1XW9A

Drosophila thioredoxin, oxidized, p21
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
106
structure length
106
Chain Sequence
MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords thioredoxin
publication title Comparative structural analysis of oxidized and reduced thioredoxin from Drosophila melanogaster
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 36
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xw9A00
3FZ9A 2IMIA 1SU9A 1Q4JA 2L5OA 1JFUA 2LQOA 3IK7A 1MEKA 1MDKA 2LJRA 6GSYA 1SL1B 1G0TA 4HU7A 2RM5A 3GX8A 4K1FA 2FUG2 3KXOA 2LRTA 3K8NA 2IMEA 2JZTA 5CO3A 2WJUA 4XRAA 2GSQA 1EZKA 2ALBA 1HNAA 3KM6A 1QGVA 4IQAA 5HR0A 5B6NA 2FA4A 4HDEA 1Z6MA 5IO0A 4ZB8A 5IMFA 3HVVA 3TKSC 4XHMA 1K0NA 2VLUA 3IRAA 3GUSA 1ERUA 5DAKB 3UVTA 4GSNA 3ZL5A 3ZLPA 2L4QA 4NAXA 3VWXA 6GSSA 5ECPB 2FNOA 2DJ2A 2A2RA 3A2XA 3WYWA 3TJJA 1GSFA 2R3XA 3UOMA 1AQWA 4IW9A 1GNEA 3G7JA 4YH2A 3WT1A 2F3MA 2WZ9A 5D8IA 5IM9A 2B5YA 3P2AA 3QD9A 5HR3A 3C8EA 2OBKA 3TRPA 4YAPA 4IS0A 5JWQB 1XFLA 4ML6A 2VCZA 2VL2C 4MF5A 1BX9A 3DRNA 2YCDA 1K0DA 5ECNB 4FO5A 3TKSA 1PX7A 1TW9A 4ZB9A 5A4WA 4JR6A 1B48A 2C0DA 4O7HA 2DIZA 1PA3A 4Q5NA 1GSEA 3KD0A 3CBUA 2IFQB 3U6VA 3HXSA 3VI5A 3E9JB 1C72A 2V2GA 4PUAA 4KGIA 4V1Ap 2G0FA 2R2JA 3BD2A 1V98A 3NOFA 1GTIA 3SBCA 1KTEA 1FVJA 2C1YA 5LD0A 1Z7RA 5ELAA 4F82A 2GT6A 5ABRA 4HI7A 3LYPA 4AGSA 3UAPA 2IMDA 2VOCA 3EWLA 4KDYA 2P0GA 2WCIA 2DMMA 1XBSA 3TGZA 2GTUA 1K0AA 4O5RA 1FG4A 5DCHA 3ZFLA 2H1DA 1ABAA 1M2AA 3CXGA 3GL5A 2N5AA 2TRCP 2VM2A 2VL2A 5IQYA 1K0CA 3IXRA 2GGTA 1LBKA 1M7TA 4WXTA 4G10A 2KOKA 1SK2A 1BQ7A 1X5EA 5D9VA 2V1MA 3FR3A 3IBHA 1Z6NA 2VCTA 3KMOA 3UJ1A 2FWGA 1ERTA 1EV9A 2Z9SA 1SENA 1ML6A 2FY6A 2I1UA 2H66A 3DD3A 2LRCA 4J56E 4RQRA 2GSTA 4ML1A 2EC4A 3I6AA 3E0UA 4MDCA 1J08A 4K0NA 4RUVA 2ZNMA 3FHKA 4F0CA 2IPAA 1GUKA 1A0FA 3U5RE 7GSSA 3MAKA 3IV4A 1JHBA 3VK9A 1OYJA 4ZBBA 4ZL8A 3IK9A 1O81A 5A4VA 1PL1A 4KW6A 2EIQA 3FEUA 5CRWA 4LL4B 2HRNA 4BPYA 2I81A 5KEJA 4MJBA 3ZTLA 4IJIA 3HY2A 3TJKA 4KX4A 4NMUA 5CRGA 2YOIA 4TXOA 1JLVA 4I97A 3L9UA 16GSA 2AYTA 2RM6A 2QSIA 1I5GA 5FHIA 1PX6A 1OC9A 3DMLA 1GRXA 2OA7A 3LJRA 1THOA 2ZCTA 3W8SA 2E7PA 1TK5B 2LNSA 5D93A 4EDZA 2BTOT 3QOUA 3VPTA 3KZQA 5F06A 3FZ5A 3HVSA 1K3YA 1Z5YE 4XS1A 1LJRA 4AF2A 1IYHA 1O8WA 3GSSA 1U87A 1AQXA 2LV3A 1TI3A 3PGTA 4I2UA 3VURA 3P8WA 4K6XA 3TB2A 3GV1A 1DE1A 3H4KA 3ME8A 4NHWA 1AQVA 6GSWA 1O7UA 2GZZA 1M2BA 1MD4A 2C0GA 5ECLB 4BVYA 3KP8A 2K6VA 2YPMA 2H6YA 4TXVA 3LEFA 3PINA 2K8SA 4RI7A 4OMVA 2YN1A 1NHOA 2LKUA 1SYXA 1AW9A 2PVQA 4KUNA 1XW6A 5F0GA 1VF1A 4XIHA 2WULA 2YWOA 2V32A 4IQ1A 2O7KA 4POKA 1N2AA 3VLNA 4HOJA 2CVKA 4EE0A 2DBCA 3TKRA 1MDIA 4KA0A 1M2DA 4WF5A 2B5EA 4DSRA 1K0BA 1O85A 3GIXA 4ZBAA 2HZEB 3LGCA 3I9V2 4ZL9A 2CAIA 1RQMA 4I8BA 1AXDA 3O76A 5ECQB 1XW5A 1MD3A 2BMXA 2HXKA 4DSSA 1U3AA 1HNCA 5ECRB 3HYPA 1LU4A 3QDNA 2LJKA 11GSA 3D5JA 3BOAA 2B5XA 2N5FA 2R6KA 3UBKA 4LL1B 1HQOA 1GTBA 2WRTA 3FZ4A 3DGQA 1WMJA 5B8AA 1M9BA 4HJMA 3I69A 4K0GA 1U88A 5CAXA 4HEA2 1O6JA 2VL9A 4YQUA 5IMCA 5LCZA 3QAVA 3ZYWA 1OC3A 1U3IA 1T4ZA 5A4UA 2CVDA 2GLRA 4PGTA 4ZL7A 1BAYA 5DJLA 1HYUA 4CDOA 4BWSA 2M80A 3KGKA 3GRXA 4KE3A 2PUKC 3H79A 3GYKA 4TW5A 5ECOB 5B7CA 2IIYA 5GZZB 3CSJA 1H4OA 3GKMA 1Y25A 3IAM2 3V1WA 3KMNA 3EC3A 1TJDA 2MBSA 1XZOA 1TDIA 1FAAA 1Z7PA 4ECCA 4EL1A 3KP9A 2GQKA 3DWVA 5A5KA 2WB9A 3NZNA 4QQ7A 1GLQA 4LMWA 4MK3A 2NVLA 5HFKA 1GLPA 3ERFA 2EIRA 3DVXA 4EO3A 2RUEA 2GDRA 5G5FA 2V6OA 3TOUA 2KHPA 4H86A 3ERWA 3IA1A 1QXHA 5ELGA 4IJ3A 5B6MA 3APSA 2VIMA 5FWGA 3FK8A 4MZWA 1AAZA 4FIWA 3APQA 4BVXA 4PURA 3TJBA 3KCMA 5ECHB 3CRUA 3Q74A 3EU4A 2GSSA 2XBIA 3KTLA 1CQHA 5IPHA 4POMA 4MABA 1QMVA 1EGOA 1E2YA 3Q6OA 3A3TA 1DE2A 3HA9A 2OACA 2F8FA 1M99A 4XCSA 1ON4A 4XS4A 2L5LA 2C0EA 1YKCA 5JWRB 2MBTA 1GSUA 4LLRA 2DC5A 2JACA 5DALA 1YQ1A 5HQPA 3WT2A 4E8EA 14GSA 3O6TA 2RUFA 2CAQA 1SK0A 2JSZA 3LG6A 3S9FA 5F8BA 1DSBA 4TR0A 1VGLA 4JZQA 2IMKA 3FKFA 3QMXA 1EP8A 3LQ7A 2OE0A 2CA8A 5G2ZA 4POBA 2YNXA 2JL4A 3R2QA 3GSTA 1TRSA 2J9HA 5AN1A 4K7OA 1WP0A 3P90A 3UARA 2HSHA 1B9XC 3APOA 4K9ZA 5H5RA 1Z3EA 1E6BA 2YV7A 3H8QA 2XPEA 3G7YA 1YJ6A 4TXOB 3UBLA 2H70A 3ZVJA 3FRCA 1YF1A 5H5SA 1T4YA 1OC9B 1SJZA 5G1KA 1ZL9A 2NPBA 4EXJA 2B1LA 1ZYEA 3D4TA 18GSA 4MZCA 1PKZA 3M8NA 4POLA 4MF7A 2E2GA 3J7Yb 1T8EB 4MF6A 2HRFA 1ILOA 3M9JA 3VWUA 2FA8A 2YWNA 2GT5A 1EGRA 2B3SA 3C7MA 5CYYA 4I2TA 5HFIA 3DXBA 4GWRA 3KIJA 5ECSA 4AJ8A 20GSA 1V58A 2XPDA 1T3BA 4IN0A 3IDVA 4ECBA 3F4TA 3FR6A 3WD6A 3CSHA 1UA5A 3E3EA 2HSYA 3HJOA 5L71A 2VO4A 5EL8A 1AC1A 5ECKB 5AIVA 1MTCA 1TKDB 1TRUA 4N30A 3ZREA 2WGRA 2C3TA 1XWBA 2KLXA 1XWKA 2XBQA 2LTKA 1X5CA 2MMZA 1ZGNA 2L6DA 5KN2A 3WGEA 3W6GA 3HJPA 3M1GA 2AUVA 4XS6A 3IHQA 1VF2A 2FLSA 1PKWA 1EOGA 2LQQA 1SK1A 3GN3A 3IC4A 3VI7A 3A5WA 1XOBA 1GNWA 1QUWA 2X8CA 4KH7A 2LSTA 5ID2A 1A0RP 1B9YC 2H76A 2MMAA 2V41A 1WIKA 2GZPA 1PL2A 2YV9A 1YDKA 3DVWA 4FYUA 2HT9A 4N0ZA 1USBA 3RHBA 4OCEA 4Z7XA 1BG5A 4DSSB 5F07A 2PMTA 5DDLA 4YAVA 3GH6A 1EEMA 1FVKA 3IOSA 2F51A 4LA1A 2B7KA 3BCKA 1A24A 1S3CA 3VWWA 3GKXA 3ZFBA 1WE0A 2B6MA 3C1SA 4MZBA 1XXUA 1SKRB 4HJ2A 2LEGA 3UL3A 1M9AA 4TOPA 3M9KA 2HE3A 1VF3A 3EMPA 2R4VA 3TJGA 3DEXA 4IKHA 1XVWA 2V6KA 3O3TA 5EPFA 4GRFA 2AAWA 3BCIA 4KCAA 4HU9A 4N10A 4EDYA 6GSVA 2WDUA 3P7XA 3EMXA 2O87A 2X8HA 3RPPA 2AJQB 3L0HA 1F3AA 4IP6A 1DUGA 2QGVA 3KH9A 5AISA 1A8YA 2FWFA 5HFGA 2YZHA 2IMFA 4IBPA 3LORA 1V57A 5JCGA 4NWYA 1BJXA 5H5QA 3TRXA 1TK8B 3LFLA 2H0HA 4MA9A 4OCFA 1RW1A 4KB3A 4Q5FA 4K7IA 3C71A 2DJ3A 1W4VA 2MMNA 10GSA 1J9BA 5GSSA 2AB6A 5KN3A 3ZIJA 2YJ7A 2IFQA 4V1Ag 2IN3A 1S3DA 5D9WA 1OKDA 3G9BA 3LSZA 2JZSA 4OO4A 4ECJA 1TU8A 1O73A 2DJJA 5G5EA 1X9MB 1GSYA 4LMVA 2VD0A 3CYNA 2DMLA 2I3YA 4MMMA 1XWGA 2DIYA 1F3BA 2L59A 1SD9A 4G9HA 4V2MA 5CRDA 4EKZA 4EF0A 5HR1A 4EC0A 2HFDA 3ERGA 3EE2A 5KN0A 1JLWA 4XS4B 1QQ2A 2L4CA 2AHEA 3LXTA 3ZMKA 4J2FA 1GUHA 3UEMA 4P3YB 1UC7A 2IJYA 4ZBDA 5DALB 2HLSA 1V2AA 1M0UA 5G1LA 2LNTA 2C4JA 2FGXA 2H1AA 3SWLA 4IHUA 1I9DA 3F3RA 1A2MA 3MWHA 5E59A 1GP1A 2YWIA 1A8LA 5IPGA 5COHA 2DJ1A 3L4NA 1F2EA 1G6YA 5IMAA 1ZZYA 2HZFA 3GA4A 1ZYQB 4KDXA 4DVCA 1ACVA 3RDWA 2VCQA 4JE1A 3IR4A 3LXZA 4TR4A 2GSRA 5J9BA 2VCXA 1IYIA 5IOWA 4X0XA 2H8LA 17GSA 4JR4A 2VD1A 4L0WA 1FHEA 2O89A 2E2MA 3GL3A 3C73A 4KDUA 4HQSA 3VPQA 1ZMAA 3F4RA 1Q98A 2NBSA 4TVEA 2P5QA 3D21A 3F9UA 1G7OA 4E8HA 3CRTA 2ON5A 3KEBA 3RBTA 4TRXA 4WR4A 1K0OA 3FZAA 2H0GA 2A4VA 2VUPA 1UVZA 5IIZA 5D96A 2OE3A 3TUEA 1THXA 5CP1A 1XVQA 4F03A 3JCML 5E4WA 4GQFA 5C00A 3UVHA 1B4PA 3CMIA 3D4MA 4YQMA 3GH9A 2DJKA 1SD8A 4JBBA 4L8EA 4OFMA 5J9CA 5ECMB 4WETA 1SJ6A 1YEPA 2CVBA 4G19A 1TU7A 4ZXGA 1B4QA 1EV4A 2KUCA 4X43A 1U6TA 2LUSA 4I5QA 1Z9HA 1SKWB 3A2WA 4X1UA 4WF4A 5IMVA 2ON7A 3QAGA 1AIUA 1GWCA 2VCWA 1PRXA 4F0BA 2FWHA 1JZRA 4L5LA 4N0VA 2RIIA 4KSOA 1AUCA 1QK8A 3DIEA 5D9TA 3TKPA 3TOTA 3F6DA 1NW2A 1G6WA 4MPFA 3ZRDA 2AV4A 1EEJA 1TXXA 2OE1A 1XWAA 5CNWA 4Q5QA 4ZILA 1XWCA 2LJAA 3ED3A 4PQIA 2H6XA 2XC2A 4KCEA 1GSDA 1NSWA 5DBQA 2B7JA 3TJFA 1X0RA 5CREA 5ID2B 5J4UA 3PH9A 3GTUA 4TR3A 2H0IA 2PN8A 5IOXA 4HQZA 3QFBC 3HVXA 2RLIA 3HZ8A 1W89A 4TKYA 5JCUA 4NHZA 2O85A 5IMDA 5G30A 2ZUPA 2NTOA 1HNBA 4EUYA 1SYRA 1XIYA 3FYGA 2DLXA 1FW1A 4RI6A 2PU9C 5EY6A 5GAND 3HCZA 5ENUA 2VAFA 2NDOA 3Q19A 1ZCPA 2HZEA 9GSSA 13GSA 1X9SB 3L9VA 4IELA 2GQMA 6GSTA 1GL8A 5DQSA 2VL3A 4J57E 4HUAA 1J0FA 1QFNA 4F9ZA 6GSUA 2H19A 4MCUA 3F8UA 3KH7A 4JRRA 3D0ZA 4OFTA 1H75A 5IMZA 4JU5A 2J23A 2R5GA 3F4SA 2EIOA 2QKEA 1ST9A 2PWJA 4PNGA 3ISOA 5DVBA 2PERA 2PVOC 2XHFA 3HD5A 4I6XA 1XPVA 4K2DA 2KP2A 4OD7A 1EP7A 1URMA 4TN8A 1TI1A 5B8BA 4TR1A 1WJKA 3FR9A 4IP1A 2CZ2A 3N9JA 3IPZA 1SL2B 3KTBA 4MH2A 3W8JA 1GTAA 4F2IA 2C3QA 4L5OA 2P31A 1SL0B 1FB0A 3WGXA 1Y6EA 2YANA 1DBYA 1BYEA 4XRDA 1V40A 4PNFA 5GAPD 2H1GA 5CRHA 3BBYA 5KN1A 4D73A 2LS5A 4NXIA 1OKTA 2H71A 1V9WA 1FOVA 2VCVA 1OE7A 1EOHA 1GSQA 1XW9A 4PQ1A 3Q18A 3I43A 1R5AA 2WS2A 1K0MA 2TRXA 3TCOA 4K7NA 1SJIA 4GSTA 1PD21 1HD2A 2GQLA 3ZMLA 4PXOA 4NV5A 3MDKA 4KNDA 2BJXA 4MJAA 4OFNA 4GTUA 2D2ZA 2H1BA 4ZIJA 2OADA 1TOFA 3GX0A 1PSQA 1YKAA 4AJ7A 2YWMA 2F8AA 2JSYA 1PQNA 22GSA 2M72A 4PX1A 19GSA 1F9MA 1O8XA 3IE3A 2MZCA 4JEDA 3H93A 4Q5RA 2JADA 1WWJA 2I9HA 3ZITA 3ZVJD 4HZ4A 2FWEA 4IVFA 4HZ2A 4MP4A 3AY8A 5J3RA 4FH8A 4RQXA 1KNGA 2E0QA 2CZ3A 3QCPA 2VLTA 4WBRD 2DJ0A 4HS1A 3L78A 2CQ9A 4K8MA 4O32A 3QAWA 1G7EA 4GCIA 3ZZXA 3US3A 3CTGA 3A2VA 4XTSA 2CV4A 3HDCA 1F6MC 4FYCA 2L6CA 5DAKA 2F9SA 4GF0A 1PMTA 4V2NA 2A2SA 2N5BA 3EU3A 4ULXA 2YJHA 5FT3A 1T7PB 8GSSA 3IAS2 3TKQA 2WFCA 2C3NA 3J7Yk 4EVMA 2G2QA 1NHYA 3OR5A 3CSIA 1S3AA 3FW2A 3RHCA 5JCWA 1ERWA 2CT6A 3LWAA 3GKNA 2P5RA 1YY7A 2HI7A 1YEXA 4DSQA 1XOAA 3VWVA 4WBJA 5IO2A 3DYRA 4KAEA 4BL7A 3F6FA 4IGJA 2R37A 3HHVA 4ISDA 1OC8A 2M46A 3FY7A 5AGYA 2QC7A 3EURA 2H01A 2MYGA 2PBJA 2VLVA 2JU5A 1OE8A 1JZOA 1WPIA 4GLTA 2REMA 4MH3A 4DEJA 1K3OA 5DQYA 3GMFA 1KBNA 1X5DA 1F37A 4MJCA 3EYTA 4KSMA 3MSZA 2PGTA 4V2LA 2K9FA 1T00A 2H74A 1GSSA 1A23A 5GSTA 2FHEA 2O8VB 5C04A 3HZ4A 4GSSA 2KP1A 4ZB6A 1EWXA 3DKSA 2C80A 3PR8A 1YZXA 1GTUA 3ZIVA 4CW9A 2X64A 3M0FA 1MDJA 2IWTA 2HNLA 4OO5A 4MLYA 1JZDA 1T1VA 1TRWA 3GNJA 1N8JA 2ES7A 3F3QA 4WEYA 5HR2A 2C0FA 1K3LA 3F63A 3GTUB 3GKKA 1OAZA 1VRSD 1GUMA 1TRVA 5INYA 4ACSA 1ZOFA 3D22A 5ECIB 3D6IA 2OBIA 3MNGA 2L57A 3UMAA 2YZUA 4WKWA 3GHAA 4YQVA 1WOUA 2GVPA 1GH2A 3TKSE 2C8UA 3KJYA 1R7HA 2K8VA 2GZYA 3HKRA 1TP9A 5DCGA 5LNKe 2MMOA 1KEBA 4ILFA 3EINA 2CX3A 3H1NA 1GULA 3G7IA 3F0IA 2YP6A 1FB6A 2OKAA 5J41A 4NV2A 5EVOA 1YF0A 5JWOB 1B8XA 5G31A 1PN9A 2FD3A 3M3MA 1A2JA 1FO5A 2LRNA 2OJLA 2B1KA 4N11A 4MPGA 4PQHA 4TR1B 1VF4A 3NIVA 5J5NA 1NM3A 4G2EA 4ID0A 3QPMA 3UIWA 1RK4A 3TDGA 5F05A 6GSXA 1X9WB 3GURA 1JZWA 3LYKA 1TK0B 4NPBA 12GSA 3VFIA 3QFAC 4BA7A 4FYBA 3L9SA 3EVIA 3C1RA 3RAZA 2H72A 2X99A 3QR6A 2I4AA 2H73A 1TTZA 4QL9A 1BEDA 4OWYA 1R4WA 2IL3A 1R26A 3GFKA 2JZRA 1PGTA 2H30A 4D73B 4BWQA 5D73A 3TRQA 3ME7A 3WGDA 1A2LA 4ECIA 4CHSA 5D9XA 4AJ6A 2GS3A 4L0UA 2X8GA 1R5PA 3CTFA 4GXZA 1OVNA 1UN2A 2PPTA 5AIXA 4WR5A 2HYXA 2VM1A 3N5OA 2DSAA 4O92A 1ERVA 4PUFC 4MJEA 4QL7A 3BJ5A 5DJMA 1XCCA 2K18A 2TIRA 1SKSB 2H75A 2H6ZA 4GQCA 2FCHA 2CX4A 1WRYA 1CQGA 3HJMA 3RPNA
chains in the Genus database with same CATH superfamily
3FZ9A 2IMIA 1SU9A 1Q4JA 2L5OA 1JFUA 2LQOA 3IK7A 1MEKA 1MDKA 2LJRA 6GSYA 1SL1B 1G0TA 4HU7A 2RM5A 3GX8A 4K1FA 2FUG2 3KXOA 2LRTA 3K8NA 2IMEA 2JZTA 5CO3A 2WJUA 4XRAA 2GSQA 1EZKA 2ALBA 1HNAA 3KM6A 1QGVA 4IQAA 5HR0A 5B6NA 2FA4A 4HDEA 1Z6MA 5IO0A 4ZB8A 5IMFA 3HVVA 3TKSC 5BRTA 4XHMA 1K0NA 2VLUA 3IRAA 3GUSA 1ERUA 5DAKB 3UVTA 4GSNA 3ZL5A 3ZLPA 2L4QA 4NAXA 3VWXA 6GSSA 5ECPB 2FNOA 3HVNA 2DJ2A 2A2RA 3A2XA 3WYWA 3TJJA 4EIQA 1GSFA 2R3XA 3UOMA 1AQWA 4IW9A 1GNEA 3G7JA 4YH2A 3WT1A 2F3MA 2WZ9A 5D8IA 5IM9A 2B5YA 3P2AA 3QD9A 5HR3A 3C8EA 2OBKA 3TRPA 4YAPA 4IS0A 5JWQB 1XFLA 4ML6A 2VCZA 4BL7B 2VL2C 4MF5A 1BX9A 3DRNA 2YCDA 1K0DA 4K2XA 5ECNB 4FO5A 3TKSA 1PX7A 1TW9A 1M3JA 4ZB9A 5A4WA 4JR6A 1B48A 2DKIA 2C0DA 4O7HA 2DIZA 1PA3A 4Q5NA 1GSEA 3KD0A 3CBUA 2IFQB 3U6VA 3HXSA 3VI5A 3E9JB 1C72A 2V2GA 4PUAA 4KGIA 4V1Ap 2G0FA 2R2JA 3BD2A 1V98A 3NOFA 1GTIA 3SBCA 1KTEA 2X4AA 1FVJA 2C1YA 5LD0A 1Z7RA 5ELAA 4F82A 2GT6A 5ABRA 4HI7A 3LYPA 4AGSA 3UAPA 2IMDA 2VOCA 3EWLA 4KDYA 2P0GA 2WCIA 2DMMA 1XBSA 3TGZA 2GTUA 1K0AA 4O5RA 1FG4A 5DCHA 3ZFLA 2H1DA 1ABAA 1M2AA 3CXGA 3GL5A 2N5AA 2TRCP 2VM2A 2VL2A 5IQYA 1K0CA 3IXRA 2GGTA 1LBKA 1M7TA 4WXTA 4G10A 2KOKA 1SK2A 1BQ7A 1X5EA 5D9VA 2V1MA 3FR3A 4A5PA 3IBHA 1Z6NA 2VCTA 3KMOA 3UJ1A 2FWGA 1ERTA 1EV9A 2Z9SA 4K5SA 1SENA 1ML6A 2FY6A 2I1UA 2DKHA 2H66A 3DD3A 2LRCA 4J56E 4RQRA 2GSTA 4ML1A 2EC4A 3I6AA 3E0UA 4MDCA 1J08A 4K0NA 4RUVA 2ZNMA 3FHKA 4F0CA 2IPAA 1GUKA 1A0FA 3U5RE 7GSSA 3MAKA 3IV4A 1JHBA 1PN0A 3VK9A 1OYJA 4ZBBA 4ZL8A 3IK9A 1O81A 5A4VA 1PL1A 4KW6A 2EIQA 3FEUA 5CRWA 4LL4B 2HRNA 4BPYA 2I81A 5KEJA 4MJBA 3ZTLA 2R0CA 3R3EA 4IJIA 3HY2A 3TJKA 4KX4A 4NMUA 5CRGA 2YOIA 4TXOA 1JLVA 4I97A 3L9UA 16GSA 2AYTA 2RM6A 2QSIA 1I5GA 5FHIA 1PX6A 1OC9A 3DMLA 1GRXA 2OA7A 3LJRA 1THOA 2ZCTA 3W8SA 2E7PA 1TK5B 2LNSA 5D93A 4EDZA 2BTOT 3QOUA 3VPTA 3KZQA 5F06A 3FZ5A 3HVSA 1K3YA 1Z5YE 4XS1A 1LJRA 4AF2A 1IYHA 1O8WA 3GSSA 1U87A 1AQXA 2LV3A 1TI3A 3PGTA 4I2UA 3VURA 3P8WA 4K6XA 3TB2A 3GV1A 1DE1A 3H4KA 3ME8A 4NHWA 1AQVA 6GSWA 1O7UA 2GZZA 1M2BA 1MD4A 2C0GA 5ECLB 4BVYA 3KP8A 2K6VA 2YPMA 2H6YA 4TXVA 3LEFA 3PINA 2K8SA 4RI7A 4OMVA 2YN1A 1NHOA 2LKUA 1SYXA 1AW9A 2PVQA 4KUNA 1XW6A 5F0GA 1VF1A 4XIHA 2WULA 2YWOA 2V32A 4IQ1A 2O7KA 4POKA 1N2AA 3VLNA 4HOJA 2CVKA 4EE0A 2DBCA 3TKRA 1MDIA 4KA0A 1M2DA 4WF5A 2B5EA 4DSRA 1K0BA 1O85A 3GIXA 4ZBAA 2HZEB 3LGCA 3I9V2 4ZL9A 2CAIA 1RQMA 4I8BA 1AXDA 3O76A 4K5RA 5ECQB 1XW5A 1MD3A 2BMXA 2HXKA 4DSSA 1U3AA 1HNCA 5ECRB 3HYPA 1LU4A 3QDNA 2LJKA 2R0GA 11GSA 2UZ8A 3BOAA 3D5JA 2B5XA 2N5FA 2R6KA 3UBKA 4LL1B 1HQOA 1GTBA 2WRTA 3FZ4A 3DGQA 1WMJA 5B8AA 1M9BA 4HJMA 3I69A 4K0GA 1U88A 5CAXA 4FQUA 4HEA2 1O6JA 2VL9A 4YQUA 5IMCA 5LCZA 3QAVA 3ZYWA 1OC3A 1U3IA 1T4ZA 5A4UA 2CVDA 2GLRA 4PGTA 4ZL7A 1BAYA 5DJLA 1HYUA 4CDOA 4BWSA 2M80A 3KGKA 3GRXA 4KE3A 2PUKC 3H79A 3GYKA 4TW5A 5ECOB 5B7CA 2IIYA 5GZZB 3CQFA 3CSJA 1H4OA 3GKMA 1Y25A 3IAM2 3V1WA 3KMNA 3EC3A 1TJDA 2MBSA 1XZOA 1TDIA 1FAAA 1Z7PA 4ECCA 4EL1A 3KP9A 2GQKA 3DWVA 5A5KA 2WB9A 3NZNA 4QQ7A 1GLQA 4LMWA 4MK3A 2NVLA 5HFKA 1GLPA 3ERFA 2EIRA 3DVXA 4EO3A 2RUEA 2GDRA 5G5FA 2V6OA 3TOUA 2KHPA 4H86A 3ERWA 3IA1A 1QXHA 5ELGA 4IJ3A 5B6MA 3APSA 2VIMA 5FWGA 3FK8A 4MZWA 1AAZA 4FIWA 3APQA 4BVXA 4PURA 3TJBA 3KCMA 5ECHB 3CRUA 3Q74A 3EU4A 2GSSA 2XBIA 3KTLA 1CQHA 5IPHA 4POMA 4MABA 1QMVA 1EGOA 1E2YA 3Q6OA 3A3TA 1DE2A 3HA9A 2OACA 2F8FA 1M99A 4XCSA 1ON4A 4XS4A 2L5LA 2C0EA 1YKCA 5JWRB 2MBTA 1GSUA 4LLRA 2DC5A 2JACA 5DALA 1YQ1A 4G0LA 5HQPA 3WT2A 4E8EA 14GSA 3O6TA 2RUFA 2CAQA 1FOHA 1SK0A 2JSZA 3LG6A 3S9FA 5F8BA 1DSBA 4TR0A 1VGLA 4JZQA 2IMKA 3FKFA 3QMXA 1EP8A 3LQ7A 2OE0A 2CA8A 5G2ZA 4POBA 2YNXA 2JL4A 3R2QA 3GSTA 1TRSA 2J9HA 5AN1A 4K7OA 1WP0A 3P90A 3UARA 2HSHA 1B9XC 3APOA 4K9ZA 5H5RA 1Z3EA 3PPUA 1E6BA 2YV7A 3H8QA 2XPEA 3G7YA 1YJ6A 4TXOB 3UBLA 2H70A 3ZVJA 3FRCA 1YF1A 5H5SA 1T4YA 1OC9B 1SJZA 5G1KA 4Z2RA 1ZL9A 2NPBA 4EXJA 2B1LA 1ZYEA 3D4TA 18GSA 4MZCA 1PKZA 3M8NA 4POLA 4MF7A 2E2GA 3J7Yb 1T8EB 4MF6A 2HRFA 1ILOA 3M9JA 3VWUA 2FA8A 2YWNA 2GT5A 1EGRA 2B3SA 3C7MA 5CYYA 4I2TA 5HFIA 3DXBA 4GWRA 3KIJA 5ECSA 4AJ8A 20GSA 1V58A 2XPDA 1T3BA 4IN0A 3IDVA 4ECBA 2X49A 3F4TA 3FR6A 3WD6A 3CSHA 1UA5A 3E3EA 2HSYA 3HJOA 5L71A 2VO4A 5EL8A 1AC1A 4BVYB 5ECKB 5AIVA 1MTCA 1TKDB 1TRUA 5KOXA 4N30A 3ZREA 2WGRA 2C3TA 1XWBA 2KLXA 1XWKA 2XBQA 2LTKA 1X5CA 2MMZA 1ZGNA 2L6DA 5KN2A 3WGEA 4PTSA 3W6GA 3HJPA 3M1GA 2AUVA 4XS6A 3IHQA 1VF2A 2FLSA 4EIPA 1PKWA 1EOGA 2LQQA 1SK1A 3GN3A 3IC4A 3VI7A 3A5WA 1XOBA 1GNWA 1QUWA 2X8CA 4KH7A 2LSTA 5ID2A 1A0RP 1B9YC 2H76A 2MMAA 2V41A 1WIKA 2GZPA 1PL2A 2YV9A 1YDKA 3DVWA 4FYUA 2HT9A 4N0ZA 1USBA 3RHBA 2HSMA 4OCEA 4Z7XA 1BG5A 4DSSB 5F07A 2PMTA 5DDLA 4YAVA 3GH6A 1EEMA 1FVKA 3IOSA 2F51A 4LA1A 2B7KA 3BCKA 1A24A 1S3CA 3VWWA 3GKXA 3ZFBA 1WE0A 2B6MA 3C1SA 4MZBA 1XXUA 1SKRB 4HJ2A 2LEGA 3UL3A 1M9AA 4TOPA 3M9KA 2HE3A 2HRKA 1VF3A 3EMPA 2R4VA 3TJGA 3DEXA 4IKHA 1XVWA 2V6KA 3O3TA 4GRFA 2AAWA 3BCIA 5EPFA 4KCAA 4HU9A 4N10A 4EDYA 6GSVA 2WDUA 3P7XA 3EMXA 2O87A 4CY6A 2X8HA 3RPPA 2AJQB 3L0HA 1F3AA 4IP6A 1DUGA 2QGVA 4Z2UA 3KH9A 5AISA 1A8YA 2FWFA 5HFGA 2YZHA 2IMFA 4IBPA 3LORA 1V57A 5JCGA 4NWYA 1BJXA 5H5QA 3TRXA 1TK8B 3LFLA 2H0HA 4MA9A 4OCFA 1RW1A 4KB3A 4Q5FA 4K7IA 3C71A 2DJ3A 1W4VA 2MMNA 10GSA 1J9BA 5GSSA 2AB6A 5KN3A 3ZIJA 2YJ7A 2IFQA 4V1Ag 2IN3A 1S3DA 5D9WA 1OKDA 3G9BA 3LSZA 2JZSA 4OO4A 2QA1A 4ECJA 1TU8A 1O73A 2DJJA 5G5EA 1X9MB 1GSYA 4LMVA 2VD0A 3CYNA 2DMLA 2I3YA 4MMMA 2R0PA 1XWGA 4BVXB 2DIYA 1F3BA 2L59A 3FMWA 1SD9A 4G9HA 4X4JA 4V2MA 5CRDA 4EKZA 4EF0A 5HR1A 4EC0A 2HFDA 3ERGA 3EE2A 5KN0A 1JLWA 4XS4B 1QQ2A 2L4CA 2AHEA 3LXTA 3ZMKA 4J2FA 1GUHA 3UEMA 4P3YB 1UC7A 2IJYA 4USSA 4ZBDA 5DALB 2HLSA 1V2AA 1M0UA 5G1LA 2LNTA 2C4JA 2FGXA 2H1AA 3LW9A 4IHUA 3SWLA 1I9DA 3F3RA 1A2MA 3MWHA 5E59A 1GP1A 2YWIA 1A8LA 5IPGA 5COHA 2DJ1A 3L4NA 1F2EA 1G6YA 5IMAA 1ZZYA 2HZFA 3GA4A 1ZYQB 4KDXA 4DVCA 1ACVA 3RDWA 2VCQA 4JE1A 3IR4A 3LXZA 4TR4A 2GSRA 5J9BA 2VCXA 1IYIA 5IOWA 4X0XA 2H8LA 17GSA 4JR4A 2VD1A 4L0WA 1FHEA 2O89A 2E2MA 3GL3A 3C73A 4KDUA 4HQSA 3VPQA 1ZMAA 3F4RA 1Q98A 2NBSA 4TVEA 4HSCX 2P5QA 3D21A 3MYDA 3F9UA 1G7OA 4E8HA 3CRTA 2ON5A 3KEBA 3RBTA 4TRXA 4WR4A 1K0OA 3FZAA 2H0GA 2A4VA 2VUPA 1UVZA 5IIZA 5D96A 2OE3A 3TUEA 1THXA 5CP1A 1XVQA 4F03A 3JCML 5E4WA 4GQFA 3A5IA 5C00A 3UVHA 1B4PA 3CMIA 3D4MA 4YQMA 3GH9A 2DJKA 1SD8A 1M3IA 4JBBA 4L8EA 4G0KA 4OFMA 4Z2TA 5J9CA 5ECMB 4WETA 1SJ6A 1YEPA 2CVBA 4G19A 1TU7A 4ZXGA 1B4QA 1EV4A 2KUCA 4MNNA 4X43A 1U6TA 2LUSA 4I5QA 1Z9HA 1SKWB 1ZYNA 3A2WA 4X1UA 4WF4A 5IMVA 2ON7A 3QAGA 1AIUA 1GWCA 2VCWA 1PRXA 4F0BA 2FWHA 1JZRA 4L5LA 4N0VA 2RIIA 3IHGA 4KSOA 1AUCA 1QK8A 3DIEA 5D9TA 3TKPA 3TOTA 3F6DA 1NW2A 1G6WA 4MPFA 3ZRDA 2AV4A 1EEJA 1TXXA 3IC8A 2OE1A 1XWAA 5CNWA 4Q5QA 4ZILA 1XWCA 2LJAA 3ED3A 4PQIA 2H6XA 2XC2A 4KCEA 1GSDA 1NSWA 5DBQA 2B7JA 3TJFA 1X0RA 5CREA 5ID2B 5J4UA 3PH9A 3GTUA 4TR3A 2H0IA 2PN8A 1XG8A 5IOXA 4HQZA 3QFBC 3HVXA 2RLIA 3HZ8A 1W89A 4TKYA 5JCUA 4BIKA 4NHZA 2O85A 5IMDA 5G30A 2ZUPA 2NTOA 1HNBA 4EUYA 1SYRA 1XIYA 4O5QA 3FYGA 2DLXA 1FW1A 4RI6A 2PU9C 5EY6A 5GAND 3HCZA 5ENUA 2VAFA 2NDOA 3Q19A 1ZCPA 2HZEA 9GSSA 13GSA 1X9SB 3L9VA 4IELA 2GQMA 6GSTA 1GL8A 5DQSA 2VL3A 4J57E 4HUAA 1J0FA 1QFNA 5KOWA 4F9ZA 6GSUA 2H19A 4MCUA 4ICYA 3F8UA 3KH7A 4JRRA 3D0ZA 4OFTA 1H75A 5IMZA 4JU5A 2J23A 2R5GA 3F4SA 2EIOA 2A4HA 2QKEA 1ST9A 2PWJA 4PNGA 3ISOA 5DVBA 2PERA 2PVOC 2XHFA 3HD5A 4I6XA 1XPVA 4K2DA 2KP2A 4OD7A 1EP7A 1URMA 3MIXA 4TN8A 1TI1A 5B8BA 4TR1A 1WJKA 3FR9A 4IP1A 2CZ2A 3N9JA 2QA2A 3IPZA 1SL2B 3KTBA 4MH2A 3W8JA 1GTAA 4F2IA 2C3QA 4L5OA 2P31A 4O5UA 1SL0B 1FB0A 3WGXA 1Y6EA 2YANA 1DBYA 1BYEA 5BMUA 4XRDA 1V40A 4PNFA 5GAPD 2H1GA 4KF9A 5CRHA 3BBYA 5KN1A 4D73A 2LS5A 4NXIA 1OKTA 2H71A 1V9WA 1FOVA 2VCVA 1OE7A 1EOHA 1GSQA 1XW9A 4PQ1A 3Q18A 3I43A 1R5AA 2WS2A 1K0MA 2TRXA 3TCOA 4K7NA 1SJIA 4GSTA 1PD21 1HD2A 2GQLA 3ZMLA 4PXOA 4NV5A 3MDKA 4KNDA 2BJXA 4MJAA 4OFNA 4GTUA 2D2ZA 2H1BA 4ZIJA 2OADA 1TOFA 3GX0A 1PSQA 1YKAA 4AJ7A 2YWMA 2F8AA 2JSYA 1PQNA 22GSA 2M72A 4PX1A 19GSA 1F9MA 1O8XA 3IE3A 2MZCA 4JEDA 3H93A 4Q5RA 2JADA 1WWJA 2I9HA 3ZITA 3ZVJD 4HZ4A 2FWEA 4IVFA 4HZ2A 4MP4A 3AY8A 5J3RA 4FH8A 4RQXA 1KNGA 2E0QA 2CZ3A 3QCPA 2VLTA 4WBRD 2DJ0A 4HS1A 3L78A 2CQ9A 4K8MA 4O32A 3QAWA 1G7EA 4GCIA 3ZZXA 3US3A 3CTGA 1ZYPA 3A2VA 4XTSA 2CV4A 3HDCA 1F6MC 4FYCA 2L6CA 5DAKA 2F9SA 4GF0A 1PMTA 4V2NA 2A2SA 2N5BA 3EU3A 4ULXA 2YJHA 5FT3A 1T7PB 8GSSA 3IAS2 3TKQA 2WFCA 2C3NA 3J7Yk 4EVMA 2G2QA 1NHYA 3OR5A 3CSIA 1S3AA 3FW2A 3RHCA 5JCWA 1ERWA 2CT6A 3LWAA 3GKNA 2P5RA 1YY7A 2HI7A 1YEXA 4DSQA 1XOAA 3VWVA 4WBJA 5IO2A 3DYRA 4KAEA 4BL7A 3F6FA 4IGJA 2R37A 3HHVA 4ISDA 1OC8A 2M46A 3FY7A 5AGYA 2QC7A 3EURA 2H01A 2MYGA 2PBJA 4YKGA 2A2PA 2VLVA 2JU5A 1OE8A 1JZOA 1WPIA 4GLTA 2REMA 4MH3A 4DEJA 1K3OA 5DQYA 3GMFA 1KBNA 1X5DA 1F37A 4MJCA 3EYTA 4KSMA 3MSZA 2PGTA 4V2LA 2K9FA 1T00A 2H74A 1GSSA 1A23A 5GSTA 2FHEA 2O8VB 5C04A 3HZ4A 4GSSA 2KP1A 4ZB6A 1EWXA 3DKSA 2C80A 3PR8A 1YZXA 1GTUA 3ZIVA 4CW9A 2X64A 3M0FA 1MDJA 2IWTA 2HNLA 4OO5A 4MLYA 1JZDA 1T1VA 1TRWA 3GNJA 1N8JA 2ES7A 3F3QA 4WEYA 5HR2A 2C0FA 1K3LA 3F63A 3GTUB 3GKKA 1OAZA 1VRSD 1GUMA 1TRVA 5INYA 1S3RA 4ACSA 1ZOFA 3D22A 5ECIB 3D6IA 2OBIA 3MNGA 2L57A 3UMAA 2YZUA 4WKWA 3GHAA 4YQVA 1WOUA 2GVPA 1GH2A 3TKSE 2C8UA 3KJYA 1R7HA 2K8VA 2GZYA 3HKRA 1TP9A 5DCGA 5LNKe 2MMOA 1KEBA 4ILFA 3EINA 2CX3A 3H1NA 1GULA 2HRAA 3G7IA 4YKFA 3F0IA 2YP6A 1FB6A 2OKAA 5J41A 4NV2A 5EVOA 1YF0A 5JWOB 4CY8A 3EPTA 1B8XA 5G31A 1PN9A 2FD3A 3M3MA 1A2JA 1FO5A 2LRNA 2OJLA 2B1KA 4N11A 4MPGA 4PQHA 4TR1B 1VF4A 3NIVA 5J5NA 1NM3A 4G2EA 4G0IA 4ID0A 3QPMA 3UIWA 1RK4A 3TDGA 5F05A 6GSXA 1X9WB 3GURA 1JZWA 3LYKA 1TK0B 4NPBA 12GSA 3VFIA 3QFAC 4BA7A 4FYBA 3L9SA 3EVIA 3C1RA 3RAZA 2H72A 2X99A 3QR6A 2I4AA 2H73A 1TTZA 4QL9A 1BEDA 4OWYA 1R4WA 2IL3A 1PFOA 1R26A 3GFKA 2JZRA 1PGTA 2H30A 4D73B 4BWQA 5D73A 3TRQA 3ME7A 3WGDA 1A2LA 4ECIA 4CHSA 5D9XA 4AJ6A 2GS3A 4L0UA 2X8GA 1R5PA 3CTFA 4GXZA 1OVNA 1UN2A 2PPTA 5AIXA 4WR5A 2HYXA 2VM1A 3N5OA 2DSAA 4O92A 1ERVA 4PUFC 4MJEA 4QL7A 3BJ5A 5DJMA 1XCCA 2K18A 2TIRA 1SKSB 2H75A 2H6ZA 4GQCA 2FCHA 2CX4A 1WRYA 1CQGA 3HJMA 3RPNA
chains in the Genus database with same CATH topology
3FZ9A 2IMIA 1SU9A 1Q4JA 2L5OA 1JFUA 2LQOA 3IK7A 1MEKA 1MDKA 2LJRA 6GSYA 1SL1B 1G0TA 4HU7A 2RM5A 3GX8A 4K1FA 2FUG2 3KXOA 2LRTA 3K8NA 2IMEA 2JZTA 5CO3A 2WJUA 4XRAA 2GSQA 1EZKA 2ALBA 1HNAA 3KM6A 1QGVA 4IQAA 5HR0A 5B6NA 2FA4A 4HDEA 1Z6MA 5IO0A 4ZB8A 5IMFA 3HVVA 3TKSC 5BRTA 4XHMA 1K0NA 2VLUA 3IRAA 3GUSA 1ERUA 5DAKB 3UVTA 4GSNA 3ZL5A 3ZLPA 2L4QA 4NAXA 3VWXA 6GSSA 5ECPB 2FNOA 2DJ2A 2A2RA 3A2XA 3WYWA 3TJJA 4EIQA 1GSFA 2R3XA 3UOMA 1AQWA 4IW9A 1GNEA 3G7JA 4YH2A 3WT1A 2F3MA 2WZ9A 5D8IA 5IM9A 2B5YA 3P2AA 3QD9A 5HR3A 3C8EA 2OBKA 3TRPA 4YAPA 4IS0A 5JWQB 1XFLA 4ML6A 2VCZA 4BL7B 2VL2C 4MF5A 1BX9A 3DRNA 2YCDA 1K0DA 4K2XA 5ECNB 4FO5A 3TKSA 1PX7A 1TW9A 4ZB9A 5A4WA 4JR6A 1B48A 2DKIA 2C0DA 4O7HA 2DIZA 1PA3A 4Q5NA 1GSEA 3KD0A 3CBUA 2IFQB 3U6VA 3HXSA 3VI5A 3E9JB 1C72A 2V2GA 4PUAA 4KGIA 4V1Ap 2G0FA 2R2JA 3BD2A 1V98A 3NOFA 1GTIA 3SBCA 1KTEA 2X4AA 1FVJA 2C1YA 5LD0A 1Z7RA 5ELAA 4F82A 2GT6A 5ABRA 4HI7A 3LYPA 4AGSA 3UAPA 2IMDA 2VOCA 3EWLA 4KDYA 2P0GA 2WCIA 2DMMA 1XBSA 3TGZA 2GTUA 1K0AA 4O5RA 1FG4A 5DCHA 3ZFLA 2H1DA 1ABAA 1M2AA 3CXGA 3GL5A 2N5AA 2TRCP 2VM2A 2VL2A 5IQYA 1K0CA 3IXRA 2GGTA 1LBKA 1M7TA 4WXTA 4G10A 2KOKA 1SK2A 1BQ7A 1X5EA 5D9VA 2V1MA 3FR3A 4A5PA 3IBHA 1Z6NA 2VCTA 3KMOA 3UJ1A 2FWGA 1ERTA 1EV9A 2Z9SA 4K5SA 1SENA 1ML6A 2FY6A 2I1UA 2DKHA 2H66A 3DD3A 2LRCA 4J56E 4RQRA 2GSTA 4ML1A 2EC4A 3I6AA 3E0UA 4MDCA 1J08A 4K0NA 4RUVA 2ZNMA 3FHKA 4F0CA 2IPAA 1GUKA 1A0FA 3U5RE 7GSSA 3MAKA 3IV4A 1JHBA 1PN0A 3VK9A 1OYJA 4ZBBA 4ZL8A 3IK9A 1O81A 5A4VA 1PL1A 4KW6A 2EIQA 3FEUA 5CRWA 4LL4B 2HRNA 4BPYA 2I81A 5KEJA 4MJBA 3ZTLA 2R0CA 3R3EA 4IJIA 3HY2A 3TJKA 4KX4A 4NMUA 5CRGA 2YOIA 4TXOA 1JLVA 4I97A 3L9UA 16GSA 2AYTA 2RM6A 2QSIA 1I5GA 5FHIA 1PX6A 1OC9A 3DMLA 1GRXA 2OA7A 3LJRA 1THOA 2ZCTA 3W8SA 2E7PA 1TK5B 2LNSA 5D93A 4EDZA 2BTOT 3QOUA 3VPTA 3KZQA 5F06A 3FZ5A 3HVSA 1K3YA 1Z5YE 4XS1A 1LJRA 4AF2A 1IYHA 1O8WA 3GSSA 1U87A 1AQXA 2LV3A 1TI3A 3PGTA 4I2UA 3VURA 3P8WA 4K6XA 3TB2A 3GV1A 1DE1A 3H4KA 3ME8A 4NHWA 1AQVA 6GSWA 1O7UA 2GZZA 1M2BA 1MD4A 2C0GA 5ECLB 4BVYA 3KP8A 2K6VA 2YPMA 2H6YA 4TXVA 3LEFA 3PINA 2K8SA 4RI7A 4OMVA 2YN1A 1NHOA 2LKUA 1SYXA 1AW9A 2PVQA 4KUNA 1XW6A 5F0GA 1VF1A 4XIHA 2WULA 2YWOA 2V32A 4IQ1A 2O7KA 4POKA 1N2AA 3VLNA 4HOJA 2CVKA 4EE0A 2DBCA 3TKRA 1MDIA 4KA0A 1M2DA 4WF5A 2B5EA 4DSRA 1K0BA 1O85A 3GIXA 4ZBAA 2HZEB 3LGCA 3I9V2 4ZL9A 2CAIA 1RQMA 4I8BA 1AXDA 3O76A 4K5RA 5ECQB 1XW5A 1MD3A 2BMXA 2HXKA 4DSSA 1U3AA 1HNCA 5ECRB 3HYPA 1LU4A 3QDNA 2LJKA 2R0GA 11GSA 2UZ8A 3BOAA 3D5JA 2B5XA 2N5FA 2R6KA 3UBKA 4LL1B 1HQOA 1GTBA 2WRTA 3FZ4A 3DGQA 1WMJA 5B8AA 1M9BA 4HJMA 3I69A 4K0GA 1U88A 5CAXA 4FQUA 4HEA2 1O6JA 2VL9A 4YQUA 5IMCA 5LCZA 3QAVA 3ZYWA 1OC3A 1U3IA 1T4ZA 5A4UA 2CVDA 2GLRA 4PGTA 4ZL7A 1BAYA 5DJLA 1HYUA 4CDOA 4BWSA 2M80A 3KGKA 3GRXA 4KE3A 2PUKC 3H79A 3GYKA 4TW5A 5ECOB 5B7CA 2IIYA 5GZZB 3CSJA 1H4OA 3GKMA 1Y25A 3IAM2 3V1WA 3KMNA 3EC3A 1TJDA 2MBSA 1XZOA 1TDIA 1FAAA 1Z7PA 4ECCA 4EL1A 3KP9A 2GQKA 3DWVA 5A5KA 2WB9A 3NZNA 4QQ7A 1GLQA 4LMWA 4MK3A 2NVLA 5HFKA 1GLPA 3ERFA 2EIRA 3DVXA 4EO3A 2RUEA 2GDRA 5G5FA 2V6OA 3TOUA 2KHPA 4H86A 3ERWA 3IA1A 1QXHA 5ELGA 4IJ3A 5B6MA 3APSA 2VIMA 5FWGA 3FK8A 4MZWA 1AAZA 4FIWA 3APQA 4BVXA 4PURA 3TJBA 3KCMA 5ECHB 3CRUA 3Q74A 3EU4A 2GSSA 2XBIA 3KTLA 1CQHA 5IPHA 4POMA 4MABA 1QMVA 1EGOA 1E2YA 3Q6OA 3A3TA 1DE2A 3HA9A 2OACA 2F8FA 1M99A 4XCSA 1ON4A 4XS4A 2L5LA 2C0EA 1YKCA 5JWRB 2MBTA 1GSUA 4LLRA 2DC5A 2JACA 5DALA 1YQ1A 4G0LA 5HQPA 3WT2A 4E8EA 14GSA 3O6TA 2RUFA 2CAQA 1FOHA 1SK0A 2JSZA 3LG6A 3S9FA 5F8BA 1DSBA 4TR0A 1VGLA 4JZQA 2IMKA 3FKFA 3QMXA 1EP8A 3LQ7A 2OE0A 2CA8A 5G2ZA 4POBA 2YNXA 2JL4A 3R2QA 3GSTA 1TRSA 2J9HA 5AN1A 4K7OA 1WP0A 3P90A 3UARA 2HSHA 1B9XC 3APOA 4K9ZA 5H5RA 1Z3EA 3PPUA 1E6BA 2YV7A 3H8QA 2XPEA 3G7YA 1YJ6A 4TXOB 3UBLA 2H70A 3ZVJA 3FRCA 1YF1A 5H5SA 1T4YA 1OC9B 1SJZA 5G1KA 4Z2RA 1ZL9A 2NPBA 4EXJA 2B1LA 1ZYEA 3D4TA 18GSA 4MZCA 1PKZA 3M8NA 4POLA 4MF7A 2E2GA 3J7Yb 1T8EB 4MF6A 2HRFA 1ILOA 3M9JA 3VWUA 2FA8A 2YWNA 2GT5A 1EGRA 2B3SA 3C7MA 5CYYA 4I2TA 5HFIA 3DXBA 4GWRA 3KIJA 5ECSA 4AJ8A 20GSA 1V58A 2XPDA 1T3BA 4IN0A 3IDVA 4ECBA 2X49A 3F4TA 3FR6A 3WD6A 3CSHA 1UA5A 3E3EA 2HSYA 3HJOA 5L71A 2VO4A 5EL8A 1AC1A 4BVYB 5ECKB 5AIVA 1MTCA 1TKDB 1TRUA 5KOXA 4N30A 3ZREA 2WGRA 2C3TA 1XWBA 2KLXA 1XWKA 2XBQA 2LTKA 1X5CA 2MMZA 1ZGNA 2L6DA 5KN2A 3WGEA 4PTSA 3W6GA 3HJPA 3M1GA 2AUVA 4XS6A 3IHQA 1VF2A 2FLSA 4EIPA 1PKWA 1EOGA 2LQQA 1SK1A 3GN3A 3IC4A 3VI7A 3A5WA 1XOBA 1GNWA 1QUWA 2X8CA 4KH7A 2LSTA 5ID2A 1A0RP 1B9YC 2H76A 2MMAA 2V41A 1WIKA 2GZPA 1PL2A 2YV9A 1YDKA 3DVWA 4FYUA 2HT9A 4N0ZA 1USBA 3RHBA 2HSMA 4OCEA 4Z7XA 1BG5A 4DSSB 5F07A 2PMTA 5DDLA 4YAVA 3GH6A 1EEMA 1FVKA 3IOSA 2F51A 4LA1A 2B7KA 3BCKA 1A24A 1S3CA 3VWWA 3GKXA 3ZFBA 1WE0A 2B6MA 3C1SA 4MZBA 1XXUA 1SKRB 4HJ2A 2LEGA 3UL3A 1M9AA 4TOPA 3M9KA 2HE3A 2HRKA 1VF3A 3EMPA 2R4VA 3TJGA 3DEXA 4IKHA 1XVWA 2V6KA 3O3TA 4GRFA 2AAWA 3BCIA 5EPFA 4KCAA 4HU9A 4N10A 4EDYA 6GSVA 2WDUA 3P7XA 3EMXA 2O87A 4CY6A 2X8HA 3RPPA 2AJQB 3L0HA 1F3AA 4IP6A 1DUGA 2QGVA 4Z2UA 3KH9A 5AISA 1A8YA 2FWFA 5HFGA 2YZHA 2IMFA 4IBPA 3LORA 1V57A 5JCGA 4NWYA 1BJXA 5H5QA 3TRXA 1TK8B 3LFLA 2H0HA 4MA9A 4OCFA 1RW1A 4KB3A 4Q5FA 4K7IA 3C71A 2DJ3A 1W4VA 2MMNA 10GSA 1J9BA 5GSSA 2AB6A 5KN3A 3ZIJA 2YJ7A 2IFQA 4V1Ag 2IN3A 1S3DA 5D9WA 1OKDA 3G9BA 3LSZA 2JZSA 4OO4A 2QA1A 4ECJA 1TU8A 1O73A 2DJJA 5G5EA 1X9MB 1GSYA 4LMVA 2VD0A 3CYNA 2DMLA 2I3YA 4MMMA 2R0PA 1XWGA 4BVXB 2DIYA 1F3BA 2L59A 3FMWA 1SD9A 4G9HA 4X4JA 4V2MA 5CRDA 4EKZA 4EF0A 5HR1A 4EC0A 2HFDA 3ERGA 3EE2A 5KN0A 1JLWA 4XS4B 1QQ2A 2L4CA 2AHEA 3LXTA 3ZMKA 4J2FA 1GUHA 3UEMA 4P3YB 1UC7A 2IJYA 4USSA 4ZBDA 5DALB 2HLSA 1V2AA 1M0UA 5G1LA 2LNTA 2C4JA 2FGXA 2H1AA 3LW9A 4IHUA 3SWLA 1I9DA 3F3RA 1A2MA 3MWHA 5E59A 1GP1A 2YWIA 1A8LA 5IPGA 5COHA 2DJ1A 3L4NA 1F2EA 1G6YA 5IMAA 1ZZYA 2HZFA 3GA4A 1ZYQB 4KDXA 4DVCA 1ACVA 3RDWA 2VCQA 4JE1A 3IR4A 3LXZA 4TR4A 2GSRA 5J9BA 2VCXA 1IYIA 5IOWA 4X0XA 2H8LA 17GSA 4JR4A 2VD1A 4L0WA 1FHEA 2O89A 2E2MA 3GL3A 3C73A 4KDUA 4HQSA 3VPQA 1ZMAA 3F4RA 1Q98A 2NBSA 4TVEA 2P5QA 3D21A 3MYDA 3F9UA 1G7OA 4E8HA 3CRTA 2ON5A 3KEBA 3RBTA 4TRXA 4WR4A 1K0OA 3FZAA 2H0GA 2A4VA 2VUPA 1UVZA 5IIZA 5D96A 2OE3A 3TUEA 1THXA 5CP1A 1XVQA 4F03A 3JCML 5E4WA 4GQFA 3A5IA 5C00A 3UVHA 1B4PA 3CMIA 3D4MA 4YQMA 3GH9A 2DJKA 1SD8A 4JBBA 4L8EA 4G0KA 4OFMA 4Z2TA 5J9CA 5ECMB 4WETA 1SJ6A 1YEPA 2CVBA 4G19A 1TU7A 4ZXGA 1B4QA 1EV4A 2KUCA 4MNNA 4X43A 1U6TA 2LUSA 4I5QA 1Z9HA 1SKWB 1ZYNA 3A2WA 4X1UA 4WF4A 5IMVA 2ON7A 3QAGA 1AIUA 1GWCA 2VCWA 1PRXA 4F0BA 2FWHA 1JZRA 4L5LA 4N0VA 2RIIA 3IHGA 4KSOA 1AUCA 1QK8A 3DIEA 5D9TA 3TKPA 3TOTA 3F6DA 1NW2A 1G6WA 4MPFA 3ZRDA 2AV4A 1EEJA 1TXXA 3IC8A 2OE1A 1XWAA 5CNWA 4Q5QA 4ZILA 1XWCA 2LJAA 3ED3A 4PQIA 2H6XA 2XC2A 4KCEA 1GSDA 1NSWA 5DBQA 2B7JA 3TJFA 1X0RA 5CREA 5ID2B 5J4UA 3PH9A 3GTUA 4TR3A 2H0IA 2PN8A 5IOXA 4HQZA 3QFBC 3HVXA 2RLIA 3HZ8A 1W89A 4TKYA 5JCUA 4NHZA 2O85A 5IMDA 5G30A 2ZUPA 2NTOA 1HNBA 4EUYA 1SYRA 1XIYA 4O5QA 3FYGA 2DLXA 1FW1A 4RI6A 2PU9C 5EY6A 5GAND 3HCZA 5ENUA 2VAFA 2NDOA 3Q19A 1ZCPA 2HZEA 9GSSA 13GSA 1X9SB 3L9VA 4IELA 2GQMA 6GSTA 1GL8A 5DQSA 2VL3A 4J57E 4HUAA 1J0FA 1QFNA 5KOWA 4F9ZA 6GSUA 2H19A 4MCUA 4ICYA 3F8UA 3KH7A 4JRRA 3D0ZA 4OFTA 1H75A 5IMZA 4JU5A 2J23A 2R5GA 3F4SA 2EIOA 2A4HA 2QKEA 1ST9A 2PWJA 4PNGA 3ISOA 5DVBA 2PERA 2PVOC 2XHFA 3HD5A 4I6XA 1XPVA 4K2DA 2KP2A 4OD7A 1EP7A 1URMA 3MIXA 4TN8A 1TI1A 5B8BA 4TR1A 1WJKA 3FR9A 4IP1A 2CZ2A 3N9JA 2QA2A 3IPZA 1SL2B 3KTBA 4MH2A 3W8JA 1GTAA 4F2IA 2C3QA 4L5OA 2P31A 4O5UA 1SL0B 1FB0A 3WGXA 1Y6EA 2YANA 1DBYA 1BYEA 5BMUA 4XRDA 1V40A 4PNFA 5GAPD 2H1GA 4KF9A 5CRHA 3BBYA 5KN1A 4D73A 2LS5A 4NXIA 1OKTA 2H71A 1V9WA 1FOVA 2VCVA 1OE7A 1EOHA 1GSQA 1XW9A 4PQ1A 3Q18A 3I43A 1R5AA 2WS2A 1K0MA 2TRXA 3TCOA 4K7NA 1SJIA 4GSTA 1PD21 1HD2A 2GQLA 3ZMLA 4PXOA 4NV5A 3MDKA 4KNDA 2BJXA 4MJAA 4OFNA 4GTUA 2D2ZA 2H1BA 4ZIJA 2OADA 1TOFA 3GX0A 1PSQA 1YKAA 4AJ7A 2YWMA 2F8AA 2JSYA 1PQNA 22GSA 2M72A 4PX1A 19GSA 1F9MA 1O8XA 3IE3A 2MZCA 4JEDA 3H93A 4Q5RA 2JADA 1WWJA 2I9HA 3ZITA 3ZVJD 4HZ4A 2FWEA 4IVFA 4HZ2A 4MP4A 3AY8A 5J3RA 4FH8A 4RQXA 1KNGA 2E0QA 2CZ3A 3QCPA 2VLTA 4WBRD 2DJ0A 4HS1A 3L78A 2CQ9A 4K8MA 4O32A 3QAWA 1G7EA 4GCIA 3ZZXA 3US3A 3CTGA 1ZYPA 3A2VA 4XTSA 2CV4A 3HDCA 1F6MC 4FYCA 2L6CA 5DAKA 2F9SA 4GF0A 1PMTA 4V2NA 2A2SA 2N5BA 3EU3A 4ULXA 2YJHA 5FT3A 1T7PB 8GSSA 3IAS2 3TKQA 2WFCA 2C3NA 3J7Yk 4EVMA 2G2QA 1NHYA 3OR5A 3CSIA 1S3AA 3FW2A 3RHCA 5JCWA 1ERWA 2CT6A 3LWAA 3GKNA 2P5RA 1YY7A 2HI7A 1YEXA 4DSQA 1XOAA 3VWVA 4WBJA 5IO2A 3DYRA 4KAEA 4BL7A 3F6FA 4IGJA 2R37A 3HHVA 4ISDA 1OC8A 2M46A 3FY7A 5AGYA 2QC7A 3EURA 2H01A 2MYGA 2PBJA 4YKGA 2A2PA 2VLVA 2JU5A 1OE8A 1JZOA 1WPIA 4GLTA 2REMA 4MH3A 4DEJA 1K3OA 5DQYA 3GMFA 1KBNA 1X5DA 1F37A 4MJCA 3EYTA 4KSMA 3MSZA 2PGTA 4V2LA 2K9FA 1T00A 2H74A 1GSSA 1A23A 5GSTA 2FHEA 2O8VB 5C04A 3HZ4A 4GSSA 2KP1A 4ZB6A 1EWXA 3DKSA 2C80A 3PR8A 1YZXA 1GTUA 3ZIVA 4CW9A 2X64A 3M0FA 1MDJA 2IWTA 2HNLA 4OO5A 4MLYA 1JZDA 1T1VA 1TRWA 3GNJA 1N8JA 2ES7A 3F3QA 4WEYA 5HR2A 2C0FA 1K3LA 3F63A 3GTUB 3GKKA 1OAZA 1VRSD 1GUMA 1TRVA 5INYA 4ACSA 1ZOFA 3D22A 5ECIB 3D6IA 2OBIA 3MNGA 2L57A 3UMAA 2YZUA 4WKWA 3GHAA 4YQVA 1WOUA 2GVPA 1GH2A 3TKSE 2C8UA 3KJYA 1R7HA 2K8VA 2GZYA 3HKRA 1TP9A 5DCGA 5LNKe 2MMOA 1KEBA 4ILFA 3EINA 2CX3A 3H1NA 1GULA 2HRAA 3G7IA 4YKFA 3F0IA 2YP6A 1FB6A 2OKAA 5J41A 4NV2A 5EVOA 1YF0A 5JWOB 4CY8A 3EPTA 1B8XA 5G31A 1PN9A 2FD3A 3M3MA 1A2JA 1FO5A 2LRNA 2OJLA 2B1KA 4N11A 4MPGA 4PQHA 4TR1B 1VF4A 3NIVA 5J5NA 1NM3A 4G2EA 4G0IA 4ID0A 3QPMA 3UIWA 1RK4A 3TDGA 5F05A 6GSXA 1X9WB 3GURA 1JZWA 3LYKA 1TK0B 4NPBA 12GSA 3VFIA 3QFAC 4BA7A 4FYBA 3L9SA 3EVIA 3C1RA 3RAZA 2H72A 2X99A 3QR6A 2I4AA 2H73A 1TTZA 4QL9A 1BEDA 4OWYA 1R4WA 2IL3A 1R26A 3GFKA 2JZRA 1PGTA 2H30A 4D73B 4BWQA 5D73A 3TRQA 3ME7A 3WGDA 1A2LA 4ECIA 4CHSA 5D9XA 4AJ6A 2GS3A 4L0UA 2X8GA 1R5PA 3CTFA 4GXZA 1OVNA 1UN2A 2PPTA 5AIXA 4WR5A 2HYXA 2VM1A 3N5OA 2DSAA 4O92A 1ERVA 4PUFC 4MJEA 4QL7A 3BJ5A 5DJMA 1XCCA 2K18A 2TIRA 1SKSB 2H75A 2H6ZA 4GQCA 2FCHA 2CX4A 1WRYA 1CQGA 3HJMA 3RPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZ9 A;  2IMI A;  1SU9 A;  1Q4J A;  2L5O A;  1JFU A;  2LQO A;  3IK7 A;  1MEK A;  1MDK A;  2LJR A;  6GSY A;  1SL1 B;  1G0T A;  4HU7 A;  2RM5 A;  3GX8 A;  4K1F A;  2FUG 2;  3KXO A;  2LRT A;  3K8N A;  2IME A;  2JZT A;  5CO3 A;  2WJU A;  4XRA A;  2GSQ A;  1EZK A;  2ALB A;  1HNA A;  3KM6 A;  1QGV A;  4IQA A;  5HR0 A;  5B6N A;  2FA4 A;  4HDE A;  1Z6M A;  5IO0 A;  4ZB8 A;  5IMF A;  3HVV A;  3TKS C;  4XHM A;  1K0N A;  2VLU A;  3IRA A;  3GUS A;  1ERU A;  5DAK B;  3UVT A;  4GSN A;  3ZL5 A;  3ZLP A;  2L4Q A;  4NAX A;  3VWX A;  6GSS A;  5ECP B;  2FNO A;  2DJ2 A;  2A2R A;  3A2X A;  3WYW A;  3TJJ A;  1GSF A;  2R3X A;  3UOM A;  1AQW A;  4IW9 A;  1GNE A;  3G7J A;  4YH2 A;  3WT1 A;  2F3M A;  2WZ9 A;  5D8I A;  5IM9 A;  2B5Y A;  3P2A A;  3QD9 A;  5HR3 A;  3C8E A;  2OBK A;  3TRP A;  4YAP A;  4IS0 A;  5JWQ B;  1XFL A;  4ML6 A;  2VCZ A;  2VL2 C;  4MF5 A;  1BX9 A;  3DRN A;  2YCD A;  1K0D A;  5ECN B;  4FO5 A;  3TKS A;  1PX7 A;  1TW9 A;  4ZB9 A;  5A4W A;  4JR6 A;  1B48 A;  2C0D A;  4O7H A;  2DIZ A;  1PA3 A;  4Q5N A;  1GSE A;  3KD0 A;  3CBU A;  2IFQ B;  3U6V A;  3HXS A;  3VI5 A;  3E9J B;  1C72 A;  2V2G A;  4PUA A;  4KGI A;  4V1A p;  2G0F A;  2R2J A;  3BD2 A;  1V98 A;  3NOF A;  1GTI A;  3SBC A;  1KTE A;  1FVJ A;  2C1Y A;  5LD0 A;  1Z7R A;  5ELA A;  4F82 A;  2GT6 A;  5ABR A;  4HI7 A;  3LYP A;  4AGS A;  3UAP A;  2IMD A;  2VOC A;  3EWL A;  4KDY A;  2P0G A;  2WCI A;  2DMM A;  1XBS A;  3TGZ A;  2GTU A;  1K0A A;  4O5R A;  1FG4 A;  5DCH A;  3ZFL A;  2H1D A;  1ABA A;  1M2A A;  3CXG A;  3GL5 A;  2N5A A;  2TRC P;  2VM2 A;  2VL2 A;  5IQY A;  1K0C A;  3IXR A;  2GGT A;  1LBK A;  1M7T A;  4WXT A;  4G10 A;  2KOK A;  1SK2 A;  1BQ7 A;  1X5E A;  5D9V A;  2V1M A;  3FR3 A;  3IBH A;  1Z6N A;  2VCT A;  3KMO A;  3UJ1 A;  2FWG A;  1ERT A;  1EV9 A;  2Z9S A;  1SEN A;  1ML6 A;  2FY6 A;  2I1U A;  2H66 A;  3DD3 A;  2LRC A;  4J56 E;  4RQR A;  2GST A;  4ML1 A;  2EC4 A;  3I6A A;  3E0U A;  4MDC A;  1J08 A;  4K0N A;  4RUV A;  2ZNM A;  3FHK A;  4F0C A;  2IPA A;  1GUK A;  1A0F A;  3U5R E;  7GSS A;  3MAK A;  3IV4 A;  1JHB A;  3VK9 A;  1OYJ A;  4ZBB A;  4ZL8 A;  3IK9 A;  1O81 A;  5A4V A;  1PL1 A;  4KW6 A;  2EIQ A;  3FEU A;  5CRW A;  4LL4 B;  2HRN A;  4BPY A;  2I81 A;  5KEJ A;  4MJB A;  3ZTL A;  4IJI A;  3HY2 A;  3TJK A;  4KX4 A;  4NMU A;  5CRG A;  2YOI A;  4TXO A;  1JLV A;  4I97 A;  3L9U A;  16GS A;  2AYT A;  2RM6 A;  2QSI A;  1I5G A;  5FHI A;  1PX6 A;  1OC9 A;  3DML A;  1GRX A;  2OA7 A;  3LJR A;  1THO A;  2ZCT A;  3W8S A;  2E7P A;  1TK5 B;  2LNS A;  5D93 A;  4EDZ A;  2BTO T;  3QOU A;  3VPT A;  3KZQ A;  5F06 A;  3FZ5 A;  3HVS A;  1K3Y A;  1Z5Y E;  4XS1 A;  1LJR A;  4AF2 A;  1IYH A;  1O8W A;  3GSS A;  1U87 A;  1AQX A;  2LV3 A;  1TI3 A;  3PGT A;  4I2U A;  3VUR A;  3P8W A;  4K6X A;  3TB2 A;  3GV1 A;  1DE1 A;  3H4K A;  3ME8 A;  4NHW A;  1AQV A;  6GSW A;  1O7U A;  2GZZ A;  1M2B A;  1MD4 A;  2C0G A;  5ECL B;  4BVY A;  3KP8 A;  2K6V A;  2YPM A;  2H6Y A;  4TXV A;  3LEF A;  3PIN A;  2K8S A;  4RI7 A;  4OMV A;  2YN1 A;  1NHO A;  2LKU A;  1SYX A;  1AW9 A;  2PVQ A;  4KUN A;  1XW6 A;  5F0G A;  1VF1 A;  4XIH A;  2WUL A;  2YWO A;  2V32 A;  4IQ1 A;  2O7K A;  4POK A;  1N2A A;  3VLN A;  4HOJ A;  2CVK A;  4EE0 A;  2DBC A;  3TKR A;  1MDI A;  4KA0 A;  1M2D A;  4WF5 A;  2B5E A;  4DSR A;  1K0B A;  1O85 A;  3GIX A;  4ZBA A;  2HZE B;  3LGC A;  3I9V 2;  4ZL9 A;  2CAI A;  1RQM A;  4I8B A;  1AXD A;  3O76 A;  5ECQ B;  1XW5 A;  1MD3 A;  2BMX A;  2HXK A;  4DSS A;  1U3A A;  1HNC A;  5ECR B;  3HYP A;  1LU4 A;  3QDN A;  2LJK A;  11GS A;  3D5J A;  3BOA A;  2B5X A;  2N5F A;  2R6K A;  3UBK A;  4LL1 B;  1HQO A;  1GTB A;  2WRT A;  3FZ4 A;  3DGQ A;  1WMJ A;  5B8A A;  1M9B A;  4HJM A;  3I69 A;  4K0G A;  1U88 A;  5CAX A;  4HEA 2;  1O6J A;  2VL9 A;  4YQU A;  5IMC A;  5LCZ A;  3QAV A;  3ZYW A;  1OC3 A;  1U3I A;  1T4Z A;  5A4U A;  2CVD A;  2GLR A;  4PGT A;  4ZL7 A;  1BAY A;  5DJL A;  1HYU A;  4CDO A;  4BWS A;  2M80 A;  3KGK A;  3GRX A;  4KE3 A;  2PUK C;  3H79 A;  3GYK A;  4TW5 A;  5ECO B;  5B7C A;  2IIY A;  5GZZ B;  3CSJ A;  1H4O A;  3GKM A;  1Y25 A;  3IAM 2;  3V1W A;  3KMN A;  3EC3 A;  1TJD A;  2MBS A;  1XZO A;  1TDI A;  1FAA A;  1Z7P A;  4ECC A;  4EL1 A;  3KP9 A;  2GQK A;  3DWV A;  5A5K A;  2WB9 A;  3NZN A;  4QQ7 A;  1GLQ A;  4LMW A;  4MK3 A;  2NVL A;  5HFK A;  1GLP A;  3ERF A;  2EIR A;  3DVX A;  4EO3 A;  2RUE A;  2GDR A;  5G5F A;  2V6O A;  3TOU A;  2KHP A;  4H86 A;  3ERW A;  3IA1 A;  1QXH A;  5ELG A;  4IJ3 A;  5B6M A;  3APS A;  2VIM A;  5FWG A;  3FK8 A;  4MZW A;  1AAZ A;  4FIW A;  3APQ A;  4BVX A;  4PUR A;  3TJB A;  3KCM A;  5ECH B;  3CRU A;  3Q74 A;  3EU4 A;  2GSS A;  2XBI A;  3KTL A;  1CQH A;  5IPH A;  4POM A;  4MAB A;  1QMV A;  1EGO A;  1E2Y A;  3Q6O A;  3A3T A;  1DE2 A;  3HA9 A;  2OAC A;  2F8F A;  1M99 A;  4XCS A;  1ON4 A;  4XS4 A;  2L5L A;  2C0E A;  1YKC A;  5JWR B;  2MBT A;  1GSU A;  4LLR A;  2DC5 A;  2JAC A;  5DAL A;  1YQ1 A;  5HQP A;  3WT2 A;  4E8E A;  14GS A;  3O6T A;  2RUF A;  2CAQ A;  1SK0 A;  2JSZ A;  3LG6 A;  3S9F A;  5F8B A;  1DSB A;  4TR0 A;  1VGL A;  4JZQ A;  2IMK A;  3FKF A;  3QMX A;  1EP8 A;  3LQ7 A;  2OE0 A;  2CA8 A;  5G2Z A;  4POB A;  2YNX A;  2JL4 A;  3R2Q A;  3GST A;  1TRS A;  2J9H A;  5AN1 A;  4K7O A;  1WP0 A;  3P90 A;  3UAR A;  2HSH A;  1B9X C;  3APO A;  4K9Z A;  5H5R A;  1Z3E A;  1E6B A;  2YV7 A;  3H8Q A;  2XPE A;  3G7Y A;  1YJ6 A;  4TXO B;  3UBL A;  2H70 A;  3ZVJ A;  3FRC A;  1YF1 A;  5H5S A;  1T4Y A;  1OC9 B;  1SJZ A;  5G1K A;  1ZL9 A;  2NPB A;  4EXJ A;  2B1L A;  1ZYE A;  3D4T A;  18GS A;  4MZC A;  1PKZ A;  3M8N A;  4POL A;  4MF7 A;  2E2G A;  3J7Y b;  1T8E B;  4MF6 A;  2HRF A;  1ILO A;  3M9J A;  3VWU A;  2FA8 A;  2YWN A;  2GT5 A;  1EGR A;  2B3S A;  3C7M A;  5CYY A;  4I2T A;  5HFI A;  3DXB A;  4GWR A;  3KIJ A;  5ECS A;  4AJ8 A;  20GS A;  1V58 A;  2XPD A;  1T3B A;  4IN0 A;  3IDV A;  4ECB A;  3F4T A;  3FR6 A;  3WD6 A;  3CSH A;  1UA5 A;  3E3E A;  2HSY A;  3HJO A;  5L71 A;  2VO4 A;  5EL8 A;  1AC1 A;  5ECK B;  5AIV A;  1MTC A;  1TKD B;  1TRU A;  4N30 A;  3ZRE A;  2WGR A;  2C3T A;  1XWB A;  2KLX A;  1XWK A;  2XBQ A;  2LTK A;  1X5C A;  2MMZ A;  1ZGN A;  2L6D A;  5KN2 A;  3WGE A;  3W6G A;  3HJP A;  3M1G A;  2AUV A;  4XS6 A;  3IHQ A;  1VF2 A;  2FLS A;  1PKW A;  1EOG A;  2LQQ A;  1SK1 A;  3GN3 A;  3IC4 A;  3VI7 A;  3A5W A;  1XOB A;  1GNW A;  1QUW A;  2X8C A;  4KH7 A;  2LST A;  5ID2 A;  1A0R P;  1B9Y C;  2H76 A;  2MMA A;  2V41 A;  1WIK A;  2GZP A;  1PL2 A;  2YV9 A;  1YDK A;  3DVW A;  4FYU A;  2HT9 A;  4N0Z A;  1USB A;  3RHB A;  4OCE A;  4Z7X A;  1BG5 A;  4DSS B;  5F07 A;  2PMT A;  5DDL A;  4YAV A;  3GH6 A;  1EEM A;  1FVK A;  3IOS A;  2F51 A;  4LA1 A;  2B7K A;  3BCK A;  1A24 A;  1S3C A;  3VWW A;  3GKX A;  3ZFB A;  1WE0 A;  2B6M A;  3C1S A;  4MZB A;  1XXU A;  1SKR B;  4HJ2 A;  2LEG A;  3UL3 A;  1M9A A;  4TOP A;  3M9K A;  2HE3 A;  1VF3 A;  3EMP A;  2R4V A;  3TJG A;  3DEX A;  4IKH A;  1XVW A;  2V6K A;  3O3T A;  5EPF A;  4GRF A;  2AAW A;  3BCI A;  4KCA A;  4HU9 A;  4N10 A;  4EDY A;  6GSV A;  2WDU A;  3P7X A;  3EMX A;  2O87 A;  2X8H A;  3RPP A;  2AJQ B;  3L0H A;  1F3A A;  4IP6 A;  1DUG A;  2QGV A;  3KH9 A;  5AIS A;  1A8Y A;  2FWF A;  5HFG A;  2YZH A;  2IMF A;  4IBP A;  3LOR A;  1V57 A;  5JCG A;  4NWY A;  1BJX A;  5H5Q A;  3TRX A;  1TK8 B;  3LFL A;  2H0H A;  4MA9 A;  4OCF A;  1RW1 A;  4KB3 A;  4Q5F A;  4K7I A;  3C71 A;  2DJ3 A;  1W4V A;  2MMN A;  10GS A;  1J9B A;  5GSS A;  2AB6 A;  5KN3 A;  3ZIJ A;  2YJ7 A;  2IFQ A;  4V1A g;  2IN3 A;  1S3D A;  5D9W A;  1OKD A;  3G9B A;  3LSZ A;  2JZS A;  4OO4 A;  4ECJ A;  1TU8 A;  1O73 A;  2DJJ A;  5G5E A;  1X9M B;  1GSY A;  4LMV A;  2VD0 A;  3CYN A;  2DML A;  2I3Y A;  4MMM A;  1XWG A;  2DIY A;  1F3B A;  2L59 A;  1SD9 A;  4G9H A;  4V2M A;  5CRD A;  4EKZ A;  4EF0 A;  5HR1 A;  4EC0 A;  2HFD A;  3ERG A;  3EE2 A;  5KN0 A;  1JLW A;  4XS4 B;  1QQ2 A;  2L4C A;  2AHE A;  3LXT A;  3ZMK A;  4J2F A;  1GUH A;  3UEM A;  4P3Y B;  1UC7 A;  2IJY A;  4ZBD A;  5DAL B;  2HLS A;  1V2A A;  1M0U A;  5G1L A;  2LNT A;  2C4J A;  2FGX A;  2H1A A;  3SWL A;  4IHU A;  1I9D A;  3F3R A;  1A2M A;  3MWH A;  5E59 A;  1GP1 A;  2YWI A;  1A8L A;  5IPG A;  5COH A;  2DJ1 A;  3L4N A;  1F2E A;  1G6Y A;  5IMA A;  1ZZY A;  2HZF A;  3GA4 A;  1ZYQ B;  4KDX A;  4DVC A;  1ACV A;  3RDW A;  2VCQ A;  4JE1 A;  3IR4 A;  3LXZ A;  4TR4 A;  2GSR A;  5J9B A;  2VCX A;  1IYI A;  5IOW A;  4X0X A;  2H8L A;  17GS A;  4JR4 A;  2VD1 A;  4L0W A;  1FHE A;  2O89 A;  2E2M A;  3GL3 A;  3C73 A;  4KDU A;  4HQS A;  3VPQ A;  1ZMA A;  3F4R A;  1Q98 A;  2NBS A;  4TVE A;  2P5Q A;  3D21 A;  3F9U A;  1G7O A;  4E8H A;  3CRT A;  2ON5 A;  3KEB A;  3RBT A;  4TRX A;  4WR4 A;  1K0O A;  3FZA A;  2H0G A;  2A4V A;  2VUP A;  1UVZ A;  5IIZ A;  5D96 A;  2OE3 A;  3TUE A;  1THX A;  5CP1 A;  1XVQ A;  4F03 A;  3JCM L;  5E4W A;  4GQF A;  5C00 A;  3UVH A;  1B4P A;  3CMI A;  3D4M A;  4YQM A;  3GH9 A;  2DJK A;  1SD8 A;  4JBB A;  4L8E A;  4OFM A;  5J9C A;  5ECM B;  4WET A;  1SJ6 A;  1YEP A;  2CVB A;  4G19 A;  1TU7 A;  4ZXG A;  1B4Q A;  1EV4 A;  2KUC A;  4X43 A;  1U6T A;  2LUS A;  4I5Q A;  1Z9H A;  1SKW B;  3A2W A;  4X1U A;  4WF4 A;  5IMV A;  2ON7 A;  3QAG A;  1AIU A;  1GWC A;  2VCW A;  1PRX A;  4F0B A;  2FWH A;  1JZR A;  4L5L A;  4N0V A;  2RII A;  4KSO A;  1AUC A;  1QK8 A;  3DIE A;  5D9T A;  3TKP A;  3TOT A;  3F6D A;  1NW2 A;  1G6W A;  4MPF A;  3ZRD A;  2AV4 A;  1EEJ A;  1TXX A;  2OE1 A;  1XWA A;  5CNW A;  4Q5Q A;  4ZIL A;  1XWC A;  2LJA A;  3ED3 A;  4PQI A;  2H6X A;  2XC2 A;  4KCE A;  1GSD A;  1NSW A;  5DBQ A;  2B7J A;  3TJF A;  1X0R A;  5CRE A;  5ID2 B;  5J4U A;  3PH9 A;  3GTU A;  4TR3 A;  2H0I A;  2PN8 A;  5IOX A;  4HQZ A;  3QFB C;  3HVX A;  2RLI A;  3HZ8 A;  1W89 A;  4TKY A;  5JCU A;  4NHZ A;  2O85 A;  5IMD A;  5G30 A;  2ZUP A;  2NTO A;  1HNB A;  4EUY A;  1SYR A;  1XIY A;  3FYG A;  2DLX A;  1FW1 A;  4RI6 A;  2PU9 C;  5EY6 A;  5GAN D;  3HCZ A;  5ENU A;  2VAF A;  2NDO A;  3Q19 A;  1ZCP A;  2HZE A;  9GSS A;  13GS A;  1X9S B;  3L9V A;  4IEL A;  2GQM A;  6GST A;  1GL8 A;  5DQS A;  2VL3 A;  4J57 E;  4HUA A;  1J0F A;  1QFN A;  4F9Z A;  6GSU A;  2H19 A;  4MCU A;  3F8U A;  3KH7 A;  4JRR A;  3D0Z A;  4OFT A;  1H75 A;  5IMZ A;  4JU5 A;  2J23 A;  2R5G A;  3F4S A;  2EIO A;  2QKE A;  1ST9 A;  2PWJ A;  4PNG A;  3ISO A;  5DVB A;  2PER A;  2PVO C;  2XHF A;  3HD5 A;  4I6X A;  1XPV A;  4K2D A;  2KP2 A;  4OD7 A;  1EP7 A;  1URM A;  4TN8 A;  1TI1 A;  5B8B A;  4TR1 A;  1WJK A;  3FR9 A;  4IP1 A;  2CZ2 A;  3N9J A;  3IPZ A;  1SL2 B;  3KTB A;  4MH2 A;  3W8J A;  1GTA A;  4F2I A;  2C3Q A;  4L5O A;  2P31 A;  1SL0 B;  1FB0 A;  3WGX A;  1Y6E A;  2YAN A;  1DBY A;  1BYE A;  4XRD A;  1V40 A;  4PNF A;  5GAP D;  2H1G A;  5CRH A;  3BBY A;  5KN1 A;  4D73 A;  2LS5 A;  4NXI A;  1OKT A;  2H71 A;  1V9W A;  1FOV A;  2VCV A;  1OE7 A;  1EOH A;  1GSQ A;  1XW9 A;  4PQ1 A;  3Q18 A;  3I43 A;  1R5A A;  2WS2 A;  1K0M A;  2TRX A;  3TCO A;  4K7N A;  1SJI A;  4GST A;  1PD2 1;  1HD2 A;  2GQL A;  3ZML A;  4PXO A;  4NV5 A;  3MDK A;  4KND A;  2BJX A;  4MJA A;  4OFN A;  4GTU A;  2D2Z A;  2H1B A;  4ZIJ A;  2OAD A;  1TOF A;  3GX0 A;  1PSQ A;  1YKA A;  4AJ7 A;  2YWM A;  2F8A A;  2JSY A;  1PQN A;  22GS A;  2M72 A;  4PX1 A;  19GS A;  1F9M A;  1O8X A;  3IE3 A;  2MZC A;  4JED A;  3H93 A;  4Q5R A;  2JAD A;  1WWJ A;  2I9H A;  3ZIT A;  3ZVJ D;  4HZ4 A;  2FWE A;  4IVF A;  4HZ2 A;  4MP4 A;  3AY8 A;  5J3R A;  4FH8 A;  4RQX A;  1KNG A;  2E0Q A;  2CZ3 A;  3QCP A;  2VLT A;  4WBR D;  2DJ0 A;  4HS1 A;  3L78 A;  2CQ9 A;  4K8M A;  4O32 A;  3QAW A;  1G7E A;  4GCI A;  3ZZX A;  3US3 A;  3CTG A;  3A2V A;  4XTS A;  2CV4 A;  3HDC A;  1F6M C;  4FYC A;  2L6C A;  5DAK A;  2F9S A;  4GF0 A;  1PMT A;  4V2N A;  2A2S A;  2N5B A;  3EU3 A;  4ULX A;  2YJH A;  5FT3 A;  1T7P B;  8GSS A;  3IAS 2;  3TKQ A;  2WFC A;  2C3N A;  3J7Y k;  4EVM A;  2G2Q A;  1NHY A;  3OR5 A;  3CSI A;  1S3A A;  3FW2 A;  3RHC A;  5JCW A;  1ERW A;  2CT6 A;  3LWA A;  3GKN A;  2P5R A;  1YY7 A;  2HI7 A;  1YEX A;  4DSQ A;  1XOA A;  3VWV A;  4WBJ A;  5IO2 A;  3DYR A;  4KAE A;  4BL7 A;  3F6F A;  4IGJ A;  2R37 A;  3HHV A;  4ISD A;  1OC8 A;  2M46 A;  3FY7 A;  5AGY A;  2QC7 A;  3EUR A;  2H01 A;  2MYG A;  2PBJ A;  2VLV A;  2JU5 A;  1OE8 A;  1JZO A;  1WPI A;  4GLT A;  2REM A;  4MH3 A;  4DEJ A;  1K3O A;  5DQY A;  3GMF A;  1KBN A;  1X5D A;  1F37 A;  4MJC A;  3EYT A;  4KSM A;  3MSZ A;  2PGT A;  4V2L A;  2K9F A;  1T00 A;  2H74 A;  1GSS A;  1A23 A;  5GST A;  2FHE A;  2O8V B;  5C04 A;  3HZ4 A;  4GSS A;  2KP1 A;  4ZB6 A;  1EWX A;  3DKS A;  2C80 A;  3PR8 A;  1YZX A;  1GTU A;  3ZIV A;  4CW9 A;  2X64 A;  3M0F A;  1MDJ A;  2IWT A;  2HNL A;  4OO5 A;  4MLY A;  1JZD A;  1T1V A;  1TRW A;  3GNJ A;  1N8J A;  2ES7 A;  3F3Q A;  4WEY A;  5HR2 A;  2C0F A;  1K3L A;  3F63 A;  3GTU B;  3GKK A;  1OAZ A;  1VRS D;  1GUM A;  1TRV A;  5INY A;  4ACS A;  1ZOF A;  3D22 A;  5ECI B;  3D6I A;  2OBI A;  3MNG A;  2L57 A;  3UMA A;  2YZU A;  4WKW A;  3GHA A;  4YQV A;  1WOU A;  2GVP A;  1GH2 A;  3TKS E;  2C8U A;  3KJY A;  1R7H A;  2K8V A;  2GZY A;  3HKR A;  1TP9 A;  5DCG A;  5LNK e;  2MMO A;  1KEB A;  4ILF A;  3EIN A;  2CX3 A;  3H1N A;  1GUL A;  3G7I A;  3F0I A;  2YP6 A;  1FB6 A;  2OKA A;  5J41 A;  4NV2 A;  5EVO A;  1YF0 A;  5JWO B;  1B8X A;  5G31 A;  1PN9 A;  2FD3 A;  3M3M A;  1A2J A;  1FO5 A;  2LRN A;  2OJL A;  2B1K A;  4N11 A;  4MPG A;  4PQH A;  4TR1 B;  1VF4 A;  3NIV A;  5J5N A;  1NM3 A;  4G2E A;  4ID0 A;  3QPM A;  3UIW A;  1RK4 A;  3TDG A;  5F05 A;  6GSX A;  1X9W B;  3GUR A;  1JZW A;  3LYK A;  1TK0 B;  4NPB A;  12GS A;  3VFI A;  3QFA C;  4BA7 A;  4FYB A;  3L9S A;  3EVI A;  3C1R A;  3RAZ A;  2H72 A;  2X99 A;  3QR6 A;  2I4A A;  2H73 A;  1TTZ A;  4QL9 A;  1BED A;  4OWY A;  1R4W A;  2IL3 A;  1R26 A;  3GFK A;  2JZR A;  1PGT A;  2H30 A;  4D73 B;  4BWQ A;  5D73 A;  3TRQ A;  3ME7 A;  3WGD A;  1A2L A;  4ECI A;  4CHS A;  5D9X A;  4AJ6 A;  2GS3 A;  4L0U A;  2X8G A;  1R5P A;  3CTF A;  4GXZ A;  1OVN A;  1UN2 A;  2PPT A;  5AIX A;  4WR5 A;  2HYX A;  2VM1 A;  3N5O A;  2DSA A;  4O92 A;  1ERV A;  4PUF C;  4MJE A;  4QL7 A;  3BJ5 A;  5DJM A;  1XCC A;  2K18 A;  2TIR A;  1SKS B;  2H75 A;  2H6Z A;  4GQC A;  2FCH A;  2CX4 A;  1WRY A;  1CQG A;  3HJM A;  3RPN A; 
#chains in the Genus database with same CATH topology
 3FZ9 A;  2IMI A;  1SU9 A;  1Q4J A;  2L5O A;  1JFU A;  2LQO A;  3IK7 A;  1MEK A;  1MDK A;  2LJR A;  6GSY A;  1SL1 B;  1G0T A;  4HU7 A;  2RM5 A;  3GX8 A;  4K1F A;  2FUG 2;  3KXO A;  2LRT A;  3K8N A;  2IME A;  2JZT A;  5CO3 A;  2WJU A;  4XRA A;  2GSQ A;  1EZK A;  2ALB A;  1HNA A;  3KM6 A;  1QGV A;  4IQA A;  5HR0 A;  5B6N A;  2FA4 A;  4HDE A;  1Z6M A;  5IO0 A;  4ZB8 A;  5IMF A;  3HVV A;  3TKS C;  5BRT A;  4XHM A;  1K0N A;  2VLU A;  3IRA A;  3GUS A;  1ERU A;  5DAK B;  3UVT A;  4GSN A;  3ZL5 A;  3ZLP A;  2L4Q A;  4NAX A;  3VWX A;  6GSS A;  5ECP B;  2FNO A;  3HVN A;  2DJ2 A;  2A2R A;  3A2X A;  3WYW A;  3TJJ A;  4EIQ A;  1GSF A;  2R3X A;  3UOM A;  1AQW A;  4IW9 A;  1GNE A;  3G7J A;  4YH2 A;  3WT1 A;  2F3M A;  2WZ9 A;  5D8I A;  5IM9 A;  2B5Y A;  3P2A A;  3QD9 A;  5HR3 A;  3C8E A;  2OBK A;  3TRP A;  4YAP A;  4IS0 A;  5JWQ B;  1XFL A;  4ML6 A;  2VCZ A;  4BL7 B;  2VL2 C;  4MF5 A;  1BX9 A;  3DRN A;  2YCD A;  1K0D A;  4K2X A;  5ECN B;  4FO5 A;  3TKS A;  1PX7 A;  1TW9 A;  1M3J A;  4ZB9 A;  5A4W A;  4JR6 A;  1B48 A;  2DKI A;  2C0D A;  4O7H A;  2DIZ A;  1PA3 A;  4Q5N A;  1GSE A;  3KD0 A;  3CBU A;  2IFQ B;  3U6V A;  3HXS A;  3VI5 A;  3E9J B;  1C72 A;  2V2G A;  4PUA A;  4KGI A;  4V1A p;  2G0F A;  2R2J A;  3BD2 A;  1V98 A;  3NOF A;  1GTI A;  3SBC A;  1KTE A;  2X4A A;  1FVJ A;  2C1Y A;  5LD0 A;  1Z7R A;  5ELA A;  4F82 A;  2GT6 A;  5ABR A;  4HI7 A;  3LYP A;  4AGS A;  3UAP A;  2IMD A;  2VOC A;  3EWL A;  4KDY A;  2P0G A;  2WCI A;  2DMM A;  1XBS A;  3TGZ A;  2GTU A;  1K0A A;  4O5R A;  1FG4 A;  5DCH A;  3ZFL A;  2H1D A;  1ABA A;  1M2A A;  3CXG A;  3GL5 A;  2N5A A;  2TRC P;  2VM2 A;  2VL2 A;  5IQY A;  1K0C A;  3IXR A;  2GGT A;  1LBK A;  1M7T A;  4WXT A;  4G10 A;  2KOK A;  1SK2 A;  1BQ7 A;  1X5E A;  5D9V A;  2V1M A;  3FR3 A;  4A5P A;  3IBH A;  1Z6N A;  2VCT A;  3KMO A;  3UJ1 A;  2FWG A;  1ERT A;  1EV9 A;  2Z9S A;  4K5S A;  1SEN A;  1ML6 A;  2FY6 A;  2I1U A;  2DKH A;  2H66 A;  3DD3 A;  2LRC A;  4J56 E;  4RQR A;  2GST A;  4ML1 A;  2EC4 A;  3I6A A;  3E0U A;  4MDC A;  1J08 A;  4K0N A;  4RUV A;  2ZNM A;  3FHK A;  4F0C A;  2IPA A;  1GUK A;  1A0F A;  3U5R E;  7GSS A;  3MAK A;  3IV4 A;  1JHB A;  1PN0 A;  3VK9 A;  1OYJ A;  4ZBB A;  4ZL8 A;  3IK9 A;  1O81 A;  5A4V A;  1PL1 A;  4KW6 A;  2EIQ A;  3FEU A;  5CRW A;  4LL4 B;  2HRN A;  4BPY A;  2I81 A;  5KEJ A;  4MJB A;  3ZTL A;  2R0C A;  3R3E A;  4IJI A;  3HY2 A;  3TJK A;  4KX4 A;  4NMU A;  5CRG A;  2YOI A;  4TXO A;  1JLV A;  4I97 A;  3L9U A;  16GS A;  2AYT A;  2RM6 A;  2QSI A;  1I5G A;  5FHI A;  1PX6 A;  1OC9 A;  3DML A;  1GRX A;  2OA7 A;  3LJR A;  1THO A;  2ZCT A;  3W8S A;  2E7P A;  1TK5 B;  2LNS A;  5D93 A;  4EDZ A;  2BTO T;  3QOU A;  3VPT A;  3KZQ A;  5F06 A;  3FZ5 A;  3HVS A;  1K3Y A;  1Z5Y E;  4XS1 A;  1LJR A;  4AF2 A;  1IYH A;  1O8W A;  3GSS A;  1U87 A;  1AQX A;  2LV3 A;  1TI3 A;  3PGT A;  4I2U A;  3VUR A;  3P8W A;  4K6X A;  3TB2 A;  3GV1 A;  1DE1 A;  3H4K A;  3ME8 A;  4NHW A;  1AQV A;  6GSW A;  1O7U A;  2GZZ A;  1M2B A;  1MD4 A;  2C0G A;  5ECL B;  4BVY A;  3KP8 A;  2K6V A;  2YPM A;  2H6Y A;  4TXV A;  3LEF A;  3PIN A;  2K8S A;  4RI7 A;  4OMV A;  2YN1 A;  1NHO A;  2LKU A;  1SYX A;  1AW9 A;  2PVQ A;  4KUN A;  1XW6 A;  5F0G A;  1VF1 A;  4XIH A;  2WUL A;  2YWO A;  2V32 A;  4IQ1 A;  2O7K A;  4POK A;  1N2A A;  3VLN A;  4HOJ A;  2CVK A;  4EE0 A;  2DBC A;  3TKR A;  1MDI A;  4KA0 A;  1M2D A;  4WF5 A;  2B5E A;  4DSR A;  1K0B A;  1O85 A;  3GIX A;  4ZBA A;  2HZE B;  3LGC A;  3I9V 2;  4ZL9 A;  2CAI A;  1RQM A;  4I8B A;  1AXD A;  3O76 A;  4K5R A;  5ECQ B;  1XW5 A;  1MD3 A;  2BMX A;  2HXK A;  4DSS A;  1U3A A;  1HNC A;  5ECR B;  3HYP A;  1LU4 A;  3QDN A;  2LJK A;  2R0G A;  11GS A;  2UZ8 A;  3BOA A;  3D5J A;  2B5X A;  2N5F A;  2R6K A;  3UBK A;  4LL1 B;  1HQO A;  1GTB A;  2WRT A;  3FZ4 A;  3DGQ A;  1WMJ A;  5B8A A;  1M9B A;  4HJM A;  3I69 A;  4K0G A;  1U88 A;  5CAX A;  4FQU A;  4HEA 2;  1O6J A;  2VL9 A;  4YQU A;  5IMC A;  5LCZ A;  3QAV A;  3ZYW A;  1OC3 A;  1U3I A;  1T4Z A;  5A4U A;  2CVD A;  2GLR A;  4PGT A;  4ZL7 A;  1BAY A;  5DJL A;  1HYU A;  4CDO A;  4BWS A;  2M80 A;  3KGK A;  3GRX A;  4KE3 A;  2PUK C;  3H79 A;  3GYK A;  4TW5 A;  5ECO B;  5B7C A;  2IIY A;  5GZZ B;  3CQF A;  3CSJ A;  1H4O A;  3GKM A;  1Y25 A;  3IAM 2;  3V1W A;  3KMN A;  3EC3 A;  1TJD A;  2MBS A;  1XZO A;  1TDI A;  1FAA A;  1Z7P A;  4ECC A;  4EL1 A;  3KP9 A;  2GQK A;  3DWV A;  5A5K A;  2WB9 A;  3NZN A;  4QQ7 A;  1GLQ A;  4LMW A;  4MK3 A;  2NVL A;  5HFK A;  1GLP A;  3ERF A;  2EIR A;  3DVX A;  4EO3 A;  2RUE A;  2GDR A;  5G5F A;  2V6O A;  3TOU A;  2KHP A;  4H86 A;  3ERW A;  3IA1 A;  1QXH A;  5ELG A;  4IJ3 A;  5B6M A;  3APS A;  2VIM A;  5FWG A;  3FK8 A;  4MZW A;  1AAZ A;  4FIW A;  3APQ A;  4BVX A;  4PUR A;  3TJB A;  3KCM A;  5ECH B;  3CRU A;  3Q74 A;  3EU4 A;  2GSS A;  2XBI A;  3KTL A;  1CQH A;  5IPH A;  4POM A;  4MAB A;  1QMV A;  1EGO A;  1E2Y A;  3Q6O A;  3A3T A;  1DE2 A;  3HA9 A;  2OAC A;  2F8F A;  1M99 A;  4XCS A;  1ON4 A;  4XS4 A;  2L5L A;  2C0E A;  1YKC A;  5JWR B;  2MBT A;  1GSU A;  4LLR A;  2DC5 A;  2JAC A;  5DAL A;  1YQ1 A;  4G0L A;  5HQP A;  3WT2 A;  4E8E A;  14GS A;  3O6T A;  2RUF A;  2CAQ A;  1FOH A;  1SK0 A;  2JSZ A;  3LG6 A;  3S9F A;  5F8B A;  1DSB A;  4TR0 A;  1VGL A;  4JZQ A;  2IMK A;  3FKF A;  3QMX A;  1EP8 A;  3LQ7 A;  2OE0 A;  2CA8 A;  5G2Z A;  4POB A;  2YNX A;  2JL4 A;  3R2Q A;  3GST A;  1TRS A;  2J9H A;  5AN1 A;  4K7O A;  1WP0 A;  3P90 A;  3UAR A;  2HSH A;  1B9X C;  3APO A;  4K9Z A;  5H5R A;  1Z3E A;  3PPU A;  1E6B A;  2YV7 A;  3H8Q A;  2XPE A;  3G7Y A;  1YJ6 A;  4TXO B;  3UBL A;  2H70 A;  3ZVJ A;  3FRC A;  1YF1 A;  5H5S A;  1T4Y A;  1OC9 B;  1SJZ A;  5G1K A;  4Z2R A;  1ZL9 A;  2NPB A;  4EXJ A;  2B1L A;  1ZYE A;  3D4T A;  18GS A;  4MZC A;  1PKZ A;  3M8N A;  4POL A;  4MF7 A;  2E2G A;  3J7Y b;  1T8E B;  4MF6 A;  2HRF A;  1ILO A;  3M9J A;  3VWU A;  2FA8 A;  2YWN A;  2GT5 A;  1EGR A;  2B3S A;  3C7M A;  5CYY A;  4I2T A;  5HFI A;  3DXB A;  4GWR A;  3KIJ A;  5ECS A;  4AJ8 A;  20GS A;  1V58 A;  2XPD A;  1T3B A;  4IN0 A;  3IDV A;  4ECB A;  2X49 A;  3F4T A;  3FR6 A;  3WD6 A;  3CSH A;  1UA5 A;  3E3E A;  2HSY A;  3HJO A;  5L71 A;  2VO4 A;  5EL8 A;  1AC1 A;  4BVY B;  5ECK B;  5AIV A;  1MTC A;  1TKD B;  1TRU A;  5KOX A;  4N30 A;  3ZRE A;  2WGR A;  2C3T A;  1XWB A;  2KLX A;  1XWK A;  2XBQ A;  2LTK A;  1X5C A;  2MMZ A;  1ZGN A;  2L6D A;  5KN2 A;  3WGE A;  4PTS A;  3W6G A;  3HJP A;  3M1G A;  2AUV A;  4XS6 A;  3IHQ A;  1VF2 A;  2FLS A;  4EIP A;  1PKW A;  1EOG A;  2LQQ A;  1SK1 A;  3GN3 A;  3IC4 A;  3VI7 A;  3A5W A;  1XOB A;  1GNW A;  1QUW A;  2X8C A;  4KH7 A;  2LST A;  5ID2 A;  1A0R P;  1B9Y C;  2H76 A;  2MMA A;  2V41 A;  1WIK A;  2GZP A;  1PL2 A;  2YV9 A;  1YDK A;  3DVW A;  4FYU A;  2HT9 A;  4N0Z A;  1USB A;  3RHB A;  2HSM A;  4OCE A;  4Z7X A;  1BG5 A;  4DSS B;  5F07 A;  2PMT A;  5DDL A;  4YAV A;  3GH6 A;  1EEM A;  1FVK A;  3IOS A;  2F51 A;  4LA1 A;  2B7K A;  3BCK A;  1A24 A;  1S3C A;  3VWW A;  3GKX A;  3ZFB A;  1WE0 A;  2B6M A;  3C1S A;  4MZB A;  1XXU A;  1SKR B;  4HJ2 A;  2LEG A;  3UL3 A;  1M9A A;  4TOP A;  3M9K A;  2HE3 A;  2HRK A;  1VF3 A;  3EMP A;  2R4V A;  3TJG A;  3DEX A;  4IKH A;  1XVW A;  2V6K A;  3O3T A;  4GRF A;  2AAW A;  3BCI A;  5EPF A;  4KCA A;  4HU9 A;  4N10 A;  4EDY A;  6GSV A;  2WDU A;  3P7X A;  3EMX A;  2O87 A;  4CY6 A;  2X8H A;  3RPP A;  2AJQ B;  3L0H A;  1F3A A;  4IP6 A;  1DUG A;  2QGV A;  4Z2U A;  3KH9 A;  5AIS A;  1A8Y A;  2FWF A;  5HFG A;  2YZH A;  2IMF A;  4IBP A;  3LOR A;  1V57 A;  5JCG A;  4NWY A;  1BJX A;  5H5Q A;  3TRX A;  1TK8 B;  3LFL A;  2H0H A;  4MA9 A;  4OCF A;  1RW1 A;  4KB3 A;  4Q5F A;  4K7I A;  3C71 A;  2DJ3 A;  1W4V A;  2MMN A;  10GS A;  1J9B A;  5GSS A;  2AB6 A;  5KN3 A;  3ZIJ A;  2YJ7 A;  2IFQ A;  4V1A g;  2IN3 A;  1S3D A;  5D9W A;  1OKD A;  3G9B A;  3LSZ A;  2JZS A;  4OO4 A;  2QA1 A;  4ECJ A;  1TU8 A;  1O73 A;  2DJJ A;  5G5E A;  1X9M B;  1GSY A;  4LMV A;  2VD0 A;  3CYN A;  2DML A;  2I3Y A;  4MMM A;  2R0P A;  1XWG A;  4BVX B;  2DIY A;  1F3B A;  2L59 A;  3FMW A;  1SD9 A;  4G9H A;  4X4J A;  4V2M A;  5CRD A;  4EKZ A;  4EF0 A;  5HR1 A;  4EC0 A;  2HFD A;  3ERG A;  3EE2 A;  5KN0 A;  1JLW A;  4XS4 B;  1QQ2 A;  2L4C A;  2AHE A;  3LXT A;  3ZMK A;  4J2F A;  1GUH A;  3UEM A;  4P3Y B;  1UC7 A;  2IJY A;  4USS A;  4ZBD A;  5DAL B;  2HLS A;  1V2A A;  1M0U A;  5G1L A;  2LNT A;  2C4J A;  2FGX A;  2H1A A;  3LW9 A;  4IHU A;  3SWL A;  1I9D A;  3F3R A;  1A2M A;  3MWH A;  5E59 A;  1GP1 A;  2YWI A;  1A8L A;  5IPG A;  5COH A;  2DJ1 A;  3L4N A;  1F2E A;  1G6Y A;  5IMA A;  1ZZY A;  2HZF A;  3GA4 A;  1ZYQ B;  4KDX A;  4DVC A;  1ACV A;  3RDW A;  2VCQ A;  4JE1 A;  3IR4 A;  3LXZ A;  4TR4 A;  2GSR A;  5J9B A;  2VCX A;  1IYI A;  5IOW A;  4X0X A;  2H8L A;  17GS A;  4JR4 A;  2VD1 A;  4L0W A;  1FHE A;  2O89 A;  2E2M A;  3GL3 A;  3C73 A;  4KDU A;  4HQS A;  3VPQ A;  1ZMA A;  3F4R A;  1Q98 A;  2NBS A;  4TVE A;  4HSC X;  2P5Q A;  3D21 A;  3MYD A;  3F9U A;  1G7O A;  4E8H A;  3CRT A;  2ON5 A;  3KEB A;  3RBT A;  4TRX A;  4WR4 A;  1K0O A;  3FZA A;  2H0G A;  2A4V A;  2VUP A;  1UVZ A;  5IIZ A;  5D96 A;  2OE3 A;  3TUE A;  1THX A;  5CP1 A;  1XVQ A;  4F03 A;  3JCM L;  5E4W A;  4GQF A;  3A5I A;  5C00 A;  3UVH A;  1B4P A;  3CMI A;  3D4M A;  4YQM A;  3GH9 A;  2DJK A;  1SD8 A;  1M3I A;  4JBB A;  4L8E A;  4G0K A;  4OFM A;  4Z2T A;  5J9C A;  5ECM B;  4WET A;  1SJ6 A;  1YEP A;  2CVB A;  4G19 A;  1TU7 A;  4ZXG A;  1B4Q A;  1EV4 A;  2KUC A;  4MNN A;  4X43 A;  1U6T A;  2LUS A;  4I5Q A;  1Z9H A;  1SKW B;  1ZYN A;  3A2W A;  4X1U A;  4WF4 A;  5IMV A;  2ON7 A;  3QAG A;  1AIU A;  1GWC A;  2VCW A;  1PRX A;  4F0B A;  2FWH A;  1JZR A;  4L5L A;  4N0V A;  2RII A;  3IHG A;  4KSO A;  1AUC A;  1QK8 A;  3DIE A;  5D9T A;  3TKP A;  3TOT A;  3F6D A;  1NW2 A;  1G6W A;  4MPF A;  3ZRD A;  2AV4 A;  1EEJ A;  1TXX A;  3IC8 A;  2OE1 A;  1XWA A;  5CNW A;  4Q5Q A;  4ZIL A;  1XWC A;  2LJA A;  3ED3 A;  4PQI A;  2H6X A;  2XC2 A;  4KCE A;  1GSD A;  1NSW A;  5DBQ A;  2B7J A;  3TJF A;  1X0R A;  5CRE A;  5ID2 B;  5J4U A;  3PH9 A;  3GTU A;  4TR3 A;  2H0I A;  2PN8 A;  1XG8 A;  5IOX A;  4HQZ A;  3QFB C;  3HVX A;  2RLI A;  3HZ8 A;  1W89 A;  4TKY A;  5JCU A;  4BIK A;  4NHZ A;  2O85 A;  5IMD A;  5G30 A;  2ZUP A;  2NTO A;  1HNB A;  4EUY A;  1SYR A;  1XIY A;  4O5Q A;  3FYG A;  2DLX A;  1FW1 A;  4RI6 A;  2PU9 C;  5EY6 A;  5GAN D;  3HCZ A;  5ENU A;  2VAF A;  2NDO A;  3Q19 A;  1ZCP A;  2HZE A;  9GSS A;  13GS A;  1X9S B;  3L9V A;  4IEL A;  2GQM A;  6GST A;  1GL8 A;  5DQS A;  2VL3 A;  4J57 E;  4HUA A;  1J0F A;  1QFN A;  5KOW A;  4F9Z A;  6GSU A;  2H19 A;  4MCU A;  4ICY A;  3F8U A;  3KH7 A;  4JRR A;  3D0Z A;  4OFT A;  1H75 A;  5IMZ A;  4JU5 A;  2J23 A;  2R5G A;  3F4S A;  2EIO A;  2A4H A;  2QKE A;  1ST9 A;  2PWJ A;  4PNG A;  3ISO A;  5DVB A;  2PER A;  2PVO C;  2XHF A;  3HD5 A;  4I6X A;  1XPV A;  4K2D A;  2KP2 A;  4OD7 A;  1EP7 A;  1URM A;  3MIX A;  4TN8 A;  1TI1 A;  5B8B A;  4TR1 A;  1WJK A;  3FR9 A;  4IP1 A;  2CZ2 A;  3N9J A;  2QA2 A;  3IPZ A;  1SL2 B;  3KTB A;  4MH2 A;  3W8J A;  1GTA A;  4F2I A;  2C3Q A;  4L5O A;  2P31 A;  4O5U A;  1SL0 B;  1FB0 A;  3WGX A;  1Y6E A;  2YAN A;  1DBY A;  1BYE A;  5BMU A;  4XRD A;  1V40 A;  4PNF A;  5GAP D;  2H1G A;  4KF9 A;  5CRH A;  3BBY A;  5KN1 A;  4D73 A;  2LS5 A;  4NXI A;  1OKT A;  2H71 A;  1V9W A;  1FOV A;  2VCV A;  1OE7 A;  1EOH A;  1GSQ A;  1XW9 A;  4PQ1 A;  3Q18 A;  3I43 A;  1R5A A;  2WS2 A;  1K0M A;  2TRX A;  3TCO A;  4K7N A;  1SJI A;  4GST A;  1PD2 1;  1HD2 A;  2GQL A;  3ZML A;  4PXO A;  4NV5 A;  3MDK A;  4KND A;  2BJX A;  4MJA A;  4OFN A;  4GTU A;  2D2Z A;  2H1B A;  4ZIJ A;  2OAD A;  1TOF A;  3GX0 A;  1PSQ A;  1YKA A;  4AJ7 A;  2YWM A;  2F8A A;  2JSY A;  1PQN A;  22GS A;  2M72 A;  4PX1 A;  19GS A;  1F9M A;  1O8X A;  3IE3 A;  2MZC A;  4JED A;  3H93 A;  4Q5R A;  2JAD A;  1WWJ A;  2I9H A;  3ZIT A;  3ZVJ D;  4HZ4 A;  2FWE A;  4IVF A;  4HZ2 A;  4MP4 A;  3AY8 A;  5J3R A;  4FH8 A;  4RQX A;  1KNG A;  2E0Q A;  2CZ3 A;  3QCP A;  2VLT A;  4WBR D;  2DJ0 A;  4HS1 A;  3L78 A;  2CQ9 A;  4K8M A;  4O32 A;  3QAW A;  1G7E A;  4GCI A;  3ZZX A;  3US3 A;  3CTG A;  1ZYP A;  3A2V A;  4XTS A;  2CV4 A;  3HDC A;  1F6M C;  4FYC A;  2L6C A;  5DAK A;  2F9S A;  4GF0 A;  1PMT A;  4V2N A;  2A2S A;  2N5B A;  3EU3 A;  4ULX A;  2YJH A;  5FT3 A;  1T7P B;  8GSS A;  3IAS 2;  3TKQ A;  2WFC A;  2C3N A;  3J7Y k;  4EVM A;  2G2Q A;  1NHY A;  3OR5 A;  3CSI A;  1S3A A;  3FW2 A;  3RHC A;  5JCW A;  1ERW A;  2CT6 A;  3LWA A;  3GKN A;  2P5R A;  1YY7 A;  2HI7 A;  1YEX A;  4DSQ A;  1XOA A;  3VWV A;  4WBJ A;  5IO2 A;  3DYR A;  4KAE A;  4BL7 A;  3F6F A;  4IGJ A;  2R37 A;  3HHV A;  4ISD A;  1OC8 A;  2M46 A;  3FY7 A;  5AGY A;  2QC7 A;  3EUR A;  2H01 A;  2MYG A;  2PBJ A;  4YKG A;  2A2P A;  2VLV A;  2JU5 A;  1OE8 A;  1JZO A;  1WPI A;  4GLT A;  2REM A;  4MH3 A;  4DEJ A;  1K3O A;  5DQY A;  3GMF A;  1KBN A;  1X5D A;  1F37 A;  4MJC A;  3EYT A;  4KSM A;  3MSZ A;  2PGT A;  4V2L A;  2K9F A;  1T00 A;  2H74 A;  1GSS A;  1A23 A;  5GST A;  2FHE A;  2O8V B;  5C04 A;  3HZ4 A;  4GSS A;  2KP1 A;  4ZB6 A;  1EWX A;  3DKS A;  2C80 A;  3PR8 A;  1YZX A;  1GTU A;  3ZIV A;  4CW9 A;  2X64 A;  3M0F A;  1MDJ A;  2IWT A;  2HNL A;  4OO5 A;  4MLY A;  1JZD A;  1T1V A;  1TRW A;  3GNJ A;  1N8J A;  2ES7 A;  3F3Q A;  4WEY A;  5HR2 A;  2C0F A;  1K3L A;  3F63 A;  3GTU B;  3GKK A;  1OAZ A;  1VRS D;  1GUM A;  1TRV A;  5INY A;  1S3R A;  4ACS A;  1ZOF A;  3D22 A;  5ECI B;  3D6I A;  2OBI A;  3MNG A;  2L57 A;  3UMA A;  2YZU A;  4WKW A;  3GHA A;  4YQV A;  1WOU A;  2GVP A;  1GH2 A;  3TKS E;  2C8U A;  3KJY A;  1R7H A;  2K8V A;  2GZY A;  3HKR A;  1TP9 A;  5DCG A;  5LNK e;  2MMO A;  1KEB A;  4ILF A;  3EIN A;  2CX3 A;  3H1N A;  1GUL A;  2HRA A;  3G7I A;  4YKF A;  3F0I A;  2YP6 A;  1FB6 A;  2OKA A;  5J41 A;  4NV2 A;  5EVO A;  1YF0 A;  5JWO B;  4CY8 A;  3EPT A;  1B8X A;  5G31 A;  1PN9 A;  2FD3 A;  3M3M A;  1A2J A;  1FO5 A;  2LRN A;  2OJL A;  2B1K A;  4N11 A;  4MPG A;  4PQH A;  4TR1 B;  1VF4 A;  3NIV A;  5J5N A;  1NM3 A;  4G2E A;  4G0I A;  4ID0 A;  3QPM A;  3UIW A;  1RK4 A;  3TDG A;  5F05 A;  6GSX A;  1X9W B;  3GUR A;  1JZW A;  3LYK A;  1TK0 B;  4NPB A;  12GS A;  3VFI A;  3QFA C;  4BA7 A;  4FYB A;  3L9S A;  3EVI A;  3C1R A;  3RAZ A;  2H72 A;  2X99 A;  3QR6 A;  2I4A A;  2H73 A;  1TTZ A;  4QL9 A;  1BED A;  4OWY A;  1R4W A;  2IL3 A;  1PFO A;  1R26 A;  3GFK A;  2JZR A;  1PGT A;  2H30 A;  4D73 B;  4BWQ A;  5D73 A;  3TRQ A;  3ME7 A;  3WGD A;  1A2L A;  4ECI A;  4CHS A;  5D9X A;  4AJ6 A;  2GS3 A;  4L0U A;  2X8G A;  1R5P A;  3CTF A;  4GXZ A;  1OVN A;  1UN2 A;  2PPT A;  5AIX A;  4WR5 A;  2HYX A;  2VM1 A;  3N5O A;  2DSA A;  4O92 A;  1ERV A;  4PUF C;  4MJE A;  4QL7 A;  3BJ5 A;  5DJM A;  1XCC A;  2K18 A;  2TIR A;  1SKS B;  2H75 A;  2H6Z A;  4GQC A;  2FCH A;  2CX4 A;  1WRY A;  1CQG A;  3HJM A;  3RPN A; 
#chains in the Genus database with same CATH homology
 3FZ9 A;  2IMI A;  1SU9 A;  1Q4J A;  2L5O A;  1JFU A;  2LQO A;  3IK7 A;  1MEK A;  1MDK A;  2LJR A;  6GSY A;  1SL1 B;  1G0T A;  4HU7 A;  2RM5 A;  3GX8 A;  4K1F A;  2FUG 2;  3KXO A;  2LRT A;  3K8N A;  2IME A;  2JZT A;  5CO3 A;  2WJU A;  4XRA A;  2GSQ A;  1EZK A;  2ALB A;  1HNA A;  3KM6 A;  1QGV A;  4IQA A;  5HR0 A;  5B6N A;  2FA4 A;  4HDE A;  1Z6M A;  5IO0 A;  4ZB8 A;  5IMF A;  3HVV A;  3TKS C;  5BRT A;  4XHM A;  1K0N A;  2VLU A;  3IRA A;  3GUS A;  1ERU A;  5DAK B;  3UVT A;  4GSN A;  3ZL5 A;  3ZLP A;  2L4Q A;  4NAX A;  3VWX A;  6GSS A;  5ECP B;  2FNO A;  2DJ2 A;  2A2R A;  3A2X A;  3WYW A;  3TJJ A;  4EIQ A;  1GSF A;  2R3X A;  3UOM A;  1AQW A;  4IW9 A;  1GNE A;  3G7J A;  4YH2 A;  3WT1 A;  2F3M A;  2WZ9 A;  5D8I A;  5IM9 A;  2B5Y A;  3P2A A;  3QD9 A;  5HR3 A;  3C8E A;  2OBK A;  3TRP A;  4YAP A;  4IS0 A;  5JWQ B;  1XFL A;  4ML6 A;  2VCZ A;  4BL7 B;  2VL2 C;  4MF5 A;  1BX9 A;  3DRN A;  2YCD A;  1K0D A;  4K2X A;  5ECN B;  4FO5 A;  3TKS A;  1PX7 A;  1TW9 A;  4ZB9 A;  5A4W A;  4JR6 A;  1B48 A;  2DKI A;  2C0D A;  4O7H A;  2DIZ A;  1PA3 A;  4Q5N A;  1GSE A;  3KD0 A;  3CBU A;  2IFQ B;  3U6V A;  3HXS A;  3VI5 A;  3E9J B;  1C72 A;  2V2G A;  4PUA A;  4KGI A;  4V1A p;  2G0F A;  2R2J A;  3BD2 A;  1V98 A;  3NOF A;  1GTI A;  3SBC A;  1KTE A;  2X4A A;  1FVJ A;  2C1Y A;  5LD0 A;  1Z7R A;  5ELA A;  4F82 A;  2GT6 A;  5ABR A;  4HI7 A;  3LYP A;  4AGS A;  3UAP A;  2IMD A;  2VOC A;  3EWL A;  4KDY A;  2P0G A;  2WCI A;  2DMM A;  1XBS A;  3TGZ A;  2GTU A;  1K0A A;  4O5R A;  1FG4 A;  5DCH A;  3ZFL A;  2H1D A;  1ABA A;  1M2A A;  3CXG A;  3GL5 A;  2N5A A;  2TRC P;  2VM2 A;  2VL2 A;  5IQY A;  1K0C A;  3IXR A;  2GGT A;  1LBK A;  1M7T A;  4WXT A;  4G10 A;  2KOK A;  1SK2 A;  1BQ7 A;  1X5E A;  5D9V A;  2V1M A;  3FR3 A;  4A5P A;  3IBH A;  1Z6N A;  2VCT A;  3KMO A;  3UJ1 A;  2FWG A;  1ERT A;  1EV9 A;  2Z9S A;  4K5S A;  1SEN A;  1ML6 A;  2FY6 A;  2I1U A;  2DKH A;  2H66 A;  3DD3 A;  2LRC A;  4J56 E;  4RQR A;  2GST A;  4ML1 A;  2EC4 A;  3I6A A;  3E0U A;  4MDC A;  1J08 A;  4K0N A;  4RUV A;  2ZNM A;  3FHK A;  4F0C A;  2IPA A;  1GUK A;  1A0F A;  3U5R E;  7GSS A;  3MAK A;  3IV4 A;  1JHB A;  1PN0 A;  3VK9 A;  1OYJ A;  4ZBB A;  4ZL8 A;  3IK9 A;  1O81 A;  5A4V A;  1PL1 A;  4KW6 A;  2EIQ A;  3FEU A;  5CRW A;  4LL4 B;  2HRN A;  4BPY A;  2I81 A;  5KEJ A;  4MJB A;  3ZTL A;  2R0C A;  3R3E A;  4IJI A;  3HY2 A;  3TJK A;  4KX4 A;  4NMU A;  5CRG A;  2YOI A;  4TXO A;  1JLV A;  4I97 A;  3L9U A;  16GS A;  2AYT A;  2RM6 A;  2QSI A;  1I5G A;  5FHI A;  1PX6 A;  1OC9 A;  3DML A;  1GRX A;  2OA7 A;  3LJR A;  1THO A;  2ZCT A;  3W8S A;  2E7P A;  1TK5 B;  2LNS A;  5D93 A;  4EDZ A;  2BTO T;  3QOU A;  3VPT A;  3KZQ A;  5F06 A;  3FZ5 A;  3HVS A;  1K3Y A;  1Z5Y E;  4XS1 A;  1LJR A;  4AF2 A;  1IYH A;  1O8W A;  3GSS A;  1U87 A;  1AQX A;  2LV3 A;  1TI3 A;  3PGT A;  4I2U A;  3VUR A;  3P8W A;  4K6X A;  3TB2 A;  3GV1 A;  1DE1 A;  3H4K A;  3ME8 A;  4NHW A;  1AQV A;  6GSW A;  1O7U A;  2GZZ A;  1M2B A;  1MD4 A;  2C0G A;  5ECL B;  4BVY A;  3KP8 A;  2K6V A;  2YPM A;  2H6Y A;  4TXV A;  3LEF A;  3PIN A;  2K8S A;  4RI7 A;  4OMV A;  2YN1 A;  1NHO A;  2LKU A;  1SYX A;  1AW9 A;  2PVQ A;  4KUN A;  1XW6 A;  5F0G A;  1VF1 A;  4XIH A;  2WUL A;  2YWO A;  2V32 A;  4IQ1 A;  2O7K A;  4POK A;  1N2A A;  3VLN A;  4HOJ A;  2CVK A;  4EE0 A;  2DBC A;  3TKR A;  1MDI A;  4KA0 A;  1M2D A;  4WF5 A;  2B5E A;  4DSR A;  1K0B A;  1O85 A;  3GIX A;  4ZBA A;  2HZE B;  3LGC A;  3I9V 2;  4ZL9 A;  2CAI A;  1RQM A;  4I8B A;  1AXD A;  3O76 A;  4K5R A;  5ECQ B;  1XW5 A;  1MD3 A;  2BMX A;  2HXK A;  4DSS A;  1U3A A;  1HNC A;  5ECR B;  3HYP A;  1LU4 A;  3QDN A;  2LJK A;  2R0G A;  11GS A;  2UZ8 A;  3BOA A;  3D5J A;  2B5X A;  2N5F A;  2R6K A;  3UBK A;  4LL1 B;  1HQO A;  1GTB A;  2WRT A;  3FZ4 A;  3DGQ A;  1WMJ A;  5B8A A;  1M9B A;  4HJM A;  3I69 A;  4K0G A;  1U88 A;  5CAX A;  4FQU A;  4HEA 2;  1O6J A;  2VL9 A;  4YQU A;  5IMC A;  5LCZ A;  3QAV A;  3ZYW A;  1OC3 A;  1U3I A;  1T4Z A;  5A4U A;  2CVD A;  2GLR A;  4PGT A;  4ZL7 A;  1BAY A;  5DJL A;  1HYU A;  4CDO A;  4BWS A;  2M80 A;  3KGK A;  3GRX A;  4KE3 A;  2PUK C;  3H79 A;  3GYK A;  4TW5 A;  5ECO B;  5B7C A;  2IIY A;  5GZZ B;  3CSJ A;  1H4O A;  3GKM A;  1Y25 A;  3IAM 2;  3V1W A;  3KMN A;  3EC3 A;  1TJD A;  2MBS A;  1XZO A;  1TDI A;  1FAA A;  1Z7P A;  4ECC A;  4EL1 A;  3KP9 A;  2GQK A;  3DWV A;  5A5K A;  2WB9 A;  3NZN A;  4QQ7 A;  1GLQ A;  4LMW A;  4MK3 A;  2NVL A;  5HFK A;  1GLP A;  3ERF A;  2EIR A;  3DVX A;  4EO3 A;  2RUE A;  2GDR A;  5G5F A;  2V6O A;  3TOU A;  2KHP A;  4H86 A;  3ERW A;  3IA1 A;  1QXH A;  5ELG A;  4IJ3 A;  5B6M A;  3APS A;  2VIM A;  5FWG A;  3FK8 A;  4MZW A;  1AAZ A;  4FIW A;  3APQ A;  4BVX A;  4PUR A;  3TJB A;  3KCM A;  5ECH B;  3CRU A;  3Q74 A;  3EU4 A;  2GSS A;  2XBI A;  3KTL A;  1CQH A;  5IPH A;  4POM A;  4MAB A;  1QMV A;  1EGO A;  1E2Y A;  3Q6O A;  3A3T A;  1DE2 A;  3HA9 A;  2OAC A;  2F8F A;  1M99 A;  4XCS A;  1ON4 A;  4XS4 A;  2L5L A;  2C0E A;  1YKC A;  5JWR B;  2MBT A;  1GSU A;  4LLR A;  2DC5 A;  2JAC A;  5DAL A;  1YQ1 A;  4G0L A;  5HQP A;  3WT2 A;  4E8E A;  14GS A;  3O6T A;  2RUF A;  2CAQ A;  1FOH A;  1SK0 A;  2JSZ A;  3LG6 A;  3S9F A;  5F8B A;  1DSB A;  4TR0 A;  1VGL A;  4JZQ A;  2IMK A;  3FKF A;  3QMX A;  1EP8 A;  3LQ7 A;  2OE0 A;  2CA8 A;  5G2Z A;  4POB A;  2YNX A;  2JL4 A;  3R2Q A;  3GST A;  1TRS A;  2J9H A;  5AN1 A;  4K7O A;  1WP0 A;  3P90 A;  3UAR A;  2HSH A;  1B9X C;  3APO A;  4K9Z A;  5H5R A;  1Z3E A;  3PPU A;  1E6B A;  2YV7 A;  3H8Q A;  2XPE A;  3G7Y A;  1YJ6 A;  4TXO B;  3UBL A;  2H70 A;  3ZVJ A;  3FRC A;  1YF1 A;  5H5S A;  1T4Y A;  1OC9 B;  1SJZ A;  5G1K A;  4Z2R A;  1ZL9 A;  2NPB A;  4EXJ A;  2B1L A;  1ZYE A;  3D4T A;  18GS A;  4MZC A;  1PKZ A;  3M8N A;  4POL A;  4MF7 A;  2E2G A;  3J7Y b;  1T8E B;  4MF6 A;  2HRF A;  1ILO A;  3M9J A;  3VWU A;  2FA8 A;  2YWN A;  2GT5 A;  1EGR A;  2B3S A;  3C7M A;  5CYY A;  4I2T A;  5HFI A;  3DXB A;  4GWR A;  3KIJ A;  5ECS A;  4AJ8 A;  20GS A;  1V58 A;  2XPD A;  1T3B A;  4IN0 A;  3IDV A;  4ECB A;  2X49 A;  3F4T A;  3FR6 A;  3WD6 A;  3CSH A;  1UA5 A;  3E3E A;  2HSY A;  3HJO A;  5L71 A;  2VO4 A;  5EL8 A;  1AC1 A;  4BVY B;  5ECK B;  5AIV A;  1MTC A;  1TKD B;  1TRU A;  5KOX A;  4N30 A;  3ZRE A;  2WGR A;  2C3T A;  1XWB A;  2KLX A;  1XWK A;  2XBQ A;  2LTK A;  1X5C A;  2MMZ A;  1ZGN A;  2L6D A;  5KN2 A;  3WGE A;  4PTS A;  3W6G A;  3HJP A;  3M1G A;  2AUV A;  4XS6 A;  3IHQ A;  1VF2 A;  2FLS A;  4EIP A;  1PKW A;  1EOG A;  2LQQ A;  1SK1 A;  3GN3 A;  3IC4 A;  3VI7 A;  3A5W A;  1XOB A;  1GNW A;  1QUW A;  2X8C A;  4KH7 A;  2LST A;  5ID2 A;  1A0R P;  1B9Y C;  2H76 A;  2MMA A;  2V41 A;  1WIK A;  2GZP A;  1PL2 A;  2YV9 A;  1YDK A;  3DVW A;  4FYU A;  2HT9 A;  4N0Z A;  1USB A;  3RHB A;  2HSM A;  4OCE A;  4Z7X A;  1BG5 A;  4DSS B;  5F07 A;  2PMT A;  5DDL A;  4YAV A;  3GH6 A;  1EEM A;  1FVK A;  3IOS A;  2F51 A;  4LA1 A;  2B7K A;  3BCK A;  1A24 A;  1S3C A;  3VWW A;  3GKX A;  3ZFB A;  1WE0 A;  2B6M A;  3C1S A;  4MZB A;  1XXU A;  1SKR B;  4HJ2 A;  2LEG A;  3UL3 A;  1M9A A;  4TOP A;  3M9K A;  2HE3 A;  2HRK A;  1VF3 A;  3EMP A;  2R4V A;  3TJG A;  3DEX A;  4IKH A;  1XVW A;  2V6K A;  3O3T A;  4GRF A;  2AAW A;  3BCI A;  5EPF A;  4KCA A;  4HU9 A;  4N10 A;  4EDY A;  6GSV A;  2WDU A;  3P7X A;  3EMX A;  2O87 A;  4CY6 A;  2X8H A;  3RPP A;  2AJQ B;  3L0H A;  1F3A A;  4IP6 A;  1DUG A;  2QGV A;  4Z2U A;  3KH9 A;  5AIS A;  1A8Y A;  2FWF A;  5HFG A;  2YZH A;  2IMF A;  4IBP A;  3LOR A;  1V57 A;  5JCG A;  4NWY A;  1BJX A;  5H5Q A;  3TRX A;  1TK8 B;  3LFL A;  2H0H A;  4MA9 A;  4OCF A;  1RW1 A;  4KB3 A;  4Q5F A;  4K7I A;  3C71 A;  2DJ3 A;  1W4V A;  2MMN A;  10GS A;  1J9B A;  5GSS A;  2AB6 A;  5KN3 A;  3ZIJ A;  2YJ7 A;  2IFQ A;  4V1A g;  2IN3 A;  1S3D A;  5D9W A;  1OKD A;  3G9B A;  3LSZ A;  2JZS A;  4OO4 A;  2QA1 A;  4ECJ A;  1TU8 A;  1O73 A;  2DJJ A;  5G5E A;  1X9M B;  1GSY A;  4LMV A;  2VD0 A;  3CYN A;  2DML A;  2I3Y A;  4MMM A;  2R0P A;  1XWG A;  4BVX B;  2DIY A;  1F3B A;  2L59 A;  3FMW A;  1SD9 A;  4G9H A;  4X4J A;  4V2M A;  5CRD A;  4EKZ A;  4EF0 A;  5HR1 A;  4EC0 A;  2HFD A;  3ERG A;  3EE2 A;  5KN0 A;  1JLW A;  4XS4 B;  1QQ2 A;  2L4C A;  2AHE A;  3LXT A;  3ZMK A;  4J2F A;  1GUH A;  3UEM A;  4P3Y B;  1UC7 A;  2IJY A;  4USS A;  4ZBD A;  5DAL B;  2HLS A;  1V2A A;  1M0U A;  5G1L A;  2LNT A;  2C4J A;  2FGX A;  2H1A A;  3LW9 A;  4IHU A;  3SWL A;  1I9D A;  3F3R A;  1A2M A;  3MWH A;  5E59 A;  1GP1 A;  2YWI A;  1A8L A;  5IPG A;  5COH A;  2DJ1 A;  3L4N A;  1F2E A;  1G6Y A;  5IMA A;  1ZZY A;  2HZF A;  3GA4 A;  1ZYQ B;  4KDX A;  4DVC A;  1ACV A;  3RDW A;  2VCQ A;  4JE1 A;  3IR4 A;  3LXZ A;  4TR4 A;  2GSR A;  5J9B A;  2VCX A;  1IYI A;  5IOW A;  4X0X A;  2H8L A;  17GS A;  4JR4 A;  2VD1 A;  4L0W A;  1FHE A;  2O89 A;  2E2M A;  3GL3 A;  3C73 A;  4KDU A;  4HQS A;  3VPQ A;  1ZMA A;  3F4R A;  1Q98 A;  2NBS A;  4TVE A;  2P5Q A;  3D21 A;  3MYD A;  3F9U A;  1G7O A;  4E8H A;  3CRT A;  2ON5 A;  3KEB A;  3RBT A;  4TRX A;  4WR4 A;  1K0O A;  3FZA A;  2H0G A;  2A4V A;  2VUP A;  1UVZ A;  5IIZ A;  5D96 A;  2OE3 A;  3TUE A;  1THX A;  5CP1 A;  1XVQ A;  4F03 A;  3JCM L;  5E4W A;  4GQF A;  3A5I A;  5C00 A;  3UVH A;  1B4P A;  3CMI A;  3D4M A;  4YQM A;  3GH9 A;  2DJK A;  1SD8 A;  4JBB A;  4L8E A;  4G0K A;  4OFM A;  4Z2T A;  5J9C A;  5ECM B;  4WET A;  1SJ6 A;  1YEP A;  2CVB A;  4G19 A;  1TU7 A;  4ZXG A;  1B4Q A;  1EV4 A;  2KUC A;  4MNN A;  4X43 A;  1U6T A;  2LUS A;  4I5Q A;  1Z9H A;  1SKW B;  1ZYN A;  3A2W A;  4X1U A;  4WF4 A;  5IMV A;  2ON7 A;  3QAG A;  1AIU A;  1GWC A;  2VCW A;  1PRX A;  4F0B A;  2FWH A;  1JZR A;  4L5L A;  4N0V A;  2RII A;  3IHG A;  4KSO A;  1AUC A;  1QK8 A;  3DIE A;  5D9T A;  3TKP A;  3TOT A;  3F6D A;  1NW2 A;  1G6W A;  4MPF A;  3ZRD A;  2AV4 A;  1EEJ A;  1TXX A;  3IC8 A;  2OE1 A;  1XWA A;  5CNW A;  4Q5Q A;  4ZIL A;  1XWC A;  2LJA A;  3ED3 A;  4PQI A;  2H6X A;  2XC2 A;  4KCE A;  1GSD A;  1NSW A;  5DBQ A;  2B7J A;  3TJF A;  1X0R A;  5CRE A;  5ID2 B;  5J4U A;  3PH9 A;  3GTU A;  4TR3 A;  2H0I A;  2PN8 A;  5IOX A;  4HQZ A;  3QFB C;  3HVX A;  2RLI A;  3HZ8 A;  1W89 A;  4TKY A;  5JCU A;  4NHZ A;  2O85 A;  5IMD A;  5G30 A;  2ZUP A;  2NTO A;  1HNB A;  4EUY A;  1SYR A;  1XIY A;  4O5Q A;  3FYG A;  2DLX A;  1FW1 A;  4RI6 A;  2PU9 C;  5EY6 A;  5GAN D;  3HCZ A;  5ENU A;  2VAF A;  2NDO A;  3Q19 A;  1ZCP A;  2HZE A;  9GSS A;  13GS A;  1X9S B;  3L9V A;  4IEL A;  2GQM A;  6GST A;  1GL8 A;  5DQS A;  2VL3 A;  4J57 E;  4HUA A;  1J0F A;  1QFN A;  5KOW A;  4F9Z A;  6GSU A;  2H19 A;  4MCU A;  4ICY A;  3F8U A;  3KH7 A;  4JRR A;  3D0Z A;  4OFT A;  1H75 A;  5IMZ A;  4JU5 A;  2J23 A;  2R5G A;  3F4S A;  2EIO A;  2A4H A;  2QKE A;  1ST9 A;  2PWJ A;  4PNG A;  3ISO A;  5DVB A;  2PER A;  2PVO C;  2XHF A;  3HD5 A;  4I6X A;  1XPV A;  4K2D A;  2KP2 A;  4OD7 A;  1EP7 A;  1URM A;  3MIX A;  4TN8 A;  1TI1 A;  5B8B A;  4TR1 A;  1WJK A;  3FR9 A;  4IP1 A;  2CZ2 A;  3N9J A;  2QA2 A;  3IPZ A;  1SL2 B;  3KTB A;  4MH2 A;  3W8J A;  1GTA A;  4F2I A;  2C3Q A;  4L5O A;  2P31 A;  4O5U A;  1SL0 B;  1FB0 A;  3WGX A;  1Y6E A;  2YAN A;  1DBY A;  1BYE A;  5BMU A;  4XRD A;  1V40 A;  4PNF A;  5GAP D;  2H1G A;  4KF9 A;  5CRH A;  3BBY A;  5KN1 A;  4D73 A;  2LS5 A;  4NXI A;  1OKT A;  2H71 A;  1V9W A;  1FOV A;  2VCV A;  1OE7 A;  1EOH A;  1GSQ A;  1XW9 A;  4PQ1 A;  3Q18 A;  3I43 A;  1R5A A;  2WS2 A;  1K0M A;  2TRX A;  3TCO A;  4K7N A;  1SJI A;  4GST A;  1PD2 1;  1HD2 A;  2GQL A;  3ZML A;  4PXO A;  4NV5 A;  3MDK A;  4KND A;  2BJX A;  4MJA A;  4OFN A;  4GTU A;  2D2Z A;  2H1B A;  4ZIJ A;  2OAD A;  1TOF A;  3GX0 A;  1PSQ A;  1YKA A;  4AJ7 A;  2YWM A;  2F8A A;  2JSY A;  1PQN A;  22GS A;  2M72 A;  4PX1 A;  19GS A;  1F9M A;  1O8X A;  3IE3 A;  2MZC A;  4JED A;  3H93 A;  4Q5R A;  2JAD A;  1WWJ A;  2I9H A;  3ZIT A;  3ZVJ D;  4HZ4 A;  2FWE A;  4IVF A;  4HZ2 A;  4MP4 A;  3AY8 A;  5J3R A;  4FH8 A;  4RQX A;  1KNG A;  2E0Q A;  2CZ3 A;  3QCP A;  2VLT A;  4WBR D;  2DJ0 A;  4HS1 A;  3L78 A;  2CQ9 A;  4K8M A;  4O32 A;  3QAW A;  1G7E A;  4GCI A;  3ZZX A;  3US3 A;  3CTG A;  1ZYP A;  3A2V A;  4XTS A;  2CV4 A;  3HDC A;  1F6M C;  4FYC A;  2L6C A;  5DAK A;  2F9S A;  4GF0 A;  1PMT A;  4V2N A;  2A2S A;  2N5B A;  3EU3 A;  4ULX A;  2YJH A;  5FT3 A;  1T7P B;  8GSS A;  3IAS 2;  3TKQ A;  2WFC A;  2C3N A;  3J7Y k;  4EVM A;  2G2Q A;  1NHY A;  3OR5 A;  3CSI A;  1S3A A;  3FW2 A;  3RHC A;  5JCW A;  1ERW A;  2CT6 A;  3LWA A;  3GKN A;  2P5R A;  1YY7 A;  2HI7 A;  1YEX A;  4DSQ A;  1XOA A;  3VWV A;  4WBJ A;  5IO2 A;  3DYR A;  4KAE A;  4BL7 A;  3F6F A;  4IGJ A;  2R37 A;  3HHV A;  4ISD A;  1OC8 A;  2M46 A;  3FY7 A;  5AGY A;  2QC7 A;  3EUR A;  2H01 A;  2MYG A;  2PBJ A;  4YKG A;  2A2P A;  2VLV A;  2JU5 A;  1OE8 A;  1JZO A;  1WPI A;  4GLT A;  2REM A;  4MH3 A;  4DEJ A;  1K3O A;  5DQY A;  3GMF A;  1KBN A;  1X5D A;  1F37 A;  4MJC A;  3EYT A;  4KSM A;  3MSZ A;  2PGT A;  4V2L A;  2K9F A;  1T00 A;  2H74 A;  1GSS A;  1A23 A;  5GST A;  2FHE A;  2O8V B;  5C04 A;  3HZ4 A;  4GSS A;  2KP1 A;  4ZB6 A;  1EWX A;  3DKS A;  2C80 A;  3PR8 A;  1YZX A;  1GTU A;  3ZIV A;  4CW9 A;  2X64 A;  3M0F A;  1MDJ A;  2IWT A;  2HNL A;  4OO5 A;  4MLY A;  1JZD A;  1T1V A;  1TRW A;  3GNJ A;  1N8J A;  2ES7 A;  3F3Q A;  4WEY A;  5HR2 A;  2C0F A;  1K3L A;  3F63 A;  3GTU B;  3GKK A;  1OAZ A;  1VRS D;  1GUM A;  1TRV A;  5INY A;  4ACS A;  1ZOF A;  3D22 A;  5ECI B;  3D6I A;  2OBI A;  3MNG A;  2L57 A;  3UMA A;  2YZU A;  4WKW A;  3GHA A;  4YQV A;  1WOU A;  2GVP A;  1GH2 A;  3TKS E;  2C8U A;  3KJY A;  1R7H A;  2K8V A;  2GZY A;  3HKR A;  1TP9 A;  5DCG A;  5LNK e;  2MMO A;  1KEB A;  4ILF A;  3EIN A;  2CX3 A;  3H1N A;  1GUL A;  2HRA A;  3G7I A;  4YKF A;  3F0I A;  2YP6 A;  1FB6 A;  2OKA A;  5J41 A;  4NV2 A;  5EVO A;  1YF0 A;  5JWO B;  4CY8 A;  3EPT A;  1B8X A;  5G31 A;  1PN9 A;  2FD3 A;  3M3M A;  1A2J A;  1FO5 A;  2LRN A;  2OJL A;  2B1K A;  4N11 A;  4MPG A;  4PQH A;  4TR1 B;  1VF4 A;  3NIV A;  5J5N A;  1NM3 A;  4G2E A;  4G0I A;  4ID0 A;  3QPM A;  3UIW A;  1RK4 A;  3TDG A;  5F05 A;  6GSX A;  1X9W B;  3GUR A;  1JZW A;  3LYK A;  1TK0 B;  4NPB A;  12GS A;  3VFI A;  3QFA C;  4BA7 A;  4FYB A;  3L9S A;  3EVI A;  3C1R A;  3RAZ A;  2H72 A;  2X99 A;  3QR6 A;  2I4A A;  2H73 A;  1TTZ A;  4QL9 A;  1BED A;  4OWY A;  1R4W A;  2IL3 A;  1R26 A;  3GFK A;  2JZR A;  1PGT A;  2H30 A;  4D73 B;  4BWQ A;  5D73 A;  3TRQ A;  3ME7 A;  3WGD A;  1A2L A;  4ECI A;  4CHS A;  5D9X A;  4AJ6 A;  2GS3 A;  4L0U A;  2X8G A;  1R5P A;  3CTF A;  4GXZ A;  1OVN A;  1UN2 A;  2PPT A;  5AIX A;  4WR5 A;  2HYX A;  2VM1 A;  3N5O A;  2DSA A;  4O92 A;  1ERV A;  4PUF C;  4MJE A;  4QL7 A;  3BJ5 A;  5DJM A;  1XCC A;  2K18 A;  2TIR A;  1SKS B;  2H75 A;  2H6Z A;  4GQC A;  2FCH A;  2CX4 A;  1WRY A;  1CQG A;  3HJM A;  3RPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...