5GAND

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
ASVLLPQLRTGWHVDQAIVTETKRLVVIRFGRKNDRQCMIMDELLSSIAERVRNFAVIYLCDIDEVSDFDEMYELTDPMTVMFFYHNKHMMCDFGTGNNNKLNFIVDDKQEMIDILETIFRGARKNKGLVVSPYDYNHKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 37
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02966 DIM1 Mitosis protein DIM1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ganD00
1SJIA 3VWWA 4XHMA 1TOFA 1XFLA 2LQOA 1ZL9A 5IO2A 4TXOA 3NOFA 5IPGA 1A2JA 2FWFA 4Q5NA 3F8UA 1SYXA 1V40A 3TJGA 5D9VA 4GTUA 5B7CA 2H19A 2MYGA 3CRUA 2K8VA 1JLWA 4JR6A 1ZGNA 3Q19A 3VFIA 2B1KA 1Y6EA 1R5PA 3HVSA 3KXOA 1R4WA 5ELGA 2IMIA 4MZWA 4YAPA 2HSHA 2GLRA 3RPPA 2REMA 3UBKA 2H01A 5IIZA 2OE0A 2VCZA 1E2YA 1FVKA 1WOUA 1BYEA 2DJJA 2X8HA 4XTSA 1U3AA 5KN2A 2YPMA 4I2TA 3US3A 2H72A 1ZCPA 2YWMA 2PGTA 3FZAA 1PKZA 3F63A 4MCUA 1A0FA 4OCFA 2YCDA 3ZITA 4NV5A 4Z7XA 4WEYA 3GRXA 4OFNA 4YQMA 3GN3A 4V1Ap 4YQUA 4YAVA 3S9FA 4PXOA 3C1SA 4ECJA 2L4CA 2C1YA 3IPZA 2FWEA 1G7EA 1MEKA 1PL1A 1VF1A 5H5QA 1V58A 4MH3A 2DSAA 1YKCA 4L5OA 1H75A 1SKWB 2H71A 5A4UA 2GQKA 5CNWA 1TJDA 2B6MA 3KM6A 18GSA 2GZPA 5A4WA 3O3TA 2A4VA 1GTAA 3TKPA 2H6ZA 5LNKe 4QQ7A 4Q5RA 4N10A 1FAAA 5LD0A 2GQMA 2IMDA 1WE0A 1C72A 2K8SA 4N30A 2H1DA 1TRSA 3UVHA 8GSSA 1EP7A 3VURA 1LJRA 1MDJA 10GSA 3D4MA 3H4KA 3N5OA 4YH2A 1GUMA 3HYPA 2C3QA 3LQ7A 4TR0A 4KB3A 5DAKB 4E8EA 3D0ZA 1X9SB 4OCEA 1Z6MA 3PINA 4HDEA 1SD8A 20GSA 2O87A 2YP6A 1PN9A 2IMKA 4DSRA 2YNXA 1X0RA 4KUNA 2AB6A 4K0NA 4POLA 2EIQA 5D93A 2P5RA 2HI7A 1YZXA 3UOMA 4IW9A 4IP1A 2H66A 1QXHA 2YOIA 2LUSA 4F03A 1GLPA 1W89A 4HU9A 4HQZA 5DQYA 5DDLA 2LEGA 1PGTA 5ECLB 2R4VA 2VL9A 1S3AA 2X64A 5IMVA 2DJ2A 5DAKA 1QQ2A 1OC8A 2JSZA 5D96A 5F0GA 1H4OA 3UBLA 3HJMA 2B5XA 5GSSA 2CX4A 2J9HA 5ECRB 1V2AA 4KCEA 5ECPB 13GSA 2AHEA 1TRVA 1CQGA 2H0IA 2VCQA 3ZZXA 3IOSA 4QL9A 1EZKA 2DC5A 3LFLA 2KLXA 12GSA 3EC3A 3K8NA 5G1LA 1OC9A 2VCVA 2XC2A 1PD21 2IFQA 1XCCA 3TJKA 3GKXA 3EURA 5JCUA 3VI7A 4KX4A 1ERVA 2DIZA 1GNWA 2H73A 2AJQB 4KW6A 3L4NA 3KZQA 2H6XA 1PSQA 3PH9A 2JZSA 2OBKA 4PQHA 3QPMA 2I1UA 3ZVJD 3IK7A 3GKMA 4P3YB 2OE1A 2VM1A 3FRCA 2VL3A 5IMDA 3L78A 3HJPA 5JCGA 4IGJA 2YV9A 2ZNMA 3HVXA 4MJAA 2ZCTA 3TCOA 4XS4A 2CV4A 5DALA 5G5EA 4ZBBA 3FZ9A 3QFAC 2L5LA 2HZEA 3WT1A 4BVYA 4TVEA 3KH9A 4ZBDA 5AIXA 3QFBC 3H8QA 3KH7A 2M46A 4JZQA 3IA1A 2VOCA 2FGXA 2DLXA 3TKSA 4BL7A 1O8XA 4IS0A 1SK1A 2VD0A 3TGZA 3TJJA 5JWQB 3I69A 2NDOA 1GSFA 1T00A 2H30A 1O81A 2I4AA 3VI5A 3F0IA 3H1NA 4XRAA 3GYKA 3CSJA 1XOBA 3J7Yk 2H70A 1GP1A 4WBRD 3CTGA 1OE8A 2PERA 1QMVA 2C80A 4ZB8A 2WRTA 4NXIA 3ERGA 5ECKB 1XOAA 1EEJA 4F82A 5G30A 5G1KA 1EOHA 2HT9A 3GMFA 1YF0A 1E6BA 1Z9HA 1TRUA 3ZVJA 5CRGA 4JBBA 3ZRDA 3M1GA 1N2AA 2K18A 2CAQA 4I2UA 4X43A 3C71A 4GSNA 3APOA 1B9XC 1GSYA 4HQSA 2XBQA 3F6FA 3L9VA 1GSUA 1GLQA 1T3BA 5H5SA 1TK8B 1TTZA 4MA9A 4HZ4A 3GTUA 4MH2A 2BMXA 2O7KA 4Q5QA 5J9BA 3W8SA 3FR9A 2GZYA 4GRFA 3I43A 5AISA 2N5BA 2B7KA 1I9DA 3WYWA 3HZ4A 1XWAA 2OKAA 3ZL5A 2CX3A 2VCXA 5ECNB 3TRXA 3FY7A 2H1BA 3IDVA 5EL8A 3TRQA 2Z9SA 1AQXA 1GULA 1O7UA 2FA8A 1TRWA 3BCIA 1MTCA 4DSSA 2AUVA 1RW1A 2YJHA 3QAVA 1ON4A 4KDYA 3O76A 3M0FA 3WGEA 2JSYA 1M99A 2YWOA 5G31A 5COHA 1TKDB 3U5RE 5ABRA 4K7IA 4O7HA 3A2WA 2B7JA 11GSA 4MPFA 3L9UA 3EU4A 4L0UA 2DJ3A 2VCWA 2MMAA 2VLVA 4OO4A 2WB9A 4HZ2A 3WD6A 3TJBA 2H6YA 2E7PA 4TXVA 6GSYA 1BX9A 2GT5A 3Q74A 1EOGA 1KTEA 4TKYA 3C8EA 3UL3A 4FYUA 3I9V2 4EO3A 3LGCA 4V1Ag 3F3QA 1XW6A 5HQPA 4PGTA 1HNAA 1GNEA 3EMXA 3GKNA 1IYIA 2IIYA 5IOXA 4V2LA 1NW2A 2VL2C 3NZNA 2E0QA 3HA9A 5F05A 2O89A 2HRNA 2AV4A 4ACSA 1Q98A 2OACA 1R26A 3BBYA 2PUKC 1PMTA 3MSZA 1FB0A 1T4YA 5H5RA 2KP2A 2XHFA 5B8AA 2IWTA 1UA5A 2L6CA 2X8GA 1EV9A 1T7PB 2JZRA 2VD1A 4E8HA 4MK3A 1B4PA 1K3LA 1K3YA 4TRXA 1K0DA 1DSBA 2G2QA 4IQAA 4DEJA 2LJAA 5CRWA 4BPYA 4FO5A 3FW2A 3P7XA 1G7OA 5HR3A 2VM2A 2HFDA 3G7YA 5J4UA 5LCZA 5ID2B 1EEMA 1USBA 4GCIA 5IMAA 3LSZA 1GUKA 2C0DA 5GSTA 4BVXA 4HI7A 1X5DA 3EINA 3LWAA 4ZL8A 5J41A 3TKRA 3VK9A 1SENA 4GLTA 2IPAA 4XIHA 2ON7A 2CZ3A 3ME7A 3WT2A 1AXDA 3CBUA 2QKEA 1ZZYA 2L5OA 4EC0A 1GSQA 1X5CA 4EE0A 3UJ1A 5ECSA 3Q6OA 5ECMB 1F2EA 3TJFA 1K3OA 1K0MA 5DJLA 5AN1A 1F37A 1TW9A 4KSOA 2F3MA 3BCKA 4KAEA 1A2LA 1SKRB 5J9CA 3G7JA 2DIYA 3EWLA 4AJ8A 1G0TA 4DVCA 2HZFA 2B3SA 3F3RA 1Z3EA 2E2GA 4EVMA 1EGOA 1WJKA 2YWNA 5ENUA 2R3XA 2AYTA 5GZZB 3LYPA 1GSDA 4HUAA 1JZOA 2XPDA 2FWHA 5A5KA 4EXJA 3GIXA 2KP1A 5IQYA 1J0FA 2JADA 2YZHA 2NTOA 2FLSA 16GSA 4PNGA 1LU4A 1XPVA 3MAKA 3QMXA 3C73A 4L0WA 2RM5A 4XS1A 2CT6A 1FW1A 3FK8A 4ZBAA 2PMTA 4NMUA 1AAZA 3M8NA 2OJLA 3ERWA 2EC4A 3ERFA 2JU5A 4F9ZA 1A24A 3ISOA 3DYRA 3TDGA 3A3TA 3TB2A 2KOKA 4J2FA 4JE1A 1SKSB 4NAXA 5IMFA 2DJKA 4N11A 3UMAA 2DMLA 4POKA 3KMNA 1G6YA 1KNGA 3HCZA 5IPHA 2GTUA 2XPEA 1A8LA 1THOA 1F3BA 3RHBA 3U6VA 3HKRA 3ZMLA 2ON5A 4K1FA 2NPBA 3Q18A 3F9UA 4XRDA 1V9WA 1GL8A 5ECIB 3IXRA 5CREA 4HJ2A 2LV3A 4ISDA 4N0VA 3LG6A 4LL4B 4TR3A 1TXXA 5IO0A 4NV2A 1K0CA 2H74A 2CA8A 2A2SA 3FHKA 4IBPA 3D21A 4ILFA 3VWXA 1K0AA 2C0FA 5J3RA 1A2MA 1VF4A 4PNFA 1K0NA 5D9TA 5DCHA 5HFIA 3TRPA 2VUPA 1SL1B 2V2GA 4K6XA 1DE1A 1YY7A 1ERWA 1M2DA 3QR6A 4TOPA 3W6GA 1YDKA 3EE2A 5E4WA 5B6NA 4WR5A 1ERTA 1X5EA 3FR3A 3D5JA 2B5YA 1DBYA 2C0EA 2J23A 2K9FA 3W8JA 2TRXA 4V2NA 2B5EA 3GFKA 1HNBA 3GA4A 3D4TA 2O85A 3D6IA 4ZB9A 3F4SA 3IBHA 5ECQB 3AY8A 4I97A 4L8EA 2FD3A 4KGIA 4G9HA 2MMZA 4OO5A 2EIOA 2NBSA 4EDYA 4MDCA 1THXA 6GSUA 1GUHA 1XW5A 1MDKA 2R5GA 3HVVA 9GSSA 5D73A 3V1WA 2V1MA 2E2MA 3CRTA 5KN3A 3SWLA 2H1GA 1TU7A 2PU9C 4OMVA 2O8VB 3ZIJA 2N5AA 1XW9A 1A8YA 5KN1A 1ERUA 1S3CA 1T8EB 4F2IA 1GSEA 2F8AA 1VRSD 2X99A 5DQSA 5E59A 4N0ZA 1SK2A 4EF0A 4XS6A 2YZUA 1B4QA 1TI1A 1FOVA 1WPIA 2TRCP 3VPQA 1Q4JA 2WDUA 5AGYA 5FT3A 14GSA 1VF2A 4MABA 5IMCA 1VGLA 3HD5A 5DJMA 2FY6A 2R2JA 2D2ZA 3GX8A 1SJ6A 3QD9A 1RK4A 3GX0A 4X0XA 4JRRA 1UC7A 3DXBA 3MDKA 2H0GA 3IHQA 3BJ5A 3E9JB 1HD2A 4JU5A 4TW5A 1EGRA 1Z6NA 1WRYA 2B1LA 4V2MA 3RDWA 3TOUA 1W4VA 1EV4A 1F9MA 1QK8A 1SL2B 3HZ8A 1BG5A 4G2EA 2C3TA 3FKFA 4HJMA 3EMPA 4POBA 4OFTA 3APQA 5JCWA 4MZCA 4POMA 3QCPA 2BTOT 3N9JA 2MMNA 3IC4A 1TK0B 2GT6A 3F4TA 3ZFBA 2HYXA 3KGKA 2LQQA 2OE3A 1NHYA 4MJBA 2IN3A 1OAZA 1U3IA 3WGDA 4KH7A 1AIUA 1Y25A 1R7HA 1YEPA 1ZMAA 3FZ4A 3EYTA 4IVFA 3UARA 4PQIA 4H86A 1U87A 5F06A 1XIYA 4PQ1A 4JR4A 1XWBA 4I5QA 3GUSA 1PRXA 1J9BA 2GQLA 3LXZA 2HE3A 2HXKA 4OD7A 4RUVA 1XVWA 4G10A 2KHPA 1NM3A 4ZL7A 2CAIA 2CVBA 1UVZA 5FHIA 4IJ3A 5C00A 3ZLPA 5JWOB 4IQ1A 2WZ9A 2MBSA 6GSVA 3GL3A 5IOWA 3CYNA 1HNCA 4GQFA 2V32A 4X1UA 1ST9A 4HU7A 1ZYEA 4CDOA 2HNLA 3P8WA 1PQNA 1M7TA 1M0UA 1AQVA 4LLRA 3IV4A 3CSIA 4MP4A 4ZILA 3ZREA 6GSTA 2HLSA 4HOJA 5IM9A 1AC1A 4K7NA 1DUGA 1JZRA 4QL7A 1Z7RA 1ACVA 5EY6A 1QGVA 2RM6A 2YJ7A 1QUWA 4GQCA 2PBJA 2H1AA 3DD3A 3RPNA 3H93A 2H76A 5B8BA 1O73A 3KJYA 5HR0A 3KCMA 1JFUA 1YJ6A 1XWKA 1FB6A 3LYKA 6GSXA 5L71A 3F4RA 4WETA 1GSSA 2L4QA 3KIJA 2HRFA 1XWGA 1YKAA 4LL1B 4TXOB 1KBNA 1U88A 5ECHB 3FYGA 4IELA 2P5QA 1FG4A 5DVBA 2C3NA 5CRDA 3ME8A 4O92A 2A2RA 2FHEA 1M9AA 3QOUA 3FR6A 2FCHA 6GSWA 4ZXGA 2C8UA 4EDZA 2NVLA 4ZIJA 2LJKA 1GRXA 2QC7A 1X9WB 2WS2A 3DGQA 4HS1A 2OADA 2K6VA 4GSTA 4ECIA 3VWVA 4K7OA 4IHUA 4RQRA 2QGVA 3TOTA 2HSYA 6GSSA 1I5GA 2VL2A 5CYYA 1OE7A 2GZZA 2LSTA 3APSA 3TUEA 4PUFC 5KN0A 5D9XA 5GAND 2GDRA 4RI7A 3E3EA 3ED3A 1XZOA 2R6KA 3UIWA 1TP9A 1UN2A 5CP1A 1CQHA 3BD2A 4GSSA 3QAWA 4O32A 2QSIA 3MNGA 3H79A 3FEUA 1TDIA 1PX7A 5F8BA 1PA3A 4NPBA 3GHAA 2R37A 5HFKA 1WIKA 2CZ2A 4KNDA 3G9BA 5DCGA 2OBIA 3LEFA 3I6AA 5GAPD 2LRNA 4ZB6A 2CVDA 4MMMA 4TR4A 4J57E 2N5FA 1ILOA 4FH8A 1XWCA 5EVOA 3KTLA 2FA4A 3KP9A 5HR1A 2VCTA 2GSRA 3A5WA 3HHVA 4JEDA 3WGXA 1AW9A 5G2ZA 5ID2A 1FVJA 2V41A 3L9SA 1XXUA 1KEBA 3M3MA 4CW9A 3DMLA 1A0RP 2WGRA 1HYUA 1OVNA 2I81A 3R2QA 4MLYA 4TN8A 4NHWA 1GTUA 3TKQA 4MF6A 1O85A 4WXTA 1GTIA 4K0GA 2V6KA 4F0CA 1VF3A 2LS5A 2EIRA 3TKSE 1JLVA 1TI3A 5D8IA 5CO3A 1K0BA 4NWYA 1YQ1A 3IAM2 2M80A 2YWIA 4IP6A 1SD9A 1M2BA 3M9JA 3HXSA 2IJYA 2L59A 3D22A 4I8BA 4LA1A 3DVWA 1WMJA 3E0UA 5B6MA 3C1RA 1ZYQB 2WCIA 2VAFA 2PPTA 5CRHA 1F3AA 1PKWA 1XVQA 7GSSA 4MF5A 1MD3A 2VO4A 1SYRA 4FYCA 4FYBA 4IJIA 3DVXA 2H75A 2L6DA 5JWRB 4OWYA 1BAYA 2V6OA 3CXGA 2JACA 4GF0A 3KTBA 1TU8A 2IL3A 1WWJA 3LXTA 1K0OA 1SU9A 4WF5A 2DJ0A 4WF4A 1SL0B 3GURA 1R5AA 4KCAA 4O5RA 1B8XA 1SK0A 2PVOC 3QAGA 3P2AA 3KP8A 1MD4A 2LRTA 2M72A 5G5FA 1EWXA 4MF7A 1OC9B 1JZWA 2IFQB 3ZTLA 3LORA 1YF1A 3RHCA 1J08A 3GV1A 2JZTA 2G0FA 4WBJA 1RQMA 2VIMA 3DKSA 4K2DA 2H8LA 19GSA 4MZBA 2F9SA 4F0BA 3RBTA 1TK5B 2GSTA 4KDUA 2L57A 1V57A 3GSTA 4EUYA 2ZUPA 2YN1A 1A23A 2ES7A 1ZOFA 2WULA 2MZCA 5KEJA 4XCSA 3GNJA 2LRCA 2BJXA 3MWHA 3GL5A 4ML6A 4RQXA 4XS4B 2MBTA 1ML6A 5DALB 4K9ZA 5CAXA 1FHEA 2HZEB 5INYA 1YEXA 2VLTA 2RIIA 3CSHA 1B9YC 2LNSA 1IYHA 4J56E 4HEA2 1V98A 2F8FA 4I6XA 4AGSA 4OFMA 3GH9A 5EPFA 1M9BA 1ABAA 1LBKA 1NSWA 3CTFA 1SJZA 3FZ5A 3J7Yb 5F07A 4D73B 4RI6A 3HJOA 1PL2A 4ZL9A 4BA7A 3G7IA 3NIVA 3TKSC 4BWSA 3M9KA 4KE3A 3KD0A 3GSSA 3RAZA 5AIVA 4EL1A 2I3YA 5DBQA 3IRAA 4BWQA 1B48A 4ECBA 4TR1B 2RUEA 5HFGA 3DEXA 5IMZA 17GSA 4LMWA 1BEDA 1OKDA 4MPGA 4PX1A 2H0HA 4YQVA 3BOAA 3HDCA 3ZIVA 4LMVA 1GH2A 4IKHA 4D73A 3GTUB 3VPTA 2I9HA 1FO5A 1S3DA 1GWCA 3DIEA 2LNTA 2TIRA 1OC3A 3C7MA 2CVKA 1WP0A 2PN8A 4MJCA 3UEMA 4ULXA 1M2AA 1O8WA 3VWUA 1QFNA 3ZFLA 4KA0A 2P31A 1G6WA 1GTBA 3OR5A 3A2VA 1T4ZA 4TR1A 2PVQA 3ZMKA 2FUG2 4IN0A 2ALBA 4L5LA 4ECCA 2RLIA 2C4JA 1EP8A 1F6MC 2DBCA 4DSSB 2DMMA 3IR4A 4EKZA 1N8JA 2FWGA 2OA7A 4KDXA 2PWJA 3IE3A 2C0GA 1DE2A 1Z7PA 3EU3A 1MDIA 3P90A 5FWGA 2MMOA 5A4VA 1OYJA 5ECOB 2GSQA 3PR8A 2WFCA 3UVTA 1AUCA 3CMIA 3EVIA 2RUFA 2GVPA 4AJ6A 1URMA 2X8CA 2AAWA 2IMFA 3GH6A 2DJ1A 2LTKA 4PURA 1BJXA 5J5NA 2GGTA 1T1VA 2GS3A 4FIWA 4K8MA 2FNOA 2GSSA 22GSA 4WR4A 3KMOA 3VLNA 1U6TA 3F6DA 2IMEA 2CQ9A 5ELAA 5HR2A 2YV7A 4AJ7A 4CHSA 4DSQA 1JZDA 3KEBA 3UAPA 1O6JA 3IAS2 1XBSA 2F51A 2LKUA 2JL4A 4Q5FA 4AF2A 3LJRA 3PGTA 1PX6A 4G19A 3GKKA 1Z5YE 2XBIA 1HQOA 2WJUA 3SBCA 2P0GA 1AQWA 4NHZA 4PUAA 5C04A 4ML1A 3O6TA 4GWRA 2YANA 3DRNA 3JCML 1JHBA 3QDNA 2VLUA 2KUCA 4MJEA 3L0HA 1OKTA 5D9WA 3IK9A 4GXZA 2LJRA 4KSMA 1BQ7A 4ID0A 1X9MB 3ZYWA 4WKWA 3A2XA 3HY2A 3DWVA 1NHOA
chains in the Genus database with same CATH superfamily
1SJIA 4BVXB 3VWWA 4XHMA 1TOFA 1XFLA 3LW9A 2LQOA 1ZL9A 1ZYNA 5IO2A 4TXOA 3NOFA 5IPGA 2HRKA 1A2JA 2FWFA 4Q5NA 3F8UA 1SYXA 1V40A 3TJGA 5D9VA 4GTUA 5B7CA 2H19A 2MYGA 3CRUA 2K8VA 1JLWA 4JR6A 1ZGNA 3Q19A 3VFIA 2B1KA 1Y6EA 1R5PA 3HVSA 3KXOA 1R4WA 5ELGA 2IMIA 4MZWA 4YAPA 2HSHA 2GLRA 3RPPA 2REMA 3UBKA 2H01A 5IIZA 2OE0A 2VCZA 1E2YA 1FVKA 1WOUA 1BYEA 2DJJA 2X8HA 4XTSA 1U3AA 5KN2A 2YPMA 4I2TA 3US3A 4PTSA 2H72A 1ZCPA 3MYDA 2YWMA 2PGTA 3FZAA 1PKZA 3F63A 4MCUA 4YKFA 1PFOA 1A0FA 4OCFA 2YCDA 3ZITA 4NV5A 4Z7XA 4WEYA 3GRXA 4OFNA 4YQMA 3GN3A 4V1Ap 4YQUA 4YAVA 3S9FA 4PXOA 3C1SA 4ECJA 2L4CA 2C1YA 3IPZA 2FWEA 1G7EA 1MEKA 1PL1A 1VF1A 5H5QA 1V58A 4MH3A 2DSAA 1YKCA 2DKHA 4L5OA 1H75A 1SKWB 2H71A 5A4UA 2GQKA 5CNWA 1TJDA 2B6MA 3KM6A 18GSA 2GZPA 5A4WA 3O3TA 2A4VA 1GTAA 3TKPA 2H6ZA 5LNKe 4QQ7A 4Q5RA 4N10A 1FAAA 5LD0A 2GQMA 2IMDA 1WE0A 1C72A 2K8SA 4N30A 2H1DA 4O5UA 1TRSA 3UVHA 3R3EA 8GSSA 1EP7A 3VURA 1LJRA 3HVNA 1MDJA 10GSA 3D4MA 3H4KA 3N5OA 4YH2A 1GUMA 3HYPA 2C3QA 3LQ7A 4TR0A 4KB3A 5DAKB 2A4HA 4E8EA 3D0ZA 1X9SB 4OCEA 1Z6MA 3PINA 4HDEA 1SD8A 20GSA 2O87A 2YP6A 1PN9A 2IMKA 4DSRA 2YNXA 1X0RA 4KUNA 2AB6A 4K0NA 4POLA 2EIQA 5D93A 2P5RA 2HI7A 1ZYPA 1YZXA 3UOMA 4IW9A 4K5RA 4IP1A 2H66A 1QXHA 2YOIA 2LUSA 4F03A 1GLPA 1W89A 4HU9A 4HQZA 5DQYA 5DDLA 2LEGA 1PGTA 5ECLB 2R4VA 2VL9A 1S3AA 2X64A 5IMVA 2DJ2A 5DAKA 1QQ2A 1OC8A 2JSZA 5D96A 5F0GA 1H4OA 3UBLA 3HJMA 2B5XA 5GSSA 4A5PA 2CX4A 2J9HA 5ECRB 1V2AA 4KCEA 5ECPB 13GSA 2AHEA 1TRVA 1CQGA 2H0IA 2VCQA 3ZZXA 3IOSA 4QL9A 1EZKA 2DC5A 3LFLA 2KLXA 12GSA 3EC3A 3K8NA 5G1LA 1OC9A 2VCVA 2XC2A 1PD21 2IFQA 1XCCA 3MIXA 3TJKA 3GKXA 3EURA 5JCUA 3VI7A 4KX4A 1ERVA 2DIZA 1GNWA 2H73A 2X49A 2AJQB 4KW6A 3L4NA 3KZQA 2H6XA 1PSQA 3PH9A 2JZSA 4BL7B 2OBKA 4PQHA 3QPMA 2I1UA 3ZVJD 3IK7A 3GKMA 4P3YB 2OE1A 2VM1A 4HSCX 3FRCA 2VL3A 5IMDA 3L78A 3HJPA 5JCGA 4IGJA 2YV9A 2ZNMA 3HVXA 4MJAA 2ZCTA 3TCOA 4XS4A 2CV4A 5DALA 5G5EA 4ZBBA 3FZ9A 3QFAC 2L5LA 2HZEA 3WT1A 4BVYA 4TVEA 3KH9A 4ZBDA 5AIXA 3QFBC 3H8QA 3KH7A 2M46A 4JZQA 3IA1A 2VOCA 2FGXA 2DLXA 3TKSA 4BL7A 1O8XA 4IS0A 1SK1A 2VD0A 3TGZA 3TJJA 5JWQB 3I69A 2NDOA 1GSFA 1T00A 2H30A 1O81A 2I4AA 3VI5A 3F0IA 3H1NA 4XRAA 3GYKA 3CSJA 1XOBA 3J7Yk 2R0PA 2H70A 1GP1A 4WBRD 3CTGA 1OE8A 2PERA 1QMVA 2C80A 4ZB8A 2WRTA 4NXIA 3ERGA 5ECKB 1XOAA 1EEJA 4F82A 5G30A 5G1KA 1EOHA 2HT9A 3GMFA 1YF0A 1E6BA 1Z9HA 1TRUA 3ZVJA 5CRGA 4JBBA 3ZRDA 3M1GA 1N2AA 2K18A 2CAQA 4I2UA 4X43A 3C71A 4GSNA 3APOA 1B9XC 1GSYA 4HQSA 2XBQA 3F6FA 3L9VA 1GSUA 1GLQA 1T3BA 5H5SA 1TK8B 1TTZA 4MA9A 4HZ4A 3GTUA 4MH2A 2BMXA 2O7KA 4Q5QA 5J9BA 3IHGA 3W8SA 3FR9A 2GZYA 4GRFA 3I43A 5AISA 2N5BA 2B7KA 1I9DA 3WYWA 3HZ4A 1XWAA 2OKAA 3ZL5A 2CX3A 2VCXA 5ECNB 3TRXA 3FY7A 2H1BA 3IDVA 5EL8A 3TRQA 2Z9SA 1AQXA 1GULA 1O7UA 4FQUA 2FA8A 1TRWA 3BCIA 1MTCA 4DSSA 2AUVA 1RW1A 2YJHA 3QAVA 1ON4A 4KDYA 3O76A 3M0FA 3WGEA 2JSYA 2A2PA 1M99A 2YWOA 5G31A 5COHA 1TKDB 3U5RE 5ABRA 4K7IA 4O7HA 3A2WA 2B7JA 11GSA 4MPFA 3L9UA 3EU4A 4L0UA 2DJ3A 2VCWA 2MMAA 2VLVA 4OO4A 2WB9A 4HZ2A 3WD6A 3TJBA 2H6YA 2E7PA 4TXVA 6GSYA 1BX9A 2GT5A 3Q74A 1EOGA 1KTEA 4TKYA 3C8EA 3UL3A 4FYUA 3CQFA 3I9V2 4K2XA 4EO3A 3LGCA 4V1Ag 3F3QA 1XW6A 5HQPA 4PGTA 1HNAA 1GNEA 4KF9A 3EMXA 3GKNA 1IYIA 4G0KA 2IIYA 5IOXA 4V2LA 1NW2A 2VL2C 3NZNA 2E0QA 3HA9A 5F05A 2O89A 2HRNA 2AV4A 4ACSA 1Q98A 2OACA 1R26A 3BBYA 2PUKC 1PMTA 3MSZA 4G0LA 1FB0A 1T4YA 5H5RA 2KP2A 2XHFA 5B8AA 2IWTA 1UA5A 2L6CA 2X8GA 1EV9A 1T7PB 2JZRA 2VD1A 4E8HA 4MK3A 1B4PA 1K3LA 1K3YA 4TRXA 1K0DA 1DSBA 2G2QA 4IQAA 4DEJA 2LJAA 4BIKA 5CRWA 4BPYA 4FO5A 3FW2A 3P7XA 1G7OA 5HR3A 2VM2A 2HFDA 3G7YA 5J4UA 5LCZA 5ID2B 1EEMA 1USBA 4GCIA 5IMAA 3LSZA 1GUKA 2C0DA 5GSTA 4BVXA 4HI7A 1X5DA 3EINA 3LWAA 4ZL8A 5J41A 3TKRA 3VK9A 1SENA 4GLTA 4O5QA 2IPAA 4XIHA 2ON7A 2CZ3A 3ME7A 3WT2A 1AXDA 3CBUA 2QKEA 1ZZYA 2L5OA 4EC0A 1GSQA 1X5CA 4EE0A 3UJ1A 5ECSA 3Q6OA 5ECMB 1F2EA 3TJFA 1K3OA 1K0MA 2HRAA 5DJLA 5AN1A 1F37A 1TW9A 4KSOA 2F3MA 3BCKA 4KAEA 1A2LA 1SKRB 5J9CA 3G7JA 2DIYA 3EWLA 4AJ8A 1G0TA 4DVCA 2HZFA 2B3SA 3F3RA 1Z3EA 2E2GA 4EVMA 1EGOA 2DKIA 1WJKA 2YWNA 2QA2A 5ENUA 2R3XA 2AYTA 5GZZB 3LYPA 1GSDA 4HUAA 1JZOA 2XPDA 2FWHA 5A5KA 4EXJA 3GIXA 2KP1A 5IQYA 1J0FA 2JADA 2YZHA 2NTOA 2FLSA 16GSA 4PNGA 1LU4A 1XPVA 3MAKA 3QMXA 3C73A 4L0WA 2RM5A 4XS1A 2CT6A 1FW1A 3FK8A 4ZBAA 2PMTA 4NMUA 1AAZA 3M8NA 2OJLA 3ERWA 2EC4A 3ERFA 2JU5A 4F9ZA 1A24A 3ISOA 3DYRA 3TDGA 3A3TA 3TB2A 2KOKA 4J2FA 4JE1A 1SKSB 4NAXA 5IMFA 2DJKA 4N11A 3UMAA 2DMLA 4POKA 3KMNA 1G6YA 1KNGA 3HCZA 5IPHA 2GTUA 2XPEA 1A8LA 1THOA 1F3BA 3RHBA 3U6VA 3HKRA 3ZMLA 2ON5A 4K1FA 2NPBA 3Q18A 3F9UA 4XRDA 1V9WA 1GL8A 5ECIB 3IXRA 5CREA 4HJ2A 2LV3A 4ISDA 4N0VA 3LG6A 4LL4B 4TR3A 1TXXA 5IO0A 4NV2A 1K0CA 2H74A 2CA8A 2A2SA 3FHKA 4IBPA 3D21A 4ILFA 3VWXA 1K0AA 2C0FA 5J3RA 1A2MA 1VF4A 4PNFA 1K0NA 5D9TA 5DCHA 5HFIA 3TRPA 2VUPA 1SL1B 2V2GA 4K6XA 1DE1A 1YY7A 1ERWA 1M2DA 3QR6A 4TOPA 3W6GA 1YDKA 3EE2A 5E4WA 5B6NA 4WR5A 1ERTA 1X5EA 3FR3A 4Z2TA 3D5JA 2B5YA 1DBYA 2C0EA 2J23A 2K9FA 3W8JA 2TRXA 4V2NA 2B5EA 3GFKA 1HNBA 3GA4A 3D4TA 2O85A 3D6IA 4ZB9A 3F4SA 3IBHA 5ECQB 3AY8A 4I97A 4L8EA 4ICYA 2UZ8A 2FD3A 4KGIA 4G9HA 2MMZA 4OO5A 2X4AA 2EIOA 2NBSA 4EDYA 4MDCA 1THXA 6GSUA 1GUHA 1XW5A 1MDKA 2R5GA 3HVVA 9GSSA 5D73A 3V1WA 2V1MA 2E2MA 3CRTA 5KN3A 3SWLA 2H1GA 1TU7A 2PU9C 4OMVA 2O8VB 3ZIJA 2N5AA 1XW9A 1A8YA 5KN1A 1ERUA 1S3CA 1T8EB 4F2IA 1GSEA 2F8AA 1VRSD 2X99A 5DQSA 5E59A 4N0ZA 4EIPA 1SK2A 4EF0A 4XS6A 2YZUA 1B4QA 1TI1A 1FOVA 1WPIA 2TRCP 3VPQA 1Q4JA 2WDUA 4Z2RA 5AGYA 5FT3A 14GSA 1VF2A 4MABA 5IMCA 1VGLA 3HD5A 5DJMA 2FY6A 2R2JA 1S3RA 2D2ZA 4CY6A 3GX8A 1SJ6A 3QD9A 1RK4A 3GX0A 4USSA 3A5IA 4X0XA 4JRRA 1UC7A 3DXBA 3MDKA 2H0GA 3IHQA 3BJ5A 3E9JB 1HD2A 4JU5A 4TW5A 1EGRA 1Z6NA 1WRYA 2B1LA 4V2MA 3RDWA 3TOUA 1W4VA 1EV4A 1F9MA 1QK8A 1SL2B 3HZ8A 1BG5A 4G2EA 2C3TA 1PN0A 3FKFA 4HJMA 3EMPA 4POBA 4OFTA 3APQA 5JCWA 4MZCA 4POMA 3QCPA 2BTOT 3N9JA 2MMNA 3IC4A 1TK0B 2GT6A 3F4TA 3ZFBA 2HYXA 3KGKA 2LQQA 2OE3A 1NHYA 4MJBA 2IN3A 1OAZA 1U3IA 3WGDA 4KH7A 1AIUA 1Y25A 1R7HA 1YEPA 1ZMAA 3FZ4A 4EIQA 3EYTA 4IVFA 3UARA 4PQIA 4H86A 1U87A 5F06A 1XIYA 4PQ1A 4JR4A 1XWBA 4I5QA 3GUSA 1PRXA 1J9BA 2GQLA 3LXZA 2HE3A 2HXKA 4OD7A 4RUVA 1XVWA 4G10A 2KHPA 1NM3A 4ZL7A 2CAIA 2CVBA 1UVZA 5FHIA 4Z2UA 4IJ3A 5C00A 3ZLPA 5JWOB 4IQ1A 2WZ9A 2MBSA 6GSVA 3GL3A 5IOWA 3CYNA 1HNCA 4GQFA 2V32A 4X1UA 4G0IA 1ST9A 4HU7A 1ZYEA 4CDOA 2HNLA 3P8WA 1PQNA 1M7TA 1M0UA 1AQVA 4LLRA 3IV4A 3CSIA 4MP4A 4ZILA 3ZREA 6GSTA 2HLSA 4HOJA 5IM9A 1AC1A 4K7NA 1DUGA 1JZRA 4QL7A 1Z7RA 1ACVA 5EY6A 1QGVA 2RM6A 2YJ7A 1QUWA 4GQCA 2PBJA 2H1AA 3DD3A 3RPNA 5BMUA 3H93A 2H76A 5B8BA 1O73A 3KJYA 4X4JA 5HR0A 3KCMA 1JFUA 1YJ6A 1XWKA 1FB6A 3LYKA 6GSXA 5L71A 3F4RA 4WETA 1GSSA 2L4QA 3KIJA 2HRFA 1XWGA 1YKAA 4LL1B 4TXOB 1KBNA 1U88A 5ECHB 3FYGA 4IELA 2P5QA 1FG4A 5DVBA 2C3NA 5CRDA 3ME8A 4O92A 2A2RA 2FHEA 1M9AA 3QOUA 3FR6A 2FCHA 6GSWA 4ZXGA 2C8UA 4EDZA 2NVLA 4ZIJA 2LJKA 1GRXA 2QC7A 1X9WB 2WS2A 3DGQA 4HS1A 2OADA 2K6VA 4GSTA 4ECIA 3VWVA 4K7OA 4IHUA 4RQRA 2QGVA 3TOTA 2HSYA 6GSSA 1I5GA 2VL2A 5CYYA 1OE7A 2GZZA 2LSTA 3APSA 3TUEA 4PUFC 5KN0A 1XG8A 5D9XA 5GAND 2GDRA 4RI7A 3E3EA 3ED3A 1XZOA 2R6KA 3UIWA 1TP9A 1UN2A 5CP1A 1CQHA 3BD2A 4GSSA 3QAWA 4O32A 2QSIA 3MNGA 3H79A 3FEUA 1TDIA 1PX7A 5F8BA 1PA3A 4NPBA 3GHAA 2R37A 5HFKA 1WIKA 2CZ2A 4KNDA 3G9BA 5DCGA 5KOXA 2OBIA 3LEFA 3I6AA 2QA1A 5GAPD 2LRNA 4ZB6A 2CVDA 4MMMA 4TR4A 4J57E 2N5FA 1ILOA 4FH8A 1XWCA 5EVOA 3KTLA 2FA4A 3KP9A 5HR1A 2VCTA 2GSRA 3A5WA 3HHVA 4JEDA 3WGXA 1AW9A 5G2ZA 5ID2A 1FVJA 2V41A 3L9SA 4MNNA 1XXUA 1KEBA 3M3MA 3PPUA 4CW9A 3DMLA 1A0RP 2WGRA 1HYUA 1OVNA 2I81A 3R2QA 4MLYA 4TN8A 4NHWA 1GTUA 3TKQA 4MF6A 1O85A 4WXTA 1GTIA 4K0GA 2V6KA 4F0CA 1VF3A 2LS5A 2EIRA 3TKSE 1JLVA 1TI3A 5D8IA 5CO3A 1K0BA 4NWYA 1YQ1A 3IAM2 2M80A 2YWIA 4IP6A 1SD9A 1M2BA 3M9JA 3HXSA 2IJYA 2L59A 3D22A 4I8BA 4LA1A 3DVWA 1WMJA 3E0UA 5B6MA 5KOWA 3C1RA 1ZYQB 2WCIA 2VAFA 2PPTA 5CRHA 1F3AA 1PKWA 2R0GA 1XVQA 7GSSA 4MF5A 1MD3A 2VO4A 1SYRA 4FYCA 4FYBA 4IJIA 3DVXA 2H75A 2L6DA 5JWRB 4OWYA 1BAYA 2V6OA 3CXGA 2JACA 4GF0A 3KTBA 1TU8A 1FOHA 2IL3A 1WWJA 3LXTA 1K0OA 1SU9A 4WF5A 2DJ0A 4WF4A 1SL0B 3GURA 1R5AA 4KCAA 4O5RA 1B8XA 1SK0A 2PVOC 3QAGA 3P2AA 3KP8A 1MD4A 2LRTA 2M72A 5G5FA 1EWXA 4MF7A 5BRTA 1OC9B 1JZWA 2IFQB 3ZTLA 3LORA 1YF1A 3RHCA 1J08A 3GV1A 1M3JA 2JZTA 2G0FA 4WBJA 1RQMA 2VIMA 3DKSA 4K2DA 2H8LA 19GSA 4MZBA 2F9SA 4F0BA 3RBTA 1TK5B 2GSTA 4KDUA 2L57A 1V57A 3GSTA 4EUYA 2ZUPA 2YN1A 1A23A 2ES7A 1ZOFA 2WULA 2MZCA 2R0CA 5KEJA 4XCSA 3GNJA 2LRCA 2BJXA 3IC8A 3MWHA 3GL5A 4ML6A 4RQXA 4XS4B 2MBTA 1ML6A 5DALB 4K9ZA 5CAXA 1FHEA 2HZEB 4BVYB 5INYA 1YEXA 2VLTA 2RIIA 3CSHA 1B9YC 2LNSA 1IYHA 4J56E 4HEA2 1V98A 2F8FA 4I6XA 4AGSA 4OFMA 3GH9A 5EPFA 1M9BA 1ABAA 1LBKA 1NSWA 3CTFA 1SJZA 3FZ5A 3J7Yb 5F07A 4D73B 4RI6A 3HJOA 1PL2A 4ZL9A 4BA7A 3G7IA 3NIVA 3TKSC 4BWSA 3M9KA 4KE3A 3KD0A 3GSSA 3RAZA 5AIVA 4EL1A 4CY8A 2I3YA 5DBQA 3IRAA 4BWQA 1B48A 4ECBA 4TR1B 2RUEA 5HFGA 3DEXA 5IMZA 17GSA 4LMWA 1BEDA 1OKDA 4MPGA 4PX1A 2H0HA 4YQVA 3BOAA 3HDCA 3ZIVA 4LMVA 1GH2A 4IKHA 4D73A 3GTUB 3VPTA 2I9HA 1FO5A 1S3DA 1GWCA 3DIEA 2LNTA 2TIRA 1OC3A 3C7MA 2CVKA 1WP0A 2PN8A 4MJCA 3UEMA 4ULXA 1M2AA 1O8WA 3VWUA 1QFNA 3ZFLA 4KA0A 2P31A 1G6WA 1GTBA 3OR5A 3A2VA 1T4ZA 4TR1A 2PVQA 3ZMKA 2FUG2 4IN0A 2ALBA 4L5LA 4ECCA 2RLIA 2C4JA 1EP8A 1F6MC 2DBCA 4DSSB 2DMMA 3IR4A 4EKZA 1N8JA 4YKGA 2FWGA 2OA7A 4KDXA 2PWJA 3IE3A 2C0GA 3FMWA 1M3IA 1DE2A 1Z7PA 3EU3A 1MDIA 3P90A 5FWGA 2MMOA 5A4VA 1OYJA 5ECOB 2GSQA 3PR8A 2HSMA 2WFCA 3UVTA 1AUCA 3CMIA 3EVIA 2RUFA 2GVPA 4AJ6A 1URMA 3EPTA 2X8CA 2AAWA 2IMFA 3GH6A 2DJ1A 2LTKA 4PURA 1BJXA 5J5NA 2GGTA 1T1VA 2GS3A 4FIWA 4K8MA 2FNOA 2GSSA 22GSA 4WR4A 3KMOA 3VLNA 1U6TA 3F6DA 2IMEA 2CQ9A 5ELAA 5HR2A 2YV7A 4AJ7A 4CHSA 4DSQA 1JZDA 3KEBA 3UAPA 1O6JA 3IAS2 1XBSA 2F51A 2LKUA 2JL4A 4Q5FA 4AF2A 3LJRA 3PGTA 1PX6A 4G19A 3GKKA 1Z5YE 2XBIA 1HQOA 2WJUA 3SBCA 2P0GA 1AQWA 4NHZA 4PUAA 5C04A 4ML1A 3O6TA 4GWRA 2YANA 3DRNA 3JCML 1JHBA 3QDNA 2VLUA 2KUCA 4MJEA 3L0HA 1OKTA 5D9WA 3IK9A 4GXZA 4K5SA 2LJRA 4KSMA 1BQ7A 4ID0A 1X9MB 3ZYWA 4WKWA 3A2XA 3HY2A 3DWVA 1NHOA
chains in the Genus database with same CATH topology
1SJIA 4BVXB 3VWWA 4XHMA 1TOFA 1XFLA 3LW9A 2LQOA 1ZL9A 1ZYNA 5IO2A 4TXOA 3NOFA 5IPGA 2HRKA 1A2JA 2FWFA 4Q5NA 3F8UA 1SYXA 1V40A 3TJGA 5D9VA 4GTUA 5B7CA 2H19A 2MYGA 3CRUA 2K8VA 1JLWA 4JR6A 1ZGNA 3Q19A 3VFIA 2B1KA 1Y6EA 1R5PA 3HVSA 3KXOA 1R4WA 5ELGA 2IMIA 4MZWA 4YAPA 2HSHA 2GLRA 3RPPA 2REMA 3UBKA 2H01A 5IIZA 2OE0A 2VCZA 1E2YA 1FVKA 1WOUA 1BYEA 2DJJA 2X8HA 4XTSA 1U3AA 5KN2A 2YPMA 4I2TA 3US3A 4PTSA 2H72A 1ZCPA 3MYDA 2YWMA 2PGTA 3FZAA 1PKZA 3F63A 4MCUA 4YKFA 1A0FA 4OCFA 2YCDA 3ZITA 4NV5A 4Z7XA 4WEYA 3GRXA 4OFNA 4YQMA 3GN3A 4V1Ap 4YQUA 4YAVA 3S9FA 4PXOA 3C1SA 4ECJA 2L4CA 2C1YA 3IPZA 2FWEA 1G7EA 1MEKA 1PL1A 1VF1A 5H5QA 1V58A 4MH3A 2DSAA 1YKCA 2DKHA 4L5OA 1H75A 1SKWB 2H71A 5A4UA 2GQKA 5CNWA 1TJDA 2B6MA 3KM6A 18GSA 2GZPA 5A4WA 3O3TA 2A4VA 1GTAA 3TKPA 2H6ZA 5LNKe 4QQ7A 4Q5RA 4N10A 1FAAA 5LD0A 2GQMA 2IMDA 1WE0A 1C72A 2K8SA 4N30A 2H1DA 4O5UA 1TRSA 3UVHA 3R3EA 8GSSA 1EP7A 3VURA 1LJRA 1MDJA 10GSA 3D4MA 3H4KA 3N5OA 4YH2A 1GUMA 3HYPA 2C3QA 3LQ7A 4TR0A 4KB3A 5DAKB 2A4HA 4E8EA 3D0ZA 1X9SB 4OCEA 1Z6MA 3PINA 4HDEA 1SD8A 20GSA 2O87A 2YP6A 1PN9A 2IMKA 4DSRA 2YNXA 1X0RA 4KUNA 2AB6A 4K0NA 4POLA 2EIQA 5D93A 2P5RA 2HI7A 1ZYPA 1YZXA 3UOMA 4IW9A 4K5RA 4IP1A 2H66A 1QXHA 2YOIA 2LUSA 4F03A 1GLPA 1W89A 4HU9A 4HQZA 5DQYA 5DDLA 2LEGA 1PGTA 5ECLB 2R4VA 2VL9A 1S3AA 2X64A 5IMVA 2DJ2A 5DAKA 1QQ2A 1OC8A 2JSZA 5D96A 5F0GA 1H4OA 3UBLA 3HJMA 2B5XA 5GSSA 4A5PA 2CX4A 2J9HA 5ECRB 1V2AA 4KCEA 5ECPB 13GSA 2AHEA 1TRVA 1CQGA 2H0IA 2VCQA 3ZZXA 3IOSA 4QL9A 1EZKA 2DC5A 3LFLA 2KLXA 12GSA 3EC3A 3K8NA 5G1LA 1OC9A 2VCVA 2XC2A 1PD21 2IFQA 1XCCA 3MIXA 3TJKA 3GKXA 3EURA 5JCUA 3VI7A 4KX4A 1ERVA 2DIZA 1GNWA 2H73A 2X49A 2AJQB 4KW6A 3L4NA 3KZQA 2H6XA 1PSQA 3PH9A 2JZSA 4BL7B 2OBKA 4PQHA 3QPMA 2I1UA 3ZVJD 3IK7A 3GKMA 4P3YB 2OE1A 2VM1A 3FRCA 2VL3A 5IMDA 3L78A 3HJPA 5JCGA 4IGJA 2YV9A 2ZNMA 3HVXA 4MJAA 2ZCTA 3TCOA 4XS4A 2CV4A 5DALA 5G5EA 4ZBBA 3FZ9A 3QFAC 2L5LA 2HZEA 3WT1A 4BVYA 4TVEA 3KH9A 4ZBDA 5AIXA 3QFBC 3H8QA 3KH7A 2M46A 4JZQA 3IA1A 2VOCA 2FGXA 2DLXA 3TKSA 4BL7A 1O8XA 4IS0A 1SK1A 2VD0A 3TGZA 3TJJA 5JWQB 3I69A 2NDOA 1GSFA 1T00A 2H30A 1O81A 2I4AA 3VI5A 3F0IA 3H1NA 4XRAA 3GYKA 3CSJA 1XOBA 3J7Yk 2R0PA 2H70A 1GP1A 4WBRD 3CTGA 1OE8A 2PERA 1QMVA 2C80A 4ZB8A 2WRTA 4NXIA 3ERGA 5ECKB 1XOAA 1EEJA 4F82A 5G30A 5G1KA 1EOHA 2HT9A 3GMFA 1YF0A 1E6BA 1Z9HA 1TRUA 3ZVJA 5CRGA 4JBBA 3ZRDA 3M1GA 1N2AA 2K18A 2CAQA 4I2UA 4X43A 3C71A 4GSNA 3APOA 1B9XC 1GSYA 4HQSA 2XBQA 3F6FA 3L9VA 1GSUA 1GLQA 1T3BA 5H5SA 1TK8B 1TTZA 4MA9A 4HZ4A 3GTUA 4MH2A 2BMXA 2O7KA 4Q5QA 5J9BA 3IHGA 3W8SA 3FR9A 2GZYA 4GRFA 3I43A 5AISA 2N5BA 2B7KA 1I9DA 3WYWA 3HZ4A 1XWAA 2OKAA 3ZL5A 2CX3A 2VCXA 5ECNB 3TRXA 3FY7A 2H1BA 3IDVA 5EL8A 3TRQA 2Z9SA 1AQXA 1GULA 1O7UA 4FQUA 2FA8A 1TRWA 3BCIA 1MTCA 4DSSA 2AUVA 1RW1A 2YJHA 3QAVA 1ON4A 4KDYA 3O76A 3M0FA 3WGEA 2JSYA 2A2PA 1M99A 2YWOA 5G31A 5COHA 1TKDB 3U5RE 5ABRA 4K7IA 4O7HA 3A2WA 2B7JA 11GSA 4MPFA 3L9UA 3EU4A 4L0UA 2DJ3A 2VCWA 2MMAA 2VLVA 4OO4A 2WB9A 4HZ2A 3WD6A 3TJBA 2H6YA 2E7PA 4TXVA 6GSYA 1BX9A 2GT5A 3Q74A 1EOGA 1KTEA 4TKYA 3C8EA 3UL3A 4FYUA 3I9V2 4K2XA 4EO3A 3LGCA 4V1Ag 3F3QA 1XW6A 5HQPA 4PGTA 1HNAA 1GNEA 4KF9A 3EMXA 3GKNA 1IYIA 4G0KA 2IIYA 5IOXA 4V2LA 1NW2A 2VL2C 3NZNA 2E0QA 3HA9A 5F05A 2O89A 2HRNA 2AV4A 4ACSA 1Q98A 2OACA 1R26A 3BBYA 2PUKC 1PMTA 3MSZA 4G0LA 1FB0A 1T4YA 5H5RA 2KP2A 2XHFA 5B8AA 2IWTA 1UA5A 2L6CA 2X8GA 1EV9A 1T7PB 2JZRA 2VD1A 4E8HA 4MK3A 1B4PA 1K3LA 1K3YA 4TRXA 1K0DA 1DSBA 2G2QA 4IQAA 4DEJA 2LJAA 5CRWA 4BPYA 4FO5A 3FW2A 3P7XA 1G7OA 5HR3A 2VM2A 2HFDA 3G7YA 5J4UA 5LCZA 5ID2B 1EEMA 1USBA 4GCIA 5IMAA 3LSZA 1GUKA 2C0DA 5GSTA 4BVXA 4HI7A 1X5DA 3EINA 3LWAA 4ZL8A 5J41A 3TKRA 3VK9A 1SENA 4GLTA 4O5QA 2IPAA 4XIHA 2ON7A 2CZ3A 3ME7A 3WT2A 1AXDA 3CBUA 2QKEA 1ZZYA 2L5OA 4EC0A 1GSQA 1X5CA 4EE0A 3UJ1A 5ECSA 3Q6OA 5ECMB 1F2EA 3TJFA 1K3OA 1K0MA 2HRAA 5DJLA 5AN1A 1F37A 1TW9A 4KSOA 2F3MA 3BCKA 4KAEA 1A2LA 1SKRB 5J9CA 3G7JA 2DIYA 3EWLA 4AJ8A 1G0TA 4DVCA 2HZFA 2B3SA 3F3RA 1Z3EA 2E2GA 4EVMA 1EGOA 2DKIA 1WJKA 2YWNA 2QA2A 5ENUA 2R3XA 2AYTA 5GZZB 3LYPA 1GSDA 4HUAA 1JZOA 2XPDA 2FWHA 5A5KA 4EXJA 3GIXA 2KP1A 5IQYA 1J0FA 2JADA 2YZHA 2NTOA 2FLSA 16GSA 4PNGA 1LU4A 1XPVA 3MAKA 3QMXA 3C73A 4L0WA 2RM5A 4XS1A 2CT6A 1FW1A 3FK8A 4ZBAA 2PMTA 4NMUA 1AAZA 3M8NA 2OJLA 3ERWA 2EC4A 3ERFA 2JU5A 4F9ZA 1A24A 3ISOA 3DYRA 3TDGA 3A3TA 3TB2A 2KOKA 4J2FA 4JE1A 1SKSB 4NAXA 5IMFA 2DJKA 4N11A 3UMAA 2DMLA 4POKA 3KMNA 1G6YA 1KNGA 3HCZA 5IPHA 2GTUA 2XPEA 1A8LA 1THOA 1F3BA 3RHBA 3U6VA 3HKRA 3ZMLA 2ON5A 4K1FA 2NPBA 3Q18A 3F9UA 4XRDA 1V9WA 1GL8A 5ECIB 3IXRA 5CREA 4HJ2A 2LV3A 4ISDA 4N0VA 3LG6A 4LL4B 4TR3A 1TXXA 5IO0A 4NV2A 1K0CA 2H74A 2CA8A 2A2SA 3FHKA 4IBPA 3D21A 4ILFA 3VWXA 1K0AA 2C0FA 5J3RA 1A2MA 1VF4A 4PNFA 1K0NA 5D9TA 5DCHA 5HFIA 3TRPA 2VUPA 1SL1B 2V2GA 4K6XA 1DE1A 1YY7A 1ERWA 1M2DA 3QR6A 4TOPA 3W6GA 1YDKA 3EE2A 5E4WA 5B6NA 4WR5A 1ERTA 1X5EA 3FR3A 4Z2TA 3D5JA 2B5YA 1DBYA 2C0EA 2J23A 2K9FA 3W8JA 2TRXA 4V2NA 2B5EA 3GFKA 1HNBA 3GA4A 3D4TA 2O85A 3D6IA 4ZB9A 3F4SA 3IBHA 5ECQB 3AY8A 4I97A 4L8EA 4ICYA 2UZ8A 2FD3A 4KGIA 4G9HA 2MMZA 4OO5A 2X4AA 2EIOA 2NBSA 4EDYA 4MDCA 1THXA 6GSUA 1GUHA 1XW5A 1MDKA 2R5GA 3HVVA 9GSSA 5D73A 3V1WA 2V1MA 2E2MA 3CRTA 5KN3A 3SWLA 2H1GA 1TU7A 2PU9C 4OMVA 2O8VB 3ZIJA 2N5AA 1XW9A 1A8YA 5KN1A 1ERUA 1S3CA 1T8EB 4F2IA 1GSEA 2F8AA 1VRSD 2X99A 5DQSA 5E59A 4N0ZA 4EIPA 1SK2A 4EF0A 4XS6A 2YZUA 1B4QA 1TI1A 1FOVA 1WPIA 2TRCP 3VPQA 1Q4JA 2WDUA 4Z2RA 5AGYA 5FT3A 14GSA 1VF2A 4MABA 5IMCA 1VGLA 3HD5A 5DJMA 2FY6A 2R2JA 2D2ZA 4CY6A 3GX8A 1SJ6A 3QD9A 1RK4A 3GX0A 4USSA 3A5IA 4X0XA 4JRRA 1UC7A 3DXBA 3MDKA 2H0GA 3IHQA 3BJ5A 3E9JB 1HD2A 4JU5A 4TW5A 1EGRA 1Z6NA 1WRYA 2B1LA 4V2MA 3RDWA 3TOUA 1W4VA 1EV4A 1F9MA 1QK8A 1SL2B 3HZ8A 1BG5A 4G2EA 2C3TA 1PN0A 3FKFA 4HJMA 3EMPA 4POBA 4OFTA 3APQA 5JCWA 4MZCA 4POMA 3QCPA 2BTOT 3N9JA 2MMNA 3IC4A 1TK0B 2GT6A 3F4TA 3ZFBA 2HYXA 3KGKA 2LQQA 2OE3A 1NHYA 4MJBA 2IN3A 1OAZA 1U3IA 3WGDA 4KH7A 1AIUA 1Y25A 1R7HA 1YEPA 1ZMAA 3FZ4A 4EIQA 3EYTA 4IVFA 3UARA 4PQIA 4H86A 1U87A 5F06A 1XIYA 4PQ1A 4JR4A 1XWBA 4I5QA 3GUSA 1PRXA 1J9BA 2GQLA 3LXZA 2HE3A 2HXKA 4OD7A 4RUVA 1XVWA 4G10A 2KHPA 1NM3A 4ZL7A 2CAIA 2CVBA 1UVZA 5FHIA 4Z2UA 4IJ3A 5C00A 3ZLPA 5JWOB 4IQ1A 2WZ9A 2MBSA 6GSVA 3GL3A 5IOWA 3CYNA 1HNCA 4GQFA 2V32A 4X1UA 4G0IA 1ST9A 4HU7A 1ZYEA 4CDOA 2HNLA 3P8WA 1PQNA 1M7TA 1M0UA 1AQVA 4LLRA 3IV4A 3CSIA 4MP4A 4ZILA 3ZREA 6GSTA 2HLSA 4HOJA 5IM9A 1AC1A 4K7NA 1DUGA 1JZRA 4QL7A 1Z7RA 1ACVA 5EY6A 1QGVA 2RM6A 2YJ7A 1QUWA 4GQCA 2PBJA 2H1AA 3DD3A 3RPNA 5BMUA 3H93A 2H76A 5B8BA 1O73A 3KJYA 4X4JA 5HR0A 3KCMA 1JFUA 1YJ6A 1XWKA 1FB6A 3LYKA 6GSXA 5L71A 3F4RA 4WETA 1GSSA 2L4QA 3KIJA 2HRFA 1XWGA 1YKAA 4LL1B 4TXOB 1KBNA 1U88A 5ECHB 3FYGA 4IELA 2P5QA 1FG4A 5DVBA 2C3NA 5CRDA 3ME8A 4O92A 2A2RA 2FHEA 1M9AA 3QOUA 3FR6A 2FCHA 6GSWA 4ZXGA 2C8UA 4EDZA 2NVLA 4ZIJA 2LJKA 1GRXA 2QC7A 1X9WB 2WS2A 3DGQA 4HS1A 2OADA 2K6VA 4GSTA 4ECIA 3VWVA 4K7OA 4IHUA 4RQRA 2QGVA 3TOTA 2HSYA 6GSSA 1I5GA 2VL2A 5CYYA 1OE7A 2GZZA 2LSTA 3APSA 3TUEA 4PUFC 5KN0A 5D9XA 5GAND 2GDRA 4RI7A 3E3EA 3ED3A 1XZOA 2R6KA 3UIWA 1TP9A 1UN2A 5CP1A 1CQHA 3BD2A 4GSSA 3QAWA 4O32A 2QSIA 3MNGA 3H79A 3FEUA 1TDIA 1PX7A 5F8BA 1PA3A 4NPBA 3GHAA 2R37A 5HFKA 1WIKA 2CZ2A 4KNDA 3G9BA 5DCGA 5KOXA 2OBIA 3LEFA 3I6AA 2QA1A 5GAPD 2LRNA 4ZB6A 2CVDA 4MMMA 4TR4A 4J57E 2N5FA 1ILOA 4FH8A 1XWCA 5EVOA 3KTLA 2FA4A 3KP9A 5HR1A 2VCTA 2GSRA 3A5WA 3HHVA 4JEDA 3WGXA 1AW9A 5G2ZA 5ID2A 1FVJA 2V41A 3L9SA 4MNNA 1XXUA 1KEBA 3M3MA 3PPUA 4CW9A 3DMLA 1A0RP 2WGRA 1HYUA 1OVNA 2I81A 3R2QA 4MLYA 4TN8A 4NHWA 1GTUA 3TKQA 4MF6A 1O85A 4WXTA 1GTIA 4K0GA 2V6KA 4F0CA 1VF3A 2LS5A 2EIRA 3TKSE 1JLVA 1TI3A 5D8IA 5CO3A 1K0BA 4NWYA 1YQ1A 3IAM2 2M80A 2YWIA 4IP6A 1SD9A 1M2BA 3M9JA 3HXSA 2IJYA 2L59A 3D22A 4I8BA 4LA1A 3DVWA 1WMJA 3E0UA 5B6MA 5KOWA 3C1RA 1ZYQB 2WCIA 2VAFA 2PPTA 5CRHA 1F3AA 1PKWA 2R0GA 1XVQA 7GSSA 4MF5A 1MD3A 2VO4A 1SYRA 4FYCA 4FYBA 4IJIA 3DVXA 2H75A 2L6DA 5JWRB 4OWYA 1BAYA 2V6OA 3CXGA 2JACA 4GF0A 3KTBA 1TU8A 1FOHA 2IL3A 1WWJA 3LXTA 1K0OA 1SU9A 4WF5A 2DJ0A 4WF4A 1SL0B 3GURA 1R5AA 4KCAA 4O5RA 1B8XA 1SK0A 2PVOC 3QAGA 3P2AA 3KP8A 1MD4A 2LRTA 2M72A 5G5FA 1EWXA 4MF7A 5BRTA 1OC9B 1JZWA 2IFQB 3ZTLA 3LORA 1YF1A 3RHCA 1J08A 3GV1A 2JZTA 2G0FA 4WBJA 1RQMA 2VIMA 3DKSA 4K2DA 2H8LA 19GSA 4MZBA 2F9SA 4F0BA 3RBTA 1TK5B 2GSTA 4KDUA 2L57A 1V57A 3GSTA 4EUYA 2ZUPA 2YN1A 1A23A 2ES7A 1ZOFA 2WULA 2MZCA 2R0CA 5KEJA 4XCSA 3GNJA 2LRCA 2BJXA 3IC8A 3MWHA 3GL5A 4ML6A 4RQXA 4XS4B 2MBTA 1ML6A 5DALB 4K9ZA 5CAXA 1FHEA 2HZEB 4BVYB 5INYA 1YEXA 2VLTA 2RIIA 3CSHA 1B9YC 2LNSA 1IYHA 4J56E 4HEA2 1V98A 2F8FA 4I6XA 4AGSA 4OFMA 3GH9A 5EPFA 1M9BA 1ABAA 1LBKA 1NSWA 3CTFA 1SJZA 3FZ5A 3J7Yb 5F07A 4D73B 4RI6A 3HJOA 1PL2A 4ZL9A 4BA7A 3G7IA 3NIVA 3TKSC 4BWSA 3M9KA 4KE3A 3KD0A 3GSSA 3RAZA 5AIVA 4EL1A 4CY8A 2I3YA 5DBQA 3IRAA 4BWQA 1B48A 4ECBA 4TR1B 2RUEA 5HFGA 3DEXA 5IMZA 17GSA 4LMWA 1BEDA 1OKDA 4MPGA 4PX1A 2H0HA 4YQVA 3BOAA 3HDCA 3ZIVA 4LMVA 1GH2A 4IKHA 4D73A 3GTUB 3VPTA 2I9HA 1FO5A 1S3DA 1GWCA 3DIEA 2LNTA 2TIRA 1OC3A 3C7MA 2CVKA 1WP0A 2PN8A 4MJCA 3UEMA 4ULXA 1M2AA 1O8WA 3VWUA 1QFNA 3ZFLA 4KA0A 2P31A 1G6WA 1GTBA 3OR5A 3A2VA 1T4ZA 4TR1A 2PVQA 3ZMKA 2FUG2 4IN0A 2ALBA 4L5LA 4ECCA 2RLIA 2C4JA 1EP8A 1F6MC 2DBCA 4DSSB 2DMMA 3IR4A 4EKZA 1N8JA 4YKGA 2FWGA 2OA7A 4KDXA 2PWJA 3IE3A 2C0GA 3FMWA 1DE2A 1Z7PA 3EU3A 1MDIA 3P90A 5FWGA 2MMOA 5A4VA 1OYJA 5ECOB 2GSQA 3PR8A 2HSMA 2WFCA 3UVTA 1AUCA 3CMIA 3EVIA 2RUFA 2GVPA 4AJ6A 1URMA 3EPTA 2X8CA 2AAWA 2IMFA 3GH6A 2DJ1A 2LTKA 4PURA 1BJXA 5J5NA 2GGTA 1T1VA 2GS3A 4FIWA 4K8MA 2FNOA 2GSSA 22GSA 4WR4A 3KMOA 3VLNA 1U6TA 3F6DA 2IMEA 2CQ9A 5ELAA 5HR2A 2YV7A 4AJ7A 4CHSA 4DSQA 1JZDA 3KEBA 3UAPA 1O6JA 3IAS2 1XBSA 2F51A 2LKUA 2JL4A 4Q5FA 4AF2A 3LJRA 3PGTA 1PX6A 4G19A 3GKKA 1Z5YE 2XBIA 1HQOA 2WJUA 3SBCA 2P0GA 1AQWA 4NHZA 4PUAA 5C04A 4ML1A 3O6TA 4GWRA 2YANA 3DRNA 3JCML 1JHBA 3QDNA 2VLUA 2KUCA 4MJEA 3L0HA 1OKTA 5D9WA 3IK9A 4GXZA 4K5SA 2LJRA 4KSMA 1BQ7A 4ID0A 1X9MB 3ZYWA 4WKWA 3A2XA 3HY2A 3DWVA 1NHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SJI A;  3VWW A;  4XHM A;  1TOF A;  1XFL A;  2LQO A;  1ZL9 A;  5IO2 A;  4TXO A;  3NOF A;  5IPG A;  1A2J A;  2FWF A;  4Q5N A;  3F8U A;  1SYX A;  1V40 A;  3TJG A;  5D9V A;  4GTU A;  5B7C A;  2H19 A;  2MYG A;  3CRU A;  2K8V A;  1JLW A;  4JR6 A;  1ZGN A;  3Q19 A;  3VFI A;  2B1K A;  1Y6E A;  1R5P A;  3HVS A;  3KXO A;  1R4W A;  5ELG A;  2IMI A;  4MZW A;  4YAP A;  2HSH A;  2GLR A;  3RPP A;  2REM A;  3UBK A;  2H01 A;  5IIZ A;  2OE0 A;  2VCZ A;  1E2Y A;  1FVK A;  1WOU A;  1BYE A;  2DJJ A;  2X8H A;  4XTS A;  1U3A A;  5KN2 A;  2YPM A;  4I2T A;  3US3 A;  2H72 A;  1ZCP A;  2YWM A;  2PGT A;  3FZA A;  1PKZ A;  3F63 A;  4MCU A;  1A0F A;  4OCF A;  2YCD A;  3ZIT A;  4NV5 A;  4Z7X A;  4WEY A;  3GRX A;  4OFN A;  4YQM A;  3GN3 A;  4V1A p;  4YQU A;  4YAV A;  3S9F A;  4PXO A;  3C1S A;  4ECJ A;  2L4C A;  2C1Y A;  3IPZ A;  2FWE A;  1G7E A;  1MEK A;  1PL1 A;  1VF1 A;  5H5Q A;  1V58 A;  4MH3 A;  2DSA A;  1YKC A;  4L5O A;  1H75 A;  1SKW B;  2H71 A;  5A4U A;  2GQK A;  5CNW A;  1TJD A;  2B6M A;  3KM6 A;  18GS A;  2GZP A;  5A4W A;  3O3T A;  2A4V A;  1GTA A;  3TKP A;  2H6Z A;  5LNK e;  4QQ7 A;  4Q5R A;  4N10 A;  1FAA A;  5LD0 A;  2GQM A;  2IMD A;  1WE0 A;  1C72 A;  2K8S A;  4N30 A;  2H1D A;  1TRS A;  3UVH A;  8GSS A;  1EP7 A;  3VUR A;  1LJR A;  1MDJ A;  10GS A;  3D4M A;  3H4K A;  3N5O A;  4YH2 A;  1GUM A;  3HYP A;  2C3Q A;  3LQ7 A;  4TR0 A;  4KB3 A;  5DAK B;  4E8E A;  3D0Z A;  1X9S B;  4OCE A;  1Z6M A;  3PIN A;  4HDE A;  1SD8 A;  20GS A;  2O87 A;  2YP6 A;  1PN9 A;  2IMK A;  4DSR A;  2YNX A;  1X0R A;  4KUN A;  2AB6 A;  4K0N A;  4POL A;  2EIQ A;  5D93 A;  2P5R A;  2HI7 A;  1YZX A;  3UOM A;  4IW9 A;  4IP1 A;  2H66 A;  1QXH A;  2YOI A;  2LUS A;  4F03 A;  1GLP A;  1W89 A;  4HU9 A;  4HQZ A;  5DQY A;  5DDL A;  2LEG A;  1PGT A;  5ECL B;  2R4V A;  2VL9 A;  1S3A A;  2X64 A;  5IMV A;  2DJ2 A;  5DAK A;  1QQ2 A;  1OC8 A;  2JSZ A;  5D96 A;  5F0G A;  1H4O A;  3UBL A;  3HJM A;  2B5X A;  5GSS A;  2CX4 A;  2J9H A;  5ECR B;  1V2A A;  4KCE A;  5ECP B;  13GS A;  2AHE A;  1TRV A;  1CQG A;  2H0I A;  2VCQ A;  3ZZX A;  3IOS A;  4QL9 A;  1EZK A;  2DC5 A;  3LFL A;  2KLX A;  12GS A;  3EC3 A;  3K8N A;  5G1L A;  1OC9 A;  2VCV A;  2XC2 A;  1PD2 1;  2IFQ A;  1XCC A;  3TJK A;  3GKX A;  3EUR A;  5JCU A;  3VI7 A;  4KX4 A;  1ERV A;  2DIZ A;  1GNW A;  2H73 A;  2AJQ B;  4KW6 A;  3L4N A;  3KZQ A;  2H6X A;  1PSQ A;  3PH9 A;  2JZS A;  2OBK A;  4PQH A;  3QPM A;  2I1U A;  3ZVJ D;  3IK7 A;  3GKM A;  4P3Y B;  2OE1 A;  2VM1 A;  3FRC A;  2VL3 A;  5IMD A;  3L78 A;  3HJP A;  5JCG A;  4IGJ A;  2YV9 A;  2ZNM A;  3HVX A;  4MJA A;  2ZCT A;  3TCO A;  4XS4 A;  2CV4 A;  5DAL A;  5G5E A;  4ZBB A;  3FZ9 A;  3QFA C;  2L5L A;  2HZE A;  3WT1 A;  4BVY A;  4TVE A;  3KH9 A;  4ZBD A;  5AIX A;  3QFB C;  3H8Q A;  3KH7 A;  2M46 A;  4JZQ A;  3IA1 A;  2VOC A;  2FGX A;  2DLX A;  3TKS A;  4BL7 A;  1O8X A;  4IS0 A;  1SK1 A;  2VD0 A;  3TGZ A;  3TJJ A;  5JWQ B;  3I69 A;  2NDO A;  1GSF A;  1T00 A;  2H30 A;  1O81 A;  2I4A A;  3VI5 A;  3F0I A;  3H1N A;  4XRA A;  3GYK A;  3CSJ A;  1XOB A;  3J7Y k;  2H70 A;  1GP1 A;  4WBR D;  3CTG A;  1OE8 A;  2PER A;  1QMV A;  2C80 A;  4ZB8 A;  2WRT A;  4NXI A;  3ERG A;  5ECK B;  1XOA A;  1EEJ A;  4F82 A;  5G30 A;  5G1K A;  1EOH A;  2HT9 A;  3GMF A;  1YF0 A;  1E6B A;  1Z9H A;  1TRU A;  3ZVJ A;  5CRG A;  4JBB A;  3ZRD A;  3M1G A;  1N2A A;  2K18 A;  2CAQ A;  4I2U A;  4X43 A;  3C71 A;  4GSN A;  3APO A;  1B9X C;  1GSY A;  4HQS A;  2XBQ A;  3F6F A;  3L9V A;  1GSU A;  1GLQ A;  1T3B A;  5H5S A;  1TK8 B;  1TTZ A;  4MA9 A;  4HZ4 A;  3GTU A;  4MH2 A;  2BMX A;  2O7K A;  4Q5Q A;  5J9B A;  3W8S A;  3FR9 A;  2GZY A;  4GRF A;  3I43 A;  5AIS A;  2N5B A;  2B7K A;  1I9D A;  3WYW A;  3HZ4 A;  1XWA A;  2OKA A;  3ZL5 A;  2CX3 A;  2VCX A;  5ECN B;  3TRX A;  3FY7 A;  2H1B A;  3IDV A;  5EL8 A;  3TRQ A;  2Z9S A;  1AQX A;  1GUL A;  1O7U A;  2FA8 A;  1TRW A;  3BCI A;  1MTC A;  4DSS A;  2AUV A;  1RW1 A;  2YJH A;  3QAV A;  1ON4 A;  4KDY A;  3O76 A;  3M0F A;  3WGE A;  2JSY A;  1M99 A;  2YWO A;  5G31 A;  5COH A;  1TKD B;  3U5R E;  5ABR A;  4K7I A;  4O7H A;  3A2W A;  2B7J A;  11GS A;  4MPF A;  3L9U A;  3EU4 A;  4L0U A;  2DJ3 A;  2VCW A;  2MMA A;  2VLV A;  4OO4 A;  2WB9 A;  4HZ2 A;  3WD6 A;  3TJB A;  2H6Y A;  2E7P A;  4TXV A;  6GSY A;  1BX9 A;  2GT5 A;  3Q74 A;  1EOG A;  1KTE A;  4TKY A;  3C8E A;  3UL3 A;  4FYU A;  3I9V 2;  4EO3 A;  3LGC A;  4V1A g;  3F3Q A;  1XW6 A;  5HQP A;  4PGT A;  1HNA A;  1GNE A;  3EMX A;  3GKN A;  1IYI A;  2IIY A;  5IOX A;  4V2L A;  1NW2 A;  2VL2 C;  3NZN A;  2E0Q A;  3HA9 A;  5F05 A;  2O89 A;  2HRN A;  2AV4 A;  4ACS A;  1Q98 A;  2OAC A;  1R26 A;  3BBY A;  2PUK C;  1PMT A;  3MSZ A;  1FB0 A;  1T4Y A;  5H5R A;  2KP2 A;  2XHF A;  5B8A A;  2IWT A;  1UA5 A;  2L6C A;  2X8G A;  1EV9 A;  1T7P B;  2JZR A;  2VD1 A;  4E8H A;  4MK3 A;  1B4P A;  1K3L A;  1K3Y A;  4TRX A;  1K0D A;  1DSB A;  2G2Q A;  4IQA A;  4DEJ A;  2LJA A;  5CRW A;  4BPY A;  4FO5 A;  3FW2 A;  3P7X A;  1G7O A;  5HR3 A;  2VM2 A;  2HFD A;  3G7Y A;  5J4U A;  5LCZ A;  5ID2 B;  1EEM A;  1USB A;  4GCI A;  5IMA A;  3LSZ A;  1GUK A;  2C0D A;  5GST A;  4BVX A;  4HI7 A;  1X5D A;  3EIN A;  3LWA A;  4ZL8 A;  5J41 A;  3TKR A;  3VK9 A;  1SEN A;  4GLT A;  2IPA A;  4XIH A;  2ON7 A;  2CZ3 A;  3ME7 A;  3WT2 A;  1AXD A;  3CBU A;  2QKE A;  1ZZY A;  2L5O A;  4EC0 A;  1GSQ A;  1X5C A;  4EE0 A;  3UJ1 A;  5ECS A;  3Q6O A;  5ECM B;  1F2E A;  3TJF A;  1K3O A;  1K0M A;  5DJL A;  5AN1 A;  1F37 A;  1TW9 A;  4KSO A;  2F3M A;  3BCK A;  4KAE A;  1A2L A;  1SKR B;  5J9C A;  3G7J A;  2DIY A;  3EWL A;  4AJ8 A;  1G0T A;  4DVC A;  2HZF A;  2B3S A;  3F3R A;  1Z3E A;  2E2G A;  4EVM A;  1EGO A;  1WJK A;  2YWN A;  5ENU A;  2R3X A;  2AYT A;  5GZZ B;  3LYP A;  1GSD A;  4HUA A;  1JZO A;  2XPD A;  2FWH A;  5A5K A;  4EXJ A;  3GIX A;  2KP1 A;  5IQY A;  1J0F A;  2JAD A;  2YZH A;  2NTO A;  2FLS A;  16GS A;  4PNG A;  1LU4 A;  1XPV A;  3MAK A;  3QMX A;  3C73 A;  4L0W A;  2RM5 A;  4XS1 A;  2CT6 A;  1FW1 A;  3FK8 A;  4ZBA A;  2PMT A;  4NMU A;  1AAZ A;  3M8N A;  2OJL A;  3ERW A;  2EC4 A;  3ERF A;  2JU5 A;  4F9Z A;  1A24 A;  3ISO A;  3DYR A;  3TDG A;  3A3T A;  3TB2 A;  2KOK A;  4J2F A;  4JE1 A;  1SKS B;  4NAX A;  5IMF A;  2DJK A;  4N11 A;  3UMA A;  2DML A;  4POK A;  3KMN A;  1G6Y A;  1KNG A;  3HCZ A;  5IPH A;  2GTU A;  2XPE A;  1A8L A;  1THO A;  1F3B A;  3RHB A;  3U6V A;  3HKR A;  3ZML A;  2ON5 A;  4K1F A;  2NPB A;  3Q18 A;  3F9U A;  4XRD A;  1V9W A;  1GL8 A;  5ECI B;  3IXR A;  5CRE A;  4HJ2 A;  2LV3 A;  4ISD A;  4N0V A;  3LG6 A;  4LL4 B;  4TR3 A;  1TXX A;  5IO0 A;  4NV2 A;  1K0C A;  2H74 A;  2CA8 A;  2A2S A;  3FHK A;  4IBP A;  3D21 A;  4ILF A;  3VWX A;  1K0A A;  2C0F A;  5J3R A;  1A2M A;  1VF4 A;  4PNF A;  1K0N A;  5D9T A;  5DCH A;  5HFI A;  3TRP A;  2VUP A;  1SL1 B;  2V2G A;  4K6X A;  1DE1 A;  1YY7 A;  1ERW A;  1M2D A;  3QR6 A;  4TOP A;  3W6G A;  1YDK A;  3EE2 A;  5E4W A;  5B6N A;  4WR5 A;  1ERT A;  1X5E A;  3FR3 A;  3D5J A;  2B5Y A;  1DBY A;  2C0E A;  2J23 A;  2K9F A;  3W8J A;  2TRX A;  4V2N A;  2B5E A;  3GFK A;  1HNB A;  3GA4 A;  3D4T A;  2O85 A;  3D6I A;  4ZB9 A;  3F4S A;  3IBH A;  5ECQ B;  3AY8 A;  4I97 A;  4L8E A;  2FD3 A;  4KGI A;  4G9H A;  2MMZ A;  4OO5 A;  2EIO A;  2NBS A;  4EDY A;  4MDC A;  1THX A;  6GSU A;  1GUH A;  1XW5 A;  1MDK A;  2R5G A;  3HVV A;  9GSS A;  5D73 A;  3V1W A;  2V1M A;  2E2M A;  3CRT A;  5KN3 A;  3SWL A;  2H1G A;  1TU7 A;  2PU9 C;  4OMV A;  2O8V B;  3ZIJ A;  2N5A A;  1XW9 A;  1A8Y A;  5KN1 A;  1ERU A;  1S3C A;  1T8E B;  4F2I A;  1GSE A;  2F8A A;  1VRS D;  2X99 A;  5DQS A;  5E59 A;  4N0Z A;  1SK2 A;  4EF0 A;  4XS6 A;  2YZU A;  1B4Q A;  1TI1 A;  1FOV A;  1WPI A;  2TRC P;  3VPQ A;  1Q4J A;  2WDU A;  5AGY A;  5FT3 A;  14GS A;  1VF2 A;  4MAB A;  5IMC A;  1VGL A;  3HD5 A;  5DJM A;  2FY6 A;  2R2J A;  2D2Z A;  3GX8 A;  1SJ6 A;  3QD9 A;  1RK4 A;  3GX0 A;  4X0X A;  4JRR A;  1UC7 A;  3DXB A;  3MDK A;  2H0G A;  3IHQ A;  3BJ5 A;  3E9J B;  1HD2 A;  4JU5 A;  4TW5 A;  1EGR A;  1Z6N A;  1WRY A;  2B1L A;  4V2M A;  3RDW A;  3TOU A;  1W4V A;  1EV4 A;  1F9M A;  1QK8 A;  1SL2 B;  3HZ8 A;  1BG5 A;  4G2E A;  2C3T A;  3FKF A;  4HJM A;  3EMP A;  4POB A;  4OFT A;  3APQ A;  5JCW A;  4MZC A;  4POM A;  3QCP A;  2BTO T;  3N9J A;  2MMN A;  3IC4 A;  1TK0 B;  2GT6 A;  3F4T A;  3ZFB A;  2HYX A;  3KGK A;  2LQQ A;  2OE3 A;  1NHY A;  4MJB A;  2IN3 A;  1OAZ A;  1U3I A;  3WGD A;  4KH7 A;  1AIU A;  1Y25 A;  1R7H A;  1YEP A;  1ZMA A;  3FZ4 A;  3EYT A;  4IVF A;  3UAR A;  4PQI A;  4H86 A;  1U87 A;  5F06 A;  1XIY A;  4PQ1 A;  4JR4 A;  1XWB A;  4I5Q A;  3GUS A;  1PRX A;  1J9B A;  2GQL A;  3LXZ A;  2HE3 A;  2HXK A;  4OD7 A;  4RUV A;  1XVW A;  4G10 A;  2KHP A;  1NM3 A;  4ZL7 A;  2CAI A;  2CVB A;  1UVZ A;  5FHI A;  4IJ3 A;  5C00 A;  3ZLP A;  5JWO B;  4IQ1 A;  2WZ9 A;  2MBS A;  6GSV A;  3GL3 A;  5IOW A;  3CYN A;  1HNC A;  4GQF A;  2V32 A;  4X1U A;  1ST9 A;  4HU7 A;  1ZYE A;  4CDO A;  2HNL A;  3P8W A;  1PQN A;  1M7T A;  1M0U A;  1AQV A;  4LLR A;  3IV4 A;  3CSI A;  4MP4 A;  4ZIL A;  3ZRE A;  6GST A;  2HLS A;  4HOJ A;  5IM9 A;  1AC1 A;  4K7N A;  1DUG A;  1JZR A;  4QL7 A;  1Z7R A;  1ACV A;  5EY6 A;  1QGV A;  2RM6 A;  2YJ7 A;  1QUW A;  4GQC A;  2PBJ A;  2H1A A;  3DD3 A;  3RPN A;  3H93 A;  2H76 A;  5B8B A;  1O73 A;  3KJY A;  5HR0 A;  3KCM A;  1JFU A;  1YJ6 A;  1XWK A;  1FB6 A;  3LYK A;  6GSX A;  5L71 A;  3F4R A;  4WET A;  1GSS A;  2L4Q A;  3KIJ A;  2HRF A;  1XWG A;  1YKA A;  4LL1 B;  4TXO B;  1KBN A;  1U88 A;  5ECH B;  3FYG A;  4IEL A;  2P5Q A;  1FG4 A;  5DVB A;  2C3N A;  5CRD A;  3ME8 A;  4O92 A;  2A2R A;  2FHE A;  1M9A A;  3QOU A;  3FR6 A;  2FCH A;  6GSW A;  4ZXG A;  2C8U A;  4EDZ A;  2NVL A;  4ZIJ A;  2LJK A;  1GRX A;  2QC7 A;  1X9W B;  2WS2 A;  3DGQ A;  4HS1 A;  2OAD A;  2K6V A;  4GST A;  4ECI A;  3VWV A;  4K7O A;  4IHU A;  4RQR A;  2QGV A;  3TOT A;  2HSY A;  6GSS A;  1I5G A;  2VL2 A;  5CYY A;  1OE7 A;  2GZZ A;  2LST A;  3APS A;  3TUE A;  4PUF C;  5KN0 A;  5D9X A;  5GAN D;  2GDR A;  4RI7 A;  3E3E A;  3ED3 A;  1XZO A;  2R6K A;  3UIW A;  1TP9 A;  1UN2 A;  5CP1 A;  1CQH A;  3BD2 A;  4GSS A;  3QAW A;  4O32 A;  2QSI A;  3MNG A;  3H79 A;  3FEU A;  1TDI A;  1PX7 A;  5F8B A;  1PA3 A;  4NPB A;  3GHA A;  2R37 A;  5HFK A;  1WIK A;  2CZ2 A;  4KND A;  3G9B A;  5DCG A;  2OBI A;  3LEF A;  3I6A A;  5GAP D;  2LRN A;  4ZB6 A;  2CVD A;  4MMM A;  4TR4 A;  4J57 E;  2N5F A;  1ILO A;  4FH8 A;  1XWC A;  5EVO A;  3KTL A;  2FA4 A;  3KP9 A;  5HR1 A;  2VCT A;  2GSR A;  3A5W A;  3HHV A;  4JED A;  3WGX A;  1AW9 A;  5G2Z A;  5ID2 A;  1FVJ A;  2V41 A;  3L9S A;  1XXU A;  1KEB A;  3M3M A;  4CW9 A;  3DML A;  1A0R P;  2WGR A;  1HYU A;  1OVN A;  2I81 A;  3R2Q A;  4MLY A;  4TN8 A;  4NHW A;  1GTU A;  3TKQ A;  4MF6 A;  1O85 A;  4WXT A;  1GTI A;  4K0G A;  2V6K A;  4F0C A;  1VF3 A;  2LS5 A;  2EIR A;  3TKS E;  1JLV A;  1TI3 A;  5D8I A;  5CO3 A;  1K0B A;  4NWY A;  1YQ1 A;  3IAM 2;  2M80 A;  2YWI A;  4IP6 A;  1SD9 A;  1M2B A;  3M9J A;  3HXS A;  2IJY A;  2L59 A;  3D22 A;  4I8B A;  4LA1 A;  3DVW A;  1WMJ A;  3E0U A;  5B6M A;  3C1R A;  1ZYQ B;  2WCI A;  2VAF A;  2PPT A;  5CRH A;  1F3A A;  1PKW A;  1XVQ A;  7GSS A;  4MF5 A;  1MD3 A;  2VO4 A;  1SYR A;  4FYC A;  4FYB A;  4IJI A;  3DVX A;  2H75 A;  2L6D A;  5JWR B;  4OWY A;  1BAY A;  2V6O A;  3CXG A;  2JAC A;  4GF0 A;  3KTB A;  1TU8 A;  2IL3 A;  1WWJ A;  3LXT A;  1K0O A;  1SU9 A;  4WF5 A;  2DJ0 A;  4WF4 A;  1SL0 B;  3GUR A;  1R5A A;  4KCA A;  4O5R A;  1B8X A;  1SK0 A;  2PVO C;  3QAG A;  3P2A A;  3KP8 A;  1MD4 A;  2LRT A;  2M72 A;  5G5F A;  1EWX A;  4MF7 A;  1OC9 B;  1JZW A;  2IFQ B;  3ZTL A;  3LOR A;  1YF1 A;  3RHC A;  1J08 A;  3GV1 A;  2JZT A;  2G0F A;  4WBJ A;  1RQM A;  2VIM A;  3DKS A;  4K2D A;  2H8L A;  19GS A;  4MZB A;  2F9S A;  4F0B A;  3RBT A;  1TK5 B;  2GST A;  4KDU A;  2L57 A;  1V57 A;  3GST A;  4EUY A;  2ZUP A;  2YN1 A;  1A23 A;  2ES7 A;  1ZOF A;  2WUL A;  2MZC A;  5KEJ A;  4XCS A;  3GNJ A;  2LRC A;  2BJX A;  3MWH A;  3GL5 A;  4ML6 A;  4RQX A;  4XS4 B;  2MBT A;  1ML6 A;  5DAL B;  4K9Z A;  5CAX A;  1FHE A;  2HZE B;  5INY A;  1YEX A;  2VLT A;  2RII A;  3CSH A;  1B9Y C;  2LNS A;  1IYH A;  4J56 E;  4HEA 2;  1V98 A;  2F8F A;  4I6X A;  4AGS A;  4OFM A;  3GH9 A;  5EPF A;  1M9B A;  1ABA A;  1LBK A;  1NSW A;  3CTF A;  1SJZ A;  3FZ5 A;  3J7Y b;  5F07 A;  4D73 B;  4RI6 A;  3HJO A;  1PL2 A;  4ZL9 A;  4BA7 A;  3G7I A;  3NIV A;  3TKS C;  4BWS A;  3M9K A;  4KE3 A;  3KD0 A;  3GSS A;  3RAZ A;  5AIV A;  4EL1 A;  2I3Y A;  5DBQ A;  3IRA A;  4BWQ A;  1B48 A;  4ECB A;  4TR1 B;  2RUE A;  5HFG A;  3DEX A;  5IMZ A;  17GS A;  4LMW A;  1BED A;  1OKD A;  4MPG A;  4PX1 A;  2H0H A;  4YQV A;  3BOA A;  3HDC A;  3ZIV A;  4LMV A;  1GH2 A;  4IKH A;  4D73 A;  3GTU B;  3VPT A;  2I9H A;  1FO5 A;  1S3D A;  1GWC A;  3DIE A;  2LNT A;  2TIR A;  1OC3 A;  3C7M A;  2CVK A;  1WP0 A;  2PN8 A;  4MJC A;  3UEM A;  4ULX A;  1M2A A;  1O8W A;  3VWU A;  1QFN A;  3ZFL A;  4KA0 A;  2P31 A;  1G6W A;  1GTB A;  3OR5 A;  3A2V A;  1T4Z A;  4TR1 A;  2PVQ A;  3ZMK A;  2FUG 2;  4IN0 A;  2ALB A;  4L5L A;  4ECC A;  2RLI A;  2C4J A;  1EP8 A;  1F6M C;  2DBC A;  4DSS B;  2DMM A;  3IR4 A;  4EKZ A;  1N8J A;  2FWG A;  2OA7 A;  4KDX A;  2PWJ A;  3IE3 A;  2C0G A;  1DE2 A;  1Z7P A;  3EU3 A;  1MDI A;  3P90 A;  5FWG A;  2MMO A;  5A4V A;  1OYJ A;  5ECO B;  2GSQ A;  3PR8 A;  2WFC A;  3UVT A;  1AUC A;  3CMI A;  3EVI A;  2RUF A;  2GVP A;  4AJ6 A;  1URM A;  2X8C A;  2AAW A;  2IMF A;  3GH6 A;  2DJ1 A;  2LTK A;  4PUR A;  1BJX A;  5J5N A;  2GGT A;  1T1V A;  2GS3 A;  4FIW A;  4K8M A;  2FNO A;  2GSS A;  22GS A;  4WR4 A;  3KMO A;  3VLN A;  1U6T A;  3F6D A;  2IME A;  2CQ9 A;  5ELA A;  5HR2 A;  2YV7 A;  4AJ7 A;  4CHS A;  4DSQ A;  1JZD A;  3KEB A;  3UAP A;  1O6J A;  3IAS 2;  1XBS A;  2F51 A;  2LKU A;  2JL4 A;  4Q5F A;  4AF2 A;  3LJR A;  3PGT A;  1PX6 A;  4G19 A;  3GKK A;  1Z5Y E;  2XBI A;  1HQO A;  2WJU A;  3SBC A;  2P0G A;  1AQW A;  4NHZ A;  4PUA A;  5C04 A;  4ML1 A;  3O6T A;  4GWR A;  2YAN A;  3DRN A;  3JCM L;  1JHB A;  3QDN A;  2VLU A;  2KUC A;  4MJE A;  3L0H A;  1OKT A;  5D9W A;  3IK9 A;  4GXZ A;  2LJR A;  4KSM A;  1BQ7 A;  4ID0 A;  1X9M B;  3ZYW A;  4WKW A;  3A2X A;  3HY2 A;  3DWV A;  1NHO A; 
#chains in the Genus database with same CATH topology
 1SJI A;  4BVX B;  3VWW A;  4XHM A;  1TOF A;  1XFL A;  3LW9 A;  2LQO A;  1ZL9 A;  1ZYN A;  5IO2 A;  4TXO A;  3NOF A;  5IPG A;  2HRK A;  1A2J A;  2FWF A;  4Q5N A;  3F8U A;  1SYX A;  1V40 A;  3TJG A;  5D9V A;  4GTU A;  5B7C A;  2H19 A;  2MYG A;  3CRU A;  2K8V A;  1JLW A;  4JR6 A;  1ZGN A;  3Q19 A;  3VFI A;  2B1K A;  1Y6E A;  1R5P A;  3HVS A;  3KXO A;  1R4W A;  5ELG A;  2IMI A;  4MZW A;  4YAP A;  2HSH A;  2GLR A;  3RPP A;  2REM A;  3UBK A;  2H01 A;  5IIZ A;  2OE0 A;  2VCZ A;  1E2Y A;  1FVK A;  1WOU A;  1BYE A;  2DJJ A;  2X8H A;  4XTS A;  1U3A A;  5KN2 A;  2YPM A;  4I2T A;  3US3 A;  4PTS A;  2H72 A;  1ZCP A;  3MYD A;  2YWM A;  2PGT A;  3FZA A;  1PKZ A;  3F63 A;  4MCU A;  4YKF A;  1PFO A;  1A0F A;  4OCF A;  2YCD A;  3ZIT A;  4NV5 A;  4Z7X A;  4WEY A;  3GRX A;  4OFN A;  4YQM A;  3GN3 A;  4V1A p;  4YQU A;  4YAV A;  3S9F A;  4PXO A;  3C1S A;  4ECJ A;  2L4C A;  2C1Y A;  3IPZ A;  2FWE A;  1G7E A;  1MEK A;  1PL1 A;  1VF1 A;  5H5Q A;  1V58 A;  4MH3 A;  2DSA A;  1YKC A;  2DKH A;  4L5O A;  1H75 A;  1SKW B;  2H71 A;  5A4U A;  2GQK A;  5CNW A;  1TJD A;  2B6M A;  3KM6 A;  18GS A;  2GZP A;  5A4W A;  3O3T A;  2A4V A;  1GTA A;  3TKP A;  2H6Z A;  5LNK e;  4QQ7 A;  4Q5R A;  4N10 A;  1FAA A;  5LD0 A;  2GQM A;  2IMD A;  1WE0 A;  1C72 A;  2K8S A;  4N30 A;  2H1D A;  4O5U A;  1TRS A;  3UVH A;  3R3E A;  8GSS A;  1EP7 A;  3VUR A;  1LJR A;  3HVN A;  1MDJ A;  10GS A;  3D4M A;  3H4K A;  3N5O A;  4YH2 A;  1GUM A;  3HYP A;  2C3Q A;  3LQ7 A;  4TR0 A;  4KB3 A;  5DAK B;  2A4H A;  4E8E A;  3D0Z A;  1X9S B;  4OCE A;  1Z6M A;  3PIN A;  4HDE A;  1SD8 A;  20GS A;  2O87 A;  2YP6 A;  1PN9 A;  2IMK A;  4DSR A;  2YNX A;  1X0R A;  4KUN A;  2AB6 A;  4K0N A;  4POL A;  2EIQ A;  5D93 A;  2P5R A;  2HI7 A;  1ZYP A;  1YZX A;  3UOM A;  4IW9 A;  4K5R A;  4IP1 A;  2H66 A;  1QXH A;  2YOI A;  2LUS A;  4F03 A;  1GLP A;  1W89 A;  4HU9 A;  4HQZ A;  5DQY A;  5DDL A;  2LEG A;  1PGT A;  5ECL B;  2R4V A;  2VL9 A;  1S3A A;  2X64 A;  5IMV A;  2DJ2 A;  5DAK A;  1QQ2 A;  1OC8 A;  2JSZ A;  5D96 A;  5F0G A;  1H4O A;  3UBL A;  3HJM A;  2B5X A;  5GSS A;  4A5P A;  2CX4 A;  2J9H A;  5ECR B;  1V2A A;  4KCE A;  5ECP B;  13GS A;  2AHE A;  1TRV A;  1CQG A;  2H0I A;  2VCQ A;  3ZZX A;  3IOS A;  4QL9 A;  1EZK A;  2DC5 A;  3LFL A;  2KLX A;  12GS A;  3EC3 A;  3K8N A;  5G1L A;  1OC9 A;  2VCV A;  2XC2 A;  1PD2 1;  2IFQ A;  1XCC A;  3MIX A;  3TJK A;  3GKX A;  3EUR A;  5JCU A;  3VI7 A;  4KX4 A;  1ERV A;  2DIZ A;  1GNW A;  2H73 A;  2X49 A;  2AJQ B;  4KW6 A;  3L4N A;  3KZQ A;  2H6X A;  1PSQ A;  3PH9 A;  2JZS A;  4BL7 B;  2OBK A;  4PQH A;  3QPM A;  2I1U A;  3ZVJ D;  3IK7 A;  3GKM A;  4P3Y B;  2OE1 A;  2VM1 A;  4HSC X;  3FRC A;  2VL3 A;  5IMD A;  3L78 A;  3HJP A;  5JCG A;  4IGJ A;  2YV9 A;  2ZNM A;  3HVX A;  4MJA A;  2ZCT A;  3TCO A;  4XS4 A;  2CV4 A;  5DAL A;  5G5E A;  4ZBB A;  3FZ9 A;  3QFA C;  2L5L A;  2HZE A;  3WT1 A;  4BVY A;  4TVE A;  3KH9 A;  4ZBD A;  5AIX A;  3QFB C;  3H8Q A;  3KH7 A;  2M46 A;  4JZQ A;  3IA1 A;  2VOC A;  2FGX A;  2DLX A;  3TKS A;  4BL7 A;  1O8X A;  4IS0 A;  1SK1 A;  2VD0 A;  3TGZ A;  3TJJ A;  5JWQ B;  3I69 A;  2NDO A;  1GSF A;  1T00 A;  2H30 A;  1O81 A;  2I4A A;  3VI5 A;  3F0I A;  3H1N A;  4XRA A;  3GYK A;  3CSJ A;  1XOB A;  3J7Y k;  2R0P A;  2H70 A;  1GP1 A;  4WBR D;  3CTG A;  1OE8 A;  2PER A;  1QMV A;  2C80 A;  4ZB8 A;  2WRT A;  4NXI A;  3ERG A;  5ECK B;  1XOA A;  1EEJ A;  4F82 A;  5G30 A;  5G1K A;  1EOH A;  2HT9 A;  3GMF A;  1YF0 A;  1E6B A;  1Z9H A;  1TRU A;  3ZVJ A;  5CRG A;  4JBB A;  3ZRD A;  3M1G A;  1N2A A;  2K18 A;  2CAQ A;  4I2U A;  4X43 A;  3C71 A;  4GSN A;  3APO A;  1B9X C;  1GSY A;  4HQS A;  2XBQ A;  3F6F A;  3L9V A;  1GSU A;  1GLQ A;  1T3B A;  5H5S A;  1TK8 B;  1TTZ A;  4MA9 A;  4HZ4 A;  3GTU A;  4MH2 A;  2BMX A;  2O7K A;  4Q5Q A;  5J9B A;  3IHG A;  3W8S A;  3FR9 A;  2GZY A;  4GRF A;  3I43 A;  5AIS A;  2N5B A;  2B7K A;  1I9D A;  3WYW A;  3HZ4 A;  1XWA A;  2OKA A;  3ZL5 A;  2CX3 A;  2VCX A;  5ECN B;  3TRX A;  3FY7 A;  2H1B A;  3IDV A;  5EL8 A;  3TRQ A;  2Z9S A;  1AQX A;  1GUL A;  1O7U A;  4FQU A;  2FA8 A;  1TRW A;  3BCI A;  1MTC A;  4DSS A;  2AUV A;  1RW1 A;  2YJH A;  3QAV A;  1ON4 A;  4KDY A;  3O76 A;  3M0F A;  3WGE A;  2JSY A;  2A2P A;  1M99 A;  2YWO A;  5G31 A;  5COH A;  1TKD B;  3U5R E;  5ABR A;  4K7I A;  4O7H A;  3A2W A;  2B7J A;  11GS A;  4MPF A;  3L9U A;  3EU4 A;  4L0U A;  2DJ3 A;  2VCW A;  2MMA A;  2VLV A;  4OO4 A;  2WB9 A;  4HZ2 A;  3WD6 A;  3TJB A;  2H6Y A;  2E7P A;  4TXV A;  6GSY A;  1BX9 A;  2GT5 A;  3Q74 A;  1EOG A;  1KTE A;  4TKY A;  3C8E A;  3UL3 A;  4FYU A;  3CQF A;  3I9V 2;  4K2X A;  4EO3 A;  3LGC A;  4V1A g;  3F3Q A;  1XW6 A;  5HQP A;  4PGT A;  1HNA A;  1GNE A;  4KF9 A;  3EMX A;  3GKN A;  1IYI A;  4G0K A;  2IIY A;  5IOX A;  4V2L A;  1NW2 A;  2VL2 C;  3NZN A;  2E0Q A;  3HA9 A;  5F05 A;  2O89 A;  2HRN A;  2AV4 A;  4ACS A;  1Q98 A;  2OAC A;  1R26 A;  3BBY A;  2PUK C;  1PMT A;  3MSZ A;  4G0L A;  1FB0 A;  1T4Y A;  5H5R A;  2KP2 A;  2XHF A;  5B8A A;  2IWT A;  1UA5 A;  2L6C A;  2X8G A;  1EV9 A;  1T7P B;  2JZR A;  2VD1 A;  4E8H A;  4MK3 A;  1B4P A;  1K3L A;  1K3Y A;  4TRX A;  1K0D A;  1DSB A;  2G2Q A;  4IQA A;  4DEJ A;  2LJA A;  4BIK A;  5CRW A;  4BPY A;  4FO5 A;  3FW2 A;  3P7X A;  1G7O A;  5HR3 A;  2VM2 A;  2HFD A;  3G7Y A;  5J4U A;  5LCZ A;  5ID2 B;  1EEM A;  1USB A;  4GCI A;  5IMA A;  3LSZ A;  1GUK A;  2C0D A;  5GST A;  4BVX A;  4HI7 A;  1X5D A;  3EIN A;  3LWA A;  4ZL8 A;  5J41 A;  3TKR A;  3VK9 A;  1SEN A;  4GLT A;  4O5Q A;  2IPA A;  4XIH A;  2ON7 A;  2CZ3 A;  3ME7 A;  3WT2 A;  1AXD A;  3CBU A;  2QKE A;  1ZZY A;  2L5O A;  4EC0 A;  1GSQ A;  1X5C A;  4EE0 A;  3UJ1 A;  5ECS A;  3Q6O A;  5ECM B;  1F2E A;  3TJF A;  1K3O A;  1K0M A;  2HRA A;  5DJL A;  5AN1 A;  1F37 A;  1TW9 A;  4KSO A;  2F3M A;  3BCK A;  4KAE A;  1A2L A;  1SKR B;  5J9C A;  3G7J A;  2DIY A;  3EWL A;  4AJ8 A;  1G0T A;  4DVC A;  2HZF A;  2B3S A;  3F3R A;  1Z3E A;  2E2G A;  4EVM A;  1EGO A;  2DKI A;  1WJK A;  2YWN A;  2QA2 A;  5ENU A;  2R3X A;  2AYT A;  5GZZ B;  3LYP A;  1GSD A;  4HUA A;  1JZO A;  2XPD A;  2FWH A;  5A5K A;  4EXJ A;  3GIX A;  2KP1 A;  5IQY A;  1J0F A;  2JAD A;  2YZH A;  2NTO A;  2FLS A;  16GS A;  4PNG A;  1LU4 A;  1XPV A;  3MAK A;  3QMX A;  3C73 A;  4L0W A;  2RM5 A;  4XS1 A;  2CT6 A;  1FW1 A;  3FK8 A;  4ZBA A;  2PMT A;  4NMU A;  1AAZ A;  3M8N A;  2OJL A;  3ERW A;  2EC4 A;  3ERF A;  2JU5 A;  4F9Z A;  1A24 A;  3ISO A;  3DYR A;  3TDG A;  3A3T A;  3TB2 A;  2KOK A;  4J2F A;  4JE1 A;  1SKS B;  4NAX A;  5IMF A;  2DJK A;  4N11 A;  3UMA A;  2DML A;  4POK A;  3KMN A;  1G6Y A;  1KNG A;  3HCZ A;  5IPH A;  2GTU A;  2XPE A;  1A8L A;  1THO A;  1F3B A;  3RHB A;  3U6V A;  3HKR A;  3ZML A;  2ON5 A;  4K1F A;  2NPB A;  3Q18 A;  3F9U A;  4XRD A;  1V9W A;  1GL8 A;  5ECI B;  3IXR A;  5CRE A;  4HJ2 A;  2LV3 A;  4ISD A;  4N0V A;  3LG6 A;  4LL4 B;  4TR3 A;  1TXX A;  5IO0 A;  4NV2 A;  1K0C A;  2H74 A;  2CA8 A;  2A2S A;  3FHK A;  4IBP A;  3D21 A;  4ILF A;  3VWX A;  1K0A A;  2C0F A;  5J3R A;  1A2M A;  1VF4 A;  4PNF A;  1K0N A;  5D9T A;  5DCH A;  5HFI A;  3TRP A;  2VUP A;  1SL1 B;  2V2G A;  4K6X A;  1DE1 A;  1YY7 A;  1ERW A;  1M2D A;  3QR6 A;  4TOP A;  3W6G A;  1YDK A;  3EE2 A;  5E4W A;  5B6N A;  4WR5 A;  1ERT A;  1X5E A;  3FR3 A;  4Z2T A;  3D5J A;  2B5Y A;  1DBY A;  2C0E A;  2J23 A;  2K9F A;  3W8J A;  2TRX A;  4V2N A;  2B5E A;  3GFK A;  1HNB A;  3GA4 A;  3D4T A;  2O85 A;  3D6I A;  4ZB9 A;  3F4S A;  3IBH A;  5ECQ B;  3AY8 A;  4I97 A;  4L8E A;  4ICY A;  2UZ8 A;  2FD3 A;  4KGI A;  4G9H A;  2MMZ A;  4OO5 A;  2X4A A;  2EIO A;  2NBS A;  4EDY A;  4MDC A;  1THX A;  6GSU A;  1GUH A;  1XW5 A;  1MDK A;  2R5G A;  3HVV A;  9GSS A;  5D73 A;  3V1W A;  2V1M A;  2E2M A;  3CRT A;  5KN3 A;  3SWL A;  2H1G A;  1TU7 A;  2PU9 C;  4OMV A;  2O8V B;  3ZIJ A;  2N5A A;  1XW9 A;  1A8Y A;  5KN1 A;  1ERU A;  1S3C A;  1T8E B;  4F2I A;  1GSE A;  2F8A A;  1VRS D;  2X99 A;  5DQS A;  5E59 A;  4N0Z A;  4EIP A;  1SK2 A;  4EF0 A;  4XS6 A;  2YZU A;  1B4Q A;  1TI1 A;  1FOV A;  1WPI A;  2TRC P;  3VPQ A;  1Q4J A;  2WDU A;  4Z2R A;  5AGY A;  5FT3 A;  14GS A;  1VF2 A;  4MAB A;  5IMC A;  1VGL A;  3HD5 A;  5DJM A;  2FY6 A;  2R2J A;  1S3R A;  2D2Z A;  4CY6 A;  3GX8 A;  1SJ6 A;  3QD9 A;  1RK4 A;  3GX0 A;  4USS A;  3A5I A;  4X0X A;  4JRR A;  1UC7 A;  3DXB A;  3MDK A;  2H0G A;  3IHQ A;  3BJ5 A;  3E9J B;  1HD2 A;  4JU5 A;  4TW5 A;  1EGR A;  1Z6N A;  1WRY A;  2B1L A;  4V2M A;  3RDW A;  3TOU A;  1W4V A;  1EV4 A;  1F9M A;  1QK8 A;  1SL2 B;  3HZ8 A;  1BG5 A;  4G2E A;  2C3T A;  1PN0 A;  3FKF A;  4HJM A;  3EMP A;  4POB A;  4OFT A;  3APQ A;  5JCW A;  4MZC A;  4POM A;  3QCP A;  2BTO T;  3N9J A;  2MMN A;  3IC4 A;  1TK0 B;  2GT6 A;  3F4T A;  3ZFB A;  2HYX A;  3KGK A;  2LQQ A;  2OE3 A;  1NHY A;  4MJB A;  2IN3 A;  1OAZ A;  1U3I A;  3WGD A;  4KH7 A;  1AIU A;  1Y25 A;  1R7H A;  1YEP A;  1ZMA A;  3FZ4 A;  4EIQ A;  3EYT A;  4IVF A;  3UAR A;  4PQI A;  4H86 A;  1U87 A;  5F06 A;  1XIY A;  4PQ1 A;  4JR4 A;  1XWB A;  4I5Q A;  3GUS A;  1PRX A;  1J9B A;  2GQL A;  3LXZ A;  2HE3 A;  2HXK A;  4OD7 A;  4RUV A;  1XVW A;  4G10 A;  2KHP A;  1NM3 A;  4ZL7 A;  2CAI A;  2CVB A;  1UVZ A;  5FHI A;  4Z2U A;  4IJ3 A;  5C00 A;  3ZLP A;  5JWO B;  4IQ1 A;  2WZ9 A;  2MBS A;  6GSV A;  3GL3 A;  5IOW A;  3CYN A;  1HNC A;  4GQF A;  2V32 A;  4X1U A;  4G0I A;  1ST9 A;  4HU7 A;  1ZYE A;  4CDO A;  2HNL A;  3P8W A;  1PQN A;  1M7T A;  1M0U A;  1AQV A;  4LLR A;  3IV4 A;  3CSI A;  4MP4 A;  4ZIL A;  3ZRE A;  6GST A;  2HLS A;  4HOJ A;  5IM9 A;  1AC1 A;  4K7N A;  1DUG A;  1JZR A;  4QL7 A;  1Z7R A;  1ACV A;  5EY6 A;  1QGV A;  2RM6 A;  2YJ7 A;  1QUW A;  4GQC A;  2PBJ A;  2H1A A;  3DD3 A;  3RPN A;  5BMU A;  3H93 A;  2H76 A;  5B8B A;  1O73 A;  3KJY A;  4X4J A;  5HR0 A;  3KCM A;  1JFU A;  1YJ6 A;  1XWK A;  1FB6 A;  3LYK A;  6GSX A;  5L71 A;  3F4R A;  4WET A;  1GSS A;  2L4Q A;  3KIJ A;  2HRF A;  1XWG A;  1YKA A;  4LL1 B;  4TXO B;  1KBN A;  1U88 A;  5ECH B;  3FYG A;  4IEL A;  2P5Q A;  1FG4 A;  5DVB A;  2C3N A;  5CRD A;  3ME8 A;  4O92 A;  2A2R A;  2FHE A;  1M9A A;  3QOU A;  3FR6 A;  2FCH A;  6GSW A;  4ZXG A;  2C8U A;  4EDZ A;  2NVL A;  4ZIJ A;  2LJK A;  1GRX A;  2QC7 A;  1X9W B;  2WS2 A;  3DGQ A;  4HS1 A;  2OAD A;  2K6V A;  4GST A;  4ECI A;  3VWV A;  4K7O A;  4IHU A;  4RQR A;  2QGV A;  3TOT A;  2HSY A;  6GSS A;  1I5G A;  2VL2 A;  5CYY A;  1OE7 A;  2GZZ A;  2LST A;  3APS A;  3TUE A;  4PUF C;  5KN0 A;  1XG8 A;  5D9X A;  5GAN D;  2GDR A;  4RI7 A;  3E3E A;  3ED3 A;  1XZO A;  2R6K A;  3UIW A;  1TP9 A;  1UN2 A;  5CP1 A;  1CQH A;  3BD2 A;  4GSS A;  3QAW A;  4O32 A;  2QSI A;  3MNG A;  3H79 A;  3FEU A;  1TDI A;  1PX7 A;  5F8B A;  1PA3 A;  4NPB A;  3GHA A;  2R37 A;  5HFK A;  1WIK A;  2CZ2 A;  4KND A;  3G9B A;  5DCG A;  5KOX A;  2OBI A;  3LEF A;  3I6A A;  2QA1 A;  5GAP D;  2LRN A;  4ZB6 A;  2CVD A;  4MMM A;  4TR4 A;  4J57 E;  2N5F A;  1ILO A;  4FH8 A;  1XWC A;  5EVO A;  3KTL A;  2FA4 A;  3KP9 A;  5HR1 A;  2VCT A;  2GSR A;  3A5W A;  3HHV A;  4JED A;  3WGX A;  1AW9 A;  5G2Z A;  5ID2 A;  1FVJ A;  2V41 A;  3L9S A;  4MNN A;  1XXU A;  1KEB A;  3M3M A;  3PPU A;  4CW9 A;  3DML A;  1A0R P;  2WGR A;  1HYU A;  1OVN A;  2I81 A;  3R2Q A;  4MLY A;  4TN8 A;  4NHW A;  1GTU A;  3TKQ A;  4MF6 A;  1O85 A;  4WXT A;  1GTI A;  4K0G A;  2V6K A;  4F0C A;  1VF3 A;  2LS5 A;  2EIR A;  3TKS E;  1JLV A;  1TI3 A;  5D8I A;  5CO3 A;  1K0B A;  4NWY A;  1YQ1 A;  3IAM 2;  2M80 A;  2YWI A;  4IP6 A;  1SD9 A;  1M2B A;  3M9J A;  3HXS A;  2IJY A;  2L59 A;  3D22 A;  4I8B A;  4LA1 A;  3DVW A;  1WMJ A;  3E0U A;  5B6M A;  5KOW A;  3C1R A;  1ZYQ B;  2WCI A;  2VAF A;  2PPT A;  5CRH A;  1F3A A;  1PKW A;  2R0G A;  1XVQ A;  7GSS A;  4MF5 A;  1MD3 A;  2VO4 A;  1SYR A;  4FYC A;  4FYB A;  4IJI A;  3DVX A;  2H75 A;  2L6D A;  5JWR B;  4OWY A;  1BAY A;  2V6O A;  3CXG A;  2JAC A;  4GF0 A;  3KTB A;  1TU8 A;  1FOH A;  2IL3 A;  1WWJ A;  3LXT A;  1K0O A;  1SU9 A;  4WF5 A;  2DJ0 A;  4WF4 A;  1SL0 B;  3GUR A;  1R5A A;  4KCA A;  4O5R A;  1B8X A;  1SK0 A;  2PVO C;  3QAG A;  3P2A A;  3KP8 A;  1MD4 A;  2LRT A;  2M72 A;  5G5F A;  1EWX A;  4MF7 A;  5BRT A;  1OC9 B;  1JZW A;  2IFQ B;  3ZTL A;  3LOR A;  1YF1 A;  3RHC A;  1J08 A;  3GV1 A;  1M3J A;  2JZT A;  2G0F A;  4WBJ A;  1RQM A;  2VIM A;  3DKS A;  4K2D A;  2H8L A;  19GS A;  4MZB A;  2F9S A;  4F0B A;  3RBT A;  1TK5 B;  2GST A;  4KDU A;  2L57 A;  1V57 A;  3GST A;  4EUY A;  2ZUP A;  2YN1 A;  1A23 A;  2ES7 A;  1ZOF A;  2WUL A;  2MZC A;  2R0C A;  5KEJ A;  4XCS A;  3GNJ A;  2LRC A;  2BJX A;  3IC8 A;  3MWH A;  3GL5 A;  4ML6 A;  4RQX A;  4XS4 B;  2MBT A;  1ML6 A;  5DAL B;  4K9Z A;  5CAX A;  1FHE A;  2HZE B;  4BVY B;  5INY A;  1YEX A;  2VLT A;  2RII A;  3CSH A;  1B9Y C;  2LNS A;  1IYH A;  4J56 E;  4HEA 2;  1V98 A;  2F8F A;  4I6X A;  4AGS A;  4OFM A;  3GH9 A;  5EPF A;  1M9B A;  1ABA A;  1LBK A;  1NSW A;  3CTF A;  1SJZ A;  3FZ5 A;  3J7Y b;  5F07 A;  4D73 B;  4RI6 A;  3HJO A;  1PL2 A;  4ZL9 A;  4BA7 A;  3G7I A;  3NIV A;  3TKS C;  4BWS A;  3M9K A;  4KE3 A;  3KD0 A;  3GSS A;  3RAZ A;  5AIV A;  4EL1 A;  4CY8 A;  2I3Y A;  5DBQ A;  3IRA A;  4BWQ A;  1B48 A;  4ECB A;  4TR1 B;  2RUE A;  5HFG A;  3DEX A;  5IMZ A;  17GS A;  4LMW A;  1BED A;  1OKD A;  4MPG A;  4PX1 A;  2H0H A;  4YQV A;  3BOA A;  3HDC A;  3ZIV A;  4LMV A;  1GH2 A;  4IKH A;  4D73 A;  3GTU B;  3VPT A;  2I9H A;  1FO5 A;  1S3D A;  1GWC A;  3DIE A;  2LNT A;  2TIR A;  1OC3 A;  3C7M A;  2CVK A;  1WP0 A;  2PN8 A;  4MJC A;  3UEM A;  4ULX A;  1M2A A;  1O8W A;  3VWU A;  1QFN A;  3ZFL A;  4KA0 A;  2P31 A;  1G6W A;  1GTB A;  3OR5 A;  3A2V A;  1T4Z A;  4TR1 A;  2PVQ A;  3ZMK A;  2FUG 2;  4IN0 A;  2ALB A;  4L5L A;  4ECC A;  2RLI A;  2C4J A;  1EP8 A;  1F6M C;  2DBC A;  4DSS B;  2DMM A;  3IR4 A;  4EKZ A;  1N8J A;  4YKG A;  2FWG A;  2OA7 A;  4KDX A;  2PWJ A;  3IE3 A;  2C0G A;  3FMW A;  1M3I A;  1DE2 A;  1Z7P A;  3EU3 A;  1MDI A;  3P90 A;  5FWG A;  2MMO A;  5A4V A;  1OYJ A;  5ECO B;  2GSQ A;  3PR8 A;  2HSM A;  2WFC A;  3UVT A;  1AUC A;  3CMI A;  3EVI A;  2RUF A;  2GVP A;  4AJ6 A;  1URM A;  3EPT A;  2X8C A;  2AAW A;  2IMF A;  3GH6 A;  2DJ1 A;  2LTK A;  4PUR A;  1BJX A;  5J5N A;  2GGT A;  1T1V A;  2GS3 A;  4FIW A;  4K8M A;  2FNO A;  2GSS A;  22GS A;  4WR4 A;  3KMO A;  3VLN A;  1U6T A;  3F6D A;  2IME A;  2CQ9 A;  5ELA A;  5HR2 A;  2YV7 A;  4AJ7 A;  4CHS A;  4DSQ A;  1JZD A;  3KEB A;  3UAP A;  1O6J A;  3IAS 2;  1XBS A;  2F51 A;  2LKU A;  2JL4 A;  4Q5F A;  4AF2 A;  3LJR A;  3PGT A;  1PX6 A;  4G19 A;  3GKK A;  1Z5Y E;  2XBI A;  1HQO A;  2WJU A;  3SBC A;  2P0G A;  1AQW A;  4NHZ A;  4PUA A;  5C04 A;  4ML1 A;  3O6T A;  4GWR A;  2YAN A;  3DRN A;  3JCM L;  1JHB A;  3QDN A;  2VLU A;  2KUC A;  4MJE A;  3L0H A;  1OKT A;  5D9W A;  3IK9 A;  4GXZ A;  4K5S A;  2LJR A;  4KSM A;  1BQ7 A;  4ID0 A;  1X9M B;  3ZYW A;  4WKW A;  3A2X A;  3HY2 A;  3DWV A;  1NHO A; 
#chains in the Genus database with same CATH homology
 1SJI A;  4BVX B;  3VWW A;  4XHM A;  1TOF A;  1XFL A;  3LW9 A;  2LQO A;  1ZL9 A;  1ZYN A;  5IO2 A;  4TXO A;  3NOF A;  5IPG A;  2HRK A;  1A2J A;  2FWF A;  4Q5N A;  3F8U A;  1SYX A;  1V40 A;  3TJG A;  5D9V A;  4GTU A;  5B7C A;  2H19 A;  2MYG A;  3CRU A;  2K8V A;  1JLW A;  4JR6 A;  1ZGN A;  3Q19 A;  3VFI A;  2B1K A;  1Y6E A;  1R5P A;  3HVS A;  3KXO A;  1R4W A;  5ELG A;  2IMI A;  4MZW A;  4YAP A;  2HSH A;  2GLR A;  3RPP A;  2REM A;  3UBK A;  2H01 A;  5IIZ A;  2OE0 A;  2VCZ A;  1E2Y A;  1FVK A;  1WOU A;  1BYE A;  2DJJ A;  2X8H A;  4XTS A;  1U3A A;  5KN2 A;  2YPM A;  4I2T A;  3US3 A;  4PTS A;  2H72 A;  1ZCP A;  3MYD A;  2YWM A;  2PGT A;  3FZA A;  1PKZ A;  3F63 A;  4MCU A;  4YKF A;  1A0F A;  4OCF A;  2YCD A;  3ZIT A;  4NV5 A;  4Z7X A;  4WEY A;  3GRX A;  4OFN A;  4YQM A;  3GN3 A;  4V1A p;  4YQU A;  4YAV A;  3S9F A;  4PXO A;  3C1S A;  4ECJ A;  2L4C A;  2C1Y A;  3IPZ A;  2FWE A;  1G7E A;  1MEK A;  1PL1 A;  1VF1 A;  5H5Q A;  1V58 A;  4MH3 A;  2DSA A;  1YKC A;  2DKH A;  4L5O A;  1H75 A;  1SKW B;  2H71 A;  5A4U A;  2GQK A;  5CNW A;  1TJD A;  2B6M A;  3KM6 A;  18GS A;  2GZP A;  5A4W A;  3O3T A;  2A4V A;  1GTA A;  3TKP A;  2H6Z A;  5LNK e;  4QQ7 A;  4Q5R A;  4N10 A;  1FAA A;  5LD0 A;  2GQM A;  2IMD A;  1WE0 A;  1C72 A;  2K8S A;  4N30 A;  2H1D A;  4O5U A;  1TRS A;  3UVH A;  3R3E A;  8GSS A;  1EP7 A;  3VUR A;  1LJR A;  1MDJ A;  10GS A;  3D4M A;  3H4K A;  3N5O A;  4YH2 A;  1GUM A;  3HYP A;  2C3Q A;  3LQ7 A;  4TR0 A;  4KB3 A;  5DAK B;  2A4H A;  4E8E A;  3D0Z A;  1X9S B;  4OCE A;  1Z6M A;  3PIN A;  4HDE A;  1SD8 A;  20GS A;  2O87 A;  2YP6 A;  1PN9 A;  2IMK A;  4DSR A;  2YNX A;  1X0R A;  4KUN A;  2AB6 A;  4K0N A;  4POL A;  2EIQ A;  5D93 A;  2P5R A;  2HI7 A;  1ZYP A;  1YZX A;  3UOM A;  4IW9 A;  4K5R A;  4IP1 A;  2H66 A;  1QXH A;  2YOI A;  2LUS A;  4F03 A;  1GLP A;  1W89 A;  4HU9 A;  4HQZ A;  5DQY A;  5DDL A;  2LEG A;  1PGT A;  5ECL B;  2R4V A;  2VL9 A;  1S3A A;  2X64 A;  5IMV A;  2DJ2 A;  5DAK A;  1QQ2 A;  1OC8 A;  2JSZ A;  5D96 A;  5F0G A;  1H4O A;  3UBL A;  3HJM A;  2B5X A;  5GSS A;  4A5P A;  2CX4 A;  2J9H A;  5ECR B;  1V2A A;  4KCE A;  5ECP B;  13GS A;  2AHE A;  1TRV A;  1CQG A;  2H0I A;  2VCQ A;  3ZZX A;  3IOS A;  4QL9 A;  1EZK A;  2DC5 A;  3LFL A;  2KLX A;  12GS A;  3EC3 A;  3K8N A;  5G1L A;  1OC9 A;  2VCV A;  2XC2 A;  1PD2 1;  2IFQ A;  1XCC A;  3MIX A;  3TJK A;  3GKX A;  3EUR A;  5JCU A;  3VI7 A;  4KX4 A;  1ERV A;  2DIZ A;  1GNW A;  2H73 A;  2X49 A;  2AJQ B;  4KW6 A;  3L4N A;  3KZQ A;  2H6X A;  1PSQ A;  3PH9 A;  2JZS A;  4BL7 B;  2OBK A;  4PQH A;  3QPM A;  2I1U A;  3ZVJ D;  3IK7 A;  3GKM A;  4P3Y B;  2OE1 A;  2VM1 A;  3FRC A;  2VL3 A;  5IMD A;  3L78 A;  3HJP A;  5JCG A;  4IGJ A;  2YV9 A;  2ZNM A;  3HVX A;  4MJA A;  2ZCT A;  3TCO A;  4XS4 A;  2CV4 A;  5DAL A;  5G5E A;  4ZBB A;  3FZ9 A;  3QFA C;  2L5L A;  2HZE A;  3WT1 A;  4BVY A;  4TVE A;  3KH9 A;  4ZBD A;  5AIX A;  3QFB C;  3H8Q A;  3KH7 A;  2M46 A;  4JZQ A;  3IA1 A;  2VOC A;  2FGX A;  2DLX A;  3TKS A;  4BL7 A;  1O8X A;  4IS0 A;  1SK1 A;  2VD0 A;  3TGZ A;  3TJJ A;  5JWQ B;  3I69 A;  2NDO A;  1GSF A;  1T00 A;  2H30 A;  1O81 A;  2I4A A;  3VI5 A;  3F0I A;  3H1N A;  4XRA A;  3GYK A;  3CSJ A;  1XOB A;  3J7Y k;  2R0P A;  2H70 A;  1GP1 A;  4WBR D;  3CTG A;  1OE8 A;  2PER A;  1QMV A;  2C80 A;  4ZB8 A;  2WRT A;  4NXI A;  3ERG A;  5ECK B;  1XOA A;  1EEJ A;  4F82 A;  5G30 A;  5G1K A;  1EOH A;  2HT9 A;  3GMF A;  1YF0 A;  1E6B A;  1Z9H A;  1TRU A;  3ZVJ A;  5CRG A;  4JBB A;  3ZRD A;  3M1G A;  1N2A A;  2K18 A;  2CAQ A;  4I2U A;  4X43 A;  3C71 A;  4GSN A;  3APO A;  1B9X C;  1GSY A;  4HQS A;  2XBQ A;  3F6F A;  3L9V A;  1GSU A;  1GLQ A;  1T3B A;  5H5S A;  1TK8 B;  1TTZ A;  4MA9 A;  4HZ4 A;  3GTU A;  4MH2 A;  2BMX A;  2O7K A;  4Q5Q A;  5J9B A;  3IHG A;  3W8S A;  3FR9 A;  2GZY A;  4GRF A;  3I43 A;  5AIS A;  2N5B A;  2B7K A;  1I9D A;  3WYW A;  3HZ4 A;  1XWA A;  2OKA A;  3ZL5 A;  2CX3 A;  2VCX A;  5ECN B;  3TRX A;  3FY7 A;  2H1B A;  3IDV A;  5EL8 A;  3TRQ A;  2Z9S A;  1AQX A;  1GUL A;  1O7U A;  4FQU A;  2FA8 A;  1TRW A;  3BCI A;  1MTC A;  4DSS A;  2AUV A;  1RW1 A;  2YJH A;  3QAV A;  1ON4 A;  4KDY A;  3O76 A;  3M0F A;  3WGE A;  2JSY A;  2A2P A;  1M99 A;  2YWO A;  5G31 A;  5COH A;  1TKD B;  3U5R E;  5ABR A;  4K7I A;  4O7H A;  3A2W A;  2B7J A;  11GS A;  4MPF A;  3L9U A;  3EU4 A;  4L0U A;  2DJ3 A;  2VCW A;  2MMA A;  2VLV A;  4OO4 A;  2WB9 A;  4HZ2 A;  3WD6 A;  3TJB A;  2H6Y A;  2E7P A;  4TXV A;  6GSY A;  1BX9 A;  2GT5 A;  3Q74 A;  1EOG A;  1KTE A;  4TKY A;  3C8E A;  3UL3 A;  4FYU A;  3I9V 2;  4K2X A;  4EO3 A;  3LGC A;  4V1A g;  3F3Q A;  1XW6 A;  5HQP A;  4PGT A;  1HNA A;  1GNE A;  4KF9 A;  3EMX A;  3GKN A;  1IYI A;  4G0K A;  2IIY A;  5IOX A;  4V2L A;  1NW2 A;  2VL2 C;  3NZN A;  2E0Q A;  3HA9 A;  5F05 A;  2O89 A;  2HRN A;  2AV4 A;  4ACS A;  1Q98 A;  2OAC A;  1R26 A;  3BBY A;  2PUK C;  1PMT A;  3MSZ A;  4G0L A;  1FB0 A;  1T4Y A;  5H5R A;  2KP2 A;  2XHF A;  5B8A A;  2IWT A;  1UA5 A;  2L6C A;  2X8G A;  1EV9 A;  1T7P B;  2JZR A;  2VD1 A;  4E8H A;  4MK3 A;  1B4P A;  1K3L A;  1K3Y A;  4TRX A;  1K0D A;  1DSB A;  2G2Q A;  4IQA A;  4DEJ A;  2LJA A;  5CRW A;  4BPY A;  4FO5 A;  3FW2 A;  3P7X A;  1G7O A;  5HR3 A;  2VM2 A;  2HFD A;  3G7Y A;  5J4U A;  5LCZ A;  5ID2 B;  1EEM A;  1USB A;  4GCI A;  5IMA A;  3LSZ A;  1GUK A;  2C0D A;  5GST A;  4BVX A;  4HI7 A;  1X5D A;  3EIN A;  3LWA A;  4ZL8 A;  5J41 A;  3TKR A;  3VK9 A;  1SEN A;  4GLT A;  4O5Q A;  2IPA A;  4XIH A;  2ON7 A;  2CZ3 A;  3ME7 A;  3WT2 A;  1AXD A;  3CBU A;  2QKE A;  1ZZY A;  2L5O A;  4EC0 A;  1GSQ A;  1X5C A;  4EE0 A;  3UJ1 A;  5ECS A;  3Q6O A;  5ECM B;  1F2E A;  3TJF A;  1K3O A;  1K0M A;  2HRA A;  5DJL A;  5AN1 A;  1F37 A;  1TW9 A;  4KSO A;  2F3M A;  3BCK A;  4KAE A;  1A2L A;  1SKR B;  5J9C A;  3G7J A;  2DIY A;  3EWL A;  4AJ8 A;  1G0T A;  4DVC A;  2HZF A;  2B3S A;  3F3R A;  1Z3E A;  2E2G A;  4EVM A;  1EGO A;  2DKI A;  1WJK A;  2YWN A;  2QA2 A;  5ENU A;  2R3X A;  2AYT A;  5GZZ B;  3LYP A;  1GSD A;  4HUA A;  1JZO A;  2XPD A;  2FWH A;  5A5K A;  4EXJ A;  3GIX A;  2KP1 A;  5IQY A;  1J0F A;  2JAD A;  2YZH A;  2NTO A;  2FLS A;  16GS A;  4PNG A;  1LU4 A;  1XPV A;  3MAK A;  3QMX A;  3C73 A;  4L0W A;  2RM5 A;  4XS1 A;  2CT6 A;  1FW1 A;  3FK8 A;  4ZBA A;  2PMT A;  4NMU A;  1AAZ A;  3M8N A;  2OJL A;  3ERW A;  2EC4 A;  3ERF A;  2JU5 A;  4F9Z A;  1A24 A;  3ISO A;  3DYR A;  3TDG A;  3A3T A;  3TB2 A;  2KOK A;  4J2F A;  4JE1 A;  1SKS B;  4NAX A;  5IMF A;  2DJK A;  4N11 A;  3UMA A;  2DML A;  4POK A;  3KMN A;  1G6Y A;  1KNG A;  3HCZ A;  5IPH A;  2GTU A;  2XPE A;  1A8L A;  1THO A;  1F3B A;  3RHB A;  3U6V A;  3HKR A;  3ZML A;  2ON5 A;  4K1F A;  2NPB A;  3Q18 A;  3F9U A;  4XRD A;  1V9W A;  1GL8 A;  5ECI B;  3IXR A;  5CRE A;  4HJ2 A;  2LV3 A;  4ISD A;  4N0V A;  3LG6 A;  4LL4 B;  4TR3 A;  1TXX A;  5IO0 A;  4NV2 A;  1K0C A;  2H74 A;  2CA8 A;  2A2S A;  3FHK A;  4IBP A;  3D21 A;  4ILF A;  3VWX A;  1K0A A;  2C0F A;  5J3R A;  1A2M A;  1VF4 A;  4PNF A;  1K0N A;  5D9T A;  5DCH A;  5HFI A;  3TRP A;  2VUP A;  1SL1 B;  2V2G A;  4K6X A;  1DE1 A;  1YY7 A;  1ERW A;  1M2D A;  3QR6 A;  4TOP A;  3W6G A;  1YDK A;  3EE2 A;  5E4W A;  5B6N A;  4WR5 A;  1ERT A;  1X5E A;  3FR3 A;  4Z2T A;  3D5J A;  2B5Y A;  1DBY A;  2C0E A;  2J23 A;  2K9F A;  3W8J A;  2TRX A;  4V2N A;  2B5E A;  3GFK A;  1HNB A;  3GA4 A;  3D4T A;  2O85 A;  3D6I A;  4ZB9 A;  3F4S A;  3IBH A;  5ECQ B;  3AY8 A;  4I97 A;  4L8E A;  4ICY A;  2UZ8 A;  2FD3 A;  4KGI A;  4G9H A;  2MMZ A;  4OO5 A;  2X4A A;  2EIO A;  2NBS A;  4EDY A;  4MDC A;  1THX A;  6GSU A;  1GUH A;  1XW5 A;  1MDK A;  2R5G A;  3HVV A;  9GSS A;  5D73 A;  3V1W A;  2V1M A;  2E2M A;  3CRT A;  5KN3 A;  3SWL A;  2H1G A;  1TU7 A;  2PU9 C;  4OMV A;  2O8V B;  3ZIJ A;  2N5A A;  1XW9 A;  1A8Y A;  5KN1 A;  1ERU A;  1S3C A;  1T8E B;  4F2I A;  1GSE A;  2F8A A;  1VRS D;  2X99 A;  5DQS A;  5E59 A;  4N0Z A;  4EIP A;  1SK2 A;  4EF0 A;  4XS6 A;  2YZU A;  1B4Q A;  1TI1 A;  1FOV A;  1WPI A;  2TRC P;  3VPQ A;  1Q4J A;  2WDU A;  4Z2R A;  5AGY A;  5FT3 A;  14GS A;  1VF2 A;  4MAB A;  5IMC A;  1VGL A;  3HD5 A;  5DJM A;  2FY6 A;  2R2J A;  2D2Z A;  4CY6 A;  3GX8 A;  1SJ6 A;  3QD9 A;  1RK4 A;  3GX0 A;  4USS A;  3A5I A;  4X0X A;  4JRR A;  1UC7 A;  3DXB A;  3MDK A;  2H0G A;  3IHQ A;  3BJ5 A;  3E9J B;  1HD2 A;  4JU5 A;  4TW5 A;  1EGR A;  1Z6N A;  1WRY A;  2B1L A;  4V2M A;  3RDW A;  3TOU A;  1W4V A;  1EV4 A;  1F9M A;  1QK8 A;  1SL2 B;  3HZ8 A;  1BG5 A;  4G2E A;  2C3T A;  1PN0 A;  3FKF A;  4HJM A;  3EMP A;  4POB A;  4OFT A;  3APQ A;  5JCW A;  4MZC A;  4POM A;  3QCP A;  2BTO T;  3N9J A;  2MMN A;  3IC4 A;  1TK0 B;  2GT6 A;  3F4T A;  3ZFB A;  2HYX A;  3KGK A;  2LQQ A;  2OE3 A;  1NHY A;  4MJB A;  2IN3 A;  1OAZ A;  1U3I A;  3WGD A;  4KH7 A;  1AIU A;  1Y25 A;  1R7H A;  1YEP A;  1ZMA A;  3FZ4 A;  4EIQ A;  3EYT A;  4IVF A;  3UAR A;  4PQI A;  4H86 A;  1U87 A;  5F06 A;  1XIY A;  4PQ1 A;  4JR4 A;  1XWB A;  4I5Q A;  3GUS A;  1PRX A;  1J9B A;  2GQL A;  3LXZ A;  2HE3 A;  2HXK A;  4OD7 A;  4RUV A;  1XVW A;  4G10 A;  2KHP A;  1NM3 A;  4ZL7 A;  2CAI A;  2CVB A;  1UVZ A;  5FHI A;  4Z2U A;  4IJ3 A;  5C00 A;  3ZLP A;  5JWO B;  4IQ1 A;  2WZ9 A;  2MBS A;  6GSV A;  3GL3 A;  5IOW A;  3CYN A;  1HNC A;  4GQF A;  2V32 A;  4X1U A;  4G0I A;  1ST9 A;  4HU7 A;  1ZYE A;  4CDO A;  2HNL A;  3P8W A;  1PQN A;  1M7T A;  1M0U A;  1AQV A;  4LLR A;  3IV4 A;  3CSI A;  4MP4 A;  4ZIL A;  3ZRE A;  6GST A;  2HLS A;  4HOJ A;  5IM9 A;  1AC1 A;  4K7N A;  1DUG A;  1JZR A;  4QL7 A;  1Z7R A;  1ACV A;  5EY6 A;  1QGV A;  2RM6 A;  2YJ7 A;  1QUW A;  4GQC A;  2PBJ A;  2H1A A;  3DD3 A;  3RPN A;  5BMU A;  3H93 A;  2H76 A;  5B8B A;  1O73 A;  3KJY A;  4X4J A;  5HR0 A;  3KCM A;  1JFU A;  1YJ6 A;  1XWK A;  1FB6 A;  3LYK A;  6GSX A;  5L71 A;  3F4R A;  4WET A;  1GSS A;  2L4Q A;  3KIJ A;  2HRF A;  1XWG A;  1YKA A;  4LL1 B;  4TXO B;  1KBN A;  1U88 A;  5ECH B;  3FYG A;  4IEL A;  2P5Q A;  1FG4 A;  5DVB A;  2C3N A;  5CRD A;  3ME8 A;  4O92 A;  2A2R A;  2FHE A;  1M9A A;  3QOU A;  3FR6 A;  2FCH A;  6GSW A;  4ZXG A;  2C8U A;  4EDZ A;  2NVL A;  4ZIJ A;  2LJK A;  1GRX A;  2QC7 A;  1X9W B;  2WS2 A;  3DGQ A;  4HS1 A;  2OAD A;  2K6V A;  4GST A;  4ECI A;  3VWV A;  4K7O A;  4IHU A;  4RQR A;  2QGV A;  3TOT A;  2HSY A;  6GSS A;  1I5G A;  2VL2 A;  5CYY A;  1OE7 A;  2GZZ A;  2LST A;  3APS A;  3TUE A;  4PUF C;  5KN0 A;  5D9X A;  5GAN D;  2GDR A;  4RI7 A;  3E3E A;  3ED3 A;  1XZO A;  2R6K A;  3UIW A;  1TP9 A;  1UN2 A;  5CP1 A;  1CQH A;  3BD2 A;  4GSS A;  3QAW A;  4O32 A;  2QSI A;  3MNG A;  3H79 A;  3FEU A;  1TDI A;  1PX7 A;  5F8B A;  1PA3 A;  4NPB A;  3GHA A;  2R37 A;  5HFK A;  1WIK A;  2CZ2 A;  4KND A;  3G9B A;  5DCG A;  5KOX A;  2OBI A;  3LEF A;  3I6A A;  2QA1 A;  5GAP D;  2LRN A;  4ZB6 A;  2CVD A;  4MMM A;  4TR4 A;  4J57 E;  2N5F A;  1ILO A;  4FH8 A;  1XWC A;  5EVO A;  3KTL A;  2FA4 A;  3KP9 A;  5HR1 A;  2VCT A;  2GSR A;  3A5W A;  3HHV A;  4JED A;  3WGX A;  1AW9 A;  5G2Z A;  5ID2 A;  1FVJ A;  2V41 A;  3L9S A;  4MNN A;  1XXU A;  1KEB A;  3M3M A;  3PPU A;  4CW9 A;  3DML A;  1A0R P;  2WGR A;  1HYU A;  1OVN A;  2I81 A;  3R2Q A;  4MLY A;  4TN8 A;  4NHW A;  1GTU A;  3TKQ A;  4MF6 A;  1O85 A;  4WXT A;  1GTI A;  4K0G A;  2V6K A;  4F0C A;  1VF3 A;  2LS5 A;  2EIR A;  3TKS E;  1JLV A;  1TI3 A;  5D8I A;  5CO3 A;  1K0B A;  4NWY A;  1YQ1 A;  3IAM 2;  2M80 A;  2YWI A;  4IP6 A;  1SD9 A;  1M2B A;  3M9J A;  3HXS A;  2IJY A;  2L59 A;  3D22 A;  4I8B A;  4LA1 A;  3DVW A;  1WMJ A;  3E0U A;  5B6M A;  5KOW A;  3C1R A;  1ZYQ B;  2WCI A;  2VAF A;  2PPT A;  5CRH A;  1F3A A;  1PKW A;  2R0G A;  1XVQ A;  7GSS A;  4MF5 A;  1MD3 A;  2VO4 A;  1SYR A;  4FYC A;  4FYB A;  4IJI A;  3DVX A;  2H75 A;  2L6D A;  5JWR B;  4OWY A;  1BAY A;  2V6O A;  3CXG A;  2JAC A;  4GF0 A;  3KTB A;  1TU8 A;  1FOH A;  2IL3 A;  1WWJ A;  3LXT A;  1K0O A;  1SU9 A;  4WF5 A;  2DJ0 A;  4WF4 A;  1SL0 B;  3GUR A;  1R5A A;  4KCA A;  4O5R A;  1B8X A;  1SK0 A;  2PVO C;  3QAG A;  3P2A A;  3KP8 A;  1MD4 A;  2LRT A;  2M72 A;  5G5F A;  1EWX A;  4MF7 A;  5BRT A;  1OC9 B;  1JZW A;  2IFQ B;  3ZTL A;  3LOR A;  1YF1 A;  3RHC A;  1J08 A;  3GV1 A;  2JZT A;  2G0F A;  4WBJ A;  1RQM A;  2VIM A;  3DKS A;  4K2D A;  2H8L A;  19GS A;  4MZB A;  2F9S A;  4F0B A;  3RBT A;  1TK5 B;  2GST A;  4KDU A;  2L57 A;  1V57 A;  3GST A;  4EUY A;  2ZUP A;  2YN1 A;  1A23 A;  2ES7 A;  1ZOF A;  2WUL A;  2MZC A;  2R0C A;  5KEJ A;  4XCS A;  3GNJ A;  2LRC A;  2BJX A;  3IC8 A;  3MWH A;  3GL5 A;  4ML6 A;  4RQX A;  4XS4 B;  2MBT A;  1ML6 A;  5DAL B;  4K9Z A;  5CAX A;  1FHE A;  2HZE B;  4BVY B;  5INY A;  1YEX A;  2VLT A;  2RII A;  3CSH A;  1B9Y C;  2LNS A;  1IYH A;  4J56 E;  4HEA 2;  1V98 A;  2F8F A;  4I6X A;  4AGS A;  4OFM A;  3GH9 A;  5EPF A;  1M9B A;  1ABA A;  1LBK A;  1NSW A;  3CTF A;  1SJZ A;  3FZ5 A;  3J7Y b;  5F07 A;  4D73 B;  4RI6 A;  3HJO A;  1PL2 A;  4ZL9 A;  4BA7 A;  3G7I A;  3NIV A;  3TKS C;  4BWS A;  3M9K A;  4KE3 A;  3KD0 A;  3GSS A;  3RAZ A;  5AIV A;  4EL1 A;  4CY8 A;  2I3Y A;  5DBQ A;  3IRA A;  4BWQ A;  1B48 A;  4ECB A;  4TR1 B;  2RUE A;  5HFG A;  3DEX A;  5IMZ A;  17GS A;  4LMW A;  1BED A;  1OKD A;  4MPG A;  4PX1 A;  2H0H A;  4YQV A;  3BOA A;  3HDC A;  3ZIV A;  4LMV A;  1GH2 A;  4IKH A;  4D73 A;  3GTU B;  3VPT A;  2I9H A;  1FO5 A;  1S3D A;  1GWC A;  3DIE A;  2LNT A;  2TIR A;  1OC3 A;  3C7M A;  2CVK A;  1WP0 A;  2PN8 A;  4MJC A;  3UEM A;  4ULX A;  1M2A A;  1O8W A;  3VWU A;  1QFN A;  3ZFL A;  4KA0 A;  2P31 A;  1G6W A;  1GTB A;  3OR5 A;  3A2V A;  1T4Z A;  4TR1 A;  2PVQ A;  3ZMK A;  2FUG 2;  4IN0 A;  2ALB A;  4L5L A;  4ECC A;  2RLI A;  2C4J A;  1EP8 A;  1F6M C;  2DBC A;  4DSS B;  2DMM A;  3IR4 A;  4EKZ A;  1N8J A;  4YKG A;  2FWG A;  2OA7 A;  4KDX A;  2PWJ A;  3IE3 A;  2C0G A;  3FMW A;  1DE2 A;  1Z7P A;  3EU3 A;  1MDI A;  3P90 A;  5FWG A;  2MMO A;  5A4V A;  1OYJ A;  5ECO B;  2GSQ A;  3PR8 A;  2HSM A;  2WFC A;  3UVT A;  1AUC A;  3CMI A;  3EVI A;  2RUF A;  2GVP A;  4AJ6 A;  1URM A;  3EPT A;  2X8C A;  2AAW A;  2IMF A;  3GH6 A;  2DJ1 A;  2LTK A;  4PUR A;  1BJX A;  5J5N A;  2GGT A;  1T1V A;  2GS3 A;  4FIW A;  4K8M A;  2FNO A;  2GSS A;  22GS A;  4WR4 A;  3KMO A;  3VLN A;  1U6T A;  3F6D A;  2IME A;  2CQ9 A;  5ELA A;  5HR2 A;  2YV7 A;  4AJ7 A;  4CHS A;  4DSQ A;  1JZD A;  3KEB A;  3UAP A;  1O6J A;  3IAS 2;  1XBS A;  2F51 A;  2LKU A;  2JL4 A;  4Q5F A;  4AF2 A;  3LJR A;  3PGT A;  1PX6 A;  4G19 A;  3GKK A;  1Z5Y E;  2XBI A;  1HQO A;  2WJU A;  3SBC A;  2P0G A;  1AQW A;  4NHZ A;  4PUA A;  5C04 A;  4ML1 A;  3O6T A;  4GWR A;  2YAN A;  3DRN A;  3JCM L;  1JHB A;  3QDN A;  2VLU A;  2KUC A;  4MJE A;  3L0H A;  1OKT A;  5D9W A;  3IK9 A;  4GXZ A;  4K5S A;  2LJR A;  4KSM A;  1BQ7 A;  4ID0 A;  1X9M B;  3ZYW A;  4WKW A;  3A2X A;  3HY2 A;  3DWV A;  1NHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...