5GAND

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
ASVLLPQLRTGWHVDQAIVTETKRLVVIRFGRKNDRQCMIMDELLSSIAERVRNFAVIYLCDIDEVSDFDEMYELTDPMTVMFFYHNKHMMCDFGTGNNNKLNFIVDDKQEMIDILETIFRGARKNKGLVVSPYDYNHKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
total genus 37
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02966 DIM1 Mitosis protein DIM1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ganD00
3BCIA 4NPBA 4ECCA 1PRXA 2E2MA 4K7IA 1V58A 2HE3A 5ECSA 2LRNA 1URMA 3R2QA 4GCIA 3C71A 1M2BA 2C0DA 1GTIA 5ECLB 2YWOA 2DIYA 4MA9A 1T4ZA 5IOWA 3I43A 2B3SA 3KIJA 1K0MA 4MJCA 3L9SA 2DMMA 3O76A 1FG4A 4EL1A 2CZ3A 5J9BA 2FGXA 4PURA 1BX9A 1PMTA 3F4TA 4OFNA 1EGOA 1NHYA 1Z7RA 4NHZA 3LFLA 1A23A 1PN9A 1ON4A 2J23A 3KD0A 2FHEA 4DVCA 4NMUA 2LRCA 4BVYA 3F8UA 3LXTA 4K6XA 3TJGA 2H1AA 4YQVA 3DMLA 5ECOB 2FWHA 2HZEB 4MF7A 2OE1A 2H71A 5HR3A 3ZLPA 2MMNA 4HS1A 1XXUA 3E3EA 3W8JA 3H4KA 2CAQA 1S3DA 1LU4A 1JZDA 2MMAA 3IBHA 4PXOA 1EP7A 4F0BA 1XWKA 4OCFA 1ILOA 4LA1A 3VPQA 4XRDA 1YF1A 1HNCA 4EDYA 1B4QA 5E4WA 2LJKA 2I3YA 1K3LA 3J7Yb 1U3AA 5AGYA 2VLUA 1A0RP 2C3QA 3NIVA 1N8JA 2VL3A 3N9JA 4V2MA 1SJZA 3CMIA 1T1VA 4MMMA 4XS4B 1K0DA 1GNEA 3APQA 5L71A 2AHEA 4TOPA 1V57A 2RUFA 2DC5A 4ECJA 4I2UA 2OE3A 1ZMAA 1AAZA 2VCZA 1K3YA 2AAWA 3I69A 2GQMA 3CTGA 4FIWA 1TTZA 4KDUA 2BMXA 3D22A 1A2LA 3H79A 1O81A 3GKXA 2CAIA 3UMAA 4TR4A 3Q19A 2MBSA 4KUNA 2HT9A 4XRAA 3IOSA 3VWXA 1SL1B 3TRXA 3H1NA 4PGTA 3N5OA 4WETA 1GSUA 2WDUA 2H30A 2LJAA 1PKWA 2LNSA 1TRWA 3U6VA 4ZXGA 4PUAA 1Y25A 2FA8A 2B7JA 3C8EA 1QK8A 3VI5A 3HVVA 2XPEA 3QAGA 4EVMA 2B7KA 3QR6A 3ZL5A 4EO3A 2KHPA 1CQGA 5IO2A 1C72A 20GSA 1PA3A 3EINA 2IIYA 1B9XC 1FOVA 4AJ6A 3IAS2 3Q6OA 4NAXA 2KUCA 4ZBDA 5INYA 1R7HA 5ELAA 1AQVA 3IC4A 6GSXA 1UVZA 3SBCA 2HNLA 2KP2A 2K8VA 4KE3A 4I8BA 2YWNA 2K18A 5JWOB 3HXSA 1V9WA 3UBKA 5ECMB 5F0GA 3DWVA 1EV4A 5COHA 4YQUA 2E0QA 4E8HA 2GZPA 2K9FA 5DQYA 4ZBBA 4YH2A 4TR1B 1ZYEA 3H93A 3GMFA 4ML1A 1Z7PA 1OE8A 4GSNA 4ILFA 4OCEA 3C1RA 4MABA 3UEMA 4MF5A 3EC3A 2VIMA 3G9BA 3HVXA 4RQXA 1O73A 4IN0A 2P5QA 2EC4A 3GX0A 2AB6A 3HVSA 1XBSA 2XHFA 4KSOA 1TRUA 3PGTA 1I9DA 2IL3A 5HR1A 1O8XA 1YDKA 4IP6A 1GSEA 3KMNA 1M0UA 3CYNA 4N11A 3D5JA 4XHMA 3WT2A 2GZYA 5CRGA 1Q98A 1WOUA 3FZ5A 1KBNA 2H0IA 1OC9B 3EURA 5FWGA 3Q18A 3BCKA 2FWGA 5IO0A 1EV9A 1ST9A 1VF1A 4HUAA 2H8LA 3F3RA 2HRFA 4MP4A 3TJKA 4O7HA 1X9WB 2VCWA 1H4OA 2XC2A 2YJHA 2F9SA 1ZZYA 1VGLA 3GTUB 5G31A 1THOA 2GS3A 2JU5A 3FZ9A 4AJ8A 3MDKA 5EY6A 2LV3A 2K6VA 4HDEA 4N0ZA 1A2MA 2I81A 3US3A 5ECKB 5KN1A 1HNAA 2PUKC 4J57E 3LG6A 6GSTA 4TXVA 5D73A 4L5OA 5DJMA 4GQCA 1F37A 1KEBA 2E2GA 1WJKA 4K8MA 5A4VA 4JU5A 1AW9A 4WF5A 3IE3A 3EWLA 2JSZA 5ECNB 14GSA 1HNBA 5B6NA 3ZVJD 5LD0A 3HYPA 2R4VA 4FO5A 3TOUA 3APSA 1V98A 1ERTA 4BA7A 6GSYA 2WB9A 3C7MA 2I1UA 5IMCA 4DSQA 3U5RE 3NZNA 3HY2A 1SJ6A 2L6CA 3GH6A 2WGRA 1A8LA 3EU4A 1RQMA 1Y6EA 1AXDA 2H66A 1MDJA 2Z9SA 3KH7A 5A4WA 3FEUA 3GKKA 3QMXA 1T3BA 2F8AA 4WR4A 3WYWA 3LWAA 3FZAA 2CX4A 5G1KA 4HQZA 1Q4JA 4EDZA 6GSVA 1FVKA 2N5BA 1SK0A 4ZBAA 3MAKA 4K9ZA 2ON7A 1WRYA 5F05A 4MZCA 2VCQA 4GLTA 3LSZA 5J5NA 4POLA 2YN1A 5HFKA 3HZ8A 6GSWA 1ZYQB 2DJ1A 1SL2B 3GURA 1JFUA 3QFBC 5H5QA 4WXTA 2JACA 4XS4A 2G2QA 5KEJA 3C1SA 2TIRA 5ID2B 1TK0B 1K0OA 1XWGA 2L5LA 3Q74A 2AV4A 9GSSA 2H6ZA 1SD9A 4MK3A 1FAAA 4IQ1A 3G7IA 3ZITA 4MH3A 1WMJA 3C73A 2V2GA 4HQSA 3AY8A 3HKRA 1F3BA 1MD3A 3EYTA 4O32A 1XPVA 4LL4B 4GRFA 4RUVA 1GH2A 4KGIA 1JLWA 2X64A 5FT3A 3HZ4A 2LTKA 3IR4A 4X43A 2L4QA 4EXJA 1M99A 5CP1A 2CX3A 2LS5A 3GYKA 2IMDA 2WCIA 1XIYA 1U87A 1PX6A 1SKWB 4F82A 4Q5FA 1ZGNA 1E6BA 2ON5A 3UOMA 4TVEA 2CVKA 3FKFA 3HJOA 3NOFA 3A2VA 1EEMA 2P5RA 1SD8A 4E8EA 3QAWA 4PUFC 1RK4A 3E9JB 3BD2A 4MCUA 3ZVJA 2DMLA 3CBUA 4MPFA 3M3MA 1QFNA 2YANA 3HCZA 2NPBA 2JZSA 3ZMLA 1Z3EA 3TKSE 1XWBA 2H0HA 2X99A 3GNJA 4F9ZA 1LBKA 1T8EB 5GZZB 2VD1A 1BEDA 4PQIA 1ML6A 1OYJA 3QCPA 2C1YA 1F3AA 3KGKA 1JLVA 2FD3A 1JZWA 1UA5A 2B1KA 2B5YA 2O87A 2M46A 2R2JA 1XVWA 1YJ6A 1B9YC 3LXZA 3FW2A 3G7JA 3I9V2 5C04A 2YZUA 1FO5A 2IN3A 2HLSA 2JZRA 1DSBA 1SKRB 2HFDA 2YPMA 3L9VA 4NV5A 3ISOA 1SENA 4MJBA 2F3MA 2R5GA 3L0HA 4IJ3A 3BJ5A 1IYHA 4XS6A 2P0GA 2DBCA 5IMZA 2M72A 2O89A 2H1GA 3UVTA 5D9TA 2A2RA 3QAVA 1K0AA 3PR8A 3FRCA 1GUKA 3TJJA 5DCGA 1EOHA 1SYRA 1TI1A 3TKSC 3FZ4A 2XBIA 4OO4A 5HFGA 1OC9A 2R6KA 3LYPA 4PQHA 4KA0A 3LGCA 2BTOT 1R26A 4WEYA 3VI7A 2PMTA 4HI7A 1NM3A 4JZQA 2DLXA 4BWSA 4WR5A 5JCGA 4EUYA 1R5PA 1UN2A 3HA9A 4RI6A 1AQWA 1AUCA 1H75A 5DAKB 4IVFA 4G19A 1EEJA 1JZRA 3ZREA 3WGXA 3ZIJA 5E59A 3KXOA 2N5AA 5EPFA 3RBTA 2RLIA 2MZCA 4DSRA 5DALB 2TRXA 5D9XA 2B5XA 4H86A 1TK8B 1IYIA 2VO4A 5LCZA 5CRDA 1ABAA 3P7XA 3F0IA 2H75A 3L9UA 1THXA 2M80A 3F4RA 3GL5A 1Z6MA 1YKAA 5G1LA 1PKZA 4ZIJA 4K7OA 2ZNMA 3ZFBA 8GSSA 2O7KA 4MZBA 4FYBA 2O8VB 1M2DA 1PSQA 4I97A 2IMEA 2HSHA 2WULA 4MJEA 4I5QA 3D0ZA 2P31A 4D73B 2JSYA 4ZB6A 2L4CA 4ZB8A 2LKUA 2R3XA 5HFIA 2G0FA 4NWYA 4KCAA 4AF2A 1GSDA 4MLYA 2VLTA 1I5GA 3DEXA 3MNGA 1GRXA 3LJRA 2OA7A 4K0NA 1K3OA 4P3YB 2D2ZA 3ZMKA 1TKDB 1GWCA 1JZOA 1GUHA 5DQSA 4MF6A 5ECHB 5D9VA 5JWQB 3LQ7A 2IPAA 1VF2A 1FB0A 4ZL8A 1WP0A 2YCDA 1GULA 2JZTA 2GSTA 1QXHA 4PQ1A 2VCTA 3EMPA 3DYRA 4V1Ag 2B1LA 5JCWA 1F6MC 2C3NA 1VF4A 3M1GA 1EOGA 4KB3A 1ERUA 2GSQA 1TDIA 1PX7A 5B8BA 1HQOA 4RI7A 5ID2A 1GSQA 4JR6A 4HU7A 5A5KA 2H72A 3TB2A 5F06A 2EIOA 4ZILA 1Z5YE 4TR3A 4N0VA 2MMZA 4BL7A 2VD0A 3MWHA 4X0XA 3UAPA 3FHKA 3LORA 1M2AA 4KAEA 3GKNA 1XCCA 3GSSA 1PD21 4IQAA 3UBLA 2KOKA 1U88A 4WBJA 2AYTA 3GSTA 2DIZA 4FYUA 2GGTA 2WS2A 2R37A 3QD9A 1TW9A 2BJXA 2JL4A 4N30A 2VL2C 5DDLA 3G7YA 2PERA 4I6XA 1SYXA 4TRXA 3FY7A 1XWAA 4XIHA 4IP1A 2GZZA 4XS1A 3FR6A 1BG5A 3TRQA 1NW2A 4YAVA 4G9HA 3ZIVA 4L8EA 4POMA 5J41A 3KP8A 4ZB9A 1W89A 1NSWA 5A4UA 4Z7XA 3SWLA 1MDKA 2QSIA 1OKTA 2H0GA 3F4SA 1N2AA 3GH9A 1LJRA 1FHEA 3GL3A 4XTSA 5DJLA 1F9MA 4IS0A 5JCUA 6GSUA 1FW1A 2WRTA 2IFQB 2VUPA 3ME7A 4O92A 1WPIA 1O85A 3ERGA 4QQ7A 1PQNA 1S3CA 1PGTA 3KCMA 2HXKA 3F9UA 1TU7A 4ZL7A 4O5RA 1SL0B 3TDGA 4WF4A 2OACA 5IMFA 4JEDA 3V1WA 5J9CA 1RW1A 1MDIA 4ID0A 1M9BA 1K0BA 4V2NA 1WWJA 5B8AA 3UJ1A 1G7EA 4L5LA 1XZOA 2F51A 1GSFA 2PU9C 3HJMA 2GQKA 2HZEA 2X8CA 1G0TA 2CV4A 4YAPA 3UARA 1G6WA 3MSZA 1R4WA 5IOXA 4TXOB 3GKMA 4XCSA 4K7NA 2H76A 2A4VA 4OWYA 2VLVA 1WIKA 3UVHA 1XW6A 3IK9A 4MPGA 3ERWA 4GWRA 2WJUA 1TJDA 1XVQA 2PVOC 2FNOA 1X9SB 4JE1A 4ECIA 5H5SA 5AIVA 1XOAA 2HI7A 3D21A 2V6OA 4L0UA 2HSYA 4TR0A 3JCML 5CNWA 3M8NA 5F07A 3IXRA 4QL9A 4QL7A 5D93A 3IPZA 4WKWA 2GT6A 3BOAA 3L78A 5ECPB 1SKSB 1G6YA 2O85A 4HJ2A 1U6TA 2VOCA 4BPYA 1A0FA 5GSTA 2CVBA 2VM1A 2CA8A 4YQMA 1YEPA 2VL9A 3KH9A 2B6MA 2H74A 3LYKA 3HDCA 5B6MA 1ZL9A 7GSSA 2LUSA 2RUEA 1OE7A 1V40A 1DUGA 3W8SA 5CRWA 4F03A 22GSA 2VAFA 4MH2A 3EU3A 2GSSA 3PH9A 1T4YA 3QOUA 3TOTA 3M9KA 2VL2A 3P90A 3RPNA 5G5EA 4KH7A 1QGVA 2RIIA 2IWTA 4OFMA 5FHIA 1EGRA 2PGTA 1HYUA 4BWQA 1BYEA 3CSJA 1OVNA 5CO3A 4OMVA 3RAZA 3VK9A 2VCVA 3I6AA 3EMXA 4FYCA 2GDRA 4RQRA 2VM2A 5GAND 1OAZA 2V32A 4J56E 4LLRA 5G30A 3H8QA 1X5EA 1NHOA 1K0CA 4V1Ap 2FY6A 1HD2A 3TGZA 4MDCA 1F2EA 3GUSA 5ABRA 1M9AA 1WE0A 2OE0A 2TRCP 1OKDA 1TOFA 1TXXA 2E7PA 3RPPA 4HJMA 2FCHA 3IRAA 1V2AA 5IPGA 4GXZA 3TKQA 4OFTA 18GSA 5ENUA 3WT1A 2B5EA 3VWVA 1UC7A 3P2AA 1GNWA 1AC1A 2L59A 2YV9A 3RDWA 5HR2A 4NXIA 5HQPA 3ERFA 4TR1A 2FA4A 2LEGA 2GT5A 1DE2A 3KEBA 2GSRA 10GSA 2LSTA 4MJAA 3CXGA 4EE0A 4PX1A 2NTOA 3ED3A 2H73A 5CAXA 4NV2A 3D4TA 2YNXA 11GSA 2H1BA 1GTUA 2DJJA 2V1MA 5F8BA 1QUWA 3TJBA 1TU8A 2OKAA 1SJIA 3P8WA 2I4AA 2PBJA 2OJLA 3DIEA 6GSSA 3ME8A 5ELGA 3FR9A 2REMA 3W6GA 3APOA 4G2EA 2CT6A 3UIWA 2PN8A 1USBA 1YQ1A 3GV1A 2C0FA 2ZCTA 4KCEA 2GTUA 4OD7A 4KNDA 3DKSA 5IQYA 2WZ9A 4PNGA 4ZL9A 3CRTA 3VWUA 5B7CA 4IKHA 1A24A 5J4UA 16GSA 5HR0A 3IK7A 2GVPA 2H6YA 4I2TA 3KMOA 5G5FA 4JR4A 1ERWA 1FVJA 2AUVA 4HOJA 1O7UA 2N5FA 3GTUA 2RM6A 5CRHA 3GX8A 4GTUA 3CRUA 13GSA 2YOIA 3ZYWA 4K2DA 4DSSB 4AGSA 3S9FA 2MMOA 2HYXA 1AIUA 3TJFA 3TUEA 3VFIA 3CTFA 3GN3A 1XW5A 1GP1A 4HZ4A 1BJXA 4V2LA 2C80A 2OADA 3WGEA 2IFQA 2L5OA 4CW9A 2C0GA 1GSYA 2FLSA 4Q5RA 4POKA 3D4MA 1GTBA 5EVOA 2CZ2A 4ISDA 4PNFA 2QC7A 5KN2A 2H6XA 2IMIA 1ZOFA 1TI3A 1GTAA 1OC8A 3D6IA 4HZ2A 1Z9HA 3ZFLA 3L4NA 2HRNA 1CQHA 5GSSA 1JHBA 3GHAA 3EVIA 5GAPD 1MD4A 2GLRA 2C8UA 1B48A 3J7Yk 2L57A 2J9HA 5JWRB 3TKPA 5LNKe 2C3TA 1Z6NA 2ZUPA 3FK8A 3FR3A 4G10A 4FH8A 1T7PB 3A2WA 3HD5A 4TXOA 1GLQA 5KN0A 2NBSA 2PVQA 1SK2A 5IM9A 3QFAC 3M0FA 1PL1A 3QPMA 2C0EA 5ECRB 2L6DA 3QDNA 2DJKA 3F6FA 4Q5NA 3PINA 4KDXA 5D8IA 2LJRA 1VRSD 2H01A 1PL2A 1GLPA 5DBQA 2CQ9A 1ERVA 1YY7A 1DE1A 4ULXA 4EKZA 1GUMA 4EF0A 4ACSA 4POBA 1T00A 2H1DA 3GFKA 5C00A 5AN1A 3TRPA 2IMKA 5EL8A 5IMAA 1DBYA 1YEXA 3M9JA 2X8HA 4TW5A 3TKSA 5KN3A 2AJQB 3ZTLA 1TP9A 3O6TA 2LRTA 5IIZA 2LNTA 2DSAA 1EZKA 1X5CA 3KM6A 1X0RA 3IV4A 4X1UA 2FWEA 2IJYA 3ZRDA 2CVDA 1GSSA 2PWJA 3HJPA 5CREA 2FUG2 3GRXA 3DRNA 5AIXA 3RHBA 1FB6A 3WGDA 3HHVA 4TN8A 2NVLA 3F63A 4IELA 4AJ7A 2YWIA 1B8XA 4GF0A 1TK5B 2ES7A 2KLXA 3DVWA 1BAYA 2GQLA 2X8GA 2ALBA 5DCHA 2NDOA 4L0WA 1EP8A 4EC0A 1XOBA 4K0GA 2F8FA 19GSA 2HZFA 2FWFA 1KNGA 2WFCA 4GSSA 4LMVA 3A2XA 3F3QA 2DJ2A 1MEKA 2YWMA 3RHCA 1A2JA 2C4JA 1EWXA 3F6DA 3TCOA 3CSIA 5J3RA 4HU9A 2QKEA 3DD3A 3E0UA 4KW6A 4BVXA 1U3IA 4TKYA 2MBTA 4Q5QA 2H19A 3VWWA 4IBPA 1TRSA 2YV7A 1XW9A 1MTCA 2YJ7A 4OO5A 4HEA2 2I9HA 4KSMA 2MYGA 2V6KA 3KP9A 4NHWA 3EE2A 3UL3A 1E2YA 1YKCA 1A8YA 1B4PA 4JBBA 3IDVA 2VCXA 1XWCA 17GSA 2V41A 1J08A 2JADA 2LQQA 3K8NA 1X9MB 2DJ0A 4K1FA 2OBIA 4N10A 2XPDA 4LMWA 3IA1A 4IJIA 1KTEA 2H70A 3KTBA 1O6JA 2LQOA 4F2IA 1ZCPA 3KZQA 4IGJA 1AQXA 1R5AA 1O8WA 5DAKA 1OC3A 4GSTA 1BQ7A 3A5WA 1YZXA 1M7TA 3OR5A 4J2FA 5AISA 3DGQA 2EIRA 1SU9A 1QMVA 3TKRA 5H5RA 3GIXA 12GSA 5D9WA 4CHSA 4F0CA 5DALA 2RM5A 2PPTA 1QQ2A 2KP1A 1X5DA 4DSSA 4ECBA 3KTLA 1GL8A 1SK1A 4IW9A 3GA4A 2A2SA 1VF3A 4DEJA 5DVBA 5D96A 3KJYA 2YP6A 4JRRA 4KX4A 1YF0A 3BBYA 5IPHA 3VLNA 4ML6A 4GQFA 1ACVA 4IHUA 5IMVA 1J9BA 2XBQA 5IMDA 2IMFA 3IHQA 3FYGA 3VPTA 3A3TA 1K0NA 1W4VA 4MZWA 3CSHA 5ECIB 1J0FA 3O3TA 2QGVA 3IAM2 3DVXA 5ECQB 1TRVA 1XFLA 3ZZXA 3WD6A 4LL1B 5CYYA 3VURA 2K8SA 4WBRD 1S3AA 2EIQA 3DXBA 2DJ3A 2YZHA 3LEFA 2OBKA 4KDYA 1G7OA 4CDOA 5G2ZA 4D73A
chains in the Genus database with same CATH superfamily
3BCIA 4NPBA 4ECCA 1PRXA 2E2MA 4K7IA 1V58A 2HE3A 5ECSA 2LRNA 1URMA 3R2QA 4GCIA 3C71A 1M2BA 5BRTA 2C0DA 1GTIA 5ECLB 2YWOA 2DIYA 4MA9A 1T4ZA 5IOWA 3I43A 2B3SA 3KIJA 1K0MA 4MJCA 3L9SA 2DMMA 3O76A 1FG4A 4EL1A 2CZ3A 4O5QA 5J9BA 3FMWA 2FGXA 4PURA 1BX9A 1PMTA 3F4TA 4OFNA 1EGOA 1NHYA 1Z7RA 2X49A 4NHZA 3LFLA 1A23A 1PN9A 1ON4A 2J23A 3KD0A 2FHEA 4DVCA 4NMUA 2LRCA 4BVYA 3F8UA 3LXTA 4K6XA 3TJGA 1ZYNA 2H1AA 4YQVA 3DMLA 5ECOB 2FWHA 3LW9A 2HZEB 4MF7A 2OE1A 2H71A 5HR3A 3ZLPA 2MMNA 4HS1A 1XXUA 3E3EA 3W8JA 3H4KA 2CAQA 1S3DA 1LU4A 1JZDA 2MMAA 3IBHA 4FQUA 1EP7A 4PXOA 4F0BA 1XWKA 4OCFA 1ILOA 4LA1A 3VPQA 4XRDA 1YF1A 1HNCA 4EDYA 1B4QA 5E4WA 2LJKA 2I3YA 1K3LA 3J7Yb 1PFOA 1U3AA 5AGYA 2VLUA 1A0RP 2C3QA 3NIVA 1N8JA 2VL3A 3N9JA 4V2MA 1SJZA 3CMIA 1T1VA 4MMMA 4XS4B 1K0DA 1GNEA 3APQA 5L71A 2AHEA 4TOPA 1V57A 2RUFA 2DC5A 4ECJA 4I2UA 2OE3A 1ZMAA 1AAZA 2VCZA 1K3YA 2AAWA 3I69A 2GQMA 3CTGA 4FIWA 1TTZA 4KDUA 2BMXA 3D22A 1A2LA 3H79A 1O81A 3GKXA 2CAIA 3UMAA 3R3EA 4TR4A 3Q19A 2MBSA 4KUNA 2HT9A 4XRAA 3IOSA 3VWXA 1SL1B 3TRXA 3H1NA 4PGTA 3N5OA 4WETA 1GSUA 2WDUA 2H30A 2LJAA 1PKWA 3IHGA 1XG8A 2LNSA 1TRWA 3U6VA 4ZXGA 4PUAA 1Y25A 2FA8A 2B7JA 3C8EA 1QK8A 3VI5A 3HVVA 2XPEA 3QAGA 4EVMA 2B7KA 3QR6A 3ZL5A 4EO3A 2KHPA 1CQGA 5IO2A 1C72A 20GSA 1PA3A 3EINA 2IIYA 1B9XC 1FOVA 4AJ6A 3IAS2 3Q6OA 4NAXA 2KUCA 4ZBDA 5INYA 1R7HA 5ELAA 1AQVA 3IC4A 6GSXA 1UVZA 3SBCA 2HNLA 2KP2A 2K8VA 4KE3A 4I8BA 2YWNA 2K18A 5JWOB 3CQFA 3HXSA 1V9WA 3UBKA 5ECMB 5F0GA 3DWVA 1EV4A 5COHA 4YQUA 2E0QA 4E8HA 2GZPA 2K9FA 5DQYA 4ZBBA 4YH2A 4TR1B 1ZYEA 3H93A 3GMFA 4ML1A 1Z7PA 1OE8A 4GSNA 4ILFA 4OCEA 3C1RA 4MABA 3UEMA 4MF5A 3EC3A 2VIMA 3G9BA 3HVXA 4RQXA 1O73A 4IN0A 2P5QA 5BMUA 2EC4A 3GX0A 2AB6A 3HVSA 1XBSA 2XHFA 4KSOA 1TRUA 3PGTA 3MYDA 1I9DA 2IL3A 5HR1A 1O8XA 1YDKA 4IP6A 1GSEA 3KMNA 1M0UA 4USSA 3CYNA 4N11A 3D5JA 4XHMA 3WT2A 2GZYA 5CRGA 1Q98A 1WOUA 3IC8A 3FZ5A 1KBNA 2H0IA 1OC9B 3EURA 5FWGA 3Q18A 3BCKA 2FWGA 5IO0A 1EV9A 1ST9A 1VF1A 4HUAA 2H8LA 3F3RA 2HRFA 4MP4A 3TJKA 4O7HA 1X9WB 2VCWA 1H4OA 2XC2A 2YJHA 2F9SA 1ZZYA 1VGLA 3GTUB 5G31A 1THOA 2GS3A 2JU5A 3FZ9A 4AJ8A 3MDKA 5EY6A 2LV3A 2K6VA 4N0ZA 4HDEA 1A2MA 2I81A 3US3A 5ECKB 5KN1A 1HNAA 2PUKC 4J57E 3LG6A 6GSTA 4TXVA 5D73A 4L5OA 5DJMA 4GQCA 1F37A 1KEBA 2E2GA 1WJKA 4K8MA 5A4VA 4JU5A 1AW9A 4WF5A 3IE3A 3EWLA 4Z2RA 2JSZA 5ECNB 14GSA 1HNBA 5B6NA 3ZVJD 5LD0A 3HYPA 2R4VA 4FO5A 3TOUA 3APSA 1V98A 1ERTA 4BA7A 4Z2TA 6GSYA 2WB9A 3C7MA 2I1UA 5IMCA 4X4JA 4DSQA 3U5RE 3NZNA 3HY2A 1SJ6A 2L6CA 3GH6A 2WGRA 1A8LA 3EU4A 1RQMA 1Y6EA 1AXDA 2H66A 1MDJA 2Z9SA 1FOHA 3KH7A 5A4WA 3FEUA 3GKKA 3QMXA 1T3BA 2F8AA 4WR4A 3WYWA 3LWAA 3FZAA 2CX4A 5G1KA 4HQZA 4K2XA 1Q4JA 4EDZA 6GSVA 1FVKA 2N5BA 2DKHA 1SK0A 4ZBAA 3MAKA 4K9ZA 2ON7A 1WRYA 5F05A 4MZCA 2VCQA 4GLTA 3LSZA 5J5NA 4POLA 2YN1A 5HFKA 3HZ8A 6GSWA 1ZYQB 2DJ1A 1SL2B 3GURA 1JFUA 3QFBC 5H5QA 4WXTA 2JACA 4XS4A 2G2QA 5KEJA 3C1SA 2TIRA 4EIPA 5ID2B 1TK0B 1K0OA 1XWGA 2L5LA 3Q74A 2AV4A 9GSSA 2H6ZA 1SD9A 4MK3A 1FAAA 4IQ1A 3G7IA 3ZITA 4MH3A 1WMJA 3C73A 2V2GA 4BL7B 4HQSA 3AY8A 3HKRA 1F3BA 1MD3A 3EYTA 4O32A 1XPVA 4LL4B 4GRFA 4RUVA 1GH2A 4KGIA 1JLWA 2X64A 5FT3A 3HZ4A 2LTKA 3IR4A 4X43A 2L4QA 4EXJA 1M99A 5CP1A 2CX3A 2LS5A 3GYKA 2IMDA 2WCIA 1XIYA 1U87A 1PX6A 4CY8A 1SKWB 4F82A 4Q5FA 1ZGNA 1E6BA 2ON5A 3UOMA 4TVEA 2CVKA 3FKFA 3HJOA 3NOFA 3A2VA 1EEMA 2P5RA 1SD8A 4E8EA 3QAWA 4PUFC 1RK4A 3E9JB 3BD2A 4MCUA 3ZVJA 2DMLA 3CBUA 4MPFA 3HVNA 3M3MA 1QFNA 2YANA 3HCZA 2NPBA 2JZSA 3ZMLA 1Z3EA 3TKSE 1XWBA 2H0HA 2X99A 3GNJA 4F9ZA 1LBKA 1T8EB 5GZZB 2VD1A 1BEDA 4PQIA 1ML6A 1OYJA 3QCPA 2C1YA 4BVXB 1F3AA 3KGKA 1JLVA 2FD3A 1JZWA 1UA5A 2B1KA 1M3JA 2B5YA 2O87A 2M46A 2R2JA 1XVWA 1YJ6A 1B9YC 2DKIA 3LXZA 3FW2A 3G7JA 3I9V2 5C04A 2YZUA 1FO5A 2IN3A 2HLSA 2JZRA 1DSBA 1SKRB 2HFDA 2YPMA 3L9VA 4NV5A 3ISOA 1SENA 4MJBA 2F3MA 2R5GA 3L0HA 4IJ3A 3BJ5A 1IYHA 4XS6A 2P0GA 2DBCA 5IMZA 2M72A 2O89A 2H1GA 3UVTA 5D9TA 2A2RA 3EPTA 3QAVA 1K0AA 3PR8A 3FRCA 1GUKA 3TJJA 4G0IA 5DCGA 1EOHA 1SYRA 1TI1A 3TKSC 3FZ4A 2XBIA 4OO4A 5HFGA 1OC9A 2R6KA 3LYPA 4PQHA 4KA0A 3LGCA 2BTOT 2X4AA 1R26A 4WEYA 3VI7A 2PMTA 4HI7A 1NM3A 4JZQA 2DLXA 4BWSA 4WR5A 2HSMA 5JCGA 4EUYA 1R5PA 1UN2A 3HA9A 4RI6A 1AQWA 1AUCA 1H75A 5DAKB 4IVFA 4G19A 1EEJA 1JZRA 3ZREA 3WGXA 3ZIJA 5E59A 3KXOA 2N5AA 5EPFA 3RBTA 2RLIA 2MZCA 4DSRA 5DALB 2TRXA 5D9XA 2B5XA 4H86A 1TK8B 1IYIA 2VO4A 5LCZA 5CRDA 1ABAA 3P7XA 3F0IA 2H75A 3L9UA 1THXA 2QA1A 2M80A 3F4RA 3GL5A 1Z6MA 1YKAA 5G1LA 1PKZA 4ZIJA 4K7OA 2ZNMA 3ZFBA 8GSSA 2O7KA 4MZBA 4FYBA 2O8VB 4ICYA 1M2DA 1PSQA 4I97A 2IMEA 2HSHA 2WULA 4MJEA 4I5QA 3D0ZA 2P31A 4D73B 2JSYA 4ZB6A 2L4CA 4ZB8A 2LKUA 2R3XA 5HFIA 2G0FA 4NWYA 4KCAA 4AF2A 1GSDA 4MLYA 2VLTA 1I5GA 3DEXA 3MNGA 1GRXA 3LJRA 2OA7A 4K0NA 1K3OA 4P3YB 2D2ZA 3ZMKA 1TKDB 1GWCA 1JZOA 1GUHA 5DQSA 4MF6A 5ECHB 5D9VA 5JWQB 3LQ7A 2IPAA 1VF2A 1FB0A 4ZL8A 1WP0A 2YCDA 1GULA 2JZTA 2GSTA 1QXHA 4PQ1A 2VCTA 3EMPA 3DYRA 4V1Ag 2B1LA 4O5UA 5JCWA 3PPUA 1F6MC 2C3NA 1VF4A 3M1GA 1EOGA 4KB3A 1ERUA 2GSQA 1TDIA 1PX7A 5B8BA 1HQOA 4RI7A 5ID2A 1GSQA 4JR6A 4HU7A 5A5KA 2H72A 3TB2A 5F06A 4BVYB 2EIOA 4ZILA 1Z5YE 4TR3A 4N0VA 2MMZA 4BL7A 2VD0A 3MWHA 4X0XA 3UAPA 3FHKA 3LORA 1M2AA 4KAEA 3GKNA 1XCCA 3GSSA 1PD21 4IQAA 3UBLA 2KOKA 1U88A 4WBJA 2AYTA 3GSTA 2DIZA 4FYUA 2GGTA 2WS2A 2R37A 3QD9A 1TW9A 2BJXA 2JL4A 4N30A 2VL2C 5DDLA 3G7YA 2PERA 4I6XA 1SYXA 4TRXA 3FY7A 1XWAA 4XIHA 4IP1A 2GZZA 4XS1A 3FR6A 1BG5A 3TRQA 1NW2A 4YAVA 4G9HA 3ZIVA 4L8EA 4POMA 5J41A 4K5SA 3KP8A 4ZB9A 1W89A 1NSWA 5A4UA 4Z7XA 3SWLA 1MDKA 2QSIA 1OKTA 2H0GA 3F4SA 1N2AA 3GH9A 1LJRA 1FHEA 3GL3A 4XTSA 5DJLA 1F9MA 4KF9A 4IS0A 5JCUA 6GSUA 1FW1A 2WRTA 2IFQB 2VUPA 3ME7A 4Z2UA 4O92A 1WPIA 1O85A 3ERGA 4QQ7A 1PQNA 1S3CA 1PGTA 3KCMA 2HXKA 3F9UA 1TU7A 4ZL7A 4O5RA 1SL0B 3TDGA 4WF4A 2OACA 5IMFA 4JEDA 3V1WA 5J9CA 1RW1A 1MDIA 4ID0A 1M9BA 1K0BA 4V2NA 1WWJA 5B8AA 3UJ1A 1G7EA 4L5LA 1XZOA 2F51A 1GSFA 1S3RA 2PU9C 3HJMA 2GQKA 2HZEA 2X8CA 1G0TA 2CV4A 4YAPA 3UARA 1G6WA 3MSZA 1R4WA 5IOXA 4TXOB 3GKMA 4XCSA 4K7NA 2H76A 2A4VA 4OWYA 2VLVA 1WIKA 3UVHA 1XW6A 3IK9A 4MPGA 3ERWA 4GWRA 2WJUA 1TJDA 1XVQA 2PVOC 2R0CA 2FNOA 1X9SB 4JE1A 4ECIA 4CY6A 5H5SA 5AIVA 1XOAA 2HI7A 3D21A 2V6OA 4L0UA 2HSYA 4TR0A 3JCML 5CNWA 4YKFA 3M8NA 5F07A 3IXRA 4QL9A 4QL7A 5D93A 3IPZA 4WKWA 2GT6A 3BOAA 3L78A 5ECPB 1SKSB 1G6YA 2O85A 4HJ2A 1U6TA 2VOCA 4BPYA 1A0FA 5GSTA 2CVBA 2A2PA 2VM1A 2CA8A 4YQMA 1YEPA 2VL9A 3KH9A 2B6MA 2H74A 3LYKA 3HDCA 5B6MA 1ZL9A 7GSSA 2LUSA 2RUEA 1OE7A 1V40A 1DUGA 3W8SA 5CRWA 4F03A 22GSA 2VAFA 4MH2A 3EU3A 2GSSA 3PH9A 1T4YA 3QOUA 3TOTA 3M9KA 2VL2A 3P90A 3RPNA 5G5EA 4KH7A 1QGVA 2RIIA 2IWTA 4OFMA 3A5IA 5FHIA 1EGRA 2PGTA 1HYUA 4BWQA 1BYEA 3CSJA 1OVNA 5CO3A 4OMVA 3RAZA 3VK9A 2VCVA 3I6AA 3EMXA 4FYCA 2GDRA 4RQRA 2VM2A 5GAND 1OAZA 2V32A 4J56E 4LLRA 5G30A 3H8QA 1X5EA 1NHOA 1K0CA 4V1Ap 2FY6A 1HD2A 3TGZA 4MDCA 1F2EA 3GUSA 5ABRA 1M9AA 1WE0A 2OE0A 2TRCP 1OKDA 1TOFA 1TXXA 2E7PA 3RPPA 4HJMA 2FCHA 3IRAA 4G0LA 1V2AA 5IPGA 2A4HA 4GXZA 3TKQA 4OFTA 18GSA 5ENUA 3WT1A 2B5EA 3VWVA 1UC7A 3P2AA 1GNWA 1AC1A 2L59A 2YV9A 3RDWA 5HR2A 4NXIA 5HQPA 3ERFA 4TR1A 2FA4A 2LEGA 2GT5A 1DE2A 3KEBA 2GSRA 10GSA 2LSTA 4MJAA 4G0KA 3CXGA 4EE0A 4PX1A 2NTOA 3ED3A 2H73A 5CAXA 4NV2A 3D4TA 2YNXA 11GSA 2H1BA 1GTUA 2DJJA 2V1MA 5F8BA 1QUWA 3TJBA 1TU8A 2OKAA 1SJIA 3P8WA 2I4AA 2PBJA 2OJLA 3DIEA 6GSSA 3ME8A 5ELGA 3FR9A 2REMA 3W6GA 3APOA 4G2EA 2CT6A 3UIWA 2PN8A 1USBA 1YQ1A 2HRKA 3GV1A 2C0FA 2ZCTA 4KCEA 2GTUA 4OD7A 4KNDA 3DKSA 5IQYA 2WZ9A 4PNGA 4ZL9A 3CRTA 3VWUA 5B7CA 2UZ8A 4IKHA 1A24A 5J4UA 16GSA 5HR0A 2R0PA 3IK7A 2GVPA 2H6YA 4I2TA 3KMOA 5G5FA 4YKGA 4JR4A 1ERWA 1FVJA 2AUVA 4HOJA 1O7UA 2N5FA 3GTUA 2RM6A 2QA2A 5CRHA 3GX8A 5KOWA 4GTUA 3CRUA 5KOXA 13GSA 2YOIA 1M3IA 3ZYWA 4K2DA 4DSSB 4AGSA 3S9FA 2MMOA 2HYXA 1AIUA 3TJFA 3TUEA 3VFIA 3CTFA 3GN3A 1XW5A 1GP1A 4HZ4A 1BJXA 4V2LA 2C80A 2OADA 3WGEA 2IFQA 2L5OA 4CW9A 2C0GA 1GSYA 2FLSA 4Q5RA 4POKA 3D4MA 1GTBA 5EVOA 2CZ2A 4ISDA 4PNFA 2R0GA 2QC7A 5KN2A 2H6XA 2IMIA 1ZOFA 1TI3A 1GTAA 1OC8A 3D6IA 4HZ2A 1Z9HA 3ZFLA 3L4NA 2HRNA 1CQHA 5GSSA 1JHBA 3GHAA 3EVIA 5GAPD 1MD4A 2GLRA 2C8UA 1B48A 3J7Yk 2L57A 2J9HA 5JWRB 3TKPA 5LNKe 2C3TA 1Z6NA 2ZUPA 3FK8A 3FR3A 4G10A 4FH8A 1T7PB 3A2WA 3HD5A 1PN0A 4TXOA 1GLQA 5KN0A 4PTSA 2NBSA 2PVQA 1ZYPA 1SK2A 5IM9A 3QFAC 3M0FA 1PL1A 3QPMA 2C0EA 5ECRB 2L6DA 3QDNA 2DJKA 3F6FA 4Q5NA 3PINA 4KDXA 5D8IA 2LJRA 1VRSD 2H01A 1PL2A 1GLPA 5DBQA 2CQ9A 1ERVA 1YY7A 1DE1A 4ULXA 4EKZA 1GUMA 4EF0A 4ACSA 4POBA 1T00A 2H1DA 4K5RA 3GFKA 5C00A 5AN1A 3TRPA 2IMKA 5EL8A 5IMAA 1DBYA 1YEXA 3M9JA 2X8HA 4TW5A 3TKSA 5KN3A 2AJQB 3ZTLA 1TP9A 3O6TA 2LRTA 5IIZA 2LNTA 2DSAA 1EZKA 1X5CA 3KM6A 1X0RA 3IV4A 4X1UA 2FWEA 2IJYA 3ZRDA 2CVDA 1GSSA 2PWJA 3HJPA 5CREA 2FUG2 3GRXA 3DRNA 5AIXA 3RHBA 1FB6A 3WGDA 3HHVA 4TN8A 2NVLA 3F63A 4IELA 4AJ7A 4MNNA 2YWIA 1B8XA 4GF0A 1TK5B 2ES7A 2KLXA 3DVWA 1BAYA 2GQLA 2X8GA 2ALBA 5DCHA 2NDOA 4L0WA 1EP8A 4EC0A 1XOBA 4K0GA 2F8FA 19GSA 2HZFA 2FWFA 1KNGA 4A5PA 2WFCA 4GSSA 4LMVA 3A2XA 3F3QA 2DJ2A 1MEKA 2YWMA 3RHCA 1A2JA 2C4JA 1EWXA 3F6DA 3TCOA 3CSIA 2HRAA 5J3RA 4HU9A 2QKEA 3DD3A 3E0UA 4KW6A 4BVXA 1U3IA 4TKYA 2MBTA 3MIXA 4Q5QA 2H19A 3VWWA 4IBPA 1TRSA 2YV7A 1XW9A 1MTCA 2YJ7A 4OO5A 4HEA2 2I9HA 4KSMA 2MYGA 2V6KA 3KP9A 4NHWA 3EE2A 3UL3A 1E2YA 1YKCA 1A8YA 1B4PA 4JBBA 3IDVA 2VCXA 1XWCA 17GSA 2V41A 1J08A 2JADA 2LQQA 3K8NA 1X9MB 2DJ0A 4K1FA 2OBIA 4N10A 2XPDA 4LMWA 3IA1A 4HSCX 4IJIA 1KTEA 2H70A 3KTBA 1O6JA 2LQOA 4F2IA 1ZCPA 3KZQA 4IGJA 1AQXA 1R5AA 1O8WA 5DAKA 1OC3A 4GSTA 1BQ7A 3A5WA 1YZXA 1M7TA 3OR5A 4J2FA 5AISA 3DGQA 2EIRA 1SU9A 1QMVA 3TKRA 5H5RA 3GIXA 12GSA 5D9WA 4CHSA 4F0CA 5DALA 2RM5A 2PPTA 1QQ2A 2KP1A 1X5DA 4DSSA 4EIQA 4ECBA 3KTLA 1GL8A 1SK1A 4IW9A 3GA4A 2A2SA 1VF3A 4DEJA 5DVBA 5D96A 3KJYA 2YP6A 4JRRA 4KX4A 1YF0A 3BBYA 5IPHA 3VLNA 4ML6A 4GQFA 1ACVA 4IHUA 4BIKA 5IMVA 1J9BA 2XBQA 5IMDA 2IMFA 3IHQA 3FYGA 3VPTA 3A3TA 1K0NA 1W4VA 4MZWA 3CSHA 5ECIB 1J0FA 3O3TA 2QGVA 3IAM2 3DVXA 5ECQB 1TRVA 1XFLA 3ZZXA 3WD6A 4LL1B 5CYYA 3VURA 2K8SA 4WBRD 1S3AA 2EIQA 3DXBA 2DJ3A 2YZHA 3LEFA 2OBKA 4KDYA 1G7OA 4CDOA 5G2ZA 4D73A
chains in the Genus database with same CATH topology
3BCIA 4NPBA 4ECCA 1PRXA 2E2MA 4K7IA 1V58A 2HE3A 5ECSA 2LRNA 1URMA 3R2QA 4GCIA 3C71A 1M2BA 5BRTA 2C0DA 1GTIA 5ECLB 2YWOA 2DIYA 4MA9A 1T4ZA 5IOWA 3I43A 2B3SA 3KIJA 1K0MA 4MJCA 3L9SA 2DMMA 3O76A 1FG4A 4EL1A 2CZ3A 4O5QA 5J9BA 3FMWA 2FGXA 4PURA 1BX9A 1PMTA 3F4TA 4OFNA 1EGOA 1NHYA 1Z7RA 2X49A 4NHZA 3LFLA 1A23A 1PN9A 1ON4A 2J23A 3KD0A 2FHEA 4DVCA 4NMUA 2LRCA 4BVYA 3F8UA 3LXTA 4K6XA 3TJGA 1ZYNA 2H1AA 4YQVA 3DMLA 5ECOB 2FWHA 3LW9A 2HZEB 4MF7A 2OE1A 2H71A 5HR3A 3ZLPA 2MMNA 4HS1A 1XXUA 3E3EA 3W8JA 3H4KA 2CAQA 1S3DA 1LU4A 1JZDA 2MMAA 3IBHA 4FQUA 1EP7A 4PXOA 4F0BA 1XWKA 4OCFA 1ILOA 4LA1A 3VPQA 4XRDA 1YF1A 1HNCA 4EDYA 1B4QA 5E4WA 2LJKA 2I3YA 1K3LA 3J7Yb 1U3AA 5AGYA 2VLUA 1A0RP 2C3QA 3NIVA 1N8JA 2VL3A 3N9JA 4V2MA 1SJZA 3CMIA 1T1VA 4MMMA 4XS4B 1K0DA 1GNEA 3APQA 5L71A 2AHEA 4TOPA 1V57A 2RUFA 2DC5A 4ECJA 4I2UA 2OE3A 1ZMAA 1AAZA 2VCZA 1K3YA 2AAWA 3I69A 2GQMA 3CTGA 4FIWA 1TTZA 4KDUA 2BMXA 3D22A 1A2LA 3H79A 1O81A 3GKXA 2CAIA 3UMAA 3R3EA 4TR4A 3Q19A 2MBSA 4KUNA 2HT9A 4XRAA 3IOSA 3VWXA 1SL1B 3TRXA 3H1NA 4PGTA 3N5OA 4WETA 1GSUA 2WDUA 2H30A 2LJAA 1PKWA 3IHGA 2LNSA 1TRWA 3U6VA 4ZXGA 4PUAA 1Y25A 2FA8A 2B7JA 3C8EA 1QK8A 3VI5A 3HVVA 2XPEA 3QAGA 4EVMA 2B7KA 3QR6A 3ZL5A 4EO3A 2KHPA 1CQGA 5IO2A 1C72A 20GSA 1PA3A 3EINA 2IIYA 1B9XC 1FOVA 4AJ6A 3IAS2 3Q6OA 4NAXA 2KUCA 4ZBDA 5INYA 1R7HA 5ELAA 1AQVA 3IC4A 6GSXA 1UVZA 3SBCA 2HNLA 2KP2A 2K8VA 4KE3A 4I8BA 2YWNA 2K18A 5JWOB 3HXSA 1V9WA 3UBKA 5ECMB 5F0GA 3DWVA 1EV4A 5COHA 4YQUA 2E0QA 4E8HA 2GZPA 2K9FA 5DQYA 4ZBBA 4YH2A 4TR1B 1ZYEA 3H93A 3GMFA 4ML1A 1Z7PA 1OE8A 4GSNA 4ILFA 4OCEA 3C1RA 4MABA 3UEMA 4MF5A 3EC3A 2VIMA 3G9BA 3HVXA 4RQXA 1O73A 4IN0A 2P5QA 5BMUA 2EC4A 3GX0A 2AB6A 3HVSA 1XBSA 2XHFA 4KSOA 1TRUA 3PGTA 3MYDA 1I9DA 2IL3A 5HR1A 1O8XA 1YDKA 4IP6A 1GSEA 3KMNA 1M0UA 4USSA 3CYNA 4N11A 3D5JA 4XHMA 3WT2A 2GZYA 5CRGA 1Q98A 1WOUA 3IC8A 3FZ5A 1KBNA 2H0IA 1OC9B 3EURA 5FWGA 3Q18A 3BCKA 2FWGA 5IO0A 1EV9A 1ST9A 1VF1A 4HUAA 2H8LA 3F3RA 2HRFA 4MP4A 3TJKA 4O7HA 1X9WB 2VCWA 1H4OA 2XC2A 2YJHA 2F9SA 1ZZYA 1VGLA 3GTUB 5G31A 1THOA 2GS3A 2JU5A 3FZ9A 4AJ8A 3MDKA 5EY6A 2LV3A 2K6VA 4N0ZA 4HDEA 1A2MA 2I81A 3US3A 5ECKB 5KN1A 1HNAA 2PUKC 4J57E 3LG6A 6GSTA 4TXVA 5D73A 4L5OA 5DJMA 4GQCA 1F37A 1KEBA 2E2GA 1WJKA 4K8MA 5A4VA 4JU5A 1AW9A 4WF5A 3IE3A 3EWLA 4Z2RA 2JSZA 5ECNB 14GSA 1HNBA 5B6NA 3ZVJD 5LD0A 3HYPA 2R4VA 4FO5A 3TOUA 3APSA 1V98A 1ERTA 4BA7A 4Z2TA 6GSYA 2WB9A 3C7MA 2I1UA 5IMCA 4X4JA 4DSQA 3U5RE 3NZNA 3HY2A 1SJ6A 2L6CA 3GH6A 2WGRA 1A8LA 3EU4A 1RQMA 1Y6EA 1AXDA 2H66A 1MDJA 2Z9SA 1FOHA 3KH7A 5A4WA 3FEUA 3GKKA 3QMXA 1T3BA 2F8AA 4WR4A 3WYWA 3LWAA 3FZAA 2CX4A 5G1KA 4HQZA 4K2XA 1Q4JA 4EDZA 6GSVA 1FVKA 2N5BA 2DKHA 1SK0A 4ZBAA 3MAKA 4K9ZA 2ON7A 1WRYA 5F05A 4MZCA 2VCQA 4GLTA 3LSZA 5J5NA 4POLA 2YN1A 5HFKA 3HZ8A 6GSWA 1ZYQB 2DJ1A 1SL2B 3GURA 1JFUA 3QFBC 5H5QA 4WXTA 2JACA 4XS4A 2G2QA 5KEJA 3C1SA 2TIRA 4EIPA 5ID2B 1TK0B 1K0OA 1XWGA 2L5LA 3Q74A 2AV4A 9GSSA 2H6ZA 1SD9A 4MK3A 1FAAA 4IQ1A 3G7IA 3ZITA 4MH3A 1WMJA 3C73A 2V2GA 4BL7B 4HQSA 3AY8A 3HKRA 1F3BA 1MD3A 3EYTA 4O32A 1XPVA 4LL4B 4GRFA 4RUVA 1GH2A 4KGIA 1JLWA 2X64A 5FT3A 3HZ4A 2LTKA 3IR4A 4X43A 2L4QA 4EXJA 1M99A 5CP1A 2CX3A 2LS5A 3GYKA 2IMDA 2WCIA 1XIYA 1U87A 1PX6A 4CY8A 1SKWB 4F82A 4Q5FA 1ZGNA 1E6BA 2ON5A 3UOMA 4TVEA 2CVKA 3FKFA 3HJOA 3NOFA 3A2VA 1EEMA 2P5RA 1SD8A 4E8EA 3QAWA 4PUFC 1RK4A 3E9JB 3BD2A 4MCUA 3ZVJA 2DMLA 3CBUA 4MPFA 3M3MA 1QFNA 2YANA 3HCZA 2NPBA 2JZSA 3ZMLA 1Z3EA 3TKSE 1XWBA 2H0HA 2X99A 3GNJA 4F9ZA 1LBKA 1T8EB 5GZZB 2VD1A 1BEDA 4PQIA 1ML6A 1OYJA 3QCPA 2C1YA 4BVXB 1F3AA 3KGKA 1JLVA 2FD3A 1JZWA 1UA5A 2B1KA 2B5YA 2O87A 2M46A 2R2JA 1XVWA 1YJ6A 1B9YC 2DKIA 3LXZA 3FW2A 3G7JA 3I9V2 5C04A 2YZUA 1FO5A 2IN3A 2HLSA 2JZRA 1DSBA 1SKRB 2HFDA 2YPMA 3L9VA 4NV5A 3ISOA 1SENA 4MJBA 2F3MA 2R5GA 3L0HA 4IJ3A 3BJ5A 1IYHA 4XS6A 2P0GA 2DBCA 5IMZA 2M72A 2O89A 2H1GA 3UVTA 5D9TA 2A2RA 3EPTA 3QAVA 1K0AA 3PR8A 3FRCA 1GUKA 3TJJA 4G0IA 5DCGA 1EOHA 1SYRA 1TI1A 3TKSC 3FZ4A 2XBIA 4OO4A 5HFGA 1OC9A 2R6KA 3LYPA 4PQHA 4KA0A 3LGCA 2BTOT 2X4AA 1R26A 4WEYA 3VI7A 2PMTA 4HI7A 1NM3A 4JZQA 2DLXA 4BWSA 4WR5A 2HSMA 5JCGA 4EUYA 1R5PA 1UN2A 3HA9A 4RI6A 1AQWA 1AUCA 1H75A 5DAKB 4IVFA 4G19A 1EEJA 1JZRA 3ZREA 3WGXA 3ZIJA 5E59A 3KXOA 2N5AA 5EPFA 3RBTA 2RLIA 2MZCA 4DSRA 5DALB 2TRXA 5D9XA 2B5XA 4H86A 1TK8B 1IYIA 2VO4A 5LCZA 5CRDA 1ABAA 3P7XA 3F0IA 2H75A 3L9UA 1THXA 2QA1A 2M80A 3F4RA 3GL5A 1Z6MA 1YKAA 5G1LA 1PKZA 4ZIJA 4K7OA 2ZNMA 3ZFBA 8GSSA 2O7KA 4MZBA 4FYBA 2O8VB 4ICYA 1M2DA 1PSQA 4I97A 2IMEA 2HSHA 2WULA 4MJEA 4I5QA 3D0ZA 2P31A 4D73B 2JSYA 4ZB6A 2L4CA 4ZB8A 2LKUA 2R3XA 5HFIA 2G0FA 4NWYA 4KCAA 4AF2A 1GSDA 4MLYA 2VLTA 1I5GA 3DEXA 3MNGA 1GRXA 3LJRA 2OA7A 4K0NA 1K3OA 4P3YB 2D2ZA 3ZMKA 1TKDB 1GWCA 1JZOA 1GUHA 5DQSA 4MF6A 5ECHB 5D9VA 5JWQB 3LQ7A 2IPAA 1VF2A 1FB0A 4ZL8A 1WP0A 2YCDA 1GULA 2JZTA 2GSTA 1QXHA 4PQ1A 2VCTA 3EMPA 3DYRA 4V1Ag 2B1LA 4O5UA 5JCWA 3PPUA 1F6MC 2C3NA 1VF4A 3M1GA 1EOGA 4KB3A 1ERUA 2GSQA 1TDIA 1PX7A 5B8BA 1HQOA 4RI7A 5ID2A 1GSQA 4JR6A 4HU7A 5A5KA 2H72A 3TB2A 5F06A 4BVYB 2EIOA 4ZILA 1Z5YE 4TR3A 4N0VA 2MMZA 4BL7A 2VD0A 3MWHA 4X0XA 3UAPA 3FHKA 3LORA 1M2AA 4KAEA 3GKNA 1XCCA 3GSSA 1PD21 4IQAA 3UBLA 2KOKA 1U88A 4WBJA 2AYTA 3GSTA 2DIZA 4FYUA 2GGTA 2WS2A 2R37A 3QD9A 1TW9A 2BJXA 2JL4A 4N30A 2VL2C 5DDLA 3G7YA 2PERA 4I6XA 1SYXA 4TRXA 3FY7A 1XWAA 4XIHA 4IP1A 2GZZA 4XS1A 3FR6A 1BG5A 3TRQA 1NW2A 4YAVA 4G9HA 3ZIVA 4L8EA 4POMA 5J41A 4K5SA 3KP8A 4ZB9A 1W89A 1NSWA 5A4UA 4Z7XA 3SWLA 1MDKA 2QSIA 1OKTA 2H0GA 3F4SA 1N2AA 3GH9A 1LJRA 1FHEA 3GL3A 4XTSA 5DJLA 1F9MA 4KF9A 4IS0A 5JCUA 6GSUA 1FW1A 2WRTA 2IFQB 2VUPA 3ME7A 4Z2UA 4O92A 1WPIA 1O85A 3ERGA 4QQ7A 1PQNA 1S3CA 1PGTA 3KCMA 2HXKA 3F9UA 1TU7A 4ZL7A 4O5RA 1SL0B 3TDGA 4WF4A 2OACA 5IMFA 4JEDA 3V1WA 5J9CA 1RW1A 1MDIA 4ID0A 1M9BA 1K0BA 4V2NA 1WWJA 5B8AA 3UJ1A 1G7EA 4L5LA 1XZOA 2F51A 1GSFA 2PU9C 3HJMA 2GQKA 2HZEA 2X8CA 1G0TA 2CV4A 4YAPA 3UARA 1G6WA 3MSZA 1R4WA 5IOXA 4TXOB 3GKMA 4XCSA 4K7NA 2H76A 2A4VA 4OWYA 2VLVA 1WIKA 3UVHA 1XW6A 3IK9A 4MPGA 3ERWA 4GWRA 2WJUA 1TJDA 1XVQA 2PVOC 2R0CA 2FNOA 1X9SB 4JE1A 4ECIA 4CY6A 5H5SA 5AIVA 1XOAA 2HI7A 3D21A 2V6OA 4L0UA 2HSYA 4TR0A 3JCML 5CNWA 4YKFA 3M8NA 5F07A 3IXRA 4QL9A 4QL7A 5D93A 3IPZA 4WKWA 2GT6A 3BOAA 3L78A 5ECPB 1SKSB 1G6YA 2O85A 4HJ2A 1U6TA 2VOCA 4BPYA 1A0FA 5GSTA 2CVBA 2A2PA 2VM1A 2CA8A 4YQMA 1YEPA 2VL9A 3KH9A 2B6MA 2H74A 3LYKA 3HDCA 5B6MA 1ZL9A 7GSSA 2LUSA 2RUEA 1OE7A 1V40A 1DUGA 3W8SA 5CRWA 4F03A 22GSA 2VAFA 4MH2A 3EU3A 2GSSA 3PH9A 1T4YA 3QOUA 3TOTA 3M9KA 2VL2A 3P90A 3RPNA 5G5EA 4KH7A 1QGVA 2RIIA 2IWTA 4OFMA 3A5IA 5FHIA 1EGRA 2PGTA 1HYUA 4BWQA 1BYEA 3CSJA 1OVNA 5CO3A 4OMVA 3RAZA 3VK9A 2VCVA 3I6AA 3EMXA 4FYCA 2GDRA 4RQRA 2VM2A 5GAND 1OAZA 2V32A 4J56E 4LLRA 5G30A 3H8QA 1X5EA 1NHOA 1K0CA 4V1Ap 2FY6A 1HD2A 3TGZA 4MDCA 1F2EA 3GUSA 5ABRA 1M9AA 1WE0A 2OE0A 2TRCP 1OKDA 1TOFA 1TXXA 2E7PA 3RPPA 4HJMA 2FCHA 3IRAA 4G0LA 1V2AA 5IPGA 2A4HA 4GXZA 3TKQA 4OFTA 18GSA 5ENUA 3WT1A 2B5EA 3VWVA 1UC7A 3P2AA 1GNWA 1AC1A 2L59A 2YV9A 3RDWA 5HR2A 4NXIA 5HQPA 3ERFA 4TR1A 2FA4A 2LEGA 2GT5A 1DE2A 3KEBA 2GSRA 10GSA 2LSTA 4MJAA 4G0KA 3CXGA 4EE0A 4PX1A 2NTOA 3ED3A 2H73A 5CAXA 4NV2A 3D4TA 2YNXA 11GSA 2H1BA 1GTUA 2DJJA 2V1MA 5F8BA 1QUWA 3TJBA 1TU8A 2OKAA 1SJIA 3P8WA 2I4AA 2PBJA 2OJLA 3DIEA 6GSSA 3ME8A 5ELGA 3FR9A 2REMA 3W6GA 3APOA 4G2EA 2CT6A 3UIWA 2PN8A 1USBA 1YQ1A 2HRKA 3GV1A 2C0FA 2ZCTA 4KCEA 2GTUA 4OD7A 4KNDA 3DKSA 5IQYA 2WZ9A 4PNGA 4ZL9A 3CRTA 3VWUA 5B7CA 2UZ8A 4IKHA 1A24A 5J4UA 16GSA 5HR0A 2R0PA 3IK7A 2GVPA 2H6YA 4I2TA 3KMOA 5G5FA 4YKGA 4JR4A 1ERWA 1FVJA 2AUVA 4HOJA 1O7UA 2N5FA 3GTUA 2RM6A 2QA2A 5CRHA 3GX8A 5KOWA 4GTUA 3CRUA 5KOXA 13GSA 2YOIA 3ZYWA 4K2DA 4DSSB 4AGSA 3S9FA 2MMOA 2HYXA 1AIUA 3TJFA 3TUEA 3VFIA 3CTFA 3GN3A 1XW5A 1GP1A 4HZ4A 1BJXA 4V2LA 2C80A 2OADA 3WGEA 2IFQA 2L5OA 4CW9A 2C0GA 1GSYA 2FLSA 4Q5RA 4POKA 3D4MA 1GTBA 5EVOA 2CZ2A 4ISDA 4PNFA 2R0GA 2QC7A 5KN2A 2H6XA 2IMIA 1ZOFA 1TI3A 1GTAA 1OC8A 3D6IA 4HZ2A 1Z9HA 3ZFLA 3L4NA 2HRNA 1CQHA 5GSSA 1JHBA 3GHAA 3EVIA 5GAPD 1MD4A 2GLRA 2C8UA 1B48A 3J7Yk 2L57A 2J9HA 5JWRB 3TKPA 5LNKe 2C3TA 1Z6NA 2ZUPA 3FK8A 3FR3A 4G10A 4FH8A 1T7PB 3A2WA 3HD5A 1PN0A 4TXOA 1GLQA 5KN0A 4PTSA 2NBSA 2PVQA 1ZYPA 1SK2A 5IM9A 3QFAC 3M0FA 1PL1A 3QPMA 2C0EA 5ECRB 2L6DA 3QDNA 2DJKA 3F6FA 4Q5NA 3PINA 4KDXA 5D8IA 2LJRA 1VRSD 2H01A 1PL2A 1GLPA 5DBQA 2CQ9A 1ERVA 1YY7A 1DE1A 4ULXA 4EKZA 1GUMA 4EF0A 4ACSA 4POBA 1T00A 2H1DA 4K5RA 3GFKA 5C00A 5AN1A 3TRPA 2IMKA 5EL8A 5IMAA 1DBYA 1YEXA 3M9JA 2X8HA 4TW5A 3TKSA 5KN3A 2AJQB 3ZTLA 1TP9A 3O6TA 2LRTA 5IIZA 2LNTA 2DSAA 1EZKA 1X5CA 3KM6A 1X0RA 3IV4A 4X1UA 2FWEA 2IJYA 3ZRDA 2CVDA 1GSSA 2PWJA 3HJPA 5CREA 2FUG2 3GRXA 3DRNA 5AIXA 3RHBA 1FB6A 3WGDA 3HHVA 4TN8A 2NVLA 3F63A 4IELA 4AJ7A 4MNNA 2YWIA 1B8XA 4GF0A 1TK5B 2ES7A 2KLXA 3DVWA 1BAYA 2GQLA 2X8GA 2ALBA 5DCHA 2NDOA 4L0WA 1EP8A 4EC0A 1XOBA 4K0GA 2F8FA 19GSA 2HZFA 2FWFA 1KNGA 4A5PA 2WFCA 4GSSA 4LMVA 3A2XA 3F3QA 2DJ2A 1MEKA 2YWMA 3RHCA 1A2JA 2C4JA 1EWXA 3F6DA 3TCOA 3CSIA 2HRAA 5J3RA 4HU9A 2QKEA 3DD3A 3E0UA 4KW6A 4BVXA 1U3IA 4TKYA 2MBTA 3MIXA 4Q5QA 2H19A 3VWWA 4IBPA 1TRSA 2YV7A 1XW9A 1MTCA 2YJ7A 4OO5A 4HEA2 2I9HA 4KSMA 2MYGA 2V6KA 3KP9A 4NHWA 3EE2A 3UL3A 1E2YA 1YKCA 1A8YA 1B4PA 4JBBA 3IDVA 2VCXA 1XWCA 17GSA 2V41A 1J08A 2JADA 2LQQA 3K8NA 1X9MB 2DJ0A 4K1FA 2OBIA 4N10A 2XPDA 4LMWA 3IA1A 4IJIA 1KTEA 2H70A 3KTBA 1O6JA 2LQOA 4F2IA 1ZCPA 3KZQA 4IGJA 1AQXA 1R5AA 1O8WA 5DAKA 1OC3A 4GSTA 1BQ7A 3A5WA 1YZXA 1M7TA 3OR5A 4J2FA 5AISA 3DGQA 2EIRA 1SU9A 1QMVA 3TKRA 5H5RA 3GIXA 12GSA 5D9WA 4CHSA 4F0CA 5DALA 2RM5A 2PPTA 1QQ2A 2KP1A 1X5DA 4DSSA 4EIQA 4ECBA 3KTLA 1GL8A 1SK1A 4IW9A 3GA4A 2A2SA 1VF3A 4DEJA 5DVBA 5D96A 3KJYA 2YP6A 4JRRA 4KX4A 1YF0A 3BBYA 5IPHA 3VLNA 4ML6A 4GQFA 1ACVA 4IHUA 5IMVA 1J9BA 2XBQA 5IMDA 2IMFA 3IHQA 3FYGA 3VPTA 3A3TA 1K0NA 1W4VA 4MZWA 3CSHA 5ECIB 1J0FA 3O3TA 2QGVA 3IAM2 3DVXA 5ECQB 1TRVA 1XFLA 3ZZXA 3WD6A 4LL1B 5CYYA 3VURA 2K8SA 4WBRD 1S3AA 2EIQA 3DXBA 2DJ3A 2YZHA 3LEFA 2OBKA 4KDYA 1G7OA 4CDOA 5G2ZA 4D73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCI A;  4NPB A;  4ECC A;  1PRX A;  2E2M A;  4K7I A;  1V58 A;  2HE3 A;  5ECS A;  2LRN A;  1URM A;  3R2Q A;  4GCI A;  3C71 A;  1M2B A;  2C0D A;  1GTI A;  5ECL B;  2YWO A;  2DIY A;  4MA9 A;  1T4Z A;  5IOW A;  3I43 A;  2B3S A;  3KIJ A;  1K0M A;  4MJC A;  3L9S A;  2DMM A;  3O76 A;  1FG4 A;  4EL1 A;  2CZ3 A;  5J9B A;  2FGX A;  4PUR A;  1BX9 A;  1PMT A;  3F4T A;  4OFN A;  1EGO A;  1NHY A;  1Z7R A;  4NHZ A;  3LFL A;  1A23 A;  1PN9 A;  1ON4 A;  2J23 A;  3KD0 A;  2FHE A;  4DVC A;  4NMU A;  2LRC A;  4BVY A;  3F8U A;  3LXT A;  4K6X A;  3TJG A;  2H1A A;  4YQV A;  3DML A;  5ECO B;  2FWH A;  2HZE B;  4MF7 A;  2OE1 A;  2H71 A;  5HR3 A;  3ZLP A;  2MMN A;  4HS1 A;  1XXU A;  3E3E A;  3W8J A;  3H4K A;  2CAQ A;  1S3D A;  1LU4 A;  1JZD A;  2MMA A;  3IBH A;  4PXO A;  1EP7 A;  4F0B A;  1XWK A;  4OCF A;  1ILO A;  4LA1 A;  3VPQ A;  4XRD A;  1YF1 A;  1HNC A;  4EDY A;  1B4Q A;  5E4W A;  2LJK A;  2I3Y A;  1K3L A;  3J7Y b;  1U3A A;  5AGY A;  2VLU A;  1A0R P;  2C3Q A;  3NIV A;  1N8J A;  2VL3 A;  3N9J A;  4V2M A;  1SJZ A;  3CMI A;  1T1V A;  4MMM A;  4XS4 B;  1K0D A;  1GNE A;  3APQ A;  5L71 A;  2AHE A;  4TOP A;  1V57 A;  2RUF A;  2DC5 A;  4ECJ A;  4I2U A;  2OE3 A;  1ZMA A;  1AAZ A;  2VCZ A;  1K3Y A;  2AAW A;  3I69 A;  2GQM A;  3CTG A;  4FIW A;  1TTZ A;  4KDU A;  2BMX A;  3D22 A;  1A2L A;  3H79 A;  1O81 A;  3GKX A;  2CAI A;  3UMA A;  4TR4 A;  3Q19 A;  2MBS A;  4KUN A;  2HT9 A;  4XRA A;  3IOS A;  3VWX A;  1SL1 B;  3TRX A;  3H1N A;  4PGT A;  3N5O A;  4WET A;  1GSU A;  2WDU A;  2H30 A;  2LJA A;  1PKW A;  2LNS A;  1TRW A;  3U6V A;  4ZXG A;  4PUA A;  1Y25 A;  2FA8 A;  2B7J A;  3C8E A;  1QK8 A;  3VI5 A;  3HVV A;  2XPE A;  3QAG A;  4EVM A;  2B7K A;  3QR6 A;  3ZL5 A;  4EO3 A;  2KHP A;  1CQG A;  5IO2 A;  1C72 A;  20GS A;  1PA3 A;  3EIN A;  2IIY A;  1B9X C;  1FOV A;  4AJ6 A;  3IAS 2;  3Q6O A;  4NAX A;  2KUC A;  4ZBD A;  5INY A;  1R7H A;  5ELA A;  1AQV A;  3IC4 A;  6GSX A;  1UVZ A;  3SBC A;  2HNL A;  2KP2 A;  2K8V A;  4KE3 A;  4I8B A;  2YWN A;  2K18 A;  5JWO B;  3HXS A;  1V9W A;  3UBK A;  5ECM B;  5F0G A;  3DWV A;  1EV4 A;  5COH A;  4YQU A;  2E0Q A;  4E8H A;  2GZP A;  2K9F A;  5DQY A;  4ZBB A;  4YH2 A;  4TR1 B;  1ZYE A;  3H93 A;  3GMF A;  4ML1 A;  1Z7P A;  1OE8 A;  4GSN A;  4ILF A;  4OCE A;  3C1R A;  4MAB A;  3UEM A;  4MF5 A;  3EC3 A;  2VIM A;  3G9B A;  3HVX A;  4RQX A;  1O73 A;  4IN0 A;  2P5Q A;  2EC4 A;  3GX0 A;  2AB6 A;  3HVS A;  1XBS A;  2XHF A;  4KSO A;  1TRU A;  3PGT A;  1I9D A;  2IL3 A;  5HR1 A;  1O8X A;  1YDK A;  4IP6 A;  1GSE A;  3KMN A;  1M0U A;  3CYN A;  4N11 A;  3D5J A;  4XHM A;  3WT2 A;  2GZY A;  5CRG A;  1Q98 A;  1WOU A;  3FZ5 A;  1KBN A;  2H0I A;  1OC9 B;  3EUR A;  5FWG A;  3Q18 A;  3BCK A;  2FWG A;  5IO0 A;  1EV9 A;  1ST9 A;  1VF1 A;  4HUA A;  2H8L A;  3F3R A;  2HRF A;  4MP4 A;  3TJK A;  4O7H A;  1X9W B;  2VCW A;  1H4O A;  2XC2 A;  2YJH A;  2F9S A;  1ZZY A;  1VGL A;  3GTU B;  5G31 A;  1THO A;  2GS3 A;  2JU5 A;  3FZ9 A;  4AJ8 A;  3MDK A;  5EY6 A;  2LV3 A;  2K6V A;  4HDE A;  4N0Z A;  1A2M A;  2I81 A;  3US3 A;  5ECK B;  5KN1 A;  1HNA A;  2PUK C;  4J57 E;  3LG6 A;  6GST A;  4TXV A;  5D73 A;  4L5O A;  5DJM A;  4GQC A;  1F37 A;  1KEB A;  2E2G A;  1WJK A;  4K8M A;  5A4V A;  4JU5 A;  1AW9 A;  4WF5 A;  3IE3 A;  3EWL A;  2JSZ A;  5ECN B;  14GS A;  1HNB A;  5B6N A;  3ZVJ D;  5LD0 A;  3HYP A;  2R4V A;  4FO5 A;  3TOU A;  3APS A;  1V98 A;  1ERT A;  4BA7 A;  6GSY A;  2WB9 A;  3C7M A;  2I1U A;  5IMC A;  4DSQ A;  3U5R E;  3NZN A;  3HY2 A;  1SJ6 A;  2L6C A;  3GH6 A;  2WGR A;  1A8L A;  3EU4 A;  1RQM A;  1Y6E A;  1AXD A;  2H66 A;  1MDJ A;  2Z9S A;  3KH7 A;  5A4W A;  3FEU A;  3GKK A;  3QMX A;  1T3B A;  2F8A A;  4WR4 A;  3WYW A;  3LWA A;  3FZA A;  2CX4 A;  5G1K A;  4HQZ A;  1Q4J A;  4EDZ A;  6GSV A;  1FVK A;  2N5B A;  1SK0 A;  4ZBA A;  3MAK A;  4K9Z A;  2ON7 A;  1WRY A;  5F05 A;  4MZC A;  2VCQ A;  4GLT A;  3LSZ A;  5J5N A;  4POL A;  2YN1 A;  5HFK A;  3HZ8 A;  6GSW A;  1ZYQ B;  2DJ1 A;  1SL2 B;  3GUR A;  1JFU A;  3QFB C;  5H5Q A;  4WXT A;  2JAC A;  4XS4 A;  2G2Q A;  5KEJ A;  3C1S A;  2TIR A;  5ID2 B;  1TK0 B;  1K0O A;  1XWG A;  2L5L A;  3Q74 A;  2AV4 A;  9GSS A;  2H6Z A;  1SD9 A;  4MK3 A;  1FAA A;  4IQ1 A;  3G7I A;  3ZIT A;  4MH3 A;  1WMJ A;  3C73 A;  2V2G A;  4HQS A;  3AY8 A;  3HKR A;  1F3B A;  1MD3 A;  3EYT A;  4O32 A;  1XPV A;  4LL4 B;  4GRF A;  4RUV A;  1GH2 A;  4KGI A;  1JLW A;  2X64 A;  5FT3 A;  3HZ4 A;  2LTK A;  3IR4 A;  4X43 A;  2L4Q A;  4EXJ A;  1M99 A;  5CP1 A;  2CX3 A;  2LS5 A;  3GYK A;  2IMD A;  2WCI A;  1XIY A;  1U87 A;  1PX6 A;  1SKW B;  4F82 A;  4Q5F A;  1ZGN A;  1E6B A;  2ON5 A;  3UOM A;  4TVE A;  2CVK A;  3FKF A;  3HJO A;  3NOF A;  3A2V A;  1EEM A;  2P5R A;  1SD8 A;  4E8E A;  3QAW A;  4PUF C;  1RK4 A;  3E9J B;  3BD2 A;  4MCU A;  3ZVJ A;  2DML A;  3CBU A;  4MPF A;  3M3M A;  1QFN A;  2YAN A;  3HCZ A;  2NPB A;  2JZS A;  3ZML A;  1Z3E A;  3TKS E;  1XWB A;  2H0H A;  2X99 A;  3GNJ A;  4F9Z A;  1LBK A;  1T8E B;  5GZZ B;  2VD1 A;  1BED A;  4PQI A;  1ML6 A;  1OYJ A;  3QCP A;  2C1Y A;  1F3A A;  3KGK A;  1JLV A;  2FD3 A;  1JZW A;  1UA5 A;  2B1K A;  2B5Y A;  2O87 A;  2M46 A;  2R2J A;  1XVW A;  1YJ6 A;  1B9Y C;  3LXZ A;  3FW2 A;  3G7J A;  3I9V 2;  5C04 A;  2YZU A;  1FO5 A;  2IN3 A;  2HLS A;  2JZR A;  1DSB A;  1SKR B;  2HFD A;  2YPM A;  3L9V A;  4NV5 A;  3ISO A;  1SEN A;  4MJB A;  2F3M A;  2R5G A;  3L0H A;  4IJ3 A;  3BJ5 A;  1IYH A;  4XS6 A;  2P0G A;  2DBC A;  5IMZ A;  2M72 A;  2O89 A;  2H1G A;  3UVT A;  5D9T A;  2A2R A;  3QAV A;  1K0A A;  3PR8 A;  3FRC A;  1GUK A;  3TJJ A;  5DCG A;  1EOH A;  1SYR A;  1TI1 A;  3TKS C;  3FZ4 A;  2XBI A;  4OO4 A;  5HFG A;  1OC9 A;  2R6K A;  3LYP A;  4PQH A;  4KA0 A;  3LGC A;  2BTO T;  1R26 A;  4WEY A;  3VI7 A;  2PMT A;  4HI7 A;  1NM3 A;  4JZQ A;  2DLX A;  4BWS A;  4WR5 A;  5JCG A;  4EUY A;  1R5P A;  1UN2 A;  3HA9 A;  4RI6 A;  1AQW A;  1AUC A;  1H75 A;  5DAK B;  4IVF A;  4G19 A;  1EEJ A;  1JZR A;  3ZRE A;  3WGX A;  3ZIJ A;  5E59 A;  3KXO A;  2N5A A;  5EPF A;  3RBT A;  2RLI A;  2MZC A;  4DSR A;  5DAL B;  2TRX A;  5D9X A;  2B5X A;  4H86 A;  1TK8 B;  1IYI A;  2VO4 A;  5LCZ A;  5CRD A;  1ABA A;  3P7X A;  3F0I A;  2H75 A;  3L9U A;  1THX A;  2M80 A;  3F4R A;  3GL5 A;  1Z6M A;  1YKA A;  5G1L A;  1PKZ A;  4ZIJ A;  4K7O A;  2ZNM A;  3ZFB A;  8GSS A;  2O7K A;  4MZB A;  4FYB A;  2O8V B;  1M2D A;  1PSQ A;  4I97 A;  2IME A;  2HSH A;  2WUL A;  4MJE A;  4I5Q A;  3D0Z A;  2P31 A;  4D73 B;  2JSY A;  4ZB6 A;  2L4C A;  4ZB8 A;  2LKU A;  2R3X A;  5HFI A;  2G0F A;  4NWY A;  4KCA A;  4AF2 A;  1GSD A;  4MLY A;  2VLT A;  1I5G A;  3DEX A;  3MNG A;  1GRX A;  3LJR A;  2OA7 A;  4K0N A;  1K3O A;  4P3Y B;  2D2Z A;  3ZMK A;  1TKD B;  1GWC A;  1JZO A;  1GUH A;  5DQS A;  4MF6 A;  5ECH B;  5D9V A;  5JWQ B;  3LQ7 A;  2IPA A;  1VF2 A;  1FB0 A;  4ZL8 A;  1WP0 A;  2YCD A;  1GUL A;  2JZT A;  2GST A;  1QXH A;  4PQ1 A;  2VCT A;  3EMP A;  3DYR A;  4V1A g;  2B1L A;  5JCW A;  1F6M C;  2C3N A;  1VF4 A;  3M1G A;  1EOG A;  4KB3 A;  1ERU A;  2GSQ A;  1TDI A;  1PX7 A;  5B8B A;  1HQO A;  4RI7 A;  5ID2 A;  1GSQ A;  4JR6 A;  4HU7 A;  5A5K A;  2H72 A;  3TB2 A;  5F06 A;  2EIO A;  4ZIL A;  1Z5Y E;  4TR3 A;  4N0V A;  2MMZ A;  4BL7 A;  2VD0 A;  3MWH A;  4X0X A;  3UAP A;  3FHK A;  3LOR A;  1M2A A;  4KAE A;  3GKN A;  1XCC A;  3GSS A;  1PD2 1;  4IQA A;  3UBL A;  2KOK A;  1U88 A;  4WBJ A;  2AYT A;  3GST A;  2DIZ A;  4FYU A;  2GGT A;  2WS2 A;  2R37 A;  3QD9 A;  1TW9 A;  2BJX A;  2JL4 A;  4N30 A;  2VL2 C;  5DDL A;  3G7Y A;  2PER A;  4I6X A;  1SYX A;  4TRX A;  3FY7 A;  1XWA A;  4XIH A;  4IP1 A;  2GZZ A;  4XS1 A;  3FR6 A;  1BG5 A;  3TRQ A;  1NW2 A;  4YAV A;  4G9H A;  3ZIV A;  4L8E A;  4POM A;  5J41 A;  3KP8 A;  4ZB9 A;  1W89 A;  1NSW A;  5A4U A;  4Z7X A;  3SWL A;  1MDK A;  2QSI A;  1OKT A;  2H0G A;  3F4S A;  1N2A A;  3GH9 A;  1LJR A;  1FHE A;  3GL3 A;  4XTS A;  5DJL A;  1F9M A;  4IS0 A;  5JCU A;  6GSU A;  1FW1 A;  2WRT A;  2IFQ B;  2VUP A;  3ME7 A;  4O92 A;  1WPI A;  1O85 A;  3ERG A;  4QQ7 A;  1PQN A;  1S3C A;  1PGT A;  3KCM A;  2HXK A;  3F9U A;  1TU7 A;  4ZL7 A;  4O5R A;  1SL0 B;  3TDG A;  4WF4 A;  2OAC A;  5IMF A;  4JED A;  3V1W A;  5J9C A;  1RW1 A;  1MDI A;  4ID0 A;  1M9B A;  1K0B A;  4V2N A;  1WWJ A;  5B8A A;  3UJ1 A;  1G7E A;  4L5L A;  1XZO A;  2F51 A;  1GSF A;  2PU9 C;  3HJM A;  2GQK A;  2HZE A;  2X8C A;  1G0T A;  2CV4 A;  4YAP A;  3UAR A;  1G6W A;  3MSZ A;  1R4W A;  5IOX A;  4TXO B;  3GKM A;  4XCS A;  4K7N A;  2H76 A;  2A4V A;  4OWY A;  2VLV A;  1WIK A;  3UVH A;  1XW6 A;  3IK9 A;  4MPG A;  3ERW A;  4GWR A;  2WJU A;  1TJD A;  1XVQ A;  2PVO C;  2FNO A;  1X9S B;  4JE1 A;  4ECI A;  5H5S A;  5AIV A;  1XOA A;  2HI7 A;  3D21 A;  2V6O A;  4L0U A;  2HSY A;  4TR0 A;  3JCM L;  5CNW A;  3M8N A;  5F07 A;  3IXR A;  4QL9 A;  4QL7 A;  5D93 A;  3IPZ A;  4WKW A;  2GT6 A;  3BOA A;  3L78 A;  5ECP B;  1SKS B;  1G6Y A;  2O85 A;  4HJ2 A;  1U6T A;  2VOC A;  4BPY A;  1A0F A;  5GST A;  2CVB A;  2VM1 A;  2CA8 A;  4YQM A;  1YEP A;  2VL9 A;  3KH9 A;  2B6M A;  2H74 A;  3LYK A;  3HDC A;  5B6M A;  1ZL9 A;  7GSS A;  2LUS A;  2RUE A;  1OE7 A;  1V40 A;  1DUG A;  3W8S A;  5CRW A;  4F03 A;  22GS A;  2VAF A;  4MH2 A;  3EU3 A;  2GSS A;  3PH9 A;  1T4Y A;  3QOU A;  3TOT A;  3M9K A;  2VL2 A;  3P90 A;  3RPN A;  5G5E A;  4KH7 A;  1QGV A;  2RII A;  2IWT A;  4OFM A;  5FHI A;  1EGR A;  2PGT A;  1HYU A;  4BWQ A;  1BYE A;  3CSJ A;  1OVN A;  5CO3 A;  4OMV A;  3RAZ A;  3VK9 A;  2VCV A;  3I6A A;  3EMX A;  4FYC A;  2GDR A;  4RQR A;  2VM2 A;  5GAN D;  1OAZ A;  2V32 A;  4J56 E;  4LLR A;  5G30 A;  3H8Q A;  1X5E A;  1NHO A;  1K0C A;  4V1A p;  2FY6 A;  1HD2 A;  3TGZ A;  4MDC A;  1F2E A;  3GUS A;  5ABR A;  1M9A A;  1WE0 A;  2OE0 A;  2TRC P;  1OKD A;  1TOF A;  1TXX A;  2E7P A;  3RPP A;  4HJM A;  2FCH A;  3IRA A;  1V2A A;  5IPG A;  4GXZ A;  3TKQ A;  4OFT A;  18GS A;  5ENU A;  3WT1 A;  2B5E A;  3VWV A;  1UC7 A;  3P2A A;  1GNW A;  1AC1 A;  2L59 A;  2YV9 A;  3RDW A;  5HR2 A;  4NXI A;  5HQP A;  3ERF A;  4TR1 A;  2FA4 A;  2LEG A;  2GT5 A;  1DE2 A;  3KEB A;  2GSR A;  10GS A;  2LST A;  4MJA A;  3CXG A;  4EE0 A;  4PX1 A;  2NTO A;  3ED3 A;  2H73 A;  5CAX A;  4NV2 A;  3D4T A;  2YNX A;  11GS A;  2H1B A;  1GTU A;  2DJJ A;  2V1M A;  5F8B A;  1QUW A;  3TJB A;  1TU8 A;  2OKA A;  1SJI A;  3P8W A;  2I4A A;  2PBJ A;  2OJL A;  3DIE A;  6GSS A;  3ME8 A;  5ELG A;  3FR9 A;  2REM A;  3W6G A;  3APO A;  4G2E A;  2CT6 A;  3UIW A;  2PN8 A;  1USB A;  1YQ1 A;  3GV1 A;  2C0F A;  2ZCT A;  4KCE A;  2GTU A;  4OD7 A;  4KND A;  3DKS A;  5IQY A;  2WZ9 A;  4PNG A;  4ZL9 A;  3CRT A;  3VWU A;  5B7C A;  4IKH A;  1A24 A;  5J4U A;  16GS A;  5HR0 A;  3IK7 A;  2GVP A;  2H6Y A;  4I2T A;  3KMO A;  5G5F A;  4JR4 A;  1ERW A;  1FVJ A;  2AUV A;  4HOJ A;  1O7U A;  2N5F A;  3GTU A;  2RM6 A;  5CRH A;  3GX8 A;  4GTU A;  3CRU A;  13GS A;  2YOI A;  3ZYW A;  4K2D A;  4DSS B;  4AGS A;  3S9F A;  2MMO A;  2HYX A;  1AIU A;  3TJF A;  3TUE A;  3VFI A;  3CTF A;  3GN3 A;  1XW5 A;  1GP1 A;  4HZ4 A;  1BJX A;  4V2L A;  2C80 A;  2OAD A;  3WGE A;  2IFQ A;  2L5O A;  4CW9 A;  2C0G A;  1GSY A;  2FLS A;  4Q5R A;  4POK A;  3D4M A;  1GTB A;  5EVO A;  2CZ2 A;  4ISD A;  4PNF A;  2QC7 A;  5KN2 A;  2H6X A;  2IMI A;  1ZOF A;  1TI3 A;  1GTA A;  1OC8 A;  3D6I A;  4HZ2 A;  1Z9H A;  3ZFL A;  3L4N A;  2HRN A;  1CQH A;  5GSS A;  1JHB A;  3GHA A;  3EVI A;  5GAP D;  1MD4 A;  2GLR A;  2C8U A;  1B48 A;  3J7Y k;  2L57 A;  2J9H A;  5JWR B;  3TKP A;  5LNK e;  2C3T A;  1Z6N A;  2ZUP A;  3FK8 A;  3FR3 A;  4G10 A;  4FH8 A;  1T7P B;  3A2W A;  3HD5 A;  4TXO A;  1GLQ A;  5KN0 A;  2NBS A;  2PVQ A;  1SK2 A;  5IM9 A;  3QFA C;  3M0F A;  1PL1 A;  3QPM A;  2C0E A;  5ECR B;  2L6D A;  3QDN A;  2DJK A;  3F6F A;  4Q5N A;  3PIN A;  4KDX A;  5D8I A;  2LJR A;  1VRS D;  2H01 A;  1PL2 A;  1GLP A;  5DBQ A;  2CQ9 A;  1ERV A;  1YY7 A;  1DE1 A;  4ULX A;  4EKZ A;  1GUM A;  4EF0 A;  4ACS A;  4POB A;  1T00 A;  2H1D A;  3GFK A;  5C00 A;  5AN1 A;  3TRP A;  2IMK A;  5EL8 A;  5IMA A;  1DBY A;  1YEX A;  3M9J A;  2X8H A;  4TW5 A;  3TKS A;  5KN3 A;  2AJQ B;  3ZTL A;  1TP9 A;  3O6T A;  2LRT A;  5IIZ A;  2LNT A;  2DSA A;  1EZK A;  1X5C A;  3KM6 A;  1X0R A;  3IV4 A;  4X1U A;  2FWE A;  2IJY A;  3ZRD A;  2CVD A;  1GSS A;  2PWJ A;  3HJP A;  5CRE A;  2FUG 2;  3GRX A;  3DRN A;  5AIX A;  3RHB A;  1FB6 A;  3WGD A;  3HHV A;  4TN8 A;  2NVL A;  3F63 A;  4IEL A;  4AJ7 A;  2YWI A;  1B8X A;  4GF0 A;  1TK5 B;  2ES7 A;  2KLX A;  3DVW A;  1BAY A;  2GQL A;  2X8G A;  2ALB A;  5DCH A;  2NDO A;  4L0W A;  1EP8 A;  4EC0 A;  1XOB A;  4K0G A;  2F8F A;  19GS A;  2HZF A;  2FWF A;  1KNG A;  2WFC A;  4GSS A;  4LMV A;  3A2X A;  3F3Q A;  2DJ2 A;  1MEK A;  2YWM A;  3RHC A;  1A2J A;  2C4J A;  1EWX A;  3F6D A;  3TCO A;  3CSI A;  5J3R A;  4HU9 A;  2QKE A;  3DD3 A;  3E0U A;  4KW6 A;  4BVX A;  1U3I A;  4TKY A;  2MBT A;  4Q5Q A;  2H19 A;  3VWW A;  4IBP A;  1TRS A;  2YV7 A;  1XW9 A;  1MTC A;  2YJ7 A;  4OO5 A;  4HEA 2;  2I9H A;  4KSM A;  2MYG A;  2V6K A;  3KP9 A;  4NHW A;  3EE2 A;  3UL3 A;  1E2Y A;  1YKC A;  1A8Y A;  1B4P A;  4JBB A;  3IDV A;  2VCX A;  1XWC A;  17GS A;  2V41 A;  1J08 A;  2JAD A;  2LQQ A;  3K8N A;  1X9M B;  2DJ0 A;  4K1F A;  2OBI A;  4N10 A;  2XPD A;  4LMW A;  3IA1 A;  4IJI A;  1KTE A;  2H70 A;  3KTB A;  1O6J A;  2LQO A;  4F2I A;  1ZCP A;  3KZQ A;  4IGJ A;  1AQX A;  1R5A A;  1O8W A;  5DAK A;  1OC3 A;  4GST A;  1BQ7 A;  3A5W A;  1YZX A;  1M7T A;  3OR5 A;  4J2F A;  5AIS A;  3DGQ A;  2EIR A;  1SU9 A;  1QMV A;  3TKR A;  5H5R A;  3GIX A;  12GS A;  5D9W A;  4CHS A;  4F0C A;  5DAL A;  2RM5 A;  2PPT A;  1QQ2 A;  2KP1 A;  1X5D A;  4DSS A;  4ECB A;  3KTL A;  1GL8 A;  1SK1 A;  4IW9 A;  3GA4 A;  2A2S A;  1VF3 A;  4DEJ A;  5DVB A;  5D96 A;  3KJY A;  2YP6 A;  4JRR A;  4KX4 A;  1YF0 A;  3BBY A;  5IPH A;  3VLN A;  4ML6 A;  4GQF A;  1ACV A;  4IHU A;  5IMV A;  1J9B A;  2XBQ A;  5IMD A;  2IMF A;  3IHQ A;  3FYG A;  3VPT A;  3A3T A;  1K0N A;  1W4V A;  4MZW A;  3CSH A;  5ECI B;  1J0F A;  3O3T A;  2QGV A;  3IAM 2;  3DVX A;  5ECQ B;  1TRV A;  1XFL A;  3ZZX A;  3WD6 A;  4LL1 B;  5CYY A;  3VUR A;  2K8S A;  4WBR D;  1S3A A;  2EIQ A;  3DXB A;  2DJ3 A;  2YZH A;  3LEF A;  2OBK A;  4KDY A;  1G7O A;  4CDO A;  5G2Z A;  4D73 A; 
#chains in the Genus database with same CATH topology
 3BCI A;  4NPB A;  4ECC A;  1PRX A;  2E2M A;  4K7I A;  1V58 A;  2HE3 A;  5ECS A;  2LRN A;  1URM A;  3R2Q A;  4GCI A;  3C71 A;  1M2B A;  5BRT A;  2C0D A;  1GTI A;  5ECL B;  2YWO A;  2DIY A;  4MA9 A;  1T4Z A;  5IOW A;  3I43 A;  2B3S A;  3KIJ A;  1K0M A;  4MJC A;  3L9S A;  2DMM A;  3O76 A;  1FG4 A;  4EL1 A;  2CZ3 A;  4O5Q A;  5J9B A;  3FMW A;  2FGX A;  4PUR A;  1BX9 A;  1PMT A;  3F4T A;  4OFN A;  1EGO A;  1NHY A;  1Z7R A;  2X49 A;  4NHZ A;  3LFL A;  1A23 A;  1PN9 A;  1ON4 A;  2J23 A;  3KD0 A;  2FHE A;  4DVC A;  4NMU A;  2LRC A;  4BVY A;  3F8U A;  3LXT A;  4K6X A;  3TJG A;  1ZYN A;  2H1A A;  4YQV A;  3DML A;  5ECO B;  2FWH A;  3LW9 A;  2HZE B;  4MF7 A;  2OE1 A;  2H71 A;  5HR3 A;  3ZLP A;  2MMN A;  4HS1 A;  1XXU A;  3E3E A;  3W8J A;  3H4K A;  2CAQ A;  1S3D A;  1LU4 A;  1JZD A;  2MMA A;  3IBH A;  4FQU A;  1EP7 A;  4PXO A;  4F0B A;  1XWK A;  4OCF A;  1ILO A;  4LA1 A;  3VPQ A;  4XRD A;  1YF1 A;  1HNC A;  4EDY A;  1B4Q A;  5E4W A;  2LJK A;  2I3Y A;  1K3L A;  3J7Y b;  1PFO A;  1U3A A;  5AGY A;  2VLU A;  1A0R P;  2C3Q A;  3NIV A;  1N8J A;  2VL3 A;  3N9J A;  4V2M A;  1SJZ A;  3CMI A;  1T1V A;  4MMM A;  4XS4 B;  1K0D A;  1GNE A;  3APQ A;  5L71 A;  2AHE A;  4TOP A;  1V57 A;  2RUF A;  2DC5 A;  4ECJ A;  4I2U A;  2OE3 A;  1ZMA A;  1AAZ A;  2VCZ A;  1K3Y A;  2AAW A;  3I69 A;  2GQM A;  3CTG A;  4FIW A;  1TTZ A;  4KDU A;  2BMX A;  3D22 A;  1A2L A;  3H79 A;  1O81 A;  3GKX A;  2CAI A;  3UMA A;  3R3E A;  4TR4 A;  3Q19 A;  2MBS A;  4KUN A;  2HT9 A;  4XRA A;  3IOS A;  3VWX A;  1SL1 B;  3TRX A;  3H1N A;  4PGT A;  3N5O A;  4WET A;  1GSU A;  2WDU A;  2H30 A;  2LJA A;  1PKW A;  3IHG A;  1XG8 A;  2LNS A;  1TRW A;  3U6V A;  4ZXG A;  4PUA A;  1Y25 A;  2FA8 A;  2B7J A;  3C8E A;  1QK8 A;  3VI5 A;  3HVV A;  2XPE A;  3QAG A;  4EVM A;  2B7K A;  3QR6 A;  3ZL5 A;  4EO3 A;  2KHP A;  1CQG A;  5IO2 A;  1C72 A;  20GS A;  1PA3 A;  3EIN A;  2IIY A;  1B9X C;  1FOV A;  4AJ6 A;  3IAS 2;  3Q6O A;  4NAX A;  2KUC A;  4ZBD A;  5INY A;  1R7H A;  5ELA A;  1AQV A;  3IC4 A;  6GSX A;  1UVZ A;  3SBC A;  2HNL A;  2KP2 A;  2K8V A;  4KE3 A;  4I8B A;  2YWN A;  2K18 A;  5JWO B;  3CQF A;  3HXS A;  1V9W A;  3UBK A;  5ECM B;  5F0G A;  3DWV A;  1EV4 A;  5COH A;  4YQU A;  2E0Q A;  4E8H A;  2GZP A;  2K9F A;  5DQY A;  4ZBB A;  4YH2 A;  4TR1 B;  1ZYE A;  3H93 A;  3GMF A;  4ML1 A;  1Z7P A;  1OE8 A;  4GSN A;  4ILF A;  4OCE A;  3C1R A;  4MAB A;  3UEM A;  4MF5 A;  3EC3 A;  2VIM A;  3G9B A;  3HVX A;  4RQX A;  1O73 A;  4IN0 A;  2P5Q A;  5BMU A;  2EC4 A;  3GX0 A;  2AB6 A;  3HVS A;  1XBS A;  2XHF A;  4KSO A;  1TRU A;  3PGT A;  3MYD A;  1I9D A;  2IL3 A;  5HR1 A;  1O8X A;  1YDK A;  4IP6 A;  1GSE A;  3KMN A;  1M0U A;  4USS A;  3CYN A;  4N11 A;  3D5J A;  4XHM A;  3WT2 A;  2GZY A;  5CRG A;  1Q98 A;  1WOU A;  3IC8 A;  3FZ5 A;  1KBN A;  2H0I A;  1OC9 B;  3EUR A;  5FWG A;  3Q18 A;  3BCK A;  2FWG A;  5IO0 A;  1EV9 A;  1ST9 A;  1VF1 A;  4HUA A;  2H8L A;  3F3R A;  2HRF A;  4MP4 A;  3TJK A;  4O7H A;  1X9W B;  2VCW A;  1H4O A;  2XC2 A;  2YJH A;  2F9S A;  1ZZY A;  1VGL A;  3GTU B;  5G31 A;  1THO A;  2GS3 A;  2JU5 A;  3FZ9 A;  4AJ8 A;  3MDK A;  5EY6 A;  2LV3 A;  2K6V A;  4N0Z A;  4HDE A;  1A2M A;  2I81 A;  3US3 A;  5ECK B;  5KN1 A;  1HNA A;  2PUK C;  4J57 E;  3LG6 A;  6GST A;  4TXV A;  5D73 A;  4L5O A;  5DJM A;  4GQC A;  1F37 A;  1KEB A;  2E2G A;  1WJK A;  4K8M A;  5A4V A;  4JU5 A;  1AW9 A;  4WF5 A;  3IE3 A;  3EWL A;  4Z2R A;  2JSZ A;  5ECN B;  14GS A;  1HNB A;  5B6N A;  3ZVJ D;  5LD0 A;  3HYP A;  2R4V A;  4FO5 A;  3TOU A;  3APS A;  1V98 A;  1ERT A;  4BA7 A;  4Z2T A;  6GSY A;  2WB9 A;  3C7M A;  2I1U A;  5IMC A;  4X4J A;  4DSQ A;  3U5R E;  3NZN A;  3HY2 A;  1SJ6 A;  2L6C A;  3GH6 A;  2WGR A;  1A8L A;  3EU4 A;  1RQM A;  1Y6E A;  1AXD A;  2H66 A;  1MDJ A;  2Z9S A;  1FOH A;  3KH7 A;  5A4W A;  3FEU A;  3GKK A;  3QMX A;  1T3B A;  2F8A A;  4WR4 A;  3WYW A;  3LWA A;  3FZA A;  2CX4 A;  5G1K A;  4HQZ A;  4K2X A;  1Q4J A;  4EDZ A;  6GSV A;  1FVK A;  2N5B A;  2DKH A;  1SK0 A;  4ZBA A;  3MAK A;  4K9Z A;  2ON7 A;  1WRY A;  5F05 A;  4MZC A;  2VCQ A;  4GLT A;  3LSZ A;  5J5N A;  4POL A;  2YN1 A;  5HFK A;  3HZ8 A;  6GSW A;  1ZYQ B;  2DJ1 A;  1SL2 B;  3GUR A;  1JFU A;  3QFB C;  5H5Q A;  4WXT A;  2JAC A;  4XS4 A;  2G2Q A;  5KEJ A;  3C1S A;  2TIR A;  4EIP A;  5ID2 B;  1TK0 B;  1K0O A;  1XWG A;  2L5L A;  3Q74 A;  2AV4 A;  9GSS A;  2H6Z A;  1SD9 A;  4MK3 A;  1FAA A;  4IQ1 A;  3G7I A;  3ZIT A;  4MH3 A;  1WMJ A;  3C73 A;  2V2G A;  4BL7 B;  4HQS A;  3AY8 A;  3HKR A;  1F3B A;  1MD3 A;  3EYT A;  4O32 A;  1XPV A;  4LL4 B;  4GRF A;  4RUV A;  1GH2 A;  4KGI A;  1JLW A;  2X64 A;  5FT3 A;  3HZ4 A;  2LTK A;  3IR4 A;  4X43 A;  2L4Q A;  4EXJ A;  1M99 A;  5CP1 A;  2CX3 A;  2LS5 A;  3GYK A;  2IMD A;  2WCI A;  1XIY A;  1U87 A;  1PX6 A;  4CY8 A;  1SKW B;  4F82 A;  4Q5F A;  1ZGN A;  1E6B A;  2ON5 A;  3UOM A;  4TVE A;  2CVK A;  3FKF A;  3HJO A;  3NOF A;  3A2V A;  1EEM A;  2P5R A;  1SD8 A;  4E8E A;  3QAW A;  4PUF C;  1RK4 A;  3E9J B;  3BD2 A;  4MCU A;  3ZVJ A;  2DML A;  3CBU A;  4MPF A;  3HVN A;  3M3M A;  1QFN A;  2YAN A;  3HCZ A;  2NPB A;  2JZS A;  3ZML A;  1Z3E A;  3TKS E;  1XWB A;  2H0H A;  2X99 A;  3GNJ A;  4F9Z A;  1LBK A;  1T8E B;  5GZZ B;  2VD1 A;  1BED A;  4PQI A;  1ML6 A;  1OYJ A;  3QCP A;  2C1Y A;  4BVX B;  1F3A A;  3KGK A;  1JLV A;  2FD3 A;  1JZW A;  1UA5 A;  2B1K A;  1M3J A;  2B5Y A;  2O87 A;  2M46 A;  2R2J A;  1XVW A;  1YJ6 A;  1B9Y C;  2DKI A;  3LXZ A;  3FW2 A;  3G7J A;  3I9V 2;  5C04 A;  2YZU A;  1FO5 A;  2IN3 A;  2HLS A;  2JZR A;  1DSB A;  1SKR B;  2HFD A;  2YPM A;  3L9V A;  4NV5 A;  3ISO A;  1SEN A;  4MJB A;  2F3M A;  2R5G A;  3L0H A;  4IJ3 A;  3BJ5 A;  1IYH A;  4XS6 A;  2P0G A;  2DBC A;  5IMZ A;  2M72 A;  2O89 A;  2H1G A;  3UVT A;  5D9T A;  2A2R A;  3EPT A;  3QAV A;  1K0A A;  3PR8 A;  3FRC A;  1GUK A;  3TJJ A;  4G0I A;  5DCG A;  1EOH A;  1SYR A;  1TI1 A;  3TKS C;  3FZ4 A;  2XBI A;  4OO4 A;  5HFG A;  1OC9 A;  2R6K A;  3LYP A;  4PQH A;  4KA0 A;  3LGC A;  2BTO T;  2X4A A;  1R26 A;  4WEY A;  3VI7 A;  2PMT A;  4HI7 A;  1NM3 A;  4JZQ A;  2DLX A;  4BWS A;  4WR5 A;  2HSM A;  5JCG A;  4EUY A;  1R5P A;  1UN2 A;  3HA9 A;  4RI6 A;  1AQW A;  1AUC A;  1H75 A;  5DAK B;  4IVF A;  4G19 A;  1EEJ A;  1JZR A;  3ZRE A;  3WGX A;  3ZIJ A;  5E59 A;  3KXO A;  2N5A A;  5EPF A;  3RBT A;  2RLI A;  2MZC A;  4DSR A;  5DAL B;  2TRX A;  5D9X A;  2B5X A;  4H86 A;  1TK8 B;  1IYI A;  2VO4 A;  5LCZ A;  5CRD A;  1ABA A;  3P7X A;  3F0I A;  2H75 A;  3L9U A;  1THX A;  2QA1 A;  2M80 A;  3F4R A;  3GL5 A;  1Z6M A;  1YKA A;  5G1L A;  1PKZ A;  4ZIJ A;  4K7O A;  2ZNM A;  3ZFB A;  8GSS A;  2O7K A;  4MZB A;  4FYB A;  2O8V B;  4ICY A;  1M2D A;  1PSQ A;  4I97 A;  2IME A;  2HSH A;  2WUL A;  4MJE A;  4I5Q A;  3D0Z A;  2P31 A;  4D73 B;  2JSY A;  4ZB6 A;  2L4C A;  4ZB8 A;  2LKU A;  2R3X A;  5HFI A;  2G0F A;  4NWY A;  4KCA A;  4AF2 A;  1GSD A;  4MLY A;  2VLT A;  1I5G A;  3DEX A;  3MNG A;  1GRX A;  3LJR A;  2OA7 A;  4K0N A;  1K3O A;  4P3Y B;  2D2Z A;  3ZMK A;  1TKD B;  1GWC A;  1JZO A;  1GUH A;  5DQS A;  4MF6 A;  5ECH B;  5D9V A;  5JWQ B;  3LQ7 A;  2IPA A;  1VF2 A;  1FB0 A;  4ZL8 A;  1WP0 A;  2YCD A;  1GUL A;  2JZT A;  2GST A;  1QXH A;  4PQ1 A;  2VCT A;  3EMP A;  3DYR A;  4V1A g;  2B1L A;  4O5U A;  5JCW A;  3PPU A;  1F6M C;  2C3N A;  1VF4 A;  3M1G A;  1EOG A;  4KB3 A;  1ERU A;  2GSQ A;  1TDI A;  1PX7 A;  5B8B A;  1HQO A;  4RI7 A;  5ID2 A;  1GSQ A;  4JR6 A;  4HU7 A;  5A5K A;  2H72 A;  3TB2 A;  5F06 A;  4BVY B;  2EIO A;  4ZIL A;  1Z5Y E;  4TR3 A;  4N0V A;  2MMZ A;  4BL7 A;  2VD0 A;  3MWH A;  4X0X A;  3UAP A;  3FHK A;  3LOR A;  1M2A A;  4KAE A;  3GKN A;  1XCC A;  3GSS A;  1PD2 1;  4IQA A;  3UBL A;  2KOK A;  1U88 A;  4WBJ A;  2AYT A;  3GST A;  2DIZ A;  4FYU A;  2GGT A;  2WS2 A;  2R37 A;  3QD9 A;  1TW9 A;  2BJX A;  2JL4 A;  4N30 A;  2VL2 C;  5DDL A;  3G7Y A;  2PER A;  4I6X A;  1SYX A;  4TRX A;  3FY7 A;  1XWA A;  4XIH A;  4IP1 A;  2GZZ A;  4XS1 A;  3FR6 A;  1BG5 A;  3TRQ A;  1NW2 A;  4YAV A;  4G9H A;  3ZIV A;  4L8E A;  4POM A;  5J41 A;  4K5S A;  3KP8 A;  4ZB9 A;  1W89 A;  1NSW A;  5A4U A;  4Z7X A;  3SWL A;  1MDK A;  2QSI A;  1OKT A;  2H0G A;  3F4S A;  1N2A A;  3GH9 A;  1LJR A;  1FHE A;  3GL3 A;  4XTS A;  5DJL A;  1F9M A;  4KF9 A;  4IS0 A;  5JCU A;  6GSU A;  1FW1 A;  2WRT A;  2IFQ B;  2VUP A;  3ME7 A;  4Z2U A;  4O92 A;  1WPI A;  1O85 A;  3ERG A;  4QQ7 A;  1PQN A;  1S3C A;  1PGT A;  3KCM A;  2HXK A;  3F9U A;  1TU7 A;  4ZL7 A;  4O5R A;  1SL0 B;  3TDG A;  4WF4 A;  2OAC A;  5IMF A;  4JED A;  3V1W A;  5J9C A;  1RW1 A;  1MDI A;  4ID0 A;  1M9B A;  1K0B A;  4V2N A;  1WWJ A;  5B8A A;  3UJ1 A;  1G7E A;  4L5L A;  1XZO A;  2F51 A;  1GSF A;  1S3R A;  2PU9 C;  3HJM A;  2GQK A;  2HZE A;  2X8C A;  1G0T A;  2CV4 A;  4YAP A;  3UAR A;  1G6W A;  3MSZ A;  1R4W A;  5IOX A;  4TXO B;  3GKM A;  4XCS A;  4K7N A;  2H76 A;  2A4V A;  4OWY A;  2VLV A;  1WIK A;  3UVH A;  1XW6 A;  3IK9 A;  4MPG A;  3ERW A;  4GWR A;  2WJU A;  1TJD A;  1XVQ A;  2PVO C;  2R0C A;  2FNO A;  1X9S B;  4JE1 A;  4ECI A;  4CY6 A;  5H5S A;  5AIV A;  1XOA A;  2HI7 A;  3D21 A;  2V6O A;  4L0U A;  2HSY A;  4TR0 A;  3JCM L;  5CNW A;  4YKF A;  3M8N A;  5F07 A;  3IXR A;  4QL9 A;  4QL7 A;  5D93 A;  3IPZ A;  4WKW A;  2GT6 A;  3BOA A;  3L78 A;  5ECP B;  1SKS B;  1G6Y A;  2O85 A;  4HJ2 A;  1U6T A;  2VOC A;  4BPY A;  1A0F A;  5GST A;  2CVB A;  2A2P A;  2VM1 A;  2CA8 A;  4YQM A;  1YEP A;  2VL9 A;  3KH9 A;  2B6M A;  2H74 A;  3LYK A;  3HDC A;  5B6M A;  1ZL9 A;  7GSS A;  2LUS A;  2RUE A;  1OE7 A;  1V40 A;  1DUG A;  3W8S A;  5CRW A;  4F03 A;  22GS A;  2VAF A;  4MH2 A;  3EU3 A;  2GSS A;  3PH9 A;  1T4Y A;  3QOU A;  3TOT A;  3M9K A;  2VL2 A;  3P90 A;  3RPN A;  5G5E A;  4KH7 A;  1QGV A;  2RII A;  2IWT A;  4OFM A;  3A5I A;  5FHI A;  1EGR A;  2PGT A;  1HYU A;  4BWQ A;  1BYE A;  3CSJ A;  1OVN A;  5CO3 A;  4OMV A;  3RAZ A;  3VK9 A;  2VCV A;  3I6A A;  3EMX A;  4FYC A;  2GDR A;  4RQR A;  2VM2 A;  5GAN D;  1OAZ A;  2V32 A;  4J56 E;  4LLR A;  5G30 A;  3H8Q A;  1X5E A;  1NHO A;  1K0C A;  4V1A p;  2FY6 A;  1HD2 A;  3TGZ A;  4MDC A;  1F2E A;  3GUS A;  5ABR A;  1M9A A;  1WE0 A;  2OE0 A;  2TRC P;  1OKD A;  1TOF A;  1TXX A;  2E7P A;  3RPP A;  4HJM A;  2FCH A;  3IRA A;  4G0L A;  1V2A A;  5IPG A;  2A4H A;  4GXZ A;  3TKQ A;  4OFT A;  18GS A;  5ENU A;  3WT1 A;  2B5E A;  3VWV A;  1UC7 A;  3P2A A;  1GNW A;  1AC1 A;  2L59 A;  2YV9 A;  3RDW A;  5HR2 A;  4NXI A;  5HQP A;  3ERF A;  4TR1 A;  2FA4 A;  2LEG A;  2GT5 A;  1DE2 A;  3KEB A;  2GSR A;  10GS A;  2LST A;  4MJA A;  4G0K A;  3CXG A;  4EE0 A;  4PX1 A;  2NTO A;  3ED3 A;  2H73 A;  5CAX A;  4NV2 A;  3D4T A;  2YNX A;  11GS A;  2H1B A;  1GTU A;  2DJJ A;  2V1M A;  5F8B A;  1QUW A;  3TJB A;  1TU8 A;  2OKA A;  1SJI A;  3P8W A;  2I4A A;  2PBJ A;  2OJL A;  3DIE A;  6GSS A;  3ME8 A;  5ELG A;  3FR9 A;  2REM A;  3W6G A;  3APO A;  4G2E A;  2CT6 A;  3UIW A;  2PN8 A;  1USB A;  1YQ1 A;  2HRK A;  3GV1 A;  2C0F A;  2ZCT A;  4KCE A;  2GTU A;  4OD7 A;  4KND A;  3DKS A;  5IQY A;  2WZ9 A;  4PNG A;  4ZL9 A;  3CRT A;  3VWU A;  5B7C A;  2UZ8 A;  4IKH A;  1A24 A;  5J4U A;  16GS A;  5HR0 A;  2R0P A;  3IK7 A;  2GVP A;  2H6Y A;  4I2T A;  3KMO A;  5G5F A;  4YKG A;  4JR4 A;  1ERW A;  1FVJ A;  2AUV A;  4HOJ A;  1O7U A;  2N5F A;  3GTU A;  2RM6 A;  2QA2 A;  5CRH A;  3GX8 A;  5KOW A;  4GTU A;  3CRU A;  5KOX A;  13GS A;  2YOI A;  1M3I A;  3ZYW A;  4K2D A;  4DSS B;  4AGS A;  3S9F A;  2MMO A;  2HYX A;  1AIU A;  3TJF A;  3TUE A;  3VFI A;  3CTF A;  3GN3 A;  1XW5 A;  1GP1 A;  4HZ4 A;  1BJX A;  4V2L A;  2C80 A;  2OAD A;  3WGE A;  2IFQ A;  2L5O A;  4CW9 A;  2C0G A;  1GSY A;  2FLS A;  4Q5R A;  4POK A;  3D4M A;  1GTB A;  5EVO A;  2CZ2 A;  4ISD A;  4PNF A;  2R0G A;  2QC7 A;  5KN2 A;  2H6X A;  2IMI A;  1ZOF A;  1TI3 A;  1GTA A;  1OC8 A;  3D6I A;  4HZ2 A;  1Z9H A;  3ZFL A;  3L4N A;  2HRN A;  1CQH A;  5GSS A;  1JHB A;  3GHA A;  3EVI A;  5GAP D;  1MD4 A;  2GLR A;  2C8U A;  1B48 A;  3J7Y k;  2L57 A;  2J9H A;  5JWR B;  3TKP A;  5LNK e;  2C3T A;  1Z6N A;  2ZUP A;  3FK8 A;  3FR3 A;  4G10 A;  4FH8 A;  1T7P B;  3A2W A;  3HD5 A;  1PN0 A;  4TXO A;  1GLQ A;  5KN0 A;  4PTS A;  2NBS A;  2PVQ A;  1ZYP A;  1SK2 A;  5IM9 A;  3QFA C;  3M0F A;  1PL1 A;  3QPM A;  2C0E A;  5ECR B;  2L6D A;  3QDN A;  2DJK A;  3F6F A;  4Q5N A;  3PIN A;  4KDX A;  5D8I A;  2LJR A;  1VRS D;  2H01 A;  1PL2 A;  1GLP A;  5DBQ A;  2CQ9 A;  1ERV A;  1YY7 A;  1DE1 A;  4ULX A;  4EKZ A;  1GUM A;  4EF0 A;  4ACS A;  4POB A;  1T00 A;  2H1D A;  4K5R A;  3GFK A;  5C00 A;  5AN1 A;  3TRP A;  2IMK A;  5EL8 A;  5IMA A;  1DBY A;  1YEX A;  3M9J A;  2X8H A;  4TW5 A;  3TKS A;  5KN3 A;  2AJQ B;  3ZTL A;  1TP9 A;  3O6T A;  2LRT A;  5IIZ A;  2LNT A;  2DSA A;  1EZK A;  1X5C A;  3KM6 A;  1X0R A;  3IV4 A;  4X1U A;  2FWE A;  2IJY A;  3ZRD A;  2CVD A;  1GSS A;  2PWJ A;  3HJP A;  5CRE A;  2FUG 2;  3GRX A;  3DRN A;  5AIX A;  3RHB A;  1FB6 A;  3WGD A;  3HHV A;  4TN8 A;  2NVL A;  3F63 A;  4IEL A;  4AJ7 A;  4MNN A;  2YWI A;  1B8X A;  4GF0 A;  1TK5 B;  2ES7 A;  2KLX A;  3DVW A;  1BAY A;  2GQL A;  2X8G A;  2ALB A;  5DCH A;  2NDO A;  4L0W A;  1EP8 A;  4EC0 A;  1XOB A;  4K0G A;  2F8F A;  19GS A;  2HZF A;  2FWF A;  1KNG A;  4A5P A;  2WFC A;  4GSS A;  4LMV A;  3A2X A;  3F3Q A;  2DJ2 A;  1MEK A;  2YWM A;  3RHC A;  1A2J A;  2C4J A;  1EWX A;  3F6D A;  3TCO A;  3CSI A;  2HRA A;  5J3R A;  4HU9 A;  2QKE A;  3DD3 A;  3E0U A;  4KW6 A;  4BVX A;  1U3I A;  4TKY A;  2MBT A;  3MIX A;  4Q5Q A;  2H19 A;  3VWW A;  4IBP A;  1TRS A;  2YV7 A;  1XW9 A;  1MTC A;  2YJ7 A;  4OO5 A;  4HEA 2;  2I9H A;  4KSM A;  2MYG A;  2V6K A;  3KP9 A;  4NHW A;  3EE2 A;  3UL3 A;  1E2Y A;  1YKC A;  1A8Y A;  1B4P A;  4JBB A;  3IDV A;  2VCX A;  1XWC A;  17GS A;  2V41 A;  1J08 A;  2JAD A;  2LQQ A;  3K8N A;  1X9M B;  2DJ0 A;  4K1F A;  2OBI A;  4N10 A;  2XPD A;  4LMW A;  3IA1 A;  4HSC X;  4IJI A;  1KTE A;  2H70 A;  3KTB A;  1O6J A;  2LQO A;  4F2I A;  1ZCP A;  3KZQ A;  4IGJ A;  1AQX A;  1R5A A;  1O8W A;  5DAK A;  1OC3 A;  4GST A;  1BQ7 A;  3A5W A;  1YZX A;  1M7T A;  3OR5 A;  4J2F A;  5AIS A;  3DGQ A;  2EIR A;  1SU9 A;  1QMV A;  3TKR A;  5H5R A;  3GIX A;  12GS A;  5D9W A;  4CHS A;  4F0C A;  5DAL A;  2RM5 A;  2PPT A;  1QQ2 A;  2KP1 A;  1X5D A;  4DSS A;  4EIQ A;  4ECB A;  3KTL A;  1GL8 A;  1SK1 A;  4IW9 A;  3GA4 A;  2A2S A;  1VF3 A;  4DEJ A;  5DVB A;  5D96 A;  3KJY A;  2YP6 A;  4JRR A;  4KX4 A;  1YF0 A;  3BBY A;  5IPH A;  3VLN A;  4ML6 A;  4GQF A;  1ACV A;  4IHU A;  4BIK A;  5IMV A;  1J9B A;  2XBQ A;  5IMD A;  2IMF A;  3IHQ A;  3FYG A;  3VPT A;  3A3T A;  1K0N A;  1W4V A;  4MZW A;  3CSH A;  5ECI B;  1J0F A;  3O3T A;  2QGV A;  3IAM 2;  3DVX A;  5ECQ B;  1TRV A;  1XFL A;  3ZZX A;  3WD6 A;  4LL1 B;  5CYY A;  3VUR A;  2K8S A;  4WBR D;  1S3A A;  2EIQ A;  3DXB A;  2DJ3 A;  2YZH A;  3LEF A;  2OBK A;  4KDY A;  1G7O A;  4CDO A;  5G2Z A;  4D73 A; 
#chains in the Genus database with same CATH homology
 3BCI A;  4NPB A;  4ECC A;  1PRX A;  2E2M A;  4K7I A;  1V58 A;  2HE3 A;  5ECS A;  2LRN A;  1URM A;  3R2Q A;  4GCI A;  3C71 A;  1M2B A;  5BRT A;  2C0D A;  1GTI A;  5ECL B;  2YWO A;  2DIY A;  4MA9 A;  1T4Z A;  5IOW A;  3I43 A;  2B3S A;  3KIJ A;  1K0M A;  4MJC A;  3L9S A;  2DMM A;  3O76 A;  1FG4 A;  4EL1 A;  2CZ3 A;  4O5Q A;  5J9B A;  3FMW A;  2FGX A;  4PUR A;  1BX9 A;  1PMT A;  3F4T A;  4OFN A;  1EGO A;  1NHY A;  1Z7R A;  2X49 A;  4NHZ A;  3LFL A;  1A23 A;  1PN9 A;  1ON4 A;  2J23 A;  3KD0 A;  2FHE A;  4DVC A;  4NMU A;  2LRC A;  4BVY A;  3F8U A;  3LXT A;  4K6X A;  3TJG A;  1ZYN A;  2H1A A;  4YQV A;  3DML A;  5ECO B;  2FWH A;  3LW9 A;  2HZE B;  4MF7 A;  2OE1 A;  2H71 A;  5HR3 A;  3ZLP A;  2MMN A;  4HS1 A;  1XXU A;  3E3E A;  3W8J A;  3H4K A;  2CAQ A;  1S3D A;  1LU4 A;  1JZD A;  2MMA A;  3IBH A;  4FQU A;  1EP7 A;  4PXO A;  4F0B A;  1XWK A;  4OCF A;  1ILO A;  4LA1 A;  3VPQ A;  4XRD A;  1YF1 A;  1HNC A;  4EDY A;  1B4Q A;  5E4W A;  2LJK A;  2I3Y A;  1K3L A;  3J7Y b;  1U3A A;  5AGY A;  2VLU A;  1A0R P;  2C3Q A;  3NIV A;  1N8J A;  2VL3 A;  3N9J A;  4V2M A;  1SJZ A;  3CMI A;  1T1V A;  4MMM A;  4XS4 B;  1K0D A;  1GNE A;  3APQ A;  5L71 A;  2AHE A;  4TOP A;  1V57 A;  2RUF A;  2DC5 A;  4ECJ A;  4I2U A;  2OE3 A;  1ZMA A;  1AAZ A;  2VCZ A;  1K3Y A;  2AAW A;  3I69 A;  2GQM A;  3CTG A;  4FIW A;  1TTZ A;  4KDU A;  2BMX A;  3D22 A;  1A2L A;  3H79 A;  1O81 A;  3GKX A;  2CAI A;  3UMA A;  3R3E A;  4TR4 A;  3Q19 A;  2MBS A;  4KUN A;  2HT9 A;  4XRA A;  3IOS A;  3VWX A;  1SL1 B;  3TRX A;  3H1N A;  4PGT A;  3N5O A;  4WET A;  1GSU A;  2WDU A;  2H30 A;  2LJA A;  1PKW A;  3IHG A;  2LNS A;  1TRW A;  3U6V A;  4ZXG A;  4PUA A;  1Y25 A;  2FA8 A;  2B7J A;  3C8E A;  1QK8 A;  3VI5 A;  3HVV A;  2XPE A;  3QAG A;  4EVM A;  2B7K A;  3QR6 A;  3ZL5 A;  4EO3 A;  2KHP A;  1CQG A;  5IO2 A;  1C72 A;  20GS A;  1PA3 A;  3EIN A;  2IIY A;  1B9X C;  1FOV A;  4AJ6 A;  3IAS 2;  3Q6O A;  4NAX A;  2KUC A;  4ZBD A;  5INY A;  1R7H A;  5ELA A;  1AQV A;  3IC4 A;  6GSX A;  1UVZ A;  3SBC A;  2HNL A;  2KP2 A;  2K8V A;  4KE3 A;  4I8B A;  2YWN A;  2K18 A;  5JWO B;  3HXS A;  1V9W A;  3UBK A;  5ECM B;  5F0G A;  3DWV A;  1EV4 A;  5COH A;  4YQU A;  2E0Q A;  4E8H A;  2GZP A;  2K9F A;  5DQY A;  4ZBB A;  4YH2 A;  4TR1 B;  1ZYE A;  3H93 A;  3GMF A;  4ML1 A;  1Z7P A;  1OE8 A;  4GSN A;  4ILF A;  4OCE A;  3C1R A;  4MAB A;  3UEM A;  4MF5 A;  3EC3 A;  2VIM A;  3G9B A;  3HVX A;  4RQX A;  1O73 A;  4IN0 A;  2P5Q A;  5BMU A;  2EC4 A;  3GX0 A;  2AB6 A;  3HVS A;  1XBS A;  2XHF A;  4KSO A;  1TRU A;  3PGT A;  3MYD A;  1I9D A;  2IL3 A;  5HR1 A;  1O8X A;  1YDK A;  4IP6 A;  1GSE A;  3KMN A;  1M0U A;  4USS A;  3CYN A;  4N11 A;  3D5J A;  4XHM A;  3WT2 A;  2GZY A;  5CRG A;  1Q98 A;  1WOU A;  3IC8 A;  3FZ5 A;  1KBN A;  2H0I A;  1OC9 B;  3EUR A;  5FWG A;  3Q18 A;  3BCK A;  2FWG A;  5IO0 A;  1EV9 A;  1ST9 A;  1VF1 A;  4HUA A;  2H8L A;  3F3R A;  2HRF A;  4MP4 A;  3TJK A;  4O7H A;  1X9W B;  2VCW A;  1H4O A;  2XC2 A;  2YJH A;  2F9S A;  1ZZY A;  1VGL A;  3GTU B;  5G31 A;  1THO A;  2GS3 A;  2JU5 A;  3FZ9 A;  4AJ8 A;  3MDK A;  5EY6 A;  2LV3 A;  2K6V A;  4N0Z A;  4HDE A;  1A2M A;  2I81 A;  3US3 A;  5ECK B;  5KN1 A;  1HNA A;  2PUK C;  4J57 E;  3LG6 A;  6GST A;  4TXV A;  5D73 A;  4L5O A;  5DJM A;  4GQC A;  1F37 A;  1KEB A;  2E2G A;  1WJK A;  4K8M A;  5A4V A;  4JU5 A;  1AW9 A;  4WF5 A;  3IE3 A;  3EWL A;  4Z2R A;  2JSZ A;  5ECN B;  14GS A;  1HNB A;  5B6N A;  3ZVJ D;  5LD0 A;  3HYP A;  2R4V A;  4FO5 A;  3TOU A;  3APS A;  1V98 A;  1ERT A;  4BA7 A;  4Z2T A;  6GSY A;  2WB9 A;  3C7M A;  2I1U A;  5IMC A;  4X4J A;  4DSQ A;  3U5R E;  3NZN A;  3HY2 A;  1SJ6 A;  2L6C A;  3GH6 A;  2WGR A;  1A8L A;  3EU4 A;  1RQM A;  1Y6E A;  1AXD A;  2H66 A;  1MDJ A;  2Z9S A;  1FOH A;  3KH7 A;  5A4W A;  3FEU A;  3GKK A;  3QMX A;  1T3B A;  2F8A A;  4WR4 A;  3WYW A;  3LWA A;  3FZA A;  2CX4 A;  5G1K A;  4HQZ A;  4K2X A;  1Q4J A;  4EDZ A;  6GSV A;  1FVK A;  2N5B A;  2DKH A;  1SK0 A;  4ZBA A;  3MAK A;  4K9Z A;  2ON7 A;  1WRY A;  5F05 A;  4MZC A;  2VCQ A;  4GLT A;  3LSZ A;  5J5N A;  4POL A;  2YN1 A;  5HFK A;  3HZ8 A;  6GSW A;  1ZYQ B;  2DJ1 A;  1SL2 B;  3GUR A;  1JFU A;  3QFB C;  5H5Q A;  4WXT A;  2JAC A;  4XS4 A;  2G2Q A;  5KEJ A;  3C1S A;  2TIR A;  4EIP A;  5ID2 B;  1TK0 B;  1K0O A;  1XWG A;  2L5L A;  3Q74 A;  2AV4 A;  9GSS A;  2H6Z A;  1SD9 A;  4MK3 A;  1FAA A;  4IQ1 A;  3G7I A;  3ZIT A;  4MH3 A;  1WMJ A;  3C73 A;  2V2G A;  4BL7 B;  4HQS A;  3AY8 A;  3HKR A;  1F3B A;  1MD3 A;  3EYT A;  4O32 A;  1XPV A;  4LL4 B;  4GRF A;  4RUV A;  1GH2 A;  4KGI A;  1JLW A;  2X64 A;  5FT3 A;  3HZ4 A;  2LTK A;  3IR4 A;  4X43 A;  2L4Q A;  4EXJ A;  1M99 A;  5CP1 A;  2CX3 A;  2LS5 A;  3GYK A;  2IMD A;  2WCI A;  1XIY A;  1U87 A;  1PX6 A;  4CY8 A;  1SKW B;  4F82 A;  4Q5F A;  1ZGN A;  1E6B A;  2ON5 A;  3UOM A;  4TVE A;  2CVK A;  3FKF A;  3HJO A;  3NOF A;  3A2V A;  1EEM A;  2P5R A;  1SD8 A;  4E8E A;  3QAW A;  4PUF C;  1RK4 A;  3E9J B;  3BD2 A;  4MCU A;  3ZVJ A;  2DML A;  3CBU A;  4MPF A;  3M3M A;  1QFN A;  2YAN A;  3HCZ A;  2NPB A;  2JZS A;  3ZML A;  1Z3E A;  3TKS E;  1XWB A;  2H0H A;  2X99 A;  3GNJ A;  4F9Z A;  1LBK A;  1T8E B;  5GZZ B;  2VD1 A;  1BED A;  4PQI A;  1ML6 A;  1OYJ A;  3QCP A;  2C1Y A;  4BVX B;  1F3A A;  3KGK A;  1JLV A;  2FD3 A;  1JZW A;  1UA5 A;  2B1K A;  2B5Y A;  2O87 A;  2M46 A;  2R2J A;  1XVW A;  1YJ6 A;  1B9Y C;  2DKI A;  3LXZ A;  3FW2 A;  3G7J A;  3I9V 2;  5C04 A;  2YZU A;  1FO5 A;  2IN3 A;  2HLS A;  2JZR A;  1DSB A;  1SKR B;  2HFD A;  2YPM A;  3L9V A;  4NV5 A;  3ISO A;  1SEN A;  4MJB A;  2F3M A;  2R5G A;  3L0H A;  4IJ3 A;  3BJ5 A;  1IYH A;  4XS6 A;  2P0G A;  2DBC A;  5IMZ A;  2M72 A;  2O89 A;  2H1G A;  3UVT A;  5D9T A;  2A2R A;  3EPT A;  3QAV A;  1K0A A;  3PR8 A;  3FRC A;  1GUK A;  3TJJ A;  4G0I A;  5DCG A;  1EOH A;  1SYR A;  1TI1 A;  3TKS C;  3FZ4 A;  2XBI A;  4OO4 A;  5HFG A;  1OC9 A;  2R6K A;  3LYP A;  4PQH A;  4KA0 A;  3LGC A;  2BTO T;  2X4A A;  1R26 A;  4WEY A;  3VI7 A;  2PMT A;  4HI7 A;  1NM3 A;  4JZQ A;  2DLX A;  4BWS A;  4WR5 A;  2HSM A;  5JCG A;  4EUY A;  1R5P A;  1UN2 A;  3HA9 A;  4RI6 A;  1AQW A;  1AUC A;  1H75 A;  5DAK B;  4IVF A;  4G19 A;  1EEJ A;  1JZR A;  3ZRE A;  3WGX A;  3ZIJ A;  5E59 A;  3KXO A;  2N5A A;  5EPF A;  3RBT A;  2RLI A;  2MZC A;  4DSR A;  5DAL B;  2TRX A;  5D9X A;  2B5X A;  4H86 A;  1TK8 B;  1IYI A;  2VO4 A;  5LCZ A;  5CRD A;  1ABA A;  3P7X A;  3F0I A;  2H75 A;  3L9U A;  1THX A;  2QA1 A;  2M80 A;  3F4R A;  3GL5 A;  1Z6M A;  1YKA A;  5G1L A;  1PKZ A;  4ZIJ A;  4K7O A;  2ZNM A;  3ZFB A;  8GSS A;  2O7K A;  4MZB A;  4FYB A;  2O8V B;  4ICY A;  1M2D A;  1PSQ A;  4I97 A;  2IME A;  2HSH A;  2WUL A;  4MJE A;  4I5Q A;  3D0Z A;  2P31 A;  4D73 B;  2JSY A;  4ZB6 A;  2L4C A;  4ZB8 A;  2LKU A;  2R3X A;  5HFI A;  2G0F A;  4NWY A;  4KCA A;  4AF2 A;  1GSD A;  4MLY A;  2VLT A;  1I5G A;  3DEX A;  3MNG A;  1GRX A;  3LJR A;  2OA7 A;  4K0N A;  1K3O A;  4P3Y B;  2D2Z A;  3ZMK A;  1TKD B;  1GWC A;  1JZO A;  1GUH A;  5DQS A;  4MF6 A;  5ECH B;  5D9V A;  5JWQ B;  3LQ7 A;  2IPA A;  1VF2 A;  1FB0 A;  4ZL8 A;  1WP0 A;  2YCD A;  1GUL A;  2JZT A;  2GST A;  1QXH A;  4PQ1 A;  2VCT A;  3EMP A;  3DYR A;  4V1A g;  2B1L A;  4O5U A;  5JCW A;  3PPU A;  1F6M C;  2C3N A;  1VF4 A;  3M1G A;  1EOG A;  4KB3 A;  1ERU A;  2GSQ A;  1TDI A;  1PX7 A;  5B8B A;  1HQO A;  4RI7 A;  5ID2 A;  1GSQ A;  4JR6 A;  4HU7 A;  5A5K A;  2H72 A;  3TB2 A;  5F06 A;  4BVY B;  2EIO A;  4ZIL A;  1Z5Y E;  4TR3 A;  4N0V A;  2MMZ A;  4BL7 A;  2VD0 A;  3MWH A;  4X0X A;  3UAP A;  3FHK A;  3LOR A;  1M2A A;  4KAE A;  3GKN A;  1XCC A;  3GSS A;  1PD2 1;  4IQA A;  3UBL A;  2KOK A;  1U88 A;  4WBJ A;  2AYT A;  3GST A;  2DIZ A;  4FYU A;  2GGT A;  2WS2 A;  2R37 A;  3QD9 A;  1TW9 A;  2BJX A;  2JL4 A;  4N30 A;  2VL2 C;  5DDL A;  3G7Y A;  2PER A;  4I6X A;  1SYX A;  4TRX A;  3FY7 A;  1XWA A;  4XIH A;  4IP1 A;  2GZZ A;  4XS1 A;  3FR6 A;  1BG5 A;  3TRQ A;  1NW2 A;  4YAV A;  4G9H A;  3ZIV A;  4L8E A;  4POM A;  5J41 A;  4K5S A;  3KP8 A;  4ZB9 A;  1W89 A;  1NSW A;  5A4U A;  4Z7X A;  3SWL A;  1MDK A;  2QSI A;  1OKT A;  2H0G A;  3F4S A;  1N2A A;  3GH9 A;  1LJR A;  1FHE A;  3GL3 A;  4XTS A;  5DJL A;  1F9M A;  4KF9 A;  4IS0 A;  5JCU A;  6GSU A;  1FW1 A;  2WRT A;  2IFQ B;  2VUP A;  3ME7 A;  4Z2U A;  4O92 A;  1WPI A;  1O85 A;  3ERG A;  4QQ7 A;  1PQN A;  1S3C A;  1PGT A;  3KCM A;  2HXK A;  3F9U A;  1TU7 A;  4ZL7 A;  4O5R A;  1SL0 B;  3TDG A;  4WF4 A;  2OAC A;  5IMF A;  4JED A;  3V1W A;  5J9C A;  1RW1 A;  1MDI A;  4ID0 A;  1M9B A;  1K0B A;  4V2N A;  1WWJ A;  5B8A A;  3UJ1 A;  1G7E A;  4L5L A;  1XZO A;  2F51 A;  1GSF A;  2PU9 C;  3HJM A;  2GQK A;  2HZE A;  2X8C A;  1G0T A;  2CV4 A;  4YAP A;  3UAR A;  1G6W A;  3MSZ A;  1R4W A;  5IOX A;  4TXO B;  3GKM A;  4XCS A;  4K7N A;  2H76 A;  2A4V A;  4OWY A;  2VLV A;  1WIK A;  3UVH A;  1XW6 A;  3IK9 A;  4MPG A;  3ERW A;  4GWR A;  2WJU A;  1TJD A;  1XVQ A;  2PVO C;  2R0C A;  2FNO A;  1X9S B;  4JE1 A;  4ECI A;  4CY6 A;  5H5S A;  5AIV A;  1XOA A;  2HI7 A;  3D21 A;  2V6O A;  4L0U A;  2HSY A;  4TR0 A;  3JCM L;  5CNW A;  4YKF A;  3M8N A;  5F07 A;  3IXR A;  4QL9 A;  4QL7 A;  5D93 A;  3IPZ A;  4WKW A;  2GT6 A;  3BOA A;  3L78 A;  5ECP B;  1SKS B;  1G6Y A;  2O85 A;  4HJ2 A;  1U6T A;  2VOC A;  4BPY A;  1A0F A;  5GST A;  2CVB A;  2A2P A;  2VM1 A;  2CA8 A;  4YQM A;  1YEP A;  2VL9 A;  3KH9 A;  2B6M A;  2H74 A;  3LYK A;  3HDC A;  5B6M A;  1ZL9 A;  7GSS A;  2LUS A;  2RUE A;  1OE7 A;  1V40 A;  1DUG A;  3W8S A;  5CRW A;  4F03 A;  22GS A;  2VAF A;  4MH2 A;  3EU3 A;  2GSS A;  3PH9 A;  1T4Y A;  3QOU A;  3TOT A;  3M9K A;  2VL2 A;  3P90 A;  3RPN A;  5G5E A;  4KH7 A;  1QGV A;  2RII A;  2IWT A;  4OFM A;  3A5I A;  5FHI A;  1EGR A;  2PGT A;  1HYU A;  4BWQ A;  1BYE A;  3CSJ A;  1OVN A;  5CO3 A;  4OMV A;  3RAZ A;  3VK9 A;  2VCV A;  3I6A A;  3EMX A;  4FYC A;  2GDR A;  4RQR A;  2VM2 A;  5GAN D;  1OAZ A;  2V32 A;  4J56 E;  4LLR A;  5G30 A;  3H8Q A;  1X5E A;  1NHO A;  1K0C A;  4V1A p;  2FY6 A;  1HD2 A;  3TGZ A;  4MDC A;  1F2E A;  3GUS A;  5ABR A;  1M9A A;  1WE0 A;  2OE0 A;  2TRC P;  1OKD A;  1TOF A;  1TXX A;  2E7P A;  3RPP A;  4HJM A;  2FCH A;  3IRA A;  4G0L A;  1V2A A;  5IPG A;  2A4H A;  4GXZ A;  3TKQ A;  4OFT A;  18GS A;  5ENU A;  3WT1 A;  2B5E A;  3VWV A;  1UC7 A;  3P2A A;  1GNW A;  1AC1 A;  2L59 A;  2YV9 A;  3RDW A;  5HR2 A;  4NXI A;  5HQP A;  3ERF A;  4TR1 A;  2FA4 A;  2LEG A;  2GT5 A;  1DE2 A;  3KEB A;  2GSR A;  10GS A;  2LST A;  4MJA A;  4G0K A;  3CXG A;  4EE0 A;  4PX1 A;  2NTO A;  3ED3 A;  2H73 A;  5CAX A;  4NV2 A;  3D4T A;  2YNX A;  11GS A;  2H1B A;  1GTU A;  2DJJ A;  2V1M A;  5F8B A;  1QUW A;  3TJB A;  1TU8 A;  2OKA A;  1SJI A;  3P8W A;  2I4A A;  2PBJ A;  2OJL A;  3DIE A;  6GSS A;  3ME8 A;  5ELG A;  3FR9 A;  2REM A;  3W6G A;  3APO A;  4G2E A;  2CT6 A;  3UIW A;  2PN8 A;  1USB A;  1YQ1 A;  2HRK A;  3GV1 A;  2C0F A;  2ZCT A;  4KCE A;  2GTU A;  4OD7 A;  4KND A;  3DKS A;  5IQY A;  2WZ9 A;  4PNG A;  4ZL9 A;  3CRT A;  3VWU A;  5B7C A;  2UZ8 A;  4IKH A;  1A24 A;  5J4U A;  16GS A;  5HR0 A;  2R0P A;  3IK7 A;  2GVP A;  2H6Y A;  4I2T A;  3KMO A;  5G5F A;  4YKG A;  4JR4 A;  1ERW A;  1FVJ A;  2AUV A;  4HOJ A;  1O7U A;  2N5F A;  3GTU A;  2RM6 A;  2QA2 A;  5CRH A;  3GX8 A;  5KOW A;  4GTU A;  3CRU A;  5KOX A;  13GS A;  2YOI A;  3ZYW A;  4K2D A;  4DSS B;  4AGS A;  3S9F A;  2MMO A;  2HYX A;  1AIU A;  3TJF A;  3TUE A;  3VFI A;  3CTF A;  3GN3 A;  1XW5 A;  1GP1 A;  4HZ4 A;  1BJX A;  4V2L A;  2C80 A;  2OAD A;  3WGE A;  2IFQ A;  2L5O A;  4CW9 A;  2C0G A;  1GSY A;  2FLS A;  4Q5R A;  4POK A;  3D4M A;  1GTB A;  5EVO A;  2CZ2 A;  4ISD A;  4PNF A;  2R0G A;  2QC7 A;  5KN2 A;  2H6X A;  2IMI A;  1ZOF A;  1TI3 A;  1GTA A;  1OC8 A;  3D6I A;  4HZ2 A;  1Z9H A;  3ZFL A;  3L4N A;  2HRN A;  1CQH A;  5GSS A;  1JHB A;  3GHA A;  3EVI A;  5GAP D;  1MD4 A;  2GLR A;  2C8U A;  1B48 A;  3J7Y k;  2L57 A;  2J9H A;  5JWR B;  3TKP A;  5LNK e;  2C3T A;  1Z6N A;  2ZUP A;  3FK8 A;  3FR3 A;  4G10 A;  4FH8 A;  1T7P B;  3A2W A;  3HD5 A;  1PN0 A;  4TXO A;  1GLQ A;  5KN0 A;  4PTS A;  2NBS A;  2PVQ A;  1ZYP A;  1SK2 A;  5IM9 A;  3QFA C;  3M0F A;  1PL1 A;  3QPM A;  2C0E A;  5ECR B;  2L6D A;  3QDN A;  2DJK A;  3F6F A;  4Q5N A;  3PIN A;  4KDX A;  5D8I A;  2LJR A;  1VRS D;  2H01 A;  1PL2 A;  1GLP A;  5DBQ A;  2CQ9 A;  1ERV A;  1YY7 A;  1DE1 A;  4ULX A;  4EKZ A;  1GUM A;  4EF0 A;  4ACS A;  4POB A;  1T00 A;  2H1D A;  4K5R A;  3GFK A;  5C00 A;  5AN1 A;  3TRP A;  2IMK A;  5EL8 A;  5IMA A;  1DBY A;  1YEX A;  3M9J A;  2X8H A;  4TW5 A;  3TKS A;  5KN3 A;  2AJQ B;  3ZTL A;  1TP9 A;  3O6T A;  2LRT A;  5IIZ A;  2LNT A;  2DSA A;  1EZK A;  1X5C A;  3KM6 A;  1X0R A;  3IV4 A;  4X1U A;  2FWE A;  2IJY A;  3ZRD A;  2CVD A;  1GSS A;  2PWJ A;  3HJP A;  5CRE A;  2FUG 2;  3GRX A;  3DRN A;  5AIX A;  3RHB A;  1FB6 A;  3WGD A;  3HHV A;  4TN8 A;  2NVL A;  3F63 A;  4IEL A;  4AJ7 A;  4MNN A;  2YWI A;  1B8X A;  4GF0 A;  1TK5 B;  2ES7 A;  2KLX A;  3DVW A;  1BAY A;  2GQL A;  2X8G A;  2ALB A;  5DCH A;  2NDO A;  4L0W A;  1EP8 A;  4EC0 A;  1XOB A;  4K0G A;  2F8F A;  19GS A;  2HZF A;  2FWF A;  1KNG A;  4A5P A;  2WFC A;  4GSS A;  4LMV A;  3A2X A;  3F3Q A;  2DJ2 A;  1MEK A;  2YWM A;  3RHC A;  1A2J A;  2C4J A;  1EWX A;  3F6D A;  3TCO A;  3CSI A;  2HRA A;  5J3R A;  4HU9 A;  2QKE A;  3DD3 A;  3E0U A;  4KW6 A;  4BVX A;  1U3I A;  4TKY A;  2MBT A;  3MIX A;  4Q5Q A;  2H19 A;  3VWW A;  4IBP A;  1TRS A;  2YV7 A;  1XW9 A;  1MTC A;  2YJ7 A;  4OO5 A;  4HEA 2;  2I9H A;  4KSM A;  2MYG A;  2V6K A;  3KP9 A;  4NHW A;  3EE2 A;  3UL3 A;  1E2Y A;  1YKC A;  1A8Y A;  1B4P A;  4JBB A;  3IDV A;  2VCX A;  1XWC A;  17GS A;  2V41 A;  1J08 A;  2JAD A;  2LQQ A;  3K8N A;  1X9M B;  2DJ0 A;  4K1F A;  2OBI A;  4N10 A;  2XPD A;  4LMW A;  3IA1 A;  4IJI A;  1KTE A;  2H70 A;  3KTB A;  1O6J A;  2LQO A;  4F2I A;  1ZCP A;  3KZQ A;  4IGJ A;  1AQX A;  1R5A A;  1O8W A;  5DAK A;  1OC3 A;  4GST A;  1BQ7 A;  3A5W A;  1YZX A;  1M7T A;  3OR5 A;  4J2F A;  5AIS A;  3DGQ A;  2EIR A;  1SU9 A;  1QMV A;  3TKR A;  5H5R A;  3GIX A;  12GS A;  5D9W A;  4CHS A;  4F0C A;  5DAL A;  2RM5 A;  2PPT A;  1QQ2 A;  2KP1 A;  1X5D A;  4DSS A;  4EIQ A;  4ECB A;  3KTL A;  1GL8 A;  1SK1 A;  4IW9 A;  3GA4 A;  2A2S A;  1VF3 A;  4DEJ A;  5DVB A;  5D96 A;  3KJY A;  2YP6 A;  4JRR A;  4KX4 A;  1YF0 A;  3BBY A;  5IPH A;  3VLN A;  4ML6 A;  4GQF A;  1ACV A;  4IHU A;  5IMV A;  1J9B A;  2XBQ A;  5IMD A;  2IMF A;  3IHQ A;  3FYG A;  3VPT A;  3A3T A;  1K0N A;  1W4V A;  4MZW A;  3CSH A;  5ECI B;  1J0F A;  3O3T A;  2QGV A;  3IAM 2;  3DVX A;  5ECQ B;  1TRV A;  1XFL A;  3ZZX A;  3WD6 A;  4LL1 B;  5CYY A;  3VUR A;  2K8S A;  4WBR D;  1S3A A;  2EIQ A;  3DXB A;  2DJ3 A;  2YZH A;  3LEF A;  2OBK A;  4KDY A;  1G7O A;  4CDO A;  5G2Z A;  4D73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...