ A;  3RPN A;  3FR6 A;  4TR0 A;  1PN0 A;  4CW9 A;  3FRC A;  1A8L A;  5HQP A;  1UN2 A;  2AAW A;  4JBB A;  3E3E A;  11GS A;  2A2S A;  5EPF A;  1FAA A;  5ECR B;  3L4N A;  2O7K A;  2O8V B;  5HR1 A;  2N5F A;  4TXO B;  2YP6 A;  4MP4 A;  3C1S A;  1QGV A;  3H4K A;  2NTO A;  4KAE A;  4AF2 A;  3CTG A;  1YKA A;  3TKP A;  4ICY A;  4V2N A;  2IMF A;  1GUM A;  2CV4 A;  4PXO A;  22GS A;  3QD9 A;  3EMP A;  5KN0 A;  2GT6 A;  1SJZ A;  4TW5 A;  4POM A;  1TK0 B;  3D0Z A;  3HHV A;  1GTA A;  5ECN B;  4JRR A;  3VWV A;  3MAK A;  3GRX A;  2H1G A;  4LMV A;  3SWL A;  5GAN D;  5A4U A;  1RQM A;  1FOV A;  3RBT A;  1Z3E A;  2H1A A;  3TKS C;  2WFC A;  3UL3 A;  6GSS A;  5J5N A;  1EEM A;  4X0X A;  2MMO A;  1FG4 A;  2VD1 A;  3ZZX A;  3HDC A;  3CXG A;  2RLI A;  3E0U A;  4YKF A;  2YWI A;  3DWV A;  2NDO A;  4G2E A;  1GUK A;  2KP2 A;  2X8H A;  3H8Q A;  1TW9 A;  4LA1 A;  1PRX A;  1VF1 A;  4BWS A;  4KCA A;  3VWU A;  1B4Q A;  2HLS A;  4KSO A;  1YQ1 A;  1OE7 A;  2VCW A;  3HJM A;  2A4H A;  2PUK C;  1Z5Y E;  5IM9 A;  3ZYW A;  3HY2 A;  5C00 A;  1V98 A;  4K5S A;  1F2E A;  4F9Z A;  1N8J A;  4TVE A;  5HR3 A;  1SJI A;  9GSS A;  2IJY A;  4N30 A;  3GH6 A;  3O3T A;  2H01 A;  1M99 A;  2CVD A;  1I9D A;  2F3M A;  4EIP A;  5CNW A;  3C8E A;  5KN3 A;  2WGR A;  1ERW A;  3KXO A;  2OKA A;  1EGR A;  5J4U A;  2P5Q A;  3M1G A;  1TRU A;  3U5R E;  5IMA A;  2MMN A;  2WJU A;  4DSQ A;  4PNG A;  4LL4 B;  4TR3 A;  3EVI A;  2CA8 A;  4KDY A;  4MDC A;  1XXU A;  4F0C A;  3J7Y k;  4OMV A;  4ZL8 A;  2C3T A;  3ZVJ A;  5IMD A;  3P7X A;  2X8C A;  3DML A;  2H74 A;  4GSS A;  1TOF A;  1TK8 B;  1PSQ A;  1KNG A;  2J9H A;  5CRE A;  1YEP A;  1SL0 B;  3BCK A;  2H1B A;  4QL9 A;  4QL7 A;  1GP1 A;  2YPM A;  1I5G A;  2RM5 A;  3L0H A;  1JZR A;  3KP9 A;  3GSS A;  3D4T A;  1SK1 A;  4L8E A;  3KM6 A;  3VI7 A;  1F6M C;  2VCZ A;  2VLT A;  2CT6 A;  1X0R A;  4WR4 A;  3LYP A;  1GNW A;  3EIN A;  2YWN A;  3TGZ A;  1ZYP A;  3VWW A;  3V1W A;  3G7I A;  4GXZ A;  3WGE A;  1MD3 A;  4EE0 A;  2B7J A;  1DE2 A;  2X99 A;  2UZ8 A;  1AXD A;  1U87 A;  2DKI A;  3P90 A;  1B9Y C;  2FWH A;  2ES7 A;  3LWA A;  1KEB A;  3CSI A;  5DJL A;  2OE0 A;  2C3N A;  1AAZ A;  4ECJ A;  2AJQ B;  1ZGN A;  3KIJ A;  4V1A p;  3EMX A;  3HCZ A;  1OKD A;  4XRA A;  1XW5 A;  4ILF A;  4XCS A;  3DKS A;  5A4W A;  1HD2 A;  4I5Q A;  2DJ2 A;  3C1R A;  4MH2 A;  5DCH A;  2B1K A;  1PL2 A;  3UOM A;  4EKZ A;  3TUE A;  2R4V A;  3LQ7 A;  4V1A g;  1G0T A;  1HNA A;  2VAF A;  5IPH A;  5B8A A;  1URM A;  2B5Y A;  3FMW A;  5KN1 A;  5AIX A;  2LS5 A;  2IMD A;  3C71 A;  4EF0 A;  1FOH A;  4XS1 A;  2X8G A;  4JZQ A;  4K6X A;  4N0V A;  2MZC A;  4OFT A;  2DIY A;  5FWG A;  3IR4 A;  3EE2 A;  4O32 A;  3GUS A;  2CZ2 A;  4PUR A;  5CO3 A;  1WIK A;  5CRG A;  5G5E A;  2FA8 A;  4KA0 A;  1V40 A;  1GSD A;  4O5Q A;  3FR3 A;  2I81 A;  3WT2 A;  1BAY A;  3WD6 A;  16GS A;  3ZL5 A;  10GS A;  2YJH A;  3HVX A;  1BJX A;  5JCG A;  2JAD A;  4JR4 A;  4WF5 A;  1OKT A;  2LQO A;  1F37 A;  1XWG A;  4MNN A;  1AQX A;  2I9H A;  3EU3 A;  3IC8 A;  2OA7 A;  3M3M A;  5IMF A;  3ZVJ D;  2L4C A;  2ON5 A;  5E4W A;  1A0R P;  1GH2 A;  4TR1 B;  1Y6E A;  1XCC A;  1GSY A;  3WGD A;  4FYU A;  4YKG A;  2PER A;  4X4J A;  3FR9 A;  4F82 A;  1G6W A;  4EDZ A;  4AJ6 A;  1PX6 A;  3TJK A;  2EC4 A;  13GS A;  1Z9H A;  2FLS A;  2HSY A;  3GNJ A;  5DJM A;  2KUC A;  2QSI A;  5B7C A;  2L59 A;  3ZRD A;  2BJX A;  3UIW A;  4KW6 A;  14GS A;  1WPI A;  2GVP A;  3LGC A;  4IVF A;  1U3A A;  2YN1 A;  5ABR A;  4IP6 A;  1A0F A;  5EL8 A;  1XWB A;  3G9B A;  1QMV A;  5HFI A;  3TRQ A;  1T8E B;  1TI1 A;  3GN3 A;  1WRY A;  1GLQ A;  2PGT A;  1JHB A;  1JLV A;  1OC9 A;  4J56 E;  1T1V A;  2HRA A;  3MDK A;  2CVK A;  3BD2 A;  5CRH A;  4HU9 A;  2DMM A;  1K0O A;  4OD7 A;  3IDV A;  3GKK A;  4I6X A;  1A2J A;  2O87 A;  2X4A A;  2C4J A;  1LJR A;  4K1F A;  1X9M B;  1PN9 A;  4USS A;  4HEA 2;  4PTS A;  4KE3 A;  2H75 A;  4WR5 A;  1GSE A;  1NW2 A;  1O85 A;  2E7P A;  2IWT A;  4KGI A;  1HNC A;  1AQW A;  4OCE A;  4OWY A;  5ENU A;  2CAQ A;  3E9J B;  3CYN A;  5H5R A;  3TRX A;  3F4S A;  4ECB A;  1CQH A;  3FYG A;  1V58 A;  4N0Z A;  3CSH A;  3TKR A;  2EIR A;  4MJC A;  1ILO A;  4AGS A;  3M8N A;  4NV5 A;  3W8S A;  1O7U A;  1HQO A;  4XS6 A;  4POK A;  2LNS A;  5GSS A;  3BOA A;  3HYP A;  3QAG A;  2JZS A;  5FHI A;  1EV4 A;  5CRW A;  3KH7 A;  4K7O A;  2IMI A;  4MZW A;  2GZP A;  2XPD A;  1SYR A;  2XC2 A;  4G19 A;  4JR6 A;  4ISD A;  1GL8 A;  2LST A;  2B5E A;  1ZZY A;  1BED A;  2PWJ A;  5DAL A;  5JCU A;  4POL A;  5CP1 A;  3LOR A;  2LEG A;  4MCU A;  2QKE A;  5LNK e;  3FZ5 A;  1K0N A;  2H1D A;  3NIV A;  3ME7 A;  1GSQ A;  1XWK A;  3GKN A;  5B6M A;  2LQQ A;  1VRS D;  4P3Y B;  7GSS A;  4MF5 A;  2H0I A;  4IP1 A;  4Z2T A;  1M9B A;  4Z7X A;  3DEX A;  2VIM A;  3DD3 A;  1OAZ A;  3KH9 A;  3A3T A;  3CRU A;  4ZL7 A;  5C04 A;  2C0E A;  4YQM A;  2YZH A;  2K9F A;  3C7M A;  4TOP A;  4TXV A;  5ECS A;  5DVB A;  4JED A;  2VCT A;  1EP7 A;  2R37 A;  4DSS A;  3L9S A;  2M80 A;  1V57 A;  2HT9 A;  3HA9 A;  2YWO A;  4G0K A;  1HYU A;  3IC4 A;  2WCI A;  3RPP A;  5IOX A;  2K8S A;  1C72 A;  3QAW A;  5INY A;  2VL3 A;  1XOA A;  1TRW A;  4DSR A;  2VD0 A;  3GHA A;  3GMF A;  4ZB6 A;  3WGX A;  3MNG A;  4BIK A;  3GX0 A;  2HZE B;  5DQS A;  3TJF A;  3IOS A;  4ECI A;  2HNL A;  1KTE A;  4Q5Q A;  5LD0 A;  2LRC A;  1B4P A;  5D9T A;  2GQL A;  3C73 A;  3I69 A;  4L5O A;  4QQ7 A;  1H75 A;  1ABA A;  2L5L A;  4KDX A;  1SKW B;  1TP9 A;  2JSZ A;  4BVX A;  4I2T A;  1RK4 A;  2CQ9 A;  3ZIJ A;  4K2X A;  4KF9 A;  4PNF A;  3GL3 A;  3QDN A;  2FCH A;  5ECI B;  3SBC A;  3PGT A;  1OE8 A;  4I2U A;  4TXO A;  4Z2R A;  3CTF A;  2TRC P;  4G0L A;  1EGO A;  4JE1 A;  4H86 A;  4FIW A;  3A5W A;  1NHO A;  4GST A;  5GAP D;  4K0N A;  1F9M A;  1CQG A;  1R5A A;  4EIQ A;  3HZ8 A;  4WBR D;  2ON7 A;  3FZA A;  2YCD A;  5CAX A;  3F8U A;  1F3B A;  2ALB A;  3TKS E;  5EY6 A;  4EUY A;  2OAC A;  5DBQ A;  5GST A;  5H5Q A;  2JZR A;  2VCQ A;  2H30 A;  5H5S A;  3FZ4 A;  1QK8 A;  5KN2 A;  2H76 A;  4FO5 A;  4MLY A;  2R5G A;  2GSR A;  3N9J A;  4BL7 B;  3LG6 A;  1EOG A;  1J0F A;  3NOF A;  3LJR A;  2M46 A;  3ZFB A;  1YDK A;  2BMX A;  4CDO A;  2HYX A;  2JU5 A;  2X49 A;  1XW9 A;  4HQZ A;  1TXX A;  2H71 A;  5ECM B;  2YV9 A;  1R26 A;  1K0C A;  2DLX A;  1O8W A;  2HRF A;  5IMV A;  1W89 A;  1XFL A;  2PVQ A;  2YNX A;  3I6A A;  5F06 A;  3A2X A;  5IPG A;  2LUS A;  1QXH A;  3VUR A;  2AYT A;  2LJK A;  3RHC A;  2F8A A;  3VPT A;  5F05 A;  1H4O A;  1SKS B;  3CBU A;  1WP0 A;  2FGX A;  4MJA A;  1JZD A;  3MIX A;  3PR8 A;  3GKM A;  3BBY A;  2CAI A;  4GWR A;  4K5R A;  1TKD B;  2H19 A;  3GA4 A;  2IPA A;  2DIZ A;  3HJO A;  1NM3 A;  1Q4J A;  4D73 B;  4KCE A;  1K0M A;  3GKX A;  4XIH A;  4GQF A;  4RI7 A;  3IHQ A;  4EXJ A;  6GSV A;  1OVN A;  4IJ3 A;  2OBI A;  5LCZ A;  4ZXG A;  1GUL A;  2IL3 A;  3MSZ A;  3KZQ A;  4KDU A;  2LRT A;  4RUV A;  2WDU A;  2QA1 A;  4WEY A;  2H6Z A;  3Q19 A;  3F3Q A;  1A8Y A;  2BTO T;  1QFN A;  4KND A;  1FHE A;  2R3X A;  4KH7 A;  1XOB A;  4MAB A;  1S3A A;  1YZX A;  3UJ1 A;  3FK8 A;  3W6G A;  3KMN A;  4YAV A;  1GTI A;  3VK9 A;  2P31 A;  3CQF A;  4ZL9 A;  1XVQ A;  2FY6 A;  5F07 A;  1YF1 A;  4XTS A;  1PQN A;  3RHB A;  3PPU A;  3GL5 A;  2ZNM A;  1SL1 B;  2VOC A;  2A2R A;  4OCF A;  1R4W A;  5G1L A;  3QFB C;  2YWM A;  1YJ6 A;  4HZ4 A;  1SEN A;  1VGL A;  1SYX A;  2FWF A;  2PPT A;  1ZOF A;  5B6N A;  2E0Q A;  3W8J A;  2C3Q A;  4ID0 A;  3UVH A;  3KJY A;  3D4M A;  4XS4 B;  2R2J A;  3QMX A;  3S9F A;  1BYE A;  3LW9 A;  4ACS A;  2MYG A;  4O92 A;  2D2Z A;  4O7H A;  1EEJ A;  2GS3 A;  1TU8 A;  2E2M A;  1EWX A;  1WE0 A;  2MBS A;  1ERT A;  4ZIL A;  4EL1 A;  5ECO B;  1XW6 A;  4IQA A;  1BQ7 A;  2DJ1 A;  2EIQ A;  2N5A A;  3F4T A;  5JWO B;  4LLR A;  3ED3 A;  3D21 A;  3ISO A;  4WXT A;  1PGT A;  3Q6O A;  3M9J A;  3LXT A;  5ID2 B;  3I43 A;  4V2L A;  3ZIT A;  3G7J A;  3Q74 A;  2A2P A;  5IMC A;  1VF4 A;  2HE3 A;  5BRT A;  4MPF A;  2MBT A;  5IQY A;  1TK5 B;  2GZZ A;  3APO A;  2H70 A;  2J23 A;  1EP8 A;  4I97 A;  1HNB A;  1XWA A;  2IME A;  4HI7 A;  3DYR A;  4MJB A;  1MDK A;  4RQX A;  1MTC A;  5J9B A;  4ZBA A;  3GUR A;  1X5D A;  4XRD A;  4PUF C;  3M9K A;  3H79 A;  1U88 A;  1TI3 A;  4ECC A;  4GLT A;  2DJ3 A;  2LKU A;  1B48 A;  2A4V A;  3I9V 2;  1SKR B;  3QOU A;  1A2M A;  2XHF A;  2L6D A;  2QA2 A;  4MK3 A;  5D9X A;  1X9W B;  4HJM A;  4ZBD A;  3DRN A;  5ECQ B;  3GFK A;  3NZN A;  2KHP A;  1FVK A;  4XHM A;  3ZMK A;  3GTU B;  1EZK A;  4LL1 B;  1M3J A;  4EC0 A;  1R5P A;  3UAR A;  4WF4 A;  4IEL A;  3HZ4 A;  2EIO A;  1WWJ A;  5AN1 A;  3RDW A;  1FW1 A;  2YAN A;  3ZIV A;  1O81 A;  2REM A;  3GYK A;  20GS A;  3CMI A;  4BVY B;  2V1M A;  3WYW A;  4TR1 A;  5KOW A;  3KEB A;  2I4A A;  3MYD A;  2NBS A;  3J7Y b;  1QQ2 A;  4K7N A;  3F6D A;  4O5R A;  4FYB A;  1GSF A;  1YEX A;  4AJ7 A;  4HOJ A;  2HFD A;  3HVN A;  1PL1 A;  5HFG A;  3ZFL A;  2LNT A;  1J9B A;  1JZW A;  3IV4 A;  4GSN A;  2Z9S A;  3GX8 A;  8GSS A;  2JAC A;  2F9S A;  1LU4 A;  1M7T A;  1S3C A;  4Q5N A;  2B5X A;  1M2A A;  2YOI A;  3L78 A;  1XZO A;  4J57 E;  3OR5 A;  1SL2 B;  1ZMA A;  3HVV A;  2F8F A;  4RI6 A;  2I3Y A;  1G7O A;  1GNE A;  2H73 A;  4F03 A;  1G6Y A;  3EU4 A;  4BWQ A;  2L5O A;  2VM1 A;  3DXB A;  2YV7 A;  3LEF A;  1ST9 A;  5ELA A;  2M72 A;  1PMT A;  2GTU A;  3TB2 A;  3H93 A;  3N5O A;  2I1U A;  2C80 A;  4NMU A;  1IYH A;  3D22 A;  3WT1 A;  3F0I A;  4PQ1 A;  4TN8 A;  3D5J A;  1T4Z A;  2GSS A;  4NPB A;  2R0G A;  5D9V A;  5DCG A;  1K0A A;  1GTB A;  3IK7 A;  1M3I A;  3KD0 A;  2DJK A;  4PX1 A;  4I8B A;  1Y25 A;  2E2G A;  2V6K A;  4HJ2 A;  2K18 A;  2C0F A;  4PUA A;  5L71 A;  2WS2 A;  2R0P A;  4MJE A;  2FUG 2;  3ERG A;  1FVJ A;  1FB0 A;  1LBK A;  5DQY A;  3DGQ A;  3DVW A;  3APS A;  5G2Z A;  2YZU A;  4PQI A;  1M9A A;  3AY8 A;  3HXS A;  2GLR A;  3Q18 A;  5FT3 A;  1TDI A;  2PVO C;  5D9W A;  4Q5F A;  1PX7 A;  3QR6 A;  1OC3 A;  4EDY A;  1U3I A;  3QCP A;  4YQV A;  3EWL A;  3US3 A;  1IYI A;  2R0C A;  3FHK A;  5B8B A;  2VLV A;  2K6V A;  1M2B A;  2DC5 A;  4YQU A;  2FD3 A;  3DVX A;  2PBJ A;  2VL2 A;  2X64 A;  2LJA A;  1THX A;  1S3R A;  1X5E A;  1Z6M A;  3ZLP A;  2HRK A;  3GIX A;  2IFQ B;  5JCW A;  3R2Q A;  3IPZ A;  17GS A;  4POB A;  3HJP A;  2IN3 A;  4NHZ A;  5GZZ B;  4N10 A;  4E8E A;  5A5K A;  3LYK A;  2KLX A;  4EVM A;  3PH9 A;  2TRX A;  1MD4 A;  1JLW A;  4OFN A;  1PD2 1;  3ZML A;  1E6B A;  4ZBB A;  3IHG A;  2WRT A;  4V2M A;  4TR4 A;  3TJB A;  1PKW A;  4IJI A;  5IMZ A;  4MH3 A;  4NHW A;  4FH8 A;  2G0F A;  4E8H A;  3R3E A;  4N11 A;  2OE1 A;  3G7Y A;  2F51 A;  1X9S B;  1O73 A;  2GST A;  1ACV A;  3QAV A;  3TKS A;  2IFQ A;  1TU7 A;  2HZE A;  4ZB9 A;  5EVO A;  3O6T A;  1Z7R A;  2H6Y A;  2V6O A;  4IBP A;  4WKW A;  2HSM A;  3TOU A;  1Z6N A;  3HD5 A;  4JU5 A;  2YJ7 A;  4GQC A;  4HS1 A;  4OO4 A;  4ML6 A;  2FWE A;  3TRP A;  3F63 A;  1G7E A;  4OO5 A;  3EUR A;  2C0G A;  5IIZ A;  4KX4 A;  2CX4 A;  4IHU A;  2O85 A;  3PIN A;  4IQ1 A;  4MPG A;  4IW9 A;  2OJL A;  3LFL A;  3UVT A;  5JWQ B;  4CY8 A;  3CRT A;  1Q98 A;  3KCM A;  4KUN A;  2LV3 A;  1A2L A;  2B7K A;  5KEJ A;  1S3D A;  1FO5 A;  1GTU A;  3BJ5 A;  4DVC A;  1EV9 A;  4A5P A;  1AIU A;  4ULX A;  4AJ8 A;  2B1L A;  4K2D A;  2XBQ A;  1UC7 A;  4L0W A;  1ZL9 A;  4MMM A;  3GV1 A;  4BL7 A;  1XG8 A;  1JZO A;  1TJD A;  1KBN A;  4MZC A;  3IAM 2;  2FWG A;  5IO0 A;  1B9X C;  1GLP A;  4HSC X;  1OC8 A;  1U6T A;  1DE1 A;  4TKY A;  3VI5 A;  2VL9 A;  2L6C A;  3ME8 A;  2HSH A;  1A24 A;  4CHS A;  2JZT A;  4YH2 A;  1T7P B;  3ZTL A;  1XVW A;  3P2A A;  4F0B A;  2R6K A;  3F6F A;  3JCM L;  1GSS A;  2AB6 A;  3A2W A;  2H0H A;  6GSW A;  1DBY A;  1VF3 A;  3TOT A;  2DML A;  2L4Q A;  3EYT A;  5ECP B;  4MF6 A;  1AQV A;  1K0B A;  3O76 A;  1T3B A;  4DEJ A;  5CRD A;  2H72 A;  2MMZ A;  4HU7 A;  3P8W A;  4NWY A;  5ELG A;  2OAD A;  5G5F A;  1GRX A;  5ECK B;  3IAS 2;  1F3A A;  18GS A;  4D73 A;  1WOU A;  2VUP A;  1RW1 A;  1VF2 A;  2G2Q A;  2DBC A;  5AIV A;  3TKQ A;  2KOK A;  1N2A A;  5AGY A;  3HKR A;  3IRA A;  2FA4 A;  1V2A A;  2DKH A;  4GTU A;  2C1Y A;  1SJ6 A;  1SU9 A;  3APQ A;  4O5U A;  2IMK A;  3VFI A;  1ML6 A;  2P5R A;  2NPB A;  2RUE A;  4PGT A;  1PKZ A;  2H8L A;  1GSU A;  1M2D A;  1ZYQ B;  4Q5R A;  3H1N A;  3ERF A;  4NAX A;  4PQH A;  1ERV A;  2V32 A;  2GGT A;  2NVL A;  3M0F A;  1NSW A;  4LMW A;  1YF0 A;  3VWX A;  2HXK A;  6GST A;  4RQR A;  5JWR B;  2JSY A;  5D93 A;  2RM6 A;  19GS A;  2C8U A;  1SD8 A;  4GF0 A;  1AC1 A;  4ML1 A;  2HZF A;  4ZIJ A;  1TTZ A;  4OFM A;  5G1K A;  4CY6 A;  2GDR A;  4XS4 A;  2MMA A;  3CSJ A;  4J2F A;  3KP8 A;  3GH9 A;  4HUA A;  2O89 A;  5DDL A;  1XIY A;  2HI7 A;  2LJR A;  1ZYN A;  1K3L A;  3RAZ A;  2L57 A;  3VPQ A;  1JFU A;  1XBS A;  2LTK A;  2WUL A;  2GZY A;  3TDG A;  1X5C A;  1TRV A;  4WET A;  2KP1 A;  3IK9 A;  2V41 A;  2WB9 A;  4IKH A;  3IA1 A;  2P0G A;  3LSZ A;  5HR0 A;  3KTB A;  1AW9 A;  3UAP A;  5D8I A;  1SK0 A;  5ID2 A;  1XPV A;  4G0I A;  1OC9 B;  1T4Y A;  4G9H A;  1USB A;  4HQS A;  3ZRE A;  2ZCT A;  3KTL A;  1R7H A;  4G10 A;  4NXI A;  2JL4 A;  1DSB A;  1YY7 A;  4MZB A;  6GSX A;  3ERW A;  1ON4 A;  2TIR A;  1M0U A;  4GCI A;  4K0G A;  4GRF A;  3A5I A;  2ZUP A;  1FB6 A;  3FZ9 A;  3TCO A;  2VCX A;  4L0U A;  4NV2 A;  12GS A;  2GQK A;  1DUG A;  3KGK A;  2WZ9 A;  2CVB A;  1A23 A;  5J41 A;  2XPE A;  3F9U A;  2GQM A;  1EOH A;  4KB3 A;  3UEM A;  1ZCP A;  4MF7 A;  1AUC A;  1O6J A;  5DAK B;  1ERU A;  3F4R A;  4FYC A;  1MDJ A;  1NHY A;  4K7I A;  6GSY A;  2AHE A;  4HDE A;  4X43 A;  2QGV A;  3F3R A;  2VM2 A;  3D6I A;  2RUF A;  1V9W A;  1GUH A;  3BCI A;  1UVZ A;  5IOW A;  4Z2U A;  4YAP A;  1WJK A;  2N5B A;  3TJG A;  1PFO A;  2CX3 A;  4HZ2 A;  1GWC A;  1UA5 A;  2LRN A;  2OBK A;  4MA9 A;  2GT5 A;  3GTU A;  3DIE A; 
#chains in the Genus database with same CATH homology
 4F2I A;  2AV4 A;  2FHE A;  2AUV A;  2IIY A;  5HR2 A;  1PA3 A;  5ECL B;  4WBJ A;  2PU9 C;  2GSQ A;  1Z7P A;  1YKC A;  1XWC A;  5HFK A;  3FKF A;  5F8B A;  3IE3 A;  2HRN A;  1B8X A;  2VLU A;  5F0G A;  2K8V A;  2PN8 A;  1WMJ A;  4FQU A;  4IS0 A;  3UBL A;  2H66 A;  4BVY A;  3TJJ A;  1ZYE A;  5DAL B;  2VO4 A;  6GSU A;  1K3Y A;  5DAK A;  4L5L A;  3K8N A;  1BX9 A;  4KSM A;  1W4V A;  3GST A;  1MDI A;  3FW2 A;  5ECH B;  4K9Z A;  4BA7 A;  1OYJ A;  2OE3 A;  1K0D A;  3A2V A;  2DSA A;  2FNO A;  4IN0 A;  3UBK A;  4ZB8 A;  5AIS A;  3L9V A;  3IBH A;  1THO A;  5J3R A;  5IO2 A;  1T00 A;  1BG5 A;  4IGJ A;  3FEU A;  3U6V A;  2B3S A;  5G30 A;  2PMT A;  3HVS A;  1QUW A;  4X1U A;  4DSS B;  2V2G A;  5BMU A;  4EO3 A;  1MEK A;  3UMA A;  5CYY A;  5D96 A;  2RII A;  2H0G A;  2H6X A;  5G31 A;  2B6M A;  3L9U A;  3MWH A;  5D73 A;  1E2Y A;  3VLN A;  4BPY A;  1SD9 A;  4K8M A;  3EPT A;  3QPM A;  3EC3 A;  1TRS A;  3FY7 A;  5COH A;  3QFA C;  2DJ0 A;  4TRX A;  2CZ3 A;  5J9C A;  5E59 A;  2XBI A;  5KOX A;  2QC7 A;  3IXR A;  5A4V A;  1O8X A;  3KMO A;  1K3O A;  2DJJ A;  4BVX B;  2C0D A;  2VL2 C;  1SK2 A;  1J08 A;  2VCV A;  3LXZ A;  3RPN A;  3FR6 A;  4TR0 A;  1PN0 A;  4CW9 A;  3FRC A;  1A8L A;  5HQP A;  1UN2 A;  2AAW A;  4JBB A;  3E3E A;  11GS A;  2A2S A;  5EPF A;  1FAA A;  5ECR B;  3L4N A;  2O7K A;  2O8V B;  5HR1 A;  2N5F A;  4TXO B;  2YP6 A;  4MP4 A;  3C1S A;  1QGV A;  3H4K A;  2NTO A;  4KAE A;  4AF2 A;  3CTG A;  1YKA A;  3TKP A;  4ICY A;  4V2N A;  2IMF A;  1GUM A;  2CV4 A;  4PXO A;  22GS A;  3QD9 A;  3EMP A;  5KN0 A;  2GT6 A;  1SJZ A;  4TW5 A;  4POM A;  1TK0 B;  3D0Z A;  3HHV A;  1GTA A;  5ECN B;  4JRR A;  3VWV A;  3MAK A;  3GRX A;  2H1G A;  4LMV A;  3SWL A;  5GAN D;  5A4U A;  1RQM A;  1FOV A;  3RBT A;  1Z3E A;  2H1A A;  3TKS C;  2WFC A;  3UL3 A;  6GSS A;  5J5N A;  1EEM A;  4X0X A;  2MMO A;  1FG4 A;  2VD1 A;  3ZZX A;  3HDC A;  3CXG A;  2RLI A;  3E0U A;  4YKF A;  2YWI A;  3DWV A;  2NDO A;  4G2E A;  1GUK A;  2KP2 A;  2X8H A;  3H8Q A;  1TW9 A;  4LA1 A;  1PRX A;  1VF1 A;  4BWS A;  4KCA A;  3VWU A;  1B4Q A;  2HLS A;  4KSO A;  1YQ1 A;  1OE7 A;  2VCW A;  3HJM A;  2A4H A;  2PUK C;  1Z5Y E;  5IM9 A;  3ZYW A;  3HY2 A;  5C00 A;  1V98 A;  4K5S A;  1F2E A;  4F9Z A;  1N8J A;  4TVE A;  5HR3 A;  1SJI A;  9GSS A;  2IJY A;  4N30 A;  3GH6 A;  3O3T A;  2H01 A;  1M99 A;  2CVD A;  1I9D A;  2F3M A;  4EIP A;  5CNW A;  3C8E A;  5KN3 A;  2WGR A;  1ERW A;  3KXO A;  2OKA A;  1EGR A;  5J4U A;  2P5Q A;  3M1G A;  1TRU A;  3U5R E;  5IMA A;  2MMN A;  2WJU A;  4DSQ A;  4PNG A;  4LL4 B;  4TR3 A;  3EVI A;  2CA8 A;  4KDY A;  4MDC A;  1XXU A;  4F0C A;  3J7Y k;  4OMV A;  4ZL8 A;  2C3T A;  3ZVJ A;  5IMD A;  3P7X A;  2X8C A;  3DML A;  2H74 A;  4GSS A;  1TOF A;  1TK8 B;  1PSQ A;  1KNG A;  2J9H A;  5CRE A;  1YEP A;  1SL0 B;  3BCK A;  2H1B A;  4QL9 A;  4QL7 A;  1GP1 A;  2YPM A;  1I5G A;  2RM5 A;  3L0H A;  1JZR A;  3KP9 A;  3GSS A;  3D4T A;  1SK1 A;  4L8E A;  3KM6 A;  3VI7 A;  1F6M C;  2VCZ A;  2VLT A;  2CT6 A;  1X0R A;  4WR4 A;  3LYP A;  1GNW A;  3EIN A;  2YWN A;  3TGZ A;  1ZYP A;  3VWW A;  3V1W A;  3G7I A;  4GXZ A;  3WGE A;  1MD3 A;  4EE0 A;  2B7J A;  1DE2 A;  2X99 A;  2UZ8 A;  1AXD A;  1U87 A;  2DKI A;  3P90 A;  1B9Y C;  2FWH A;  2ES7 A;  3LWA A;  1KEB A;  3CSI A;  5DJL A;  2OE0 A;  2C3N A;  1AAZ A;  4ECJ A;  2AJQ B;  1ZGN A;  3KIJ A;  4V1A p;  3EMX A;  3HCZ A;  1OKD A;  4XRA A;  1XW5 A;  4ILF A;  4XCS A;  3DKS A;  5A4W A;  1HD2 A;  4I5Q A;  2DJ2 A;  3C1R A;  4MH2 A;  5DCH A;  2B1K A;  1PL2 A;  3UOM A;  4EKZ A;  3TUE A;  2R4V A;  3LQ7 A;  4V1A g;  1G0T A;  1HNA A;  2VAF A;  5IPH A;  5B8A A;  1URM A;  2B5Y A;  3FMW A;  5KN1 A;  5AIX A;  2LS5 A;  2IMD A;  3C71 A;  4EF0 A;  1FOH A;  4XS1 A;  2X8G A;  4JZQ A;  4K6X A;  4N0V A;  2MZC A;  4OFT A;  2DIY A;  5FWG A;  3IR4 A;  3EE2 A;  4O32 A;  3GUS A;  2CZ2 A;  4PUR A;  5CO3 A;  1WIK A;  5CRG A;  5G5E A;  2FA8 A;  4KA0 A;  1V40 A;  1GSD A;  4O5Q A;  3FR3 A;  2I81 A;  3WT2 A;  1BAY A;  3WD6 A;  16GS A;  3ZL5 A;  10GS A;  2YJH A;  3HVX A;  1BJX A;  5JCG A;  2JAD A;  4JR4 A;  4WF5 A;  1OKT A;  2LQO A;  1F37 A;  1XWG A;  4MNN A;  1AQX A;  2I9H A;  3EU3 A;  3IC8 A;  2OA7 A;  3M3M A;  5IMF A;  3ZVJ D;  2L4C A;  2ON5 A;  5E4W A;  1A0R P;  1GH2 A;  4TR1 B;  1Y6E A;  1XCC A;  1GSY A;  3WGD A;  4FYU A;  4YKG A;  2PER A;  4X4J A;  3FR9 A;  4F82 A;  1G6W A;  4EDZ A;  4AJ6 A;  1PX6 A;  3TJK A;  2EC4 A;  13GS A;  1Z9H A;  2FLS A;  2HSY A;  3GNJ A;  5DJM A;  2KUC A;  2QSI A;  5B7C A;  2L59 A;  3ZRD A;  2BJX A;  3UIW A;  4KW6 A;  14GS A;  1WPI A;  2GVP A;  3LGC A;  4IVF A;  1U3A A;  2YN1 A;  5ABR A;  4IP6 A;  1A0F A;  5EL8 A;  1XWB A;  3G9B A;  1QMV A;  5HFI A;  3TRQ A;  1T8E B;  1TI1 A;  3GN3 A;  1WRY A;  1GLQ A;  2PGT A;  1JHB A;  1JLV A;  1OC9 A;  4J56 E;  1T1V A;  2HRA A;  3MDK A;  2CVK A;  3BD2 A;  5CRH A;  4HU9 A;  2DMM A;  1K0O A;  4OD7 A;  3IDV A;  3GKK A;  4I6X A;  1A2J A;  2O87 A;  2X4A A;  2C4J A;  1LJR A;  4K1F A;  1X9M B;  1PN9 A;  4USS A;  4HEA 2;  4PTS A;  4KE3 A;  2H75 A;  4WR5 A;  1GSE A;  1NW2 A;  1O85 A;  2E7P A;  2IWT A;  4KGI A;  1HNC A;  1AQW A;  4OCE A;  4OWY A;  5ENU A;  2CAQ A;  3E9J B;  3CYN A;  5H5R A;  3TRX A;  3F4S A;  4ECB A;  1CQH A;  3FYG A;  1V58 A;  4N0Z A;  3CSH A;  3TKR A;  2EIR A;  4MJC A;  1ILO A;  4AGS A;  3M8N A;  4NV5 A;  3W8S A;  1O7U A;  1HQO A;  4XS6 A;  4POK A;  2LNS A;  5GSS A;  3BOA A;  3HYP A;  3QAG A;  2JZS A;  5FHI A;  1EV4 A;  5CRW A;  3KH7 A;  4K7O A;  2IMI A;  4MZW A;  2GZP A;  2XPD A;  1SYR A;  2XC2 A;  4G19 A;  4JR6 A;  4ISD A;  1GL8 A;  2LST A;  2B5E A;  1ZZY A;  1BED A;  2PWJ A;  5DAL A;  5JCU A;  4POL A;  5CP1 A;  3LOR A;  2LEG A;  4MCU A;  2QKE A;  5LNK e;  3FZ5 A;  1K0N A;  2H1D A;  3NIV A;  3ME7 A;  1GSQ A;  1XWK A;  3GKN A;  5B6M A;  2LQQ A;  1VRS D;  4P3Y B;  7GSS A;  4MF5 A;  2H0I A;  4IP1 A;  4Z2T A;  1M9B A;  4Z7X A;  3DEX A;  2VIM A;  3DD3 A;  1OAZ A;  3KH9 A;  3A3T A;  3CRU A;  4ZL7 A;  5C04 A;  2C0E A;  4YQM A;  2YZH A;  2K9F A;  3C7M A;  4TOP A;  4TXV A;  5ECS A;  5DVB A;  4JED A;  2VCT A;  1EP7 A;  2R37 A;  4DSS A;  3L9S A;  2M80 A;  1V57 A;  2HT9 A;  3HA9 A;  2YWO A;  4G0K A;  1HYU A;  3IC4 A;  2WCI A;  3RPP A;  5IOX A;  2K8S A;  1C72 A;  3QAW A;  5INY A;  2VL3 A;  1XOA A;  1TRW A;  4DSR A;  2VD0 A;  3GHA A;  3GMF A;  4ZB6 A;  3WGX A;  3MNG A;  3GX0 A;  2HZE B;  5DQS A;  3TJF A;  3IOS A;  4ECI A;  2HNL A;  1KTE A;  4Q5Q A;  5LD0 A;  2LRC A;  1B4P A;  5D9T A;  2GQL A;  3C73 A;  3I69 A;  4L5O A;  4QQ7 A;  1H75 A;  1ABA A;  2L5L A;  4KDX A;  1SKW B;  1TP9 A;  2JSZ A;  4BVX A;  4I2T A;  1RK4 A;  2CQ9 A;  3ZIJ A;  4K2X A;  4KF9 A;  4PNF A;  3GL3 A;  3QDN A;  2FCH A;  5ECI B;  3SBC A;  3PGT A;  1OE8 A;  4I2U A;  4TXO A;  4Z2R A;  3CTF A;  2TRC P;  4G0L A;  1EGO A;  4JE1 A;  4H86 A;  4FIW A;  3A5W A;  1NHO A;  4GST A;  5GAP D;  4K0N A;  1F9M A;  1CQG A;  1R5A A;  4EIQ A;  3HZ8 A;  4WBR D;  2ON7 A;  3FZA A;  2YCD A;  5CAX A;  3F8U A;  1F3B A;  2ALB A;  3TKS E;  5EY6 A;  4EUY A;  2OAC A;  5DBQ A;  5GST A;  5H5Q A;  2JZR A;  2VCQ A;  2H30 A;  5H5S A;  3FZ4 A;  1QK8 A;  5KN2 A;  2H76 A;  4FO5 A;  4MLY A;  2R5G A;  2GSR A;  3N9J A;  4BL7 B;  3LG6 A;  1EOG A;  1J0F A;  3NOF A;  3LJR A;  2M46 A;  3ZFB A;  1YDK A;  2BMX A;  4CDO A;  2HYX A;  2JU5 A;  2X49 A;  1XW9 A;  4HQZ A;  1TXX A;  2H71 A;  5ECM B;  2YV9 A;  1R26 A;  1K0C A;  2DLX A;  1O8W A;  2HRF A;  5IMV A;  1W89 A;  1XFL A;  2PVQ A;  2YNX A;  3I6A A;  5F06 A;  3A2X A;  5IPG A;  2LUS A;  1QXH A;  3VUR A;  2AYT A;  2LJK A;  3RHC A;  2F8A A;  3VPT A;  5F05 A;  1H4O A;  1SKS B;  3CBU A;  1WP0 A;  2FGX A;  4MJA A;  1JZD A;  3MIX A;  3PR8 A;  3GKM A;  3BBY A;  2CAI A;  4GWR A;  4K5R A;  1TKD B;  2H19 A;  3GA4 A;  2IPA A;  2DIZ A;  3HJO A;  1NM3 A;  1Q4J A;  4D73 B;  4KCE A;  1K0M A;  3GKX A;  4XIH A;  4GQF A;  4RI7 A;  3IHQ A;  4EXJ A;  6GSV A;  1OVN A;  4IJ3 A;  2OBI A;  5LCZ A;  4ZXG A;  1GUL A;  2IL3 A;  3MSZ A;  3KZQ A;  4KDU A;  2LRT A;  4RUV A;  2WDU A;  2QA1 A;  4WEY A;  2H6Z A;  3Q19 A;  3F3Q A;  1A8Y A;  2BTO T;  1QFN A;  4KND A;  1FHE A;  2R3X A;  4KH7 A;  1XOB A;  4MAB A;  1S3A A;  1YZX A;  3UJ1 A;  3FK8 A;  3W6G A;  3KMN A;  4YAV A;  1GTI A;  3VK9 A;  2P31 A;  4ZL9 A;  1XVQ A;  2FY6 A;  5F07 A;  1YF1 A;  4XTS A;  1PQN A;  3RHB A;  3PPU A;  3GL5 A;  2ZNM A;  1SL1 B;  2VOC A;  2A2R A;  4OCF A;  1R4W A;  5G1L A;  3QFB C;  2YWM A;  1YJ6 A;  4HZ4 A;  1SEN A;  1VGL A;  1SYX A;  2FWF A;  2PPT A;  1ZOF A;  5B6N A;  2E0Q A;  3W8J A;  2C3Q A;  4ID0 A;  3UVH A;  3KJY A;  3D4M A;  4XS4 B;  2R2J A;  3QMX A;  3S9F A;  1BYE A;  3LW9 A;  4ACS A;  2MYG A;  4O92 A;  2D2Z A;  4O7H A;  1EEJ A;  2GS3 A;  1TU8 A;  2E2M A;  1EWX A;  1WE0 A;  2MBS A;  1ERT A;  4ZIL A;  4EL1 A;  5ECO B;  1XW6 A;  4IQA A;  1BQ7 A;  2DJ1 A;  2EIQ A;  2N5A A;  3F4T A;  5JWO B;  4LLR A;  3ED3 A;  3D21 A;  3ISO A;  4WXT A;  1PGT A;  3Q6O A;  3M9J A;  3LXT A;  5ID2 B;  3I43 A;  4V2L A;  3ZIT A;  3G7J A;  3Q74 A;  2A2P A;  5IMC A;  1VF4 A;  2HE3 A;  5BRT A;  4MPF A;  2MBT A;  5IQY A;  1TK5 B;  2GZZ A;  3APO A;  2H70 A;  2J23 A;  1EP8 A;  4I97 A;  1HNB A;  1XWA A;  2IME A;  4HI7 A;  3DYR A;  4MJB A;  1MDK A;  4RQX A;  1MTC A;  5J9B A;  4ZBA A;  3GUR A;  1X5D A;  4XRD A;  4PUF C;  3M9K A;  3H79 A;  1U88 A;  1TI3 A;  4ECC A;  4GLT A;  2DJ3 A;  2LKU A;  1B48 A;  2A4V A;  3I9V 2;  1SKR B;  3QOU A;  1A2M A;  2XHF A;  2L6D A;  2QA2 A;  4MK3 A;  5D9X A;  1X9W B;  4HJM A;  4ZBD A;  3DRN A;  5ECQ B;  3GFK A;  3NZN A;  2KHP A;  1FVK A;  4XHM A;  3ZMK A;  3GTU B;  1EZK A;  4LL1 B;  4EC0 A;  1R5P A;  3UAR A;  4WF4 A;  4IEL A;  3HZ4 A;  2EIO A;  1WWJ A;  5AN1 A;  3RDW A;  1FW1 A;  2YAN A;  3ZIV A;  1O81 A;  2REM A;  3GYK A;  20GS A;  3CMI A;  4BVY B;  2V1M A;  3WYW A;  4TR1 A;  5KOW A;  3KEB A;  2I4A A;  3MYD A;  2NBS A;  3J7Y b;  1QQ2 A;  4K7N A;  3F6D A;  4O5R A;  4FYB A;  1GSF A;  1YEX A;  4AJ7 A;  4HOJ A;  2HFD A;  1PL1 A;  5HFG A;  3ZFL A;  2LNT A;  1J9B A;  1JZW A;  3IV4 A;  4GSN A;  2Z9S A;  3GX8 A;  8GSS A;  2JAC A;  2F9S A;  1LU4 A;  1M7T A;  1S3C A;  4Q5N A;  2B5X A;  1M2A A;  2YOI A;  3L78 A;  1XZO A;  4J57 E;  3OR5 A;  1SL2 B;  1ZMA A;  3HVV A;  2F8F A;  4RI6 A;  2I3Y A;  1G7O A;  1GNE A;  2H73 A;  4F03 A;  1G6Y A;  3EU4 A;  4BWQ A;  2L5O A;  2VM1 A;  3DXB A;  2YV7 A;  3LEF A;  1ST9 A;  5ELA A;  2M72 A;  1PMT A;  2GTU A;  3TB2 A;  3H93 A;  3N5O A;  2I1U A;  2C80 A;  4NMU A;  1IYH A;  3D22 A;  3WT1 A;  3F0I A;  4PQ1 A;  4TN8 A;  3D5J A;  1T4Z A;  2GSS A;  4NPB A;  2R0G A;  5D9V A;  5DCG A;  1K0A A;  1GTB A;  3IK7 A;  3KD0 A;  2DJK A;  4PX1 A;  4I8B A;  1Y25 A;  2E2G A;  2V6K A;  4HJ2 A;  2K18 A;  2C0F A;  4PUA A;  5L71 A;  2WS2 A;  2R0P A;  4MJE A;  2FUG 2;  3ERG A;  1FVJ A;  1FB0 A;  1LBK A;  5DQY A;  3DGQ A;  3DVW A;  3APS A;  5G2Z A;  2YZU A;  4PQI A;  1M9A A;  3AY8 A;  3HXS A;  2GLR A;  3Q18 A;  5FT3 A;  1TDI A;  2PVO C;  5D9W A;  4Q5F A;  1PX7 A;  3QR6 A;  1OC3 A;  4EDY A;  1U3I A;  3QCP A;  4YQV A;  3EWL A;  3US3 A;  1IYI A;  2R0C A;  3FHK A;  5B8B A;  2VLV A;  2K6V A;  1M2B A;  2DC5 A;  4YQU A;  2FD3 A;  3DVX A;  2PBJ A;  2VL2 A;  2X64 A;  2LJA A;  1THX A;  1X5E A;  1Z6M A;  3ZLP A;  2HRK A;  3GIX A;  2IFQ B;  5JCW A;  3R2Q A;  3IPZ A;  17GS A;  4POB A;  3HJP A;  2IN3 A;  4NHZ A;  5GZZ B;  4N10 A;  4E8E A;  5A5K A;  3LYK A;  2KLX A;  4EVM A;  3PH9 A;  2TRX A;  1MD4 A;  1JLW A;  4OFN A;  1PD2 1;  3ZML A;  1E6B A;  4ZBB A;  3IHG A;  2WRT A;  4V2M A;  4TR4 A;  3TJB A;  1PKW A;  4IJI A;  5IMZ A;  4MH3 A;  4NHW A;  4FH8 A;  2G0F A;  4E8H A;  3R3E A;  4N11 A;  2OE1 A;  3G7Y A;  2F51 A;  1X9S B;  1O73 A;  2GST A;  1ACV A;  3QAV A;  3TKS A;  2IFQ A;  1TU7 A;  2HZE A;  4ZB9 A;  5EVO A;  3O6T A;  1Z7R A;  2H6Y A;  2V6O A;  4IBP A;  4WKW A;  2HSM A;  3TOU A;  1Z6N A;  3HD5 A;  4JU5 A;  2YJ7 A;  4GQC A;  4HS1 A;  4OO4 A;  4ML6 A;  2FWE A;  3TRP A;  3F63 A;  1G7E A;  4OO5 A;  3EUR A;  2C0G A;  5IIZ A;  4KX4 A;  2CX4 A;  4IHU A;  2O85 A;  3PIN A;  4IQ1 A;  4MPG A;  4IW9 A;  2OJL A;  3LFL A;  3UVT A;  5JWQ B;  4CY8 A;  3CRT A;  1Q98 A;  3KCM A;  4KUN A;  2LV3 A;  1A2L A;  2B7K A;  5KEJ A;  1S3D A;  1FO5 A;  1GTU A;  3BJ5 A;  4DVC A;  1EV9 A;  4A5P A;  1AIU A;  4ULX A;  4AJ8 A;  2B1L A;  4K2D A;  2XBQ A;  1UC7 A;  4L0W A;  1ZL9 A;  4MMM A;  3GV1 A;  4BL7 A;  1JZO A;  1TJD A;  1KBN A;  4MZC A;  3IAM 2;  2FWG A;  5IO0 A;  1B9X C;  1GLP A;  1OC8 A;  1U6T A;  1DE1 A;  4TKY A;  3VI5 A;  2VL9 A;  2L6C A;  3ME8 A;  2HSH A;  1A24 A;  4CHS A;  2JZT A;  4YH2 A;  1T7P B;  3ZTL A;  1XVW A;  3P2A A;  4F0B A;  2R6K A;  3F6F A;  3JCM L;  1GSS A;  2AB6 A;  3A2W A;  2H0H A;  6GSW A;  1DBY A;  1VF3 A;  3TOT A;  2DML A;  2L4Q A;  3EYT A;  5ECP B;  4MF6 A;  1AQV A;  1K0B A;  3O76 A;  1T3B A;  4DEJ A;  5CRD A;  2H72 A;  2MMZ A;  4HU7 A;  3P8W A;  4NWY A;  5ELG A;  2OAD A;  5G5F A;  1GRX A;  5ECK B;  3IAS 2;  1F3A A;  18GS A;  4D73 A;  1WOU A;  2VUP A;  1RW1 A;  1VF2 A;  2G2Q A;  2DBC A;  5AIV A;  3TKQ A;  2KOK A;  1N2A A;  5AGY A;  3HKR A;  3IRA A;  2FA4 A;  1V2A A;  2DKH A;  4GTU A;  2C1Y A;  1SJ6 A;  1SU9 A;  3APQ A;  4O5U A;  2IMK A;  3VFI A;  1ML6 A;  2P5R A;  2NPB A;  2RUE A;  4PGT A;  1PKZ A;  2H8L A;  1GSU A;  1M2D A;  1ZYQ B;  4Q5R A;  3H1N A;  3ERF A;  4NAX A;  4PQH A;  1ERV A;  2V32 A;  2GGT A;  2NVL A;  3M0F A;  1NSW A;  4LMW A;  1YF0 A;  3VWX A;  2HXK A;  6GST A;  4RQR A;  5JWR B;  2JSY A;  5D93 A;  2RM6 A;  19GS A;  2C8U A;  1SD8 A;  4GF0 A;  1AC1 A;  4ML1 A;  2HZF A;  4ZIJ A;  1TTZ A;  4OFM A;  5G1K A;  4CY6 A;  2GDR A;  4XS4 A;  2MMA A;  3CSJ A;  4J2F A;  3KP8 A;  3GH9 A;  4HUA A;  2O89 A;  5DDL A;  1XIY A;  2HI7 A;  2LJR A;  1ZYN A;  1K3L A;  3RAZ A;  2L57 A;  3VPQ A;  1JFU A;  1XBS A;  2LTK A;  2WUL A;  2GZY A;  3TDG A;  1X5C A;  1TRV A;  4WET A;  2KP1 A;  3IK9 A;  2V41 A;  2WB9 A;  4IKH A;  3IA1 A;  2P0G A;  3LSZ A;  5HR0 A;  3KTB A;  1AW9 A;  3UAP A;  5D8I A;  1SK0 A;  5ID2 A;  1XPV A;  4G0I A;  1OC9 B;  1T4Y A;  4G9H A;  1USB A;  4HQS A;  3ZRE A;  2ZCT A;  3KTL A;  1R7H A;  4G10 A;  4NXI A;  2JL4 A;  1DSB A;  1YY7 A;  4MZB A;  6GSX A;  3ERW A;  1ON4 A;  2TIR A;  1M0U A;  4GCI A;  4K0G A;  4GRF A;  3A5I A;  2ZUP A;  1FB6 A;  3FZ9 A;  3TCO A;  2VCX A;  4L0U A;  4NV2 A;  12GS A;  2GQK A;  1DUG A;  3KGK A;  2WZ9 A;  2CVB A;  1A23 A;  5J41 A;  2XPE A;  3F9U A;  2GQM A;  1EOH A;  4KB3 A;  3UEM A;  1ZCP A;  4MF7 A;  1AUC A;  1O6J A;  5DAK B;  1ERU A;  3F4R A;  4FYC A;  1MDJ A;  1NHY A;  4K7I A;  6GSY A;  2AHE A;  4HDE A;  4X43 A;  2QGV A;  3F3R A;  2VM2 A;  3D6I A;  2RUF A;  1V9W A;  1GUH A;  3BCI A;  1UVZ A;  5IOW A;  4Z2U A;  4YAP A;  1WJK A;  2N5B A;  3TJG A;  2CX3 A;  4HZ2 A;  1GWC A;  1UA5 A;  2LRN A;  2OBK A;  4MA9 A;  2GT5 A;  3GTU A;  3DIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...