1XW9A

Drosophila thioredoxin, oxidized, p21
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
106
structure length
106
Chain Sequence
MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thioredoxin
publication title Comparative structural analysis of oxidized and reduced thioredoxin from Drosophila melanogaster
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Electron transport
total genus 36
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xw9A00
1F3AA 2P5RA 2VIMA 2JZTA 2OKAA 3ZFLA 4N10A 5CRHA 4NHWA 1HYUA 1VRSD 2YNXA 3GX8A 2H0HA 3KD0A 3LFLA 1TJDA 3MWHA 3LXTA 1TU7A 3F4RA 3GH6A 3HVVA 2VOCA 5DCHA 2FWGA 2QKEA 3VI7A 3C1RA 3TOTA 1TP9A 4IP1A 2MZCA 3BJ5A 2PBJA 1PMTA 2CX3A 1ERWA 2A2RA 3MDKA 1GSFA 3SBCA 3TOUA 2GZZA 2C80A 4MF6A 1BG5A 1B9YC 3GRXA 1TK0B 1J9BA 2VL3A 4HJMA 3FZ4A 4I8BA 4E8HA 1FHEA 4MJEA 2HLSA 3GSTA 4OFNA 2KUCA 4HUAA 5AGYA 1R4WA 3VPTA 4XTSA 1YY7A 5ECIB 5D9XA 2H19A 1JZWA 5G30A 4MZWA 2FLSA 1K3OA 2L5LA 3G7JA 4G2EA 4TR0A 2K9FA 1O7UA 1DUGA 2B7JA 5ECOB 1O8WA 1XW9A 4WF4A 3ZIVA 4XIHA 4KAEA 3R2QA 2NTOA 2CQ9A 22GSA 2K18A 2MBSA 2C3TA 2WZ9A 1ZYEA 3ZVJA 4LLRA 2GSTA 2FCHA 4V1Ag 2DJJA 2GVPA 4G9HA 2DJKA 1PD21 3QAVA 2AHEA 3P8WA 1ABAA 1A0RP 3L78A 1KTEA 2LNTA 13GSA 3QPMA 5GSSA 1J08A 4ECIA 1K3YA 5G1KA 2BJXA 1JFUA 1XOBA 1T4ZA 2LRTA 2R37A 2FGXA 1TXXA 1Z9HA 1R26A 3MSZA 2H01A 1SD8A 1XWCA 1QUWA 4HJ2A 2F8AA 1A8LA 1Z7PA 1T7PB 3KCMA 4KUNA 2P0GA 1HNBA 2VL2C 2LJRA 3NZNA 2EIOA 3IR4A 2PVOC 5JCGA 4V2LA 1KEBA 4I2TA 5KN2A 3PGTA 2XBIA 2FY6A 5DBQA 2ZNMA 1FG4A 1VF1A 3NIVA 2F51A 4ISDA 3F63A 3TCOA 3ZMKA 2DIZA 4IELA 2P5QA 2YOIA 4GLTA 4KX4A 1M2DA 1TU8A 5J5NA 4XS1A 1OAZA 4F0BA 1QMVA 2BMXA 2WJUA 3ZFBA 5IOWA 2OE3A 1BYEA 3FRCA 2HNLA 2I81A 1MD4A 1SJ6A 2CZ3A 1ZL9A 4F0CA 2I9HA 4XRDA 4NAXA 3CSJA 1MDKA 4FYUA 2DMLA 1A2MA 5B7CA 4IP6A 4OWYA 1BJXA 1GLQA 2E2MA 3IA1A 2MBTA 4MJBA 4ID0A 1I9DA 1R5PA 5F07A 4POMA 2ON5A 4LL4B 3Q74A 20GSA 3VWXA 2G0FA 1ZCPA 2OA7A 4MF5A 3QD9A 5INYA 4IJIA 3RPPA 2VCQA 1VF4A 1NM3A 1ZYQB 5ELAA 2CAIA 1M7TA 4HOJA 4WKWA 5EY6A 1SYRA 1W4VA 3IAM2 1V40A 2P31A 4NPBA 2OBKA 1X0RA 2R4VA 3TKRA 1NSWA 2H6ZA 4X1UA 2V6KA 4ZB6A 2IMDA 4EKZA 1UC7A 5LNKe 4QQ7A 9GSSA 1GNEA 4J2FA 4PNFA 1X9WB 5ECKB 2B5YA 5D8IA 2WCIA 1SJIA 1ERUA 1EV9A 1GL8A 2LKUA 4MCUA 2H1AA 2R6KA 3D4MA 3LYKA 1YEXA 3HVXA 1EGOA 2OJLA 3N5OA 4QL7A 1O85A 1O8XA 4YQUA 4BVXA 1GLPA 1SJZA 3CMIA 3KGKA 1AIUA 4PXOA 2H0IA 1Q98A 5ECSA 4L8EA 3KTBA 4CDOA 1S3AA 2PMTA 3GN3A 3IRAA 5B8BA 1ZMAA 3GHAA 2RUFA 6GSXA 2K8SA 2Z9SA 2EC4A 2LJAA 3HJOA 1U3AA 2KLXA 1E6BA 2VLUA 2DJ3A 1GNWA 2YWIA 5IM9A 5HFIA 3DRNA 4K8MA 1FVKA 3QMXA 4ZB8A 2IIYA 5IPGA 4GCIA 4KGIA 3F6FA 3DEXA 5EPFA 4YQMA 3GL5A 2PPTA 1N8JA 4PQHA 5CO3A 4HI7A 4V2MA 1YDKA 1RQMA 2IN3A 5L71A 4N30A 2AB6A 4KA0A 2LNSA 2IL3A 5HR3A 2ZUPA 1YEPA 1TK8B 2CVBA 4FYBA 4HU9A 3RHBA 3LYPA 5COHA 5DJLA 6GSYA 1S3DA 3GUSA 2PN8A 2H70A 3CSIA 4YQVA 1TKDB 2YZHA 4ACSA 4NXIA 2FWFA 2H1GA 3TKPA 1V9WA 2CVDA 19GSA 3W6GA 1RW1A 1GSEA 1AC1A 3OR5A 4L0UA 4ML6A 4O32A 1EGRA 2AV4A 1GUMA 2C1YA 4MH2A 2WULA 4XRAA 3TKSC 2PWJA 4XS6A 4KDXA 2O87A 1PN9A 4KSOA 2H1BA 5J3RA 5IMZA 4WBRD 2CT6A 1M99A 1TRSA 3M1GA 1WMJA 1DE2A 4O7HA 2GQKA 4AJ7A 4F82A 2VLVA 4EDYA 3BOAA 1K0CA 4MLYA 1JZOA 3JCML 3IC4A 3L9UA 1NW2A 1M9AA 1SD9A 2AJQB 4F9ZA 2MMNA 5HFGA 2LS5A 5JCUA 3ZZXA 1T3BA 2B5EA 1U87A 3G9BA 1PRXA 2CZ2A 2O8VB 1R5AA 11GSA 3HA9A 1FB6A 1K0BA 1GSYA 1PL2A 2AYTA 3TDGA 4HQSA 2J23A 4Q5RA 4FYCA 4PNGA 1WIKA 2YV9A 3HHVA 3WT1A 4MABA 4LL1B 1SKSB 5JCWA 4K1FA 1OYJA 4K9ZA 2H1DA 3GL3A 1K0OA 3KZQA 3ZIJA 4FH8A 2REMA 2H8LA 3M9KA 5D96A 1FW1A 3ZVJD 3KIJA 4DVCA 5ECHB 2RUEA 2FUG2 4EUYA 3TJBA 5IMAA 2C0GA 2FA8A 5ECRB 1LBKA 2D2ZA 4EL1A 3TKSE 2VL9A 4FO5A 3ERGA 3LEFA 3UOMA 1B9XC 1ML6A 1JLWA 4KH7A 4ZL7A 1AW9A 2QC7A 3FR3A 1FVJA 3CBUA 2OACA 1WP0A 4JR6A 1HQOA 2E0QA 2N5FA 4X0XA 2PERA 5ECMB 2C0FA 1EP7A 3HKRA 4P3YB 1C72A 3VK9A 4I97A 2JSZA 1CQHA 4Q5QA 2I1UA 3ME8A 2YV7A 4AF2A 1LU4A 1Z5YE 1UA5A 3GMFA 3I6AA 1EP8A 2NVLA 4WETA 1HD2A 3RPNA 1TRUA 4ILFA 3C7MA 1PX7A 5D9TA 5B6MA 1K0NA 3VFIA 3C8EA 2JU5A 2H72A 3J7Yb 1SENA 4F03A 3ZYWA 4AJ6A 3D0ZA 1QQ2A 2XHFA 4EDZA 2F9SA 3GTUA 5ID2A 3U6VA 4HEA2 4PGTA 3CTGA 3FY7A 4DEJA 1U88A 4NMUA 2OE1A 4BWSA 2V6OA 1PL1A 7GSSA 1XWAA 1DSBA 1V98A 3EU4A 5IMDA 3KTLA 3E3EA 1VF2A 2AAWA 4CW9A 4I5QA 4YAPA 3BBYA 4L5LA 2CVKA 2JZRA 4ZB9A 3DIEA 3VURA 5ECNB 1T1VA 1F2EA 2CV4A 3IE3A 2ZCTA 4GWRA 5ELGA 4ECBA 4GSNA 5E59A 4ZBAA 1VF3A 1IYHA 1B48A 1TW9A 2YWNA 3TRXA 1NHOA 4IKHA 2K6VA 4MPGA 1SK1A 2ES7A 1FOVA 1OC9A 5CREA 3MNGA 2FWEA 3U5RE 2FWHA 2HRFA 2G2QA 5DALA 3CXGA 1PA3A 3UVHA 5IMFA 3ERWA 3D21A 1ERTA 3G7IA 4RI6A 2XC2A 2HZEA 3H4KA 5J41A 3VWVA 3TB2A 4G19A 1BQ7A 5G2ZA 1S3CA 4OCEA 2TRCP 1A8YA 2JADA 3LQ7A 2C0EA 1B4PA 4ECCA 1YZXA 5A4VA 3GTUB 5ID2B 4OD7A 3DXBA 4JR4A 4IHUA 5ECLB 3ZTLA 3TJJA 2HRNA 4LMVA 3C71A 5F06A 3WGXA 2HSHA 1XVWA 2TRXA 1THXA 3A5WA 2YANA 2VCWA 4N11A 4IS0A 1W89A 4K0GA 2J9HA 1ILOA 4BA7A 1EEJA 1PSQA 4ZBBA 2OE0A 3FW2A 2IWTA 5G1LA 3L0HA 4OCFA 2L4CA 2KOKA 1GUKA 4JBBA 3D5JA 1XVQA 1M2BA 3VI5A 1JHBA 3M0FA 3TRQA 12GSA 3IV4A 2X8CA 1AUCA 1OC9B 5GZZB 2CX4A 3FYGA 5LD0A 1QGVA 5DALB 3K8NA 5KEJA 3FK8A 4E8EA 5IMVA 4EO3A 2HZEB 2RM6A 2GDRA 2YWOA 4N0ZA 4RI7A 2TIRA 4RQRA 2JSYA 3F8UA 3UIWA 2XBQA 1X5DA 5GAND 5A5KA 2HSYA 4WR5A 1F6MC 3HZ8A 3ZITA 5IMCA 2VCZA 1PGTA 3I9V2 3Q18A 4IQAA 3FR6A 4KB3A 5A4WA 5IQYA 1A2JA 5HR1A 4IJ3A 2DLXA 4O5RA 4TR4A 5DAKA 4KW6A 1PX6A 1G6YA 2IMKA 2R3XA 1V2AA 4POKA 2GT5A 6GSUA 2VL2A 4PX1A 1TI3A 2MMOA 4HZ2A 2WS2A 1MEKA 3UJ1A 1AXDA 5GSTA 2ALBA 3PINA 3LXZA 2K8VA 2YJ7A 3IHQA 2F8FA 4HU7A 4JZQA 1RK4A 3UEMA 2VD1A 4AGSA 4LMWA 5J9CA 2C4JA 1BX9A 2HI7A 2FHEA 1SL0B 5D9VA 3DYRA 1XCCA 1U6TA 4PUAA 5A4UA 2VD0A 1A24A 3QFBC 1H4OA 4TXVA 1GSDA 3FZ5A 1IYIA 3KEBA 4BPYA 4GQFA 1F3BA 2RLIA 3UARA 2DSAA 2X64A 4L0WA 4OFMA 2NDOA 3TJKA 1X5EA 1GTUA 3LGCA 1FAAA 1THOA 3EWLA 1XPVA 5HFKA 3VPQA 2V41A 3ZL5A 3AY8A 4TKYA 3GH9A 2IJYA 18GSA 4PQ1A 5C04A 2LRNA 3EE2A 4V1Ap 5DQSA 3DMLA 3IXRA 1TRVA 5JWQB 5D73A 5HR0A 3I69A 4OMVA 1AAZA 5AN1A 4PUFC 17GSA 1GTIA 3BD2A 5G5FA 1Y6EA 5DAKB 1DE1A 2JACA 5CRDA 4WEYA 2LUSA 1G7EA 5ECPB 1H75A 3TUEA 2IMEA 3F6DA 4XS4A 4DSRA 2MMAA 2YP6A 4DSQA 1UN2A 4WXTA 4ZL8A 3W8SA 4Q5NA 1MD3A 4YAVA 3CYNA 3QFAC 2GGTA 2A2SA 2LRCA 5HR2A 3FZAA 1FB0A 3EMPA 4D73A 1WJKA 3N9JA 2DJ0A 1Q4JA 1GSUA 2B6MA 3US3A 4JEDA 3FR9A 3LG6A 3A2WA 3GA4A 3F4TA 3WD6A 4MP4A 3RDWA 3UMAA 4MJAA 2DIYA 4HDEA 5DQYA 5DVBA 1HNAA 2VCXA 4TRXA 1GUHA 1GH2A 2FA4A 3LWAA 1N2AA 2VO4A 1A23A 2GQLA 3FZ9A 5GAPD 4J56E 1XXUA 1Z6MA 2EIQA 1OC8A 4CHSA 3BCKA 1KBNA 1WWJA 4N0VA 3FEUA 2E7PA 4KCAA 4ZXGA 4G10A 5J9BA 2GT6A 1O73A 4ZIJA 1K0MA 2YWMA 4XS4B 3UL3A 4Z7XA 2O85A 2GLRA 2B5XA 1MTCA 2IFQA 2L6CA 2M72A 4Q5FA 4KNDA 1V58A 4D73B 6GSTA 5EVOA 2H74A 2IMIA 2WRTA 3HDCA 5DJMA 4EXJA 3H8QA 4O92A 3L9VA 2FNOA 3DD3A 4TOPA 3QOUA 2IMFA 5FWGA 4F2IA 1WRYA 3IPZA 4NV5A 2WGRA 1X9SB 1GULA 3Q19A 6GSWA 1T00A 2NPBA 3UBKA 1TDIA 3L4NA 1E2YA 1JZRA 3EYTA 4POBA 4IGJA 4JE1A 1ZZYA 3ZMLA 2V32A 3FKFA 1EWXA 1WPIA 2L4QA 4ULXA 5AIVA 2H66A 1SKWB 3F3RA 1PKZA 1OKTA 1ZOFA 2GZYA 1U3IA 1QFNA 2O7KA 3ZREA 3QAGA 4K7NA 4K2DA 1TOFA 4X43A 2GZPA 1XWBA 3HYPA 14GSA 3EMXA 3KP8A 4I2UA 2LJKA 1SK0A 2LQOA 2CAQA 2MMZA 1ON4A 5CRWA 2LV3A 4BL7A 3TKSA 16GSA 3EU3A 1F37A 5EL8A 2IFQB 1Z3EA 3KXOA 3H1NA 1EOGA 2LTKA 4TR1A 3GX0A 1GWCA 3RAZA 1M0UA 3GV1A 1G6WA 1O6JA 2WB9A 4GTUA 4WF5A 3IAS2 4OO5A 4J57E 2GTUA 2XPEA 3HVSA 3MAKA 3CSHA 3HCZA 5JWRB 4I6XA 1XOAA 4MJCA 6GSSA 1EZKA 4GRFA 4WBJA 1V57A 1OKDA 3TKQA 3KP9A 3FHKA 1X5CA 3GKNA 2DMMA 1GTAA 3M9JA 2YZUA 3D4TA 3P2AA 4HQZA 4HZ4A 1A0FA 1M2AA 2OADA 2L5OA 5F0GA 3HZ4A 2HE3A 2C3NA 1XWGA 4TR3A 2I3YA 2M46A 4TW5A 3ERFA 5G31A 2CA8A 1T8EB 4MA9A 3D22A 5JWOB 1OE7A 1XIYA 3O6TA 4MDCA 5F8BA 4TR1B 3A2XA 4JU5A 2R5GA 5LCZA 4ZL9A 2KHPA 1F9MA 2M80A 2VM1A 2B1KA 4EE0A 3H93A 2MYGA 1MDIA 4MZBA 4NV2A 1XW5A 2LQQA 4RQXA 4BVYA 1BAYA 1PQNA 1XBSA 3CRTA 3HJPA 4IQ1A 1JLVA 3LSZA 1PKWA 5D93A 2C3QA 3QCPA 1QK8A 1SL2B 5H5RA 3IK9A 2V1MA 1XWKA 1JZDA 4IW9A 1EEMA 1M9BA 2PU9C 3D6IA 2F3MA 3UBLA 1YJ6A 2N5BA 4ZILA 4DSSA 2C0DA 2X8GA 1GTBA 4ECJA 4EF0A 3IOSA 3DGQA 4L5OA 4K0NA 5C00A 1Y25A 3KH9A 3C1SA 1YKAA 3PH9A 1Z6NA 2VUPA 4K7OA 2VCVA 3KMNA 1XZOA 2PGTA 1KNGA 1SU9A 4MK3A 1TK5B 3UVTA 5CRGA 3SWLA 3DVWA 3WGEA 3GNJA 3S9FA 3EURA 4TXOA 4RUVA 3W8JA 2VAFA 3TJFA 3APSA 2VLTA 3KH7A 4MZCA 1YF0A 1B8XA 3GURA 2HFDA 1AQXA 2KP1A 1EV4A 2B1LA 3I43A 3KMOA 2B3SA 2PVQA 2DJ2A 5KN1A 4EVMA 3WT2A 4ML1A 4IBPA 2HT9A 3A2VA 4NWYA 1R7HA 2ON7A 1AQWA 3WYWA 1WE0A 1TTZA 8GSSA 5KN0A 1K3LA 4POLA 5FT3A 1XFLA 1J0FA 1G0TA 4GSSA 2GSRA 1USBA 1EOHA 1NHYA 1T4YA 4DSSB 4GF0A 1G7OA 2H6YA 2L57A 2A4VA 2R2JA 3M8NA 2X8HA 2JZSA 1UVZA 4NHZA 1QXHA 5AISA 5CNWA 1SKRB 4TN8A 2LSTA 3KJYA 4HS1A 5CAXA 2OBIA 1SK2A 3IDVA 5AIXA 3VWUA 1MDJA 3KM6A 3EC3A 4TXOB 5IO0A 2H71A 4MPFA 2DJ1A 2EIRA 2V2GA 2JL4A 3Q6OA 4MH3A 4LA1A 2AUVA 4IN0A 5J4UA 4ZBDA 3APQA 4V2NA 3QDNA 2RIIA 1SL1B 1ACVA 5IOXA 3H79A 3HY2A 2C8UA 2H75A 3EVIA 4OO4A 4XHMA 3RBTA 4OFTA 5ABRA 4TVEA 3APOA 2B7KA 2YN1A 2H73A 4PURA 3CTFA 2YJHA 2L6DA 5CYYA 1O81A 3GFKA 3BCIA 5DCGA 2KP2A 2FD3A 3ME7A 1YKCA 4EC0A 1HNCA 3IK7A 3QR6A 3E9JB 4K6XA 1BEDA 5IO2A 1XW6A 1URMA 3QAWA 4GSTA 4WR4A 1I5GA 3P7XA 2WFCA 3C73A 4XCSA 3PR8A 1AQVA 1OC3A 2VM2A 4JRRA 4H86A 10GSA 2H30A 2YCDA 5FHIA 3GKXA 2HXKA 3WGDA 2GS3A 5IIZA 1K0DA 3DVXA 3RHCA 2WDUA 2NBSA 3UAPA 1ST9A 1DBYA 3VWWA 1OVNA 6GSVA 2BTOT 1SYXA 3J7Yk 3GYKA 2I4AA 3E0UA 2RM5A 3DWVA 2QSIA 3ZLPA 2H76A 1TI1A 4IVFA 3ED3A 3G7YA 4FIWA 5B6NA 3F9UA 3DKSA 1TRWA 3TJGA 3V1WA 4MF7A 4YH2A 1GSQA 3L9SA 3ZRDA 2E2GA 1GRXA 2PUKC 3F3QA 2GQMA 4KSMA 1LJRA 2VCTA 2DBCA 5IPHA 4KDYA 1B4QA 5H5QA 3VLNA 3TGZA 2H0GA 1FO5A 5CP1A 3GIXA 2L59A 3NOFA 5G5EA 3P90A 5ENUA 1ZGNA 4PQIA 2QGVA 1X9MB 5ECQB 4K7IA 3HXSA 2GSQA 3A3TA 2GSSA 4AJ8A 1GSSA 2XPDA 2LEGA 1K0AA 3M3MA 4BWQA 5HQPA 3F4SA 4GXZA 3TRPA 4KDUA 5H5SA 3HJMA 3CRUA 4GQCA 5F05A 3LJRA 3F0IA 2YPMA 3HD5A 3ISOA 2IPAA 1VGLA 4QL9A 5D9WA 5E4WA 1YF1A 2DC5A 5B8AA 2HZFA 1GP1A 3GKKA 3EINA 2X99A 1Z7RA 4KE3A 3GKMA 1YQ1A 1ERVA 2H6XA 5KN3A 3IBHA 3O3TA 1OE8A 5DDLA 3LORA 3GSSA 2HYXA 1A2LA 1WOUA 2N5AA 4KCEA 4MMMA 3O76A 2O89A 1CQGA
chains in the Genus database with same CATH superfamily
1F3AA 2P5RA 2VIMA 2JZTA 2OKAA 3ZFLA 4N10A 5CRHA 4NHWA 1HYUA 1VRSD 2YNXA 3GX8A 2H0HA 3KD0A 3LFLA 1TJDA 3MWHA 3LXTA 1TU7A 3F4RA 3GH6A 3HVVA 2VOCA 5DCHA 3IHGA 2FWGA 2QKEA 3VI7A 3C1RA 3TOTA 1TP9A 2X49A 4IP1A 2MZCA 3BJ5A 2PBJA 1PMTA 2CX3A 1ERWA 2A2RA 4MNNA 3MDKA 1GSFA 3SBCA 3TOUA 2GZZA 2C80A 4MF6A 1BG5A 1B9YC 3GRXA 1TK0B 1J9BA 2VL3A 4HJMA 3FZ4A 4I8BA 4E8HA 1FHEA 4MJEA 2HLSA 3GSTA 4OFNA 2KUCA 4HUAA 5AGYA 1R4WA 3VPTA 4XTSA 2DKHA 1YY7A 5ECIB 5D9XA 2H19A 1JZWA 5G30A 4MZWA 2FLSA 1K3OA 2L5LA 3G7JA 4G2EA 4TR0A 2K9FA 1O7UA 1DUGA 2B7JA 5ECOB 1O8WA 1XW9A 4WF4A 3LW9A 3ZIVA 4XIHA 4KAEA 3R2QA 2NTOA 5BMUA 2CQ9A 22GSA 2A2PA 2K18A 2MBSA 2C3TA 2WZ9A 1ZYEA 3ZVJA 4LLRA 2GSTA 2FCHA 4V1Ag 2DJJA 2GVPA 4G9HA 2DJKA 1PD21 3QAVA 4FQUA 2AHEA 3P8WA 1ABAA 1A0RP 3L78A 1KTEA 2LNTA 13GSA 3QPMA 5GSSA 1J08A 4ECIA 1K3YA 5G1KA 2BJXA 1JFUA 1XOBA 1T4ZA 2LRTA 2R37A 2FGXA 1TXXA 1Z9HA 1R26A 3MSZA 2H01A 1SD8A 1XWCA 1QUWA 4YKFA 4HJ2A 2F8AA 1A8LA 1Z7PA 1T7PB 3KCMA 4KUNA 2P0GA 4Z2UA 1HNBA 2VL2C 2LJRA 3NZNA 2EIOA 3IR4A 2PVOC 5JCGA 4V2LA 1KEBA 4I2TA 5KN2A 3PGTA 2XBIA 2FY6A 5DBQA 2ZNMA 1FG4A 1VF1A 3NIVA 2F51A 4ISDA 3F63A 3TCOA 3ZMKA 2DIZA 4IELA 2P5QA 4X4JA 2YOIA 4GLTA 4KX4A 1M2DA 1TU8A 5J5NA 4XS1A 1OAZA 4F0BA 1QMVA 2BMXA 2WJUA 3ZFBA 5IOWA 2OE3A 1BYEA 3FRCA 2HNLA 2I81A 1MD4A 1SJ6A 2CZ3A 1ZL9A 4F0CA 2I9HA 4XRDA 4NAXA 3CSJA 1MDKA 4FYUA 2DMLA 1A2MA 5B7CA 4IP6A 4OWYA 1BJXA 1GLQA 2E2MA 3IA1A 2MBTA 4MJBA 4ID0A 1I9DA 1R5PA 5F07A 4POMA 2ON5A 4LL4B 3Q74A 20GSA 3VWXA 2G0FA 1ZCPA 2OA7A 4MF5A 3QD9A 5INYA 4IJIA 3RPPA 2VCQA 1VF4A 1NM3A 1ZYQB 5ELAA 2CAIA 1M7TA 1M3IA 4HOJA 4WKWA 5EY6A 1SYRA 1W4VA 3IAM2 1V40A 2P31A 4NPBA 2OBKA 1X0RA 2R4VA 3TKRA 1NSWA 2H6ZA 4X1UA 2V6KA 4ZB6A 2IMDA 4EKZA 1UC7A 5LNKe 4QQ7A 9GSSA 1GNEA 4J2FA 4PNFA 1X9WB 5ECKB 2B5YA 5D8IA 2WCIA 1SJIA 1ERUA 1EV9A 1GL8A 2LKUA 4MCUA 2H1AA 2R6KA 3D4MA 3LYKA 1YEXA 3HVXA 1EGOA 2OJLA 3N5OA 4QL7A 1ZYPA 1O85A 1O8XA 4YQUA 4BVXA 1GLPA 1SJZA 3CMIA 3KGKA 1AIUA 4PXOA 2H0IA 1Q98A 5ECSA 4L8EA 3KTBA 4CDOA 1S3AA 2PMTA 3GN3A 3IRAA 5B8BA 1ZMAA 3GHAA 2RUFA 6GSXA 2K8SA 2Z9SA 2EC4A 2LJAA 3HJOA 1U3AA 2KLXA 1E6BA 2VLUA 2DJ3A 1GNWA 2YWIA 5IM9A 5HFIA 3DRNA 4K8MA 1FVKA 3QMXA 4USSA 2DKIA 4ZB8A 2IIYA 5IPGA 4GCIA 4KGIA 3F6FA 3DEXA 5EPFA 4YQMA 3GL5A 2PPTA 1N8JA 4PQHA 5CO3A 4HI7A 4V2MA 1YDKA 1RQMA 2IN3A 5L71A 4N30A 2AB6A 2X4AA 4KA0A 2LNSA 2IL3A 5HR3A 2ZUPA 4ICYA 1YEPA 1TK8B 2CVBA 4FYBA 4HU9A 3RHBA 3LYPA 5COHA 5DJLA 6GSYA 1S3DA 3GUSA 2PN8A 4BVXB 2H70A 3CSIA 4YQVA 1TKDB 2YZHA 4ACSA 4NXIA 2FWFA 2H1GA 3TKPA 1V9WA 2CVDA 19GSA 3W6GA 1RW1A 1GSEA 1AC1A 3OR5A 4L0UA 2R0GA 4ML6A 4O32A 4G0LA 1EGRA 2AV4A 1GUMA 2C1YA 4MH2A 2WULA 4XRAA 3TKSC 2PWJA 4XS6A 4KDXA 2O87A 1PN9A 4KSOA 2H1BA 5J3RA 5IMZA 4WBRD 2CT6A 1M99A 1TRSA 3M1GA 1WMJA 1DE2A 4O7HA 2GQKA 4AJ7A 4F82A 2VLVA 4EDYA 3BOAA 1K0CA 4MLYA 1JZOA 3JCML 3IC4A 3L9UA 1NW2A 1M9AA 1SD9A 2AJQB 4F9ZA 2MMNA 5HFGA 2LS5A 5JCUA 3ZZXA 1T3BA 2B5EA 1U87A 3G9BA 1PRXA 2CZ2A 2O8VB 1R5AA 11GSA 3HA9A 1FB6A 1K0BA 1GSYA 1PL2A 2AYTA 3TDGA 4HQSA 2J23A 3PPUA 4Q5RA 4FYCA 4PNGA 1WIKA 2YV9A 3HHVA 3WT1A 4MABA 4LL1B 1SKSB 5JCWA 4K1FA 1OYJA 4K9ZA 2H1DA 3GL3A 1K0OA 3KZQA 3ZIJA 4FH8A 2REMA 2H8LA 3M9KA 5D96A 1FW1A 3ZVJD 3KIJA 4DVCA 5ECHB 2RUEA 2FUG2 4EUYA 3TJBA 5IMAA 2C0GA 2FA8A 5ECRB 1LBKA 2D2ZA 4EL1A 3TKSE 2VL9A 4FO5A 3ERGA 3LEFA 3UOMA 1B9XC 1ML6A 1JLWA 4KH7A 4ZL7A 1AW9A 5BRTA 2QC7A 3FR3A 1FVJA 3CBUA 2OACA 1WP0A 4JR6A 1HQOA 2E0QA 2N5FA 4X0XA 2PERA 5ECMB 2C0FA 1EP7A 3HKRA 4P3YB 1C72A 4EIPA 3VK9A 4I97A 2JSZA 1CQHA 4Q5QA 2I1UA 3ME8A 2YV7A 2R0CA 4AF2A 1LU4A 1Z5YE 1UA5A 3GMFA 3I6AA 1EP8A 2NVLA 4WETA 1HD2A 3RPNA 1TRUA 4ILFA 3C7MA 1PX7A 5D9TA 5B6MA 1K0NA 3VFIA 4O5UA 3C8EA 2JU5A 2H72A 3J7Yb 1SENA 4F03A 3ZYWA 4AJ6A 3D0ZA 1QQ2A 2XHFA 4EDZA 2F9SA 3GTUA 5ID2A 3U6VA 4HEA2 4PGTA 3CTGA 3FY7A 4DEJA 1U88A 4NMUA 4PTSA 2OE1A 4BWSA 2V6OA 1PL1A 7GSSA 1XWAA 1DSBA 1V98A 3EU4A 5IMDA 3KTLA 3E3EA 1VF2A 2AAWA 4CW9A 4I5QA 4YAPA 3BBYA 4L5LA 2CVKA 2JZRA 4ZB9A 3DIEA 3VURA 4K5SA 5ECNB 1T1VA 1F2EA 2CV4A 3IE3A 2ZCTA 4GWRA 5ELGA 4ECBA 4GSNA 5E59A 4ZBAA 1VF3A 1IYHA 1B48A 1TW9A 2YWNA 3TRXA 1NHOA 4IKHA 2K6VA 4MPGA 1SK1A 2ES7A 1FOVA 1OC9A 5CREA 3MNGA 2FWEA 3U5RE 2FWHA 2HRFA 4O5QA 2G2QA 5DALA 3CXGA 1PA3A 3UVHA 5IMFA 3ERWA 3D21A 1ERTA 3G7IA 4RI6A 2XC2A 2HZEA 3H4KA 5J41A 3VWVA 3TB2A 4G19A 1BQ7A 5G2ZA 1S3CA 4OCEA 2TRCP 1A8YA 2JADA 3IC8A 3LQ7A 2C0EA 1B4PA 4ECCA 1YZXA 5A4VA 3GTUB 5ID2B 4OD7A 3DXBA 4JR4A 4IHUA 5ECLB 3ZTLA 3TJJA 2HRNA 4LMVA 3C71A 5F06A 3WGXA 2HSHA 1XVWA 2TRXA 1THXA 3A5WA 2YANA 2VCWA 4N11A 4IS0A 1W89A 4K0GA 2J9HA 1ILOA 4BA7A 1EEJA 1PSQA 4ZBBA 2OE0A 3FW2A 2IWTA 5G1LA 3L0HA 4OCFA 2L4CA 2KOKA 1GUKA 4JBBA 3D5JA 1XVQA 1M2BA 3VI5A 1JHBA 3M0FA 3TRQA 12GSA 3IV4A 2X8CA 1AUCA 1OC9B 5GZZB 2CX4A 3FYGA 5LD0A 1QGVA 5DALB 3K8NA 5KEJA 3FK8A 4E8EA 5IMVA 4EO3A 2HZEB 2RM6A 2GDRA 2YWOA 4N0ZA 4RI7A 2TIRA 4RQRA 2JSYA 3F8UA 3UIWA 2XBQA 1X5DA 5GAND 5A5KA 2HSYA 4WR5A 1F6MC 3HZ8A 3ZITA 5IMCA 2VCZA 1PGTA 3I9V2 3Q18A 4IQAA 3FR6A 4KB3A 1S3RA 5A4WA 5IQYA 1A2JA 5HR1A 4IJ3A 2DLXA 4O5RA 4TR4A 5DAKA 4KW6A 1PX6A 1G6YA 2IMKA 2R3XA 1V2AA 4POKA 2GT5A 6GSUA 2VL2A 4PX1A 1TI3A 2MMOA 4HZ2A 2WS2A 1MEKA 3UJ1A 1AXDA 5GSTA 2ALBA 3PINA 3LXZA 2K8VA 2YJ7A 3IHQA 2F8FA 4HU7A 4JZQA 1RK4A 3UEMA 2VD1A 4AGSA 4LMWA 5J9CA 2C4JA 1BX9A 2HI7A 2FHEA 1SL0B 5D9VA 3DYRA 1XCCA 1U6TA 4PUAA 5A4UA 2VD0A 1A24A 3QFBC 1H4OA 4TXVA 1GSDA 3FZ5A 1IYIA 3KEBA 4BPYA 4GQFA 1F3BA 4G0IA 2RLIA 3UARA 2DSAA 2X64A 4L0WA 4OFMA 2NDOA 3TJKA 1X5EA 1GTUA 3LGCA 1FAAA 1THOA 3EWLA 1XPVA 5HFKA 3VPQA 2V41A 3ZL5A 3AY8A 4TKYA 3GH9A 2IJYA 18GSA 4PQ1A 5C04A 2LRNA 3EE2A 4V1Ap 5DQSA 3DMLA 3IXRA 1TRVA 5JWQB 5D73A 5HR0A 3I69A 4OMVA 1AAZA 5AN1A 4PUFC 17GSA 1GTIA 3BD2A 5G5FA 1Y6EA 5DAKB 1DE1A 2JACA 5CRDA 4WEYA 2LUSA 1G7EA 5ECPB 1H75A 3TUEA 2IMEA 3F6DA 4XS4A 4DSRA 2MMAA 2YP6A 4DSQA 1UN2A 4WXTA 4ZL8A 3W8SA 4Q5NA 1MD3A 4YAVA 3CYNA 3QFAC 3R3EA 2GGTA 2A2SA 2LRCA 5HR2A 3FZAA 1FB0A 3EMPA 4D73A 1WJKA 3N9JA 2DJ0A 1Q4JA 1GSUA 2B6MA 3US3A 4JEDA 3FR9A 3LG6A 3A2WA 3GA4A 1M3JA 3F4TA 3WD6A 4MP4A 3RDWA 3UMAA 4HSCX 4MJAA 2DIYA 4HDEA 1ZYNA 5DQYA 5DVBA 1HNAA 2VCXA 4TRXA 1GUHA 1GH2A 2FA4A 3LWAA 1N2AA 2VO4A 1A23A 2GQLA 3FZ9A 5GAPD 4J56E 1XXUA 1Z6MA 2EIQA 1OC8A 4CHSA 3BCKA 1KBNA 1WWJA 4N0VA 3FEUA 3A5IA 2E7PA 4KCAA 4ZXGA 4G10A 5J9BA 2GT6A 1O73A 4ZIJA 1K0MA 2YWMA 4XS4B 3UL3A 4Z7XA 2O85A 2GLRA 2B5XA 1MTCA 2IFQA 2L6CA 2HRAA 2M72A 4Q5FA 4KNDA 1V58A 4D73B 6GSTA 5EVOA 2H74A 2IMIA 2WRTA 3HDCA 5DJMA 4EXJA 3H8QA 4O92A 3L9VA 4CY6A 2FNOA 3DD3A 4TOPA 3QOUA 2IMFA 5FWGA 4F2IA 1WRYA 3IPZA 4NV5A 2WGRA 3EPTA 1X9SB 1GULA 3Q19A 6GSWA 1T00A 2NPBA 3UBKA 1TDIA 3L4NA 1E2YA 1JZRA 3EYTA 4POBA 4IGJA 4JE1A 1ZZYA 3ZMLA 2V32A 3FKFA 1EWXA 1WPIA 2L4QA 4ULXA 5AIVA 4Z2TA 2H66A 1SKWB 3F3RA 1PKZA 1OKTA 1ZOFA 2GZYA 1U3IA 1QFNA 2O7KA 3ZREA 3QAGA 4K7NA 4K2DA 1TOFA 4X43A 2GZPA 1XWBA 3MIXA 3HYPA 4EIQA 14GSA 3EMXA 3KP8A 4I2UA 2LJKA 1SK0A 2LQOA 2CAQA 2MMZA 1ON4A 5CRWA 2LV3A 4BL7A 1XG8A 3TKSA 16GSA 3EU3A 1F37A 5EL8A 2IFQB 1Z3EA 3KXOA 3H1NA 1EOGA 2LTKA 4TR1A 3MYDA 3GX0A 1GWCA 3RAZA 1M0UA 3GV1A 1G6WA 1O6JA 2WB9A 4GTUA 4WF5A 3IAS2 4G0KA 4OO5A 4J57E 2GTUA 2XPEA 3HVSA 3MAKA 3CSHA 3HCZA 5JWRB 4I6XA 1XOAA 4MJCA 6GSSA 1EZKA 4GRFA 4WBJA 1V57A 2HRKA 1OKDA 3TKQA 3KP9A 3FHKA 2HSMA 1X5CA 3GKNA 2DMMA 1GTAA 3M9JA 2YZUA 3D4TA 3P2AA 4HQZA 4HZ4A 4Z2RA 1A0FA 1M2AA 2OADA 2L5OA 5F0GA 3HZ4A 2HE3A 2C3NA 1XWGA 4TR3A 2I3YA 2M46A 4TW5A 3ERFA 4BL7B 5G31A 2CA8A 1T8EB 4MA9A 3D22A 5JWOB 1OE7A 1XIYA 3O6TA 4MDCA 5F8BA 4TR1B 3A2XA 4JU5A 2R5GA 5LCZA 4ZL9A 2KHPA 1F9MA 2M80A 2VM1A 2B1KA 4EE0A 3H93A 2MYGA 1MDIA 4MZBA 4NV2A 1XW5A 2LQQA 4RQXA 4BVYA 1BAYA 1PQNA 1XBSA 3CRTA 3HJPA 4IQ1A 1JLVA 3LSZA 1PKWA 5D93A 2C3QA 3QCPA 1QK8A 1SL2B 5H5RA 3IK9A 3CQFA 2V1MA 1XWKA 1JZDA 4IW9A 1EEMA 1M9BA 2PU9C 3D6IA 2F3MA 3UBLA 1YJ6A 2N5BA 4ZILA 4DSSA 2C0DA 2X8GA 1GTBA 4ECJA 4EF0A 3IOSA 3DGQA 4L5OA 4K0NA 5C00A 1Y25A 3KH9A 3C1SA 1YKAA 3PH9A 1Z6NA 2VUPA 4K7OA 2VCVA 3KMNA 1XZOA 2PGTA 1KNGA 1SU9A 4MK3A 1TK5B 3UVTA 5CRGA 3SWLA 3DVWA 3WGEA 3GNJA 4CY8A 3S9FA 3EURA 4TXOA 4RUVA 3W8JA 2VAFA 3TJFA 3APSA 2VLTA 3KH7A 4MZCA 1YF0A 1B8XA 3GURA 2HFDA 4BVYB 1AQXA 2KP1A 1EV4A 2B1LA 3I43A 3KMOA 2B3SA 2PVQA 4A5PA 2DJ2A 5KN1A 4EVMA 3WT2A 4ML1A 4IBPA 2HT9A 3A2VA 4NWYA 1R7HA 2ON7A 1AQWA 3WYWA 1WE0A 1TTZA 2UZ8A 8GSSA 5KN0A 1K3LA 4POLA 5FT3A 1XFLA 1J0FA 1G0TA 4GSSA 4K2XA 2GSRA 1USBA 1EOHA 4K5RA 1NHYA 1T4YA 4DSSB 4GF0A 1G7OA 2H6YA 2L57A 2A4VA 2R2JA 3M8NA 2X8HA 2JZSA 1UVZA 4NHZA 1QXHA 5AISA 5CNWA 1SKRB 4TN8A 2LSTA 3KJYA 4HS1A 5CAXA 2OBIA 1SK2A 3IDVA 5AIXA 3VWUA 1MDJA 3KM6A 3EC3A 4TXOB 5IO0A 2H71A 4MPFA 2DJ1A 2EIRA 2V2GA 2JL4A 3Q6OA 4MH3A 4LA1A 2AUVA 4IN0A 5J4UA 4ZBDA 3APQA 4V2NA 3QDNA 2RIIA 1SL1B 1ACVA 5IOXA 3H79A 3HY2A 2C8UA 2H75A 3EVIA 4OO4A 4XHMA 3RBTA 4OFTA 5ABRA 4TVEA 5KOWA 3APOA 2B7KA 2YN1A 2H73A 4PURA 3CTFA 2YJHA 2L6DA 5CYYA 1O81A 3GFKA 3BCIA 5DCGA 2KP2A 2FD3A 3ME7A 1YKCA 4EC0A 1HNCA 3IK7A 3QR6A 3E9JB 1PN0A 4K6XA 1BEDA 5IO2A 1XW6A 1URMA 3QAWA 4GSTA 4WR4A 1I5GA 3P7XA 2WFCA 3C73A 4XCSA 3PR8A 1AQVA 1OC3A 2VM2A 4JRRA 4H86A 10GSA 2H30A 2YCDA 5FHIA 3GKXA 2HXKA 3WGDA 1FOHA 2GS3A 4KF9A 2A4HA 5IIZA 1K0DA 3DVXA 3RHCA 2WDUA 2NBSA 3UAPA 1ST9A 4YKGA 1DBYA 3VWWA 1OVNA 6GSVA 2BTOT 1SYXA 3J7Yk 3GYKA 3FMWA 2I4AA 3E0UA 2RM5A 3DWVA 2QSIA 3ZLPA 2H76A 1TI1A 4IVFA 3ED3A 1PFOA 3G7YA 4FIWA 2R0PA 5B6NA 3F9UA 3DKSA 1TRWA 3TJGA 3V1WA 4MF7A 4YH2A 1GSQA 3L9SA 3ZRDA 2E2GA 1GRXA 2PUKC 4BIKA 3F3QA 2GQMA 4KSMA 1LJRA 2VCTA 2DBCA 5IPHA 4KDYA 1B4QA 5H5QA 3VLNA 3TGZA 2H0GA 1FO5A 5CP1A 3GIXA 2L59A 3NOFA 5G5EA 3P90A 5ENUA 1ZGNA 4PQIA 2QGVA 1X9MB 5ECQB 4K7IA 3HXSA 2GSQA 3A3TA 2GSSA 4AJ8A 1GSSA 2XPDA 2LEGA 1K0AA 3M3MA 4BWQA 5HQPA 3F4SA 4GXZA 3TRPA 4KDUA 5H5SA 3HJMA 3CRUA 4GQCA 5F05A 2QA2A 3LJRA 2QA1A 5KOXA 3F0IA 2YPMA 3HD5A 3ISOA 2IPAA 1VGLA 4QL9A 5D9WA 5E4WA 1YF1A 2DC5A 5B8AA 2HZFA 1GP1A 3GKKA 3EINA 2X99A 1Z7RA 4KE3A 3GKMA 1YQ1A 1ERVA 2H6XA 5KN3A 3IBHA 3O3TA 3HVNA 1OE8A 5DDLA 3LORA 3GSSA 2HYXA 1A2LA 1WOUA 2N5AA 4KCEA 4MMMA 3O76A 2O89A 1CQGA
chains in the Genus database with same CATH topology
1F3AA 2P5RA 2VIMA 2JZTA 2OKAA 3ZFLA 4N10A 5CRHA 4NHWA 1HYUA 1VRSD 2YNXA 3GX8A 2H0HA 3KD0A 3LFLA 1TJDA 3MWHA 3LXTA 1TU7A 3F4RA 3GH6A 3HVVA 2VOCA 5DCHA 3IHGA 2FWGA 2QKEA 3VI7A 3C1RA 3TOTA 1TP9A 2X49A 4IP1A 2MZCA 3BJ5A 2PBJA 1PMTA 2CX3A 1ERWA 2A2RA 4MNNA 3MDKA 1GSFA 3SBCA 3TOUA 2GZZA 2C80A 4MF6A 1BG5A 1B9YC 3GRXA 1TK0B 1J9BA 2VL3A 4HJMA 3FZ4A 4I8BA 4E8HA 1FHEA 4MJEA 2HLSA 3GSTA 4OFNA 2KUCA 4HUAA 5AGYA 1R4WA 3VPTA 4XTSA 2DKHA 1YY7A 5ECIB 5D9XA 2H19A 1JZWA 5G30A 4MZWA 2FLSA 1K3OA 2L5LA 3G7JA 4G2EA 4TR0A 2K9FA 1O7UA 1DUGA 2B7JA 5ECOB 1O8WA 1XW9A 4WF4A 3LW9A 3ZIVA 4XIHA 4KAEA 3R2QA 2NTOA 5BMUA 2CQ9A 22GSA 2A2PA 2K18A 2MBSA 2C3TA 2WZ9A 1ZYEA 3ZVJA 4LLRA 2GSTA 2FCHA 4V1Ag 2DJJA 2GVPA 4G9HA 2DJKA 1PD21 3QAVA 4FQUA 2AHEA 3P8WA 1ABAA 1A0RP 3L78A 1KTEA 2LNTA 13GSA 3QPMA 5GSSA 1J08A 4ECIA 1K3YA 5G1KA 2BJXA 1JFUA 1XOBA 1T4ZA 2LRTA 2R37A 2FGXA 1TXXA 1Z9HA 1R26A 3MSZA 2H01A 1SD8A 1XWCA 1QUWA 4YKFA 4HJ2A 2F8AA 1A8LA 1Z7PA 1T7PB 3KCMA 4KUNA 2P0GA 4Z2UA 1HNBA 2VL2C 2LJRA 3NZNA 2EIOA 3IR4A 2PVOC 5JCGA 4V2LA 1KEBA 4I2TA 5KN2A 3PGTA 2XBIA 2FY6A 5DBQA 2ZNMA 1FG4A 1VF1A 3NIVA 2F51A 4ISDA 3F63A 3TCOA 3ZMKA 2DIZA 4IELA 2P5QA 4X4JA 2YOIA 4GLTA 4KX4A 1M2DA 1TU8A 5J5NA 4XS1A 1OAZA 4F0BA 1QMVA 2BMXA 2WJUA 3ZFBA 5IOWA 2OE3A 1BYEA 3FRCA 2HNLA 2I81A 1MD4A 1SJ6A 2CZ3A 1ZL9A 4F0CA 2I9HA 4XRDA 4NAXA 3CSJA 1MDKA 4FYUA 2DMLA 1A2MA 5B7CA 4IP6A 4OWYA 1BJXA 1GLQA 2E2MA 3IA1A 2MBTA 4MJBA 4ID0A 1I9DA 1R5PA 5F07A 4POMA 2ON5A 4LL4B 3Q74A 20GSA 3VWXA 2G0FA 1ZCPA 2OA7A 4MF5A 3QD9A 5INYA 4IJIA 3RPPA 2VCQA 1VF4A 1NM3A 1ZYQB 5ELAA 2CAIA 1M7TA 4HOJA 4WKWA 5EY6A 1SYRA 1W4VA 3IAM2 1V40A 2P31A 4NPBA 2OBKA 1X0RA 2R4VA 3TKRA 1NSWA 2H6ZA 4X1UA 2V6KA 4ZB6A 2IMDA 4EKZA 1UC7A 5LNKe 4QQ7A 9GSSA 1GNEA 4J2FA 4PNFA 1X9WB 5ECKB 2B5YA 5D8IA 2WCIA 1SJIA 1ERUA 1EV9A 1GL8A 2LKUA 4MCUA 2H1AA 2R6KA 3D4MA 3LYKA 1YEXA 3HVXA 1EGOA 2OJLA 3N5OA 4QL7A 1ZYPA 1O85A 1O8XA 4YQUA 4BVXA 1GLPA 1SJZA 3CMIA 3KGKA 1AIUA 4PXOA 2H0IA 1Q98A 5ECSA 4L8EA 3KTBA 4CDOA 1S3AA 2PMTA 3GN3A 3IRAA 5B8BA 1ZMAA 3GHAA 2RUFA 6GSXA 2K8SA 2Z9SA 2EC4A 2LJAA 3HJOA 1U3AA 2KLXA 1E6BA 2VLUA 2DJ3A 1GNWA 2YWIA 5IM9A 5HFIA 3DRNA 4K8MA 1FVKA 3QMXA 4USSA 2DKIA 4ZB8A 2IIYA 5IPGA 4GCIA 4KGIA 3F6FA 3DEXA 5EPFA 4YQMA 3GL5A 2PPTA 1N8JA 4PQHA 5CO3A 4HI7A 4V2MA 1YDKA 1RQMA 2IN3A 5L71A 4N30A 2AB6A 2X4AA 4KA0A 2LNSA 2IL3A 5HR3A 2ZUPA 4ICYA 1YEPA 1TK8B 2CVBA 4FYBA 4HU9A 3RHBA 3LYPA 5COHA 5DJLA 6GSYA 1S3DA 3GUSA 2PN8A 4BVXB 2H70A 3CSIA 4YQVA 1TKDB 2YZHA 4ACSA 4NXIA 2FWFA 2H1GA 3TKPA 1V9WA 2CVDA 19GSA 3W6GA 1RW1A 1GSEA 1AC1A 3OR5A 4L0UA 2R0GA 4ML6A 4O32A 4G0LA 1EGRA 2AV4A 1GUMA 2C1YA 4MH2A 2WULA 4XRAA 3TKSC 2PWJA 4XS6A 4KDXA 2O87A 1PN9A 4KSOA 2H1BA 5J3RA 5IMZA 4WBRD 2CT6A 1M99A 1TRSA 3M1GA 1WMJA 1DE2A 4O7HA 2GQKA 4AJ7A 4F82A 2VLVA 4EDYA 3BOAA 1K0CA 4MLYA 1JZOA 3JCML 3IC4A 3L9UA 1NW2A 1M9AA 1SD9A 2AJQB 4F9ZA 2MMNA 5HFGA 2LS5A 5JCUA 3ZZXA 1T3BA 2B5EA 1U87A 3G9BA 1PRXA 2CZ2A 2O8VB 1R5AA 11GSA 3HA9A 1FB6A 1K0BA 1GSYA 1PL2A 2AYTA 3TDGA 4HQSA 2J23A 3PPUA 4Q5RA 4FYCA 4PNGA 1WIKA 2YV9A 3HHVA 3WT1A 4MABA 4LL1B 1SKSB 5JCWA 4K1FA 1OYJA 4K9ZA 2H1DA 3GL3A 1K0OA 3KZQA 3ZIJA 4FH8A 2REMA 2H8LA 3M9KA 5D96A 1FW1A 3ZVJD 3KIJA 4DVCA 5ECHB 2RUEA 2FUG2 4EUYA 3TJBA 5IMAA 2C0GA 2FA8A 5ECRB 1LBKA 2D2ZA 4EL1A 3TKSE 2VL9A 4FO5A 3ERGA 3LEFA 3UOMA 1B9XC 1ML6A 1JLWA 4KH7A 4ZL7A 1AW9A 5BRTA 2QC7A 3FR3A 1FVJA 3CBUA 2OACA 1WP0A 4JR6A 1HQOA 2E0QA 2N5FA 4X0XA 2PERA 5ECMB 2C0FA 1EP7A 3HKRA 4P3YB 1C72A 4EIPA 3VK9A 4I97A 2JSZA 1CQHA 4Q5QA 2I1UA 3ME8A 2YV7A 2R0CA 4AF2A 1LU4A 1Z5YE 1UA5A 3GMFA 3I6AA 1EP8A 2NVLA 4WETA 1HD2A 3RPNA 1TRUA 4ILFA 3C7MA 1PX7A 5D9TA 5B6MA 1K0NA 3VFIA 4O5UA 3C8EA 2JU5A 2H72A 3J7Yb 1SENA 4F03A 3ZYWA 4AJ6A 3D0ZA 1QQ2A 2XHFA 4EDZA 2F9SA 3GTUA 5ID2A 3U6VA 4HEA2 4PGTA 3CTGA 3FY7A 4DEJA 1U88A 4NMUA 4PTSA 2OE1A 4BWSA 2V6OA 1PL1A 7GSSA 1XWAA 1DSBA 1V98A 3EU4A 5IMDA 3KTLA 3E3EA 1VF2A 2AAWA 4CW9A 4I5QA 4YAPA 3BBYA 4L5LA 2CVKA 2JZRA 4ZB9A 3DIEA 3VURA 4K5SA 5ECNB 1T1VA 1F2EA 2CV4A 3IE3A 2ZCTA 4GWRA 5ELGA 4ECBA 4GSNA 5E59A 4ZBAA 1VF3A 1IYHA 1B48A 1TW9A 2YWNA 3TRXA 1NHOA 4IKHA 2K6VA 4MPGA 1SK1A 2ES7A 1FOVA 1OC9A 5CREA 3MNGA 2FWEA 3U5RE 2FWHA 2HRFA 4O5QA 2G2QA 5DALA 3CXGA 1PA3A 3UVHA 5IMFA 3ERWA 3D21A 1ERTA 3G7IA 4RI6A 2XC2A 2HZEA 3H4KA 5J41A 3VWVA 3TB2A 4G19A 1BQ7A 5G2ZA 1S3CA 4OCEA 2TRCP 1A8YA 2JADA 3IC8A 3LQ7A 2C0EA 1B4PA 4ECCA 1YZXA 5A4VA 3GTUB 5ID2B 4OD7A 3DXBA 4JR4A 4IHUA 5ECLB 3ZTLA 3TJJA 2HRNA 4LMVA 3C71A 5F06A 3WGXA 2HSHA 1XVWA 2TRXA 1THXA 3A5WA 2YANA 2VCWA 4N11A 4IS0A 1W89A 4K0GA 2J9HA 1ILOA 4BA7A 1EEJA 1PSQA 4ZBBA 2OE0A 3FW2A 2IWTA 5G1LA 3L0HA 4OCFA 2L4CA 2KOKA 1GUKA 4JBBA 3D5JA 1XVQA 1M2BA 3VI5A 1JHBA 3M0FA 3TRQA 12GSA 3IV4A 2X8CA 1AUCA 1OC9B 5GZZB 2CX4A 3FYGA 5LD0A 1QGVA 5DALB 3K8NA 5KEJA 3FK8A 4E8EA 5IMVA 4EO3A 2HZEB 2RM6A 2GDRA 2YWOA 4N0ZA 4RI7A 2TIRA 4RQRA 2JSYA 3F8UA 3UIWA 2XBQA 1X5DA 5GAND 5A5KA 2HSYA 4WR5A 1F6MC 3HZ8A 3ZITA 5IMCA 2VCZA 1PGTA 3I9V2 3Q18A 4IQAA 3FR6A 4KB3A 5A4WA 5IQYA 1A2JA 5HR1A 4IJ3A 2DLXA 4O5RA 4TR4A 5DAKA 4KW6A 1PX6A 1G6YA 2IMKA 2R3XA 1V2AA 4POKA 2GT5A 6GSUA 2VL2A 4PX1A 1TI3A 2MMOA 4HZ2A 2WS2A 1MEKA 3UJ1A 1AXDA 5GSTA 2ALBA 3PINA 3LXZA 2K8VA 2YJ7A 3IHQA 2F8FA 4HU7A 4JZQA 1RK4A 3UEMA 2VD1A 4AGSA 4LMWA 5J9CA 2C4JA 1BX9A 2HI7A 2FHEA 1SL0B 5D9VA 3DYRA 1XCCA 1U6TA 4PUAA 5A4UA 2VD0A 1A24A 3QFBC 1H4OA 4TXVA 1GSDA 3FZ5A 1IYIA 3KEBA 4BPYA 4GQFA 1F3BA 4G0IA 2RLIA 3UARA 2DSAA 2X64A 4L0WA 4OFMA 2NDOA 3TJKA 1X5EA 1GTUA 3LGCA 1FAAA 1THOA 3EWLA 1XPVA 5HFKA 3VPQA 2V41A 3ZL5A 3AY8A 4TKYA 3GH9A 2IJYA 18GSA 4PQ1A 5C04A 2LRNA 3EE2A 4V1Ap 5DQSA 3DMLA 3IXRA 1TRVA 5JWQB 5D73A 5HR0A 3I69A 4OMVA 1AAZA 5AN1A 4PUFC 17GSA 1GTIA 3BD2A 5G5FA 1Y6EA 5DAKB 1DE1A 2JACA 5CRDA 4WEYA 2LUSA 1G7EA 5ECPB 1H75A 3TUEA 2IMEA 3F6DA 4XS4A 4DSRA 2MMAA 2YP6A 4DSQA 1UN2A 4WXTA 4ZL8A 3W8SA 4Q5NA 1MD3A 4YAVA 3CYNA 3QFAC 3R3EA 2GGTA 2A2SA 2LRCA 5HR2A 3FZAA 1FB0A 3EMPA 4D73A 1WJKA 3N9JA 2DJ0A 1Q4JA 1GSUA 2B6MA 3US3A 4JEDA 3FR9A 3LG6A 3A2WA 3GA4A 3F4TA 3WD6A 4MP4A 3RDWA 3UMAA 4MJAA 2DIYA 4HDEA 1ZYNA 5DQYA 5DVBA 1HNAA 2VCXA 4TRXA 1GUHA 1GH2A 2FA4A 3LWAA 1N2AA 2VO4A 1A23A 2GQLA 3FZ9A 5GAPD 4J56E 1XXUA 1Z6MA 2EIQA 1OC8A 4CHSA 3BCKA 1KBNA 1WWJA 4N0VA 3FEUA 3A5IA 2E7PA 4KCAA 4ZXGA 4G10A 5J9BA 2GT6A 1O73A 4ZIJA 1K0MA 2YWMA 4XS4B 3UL3A 4Z7XA 2O85A 2GLRA 2B5XA 1MTCA 2IFQA 2L6CA 2HRAA 2M72A 4Q5FA 4KNDA 1V58A 4D73B 6GSTA 5EVOA 2H74A 2IMIA 2WRTA 3HDCA 5DJMA 4EXJA 3H8QA 4O92A 3L9VA 4CY6A 2FNOA 3DD3A 4TOPA 3QOUA 2IMFA 5FWGA 4F2IA 1WRYA 3IPZA 4NV5A 2WGRA 3EPTA 1X9SB 1GULA 3Q19A 6GSWA 1T00A 2NPBA 3UBKA 1TDIA 3L4NA 1E2YA 1JZRA 3EYTA 4POBA 4IGJA 4JE1A 1ZZYA 3ZMLA 2V32A 3FKFA 1EWXA 1WPIA 2L4QA 4ULXA 5AIVA 4Z2TA 2H66A 1SKWB 3F3RA 1PKZA 1OKTA 1ZOFA 2GZYA 1U3IA 1QFNA 2O7KA 3ZREA 3QAGA 4K7NA 4K2DA 1TOFA 4X43A 2GZPA 1XWBA 3MIXA 3HYPA 4EIQA 14GSA 3EMXA 3KP8A 4I2UA 2LJKA 1SK0A 2LQOA 2CAQA 2MMZA 1ON4A 5CRWA 2LV3A 4BL7A 3TKSA 16GSA 3EU3A 1F37A 5EL8A 2IFQB 1Z3EA 3KXOA 3H1NA 1EOGA 2LTKA 4TR1A 3MYDA 3GX0A 1GWCA 3RAZA 1M0UA 3GV1A 1G6WA 1O6JA 2WB9A 4GTUA 4WF5A 3IAS2 4G0KA 4OO5A 4J57E 2GTUA 2XPEA 3HVSA 3MAKA 3CSHA 3HCZA 5JWRB 4I6XA 1XOAA 4MJCA 6GSSA 1EZKA 4GRFA 4WBJA 1V57A 2HRKA 1OKDA 3TKQA 3KP9A 3FHKA 2HSMA 1X5CA 3GKNA 2DMMA 1GTAA 3M9JA 2YZUA 3D4TA 3P2AA 4HQZA 4HZ4A 4Z2RA 1A0FA 1M2AA 2OADA 2L5OA 5F0GA 3HZ4A 2HE3A 2C3NA 1XWGA 4TR3A 2I3YA 2M46A 4TW5A 3ERFA 4BL7B 5G31A 2CA8A 1T8EB 4MA9A 3D22A 5JWOB 1OE7A 1XIYA 3O6TA 4MDCA 5F8BA 4TR1B 3A2XA 4JU5A 2R5GA 5LCZA 4ZL9A 2KHPA 1F9MA 2M80A 2VM1A 2B1KA 4EE0A 3H93A 2MYGA 1MDIA 4MZBA 4NV2A 1XW5A 2LQQA 4RQXA 4BVYA 1BAYA 1PQNA 1XBSA 3CRTA 3HJPA 4IQ1A 1JLVA 3LSZA 1PKWA 5D93A 2C3QA 3QCPA 1QK8A 1SL2B 5H5RA 3IK9A 2V1MA 1XWKA 1JZDA 4IW9A 1EEMA 1M9BA 2PU9C 3D6IA 2F3MA 3UBLA 1YJ6A 2N5BA 4ZILA 4DSSA 2C0DA 2X8GA 1GTBA 4ECJA 4EF0A 3IOSA 3DGQA 4L5OA 4K0NA 5C00A 1Y25A 3KH9A 3C1SA 1YKAA 3PH9A 1Z6NA 2VUPA 4K7OA 2VCVA 3KMNA 1XZOA 2PGTA 1KNGA 1SU9A 4MK3A 1TK5B 3UVTA 5CRGA 3SWLA 3DVWA 3WGEA 3GNJA 4CY8A 3S9FA 3EURA 4TXOA 4RUVA 3W8JA 2VAFA 3TJFA 3APSA 2VLTA 3KH7A 4MZCA 1YF0A 1B8XA 3GURA 2HFDA 4BVYB 1AQXA 2KP1A 1EV4A 2B1LA 3I43A 3KMOA 2B3SA 2PVQA 4A5PA 2DJ2A 5KN1A 4EVMA 3WT2A 4ML1A 4IBPA 2HT9A 3A2VA 4NWYA 1R7HA 2ON7A 1AQWA 3WYWA 1WE0A 1TTZA 2UZ8A 8GSSA 5KN0A 1K3LA 4POLA 5FT3A 1XFLA 1J0FA 1G0TA 4GSSA 4K2XA 2GSRA 1USBA 1EOHA 4K5RA 1NHYA 1T4YA 4DSSB 4GF0A 1G7OA 2H6YA 2L57A 2A4VA 2R2JA 3M8NA 2X8HA 2JZSA 1UVZA 4NHZA 1QXHA 5AISA 5CNWA 1SKRB 4TN8A 2LSTA 3KJYA 4HS1A 5CAXA 2OBIA 1SK2A 3IDVA 5AIXA 3VWUA 1MDJA 3KM6A 3EC3A 4TXOB 5IO0A 2H71A 4MPFA 2DJ1A 2EIRA 2V2GA 2JL4A 3Q6OA 4MH3A 4LA1A 2AUVA 4IN0A 5J4UA 4ZBDA 3APQA 4V2NA 3QDNA 2RIIA 1SL1B 1ACVA 5IOXA 3H79A 3HY2A 2C8UA 2H75A 3EVIA 4OO4A 4XHMA 3RBTA 4OFTA 5ABRA 4TVEA 5KOWA 3APOA 2B7KA 2YN1A 2H73A 4PURA 3CTFA 2YJHA 2L6DA 5CYYA 1O81A 3GFKA 3BCIA 5DCGA 2KP2A 2FD3A 3ME7A 1YKCA 4EC0A 1HNCA 3IK7A 3QR6A 3E9JB 1PN0A 4K6XA 1BEDA 5IO2A 1XW6A 1URMA 3QAWA 4GSTA 4WR4A 1I5GA 3P7XA 2WFCA 3C73A 4XCSA 3PR8A 1AQVA 1OC3A 2VM2A 4JRRA 4H86A 10GSA 2H30A 2YCDA 5FHIA 3GKXA 2HXKA 3WGDA 1FOHA 2GS3A 4KF9A 2A4HA 5IIZA 1K0DA 3DVXA 3RHCA 2WDUA 2NBSA 3UAPA 1ST9A 4YKGA 1DBYA 3VWWA 1OVNA 6GSVA 2BTOT 1SYXA 3J7Yk 3GYKA 3FMWA 2I4AA 3E0UA 2RM5A 3DWVA 2QSIA 3ZLPA 2H76A 1TI1A 4IVFA 3ED3A 3G7YA 4FIWA 2R0PA 5B6NA 3F9UA 3DKSA 1TRWA 3TJGA 3V1WA 4MF7A 4YH2A 1GSQA 3L9SA 3ZRDA 2E2GA 1GRXA 2PUKC 3F3QA 2GQMA 4KSMA 1LJRA 2VCTA 2DBCA 5IPHA 4KDYA 1B4QA 5H5QA 3VLNA 3TGZA 2H0GA 1FO5A 5CP1A 3GIXA 2L59A 3NOFA 5G5EA 3P90A 5ENUA 1ZGNA 4PQIA 2QGVA 1X9MB 5ECQB 4K7IA 3HXSA 2GSQA 3A3TA 2GSSA 4AJ8A 1GSSA 2XPDA 2LEGA 1K0AA 3M3MA 4BWQA 5HQPA 3F4SA 4GXZA 3TRPA 4KDUA 5H5SA 3HJMA 3CRUA 4GQCA 5F05A 2QA2A 3LJRA 2QA1A 5KOXA 3F0IA 2YPMA 3HD5A 3ISOA 2IPAA 1VGLA 4QL9A 5D9WA 5E4WA 1YF1A 2DC5A 5B8AA 2HZFA 1GP1A 3GKKA 3EINA 2X99A 1Z7RA 4KE3A 3GKMA 1YQ1A 1ERVA 2H6XA 5KN3A 3IBHA 3O3TA 1OE8A 5DDLA 3LORA 3GSSA 2HYXA 1A2LA 1WOUA 2N5AA 4KCEA 4MMMA 3O76A 2O89A 1CQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F3A A;  2P5R A;  2VIM A;  2JZT A;  2OKA A;  3ZFL A;  4N10 A;  5CRH A;  4NHW A;  1HYU A;  1VRS D;  2YNX A;  3GX8 A;  2H0H A;  3KD0 A;  3LFL A;  1TJD A;  3MWH A;  3LXT A;  1TU7 A;  3F4R A;  3GH6 A;  3HVV A;  2VOC A;  5DCH A;  2FWG A;  2QKE A;  3VI7 A;  3C1R A;  3TOT A;  1TP9 A;  4IP1 A;  2MZC A;  3BJ5 A;  2PBJ A;  1PMT A;  2CX3 A;  1ERW A;  2A2R A;  3MDK A;  1GSF A;  3SBC A;  3TOU A;  2GZZ A;  2C80 A;  4MF6 A;  1BG5 A;  1B9Y C;  3GRX A;  1TK0 B;  1J9B A;  2VL3 A;  4HJM A;  3FZ4 A;  4I8B A;  4E8H A;  1FHE A;  4MJE A;  2HLS A;  3GST A;  4OFN A;  2KUC A;  4HUA A;  5AGY A;  1R4W A;  3VPT A;  4XTS A;  1YY7 A;  5ECI B;  5D9X A;  2H19 A;  1JZW A;  5G30 A;  4MZW A;  2FLS A;  1K3O A;  2L5L A;  3G7J A;  4G2E A;  4TR0 A;  2K9F A;  1O7U A;  1DUG A;  2B7J A;  5ECO B;  1O8W A;  1XW9 A;  4WF4 A;  3ZIV A;  4XIH A;  4KAE A;  3R2Q A;  2NTO A;  2CQ9 A;  22GS A;  2K18 A;  2MBS A;  2C3T A;  2WZ9 A;  1ZYE A;  3ZVJ A;  4LLR A;  2GST A;  2FCH A;  4V1A g;  2DJJ A;  2GVP A;  4G9H A;  2DJK A;  1PD2 1;  3QAV A;  2AHE A;  3P8W A;  1ABA A;  1A0R P;  3L78 A;  1KTE A;  2LNT A;  13GS A;  3QPM A;  5GSS A;  1J08 A;  4ECI A;  1K3Y A;  5G1K A;  2BJX A;  1JFU A;  1XOB A;  1T4Z A;  2LRT A;  2R37 A;  2FGX A;  1TXX A;  1Z9H A;  1R26 A;  3MSZ A;  2H01 A;  1SD8 A;  1XWC A;  1QUW A;  4HJ2 A;  2F8A A;  1A8L A;  1Z7P A;  1T7P B;  3KCM A;  4KUN A;  2P0G A;  1HNB A;  2VL2 C;  2LJR A;  3NZN A;  2EIO A;  3IR4 A;  2PVO C;  5JCG A;  4V2L A;  1KEB A;  4I2T A;  5KN2 A;  3PGT A;  2XBI A;  2FY6 A;  5DBQ A;  2ZNM A;  1FG4 A;  1VF1 A;  3NIV A;  2F51 A;  4ISD A;  3F63 A;  3TCO A;  3ZMK A;  2DIZ A;  4IEL A;  2P5Q A;  2YOI A;  4GLT A;  4KX4 A;  1M2D A;  1TU8 A;  5J5N A;  4XS1 A;  1OAZ A;  4F0B A;  1QMV A;  2BMX A;  2WJU A;  3ZFB A;  5IOW A;  2OE3 A;  1BYE A;  3FRC A;  2HNL A;  2I81 A;  1MD4 A;  1SJ6 A;  2CZ3 A;  1ZL9 A;  4F0C A;  2I9H A;  4XRD A;  4NAX A;  3CSJ A;  1MDK A;  4FYU A;  2DML A;  1A2M A;  5B7C A;  4IP6 A;  4OWY A;  1BJX A;  1GLQ A;  2E2M A;  3IA1 A;  2MBT A;  4MJB A;  4ID0 A;  1I9D A;  1R5P A;  5F07 A;  4POM A;  2ON5 A;  4LL4 B;  3Q74 A;  20GS A;  3VWX A;  2G0F A;  1ZCP A;  2OA7 A;  4MF5 A;  3QD9 A;  5INY A;  4IJI A;  3RPP A;  2VCQ A;  1VF4 A;  1NM3 A;  1ZYQ B;  5ELA A;  2CAI A;  1M7T A;  4HOJ A;  4WKW A;  5EY6 A;  1SYR A;  1W4V A;  3IAM 2;  1V40 A;  2P31 A;  4NPB A;  2OBK A;  1X0R A;  2R4V A;  3TKR A;  1NSW A;  2H6Z A;  4X1U A;  2V6K A;  4ZB6 A;  2IMD A;  4EKZ A;  1UC7 A;  5LNK e;  4QQ7 A;  9GSS A;  1GNE A;  4J2F A;  4PNF A;  1X9W B;  5ECK B;  2B5Y A;  5D8I A;  2WCI A;  1SJI A;  1ERU A;  1EV9 A;  1GL8 A;  2LKU A;  4MCU A;  2H1A A;  2R6K A;  3D4M A;  3LYK A;  1YEX A;  3HVX A;  1EGO A;  2OJL A;  3N5O A;  4QL7 A;  1O85 A;  1O8X A;  4YQU A;  4BVX A;  1GLP A;  1SJZ A;  3CMI A;  3KGK A;  1AIU A;  4PXO A;  2H0I A;  1Q98 A;  5ECS A;  4L8E A;  3KTB A;  4CDO A;  1S3A A;  2PMT A;  3GN3 A;  3IRA A;  5B8B A;  1ZMA A;  3GHA A;  2RUF A;  6GSX A;  2K8S A;  2Z9S A;  2EC4 A;  2LJA A;  3HJO A;  1U3A A;  2KLX A;  1E6B A;  2VLU A;  2DJ3 A;  1GNW A;  2YWI A;  5IM9 A;  5HFI A;  3DRN A;  4K8M A;  1FVK A;  3QMX A;  4ZB8 A;  2IIY A;  5IPG A;  4GCI A;  4KGI A;  3F6F A;  3DEX A;  5EPF A;  4YQM A;  3GL5 A;  2PPT A;  1N8J A;  4PQH A;  5CO3 A;  4HI7 A;  4V2M A;  1YDK A;  1RQM A;  2IN3 A;  5L71 A;  4N30 A;  2AB6 A;  4KA0 A;  2LNS A;  2IL3 A;  5HR3 A;  2ZUP A;  1YEP A;  1TK8 B;  2CVB A;  4FYB A;  4HU9 A;  3RHB A;  3LYP A;  5COH A;  5DJL A;  6GSY A;  1S3D A;  3GUS A;  2PN8 A;  2H70 A;  3CSI A;  4YQV A;  1TKD B;  2YZH A;  4ACS A;  4NXI A;  2FWF A;  2H1G A;  3TKP A;  1V9W A;  2CVD A;  19GS A;  3W6G A;  1RW1 A;  1GSE A;  1AC1 A;  3OR5 A;  4L0U A;  4ML6 A;  4O32 A;  1EGR A;  2AV4 A;  1GUM A;  2C1Y A;  4MH2 A;  2WUL A;  4XRA A;  3TKS C;  2PWJ A;  4XS6 A;  4KDX A;  2O87 A;  1PN9 A;  4KSO A;  2H1B A;  5J3R A;  5IMZ A;  4WBR D;  2CT6 A;  1M99 A;  1TRS A;  3M1G A;  1WMJ A;  1DE2 A;  4O7H A;  2GQK A;  4AJ7 A;  4F82 A;  2VLV A;  4EDY A;  3BOA A;  1K0C A;  4MLY A;  1JZO A;  3JCM L;  3IC4 A;  3L9U A;  1NW2 A;  1M9A A;  1SD9 A;  2AJQ B;  4F9Z A;  2MMN A;  5HFG A;  2LS5 A;  5JCU A;  3ZZX A;  1T3B A;  2B5E A;  1U87 A;  3G9B A;  1PRX A;  2CZ2 A;  2O8V B;  1R5A A;  11GS A;  3HA9 A;  1FB6 A;  1K0B A;  1GSY A;  1PL2 A;  2AYT A;  3TDG A;  4HQS A;  2J23 A;  4Q5R A;  4FYC A;  4PNG A;  1WIK A;  2YV9 A;  3HHV A;  3WT1 A;  4MAB A;  4LL1 B;  1SKS B;  5JCW A;  4K1F A;  1OYJ A;  4K9Z A;  2H1D A;  3GL3 A;  1K0O A;  3KZQ A;  3ZIJ A;  4FH8 A;  2REM A;  2H8L A;  3M9K A;  5D96 A;  1FW1 A;  3ZVJ D;  3KIJ A;  4DVC A;  5ECH B;  2RUE A;  2FUG 2;  4EUY A;  3TJB A;  5IMA A;  2C0G A;  2FA8 A;  5ECR B;  1LBK A;  2D2Z A;  4EL1 A;  3TKS E;  2VL9 A;  4FO5 A;  3ERG A;  3LEF A;  3UOM A;  1B9X C;  1ML6 A;  1JLW A;  4KH7 A;  4ZL7 A;  1AW9 A;  2QC7 A;  3FR3 A;  1FVJ A;  3CBU A;  2OAC A;  1WP0 A;  4JR6 A;  1HQO A;  2E0Q A;  2N5F A;  4X0X A;  2PER A;  5ECM B;  2C0F A;  1EP7 A;  3HKR A;  4P3Y B;  1C72 A;  3VK9 A;  4I97 A;  2JSZ A;  1CQH A;  4Q5Q A;  2I1U A;  3ME8 A;  2YV7 A;  4AF2 A;  1LU4 A;  1Z5Y E;  1UA5 A;  3GMF A;  3I6A A;  1EP8 A;  2NVL A;  4WET A;  1HD2 A;  3RPN A;  1TRU A;  4ILF A;  3C7M A;  1PX7 A;  5D9T A;  5B6M A;  1K0N A;  3VFI A;  3C8E A;  2JU5 A;  2H72 A;  3J7Y b;  1SEN A;  4F03 A;  3ZYW A;  4AJ6 A;  3D0Z A;  1QQ2 A;  2XHF A;  4EDZ A;  2F9S A;  3GTU A;  5ID2 A;  3U6V A;  4HEA 2;  4PGT A;  3CTG A;  3FY7 A;  4DEJ A;  1U88 A;  4NMU A;  2OE1 A;  4BWS A;  2V6O A;  1PL1 A;  7GSS A;  1XWA A;  1DSB A;  1V98 A;  3EU4 A;  5IMD A;  3KTL A;  3E3E A;  1VF2 A;  2AAW A;  4CW9 A;  4I5Q A;  4YAP A;  3BBY A;  4L5L A;  2CVK A;  2JZR A;  4ZB9 A;  3DIE A;  3VUR A;  5ECN B;  1T1V A;  1F2E A;  2CV4 A;  3IE3 A;  2ZCT A;  4GWR A;  5ELG A;  4ECB A;  4GSN A;  5E59 A;  4ZBA A;  1VF3 A;  1IYH A;  1B48 A;  1TW9 A;  2YWN A;  3TRX A;  1NHO A;  4IKH A;  2K6V A;  4MPG A;  1SK1 A;  2ES7 A;  1FOV A;  1OC9 A;  5CRE A;  3MNG A;  2FWE A;  3U5R E;  2FWH A;  2HRF A;  2G2Q A;  5DAL A;  3CXG A;  1PA3 A;  3UVH A;  5IMF A;  3ERW A;  3D21 A;  1ERT A;  3G7I A;  4RI6 A;  2XC2 A;  2HZE A;  3H4K A;  5J41 A;  3VWV A;  3TB2 A;  4G19 A;  1BQ7 A;  5G2Z A;  1S3C A;  4OCE A;  2TRC P;  1A8Y A;  2JAD A;  3LQ7 A;  2C0E A;  1B4P A;  4ECC A;  1YZX A;  5A4V A;  3GTU B;  5ID2 B;  4OD7 A;  3DXB A;  4JR4 A;  4IHU A;  5ECL B;  3ZTL A;  3TJJ A;  2HRN A;  4LMV A;  3C71 A;  5F06 A;  3WGX A;  2HSH A;  1XVW A;  2TRX A;  1THX A;  3A5W A;  2YAN A;  2VCW A;  4N11 A;  4IS0 A;  1W89 A;  4K0G A;  2J9H A;  1ILO A;  4BA7 A;  1EEJ A;  1PSQ A;  4ZBB A;  2OE0 A;  3FW2 A;  2IWT A;  5G1L A;  3L0H A;  4OCF A;  2L4C A;  2KOK A;  1GUK A;  4JBB A;  3D5J A;  1XVQ A;  1M2B A;  3VI5 A;  1JHB A;  3M0F A;  3TRQ A;  12GS A;  3IV4 A;  2X8C A;  1AUC A;  1OC9 B;  5GZZ B;  2CX4 A;  3FYG A;  5LD0 A;  1QGV A;  5DAL B;  3K8N A;  5KEJ A;  3FK8 A;  4E8E A;  5IMV A;  4EO3 A;  2HZE B;  2RM6 A;  2GDR A;  2YWO A;  4N0Z A;  4RI7 A;  2TIR A;  4RQR A;  2JSY A;  3F8U A;  3UIW A;  2XBQ A;  1X5D A;  5GAN D;  5A5K A;  2HSY A;  4WR5 A;  1F6M C;  3HZ8 A;  3ZIT A;  5IMC A;  2VCZ A;  1PGT A;  3I9V 2;  3Q18 A;  4IQA A;  3FR6 A;  4KB3 A;  5A4W A;  5IQY A;  1A2J A;  5HR1 A;  4IJ3 A;  2DLX A;  4O5R A;  4TR4 A;  5DAK A;  4KW6 A;  1PX6 A;  1G6Y A;  2IMK A;  2R3X A;  1V2A A;  4POK A;  2GT5 A;  6GSU A;  2VL2 A;  4PX1 A;  1TI3 A;  2MMO A;  4HZ2 A;  2WS2 A;  1MEK A;  3UJ1 A;  1AXD A;  5GST A;  2ALB A;  3PIN A;  3LXZ A;  2K8V A;  2YJ7 A;  3IHQ A;  2F8F A;  4HU7 A;  4JZQ A;  1RK4 A;  3UEM A;  2VD1 A;  4AGS A;  4LMW A;  5J9C A;  2C4J A;  1BX9 A;  2HI7 A;  2FHE A;  1SL0 B;  5D9V A;  3DYR A;  1XCC A;  1U6T A;  4PUA A;  5A4U A;  2VD0 A;  1A24 A;  3QFB C;  1H4O A;  4TXV A;  1GSD A;  3FZ5 A;  1IYI A;  3KEB A;  4BPY A;  4GQF A;  1F3B A;  2RLI A;  3UAR A;  2DSA A;  2X64 A;  4L0W A;  4OFM A;  2NDO A;  3TJK A;  1X5E A;  1GTU A;  3LGC A;  1FAA A;  1THO A;  3EWL A;  1XPV A;  5HFK A;  3VPQ A;  2V41 A;  3ZL5 A;  3AY8 A;  4TKY A;  3GH9 A;  2IJY A;  18GS A;  4PQ1 A;  5C04 A;  2LRN A;  3EE2 A;  4V1A p;  5DQS A;  3DML A;  3IXR A;  1TRV A;  5JWQ B;  5D73 A;  5HR0 A;  3I69 A;  4OMV A;  1AAZ A;  5AN1 A;  4PUF C;  17GS A;  1GTI A;  3BD2 A;  5G5F A;  1Y6E A;  5DAK B;  1DE1 A;  2JAC A;  5CRD A;  4WEY A;  2LUS A;  1G7E A;  5ECP B;  1H75 A;  3TUE A;  2IME A;  3F6D A;  4XS4 A;  4DSR A;  2MMA A;  2YP6 A;  4DSQ A;  1UN2 A;  4WXT A;  4ZL8 A;  3W8S A;  4Q5N A;  1MD3 A;  4YAV A;  3CYN A;  3QFA C;  2GGT A;  2A2S A;  2LRC A;  5HR2 A;  3FZA A;  1FB0 A;  3EMP A;  4D73 A;  1WJK A;  3N9J A;  2DJ0 A;  1Q4J A;  1GSU A;  2B6M A;  3US3 A;  4JED A;  3FR9 A;  3LG6 A;  3A2W A;  3GA4 A;  3F4T A;  3WD6 A;  4MP4 A;  3RDW A;  3UMA A;  4MJA A;  2DIY A;  4HDE A;  5DQY A;  5DVB A;  1HNA A;  2VCX A;  4TRX A;  1GUH A;  1GH2 A;  2FA4 A;  3LWA A;  1N2A A;  2VO4 A;  1A23 A;  2GQL A;  3FZ9 A;  5GAP D;  4J56 E;  1XXU A;  1Z6M A;  2EIQ A;  1OC8 A;  4CHS A;  3BCK A;  1KBN A;  1WWJ A;  4N0V A;  3FEU A;  2E7P A;  4KCA A;  4ZXG A;  4G10 A;  5J9B A;  2GT6 A;  1O73 A;  4ZIJ A;  1K0M A;  2YWM A;  4XS4 B;  3UL3 A;  4Z7X A;  2O85 A;  2GLR A;  2B5X A;  1MTC A;  2IFQ A;  2L6C A;  2M72 A;  4Q5F A;  4KND A;  1V58 A;  4D73 B;  6GST A;  5EVO A;  2H74 A;  2IMI A;  2WRT A;  3HDC A;  5DJM A;  4EXJ A;  3H8Q A;  4O92 A;  3L9V A;  2FNO A;  3DD3 A;  4TOP A;  3QOU A;  2IMF A;  5FWG A;  4F2I A;  1WRY A;  3IPZ A;  4NV5 A;  2WGR A;  1X9S B;  1GUL A;  3Q19 A;  6GSW A;  1T00 A;  2NPB A;  3UBK A;  1TDI A;  3L4N A;  1E2Y A;  1JZR A;  3EYT A;  4POB A;  4IGJ A;  4JE1 A;  1ZZY A;  3ZML A;  2V32 A;  3FKF A;  1EWX A;  1WPI A;  2L4Q A;  4ULX A;  5AIV A;  2H66 A;  1SKW B;  3F3R A;  1PKZ A;  1OKT A;  1ZOF A;  2GZY A;  1U3I A;  1QFN A;  2O7K A;  3ZRE A;  3QAG A;  4K7N A;  4K2D A;  1TOF A;  4X43 A;  2GZP A;  1XWB A;  3HYP A;  14GS A;  3EMX A;  3KP8 A;  4I2U A;  2LJK A;  1SK0 A;  2LQO A;  2CAQ A;  2MMZ A;  1ON4 A;  5CRW A;  2LV3 A;  4BL7 A;  3TKS A;  16GS A;  3EU3 A;  1F37 A;  5EL8 A;  2IFQ B;  1Z3E A;  3KXO A;  3H1N A;  1EOG A;  2LTK A;  4TR1 A;  3GX0 A;  1GWC A;  3RAZ A;  1M0U A;  3GV1 A;  1G6W A;  1O6J A;  2WB9 A;  4GTU A;  4WF5 A;  3IAS 2;  4OO5 A;  4J57 E;  2GTU A;  2XPE A;  3HVS A;  3MAK A;  3CSH A;  3HCZ A;  5JWR B;  4I6X A;  1XOA A;  4MJC A;  6GSS A;  1EZK A;  4GRF A;  4WBJ A;  1V57 A;  1OKD A;  3TKQ A;  3KP9 A;  3FHK A;  1X5C A;  3GKN A;  2DMM A;  1GTA A;  3M9J A;  2YZU A;  3D4T A;  3P2A A;  4HQZ A;  4HZ4 A;  1A0F A;  1M2A A;  2OAD A;  2L5O A;  5F0G A;  3HZ4 A;  2HE3 A;  2C3N A;  1XWG A;  4TR3 A;  2I3Y A;  2M46 A;  4TW5 A;  3ERF A;  5G31 A;  2CA8 A;  1T8E B;  4MA9 A;  3D22 A;  5JWO B;  1OE7 A;  1XIY A;  3O6T A;  4MDC A;  5F8B A;  4TR1 B;  3A2X A;  4JU5 A;  2R5G A;  5LCZ A;  4ZL9 A;  2KHP A;  1F9M A;  2M80 A;  2VM1 A;  2B1K A;  4EE0 A;  3H93 A;  2MYG A;  1MDI A;  4MZB A;  4NV2 A;  1XW5 A;  2LQQ A;  4RQX A;  4BVY A;  1BAY A;  1PQN A;  1XBS A;  3CRT A;  3HJP A;  4IQ1 A;  1JLV A;  3LSZ A;  1PKW A;  5D93 A;  2C3Q A;  3QCP A;  1QK8 A;  1SL2 B;  5H5R A;  3IK9 A;  2V1M A;  1XWK A;  1JZD A;  4IW9 A;  1EEM A;  1M9B A;  2PU9 C;  3D6I A;  2F3M A;  3UBL A;  1YJ6 A;  2N5B A;  4ZIL A;  4DSS A;  2C0D A;  2X8G A;  1GTB A;  4ECJ A;  4EF0 A;  3IOS A;  3DGQ A;  4L5O A;  4K0N A;  5C00 A;  1Y25 A;  3KH9 A;  3C1S A;  1YKA A;  3PH9 A;  1Z6N A;  2VUP A;  4K7O A;  2VCV A;  3KMN A;  1XZO A;  2PGT A;  1KNG A;  1SU9 A;  4MK3 A;  1TK5 B;  3UVT A;  5CRG A;  3SWL A;  3DVW A;  3WGE A;  3GNJ A;  3S9F A;  3EUR A;  4TXO A;  4RUV A;  3W8J A;  2VAF A;  3TJF A;  3APS A;  2VLT A;  3KH7 A;  4MZC A;  1YF0 A;  1B8X A;  3GUR A;  2HFD A;  1AQX A;  2KP1 A;  1EV4 A;  2B1L A;  3I43 A;  3KMO A;  2B3S A;  2PVQ A;  2DJ2 A;  5KN1 A;  4EVM A;  3WT2 A;  4ML1 A;  4IBP A;  2HT9 A;  3A2V A;  4NWY A;  1R7H A;  2ON7 A;  1AQW A;  3WYW A;  1WE0 A;  1TTZ A;  8GSS A;  5KN0 A;  1K3L A;  4POL A;  5FT3 A;  1XFL A;  1J0F A;  1G0T A;  4GSS A;  2GSR A;  1USB A;  1EOH A;  1NHY A;  1T4Y A;  4DSS B;  4GF0 A;  1G7O A;  2H6Y A;  2L57 A;  2A4V A;  2R2J A;  3M8N A;  2X8H A;  2JZS A;  1UVZ A;  4NHZ A;  1QXH A;  5AIS A;  5CNW A;  1SKR B;  4TN8 A;  2LST A;  3KJY A;  4HS1 A;  5CAX A;  2OBI A;  1SK2 A;  3IDV A;  5AIX A;  3VWU A;  1MDJ A;  3KM6 A;  3EC3 A;  4TXO B;  5IO0 A;  2H71 A;  4MPF A;  2DJ1 A;  2EIR A;  2V2G A;  2JL4 A;  3Q6O A;  4MH3 A;  4LA1 A;  2AUV A;  4IN0 A;  5J4U A;  4ZBD A;  3APQ A;  4V2N A;  3QDN A;  2RII A;  1SL1 B;  1ACV A;  5IOX A;  3H79 A;  3HY2 A;  2C8U A;  2H75 A;  3EVI A;  4OO4 A;  4XHM A;  3RBT A;  4OFT A;  5ABR A;  4TVE A;  3APO A;  2B7K A;  2YN1 A;  2H73 A;  4PUR A;  3CTF A;  2YJH A;  2L6D A;  5CYY A;  1O81 A;  3GFK A;  3BCI A;  5DCG A;  2KP2 A;  2FD3 A;  3ME7 A;  1YKC A;  4EC0 A;  1HNC A;  3IK7 A;  3QR6 A;  3E9J B;  4K6X A;  1BED A;  5IO2 A;  1XW6 A;  1URM A;  3QAW A;  4GST A;  4WR4 A;  1I5G A;  3P7X A;  2WFC A;  3C73 A;  4XCS A;  3PR8 A;  1AQV A;  1OC3 A;  2VM2 A;  4JRR A;  4H86 A;  10GS A;  2H30 A;  2YCD A;  5FHI A;  3GKX A;  2HXK A;  3WGD A;  2GS3 A;  5IIZ A;  1K0D A;  3DVX A;  3RHC A;  2WDU A;  2NBS A;  3UAP A;  1ST9 A;  1DBY A;  3VWW A;  1OVN A;  6GSV A;  2BTO T;  1SYX A;  3J7Y k;  3GYK A;  2I4A A;  3E0U A;  2RM5 A;  3DWV A;  2QSI A;  3ZLP A;  2H76 A;  1TI1 A;  4IVF A;  3ED3 A;  3G7Y A;  4FIW A;  5B6N A;  3F9U A;  3DKS A;  1TRW A;  3TJG A;  3V1W A;  4MF7 A;  4YH2 A;  1GSQ A;  3L9S A;  3ZRD A;  2E2G A;  1GRX A;  2PUK C;  3F3Q A;  2GQM A;  4KSM A;  1LJR A;  2VCT A;  2DBC A;  5IPH A;  4KDY A;  1B4Q A;  5H5Q A;  3VLN A;  3TGZ A;  2H0G A;  1FO5 A;  5CP1 A;  3GIX A;  2L59 A;  3NOF A;  5G5E A;  3P90 A;  5ENU A;  1ZGN A;  4PQI A;  2QGV A;  1X9M B;  5ECQ B;  4K7I A;  3HXS A;  2GSQ A;  3A3T A;  2GSS A;  4AJ8 A;  1GSS A;  2XPD A;  2LEG A;  1K0A A;  3M3M A;  4BWQ A;  5HQP A;  3F4S A;  4GXZ A;  3TRP A;  4KDU A;  5H5S A;  3HJM A;  3CRU A;  4GQC A;  5F05 A;  3LJR A;  3F0I A;  2YPM A;  3HD5 A;  3ISO A;  2IPA A;  1VGL A;  4QL9 A;  5D9W A;  5E4W A;  1YF1 A;  2DC5 A;  5B8A A;  2HZF A;  1GP1 A;  3GKK A;  3EIN A;  2X99 A;  1Z7R A;  4KE3 A;  3GKM A;  1YQ1 A;  1ERV A;  2H6X A;  5KN3 A;  3IBH A;  3O3T A;  1OE8 A;  5DDL A;  3LOR A;  3GSS A;  2HYX A;  1A2L A;  1WOU A;  2N5A A;  4KCE A;  4MMM A;  3O76 A;  2O89 A;  1CQG A; 
#chains in the Genus database with same CATH topology
 1F3A A;  2P5R A;  2VIM A;  2JZT A;  2OKA A;  3ZFL A;  4N10 A;  5CRH A;  4NHW A;  1HYU A;  1VRS D;  2YNX A;  3GX8 A;  2H0H A;  3KD0 A;  3LFL A;  1TJD A;  3MWH A;  3LXT A;  1TU7 A;  3F4R A;  3GH6 A;  3HVV A;  2VOC A;  5DCH A;  3IHG A;  2FWG A;  2QKE A;  3VI7 A;  3C1R A;  3TOT A;  1TP9 A;  2X49 A;  4IP1 A;  2MZC A;  3BJ5 A;  2PBJ A;  1PMT A;  2CX3 A;  1ERW A;  2A2R A;  4MNN A;  3MDK A;  1GSF A;  3SBC A;  3TOU A;  2GZZ A;  2C80 A;  4MF6 A;  1BG5 A;  1B9Y C;  3GRX A;  1TK0 B;  1J9B A;  2VL3 A;  4HJM A;  3FZ4 A;  4I8B A;  4E8H A;  1FHE A;  4MJE A;  2HLS A;  3GST A;  4OFN A;  2KUC A;  4HUA A;  5AGY A;  1R4W A;  3VPT A;  4XTS A;  2DKH A;  1YY7 A;  5ECI B;  5D9X A;  2H19 A;  1JZW A;  5G30 A;  4MZW A;  2FLS A;  1K3O A;  2L5L A;  3G7J A;  4G2E A;  4TR0 A;  2K9F A;  1O7U A;  1DUG A;  2B7J A;  5ECO B;  1O8W A;  1XW9 A;  4WF4 A;  3LW9 A;  3ZIV A;  4XIH A;  4KAE A;  3R2Q A;  2NTO A;  5BMU A;  2CQ9 A;  22GS A;  2A2P A;  2K18 A;  2MBS A;  2C3T A;  2WZ9 A;  1ZYE A;  3ZVJ A;  4LLR A;  2GST A;  2FCH A;  4V1A g;  2DJJ A;  2GVP A;  4G9H A;  2DJK A;  1PD2 1;  3QAV A;  4FQU A;  2AHE A;  3P8W A;  1ABA A;  1A0R P;  3L78 A;  1KTE A;  2LNT A;  13GS A;  3QPM A;  5GSS A;  1J08 A;  4ECI A;  1K3Y A;  5G1K A;  2BJX A;  1JFU A;  1XOB A;  1T4Z A;  2LRT A;  2R37 A;  2FGX A;  1TXX A;  1Z9H A;  1R26 A;  3MSZ A;  2H01 A;  1SD8 A;  1XWC A;  1QUW A;  4YKF A;  4HJ2 A;  2F8A A;  1A8L A;  1Z7P A;  1T7P B;  3KCM A;  4KUN A;  2P0G A;  4Z2U A;  1HNB A;  2VL2 C;  2LJR A;  3NZN A;  2EIO A;  3IR4 A;  2PVO C;  5JCG A;  4V2L A;  1KEB A;  4I2T A;  5KN2 A;  3PGT A;  2XBI A;  2FY6 A;  5DBQ A;  2ZNM A;  1FG4 A;  1VF1 A;  3NIV A;  2F51 A;  4ISD A;  3F63 A;  3TCO A;  3ZMK A;  2DIZ A;  4IEL A;  2P5Q A;  4X4J A;  2YOI A;  4GLT A;  4KX4 A;  1M2D A;  1TU8 A;  5J5N A;  4XS1 A;  1OAZ A;  4F0B A;  1QMV A;  2BMX A;  2WJU A;  3ZFB A;  5IOW A;  2OE3 A;  1BYE A;  3FRC A;  2HNL A;  2I81 A;  1MD4 A;  1SJ6 A;  2CZ3 A;  1ZL9 A;  4F0C A;  2I9H A;  4XRD A;  4NAX A;  3CSJ A;  1MDK A;  4FYU A;  2DML A;  1A2M A;  5B7C A;  4IP6 A;  4OWY A;  1BJX A;  1GLQ A;  2E2M A;  3IA1 A;  2MBT A;  4MJB A;  4ID0 A;  1I9D A;  1R5P A;  5F07 A;  4POM A;  2ON5 A;  4LL4 B;  3Q74 A;  20GS A;  3VWX A;  2G0F A;  1ZCP A;  2OA7 A;  4MF5 A;  3QD9 A;  5INY A;  4IJI A;  3RPP A;  2VCQ A;  1VF4 A;  1NM3 A;  1ZYQ B;  5ELA A;  2CAI A;  1M7T A;  1M3I A;  4HOJ A;  4WKW A;  5EY6 A;  1SYR A;  1W4V A;  3IAM 2;  1V40 A;  2P31 A;  4NPB A;  2OBK A;  1X0R A;  2R4V A;  3TKR A;  1NSW A;  2H6Z A;  4X1U A;  2V6K A;  4ZB6 A;  2IMD A;  4EKZ A;  1UC7 A;  5LNK e;  4QQ7 A;  9GSS A;  1GNE A;  4J2F A;  4PNF A;  1X9W B;  5ECK B;  2B5Y A;  5D8I A;  2WCI A;  1SJI A;  1ERU A;  1EV9 A;  1GL8 A;  2LKU A;  4MCU A;  2H1A A;  2R6K A;  3D4M A;  3LYK A;  1YEX A;  3HVX A;  1EGO A;  2OJL A;  3N5O A;  4QL7 A;  1ZYP A;  1O85 A;  1O8X A;  4YQU A;  4BVX A;  1GLP A;  1SJZ A;  3CMI A;  3KGK A;  1AIU A;  4PXO A;  2H0I A;  1Q98 A;  5ECS A;  4L8E A;  3KTB A;  4CDO A;  1S3A A;  2PMT A;  3GN3 A;  3IRA A;  5B8B A;  1ZMA A;  3GHA A;  2RUF A;  6GSX A;  2K8S A;  2Z9S A;  2EC4 A;  2LJA A;  3HJO A;  1U3A A;  2KLX A;  1E6B A;  2VLU A;  2DJ3 A;  1GNW A;  2YWI A;  5IM9 A;  5HFI A;  3DRN A;  4K8M A;  1FVK A;  3QMX A;  4USS A;  2DKI A;  4ZB8 A;  2IIY A;  5IPG A;  4GCI A;  4KGI A;  3F6F A;  3DEX A;  5EPF A;  4YQM A;  3GL5 A;  2PPT A;  1N8J A;  4PQH A;  5CO3 A;  4HI7 A;  4V2M A;  1YDK A;  1RQM A;  2IN3 A;  5L71 A;  4N30 A;  2AB6 A;  2X4A A;  4KA0 A;  2LNS A;  2IL3 A;  5HR3 A;  2ZUP A;  4ICY A;  1YEP A;  1TK8 B;  2CVB A;  4FYB A;  4HU9 A;  3RHB A;  3LYP A;  5COH A;  5DJL A;  6GSY A;  1S3D A;  3GUS A;  2PN8 A;  4BVX B;  2H70 A;  3CSI A;  4YQV A;  1TKD B;  2YZH A;  4ACS A;  4NXI A;  2FWF A;  2H1G A;  3TKP A;  1V9W A;  2CVD A;  19GS A;  3W6G A;  1RW1 A;  1GSE A;  1AC1 A;  3OR5 A;  4L0U A;  2R0G A;  4ML6 A;  4O32 A;  4G0L A;  1EGR A;  2AV4 A;  1GUM A;  2C1Y A;  4MH2 A;  2WUL A;  4XRA A;  3TKS C;  2PWJ A;  4XS6 A;  4KDX A;  2O87 A;  1PN9 A;  4KSO A;  2H1B A;  5J3R A;  5IMZ A;  4WBR D;  2CT6 A;  1M99 A;  1TRS A;  3M1G A;  1WMJ A;  1DE2 A;  4O7H A;  2GQK A;  4AJ7 A;  4F82 A;  2VLV A;  4EDY A;  3BOA A;  1K0C A;  4MLY A;  1JZO A;  3JCM L;  3IC4 A;  3L9U A;  1NW2 A;  1M9A A;  1SD9 A;  2AJQ B;  4F9Z A;  2MMN A;  5HFG A;  2LS5 A;  5JCU A;  3ZZX A;  1T3B A;  2B5E A;  1U87 A;  3G9B A;  1PRX A;  2CZ2 A;  2O8V B;  1R5A A;  11GS A;  3HA9 A;  1FB6 A;  1K0B A;  1GSY A;  1PL2 A;  2AYT A;  3TDG A;  4HQS A;  2J23 A;  3PPU A;  4Q5R A;  4FYC A;  4PNG A;  1WIK A;  2YV9 A;  3HHV A;  3WT1 A;  4MAB A;  4LL1 B;  1SKS B;  5JCW A;  4K1F A;  1OYJ A;  4K9Z A;  2H1D A;  3GL3 A;  1K0O A;  3KZQ A;  3ZIJ A;  4FH8 A;  2REM A;  2H8L A;  3M9K A;  5D96 A;  1FW1 A;  3ZVJ D;  3KIJ A;  4DVC A;  5ECH B;  2RUE A;  2FUG 2;  4EUY A;  3TJB A;  5IMA A;  2C0G A;  2FA8 A;  5ECR B;  1LBK A;  2D2Z A;  4EL1 A;  3TKS E;  2VL9 A;  4FO5 A;  3ERG A;  3LEF A;  3UOM A;  1B9X C;  1ML6 A;  1JLW A;  4KH7 A;  4ZL7 A;  1AW9 A;  5BRT A;  2QC7 A;  3FR3 A;  1FVJ A;  3CBU A;  2OAC A;  1WP0 A;  4JR6 A;  1HQO A;  2E0Q A;  2N5F A;  4X0X A;  2PER A;  5ECM B;  2C0F A;  1EP7 A;  3HKR A;  4P3Y B;  1C72 A;  4EIP A;  3VK9 A;  4I97 A;  2JSZ A;  1CQH A;  4Q5Q A;  2I1U A;  3ME8 A;  2YV7 A;  2R0C A;  4AF2 A;  1LU4 A;  1Z5Y E;  1UA5 A;  3GMF A;  3I6A A;  1EP8 A;  2NVL A;  4WET A;  1HD2 A;  3RPN A;  1TRU A;  4ILF A;  3C7M A;  1PX7 A;  5D9T A;  5B6M A;  1K0N A;  3VFI A;  4O5U A;  3C8E A;  2JU5 A;  2H72 A;  3J7Y b;  1SEN A;  4F03 A;  3ZYW A;  4AJ6 A;  3D0Z A;  1QQ2 A;  2XHF A;  4EDZ A;  2F9S A;  3GTU A;  5ID2 A;  3U6V A;  4HEA 2;  4PGT A;  3CTG A;  3FY7 A;  4DEJ A;  1U88 A;  4NMU A;  4PTS A;  2OE1 A;  4BWS A;  2V6O A;  1PL1 A;  7GSS A;  1XWA A;  1DSB A;  1V98 A;  3EU4 A;  5IMD A;  3KTL A;  3E3E A;  1VF2 A;  2AAW A;  4CW9 A;  4I5Q A;  4YAP A;  3BBY A;  4L5L A;  2CVK A;  2JZR A;  4ZB9 A;  3DIE A;  3VUR A;  4K5S A;  5ECN B;  1T1V A;  1F2E A;  2CV4 A;  3IE3 A;  2ZCT A;  4GWR A;  5ELG A;  4ECB A;  4GSN A;  5E59 A;  4ZBA A;  1VF3 A;  1IYH A;  1B48 A;  1TW9 A;  2YWN A;  3TRX A;  1NHO A;  4IKH A;  2K6V A;  4MPG A;  1SK1 A;  2ES7 A;  1FOV A;  1OC9 A;  5CRE A;  3MNG A;  2FWE A;  3U5R E;  2FWH A;  2HRF A;  4O5Q A;  2G2Q A;  5DAL A;  3CXG A;  1PA3 A;  3UVH A;  5IMF A;  3ERW A;  3D21 A;  1ERT A;  3G7I A;  4RI6 A;  2XC2 A;  2HZE A;  3H4K A;  5J41 A;  3VWV A;  3TB2 A;  4G19 A;  1BQ7 A;  5G2Z A;  1S3C A;  4OCE A;  2TRC P;  1A8Y A;  2JAD A;  3IC8 A;  3LQ7 A;  2C0E A;  1B4P A;  4ECC A;  1YZX A;  5A4V A;  3GTU B;  5ID2 B;  4OD7 A;  3DXB A;  4JR4 A;  4IHU A;  5ECL B;  3ZTL A;  3TJJ A;  2HRN A;  4LMV A;  3C71 A;  5F06 A;  3WGX A;  2HSH A;  1XVW A;  2TRX A;  1THX A;  3A5W A;  2YAN A;  2VCW A;  4N11 A;  4IS0 A;  1W89 A;  4K0G A;  2J9H A;  1ILO A;  4BA7 A;  1EEJ A;  1PSQ A;  4ZBB A;  2OE0 A;  3FW2 A;  2IWT A;  5G1L A;  3L0H A;  4OCF A;  2L4C A;  2KOK A;  1GUK A;  4JBB A;  3D5J A;  1XVQ A;  1M2B A;  3VI5 A;  1JHB A;  3M0F A;  3TRQ A;  12GS A;  3IV4 A;  2X8C A;  1AUC A;  1OC9 B;  5GZZ B;  2CX4 A;  3FYG A;  5LD0 A;  1QGV A;  5DAL B;  3K8N A;  5KEJ A;  3FK8 A;  4E8E A;  5IMV A;  4EO3 A;  2HZE B;  2RM6 A;  2GDR A;  2YWO A;  4N0Z A;  4RI7 A;  2TIR A;  4RQR A;  2JSY A;  3F8U A;  3UIW A;  2XBQ A;  1X5D A;  5GAN D;  5A5K A;  2HSY A;  4WR5 A;  1F6M C;  3HZ8 A;  3ZIT A;  5IMC A;  2VCZ A;  1PGT A;  3I9V 2;  3Q18 A;  4IQA A;  3FR6 A;  4KB3 A;  1S3R A;  5A4W A;  5IQY A;  1A2J A;  5HR1 A;  4IJ3 A;  2DLX A;  4O5R A;  4TR4 A;  5DAK A;  4KW6 A;  1PX6 A;  1G6Y A;  2IMK A;  2R3X A;  1V2A A;  4POK A;  2GT5 A;  6GSU A;  2VL2 A;  4PX1 A;  1TI3 A;  2MMO A;  4HZ2 A;  2WS2 A;  1MEK A;  3UJ1 A;  1AXD A;  5GST A;  2ALB A;  3PIN A;  3LXZ A;  2K8V A;  2YJ7 A;  3IHQ A;  2F8F A;  4HU7 A;  4JZQ A;  1RK4 A;  3UEM A;  2VD1 A;  4AGS A;  4LMW A;  5J9C A;  2C4J A;  1BX9 A;  2HI7 A;  2FHE A;  1SL0 B;  5D9V A;  3DYR A;  1XCC A;  1U6T A;  4PUA A;  5A4U A;  2VD0 A;  1A24 A;  3QFB C;  1H4O A;  4TXV A;  1GSD A;  3FZ5 A;  1IYI A;  3KEB A;  4BPY A;  4GQF A;  1F3B A;  4G0I A;  2RLI A;  3UAR A;  2DSA A;  2X64 A;  4L0W A;  4OFM A;  2NDO A;  3TJK A;  1X5E A;  1GTU A;  3LGC A;  1FAA A;  1THO A;  3EWL A;  1XPV A;  5HFK A;  3VPQ A;  2V41 A;  3ZL5 A;  3AY8 A;  4TKY A;  3GH9 A;  2IJY A;  18GS A;  4PQ1 A;  5C04 A;  2LRN A;  3EE2 A;  4V1A p;  5DQS A;  3DML A;  3IXR A;  1TRV A;  5JWQ B;  5D73 A;  5HR0 A;  3I69 A;  4OMV A;  1AAZ A;  5AN1 A;  4PUF C;  17GS A;  1GTI A;  3BD2 A;  5G5F A;  1Y6E A;  5DAK B;  1DE1 A;  2JAC A;  5CRD A;  4WEY A;  2LUS A;  1G7E A;  5ECP B;  1H75 A;  3TUE A;  2IME A;  3F6D A;  4XS4 A;  4DSR A;  2MMA A;  2YP6 A;  4DSQ A;  1UN2 A;  4WXT A;  4ZL8 A;  3W8S A;  4Q5N A;  1MD3 A;  4YAV A;  3CYN A;  3QFA C;  3R3E A;  2GGT A;  2A2S A;  2LRC A;  5HR2 A;  3FZA A;  1FB0 A;  3EMP A;  4D73 A;  1WJK A;  3N9J A;  2DJ0 A;  1Q4J A;  1GSU A;  2B6M A;  3US3 A;  4JED A;  3FR9 A;  3LG6 A;  3A2W A;  3GA4 A;  1M3J A;  3F4T A;  3WD6 A;  4MP4 A;  3RDW A;  3UMA A;  4HSC X;  4MJA A;  2DIY A;  4HDE A;  1ZYN A;  5DQY A;  5DVB A;  1HNA A;  2VCX A;  4TRX A;  1GUH A;  1GH2 A;  2FA4 A;  3LWA A;  1N2A A;  2VO4 A;  1A23 A;  2GQL A;  3FZ9 A;  5GAP D;  4J56 E;  1XXU A;  1Z6M A;  2EIQ A;  1OC8 A;  4CHS A;  3BCK A;  1KBN A;  1WWJ A;  4N0V A;  3FEU A;  3A5I A;  2E7P A;  4KCA A;  4ZXG A;  4G10 A;  5J9B A;  2GT6 A;  1O73 A;  4ZIJ A;  1K0M A;  2YWM A;  4XS4 B;  3UL3 A;  4Z7X A;  2O85 A;  2GLR A;  2B5X A;  1MTC A;  2IFQ A;  2L6C A;  2HRA A;  2M72 A;  4Q5F A;  4KND A;  1V58 A;  4D73 B;  6GST A;  5EVO A;  2H74 A;  2IMI A;  2WRT A;  3HDC A;  5DJM A;  4EXJ A;  3H8Q A;  4O92 A;  3L9V A;  4CY6 A;  2FNO A;  3DD3 A;  4TOP A;  3QOU A;  2IMF A;  5FWG A;  4F2I A;  1WRY A;  3IPZ A;  4NV5 A;  2WGR A;  3EPT A;  1X9S B;  1GUL A;  3Q19 A;  6GSW A;  1T00 A;  2NPB A;  3UBK A;  1TDI A;  3L4N A;  1E2Y A;  1JZR A;  3EYT A;  4POB A;  4IGJ A;  4JE1 A;  1ZZY A;  3ZML A;  2V32 A;  3FKF A;  1EWX A;  1WPI A;  2L4Q A;  4ULX A;  5AIV A;  4Z2T A;  2H66 A;  1SKW B;  3F3R A;  1PKZ A;  1OKT A;  1ZOF A;  2GZY A;  1U3I A;  1QFN A;  2O7K A;  3ZRE A;  3QAG A;  4K7N A;  4K2D A;  1TOF A;  4X43 A;  2GZP A;  1XWB A;  3MIX A;  3HYP A;  4EIQ A;  14GS A;  3EMX A;  3KP8 A;  4I2U A;  2LJK A;  1SK0 A;  2LQO A;  2CAQ A;  2MMZ A;  1ON4 A;  5CRW A;  2LV3 A;  4BL7 A;  1XG8 A;  3TKS A;  16GS A;  3EU3 A;  1F37 A;  5EL8 A;  2IFQ B;  1Z3E A;  3KXO A;  3H1N A;  1EOG A;  2LTK A;  4TR1 A;  3MYD A;  3GX0 A;  1GWC A;  3RAZ A;  1M0U A;  3GV1 A;  1G6W A;  1O6J A;  2WB9 A;  4GTU A;  4WF5 A;  3IAS 2;  4G0K A;  4OO5 A;  4J57 E;  2GTU A;  2XPE A;  3HVS A;  3MAK A;  3CSH A;  3HCZ A;  5JWR B;  4I6X A;  1XOA A;  4MJC A;  6GSS A;  1EZK A;  4GRF A;  4WBJ A;  1V57 A;  2HRK A;  1OKD A;  3TKQ A;  3KP9 A;  3FHK A;  2HSM A;  1X5C A;  3GKN A;  2DMM A;  1GTA A;  3M9J A;  2YZU A;  3D4T A;  3P2A A;  4HQZ A;  4HZ4 A;  4Z2R A;  1A0F A;  1M2A A;  2OAD A;  2L5O A;  5F0G A;  3HZ4 A;  2HE3 A;  2C3N A;  1XWG A;  4TR3 A;  2I3Y A;  2M46 A;  4TW5 A;  3ERF A;  4BL7 B;  5G31 A;  2CA8 A;  1T8E B;  4MA9 A;  3D22 A;  5JWO B;  1OE7 A;  1XIY A;  3O6T A;  4MDC A;  5F8B A;  4TR1 B;  3A2X A;  4JU5 A;  2R5G A;  5LCZ A;  4ZL9 A;  2KHP A;  1F9M A;  2M80 A;  2VM1 A;  2B1K A;  4EE0 A;  3H93 A;  2MYG A;  1MDI A;  4MZB A;  4NV2 A;  1XW5 A;  2LQQ A;  4RQX A;  4BVY A;  1BAY A;  1PQN A;  1XBS A;  3CRT A;  3HJP A;  4IQ1 A;  1JLV A;  3LSZ A;  1PKW A;  5D93 A;  2C3Q A;  3QCP A;  1QK8 A;  1SL2 B;  5H5R A;  3IK9 A;  3CQF A;  2V1M A;  1XWK A;  1JZD A;  4IW9 A;  1EEM A;  1M9B A;  2PU9 C;  3D6I A;  2F3M A;  3UBL A;  1YJ6 A;  2N5B A;  4ZIL A;  4DSS A;  2C0D A;  2X8G A;  1GTB A;  4ECJ A;  4EF0 A;  3IOS A;  3DGQ A;  4L5O A;  4K0N A;  5C00 A;  1Y25 A;  3KH9 A;  3C1S A;  1YKA A;  3PH9 A;  1Z6N A;  2VUP A;  4K7O A;  2VCV A;  3KMN A;  1XZO A;  2PGT A;  1KNG A;  1SU9 A;  4MK3 A;  1TK5 B;  3UVT A;  5CRG A;  3SWL A;  3DVW A;  3WGE A;  3GNJ A;  4CY8 A;  3S9F A;  3EUR A;  4TXO A;  4RUV A;  3W8J A;  2VAF A;  3TJF A;  3APS A;  2VLT A;  3KH7 A;  4MZC A;  1YF0 A;  1B8X A;  3GUR A;  2HFD A;  4BVY B;  1AQX A;  2KP1 A;  1EV4 A;  2B1L A;  3I43 A;  3KMO A;  2B3S A;  2PVQ A;  4A5P A;  2DJ2 A;  5KN1 A;  4EVM A;  3WT2 A;  4ML1 A;  4IBP A;  2HT9 A;  3A2V A;  4NWY A;  1R7H A;  2ON7 A;  1AQW A;  3WYW A;  1WE0 A;  1TTZ A;  2UZ8 A;  8GSS A;  5KN0 A;  1K3L A;  4POL A;  5FT3 A;  1XFL A;  1J0F A;  1G0T A;  4GSS A;  4K2X A;  2GSR A;  1USB A;  1EOH A;  4K5R A;  1NHY A;  1T4Y A;  4DSS B;  4GF0 A;  1G7O A;  2H6Y A;  2L57 A;  2A4V A;  2R2J A;  3M8N A;  2X8H A;  2JZS A;  1UVZ A;  4NHZ A;  1QXH A;  5AIS A;  5CNW A;  1SKR B;  4TN8 A;  2LST A;  3KJY A;  4HS1 A;  5CAX A;  2OBI A;  1SK2 A;  3IDV A;  5AIX A;  3VWU A;  1MDJ A;  3KM6 A;  3EC3 A;  4TXO B;  5IO0 A;  2H71 A;  4MPF A;  2DJ1 A;  2EIR A;  2V2G A;  2JL4 A;  3Q6O A;  4MH3 A;  4LA1 A;  2AUV A;  4IN0 A;  5J4U A;  4ZBD A;  3APQ A;  4V2N A;  3QDN A;  2RII A;  1SL1 B;  1ACV A;  5IOX A;  3H79 A;  3HY2 A;  2C8U A;  2H75 A;  3EVI A;  4OO4 A;  4XHM A;  3RBT A;  4OFT A;  5ABR A;  4TVE A;  5KOW A;  3APO A;  2B7K A;  2YN1 A;  2H73 A;  4PUR A;  3CTF A;  2YJH A;  2L6D A;  5CYY A;  1O81 A;  3GFK A;  3BCI A;  5DCG A;  2KP2 A;  2FD3 A;  3ME7 A;  1YKC A;  4EC0 A;  1HNC A;  3IK7 A;  3QR6 A;  3E9J B;  1PN0 A;  4K6X A;  1BED A;  5IO2 A;  1XW6 A;  1URM A;  3QAW A;  4GST A;  4WR4 A;  1I5G A;  3P7X A;  2WFC A;  3C73 A;  4XCS A;  3PR8 A;  1AQV A;  1OC3 A;  2VM2 A;  4JRR A;  4H86 A;  10GS A;  2H30 A;  2YCD A;  5FHI A;  3GKX A;  2HXK A;  3WGD A;  1FOH A;  2GS3 A;  4KF9 A;  2A4H A;  5IIZ A;  1K0D A;  3DVX A;  3RHC A;  2WDU A;  2NBS A;  3UAP A;  1ST9 A;  4YKG A;  1DBY A;  3VWW A;  1OVN A;  6GSV A;  2BTO T;  1SYX A;  3J7Y k;  3GYK A;  3FMW A;  2I4A A;  3E0U A;  2RM5 A;  3DWV A;  2QSI A;  3ZLP A;  2H76 A;  1TI1 A;  4IVF A;  3ED3 A;  1PFO A;  3G7Y A;  4FIW A;  2R0P A;  5B6N A;  3F9U A;  3DKS A;  1TRW A;  3TJG A;  3V1W A;  4MF7 A;  4YH2 A;  1GSQ A;  3L9S A;  3ZRD A;  2E2G A;  1GRX A;  2PUK C;  4BIK A;  3F3Q A;  2GQM A;  4KSM A;  1LJR A;  2VCT A;  2DBC A;  5IPH A;  4KDY A;  1B4Q A;  5H5Q A;  3VLN A;  3TGZ A;  2H0G A;  1FO5 A;  5CP1 A;  3GIX A;  2L59 A;  3NOF A;  5G5E A;  3P90 A;  5ENU A;  1ZGN A;  4PQI A;  2QGV A;  1X9M B;  5ECQ B;  4K7I A;  3HXS A;  2GSQ A;  3A3T A;  2GSS A;  4AJ8 A;  1GSS A;  2XPD A;  2LEG A;  1K0A A;  3M3M A;  4BWQ A;  5HQP A;  3F4S A;  4GXZ A;  3TRP A;  4KDU A;  5H5S A;  3HJM A;  3CRU A;  4GQC A;  5F05 A;  2QA2 A;  3LJR A;  2QA1 A;  5KOX A;  3F0I A;  2YPM A;  3HD5 A;  3ISO A;  2IPA A;  1VGL A;  4QL9 A;  5D9W A;  5E4W A;  1YF1 A;  2DC5 A;  5B8A A;  2HZF A;  1GP1 A;  3GKK A;  3EIN A;  2X99 A;  1Z7R A;  4KE3 A;  3GKM A;  1YQ1 A;  1ERV A;  2H6X A;  5KN3 A;  3IBH A;  3O3T A;  3HVN A;  1OE8 A;  5DDL A;  3LOR A;  3GSS A;  2HYX A;  1A2L A;  1WOU A;  2N5A A;  4KCE A;  4MMM A;  3O76 A;  2O89 A;  1CQG A; 
#chains in the Genus database with same CATH homology
 1F3A A;  2P5R A;  2VIM A;  2JZT A;  2OKA A;  3ZFL A;  4N10 A;  5CRH A;  4NHW A;  1HYU A;  1VRS D;  2YNX A;  3GX8 A;  2H0H A;  3KD0 A;  3LFL A;  1TJD A;  3MWH A;  3LXT A;  1TU7 A;  3F4R A;  3GH6 A;  3HVV A;  2VOC A;  5DCH A;  3IHG A;  2FWG A;  2QKE A;  3VI7 A;  3C1R A;  3TOT A;  1TP9 A;  2X49 A;  4IP1 A;  2MZC A;  3BJ5 A;  2PBJ A;  1PMT A;  2CX3 A;  1ERW A;  2A2R A;  4MNN A;  3MDK A;  1GSF A;  3SBC A;  3TOU A;  2GZZ A;  2C80 A;  4MF6 A;  1BG5 A;  1B9Y C;  3GRX A;  1TK0 B;  1J9B A;  2VL3 A;  4HJM A;  3FZ4 A;  4I8B A;  4E8H A;  1FHE A;  4MJE A;  2HLS A;  3GST A;  4OFN A;  2KUC A;  4HUA A;  5AGY A;  1R4W A;  3VPT A;  4XTS A;  2DKH A;  1YY7 A;  5ECI B;  5D9X A;  2H19 A;  1JZW A;  5G30 A;  4MZW A;  2FLS A;  1K3O A;  2L5L A;  3G7J A;  4G2E A;  4TR0 A;  2K9F A;  1O7U A;  1DUG A;  2B7J A;  5ECO B;  1O8W A;  1XW9 A;  4WF4 A;  3LW9 A;  3ZIV A;  4XIH A;  4KAE A;  3R2Q A;  2NTO A;  5BMU A;  2CQ9 A;  22GS A;  2A2P A;  2K18 A;  2MBS A;  2C3T A;  2WZ9 A;  1ZYE A;  3ZVJ A;  4LLR A;  2GST A;  2FCH A;  4V1A g;  2DJJ A;  2GVP A;  4G9H A;  2DJK A;  1PD2 1;  3QAV A;  4FQU A;  2AHE A;  3P8W A;  1ABA A;  1A0R P;  3L78 A;  1KTE A;  2LNT A;  13GS A;  3QPM A;  5GSS A;  1J08 A;  4ECI A;  1K3Y A;  5G1K A;  2BJX A;  1JFU A;  1XOB A;  1T4Z A;  2LRT A;  2R37 A;  2FGX A;  1TXX A;  1Z9H A;  1R26 A;  3MSZ A;  2H01 A;  1SD8 A;  1XWC A;  1QUW A;  4YKF A;  4HJ2 A;  2F8A A;  1A8L A;  1Z7P A;  1T7P B;  3KCM A;  4KUN A;  2P0G A;  4Z2U A;  1HNB A;  2VL2 C;  2LJR A;  3NZN A;  2EIO A;  3IR4 A;  2PVO C;  5JCG A;  4V2L A;  1KEB A;  4I2T A;  5KN2 A;  3PGT A;  2XBI A;  2FY6 A;  5DBQ A;  2ZNM A;  1FG4 A;  1VF1 A;  3NIV A;  2F51 A;  4ISD A;  3F63 A;  3TCO A;  3ZMK A;  2DIZ A;  4IEL A;  2P5Q A;  4X4J A;  2YOI A;  4GLT A;  4KX4 A;  1M2D A;  1TU8 A;  5J5N A;  4XS1 A;  1OAZ A;  4F0B A;  1QMV A;  2BMX A;  2WJU A;  3ZFB A;  5IOW A;  2OE3 A;  1BYE A;  3FRC A;  2HNL A;  2I81 A;  1MD4 A;  1SJ6 A;  2CZ3 A;  1ZL9 A;  4F0C A;  2I9H A;  4XRD A;  4NAX A;  3CSJ A;  1MDK A;  4FYU A;  2DML A;  1A2M A;  5B7C A;  4IP6 A;  4OWY A;  1BJX A;  1GLQ A;  2E2M A;  3IA1 A;  2MBT A;  4MJB A;  4ID0 A;  1I9D A;  1R5P A;  5F07 A;  4POM A;  2ON5 A;  4LL4 B;  3Q74 A;  20GS A;  3VWX A;  2G0F A;  1ZCP A;  2OA7 A;  4MF5 A;  3QD9 A;  5INY A;  4IJI A;  3RPP A;  2VCQ A;  1VF4 A;  1NM3 A;  1ZYQ B;  5ELA A;  2CAI A;  1M7T A;  4HOJ A;  4WKW A;  5EY6 A;  1SYR A;  1W4V A;  3IAM 2;  1V40 A;  2P31 A;  4NPB A;  2OBK A;  1X0R A;  2R4V A;  3TKR A;  1NSW A;  2H6Z A;  4X1U A;  2V6K A;  4ZB6 A;  2IMD A;  4EKZ A;  1UC7 A;  5LNK e;  4QQ7 A;  9GSS A;  1GNE A;  4J2F A;  4PNF A;  1X9W B;  5ECK B;  2B5Y A;  5D8I A;  2WCI A;  1SJI A;  1ERU A;  1EV9 A;  1GL8 A;  2LKU A;  4MCU A;  2H1A A;  2R6K A;  3D4M A;  3LYK A;  1YEX A;  3HVX A;  1EGO A;  2OJL A;  3N5O A;  4QL7 A;  1ZYP A;  1O85 A;  1O8X A;  4YQU A;  4BVX A;  1GLP A;  1SJZ A;  3CMI A;  3KGK A;  1AIU A;  4PXO A;  2H0I A;  1Q98 A;  5ECS A;  4L8E A;  3KTB A;  4CDO A;  1S3A A;  2PMT A;  3GN3 A;  3IRA A;  5B8B A;  1ZMA A;  3GHA A;  2RUF A;  6GSX A;  2K8S A;  2Z9S A;  2EC4 A;  2LJA A;  3HJO A;  1U3A A;  2KLX A;  1E6B A;  2VLU A;  2DJ3 A;  1GNW A;  2YWI A;  5IM9 A;  5HFI A;  3DRN A;  4K8M A;  1FVK A;  3QMX A;  4USS A;  2DKI A;  4ZB8 A;  2IIY A;  5IPG A;  4GCI A;  4KGI A;  3F6F A;  3DEX A;  5EPF A;  4YQM A;  3GL5 A;  2PPT A;  1N8J A;  4PQH A;  5CO3 A;  4HI7 A;  4V2M A;  1YDK A;  1RQM A;  2IN3 A;  5L71 A;  4N30 A;  2AB6 A;  2X4A A;  4KA0 A;  2LNS A;  2IL3 A;  5HR3 A;  2ZUP A;  4ICY A;  1YEP A;  1TK8 B;  2CVB A;  4FYB A;  4HU9 A;  3RHB A;  3LYP A;  5COH A;  5DJL A;  6GSY A;  1S3D A;  3GUS A;  2PN8 A;  4BVX B;  2H70 A;  3CSI A;  4YQV A;  1TKD B;  2YZH A;  4ACS A;  4NXI A;  2FWF A;  2H1G A;  3TKP A;  1V9W A;  2CVD A;  19GS A;  3W6G A;  1RW1 A;  1GSE A;  1AC1 A;  3OR5 A;  4L0U A;  2R0G A;  4ML6 A;  4O32 A;  4G0L A;  1EGR A;  2AV4 A;  1GUM A;  2C1Y A;  4MH2 A;  2WUL A;  4XRA A;  3TKS C;  2PWJ A;  4XS6 A;  4KDX A;  2O87 A;  1PN9 A;  4KSO A;  2H1B A;  5J3R A;  5IMZ A;  4WBR D;  2CT6 A;  1M99 A;  1TRS A;  3M1G A;  1WMJ A;  1DE2 A;  4O7H A;  2GQK A;  4AJ7 A;  4F82 A;  2VLV A;  4EDY A;  3BOA A;  1K0C A;  4MLY A;  1JZO A;  3JCM L;  3IC4 A;  3L9U A;  1NW2 A;  1M9A A;  1SD9 A;  2AJQ B;  4F9Z A;  2MMN A;  5HFG A;  2LS5 A;  5JCU A;  3ZZX A;  1T3B A;  2B5E A;  1U87 A;  3G9B A;  1PRX A;  2CZ2 A;  2O8V B;  1R5A A;  11GS A;  3HA9 A;  1FB6 A;  1K0B A;  1GSY A;  1PL2 A;  2AYT A;  3TDG A;  4HQS A;  2J23 A;  3PPU A;  4Q5R A;  4FYC A;  4PNG A;  1WIK A;  2YV9 A;  3HHV A;  3WT1 A;  4MAB A;  4LL1 B;  1SKS B;  5JCW A;  4K1F A;  1OYJ A;  4K9Z A;  2H1D A;  3GL3 A;  1K0O A;  3KZQ A;  3ZIJ A;  4FH8 A;  2REM A;  2H8L A;  3M9K A;  5D96 A;  1FW1 A;  3ZVJ D;  3KIJ A;  4DVC A;  5ECH B;  2RUE A;  2FUG 2;  4EUY A;  3TJB A;  5IMA A;  2C0G A;  2FA8 A;  5ECR B;  1LBK A;  2D2Z A;  4EL1 A;  3TKS E;  2VL9 A;  4FO5 A;  3ERG A;  3LEF A;  3UOM A;  1B9X C;  1ML6 A;  1JLW A;  4KH7 A;  4ZL7 A;  1AW9 A;  5BRT A;  2QC7 A;  3FR3 A;  1FVJ A;  3CBU A;  2OAC A;  1WP0 A;  4JR6 A;  1HQO A;  2E0Q A;  2N5F A;  4X0X A;  2PER A;  5ECM B;  2C0F A;  1EP7 A;  3HKR A;  4P3Y B;  1C72 A;  4EIP A;  3VK9 A;  4I97 A;  2JSZ A;  1CQH A;  4Q5Q A;  2I1U A;  3ME8 A;  2YV7 A;  2R0C A;  4AF2 A;  1LU4 A;  1Z5Y E;  1UA5 A;  3GMF A;  3I6A A;  1EP8 A;  2NVL A;  4WET A;  1HD2 A;  3RPN A;  1TRU A;  4ILF A;  3C7M A;  1PX7 A;  5D9T A;  5B6M A;  1K0N A;  3VFI A;  4O5U A;  3C8E A;  2JU5 A;  2H72 A;  3J7Y b;  1SEN A;  4F03 A;  3ZYW A;  4AJ6 A;  3D0Z A;  1QQ2 A;  2XHF A;  4EDZ A;  2F9S A;  3GTU A;  5ID2 A;  3U6V A;  4HEA 2;  4PGT A;  3CTG A;  3FY7 A;  4DEJ A;  1U88 A;  4NMU A;  4PTS A;  2OE1 A;  4BWS A;  2V6O A;  1PL1 A;  7GSS A;  1XWA A;  1DSB A;  1V98 A;  3EU4 A;  5IMD A;  3KTL A;  3E3E A;  1VF2 A;  2AAW A;  4CW9 A;  4I5Q A;  4YAP A;  3BBY A;  4L5L A;  2CVK A;  2JZR A;  4ZB9 A;  3DIE A;  3VUR A;  4K5S A;  5ECN B;  1T1V A;  1F2E A;  2CV4 A;  3IE3 A;  2ZCT A;  4GWR A;  5ELG A;  4ECB A;  4GSN A;  5E59 A;  4ZBA A;  1VF3 A;  1IYH A;  1B48 A;  1TW9 A;  2YWN A;  3TRX A;  1NHO A;  4IKH A;  2K6V A;  4MPG A;  1SK1 A;  2ES7 A;  1FOV A;  1OC9 A;  5CRE A;  3MNG A;  2FWE A;  3U5R E;  2FWH A;  2HRF A;  4O5Q A;  2G2Q A;  5DAL A;  3CXG A;  1PA3 A;  3UVH A;  5IMF A;  3ERW A;  3D21 A;  1ERT A;  3G7I A;  4RI6 A;  2XC2 A;  2HZE A;  3H4K A;  5J41 A;  3VWV A;  3TB2 A;  4G19 A;  1BQ7 A;  5G2Z A;  1S3C A;  4OCE A;  2TRC P;  1A8Y A;  2JAD A;  3IC8 A;  3LQ7 A;  2C0E A;  1B4P A;  4ECC A;  1YZX A;  5A4V A;  3GTU B;  5ID2 B;  4OD7 A;  3DXB A;  4JR4 A;  4IHU A;  5ECL B;  3ZTL A;  3TJJ A;  2HRN A;  4LMV A;  3C71 A;  5F06 A;  3WGX A;  2HSH A;  1XVW A;  2TRX A;  1THX A;  3A5W A;  2YAN A;  2VCW A;  4N11 A;  4IS0 A;  1W89 A;  4K0G A;  2J9H A;  1ILO A;  4BA7 A;  1EEJ A;  1PSQ A;  4ZBB A;  2OE0 A;  3FW2 A;  2IWT A;  5G1L A;  3L0H A;  4OCF A;  2L4C A;  2KOK A;  1GUK A;  4JBB A;  3D5J A;  1XVQ A;  1M2B A;  3VI5 A;  1JHB A;  3M0F A;  3TRQ A;  12GS A;  3IV4 A;  2X8C A;  1AUC A;  1OC9 B;  5GZZ B;  2CX4 A;  3FYG A;  5LD0 A;  1QGV A;  5DAL B;  3K8N A;  5KEJ A;  3FK8 A;  4E8E A;  5IMV A;  4EO3 A;  2HZE B;  2RM6 A;  2GDR A;  2YWO A;  4N0Z A;  4RI7 A;  2TIR A;  4RQR A;  2JSY A;  3F8U A;  3UIW A;  2XBQ A;  1X5D A;  5GAN D;  5A5K A;  2HSY A;  4WR5 A;  1F6M C;  3HZ8 A;  3ZIT A;  5IMC A;  2VCZ A;  1PGT A;  3I9V 2;  3Q18 A;  4IQA A;  3FR6 A;  4KB3 A;  5A4W A;  5IQY A;  1A2J A;  5HR1 A;  4IJ3 A;  2DLX A;  4O5R A;  4TR4 A;  5DAK A;  4KW6 A;  1PX6 A;  1G6Y A;  2IMK A;  2R3X A;  1V2A A;  4POK A;  2GT5 A;  6GSU A;  2VL2 A;  4PX1 A;  1TI3 A;  2MMO A;  4HZ2 A;  2WS2 A;  1MEK A;  3UJ1 A;  1AXD A;  5GST A;  2ALB A;  3PIN A;  3LXZ A;  2K8V A;  2YJ7 A;  3IHQ A;  2F8F A;  4HU7 A;  4JZQ A;  1RK4 A;  3UEM A;  2VD1 A;  4AGS A;  4LMW A;  5J9C A;  2C4J A;  1BX9 A;  2HI7 A;  2FHE A;  1SL0 B;  5D9V A;  3DYR A;  1XCC A;  1U6T A;  4PUA A;  5A4U A;  2VD0 A;  1A24 A;  3QFB C;  1H4O A;  4TXV A;  1GSD A;  3FZ5 A;  1IYI A;  3KEB A;  4BPY A;  4GQF A;  1F3B A;  4G0I A;  2RLI A;  3UAR A;  2DSA A;  2X64 A;  4L0W A;  4OFM A;  2NDO A;  3TJK A;  1X5E A;  1GTU A;  3LGC A;  1FAA A;  1THO A;  3EWL A;  1XPV A;  5HFK A;  3VPQ A;  2V41 A;  3ZL5 A;  3AY8 A;  4TKY A;  3GH9 A;  2IJY A;  18GS A;  4PQ1 A;  5C04 A;  2LRN A;  3EE2 A;  4V1A p;  5DQS A;  3DML A;  3IXR A;  1TRV A;  5JWQ B;  5D73 A;  5HR0 A;  3I69 A;  4OMV A;  1AAZ A;  5AN1 A;  4PUF C;  17GS A;  1GTI A;  3BD2 A;  5G5F A;  1Y6E A;  5DAK B;  1DE1 A;  2JAC A;  5CRD A;  4WEY A;  2LUS A;  1G7E A;  5ECP B;  1H75 A;  3TUE A;  2IME A;  3F6D A;  4XS4 A;  4DSR A;  2MMA A;  2YP6 A;  4DSQ A;  1UN2 A;  4WXT A;  4ZL8 A;  3W8S A;  4Q5N A;  1MD3 A;  4YAV A;  3CYN A;  3QFA C;  3R3E A;  2GGT A;  2A2S A;  2LRC A;  5HR2 A;  3FZA A;  1FB0 A;  3EMP A;  4D73 A;  1WJK A;  3N9J A;  2DJ0 A;  1Q4J A;  1GSU A;  2B6M A;  3US3 A;  4JED A;  3FR9 A;  3LG6 A;  3A2W A;  3GA4 A;  3F4T A;  3WD6 A;  4MP4 A;  3RDW A;  3UMA A;  4MJA A;  2DIY A;  4HDE A;  1ZYN A;  5DQY A;  5DVB A;  1HNA A;  2VCX A;  4TRX A;  1GUH A;  1GH2 A;  2FA4 A;  3LWA A;  1N2A A;  2VO4 A;  1A23 A;  2GQL A;  3FZ9 A;  5GAP D;  4J56 E;  1XXU A;  1Z6M A;  2EIQ A;  1OC8 A;  4CHS A;  3BCK A;  1KBN A;  1WWJ A;  4N0V A;  3FEU A;  3A5I A;  2E7P A;  4KCA A;  4ZXG A;  4G10 A;  5J9B A;  2GT6 A;  1O73 A;  4ZIJ A;  1K0M A;  2YWM A;  4XS4 B;  3UL3 A;  4Z7X A;  2O85 A;  2GLR A;  2B5X A;  1MTC A;  2IFQ A;  2L6C A;  2HRA A;  2M72 A;  4Q5F A;  4KND A;  1V58 A;  4D73 B;  6GST A;  5EVO A;  2H74 A;  2IMI A;  2WRT A;  3HDC A;  5DJM A;  4EXJ A;  3H8Q A;  4O92 A;  3L9V A;  4CY6 A;  2FNO A;  3DD3 A;  4TOP A;  3QOU A;  2IMF A;  5FWG A;  4F2I A;  1WRY A;  3IPZ A;  4NV5 A;  2WGR A;  3EPT A;  1X9S B;  1GUL A;  3Q19 A;  6GSW A;  1T00 A;  2NPB A;  3UBK A;  1TDI A;  3L4N A;  1E2Y A;  1JZR A;  3EYT A;  4POB A;  4IGJ A;  4JE1 A;  1ZZY A;  3ZML A;  2V32 A;  3FKF A;  1EWX A;  1WPI A;  2L4Q A;  4ULX A;  5AIV A;  4Z2T A;  2H66 A;  1SKW B;  3F3R A;  1PKZ A;  1OKT A;  1ZOF A;  2GZY A;  1U3I A;  1QFN A;  2O7K A;  3ZRE A;  3QAG A;  4K7N A;  4K2D A;  1TOF A;  4X43 A;  2GZP A;  1XWB A;  3MIX A;  3HYP A;  4EIQ A;  14GS A;  3EMX A;  3KP8 A;  4I2U A;  2LJK A;  1SK0 A;  2LQO A;  2CAQ A;  2MMZ A;  1ON4 A;  5CRW A;  2LV3 A;  4BL7 A;  3TKS A;  16GS A;  3EU3 A;  1F37 A;  5EL8 A;  2IFQ B;  1Z3E A;  3KXO A;  3H1N A;  1EOG A;  2LTK A;  4TR1 A;  3MYD A;  3GX0 A;  1GWC A;  3RAZ A;  1M0U A;  3GV1 A;  1G6W A;  1O6J A;  2WB9 A;  4GTU A;  4WF5 A;  3IAS 2;  4G0K A;  4OO5 A;  4J57 E;  2GTU A;  2XPE A;  3HVS A;  3MAK A;  3CSH A;  3HCZ A;  5JWR B;  4I6X A;  1XOA A;  4MJC A;  6GSS A;  1EZK A;  4GRF A;  4WBJ A;  1V57 A;  2HRK A;  1OKD A;  3TKQ A;  3KP9 A;  3FHK A;  2HSM A;  1X5C A;  3GKN A;  2DMM A;  1GTA A;  3M9J A;  2YZU A;  3D4T A;  3P2A A;  4HQZ A;  4HZ4 A;  4Z2R A;  1A0F A;  1M2A A;  2OAD A;  2L5O A;  5F0G A;  3HZ4 A;  2HE3 A;  2C3N A;  1XWG A;  4TR3 A;  2I3Y A;  2M46 A;  4TW5 A;  3ERF A;  4BL7 B;  5G31 A;  2CA8 A;  1T8E B;  4MA9 A;  3D22 A;  5JWO B;  1OE7 A;  1XIY A;  3O6T A;  4MDC A;  5F8B A;  4TR1 B;  3A2X A;  4JU5 A;  2R5G A;  5LCZ A;  4ZL9 A;  2KHP A;  1F9M A;  2M80 A;  2VM1 A;  2B1K A;  4EE0 A;  3H93 A;  2MYG A;  1MDI A;  4MZB A;  4NV2 A;  1XW5 A;  2LQQ A;  4RQX A;  4BVY A;  1BAY A;  1PQN A;  1XBS A;  3CRT A;  3HJP A;  4IQ1 A;  1JLV A;  3LSZ A;  1PKW A;  5D93 A;  2C3Q A;  3QCP A;  1QK8 A;  1SL2 B;  5H5R A;  3IK9 A;  2V1M A;  1XWK A;  1JZD A;  4IW9 A;  1EEM A;  1M9B A;  2PU9 C;  3D6I A;  2F3M A;  3UBL A;  1YJ6 A;  2N5B A;  4ZIL A;  4DSS A;  2C0D A;  2X8G A;  1GTB A;  4ECJ A;  4EF0 A;  3IOS A;  3DGQ A;  4L5O A;  4K0N A;  5C00 A;  1Y25 A;  3KH9 A;  3C1S A;  1YKA A;  3PH9 A;  1Z6N A;  2VUP A;  4K7O A;  2VCV A;  3KMN A;  1XZO A;  2PGT A;  1KNG A;  1SU9 A;  4MK3 A;  1TK5 B;  3UVT A;  5CRG A;  3SWL A;  3DVW A;  3WGE A;  3GNJ A;  4CY8 A;  3S9F A;  3EUR A;  4TXO A;  4RUV A;  3W8J A;  2VAF A;  3TJF A;  3APS A;  2VLT A;  3KH7 A;  4MZC A;  1YF0 A;  1B8X A;  3GUR A;  2HFD A;  4BVY B;  1AQX A;  2KP1 A;  1EV4 A;  2B1L A;  3I43 A;  3KMO A;  2B3S A;  2PVQ A;  4A5P A;  2DJ2 A;  5KN1 A;  4EVM A;  3WT2 A;  4ML1 A;  4IBP A;  2HT9 A;  3A2V A;  4NWY A;  1R7H A;  2ON7 A;  1AQW A;  3WYW A;  1WE0 A;  1TTZ A;  2UZ8 A;  8GSS A;  5KN0 A;  1K3L A;  4POL A;  5FT3 A;  1XFL A;  1J0F A;  1G0T A;  4GSS A;  4K2X A;  2GSR A;  1USB A;  1EOH A;  4K5R A;  1NHY A;  1T4Y A;  4DSS B;  4GF0 A;  1G7O A;  2H6Y A;  2L57 A;  2A4V A;  2R2J A;  3M8N A;  2X8H A;  2JZS A;  1UVZ A;  4NHZ A;  1QXH A;  5AIS A;  5CNW A;  1SKR B;  4TN8 A;  2LST A;  3KJY A;  4HS1 A;  5CAX A;  2OBI A;  1SK2 A;  3IDV A;  5AIX A;  3VWU A;  1MDJ A;  3KM6 A;  3EC3 A;  4TXO B;  5IO0 A;  2H71 A;  4MPF A;  2DJ1 A;  2EIR A;  2V2G A;  2JL4 A;  3Q6O A;  4MH3 A;  4LA1 A;  2AUV A;  4IN0 A;  5J4U A;  4ZBD A;  3APQ A;  4V2N A;  3QDN A;  2RII A;  1SL1 B;  1ACV A;  5IOX A;  3H79 A;  3HY2 A;  2C8U A;  2H75 A;  3EVI A;  4OO4 A;  4XHM A;  3RBT A;  4OFT A;  5ABR A;  4TVE A;  5KOW A;  3APO A;  2B7K A;  2YN1 A;  2H73 A;  4PUR A;  3CTF A;  2YJH A;  2L6D A;  5CYY A;  1O81 A;  3GFK A;  3BCI A;  5DCG A;  2KP2 A;  2FD3 A;  3ME7 A;  1YKC A;  4EC0 A;  1HNC A;  3IK7 A;  3QR6 A;  3E9J B;  1PN0 A;  4K6X A;  1BED A;  5IO2 A;  1XW6 A;  1URM A;  3QAW A;  4GST A;  4WR4 A;  1I5G A;  3P7X A;  2WFC A;  3C73 A;  4XCS A;  3PR8 A;  1AQV A;  1OC3 A;  2VM2 A;  4JRR A;  4H86 A;  10GS A;  2H30 A;  2YCD A;  5FHI A;  3GKX A;  2HXK A;  3WGD A;  1FOH A;  2GS3 A;  4KF9 A;  2A4H A;  5IIZ A;  1K0D A;  3DVX A;  3RHC A;  2WDU A;  2NBS A;  3UAP A;  1ST9 A;  4YKG A;  1DBY A;  3VWW A;  1OVN A;  6GSV A;  2BTO T;  1SYX A;  3J7Y k;  3GYK A;  3FMW A;  2I4A A;  3E0U A;  2RM5 A;  3DWV A;  2QSI A;  3ZLP A;  2H76 A;  1TI1 A;  4IVF A;  3ED3 A;  3G7Y A;  4FIW A;  2R0P A;  5B6N A;  3F9U A;  3DKS A;  1TRW A;  3TJG A;  3V1W A;  4MF7 A;  4YH2 A;  1GSQ A;  3L9S A;  3ZRD A;  2E2G A;  1GRX A;  2PUK C;  3F3Q A;  2GQM A;  4KSM A;  1LJR A;  2VCT A;  2DBC A;  5IPH A;  4KDY A;  1B4Q A;  5H5Q A;  3VLN A;  3TGZ A;  2H0G A;  1FO5 A;  5CP1 A;  3GIX A;  2L59 A;  3NOF A;  5G5E A;  3P90 A;  5ENU A;  1ZGN A;  4PQI A;  2QGV A;  1X9M B;  5ECQ B;  4K7I A;  3HXS A;  2GSQ A;  3A3T A;  2GSS A;  4AJ8 A;  1GSS A;  2XPD A;  2LEG A;  1K0A A;  3M3M A;  4BWQ A;  5HQP A;  3F4S A;  4GXZ A;  3TRP A;  4KDU A;  5H5S A;  3HJM A;  3CRU A;  4GQC A;  5F05 A;  2QA2 A;  3LJR A;  2QA1 A;  5KOX A;  3F0I A;  2YPM A;  3HD5 A;  3ISO A;  2IPA A;  1VGL A;  4QL9 A;  5D9W A;  5E4W A;  1YF1 A;  2DC5 A;  5B8A A;  2HZF A;  1GP1 A;  3GKK A;  3EIN A;  2X99 A;  1Z7R A;  4KE3 A;  3GKM A;  1YQ1 A;  1ERV A;  2H6X A;  5KN3 A;  3IBH A;  3O3T A;  1OE8 A;  5DDL A;  3LOR A;  3GSS A;  2HYX A;  1A2L A;  1WOU A;  2N5A A;  4KCE A;  4MMM A;  3O76 A;  2O89 A;  1CQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...