1M2BA

Crystal structure at 1.25 angstroms resolution of the cys55ser variant of the thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
101
structure length
101
Chain Sequence
FKHVFVCVQDRPPGHPQGSCAQRGSREVFQAFMEKIQTDPQLFMTTVITPTGSMNACMMGPVVVVYPDGVWYGQVKPEDVDEIVEKHLKGGEPVERLVISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords [2Fe-2S] ferredoxin
publication title High-resolution crystal structures of the wild type and Cys-55-->Ser and Cys-59-->Ser variants of the thioredoxin-like [2Fe-2S] ferredoxin from Aquifex aeolicus
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 33
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1m2bA00
3LWAA 2WCIA 4DEJA 3UJ1A 1G6WA 3ZFLA 5DALA 1AIUA 1DBYA 2VO4A 3D4TA 3C8EA 3W8JA 5KN2A 3EU3A 4ECJA 2GQMA 1G7EA 3D5JA 1U3AA 3RBTA 4IW9A 2C1YA 3D22A 5D73A 10GSA 2JZTA 5F0GA 1UA5A 2M46A 4TR4A 3EMXA 4KW6A 1MD3A 3Q6OA 2I81A 2MMNA 1MD4A 2RIIA 5ECQB 3FZ5A 2B5YA 5J41A 3C71A 3GL3A 1Z7RA 1TP9A 3IK7A 2HYXA 5FHIA 3F8UA 3TKPA 1Z6MA 2OE3A 2VUPA 1PSQA 3KTLA 3TJJA 3HD5A 4PXOA 5IIZA 1OE8A 4AJ8A 1R5PA 1SKSB 1OC8A 1XOAA 4KGIA 5HFIA 2PGTA 4O5RA 1EP7A 4JE1A 4CW9A 1X9MB 1OE7A 2OACA 2P31A 2YCDA 3EINA 3IHQA 5CRHA 1ST9A 2O8VB 4FH8A 4WXTA 3GA4A 2E0QA 4FIWA 4WBJA 4EO3A 4IGJA 1F2EA 2HFDA 2PPTA 2EIQA 2X8HA 2V6OA 3ZMKA 4MF7A 2FLSA 2YPMA 1AQXA 4KSMA 2X99A 1JLWA 5ELAA 2DLXA 3VFIA 2QSIA 3ERGA 1QFNA 2PMTA 2OBKA 2PBJA 3M0FA 1SJ6A 2AJQB 1A2LA 2F8AA 1BX9A 3GTUA 1USBA 5LCZA 2GS3A 4OO4A 1FVKA 12GSA 1K3LA 4EDZA 2JZRA 1X5CA 2AAWA 1YEPA 3L9VA 2C0EA 5B8AA 2E2GA 3A2WA 1E6BA 5CNWA 1TTZA 1K0MA 2B5EA 1M9BA 1GH2A 1S3DA 4ZBDA 4F03A 4HQZA 2DJ2A 4BVXA 1T7PB 2L5LA 3N9JA 2LQQA 5JCUA 1PGTA 1OKDA 4WF4A 4KCEA 2PU9C 3QD9A 2N5AA 4GWRA 1NW2A 5DVBA 5IOWA 3KGKA 1SD8A 2H1GA 2CVBA 2KOKA 5JWQB 4TN8A 1SK0A 5ECLB 2LV3A 1SU9A 4GQFA 5KN3A 3QAVA 3GH6A 2R37A 4POBA 4MP4A 2O89A 2ON7A 3HA9A 2O7KA 3VWXA 4PUAA 5GZZB 2LJKA 1KBNA 2V6KA 2VD1A 4I2TA 1SJIA 8GSSA 3HCZA 2B1LA 2WRTA 1K0AA 5ECKB 5J4UA 2LNTA 3LEFA 4F9ZA 3QPMA 1XWAA 3TOTA 4AGSA 2PN8A 5F07A 4RQXA 2GQKA 2AB6A 4EKZA 2B7JA 4ZL9A 4EDYA 19GSA 2DMMA 1TJDA 1H75A 2VCQA 3HJPA 4ZB6A 4JU5A 4NHWA 4BWQA 3CTFA 2H76A 4KAEA 5EL8A 4HU7A 1DE2A 3DMLA 2LNSA 3GFKA 4KB3A 5LNKe 2ES7A 1YEXA 1SKWB 3VWVA 3DXBA 1YF0A 4TXOA 2GT6A 5A5KA 5DBQA 2PVQA 4PUFC 2YNXA 1LJRA 4BVYA 3LQ7A 3QMXA 1X0RA 4G10A 1H4OA 4XIHA 1X9WB 1AAZA 2GZYA 3TRXA 4ULXA 1U3IA 4Q5FA 4F2IA 4HEA2 4V1Ag 1Z5YE 1FW1A 1AQWA 3QR6A 3GKMA 4OWYA 2YOIA 1ZCPA 2G2QA 5IMFA 3L78A 4N10A 5G5FA 5ECIB 3FR6A 3WGDA 1GLQA 2WDUA 2C3NA 4GSNA 4GRFA 2JL4A 1GNWA 1J0FA 2AUVA 2VM1A 3D0ZA 2OADA 2LRCA 1TXXA 2DJKA 1WP0A 2YP6A 5B8BA 3DKSA 3KM6A 3FZ4A 2IMFA 3Q19A 4ACSA 2L6CA 5GSSA 5ECHB 1O81A 5CP1A 5J9CA 4K0GA 3L9UA 5D9XA 2MMOA 3GV1A 3TJFA 3KH7A 1U87A 3GX0A 3ZVJD 1PD21 1GL8A 5B6NA 3IC4A 4AF2A 2R4VA 4WBRD 3ZITA 1R26A 2P0GA 4MPFA 4TR1A 3HKRA 2ZUPA 2JADA 1PL1A 3A5WA 3IOSA 2ALBA 1SENA 1NHOA 5B6MA 4FYCA 4TR0A 5HFGA 1K0OA 2L4QA 5DAKA 2IMKA 1HD2A 4AJ6A 2ZCTA 1PN9A 4NMUA 1AXDA 1T1VA 4TOPA 3DVWA 1FG4A 4PQIA 1GWCA 2HLSA 2TRXA 2A4VA 2MBTA 5D9VA 2GSRA 5ECNB 4O92A 2E2MA 2H01A 3FR9A 4F0BA 2NVLA 2OA7A 5LD0A 4MZWA 1V9WA 4K9ZA 4EVMA 3C1RA 4JZQA 4NPBA 5G1LA 1ML6A 5D9WA 1R7HA 5J9BA 3ME7A 3H4KA 3ZMLA 4ZIJA 1PA3A 1NHYA 4V2MA 4NXIA 3M9KA 3LXZA 5IPHA 2IN3A 4LL4B 4ZILA 1PKZA 2YANA 2B7KA 2HI7A 5HQPA 2FWEA 2LEGA 1GSFA 5B7CA 6GSSA 4XS4B 2IJYA 1X9SB 5F8BA 3HY2A 3FYGA 3QAGA 2LJAA 2B3SA 4WF5A 2H19A 5GSTA 2H72A 3N5OA 2V2GA 2H0GA 2CV4A 4BWSA 2O85A 1Q4JA 4XRAA 1TI1A 3W6GA 4ID0A 1HYUA 4F82A 1A23A 4DVCA 3VWWA 1JZDA 1PL2A 3VPQA 1XCCA 2R2JA 2WJUA 1Z6NA 3DGQA 2IFQB 2HRFA 4FYUA 2FWHA 3KCMA 2KLXA 3O3TA 2ZNMA 3TKQA 2CZ2A 3HYPA 2GVPA 1YKCA 4DSSB 5ID2B 3PINA 1OYJA 3GSTA 5E4WA 5AIVA 1BYEA 4N0ZA 5E59A 2DIZA 2K8SA 5ELGA 3TKSE 2L57A 2L5OA 2YZUA 2GZZA 3AY8A 4MF5A 4MK3A 1M7TA 4RI7A 5AISA 3H79A 3TKRA 2WULA 2YZHA 3EC3A 1SYXA 4X0XA 1FB0A 1MDJA 3C73A 1TRWA 2MYGA 2IIYA 1GLPA 2X8GA 3ZIVA 3DD3A 4MJCA 2FHEA 4TR3A 2LRTA 1YZXA 3CXGA 5IOXA 4PNGA 1RQMA 3DYRA 3MSZA 4L5OA 4IN0A 5KN1A 1AUCA 1PMTA 2FWFA 1ILOA 1QMVA 1XW6A 3G7IA 3J7Yb 2CX4A 2KUCA 3DRNA 3HHVA 1Z9HA 2OE1A 1WJKA 4L0WA 3ZREA 2CZ3A 1JZWA 1F6MC 1M2AA 3LSZA 5HR2A 1GUHA 1EP8A 1T4YA 4D73A 3I43A 4MDCA 3BOAA 3UAPA 1FO5A 2HZEB 3TKSA 4NHZA 2C3QA 3A2VA 1GRXA 3EURA 2TRCP 1YJ6A 4OFNA 4PQHA 4MABA 5J5NA 1TK0B 3CRTA 4ZB9A 4MLYA 5JCGA 1GTIA 2GZPA 2H66A 3FHKA 4CHSA 4XRDA 3TRPA 2PWJA 5IMAA 2JACA 2ON5A 1XPVA 4HZ2A 5ABRA 4BPYA 5A4VA 1GULA 1UN2A 5CYYA 5FT3A 2WB9A 5DJMA 3UMAA 3CSJA 4H86A 2O87A 3HDCA 1XFLA 4Q5QA 4Q5NA 1ZGNA 2V32A 3OR5A 4WR4A 3E9JB 4WETA 3VURA 1EWXA 4ILFA 1GSDA 1OC9B 5JWRB 4MMMA 1ERTA 2GQLA 18GSA 1B9YC 1CQGA 2LQOA 1THXA 1WIKA 2H6YA 1UC7A 1T00A 4KE3A 2VL2A 2HNLA 2XPDA 3UVTA 1IYHA 3BBYA 4MF6A 4QL9A 2YWIA 1O7UA 2PUKC 4LL1B 3MWHA 5A4UA 1A2JA 1F3AA 2K9FA 4WR5A 4OCFA 3CSIA 2IMEA 1G0TA 3DWVA 5INYA 4QQ7A 5IMVA 1EV4A 2E7PA 3Q18A 3RAZA 1TU8A 2EC4A 2LS5A 1BG5A 3TGZA 2CVKA 3F6DA 2H75A 4TVEA 2FY6A 1O6JA 4FO5A 5G30A 3LYPA 2LJRA 5G1KA 4G9HA 4OO5A 1R5AA 1WMJA 2DJ3A 4JR6A 4J57E 3FRCA 2DBCA 1OC3A 5AN1A 4EC0A 4KUNA 4RUVA 2CAIA 3LFLA 3LGCA 3HVSA 3GN3A 2Z9SA 1MDIA 1TK8B 1XVQA 3VWUA 2I1UA 3V1WA 2GSTA 1K0NA 1AQVA 3UOMA 2LSTA 2A2RA 5DCGA 3ZVJA 1YKAA 1XW9A 1GTUA 2RM6A 1SL2B 1X5EA 5H5SA 5IM9A 3VI7A 1XWBA 3UVHA 2GSSA 1MTCA 5KEJA 2FA4A 2VLUA 4IP6A 3WD6A 3P8WA 4ZL7A 1BQ7A 1SJZA 2RM5A 1KNGA 1AC1A 2OJLA 1GSEA 1O8WA 6GSYA 3C1SA 1DSBA 1V40A 1AW9A 4L8EA 2R3XA 4POLA 2R5GA 4IBPA 2M80A 3L9SA 4KA0A 4V2LA 5CAXA 2IPAA 5ECSA 4MJEA 1JLVA 4K2DA 4EUYA 2H0IA 3Q74A 5JWOB 4IP1A 3KIJA 3CTGA 3DVXA 5DCHA 3HZ8A 4HQSA 1YF1A 1VF1A 3NZNA 4POKA 5IO2A 2C4JA 4FYBA 1B4QA 5EY6A 1FHEA 3IA1A 2DSAA 3KJYA 2K6VA 3GKNA 3QOUA 3DIEA 2WFCA 2PVOC 4L0UA 2VCTA 2WGRA 4PNFA 2VCWA 1TRVA 4GF0A 4O7HA 2VCZA 3KZQA 4XCSA 5ECPB 1ERVA 2VD0A 2V1MA 2H6ZA 1OKTA 4POMA 11GSA 2WS2A 3GL5A 3MAKA 7GSSA 1GNEA 6GSVA 4PQ1A 2HXKA 1M2DA 2YJ7A 3A2XA 2H8LA 2B6MA 4PX1A 1GSQA 1IYIA 5ECMB 1G6YA 5CRDA 2DJ1A 2L4CA 1TK5B 1GUMA 4GCIA 4TXVA 5DALB 3M8NA 1JZOA 2KP1A 3M3MA 3H1NA 2NBSA 2M72A 1EOHA 2FA8A 2F3MA 5J3RA 3NOFA 1G7OA 1RW1A 3TOUA 3TJGA 2I4AA 1A0RP 4E8HA 3GKKA 2CA8A 2VCXA 2JSZA 4E8EA 4X1UA 3KP9A 2FGXA 3L0HA 2VLTA 4PURA 1SKRB 1TI3A 3GRXA 4IKHA 1YDKA 3GIXA 3VK9A 2FD3A 1EEJA 1GTBA 1XWKA 2XPEA 2VAFA 2CAQA 5IPGA 4K7OA 3IBHA 1F9MA 1GUKA 3RHCA 2H1BA 2IWTA 3KXOA 1LU4A 4K6XA 3UL3A 4CDOA 3TDGA 4LMWA 5D96A 3GYKA 2KHPA 2N5FA 2YV9A 4G2EA 1TOFA 1E2YA 5HFKA 1WPIA 1BJXA 2CX3A 5DQSA 1TU7A 1WWJA 2H6XA 2V41A 3BD2A 1XW5A 2HSYA 3KP8A 2C80A 3ZYWA 3QDNA 1F3BA 1ABAA 3GHAA 1CQHA 2DMLA 1PX7A 2L59A 5COHA 1WE0A 2C3TA 4OMVA 1PX6A 2DC5A 2QKEA 1FOVA 2K8VA 3PGTA 4ML1A 1O8XA 5HR3A 1SL1B 3L4NA 3UBLA 4IELA 5DDLA 3D6IA 3IAS2 5A4WA 1FAAA 1PRXA 1N8JA 5CRGA 2G0FA 1ZOFA 2P5RA 2F8FA 2YWNA 2B5XA 3GTUB 2I9HA 5ECOB 2H74A 2OKAA 3HZ4A 4GQCA 3ZTLA 3ZIJA 3ME8A 1ERWA 3I69A 4NV2A 1K3YA 1EEMA 4JEDA 5IO0A 5DJLA 5KN0A 5IMCA 5C04A 2RUFA 3FK8A 2N5BA 3CBUA 3WGXA 2WZ9A 4MH2A 5IMZA 5D8IA 4I2UA 1B9XC 3UEMA 1RK4A 2R6KA 3FZAA 2MBSA 4IHUA 4MJBA 3ISOA 4I8BA 2DIYA 3PR8A 3GMFA 2GDRA 3P7XA 1V57A 2H1AA 2P5QA 3QAWA 3WGEA 2JU5A 4J2FA 3H93A 1QUWA 2YWMA 4V2NA 4KCAA 2GTUA 1W4VA 1HNCA 5GAPD 4I5QA 4K0NA 1QXHA 1TW9A 3A3TA 3KEBA 16GSA 4HUAA 1YQ1A 1FB6A 4TW5A 1TDIA 4HJMA 4HZ4A 1GSUA 4YH2A 2YV7A 1PQNA 4JRRA 3F9UA 3VI5A 3TJBA 4MA9A 4I6XA 4YAVA 1V98A 1O73A 1VF3A 2PERA 3ZZXA 4GLTA 1V58A 2C8UA 1M0UA 1XWGA 2AYTA 3MNGA 4ECCA 5JCWA 3IK9A 5FWGA 2HSHA 2TIRA 4I97A 3PH9A 2BMXA 1ON4A 1THOA 1GSYA 3VPTA 1T4ZA 5HR0A 1M9AA 2IMIA 2K18A 1VF2A 4GSTA 3WT2A 4TXOB 4Z7XA 5F06A 3E3EA 4XS4A 6GSXA 2CQ9A 2HZFA 1LBKA 3SBCA 1MDKA 3IPZA 3TRQA 2MZCA 3U5RE 4K8MA 2RUEA 1WRYA 17GSA 3ED3A 3F6FA 1ZMAA 2X8CA 3NIVA 2VCVA 1Z7PA 3F0IA 4RI6A 4MJAA 3DEXA 2H0HA 1EGRA 4ZL8A 4IQAA 3KMNA 2NDOA 4KDXA 2H73A 4WEYA 4EF0A 3JCML 4JBBA 2IFQA 3P90A 2AV4A 4YQVA 3TB2A 1Y6EA 2IMDA 4X43A 4KDYA 1EOGA 4BL7A 4DSSA 4K1FA 5ID2A 1R4WA 4IS0A 1K3OA 2GLRA 4XS1A 3W8SA 5CO3A 2LUSA 1QK8A 1HQOA 4IQ1A 3E0UA 3ERWA 2OE0A 5CREA 1T3BA 3M9JA 4YAPA 3IE3A 5G31A 3TCOA 3HJOA 2H30A 1ZL9A 3S9FA 1GTAA 2GSQA 1A8LA 4AJ7A 2J23A 1A8YA 2MMAA 2F9SA 2GT5A 4TR1B 1NSWA 4MZCA 4Q5RA 1QGVA 1DUGA 4NV5A 2YJHA 4O32A 5GAND 1ZYEA 3IXRA 3LXTA 2CT6A 2LKUA 5D9TA 5DAKB 2A2SA 4ZB8A 2FCHA 3FR3A 4MCUA 2REMA 3FZ9A 3IR4A 2EIRA 1MEKA 1F37A 5F05A 3HXSA 5EVOA 3M1GA 5IMDA 4GTUA 4HDEA 4L5LA 1XWCA 3EVIA 3LJRA 3LORA 2XC2A 4EL1A 1O85A 1X5DA 3IV4A 1BEDA 3GURA 3QFBC 4XTSA 2YN1A 4YQMA 2HZEA 1DE1A 2H70A 1EZKA 3HVVA 2KP2A 1JFUA 1SK2A 4QL7A 2FWGA 4LLRA 4TRXA 2DJ0A 2LRNA 4J56E 1S3CA 1V2AA 4HS1A 2BTOT 1B48A 2XHFA 2RLIA 3F63A 20GSA 2VLVA 2HE3A 2NTOA 5G5EA 4MZBA 1S3AA 1VGLA 1XXUA 2EIOA 3US3A 1K0DA 4OFTA 4DSQA 3KTBA 3TJKA 5ENUA 3KMOA 4NWYA 3F4TA 3BJ5A 1XBSA 3TKSC 4K7NA 1UVZA 4NAXA 3I9V2 2VOCA 3KD0A 1BAYA 3ERFA 5DQYA 3APSA 3GH9A 13GSA 5AGYA 2CVDA 3VLNA 1Z3EA 1T8EB 1U88A 3P2AA 6GSTA 3C7MA 1XVWA 3BCKA 3LYKA 4P3YB 2VIMA 1OC9A 4DSRA 3EE2A 1EV9A 3FEUA 1NM3A 1Y25A 1I9DA 3CRUA 4ZBBA 4LA1A 2HT9A 1YY7A 3G9BA 4KDUA 4KNDA 3K8NA 4HOJA 3WT1A 3ZLPA 3J7Yk 1GP1A 1SK1A 4ML6A 3QFAC 2QGVA 3R2QA 1M99A 2L6DA 1ZYQB 3IDVA 3APOA 4YQUA 1Q98A 2XBQA 3G7JA 2VL2C 4GXZA 3FY7A 4ZBAA 3ZRDA 3UARA 4PGTA 4KX4A 3G7YA 3GKXA 2IL3A 4OCEA 3MDKA 2VL3A 5D93A 2VL9A 4ISDA 3UBKA 1WOUA 1TKDB 4HI7A 1U6TA 4LMVA 3O76A 2LTKA 3CYNA 1TRSA 3GSSA 4BA7A 1A0FA 3FKFA 2DJJA 4OD7A 5CRWA 3EU4A 5ECRB 3ZFBA 4XHMA 3HJMA 1FVJA 3GX8A 1A2MA 4MH3A 14GSA 3KH9A 4WKWA 4HU9A 1OAZA 2AHEA 2XBIA 3BCIA 4G19A 4ECIA 4TKYA 2I3YA 4EXJA 4KSOA 1VRSD 1ACVA 3QCPA 2F51A 2GGTA 5H5RA 5IQYA 1K0BA 3RHBA 4ZXGA 4XS6A 2YWOA 5H5QA 1KTEA 1B8XA 1ERUA 4MPGA 1HNBA 2VM2A 2FNOA 2FUG2 1A24A 1J08A 4D73B 9GSSA 3EWLA 3GNJA 2D2ZA 1SL0B 2NPBA 1XOBA 1W89A 1C72A 2OBIA 3RPPA 2C0GA 3I6AA 1OVNA 3LG6A 2JSYA 3TUEA 3RDWA 1SYRA 4IVFA 1EGOA 4N0VA 2BJXA 1JHBA 4N30A 4K7IA 1J9BA 2QC7A 4IJIA 3HVXA 3EYTA 4RQRA 1SD9A 5G2ZA 1PKWA 1ZZYA 5EPFA 1I5GA 2C0DA 4F0CA 3U6VA 4HJ2A 5AIXA 3F3QA 3CMIA 1KEBA 1JZRA 1HNAA 3H8QA 1TRUA 2H1DA 22GSA 2MMZA 3GUSA 3IAM2 3UIWA 3D4MA 2HRNA 4EE0A 4GSSA 3APQA 1XIYA 1XZOA 3D21A 5C00A 3IRAA 4V1Ap 2J9HA 4OFMA 2X64A 4IJ3A 6GSWA 2C0FA 3FW2A 4N11A 3WYWA 1M2BA 5HR1A 1K0CA 1VF4A 3EMPA 1QQ2A 4JR4A 2JZSA 1URMA 3F3RA 6GSUA 5L71A 3F4SA 1GSSA 3ZL5A 2H71A 3CSHA 4ECBA 3RPNA 3F4RA 3SWLA 2B1KA 1B4PA 1N2AA 3O6TA 4KH7A
chains in the Genus database with same CATH superfamily
3LWAA 2WCIA 4DEJA 3UJ1A 1G6WA 3ZFLA 5DALA 1AIUA 3IC8A 1DBYA 2VO4A 3D4TA 3C8EA 3W8JA 5KN2A 3LW9A 3EU3A 4ECJA 2GQMA 1G7EA 3D5JA 1U3AA 3RBTA 4IW9A 2C1YA 3D22A 5D73A 10GSA 2JZTA 5F0GA 1UA5A 4G0LA 2M46A 4TR4A 3EMXA 4KW6A 1MD3A 3Q6OA 2I81A 2MMNA 1MD4A 2RIIA 5ECQB 3FZ5A 2B5YA 5J41A 3C71A 3GL3A 1Z7RA 1TP9A 3IK7A 2HYXA 5FHIA 3F8UA 3TKPA 1Z6MA 2OE3A 2VUPA 1PSQA 3KTLA 3TJJA 3HD5A 4PXOA 5IIZA 1OE8A 4AJ8A 1R5PA 1SKSB 1OC8A 1XOAA 4KGIA 5HFIA 2PGTA 4O5RA 1EP7A 4JE1A 4CW9A 1X9MB 1OE7A 2OACA 2P31A 2YCDA 3EINA 3IHQA 5CRHA 1ST9A 2O8VB 4FH8A 4WXTA 3GA4A 2E0QA 4FIWA 4WBJA 4EO3A 4IGJA 4K2XA 1F2EA 2HFDA 2PPTA 2EIQA 2X8HA 2V6OA 3ZMKA 4MF7A 2FLSA 2YPMA 1AQXA 4KSMA 2X99A 1JLWA 5ELAA 2DLXA 3VFIA 2QSIA 4X4JA 3ERGA 1QFNA 2PMTA 2OBKA 2PBJA 3M0FA 1SJ6A 2AJQB 1A2LA 2F8AA 1BX9A 3GTUA 1USBA 5LCZA 2GS3A 4OO4A 1FVKA 12GSA 1K3LA 4EDZA 2JZRA 1X5CA 2AAWA 1YEPA 3L9VA 2C0EA 5B8AA 2E2GA 3A2WA 1E6BA 5CNWA 1TTZA 1K0MA 2B5EA 1M9BA 1GH2A 1S3DA 2X4AA 4ZBDA 2X49A 4F03A 4HQZA 4YKGA 2DJ2A 4BVXA 1T7PB 2L5LA 3N9JA 2LQQA 5JCUA 1PGTA 1OKDA 4WF4A 4KCEA 2PU9C 3QD9A 2N5AA 4GWRA 1NW2A 5DVBA 5IOWA 3KGKA 1SD8A 2H1GA 2CVBA 2KOKA 5JWQB 4TN8A 1SK0A 5ECLB 2LV3A 1SU9A 4GQFA 5KN3A 3QAVA 3GH6A 2R37A 4POBA 4MP4A 2O89A 2ON7A 3CQFA 3HA9A 2O7KA 3VWXA 5BRTA 4PUAA 5GZZB 2LJKA 1KBNA 2V6KA 2VD1A 4I2TA 1SJIA 2HRKA 8GSSA 3HCZA 4CY6A 2B1LA 2WRTA 1K0AA 5ECKB 5J4UA 2LNTA 3MIXA 3LEFA 4F9ZA 3QPMA 1XWAA 3TOTA 4AGSA 2PN8A 5F07A 4RQXA 2GQKA 5BMUA 2AB6A 4EKZA 2B7JA 4ZL9A 4EDYA 19GSA 2DMMA 1TJDA 1H75A 3PPUA 2VCQA 3HJPA 4ZB6A 4JU5A 4NHWA 4BWQA 3CTFA 2H76A 4KAEA 5EL8A 4HU7A 1DE2A 3DMLA 1PFOA 2LNSA 3GFKA 4KB3A 5LNKe 2ES7A 1YEXA 1SKWB 3VWVA 3DXBA 1YF0A 5KOWA 4TXOA 2GT6A 5A5KA 5DBQA 2PVQA 4PUFC 2YNXA 1LJRA 4BVYA 4EIPA 3LQ7A 4FQUA 3QMXA 1X0RA 4G10A 1H4OA 4XIHA 1X9WB 1AAZA 2GZYA 3TRXA 4ULXA 1U3IA 4Q5FA 4F2IA 4HEA2 4V1Ag 1Z5YE 1FW1A 1AQWA 3QR6A 3GKMA 4OWYA 2YOIA 1ZCPA 2G2QA 5IMFA 3L78A 4N10A 5G5FA 5ECIB 3FR6A 3WGDA 1GLQA 2WDUA 2C3NA 4GSNA 4GRFA 2JL4A 1GNWA 1J0FA 2AUVA 2VM1A 3D0ZA 2OADA 2LRCA 1TXXA 2DJKA 2DKHA 1WP0A 2YP6A 4EIQA 5B8BA 3DKSA 3KM6A 3FZ4A 2IMFA 3Q19A 4ACSA 2L6CA 5GSSA 5ECHB 1O81A 5CP1A 5J9CA 4K0GA 3L9UA 5D9XA 2MMOA 3GV1A 3TJFA 3KH7A 1U87A 3GX0A 3ZVJD 1PD21 1GL8A 5B6NA 3IC4A 4AF2A 2R4VA 4WBRD 3ZITA 1R26A 2P0GA 4MPFA 4TR1A 3HKRA 2ZUPA 2JADA 1PL1A 3A5WA 3IOSA 2ALBA 1SENA 1NHOA 5B6MA 4FYCA 4TR0A 5HFGA 1K0OA 2L4QA 5DAKA 2IMKA 1HD2A 4AJ6A 2ZCTA 1FOHA 1PN9A 4NMUA 1AXDA 1T1VA 4TOPA 3DVWA 1FG4A 4PQIA 1GWCA 2HLSA 2TRXA 2A4VA 2MBTA 5D9VA 2GSRA 5ECNB 4O92A 2E2MA 2H01A 3FR9A 4F0BA 2NVLA 2OA7A 5LD0A 4MZWA 1V9WA 4K9ZA 4EVMA 3C1RA 4JZQA 4NPBA 5G1LA 1ML6A 5D9WA 1R7HA 5J9BA 3ME7A 4MNNA 3H4KA 3ZMLA 4ZIJA 1PA3A 1NHYA 4V2MA 4NXIA 3M9KA 3LXZA 5IPHA 2IN3A 4LL4B 4ZILA 1PKZA 2YANA 2B7KA 2HI7A 5HQPA 2FWEA 2LEGA 1GSFA 5B7CA 6GSSA 4XS4B 2IJYA 1X9SB 5F8BA 3HY2A 3FYGA 3QAGA 2LJAA 2B3SA 4WF5A 2H19A 5GSTA 2H72A 3N5OA 2V2GA 2H0GA 2CV4A 4BWSA 2O85A 1Q4JA 4XRAA 1TI1A 3W6GA 4ID0A 1HYUA 4F82A 1A23A 4DVCA 3VWWA 1JZDA 1PL2A 3VPQA 1XCCA 2R2JA 2WJUA 1Z6NA 3DGQA 2IFQB 2HRFA 4FYUA 2FWHA 3KCMA 2KLXA 3O3TA 2ZNMA 3TKQA 2CZ2A 3R3EA 4BL7B 3HYPA 2GVPA 1YKCA 4DSSB 5ID2B 3PINA 1OYJA 3GSTA 5E4WA 5AIVA 1BYEA 4N0ZA 5E59A 2DIZA 2K8SA 5ELGA 3TKSE 2L57A 2L5OA 2YZUA 2GZZA 3AY8A 4MF5A 4MK3A 1M7TA 4RI7A 5AISA 3H79A 3TKRA 2WULA 2YZHA 3EC3A 1SYXA 4X0XA 1FB0A 1MDJA 3C73A 1TRWA 2MYGA 2IIYA 1GLPA 2X8GA 4ICYA 3ZIVA 3DD3A 4MJCA 2FHEA 4TR3A 2LRTA 1YZXA 3CXGA 5IOXA 4PNGA 1RQMA 3DYRA 3MSZA 4L5OA 4IN0A 5KN1A 1AUCA 1PMTA 2FWFA 1ILOA 1QMVA 1XW6A 3G7IA 3J7Yb 2CX4A 2KUCA 3DRNA 3HHVA 1Z9HA 2OE1A 1WJKA 4L0WA 3ZREA 2CZ3A 1JZWA 1F6MC 1M2AA 3LSZA 4PTSA 5HR2A 1GUHA 1EP8A 1T4YA 4D73A 3I43A 4MDCA 3BOAA 3UAPA 1FO5A 2HZEB 3TKSA 4NHZA 2C3QA 3A2VA 1GRXA 3EURA 2TRCP 1YJ6A 4OFNA 4PQHA 4MABA 5J5NA 1TK0B 3CRTA 4ZB9A 3MYDA 4MLYA 1GTIA 5JCGA 2GZPA 2H66A 3FHKA 4CHSA 4XRDA 3TRPA 2PWJA 5IMAA 2JACA 2ON5A 1XPVA 4HZ2A 5ABRA 4BPYA 5A4VA 1GULA 1UN2A 5CYYA 5FT3A 2WB9A 5DJMA 3UMAA 3CSJA 4H86A 2O87A 3HDCA 1XFLA 4Q5QA 4Q5NA 1ZGNA 2V32A 3OR5A 4WR4A 3E9JB 4WETA 3VURA 1EWXA 4ILFA 1GSDA 4CY8A 1OC9B 5JWRB 4MMMA 4K5SA 1ERTA 2GQLA 18GSA 2DKIA 1B9YC 1CQGA 2LQOA 1THXA 1WIKA 2H6YA 1UC7A 1T00A 4KE3A 2VL2A 2HNLA 2XPDA 3UVTA 1IYHA 3BBYA 4MF6A 4QL9A 2YWIA 3IHGA 1O7UA 2PUKC 4LL1B 3MWHA 5A4UA 1A2JA 1F3AA 2K9FA 4WR5A 1S3RA 4OCFA 3CSIA 2IMEA 1G0TA 3DWVA 5INYA 4QQ7A 5IMVA 1EV4A 2E7PA 3Q18A 3RAZA 1TU8A 2EC4A 2LS5A 1BG5A 3TGZA 2CVKA 3F6DA 2H75A 4TVEA 2FY6A 1O6JA 4FO5A 5G30A 3LYPA 2LJRA 5G1KA 1XG8A 4G9HA 4OO5A 1R5AA 1WMJA 2DJ3A 4JR6A 4J57E 3FRCA 2DBCA 1OC3A 5AN1A 4EC0A 4KUNA 4RUVA 2CAIA 3LFLA 3LGCA 3HVSA 3GN3A 2Z9SA 1MDIA 2R0GA 4O5UA 1TK8B 1XVQA 3VWUA 2I1UA 3V1WA 2GSTA 1K0NA 1AQVA 3UOMA 2LSTA 2A2RA 5DCGA 3ZVJA 1YKAA 1XW9A 1GTUA 2RM6A 1SL2B 1X5EA 5H5SA 5IM9A 3VI7A 1XWBA 3UVHA 2GSSA 1MTCA 5KEJA 2FA4A 2VLUA 4IP6A 3WD6A 3P8WA 4ZL7A 1BQ7A 1SJZA 2RM5A 1KNGA 1AC1A 2OJLA 1GSEA 1O8WA 6GSYA 3C1SA 1DSBA 1V40A 1AW9A 4L8EA 2R3XA 4POLA 2R5GA 3EPTA 4IBPA 2M80A 3L9SA 4KA0A 4V2LA 5CAXA 2IPAA 5ECSA 4MJEA 1JLVA 4HSCX 4K2DA 4EUYA 2H0IA 3Q74A 5JWOB 4IP1A 3KIJA 3CTGA 3DVXA 5DCHA 3HZ8A 4HQSA 1YF1A 1VF1A 3NZNA 4POKA 5IO2A 2C4JA 4FYBA 1B4QA 5EY6A 1FHEA 3IA1A 2DSAA 3KJYA 2K6VA 3GKNA 3QOUA 3DIEA 2WFCA 2PVOC 4L0UA 2VCTA 2WGRA 4PNFA 2VCWA 1TRVA 4GF0A 4O7HA 2VCZA 3KZQA 4XCSA 5ECPB 1ERVA 2VD0A 2V1MA 2H6ZA 1OKTA 4POMA 11GSA 2WS2A 3GL5A 3MAKA 7GSSA 1GNEA 6GSVA 4PQ1A 2HXKA 1M2DA 2YJ7A 3A2XA 2H8LA 2B6MA 4PX1A 1GSQA 1IYIA 5ECMB 1G6YA 5CRDA 2DJ1A 2L4CA 1TK5B 1GUMA 4GCIA 4TXVA 5DALB 3M8NA 1JZOA 2KP1A 4G0KA 3M3MA 3H1NA 2NBSA 2M72A 1EOHA 2FA8A 2F3MA 5J3RA 3NOFA 1G7OA 1RW1A 3TOUA 3TJGA 2I4AA 1A0RP 4E8HA 3GKKA 2CA8A 2VCXA 2JSZA 4E8EA 4X1UA 3KP9A 2FGXA 3L0HA 2VLTA 4PURA 1SKRB 1TI3A 3GRXA 4IKHA 1YDKA 3GIXA 3VK9A 2FD3A 1PN0A 1EEJA 1GTBA 1XWKA 2XPEA 2VAFA 2CAQA 5IPGA 4K7OA 3IBHA 1F9MA 1GUKA 3RHCA 2H1BA 2IWTA 3KXOA 1LU4A 4K6XA 3UL3A 4G0IA 4CDOA 3TDGA 4LMWA 5D96A 3GYKA 2KHPA 2N5FA 2YV9A 4G2EA 1TOFA 1E2YA 5HFKA 1WPIA 1BJXA 2CX3A 5DQSA 2QA1A 1TU7A 1WWJA 2H6XA 2V41A 3BD2A 1XW5A 2HSYA 3KP8A 2C80A 3ZYWA 3QDNA 1F3BA 1ABAA 3GHAA 1CQHA 2DMLA 1PX7A 2L59A 5COHA 1WE0A 2C3TA 4OMVA 1PX6A 2DC5A 2QKEA 1FOVA 2K8VA 3PGTA 4ML1A 1O8XA 5HR3A 1SL1B 3L4NA 3UBLA 4IELA 5DDLA 3D6IA 3IAS2 5A4WA 1FAAA 1PRXA 1N8JA 5CRGA 2G0FA 1ZOFA 2P5RA 2F8FA 2YWNA 2B5XA 3GTUB 2I9HA 5ECOB 2H74A 2OKAA 3HZ4A 4GQCA 3ZTLA 3ZIJA 3ME8A 1ERWA 3I69A 4NV2A 1K3YA 1EEMA 4JEDA 5IO0A 5DJLA 5KN0A 1M3JA 5IMCA 5C04A 2RUFA 3FK8A 2N5BA 3CBUA 3WGXA 2WZ9A 4MH2A 4BVXB 5IMZA 5D8IA 4I2UA 1B9XC 3UEMA 1RK4A 2R6KA 3FZAA 2MBSA 4IHUA 4Z2UA 4MJBA 3ISOA 4I8BA 2DIYA 3PR8A 3GMFA 2GDRA 3P7XA 1V57A 2H1AA 4YKFA 2P5QA 3QAWA 3WGEA 2JU5A 4J2FA 3H93A 4BIKA 1QUWA 2YWMA 4V2NA 4KCAA 2GTUA 1W4VA 1HNCA 5GAPD 4I5QA 4K0NA 1QXHA 1TW9A 3A3TA 3KEBA 16GSA 4HUAA 1YQ1A 1FB6A 4TW5A 1M3IA 1TDIA 4HJMA 4HZ4A 1GSUA 4YH2A 2YV7A 1PQNA 4JRRA 3F9UA 3VI5A 3TJBA 4MA9A 4I6XA 4Z2RA 4YAVA 1V98A 1O73A 1VF3A 2PERA 3ZZXA 4GLTA 1V58A 4O5QA 2C8UA 1M0UA 1XWGA 2AYTA 3MNGA 4ECCA 5JCWA 3IK9A 5FWGA 2HSHA 2TIRA 4I97A 4A5PA 3PH9A 2BMXA 1ON4A 1THOA 1GSYA 3VPTA 1T4ZA 5HR0A 1M9AA 2IMIA 2K18A 1VF2A 4GSTA 3WT2A 4TXOB 4Z7XA 5F06A 3E3EA 2UZ8A 4XS4A 2QA2A 6GSXA 2CQ9A 2HZFA 4BVYB 1LBKA 3SBCA 1MDKA 3IPZA 3TRQA 2MZCA 4K5RA 3U5RE 4K8MA 2RUEA 1WRYA 17GSA 3ED3A 3F6FA 1ZMAA 2X8CA 3NIVA 2VCVA 4USSA 1Z7PA 3F0IA 4RI6A 4MJAA 3DEXA 2H0HA 1EGRA 4ZL8A 4IQAA 3KMNA 2NDOA 4KDXA 2H73A 4WEYA 4EF0A 3JCML 4JBBA 2IFQA 3P90A 2AV4A 4YQVA 3TB2A 1Y6EA 2IMDA 4X43A 4KDYA 1EOGA 4BL7A 4DSSA 4K1FA 5ID2A 1R4WA 4IS0A 1K3OA 2GLRA 2HRAA 4XS1A 3W8SA 5CO3A 2LUSA 1QK8A 1HQOA 4IQ1A 3E0UA 3ERWA 2OE0A 2A4HA 5CREA 1T3BA 3M9JA 4YAPA 3IE3A 5G31A 3TCOA 3HJOA 2H30A 1ZL9A 3S9FA 1GTAA 2GSQA 1A8LA 4AJ7A 2J23A 1A8YA 2MMAA 2F9SA 2GT5A 4TR1B 1NSWA 4MZCA 4Q5RA 1QGVA 1DUGA 4NV5A 2YJHA 4O32A 5GAND 1ZYEA 3IXRA 3LXTA 2CT6A 2LKUA 5D9TA 5DAKB 2A2SA 4ZB8A 2FCHA 3FR3A 4MCUA 2REMA 3FZ9A 4Z2TA 3IR4A 2EIRA 1MEKA 1F37A 5F05A 1ZYPA 3HXSA 5EVOA 3M1GA 5IMDA 4GTUA 2A2PA 4HDEA 4L5LA 1XWCA 3EVIA 3LJRA 3LORA 2XC2A 1ZYNA 4EL1A 5KOXA 1O85A 1X5DA 3IV4A 1BEDA 3GURA 3QFBC 4XTSA 2YN1A 4YQMA 2HZEA 1DE1A 2H70A 1EZKA 3HVVA 2KP2A 1JFUA 1SK2A 4QL7A 2FWGA 4LLRA 4TRXA 2DJ0A 2LRNA 4J56E 1S3CA 1V2AA 4HS1A 2BTOT 1B48A 2XHFA 2RLIA 3F63A 20GSA 2VLVA 2HE3A 2NTOA 5G5EA 4MZBA 1S3AA 1VGLA 1XXUA 2EIOA 3US3A 1K0DA 4OFTA 3A5IA 2R0PA 4DSQA 3KTBA 3TJKA 5ENUA 3KMOA 4NWYA 3F4TA 3BJ5A 1XBSA 3TKSC 4K7NA 1UVZA 4NAXA 3I9V2 2VOCA 3KD0A 1BAYA 3ERFA 5DQYA 3APSA 3GH9A 13GSA 5AGYA 2CVDA 3VLNA 1Z3EA 1T8EB 1U88A 3P2AA 6GSTA 3C7MA 1XVWA 3BCKA 3LYKA 4P3YB 2VIMA 1OC9A 4DSRA 3EE2A 1EV9A 3FEUA 1NM3A 1Y25A 1I9DA 3CRUA 4ZBBA 4LA1A 2HT9A 1YY7A 3G9BA 4KDUA 4KNDA 3K8NA 4HOJA 3WT1A 3ZLPA 3J7Yk 1GP1A 1SK1A 4ML6A 4KF9A 3QFAC 2QGVA 3R2QA 1M99A 2L6DA 1ZYQB 3IDVA 3APOA 3FMWA 4YQUA 1Q98A 2XBQA 3G7JA 2VL2C 4GXZA 3FY7A 4ZBAA 3ZRDA 2HSMA 4PGTA 3UARA 4KX4A 3G7YA 3GKXA 2IL3A 4OCEA 3MDKA 2VL3A 5D93A 2VL9A 4ISDA 3UBKA 1WOUA 1TKDB 4HI7A 1U6TA 4LMVA 3O76A 2LTKA 3CYNA 1TRSA 3GSSA 4BA7A 1A0FA 3FKFA 2DJJA 4OD7A 5CRWA 3EU4A 5ECRB 3ZFBA 4XHMA 3HJMA 1FVJA 3GX8A 1A2MA 4MH3A 14GSA 3KH9A 4WKWA 4HU9A 1OAZA 2AHEA 2XBIA 3BCIA 4G19A 4ECIA 4TKYA 2I3YA 4EXJA 3HVNA 4KSOA 1VRSD 1ACVA 3QCPA 2F51A 2GGTA 2R0CA 5H5RA 5IQYA 1K0BA 3RHBA 4ZXGA 4XS6A 2YWOA 5H5QA 1KTEA 1B8XA 1ERUA 4MPGA 1HNBA 2VM2A 2FNOA 2FUG2 1A24A 1J08A 4D73B 9GSSA 3EWLA 3GNJA 2D2ZA 1SL0B 2NPBA 1XOBA 1W89A 1C72A 2OBIA 3RPPA 2C0GA 3I6AA 1OVNA 3LG6A 2JSYA 3TUEA 3RDWA 1SYRA 4IVFA 1EGOA 4N0VA 2BJXA 1JHBA 4N30A 4K7IA 1J9BA 2QC7A 4IJIA 3HVXA 3EYTA 4RQRA 1SD9A 5G2ZA 1PKWA 1ZZYA 5EPFA 1I5GA 2C0DA 4F0CA 3U6VA 4HJ2A 5AIXA 3F3QA 3CMIA 1KEBA 1JZRA 1HNAA 3H8QA 1TRUA 2H1DA 22GSA 2MMZA 3GUSA 3IAM2 3UIWA 3D4MA 2HRNA 4EE0A 4GSSA 3APQA 1XIYA 1XZOA 3D21A 5C00A 3IRAA 4V1Ap 2J9HA 4OFMA 2X64A 4IJ3A 6GSWA 2C0FA 3FW2A 4N11A 3WYWA 1M2BA 5HR1A 1K0CA 1VF4A 3EMPA 1QQ2A 4JR4A 2JZSA 1URMA 3F3RA 6GSUA 5L71A 3F4SA 1GSSA 3ZL5A 2H71A 3CSHA 4ECBA 3RPNA 3F4RA 3SWLA 2B1KA 1B4PA 1N2AA 3O6TA 4KH7A
chains in the Genus database with same CATH topology
3LWAA 2WCIA 4DEJA 3UJ1A 1G6WA 3ZFLA 5DALA 1AIUA 3IC8A 1DBYA 2VO4A 3D4TA 3C8EA 3W8JA 5KN2A 3LW9A 3EU3A 4ECJA 2GQMA 1G7EA 3D5JA 1U3AA 3RBTA 4IW9A 2C1YA 3D22A 5D73A 10GSA 2JZTA 5F0GA 1UA5A 4G0LA 2M46A 4TR4A 3EMXA 4KW6A 1MD3A 3Q6OA 2I81A 2MMNA 1MD4A 2RIIA 5ECQB 3FZ5A 2B5YA 5J41A 3C71A 3GL3A 1Z7RA 1TP9A 3IK7A 2HYXA 5FHIA 3F8UA 3TKPA 1Z6MA 2OE3A 2VUPA 1PSQA 3KTLA 3TJJA 3HD5A 4PXOA 5IIZA 1OE8A 4AJ8A 1R5PA 1SKSB 1OC8A 1XOAA 4KGIA 5HFIA 2PGTA 4O5RA 1EP7A 4JE1A 4CW9A 1X9MB 1OE7A 2OACA 2P31A 2YCDA 3EINA 3IHQA 5CRHA 1ST9A 2O8VB 4FH8A 4WXTA 3GA4A 2E0QA 4FIWA 4WBJA 4EO3A 4IGJA 4K2XA 1F2EA 2HFDA 2PPTA 2EIQA 2X8HA 2V6OA 3ZMKA 4MF7A 2FLSA 2YPMA 1AQXA 4KSMA 2X99A 1JLWA 5ELAA 2DLXA 3VFIA 2QSIA 4X4JA 3ERGA 1QFNA 2PMTA 2OBKA 2PBJA 3M0FA 1SJ6A 2AJQB 1A2LA 2F8AA 1BX9A 3GTUA 1USBA 5LCZA 2GS3A 4OO4A 1FVKA 12GSA 1K3LA 4EDZA 2JZRA 1X5CA 2AAWA 1YEPA 3L9VA 2C0EA 5B8AA 2E2GA 3A2WA 1E6BA 5CNWA 1TTZA 1K0MA 2B5EA 1M9BA 1GH2A 1S3DA 2X4AA 4ZBDA 2X49A 4F03A 4HQZA 4YKGA 2DJ2A 4BVXA 1T7PB 2L5LA 3N9JA 2LQQA 5JCUA 1PGTA 1OKDA 4WF4A 4KCEA 2PU9C 3QD9A 2N5AA 4GWRA 1NW2A 5DVBA 5IOWA 3KGKA 1SD8A 2H1GA 2CVBA 2KOKA 5JWQB 4TN8A 1SK0A 5ECLB 2LV3A 1SU9A 4GQFA 5KN3A 3QAVA 3GH6A 2R37A 4POBA 4MP4A 2O89A 2ON7A 3HA9A 2O7KA 3VWXA 5BRTA 4PUAA 5GZZB 2LJKA 1KBNA 2V6KA 2VD1A 4I2TA 1SJIA 2HRKA 8GSSA 3HCZA 4CY6A 2B1LA 2WRTA 1K0AA 5ECKB 5J4UA 2LNTA 3MIXA 3LEFA 4F9ZA 3QPMA 1XWAA 3TOTA 4AGSA 2PN8A 5F07A 4RQXA 2GQKA 5BMUA 2AB6A 4EKZA 2B7JA 4ZL9A 4EDYA 19GSA 2DMMA 1TJDA 1H75A 3PPUA 2VCQA 3HJPA 4ZB6A 4JU5A 4NHWA 4BWQA 3CTFA 2H76A 4KAEA 5EL8A 4HU7A 1DE2A 3DMLA 2LNSA 3GFKA 4KB3A 5LNKe 2ES7A 1YEXA 1SKWB 3VWVA 3DXBA 1YF0A 5KOWA 4TXOA 2GT6A 5A5KA 5DBQA 2PVQA 4PUFC 2YNXA 1LJRA 4BVYA 4EIPA 3LQ7A 4FQUA 3QMXA 1X0RA 4G10A 1H4OA 4XIHA 1X9WB 1AAZA 2GZYA 3TRXA 4ULXA 1U3IA 4Q5FA 4F2IA 4HEA2 4V1Ag 1Z5YE 1FW1A 1AQWA 3QR6A 3GKMA 4OWYA 2YOIA 1ZCPA 2G2QA 5IMFA 3L78A 4N10A 5G5FA 5ECIB 3FR6A 3WGDA 1GLQA 2WDUA 2C3NA 4GSNA 4GRFA 2JL4A 1GNWA 1J0FA 2AUVA 2VM1A 3D0ZA 2OADA 2LRCA 1TXXA 2DJKA 2DKHA 1WP0A 2YP6A 4EIQA 5B8BA 3DKSA 3KM6A 3FZ4A 2IMFA 3Q19A 4ACSA 2L6CA 5GSSA 5ECHB 1O81A 5CP1A 5J9CA 4K0GA 3L9UA 5D9XA 2MMOA 3GV1A 3TJFA 3KH7A 1U87A 3GX0A 3ZVJD 1PD21 1GL8A 5B6NA 3IC4A 4AF2A 2R4VA 4WBRD 3ZITA 1R26A 2P0GA 4MPFA 4TR1A 3HKRA 2ZUPA 2JADA 1PL1A 3A5WA 3IOSA 2ALBA 1SENA 1NHOA 5B6MA 4FYCA 4TR0A 5HFGA 1K0OA 2L4QA 5DAKA 2IMKA 1HD2A 4AJ6A 2ZCTA 1FOHA 1PN9A 4NMUA 1AXDA 1T1VA 4TOPA 3DVWA 1FG4A 4PQIA 1GWCA 2HLSA 2TRXA 2A4VA 2MBTA 5D9VA 2GSRA 5ECNB 4O92A 2E2MA 2H01A 3FR9A 4F0BA 2NVLA 2OA7A 5LD0A 4MZWA 1V9WA 4K9ZA 4EVMA 3C1RA 4JZQA 4NPBA 5G1LA 1ML6A 5D9WA 1R7HA 5J9BA 3ME7A 4MNNA 3H4KA 3ZMLA 4ZIJA 1PA3A 1NHYA 4V2MA 4NXIA 3M9KA 3LXZA 5IPHA 2IN3A 4LL4B 4ZILA 1PKZA 2YANA 2B7KA 2HI7A 5HQPA 2FWEA 2LEGA 1GSFA 5B7CA 6GSSA 4XS4B 2IJYA 1X9SB 5F8BA 3HY2A 3FYGA 3QAGA 2LJAA 2B3SA 4WF5A 2H19A 5GSTA 2H72A 3N5OA 2V2GA 2H0GA 2CV4A 4BWSA 2O85A 1Q4JA 4XRAA 1TI1A 3W6GA 4ID0A 1HYUA 4F82A 1A23A 4DVCA 3VWWA 1JZDA 1PL2A 3VPQA 1XCCA 2R2JA 2WJUA 1Z6NA 3DGQA 2IFQB 2HRFA 4FYUA 2FWHA 3KCMA 2KLXA 3O3TA 2ZNMA 3TKQA 2CZ2A 3R3EA 4BL7B 3HYPA 2GVPA 1YKCA 4DSSB 5ID2B 3PINA 1OYJA 3GSTA 5E4WA 5AIVA 1BYEA 4N0ZA 5E59A 2DIZA 2K8SA 5ELGA 3TKSE 2L57A 2L5OA 2YZUA 2GZZA 3AY8A 4MF5A 4MK3A 1M7TA 4RI7A 5AISA 3H79A 3TKRA 2WULA 2YZHA 3EC3A 1SYXA 4X0XA 1FB0A 1MDJA 3C73A 1TRWA 2MYGA 2IIYA 1GLPA 2X8GA 4ICYA 3ZIVA 3DD3A 4MJCA 2FHEA 4TR3A 2LRTA 1YZXA 3CXGA 5IOXA 4PNGA 1RQMA 3DYRA 3MSZA 4L5OA 4IN0A 5KN1A 1AUCA 1PMTA 2FWFA 1ILOA 1QMVA 1XW6A 3G7IA 3J7Yb 2CX4A 2KUCA 3DRNA 3HHVA 1Z9HA 2OE1A 1WJKA 4L0WA 3ZREA 2CZ3A 1JZWA 1F6MC 1M2AA 3LSZA 4PTSA 5HR2A 1GUHA 1EP8A 1T4YA 4D73A 3I43A 4MDCA 3BOAA 3UAPA 1FO5A 2HZEB 3TKSA 4NHZA 2C3QA 3A2VA 1GRXA 3EURA 2TRCP 1YJ6A 4OFNA 4PQHA 4MABA 5J5NA 1TK0B 3CRTA 4ZB9A 3MYDA 4MLYA 1GTIA 5JCGA 2GZPA 2H66A 3FHKA 4CHSA 4XRDA 3TRPA 2PWJA 5IMAA 2JACA 2ON5A 1XPVA 4HZ2A 5ABRA 4BPYA 5A4VA 1GULA 1UN2A 5CYYA 5FT3A 2WB9A 5DJMA 3UMAA 3CSJA 4H86A 2O87A 3HDCA 1XFLA 4Q5QA 4Q5NA 1ZGNA 2V32A 3OR5A 4WR4A 3E9JB 4WETA 3VURA 1EWXA 4ILFA 1GSDA 4CY8A 1OC9B 5JWRB 4MMMA 4K5SA 1ERTA 2GQLA 18GSA 2DKIA 1B9YC 1CQGA 2LQOA 1THXA 1WIKA 2H6YA 1UC7A 1T00A 4KE3A 2VL2A 2HNLA 2XPDA 3UVTA 1IYHA 3BBYA 4MF6A 4QL9A 2YWIA 3IHGA 1O7UA 2PUKC 4LL1B 3MWHA 5A4UA 1A2JA 1F3AA 2K9FA 4WR5A 4OCFA 3CSIA 2IMEA 1G0TA 3DWVA 5INYA 4QQ7A 5IMVA 1EV4A 2E7PA 3Q18A 3RAZA 1TU8A 2EC4A 2LS5A 1BG5A 3TGZA 2CVKA 3F6DA 2H75A 4TVEA 2FY6A 1O6JA 4FO5A 5G30A 3LYPA 2LJRA 5G1KA 4G9HA 4OO5A 1R5AA 1WMJA 2DJ3A 4JR6A 4J57E 3FRCA 2DBCA 1OC3A 5AN1A 4EC0A 4KUNA 4RUVA 2CAIA 3LFLA 3LGCA 3HVSA 3GN3A 2Z9SA 1MDIA 2R0GA 4O5UA 1TK8B 1XVQA 3VWUA 2I1UA 3V1WA 2GSTA 1K0NA 1AQVA 3UOMA 2LSTA 2A2RA 5DCGA 3ZVJA 1YKAA 1XW9A 1GTUA 2RM6A 1SL2B 1X5EA 5H5SA 5IM9A 3VI7A 1XWBA 3UVHA 2GSSA 1MTCA 5KEJA 2FA4A 2VLUA 4IP6A 3WD6A 3P8WA 4ZL7A 1BQ7A 1SJZA 2RM5A 1KNGA 1AC1A 2OJLA 1GSEA 1O8WA 6GSYA 3C1SA 1DSBA 1V40A 1AW9A 4L8EA 2R3XA 4POLA 2R5GA 3EPTA 4IBPA 2M80A 3L9SA 4KA0A 4V2LA 5CAXA 2IPAA 5ECSA 4MJEA 1JLVA 4K2DA 4EUYA 2H0IA 3Q74A 5JWOB 4IP1A 3KIJA 3CTGA 3DVXA 5DCHA 3HZ8A 4HQSA 1YF1A 1VF1A 3NZNA 4POKA 5IO2A 2C4JA 4FYBA 1B4QA 5EY6A 1FHEA 3IA1A 2DSAA 3KJYA 2K6VA 3GKNA 3QOUA 3DIEA 2WFCA 2PVOC 4L0UA 2VCTA 2WGRA 4PNFA 2VCWA 1TRVA 4GF0A 4O7HA 2VCZA 3KZQA 4XCSA 5ECPB 1ERVA 2VD0A 2V1MA 2H6ZA 1OKTA 4POMA 11GSA 2WS2A 3GL5A 3MAKA 7GSSA 1GNEA 6GSVA 4PQ1A 2HXKA 1M2DA 2YJ7A 3A2XA 2H8LA 2B6MA 4PX1A 1GSQA 1IYIA 5ECMB 1G6YA 5CRDA 2DJ1A 2L4CA 1TK5B 1GUMA 4GCIA 4TXVA 5DALB 3M8NA 1JZOA 2KP1A 4G0KA 3M3MA 3H1NA 2NBSA 2M72A 1EOHA 2FA8A 2F3MA 5J3RA 3NOFA 1G7OA 1RW1A 3TOUA 3TJGA 2I4AA 1A0RP 4E8HA 3GKKA 2CA8A 2VCXA 2JSZA 4E8EA 4X1UA 3KP9A 2FGXA 3L0HA 2VLTA 4PURA 1SKRB 1TI3A 3GRXA 4IKHA 1YDKA 3GIXA 3VK9A 2FD3A 1PN0A 1EEJA 1GTBA 1XWKA 2XPEA 2VAFA 2CAQA 5IPGA 4K7OA 3IBHA 1F9MA 1GUKA 3RHCA 2H1BA 2IWTA 3KXOA 1LU4A 4K6XA 3UL3A 4G0IA 4CDOA 3TDGA 4LMWA 5D96A 3GYKA 2KHPA 2N5FA 2YV9A 4G2EA 1TOFA 1E2YA 5HFKA 1WPIA 1BJXA 2CX3A 5DQSA 2QA1A 1TU7A 1WWJA 2H6XA 2V41A 3BD2A 1XW5A 2HSYA 3KP8A 2C80A 3ZYWA 3QDNA 1F3BA 1ABAA 3GHAA 1CQHA 2DMLA 1PX7A 2L59A 5COHA 1WE0A 2C3TA 4OMVA 1PX6A 2DC5A 2QKEA 1FOVA 2K8VA 3PGTA 4ML1A 1O8XA 5HR3A 1SL1B 3L4NA 3UBLA 4IELA 5DDLA 3D6IA 3IAS2 5A4WA 1FAAA 1PRXA 1N8JA 5CRGA 2G0FA 1ZOFA 2P5RA 2F8FA 2YWNA 2B5XA 3GTUB 2I9HA 5ECOB 2H74A 2OKAA 3HZ4A 4GQCA 3ZTLA 3ZIJA 3ME8A 1ERWA 3I69A 4NV2A 1K3YA 1EEMA 4JEDA 5IO0A 5DJLA 5KN0A 5IMCA 5C04A 2RUFA 3FK8A 2N5BA 3CBUA 3WGXA 2WZ9A 4MH2A 4BVXB 5IMZA 5D8IA 4I2UA 1B9XC 3UEMA 1RK4A 2R6KA 3FZAA 2MBSA 4IHUA 4Z2UA 4MJBA 3ISOA 4I8BA 2DIYA 3PR8A 3GMFA 2GDRA 3P7XA 1V57A 2H1AA 4YKFA 2P5QA 3QAWA 3WGEA 2JU5A 4J2FA 3H93A 1QUWA 2YWMA 4V2NA 4KCAA 2GTUA 1W4VA 1HNCA 5GAPD 4I5QA 4K0NA 1QXHA 1TW9A 3A3TA 3KEBA 16GSA 4HUAA 1YQ1A 1FB6A 4TW5A 1TDIA 4HJMA 4HZ4A 1GSUA 4YH2A 2YV7A 1PQNA 4JRRA 3F9UA 3VI5A 3TJBA 4MA9A 4I6XA 4Z2RA 4YAVA 1V98A 1O73A 1VF3A 2PERA 3ZZXA 4GLTA 1V58A 4O5QA 2C8UA 1M0UA 1XWGA 2AYTA 3MNGA 4ECCA 5JCWA 3IK9A 5FWGA 2HSHA 2TIRA 4I97A 4A5PA 3PH9A 2BMXA 1ON4A 1THOA 1GSYA 3VPTA 1T4ZA 5HR0A 1M9AA 2IMIA 2K18A 1VF2A 4GSTA 3WT2A 4TXOB 4Z7XA 5F06A 3E3EA 2UZ8A 4XS4A 2QA2A 6GSXA 2CQ9A 2HZFA 4BVYB 1LBKA 3SBCA 1MDKA 3IPZA 3TRQA 2MZCA 4K5RA 3U5RE 4K8MA 2RUEA 1WRYA 17GSA 3ED3A 3F6FA 1ZMAA 2X8CA 3NIVA 2VCVA 4USSA 1Z7PA 3F0IA 4RI6A 4MJAA 3DEXA 2H0HA 1EGRA 4ZL8A 4IQAA 3KMNA 2NDOA 4KDXA 2H73A 4WEYA 4EF0A 3JCML 4JBBA 2IFQA 3P90A 2AV4A 4YQVA 3TB2A 1Y6EA 2IMDA 4X43A 4KDYA 1EOGA 4BL7A 4DSSA 4K1FA 5ID2A 1R4WA 4IS0A 1K3OA 2GLRA 2HRAA 4XS1A 3W8SA 5CO3A 2LUSA 1QK8A 1HQOA 4IQ1A 3E0UA 3ERWA 2OE0A 2A4HA 5CREA 1T3BA 3M9JA 4YAPA 3IE3A 5G31A 3TCOA 3HJOA 2H30A 1ZL9A 3S9FA 1GTAA 2GSQA 1A8LA 4AJ7A 2J23A 1A8YA 2MMAA 2F9SA 2GT5A 4TR1B 1NSWA 4MZCA 4Q5RA 1QGVA 1DUGA 4NV5A 2YJHA 4O32A 5GAND 1ZYEA 3IXRA 3LXTA 2CT6A 2LKUA 5D9TA 5DAKB 2A2SA 4ZB8A 2FCHA 3FR3A 4MCUA 2REMA 3FZ9A 4Z2TA 3IR4A 2EIRA 1MEKA 1F37A 5F05A 1ZYPA 3HXSA 5EVOA 3M1GA 5IMDA 4GTUA 2A2PA 4HDEA 4L5LA 1XWCA 3EVIA 3LJRA 3LORA 2XC2A 1ZYNA 4EL1A 5KOXA 1O85A 1X5DA 3IV4A 1BEDA 3GURA 3QFBC 4XTSA 2YN1A 4YQMA 2HZEA 1DE1A 2H70A 1EZKA 3HVVA 2KP2A 1JFUA 1SK2A 4QL7A 2FWGA 4LLRA 4TRXA 2DJ0A 2LRNA 4J56E 1S3CA 1V2AA 4HS1A 2BTOT 1B48A 2XHFA 2RLIA 3F63A 20GSA 2VLVA 2HE3A 2NTOA 5G5EA 4MZBA 1S3AA 1VGLA 1XXUA 2EIOA 3US3A 1K0DA 4OFTA 3A5IA 2R0PA 4DSQA 3KTBA 3TJKA 5ENUA 3KMOA 4NWYA 3F4TA 3BJ5A 1XBSA 3TKSC 4K7NA 1UVZA 4NAXA 3I9V2 2VOCA 3KD0A 1BAYA 3ERFA 5DQYA 3APSA 3GH9A 13GSA 5AGYA 2CVDA 3VLNA 1Z3EA 1T8EB 1U88A 3P2AA 6GSTA 3C7MA 1XVWA 3BCKA 3LYKA 4P3YB 2VIMA 1OC9A 4DSRA 3EE2A 1EV9A 3FEUA 1NM3A 1Y25A 1I9DA 3CRUA 4ZBBA 4LA1A 2HT9A 1YY7A 3G9BA 4KDUA 4KNDA 3K8NA 4HOJA 3WT1A 3ZLPA 3J7Yk 1GP1A 1SK1A 4ML6A 4KF9A 3QFAC 2QGVA 3R2QA 1M99A 2L6DA 1ZYQB 3IDVA 3APOA 3FMWA 4YQUA 1Q98A 2XBQA 3G7JA 2VL2C 4GXZA 3FY7A 4ZBAA 3ZRDA 2HSMA 4PGTA 3UARA 4KX4A 3G7YA 3GKXA 2IL3A 4OCEA 3MDKA 2VL3A 5D93A 2VL9A 4ISDA 3UBKA 1WOUA 1TKDB 4HI7A 1U6TA 4LMVA 3O76A 2LTKA 3CYNA 1TRSA 3GSSA 4BA7A 1A0FA 3FKFA 2DJJA 4OD7A 5CRWA 3EU4A 5ECRB 3ZFBA 4XHMA 3HJMA 1FVJA 3GX8A 1A2MA 4MH3A 14GSA 3KH9A 4WKWA 4HU9A 1OAZA 2AHEA 2XBIA 3BCIA 4G19A 4ECIA 4TKYA 2I3YA 4EXJA 4KSOA 1VRSD 1ACVA 3QCPA 2F51A 2GGTA 2R0CA 5H5RA 5IQYA 1K0BA 3RHBA 4ZXGA 4XS6A 2YWOA 5H5QA 1KTEA 1B8XA 1ERUA 4MPGA 1HNBA 2VM2A 2FNOA 2FUG2 1A24A 1J08A 4D73B 9GSSA 3EWLA 3GNJA 2D2ZA 1SL0B 2NPBA 1XOBA 1W89A 1C72A 2OBIA 3RPPA 2C0GA 3I6AA 1OVNA 3LG6A 2JSYA 3TUEA 3RDWA 1SYRA 4IVFA 1EGOA 4N0VA 2BJXA 1JHBA 4N30A 4K7IA 1J9BA 2QC7A 4IJIA 3HVXA 3EYTA 4RQRA 1SD9A 5G2ZA 1PKWA 1ZZYA 5EPFA 1I5GA 2C0DA 4F0CA 3U6VA 4HJ2A 5AIXA 3F3QA 3CMIA 1KEBA 1JZRA 1HNAA 3H8QA 1TRUA 2H1DA 22GSA 2MMZA 3GUSA 3IAM2 3UIWA 3D4MA 2HRNA 4EE0A 4GSSA 3APQA 1XIYA 1XZOA 3D21A 5C00A 3IRAA 4V1Ap 2J9HA 4OFMA 2X64A 4IJ3A 6GSWA 2C0FA 3FW2A 4N11A 3WYWA 1M2BA 5HR1A 1K0CA 1VF4A 3EMPA 1QQ2A 4JR4A 2JZSA 1URMA 3F3RA 6GSUA 5L71A 3F4SA 1GSSA 3ZL5A 2H71A 3CSHA 4ECBA 3RPNA 3F4RA 3SWLA 2B1KA 1B4PA 1N2AA 3O6TA 4KH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWA A;  2WCI A;  4DEJ A;  3UJ1 A;  1G6W A;  3ZFL A;  5DAL A;  1AIU A;  1DBY A;  2VO4 A;  3D4T A;  3C8E A;  3W8J A;  5KN2 A;  3EU3 A;  4ECJ A;  2GQM A;  1G7E A;  3D5J A;  1U3A A;  3RBT A;  4IW9 A;  2C1Y A;  3D22 A;  5D73 A;  10GS A;  2JZT A;  5F0G A;  1UA5 A;  2M46 A;  4TR4 A;  3EMX A;  4KW6 A;  1MD3 A;  3Q6O A;  2I81 A;  2MMN A;  1MD4 A;  2RII A;  5ECQ B;  3FZ5 A;  2B5Y A;  5J41 A;  3C71 A;  3GL3 A;  1Z7R A;  1TP9 A;  3IK7 A;  2HYX A;  5FHI A;  3F8U A;  3TKP A;  1Z6M A;  2OE3 A;  2VUP A;  1PSQ A;  3KTL A;  3TJJ A;  3HD5 A;  4PXO A;  5IIZ A;  1OE8 A;  4AJ8 A;  1R5P A;  1SKS B;  1OC8 A;  1XOA A;  4KGI A;  5HFI A;  2PGT A;  4O5R A;  1EP7 A;  4JE1 A;  4CW9 A;  1X9M B;  1OE7 A;  2OAC A;  2P31 A;  2YCD A;  3EIN A;  3IHQ A;  5CRH A;  1ST9 A;  2O8V B;  4FH8 A;  4WXT A;  3GA4 A;  2E0Q A;  4FIW A;  4WBJ A;  4EO3 A;  4IGJ A;  1F2E A;  2HFD A;  2PPT A;  2EIQ A;  2X8H A;  2V6O A;  3ZMK A;  4MF7 A;  2FLS A;  2YPM A;  1AQX A;  4KSM A;  2X99 A;  1JLW A;  5ELA A;  2DLX A;  3VFI A;  2QSI A;  3ERG A;  1QFN A;  2PMT A;  2OBK A;  2PBJ A;  3M0F A;  1SJ6 A;  2AJQ B;  1A2L A;  2F8A A;  1BX9 A;  3GTU A;  1USB A;  5LCZ A;  2GS3 A;  4OO4 A;  1FVK A;  12GS A;  1K3L A;  4EDZ A;  2JZR A;  1X5C A;  2AAW A;  1YEP A;  3L9V A;  2C0E A;  5B8A A;  2E2G A;  3A2W A;  1E6B A;  5CNW A;  1TTZ A;  1K0M A;  2B5E A;  1M9B A;  1GH2 A;  1S3D A;  4ZBD A;  4F03 A;  4HQZ A;  2DJ2 A;  4BVX A;  1T7P B;  2L5L A;  3N9J A;  2LQQ A;  5JCU A;  1PGT A;  1OKD A;  4WF4 A;  4KCE A;  2PU9 C;  3QD9 A;  2N5A A;  4GWR A;  1NW2 A;  5DVB A;  5IOW A;  3KGK A;  1SD8 A;  2H1G A;  2CVB A;  2KOK A;  5JWQ B;  4TN8 A;  1SK0 A;  5ECL B;  2LV3 A;  1SU9 A;  4GQF A;  5KN3 A;  3QAV A;  3GH6 A;  2R37 A;  4POB A;  4MP4 A;  2O89 A;  2ON7 A;  3HA9 A;  2O7K A;  3VWX A;  4PUA A;  5GZZ B;  2LJK A;  1KBN A;  2V6K A;  2VD1 A;  4I2T A;  1SJI A;  8GSS A;  3HCZ A;  2B1L A;  2WRT A;  1K0A A;  5ECK B;  5J4U A;  2LNT A;  3LEF A;  4F9Z A;  3QPM A;  1XWA A;  3TOT A;  4AGS A;  2PN8 A;  5F07 A;  4RQX A;  2GQK A;  2AB6 A;  4EKZ A;  2B7J A;  4ZL9 A;  4EDY A;  19GS A;  2DMM A;  1TJD A;  1H75 A;  2VCQ A;  3HJP A;  4ZB6 A;  4JU5 A;  4NHW A;  4BWQ A;  3CTF A;  2H76 A;  4KAE A;  5EL8 A;  4HU7 A;  1DE2 A;  3DML A;  2LNS A;  3GFK A;  4KB3 A;  5LNK e;  2ES7 A;  1YEX A;  1SKW B;  3VWV A;  3DXB A;  1YF0 A;  4TXO A;  2GT6 A;  5A5K A;  5DBQ A;  2PVQ A;  4PUF C;  2YNX A;  1LJR A;  4BVY A;  3LQ7 A;  3QMX A;  1X0R A;  4G10 A;  1H4O A;  4XIH A;  1X9W B;  1AAZ A;  2GZY A;  3TRX A;  4ULX A;  1U3I A;  4Q5F A;  4F2I A;  4HEA 2;  4V1A g;  1Z5Y E;  1FW1 A;  1AQW A;  3QR6 A;  3GKM A;  4OWY A;  2YOI A;  1ZCP A;  2G2Q A;  5IMF A;  3L78 A;  4N10 A;  5G5F A;  5ECI B;  3FR6 A;  3WGD A;  1GLQ A;  2WDU A;  2C3N A;  4GSN A;  4GRF A;  2JL4 A;  1GNW A;  1J0F A;  2AUV A;  2VM1 A;  3D0Z A;  2OAD A;  2LRC A;  1TXX A;  2DJK A;  1WP0 A;  2YP6 A;  5B8B A;  3DKS A;  3KM6 A;  3FZ4 A;  2IMF A;  3Q19 A;  4ACS A;  2L6C A;  5GSS A;  5ECH B;  1O81 A;  5CP1 A;  5J9C A;  4K0G A;  3L9U A;  5D9X A;  2MMO A;  3GV1 A;  3TJF A;  3KH7 A;  1U87 A;  3GX0 A;  3ZVJ D;  1PD2 1;  1GL8 A;  5B6N A;  3IC4 A;  4AF2 A;  2R4V A;  4WBR D;  3ZIT A;  1R26 A;  2P0G A;  4MPF A;  4TR1 A;  3HKR A;  2ZUP A;  2JAD A;  1PL1 A;  3A5W A;  3IOS A;  2ALB A;  1SEN A;  1NHO A;  5B6M A;  4FYC A;  4TR0 A;  5HFG A;  1K0O A;  2L4Q A;  5DAK A;  2IMK A;  1HD2 A;  4AJ6 A;  2ZCT A;  1PN9 A;  4NMU A;  1AXD A;  1T1V A;  4TOP A;  3DVW A;  1FG4 A;  4PQI A;  1GWC A;  2HLS A;  2TRX A;  2A4V A;  2MBT A;  5D9V A;  2GSR A;  5ECN B;  4O92 A;  2E2M A;  2H01 A;  3FR9 A;  4F0B A;  2NVL A;  2OA7 A;  5LD0 A;  4MZW A;  1V9W A;  4K9Z A;  4EVM A;  3C1R A;  4JZQ A;  4NPB A;  5G1L A;  1ML6 A;  5D9W A;  1R7H A;  5J9B A;  3ME7 A;  3H4K A;  3ZML A;  4ZIJ A;  1PA3 A;  1NHY A;  4V2M A;  4NXI A;  3M9K A;  3LXZ A;  5IPH A;  2IN3 A;  4LL4 B;  4ZIL A;  1PKZ A;  2YAN A;  2B7K A;  2HI7 A;  5HQP A;  2FWE A;  2LEG A;  1GSF A;  5B7C A;  6GSS A;  4XS4 B;  2IJY A;  1X9S B;  5F8B A;  3HY2 A;  3FYG A;  3QAG A;  2LJA A;  2B3S A;  4WF5 A;  2H19 A;  5GST A;  2H72 A;  3N5O A;  2V2G A;  2H0G A;  2CV4 A;  4BWS A;  2O85 A;  1Q4J A;  4XRA A;  1TI1 A;  3W6G A;  4ID0 A;  1HYU A;  4F82 A;  1A23 A;  4DVC A;  3VWW A;  1JZD A;  1PL2 A;  3VPQ A;  1XCC A;  2R2J A;  2WJU A;  1Z6N A;  3DGQ A;  2IFQ B;  2HRF A;  4FYU A;  2FWH A;  3KCM A;  2KLX A;  3O3T A;  2ZNM A;  3TKQ A;  2CZ2 A;  3HYP A;  2GVP A;  1YKC A;  4DSS B;  5ID2 B;  3PIN A;  1OYJ A;  3GST A;  5E4W A;  5AIV A;  1BYE A;  4N0Z A;  5E59 A;  2DIZ A;  2K8S A;  5ELG A;  3TKS E;  2L57 A;  2L5O A;  2YZU A;  2GZZ A;  3AY8 A;  4MF5 A;  4MK3 A;  1M7T A;  4RI7 A;  5AIS A;  3H79 A;  3TKR A;  2WUL A;  2YZH A;  3EC3 A;  1SYX A;  4X0X A;  1FB0 A;  1MDJ A;  3C73 A;  1TRW A;  2MYG A;  2IIY A;  1GLP A;  2X8G A;  3ZIV A;  3DD3 A;  4MJC A;  2FHE A;  4TR3 A;  2LRT A;  1YZX A;  3CXG A;  5IOX A;  4PNG A;  1RQM A;  3DYR A;  3MSZ A;  4L5O A;  4IN0 A;  5KN1 A;  1AUC A;  1PMT A;  2FWF A;  1ILO A;  1QMV A;  1XW6 A;  3G7I A;  3J7Y b;  2CX4 A;  2KUC A;  3DRN A;  3HHV A;  1Z9H A;  2OE1 A;  1WJK A;  4L0W A;  3ZRE A;  2CZ3 A;  1JZW A;  1F6M C;  1M2A A;  3LSZ A;  5HR2 A;  1GUH A;  1EP8 A;  1T4Y A;  4D73 A;  3I43 A;  4MDC A;  3BOA A;  3UAP A;  1FO5 A;  2HZE B;  3TKS A;  4NHZ A;  2C3Q A;  3A2V A;  1GRX A;  3EUR A;  2TRC P;  1YJ6 A;  4OFN A;  4PQH A;  4MAB A;  5J5N A;  1TK0 B;  3CRT A;  4ZB9 A;  4MLY A;  5JCG A;  1GTI A;  2GZP A;  2H66 A;  3FHK A;  4CHS A;  4XRD A;  3TRP A;  2PWJ A;  5IMA A;  2JAC A;  2ON5 A;  1XPV A;  4HZ2 A;  5ABR A;  4BPY A;  5A4V A;  1GUL A;  1UN2 A;  5CYY A;  5FT3 A;  2WB9 A;  5DJM A;  3UMA A;  3CSJ A;  4H86 A;  2O87 A;  3HDC A;  1XFL A;  4Q5Q A;  4Q5N A;  1ZGN A;  2V32 A;  3OR5 A;  4WR4 A;  3E9J B;  4WET A;  3VUR A;  1EWX A;  4ILF A;  1GSD A;  1OC9 B;  5JWR B;  4MMM A;  1ERT A;  2GQL A;  18GS A;  1B9Y C;  1CQG A;  2LQO A;  1THX A;  1WIK A;  2H6Y A;  1UC7 A;  1T00 A;  4KE3 A;  2VL2 A;  2HNL A;  2XPD A;  3UVT A;  1IYH A;  3BBY A;  4MF6 A;  4QL9 A;  2YWI A;  1O7U A;  2PUK C;  4LL1 B;  3MWH A;  5A4U A;  1A2J A;  1F3A A;  2K9F A;  4WR5 A;  4OCF A;  3CSI A;  2IME A;  1G0T A;  3DWV A;  5INY A;  4QQ7 A;  5IMV A;  1EV4 A;  2E7P A;  3Q18 A;  3RAZ A;  1TU8 A;  2EC4 A;  2LS5 A;  1BG5 A;  3TGZ A;  2CVK A;  3F6D A;  2H75 A;  4TVE A;  2FY6 A;  1O6J A;  4FO5 A;  5G30 A;  3LYP A;  2LJR A;  5G1K A;  4G9H A;  4OO5 A;  1R5A A;  1WMJ A;  2DJ3 A;  4JR6 A;  4J57 E;  3FRC A;  2DBC A;  1OC3 A;  5AN1 A;  4EC0 A;  4KUN A;  4RUV A;  2CAI A;  3LFL A;  3LGC A;  3HVS A;  3GN3 A;  2Z9S A;  1MDI A;  1TK8 B;  1XVQ A;  3VWU A;  2I1U A;  3V1W A;  2GST A;  1K0N A;  1AQV A;  3UOM A;  2LST A;  2A2R A;  5DCG A;  3ZVJ A;  1YKA A;  1XW9 A;  1GTU A;  2RM6 A;  1SL2 B;  1X5E A;  5H5S A;  5IM9 A;  3VI7 A;  1XWB A;  3UVH A;  2GSS A;  1MTC A;  5KEJ A;  2FA4 A;  2VLU A;  4IP6 A;  3WD6 A;  3P8W A;  4ZL7 A;  1BQ7 A;  1SJZ A;  2RM5 A;  1KNG A;  1AC1 A;  2OJL A;  1GSE A;  1O8W A;  6GSY A;  3C1S A;  1DSB A;  1V40 A;  1AW9 A;  4L8E A;  2R3X A;  4POL A;  2R5G A;  4IBP A;  2M80 A;  3L9S A;  4KA0 A;  4V2L A;  5CAX A;  2IPA A;  5ECS A;  4MJE A;  1JLV A;  4K2D A;  4EUY A;  2H0I A;  3Q74 A;  5JWO B;  4IP1 A;  3KIJ A;  3CTG A;  3DVX A;  5DCH A;  3HZ8 A;  4HQS A;  1YF1 A;  1VF1 A;  3NZN A;  4POK A;  5IO2 A;  2C4J A;  4FYB A;  1B4Q A;  5EY6 A;  1FHE A;  3IA1 A;  2DSA A;  3KJY A;  2K6V A;  3GKN A;  3QOU A;  3DIE A;  2WFC A;  2PVO C;  4L0U A;  2VCT A;  2WGR A;  4PNF A;  2VCW A;  1TRV A;  4GF0 A;  4O7H A;  2VCZ A;  3KZQ A;  4XCS A;  5ECP B;  1ERV A;  2VD0 A;  2V1M A;  2H6Z A;  1OKT A;  4POM A;  11GS A;  2WS2 A;  3GL5 A;  3MAK A;  7GSS A;  1GNE A;  6GSV A;  4PQ1 A;  2HXK A;  1M2D A;  2YJ7 A;  3A2X A;  2H8L A;  2B6M A;  4PX1 A;  1GSQ A;  1IYI A;  5ECM B;  1G6Y A;  5CRD A;  2DJ1 A;  2L4C A;  1TK5 B;  1GUM A;  4GCI A;  4TXV A;  5DAL B;  3M8N A;  1JZO A;  2KP1 A;  3M3M A;  3H1N A;  2NBS A;  2M72 A;  1EOH A;  2FA8 A;  2F3M A;  5J3R A;  3NOF A;  1G7O A;  1RW1 A;  3TOU A;  3TJG A;  2I4A A;  1A0R P;  4E8H A;  3GKK A;  2CA8 A;  2VCX A;  2JSZ A;  4E8E A;  4X1U A;  3KP9 A;  2FGX A;  3L0H A;  2VLT A;  4PUR A;  1SKR B;  1TI3 A;  3GRX A;  4IKH A;  1YDK A;  3GIX A;  3VK9 A;  2FD3 A;  1EEJ A;  1GTB A;  1XWK A;  2XPE A;  2VAF A;  2CAQ A;  5IPG A;  4K7O A;  3IBH A;  1F9M A;  1GUK A;  3RHC A;  2H1B A;  2IWT A;  3KXO A;  1LU4 A;  4K6X A;  3UL3 A;  4CDO A;  3TDG A;  4LMW A;  5D96 A;  3GYK A;  2KHP A;  2N5F A;  2YV9 A;  4G2E A;  1TOF A;  1E2Y A;  5HFK A;  1WPI A;  1BJX A;  2CX3 A;  5DQS A;  1TU7 A;  1WWJ A;  2H6X A;  2V41 A;  3BD2 A;  1XW5 A;  2HSY A;  3KP8 A;  2C80 A;  3ZYW A;  3QDN A;  1F3B A;  1ABA A;  3GHA A;  1CQH A;  2DML A;  1PX7 A;  2L59 A;  5COH A;  1WE0 A;  2C3T A;  4OMV A;  1PX6 A;  2DC5 A;  2QKE A;  1FOV A;  2K8V A;  3PGT A;  4ML1 A;  1O8X A;  5HR3 A;  1SL1 B;  3L4N A;  3UBL A;  4IEL A;  5DDL A;  3D6I A;  3IAS 2;  5A4W A;  1FAA A;  1PRX A;  1N8J A;  5CRG A;  2G0F A;  1ZOF A;  2P5R A;  2F8F A;  2YWN A;  2B5X A;  3GTU B;  2I9H A;  5ECO B;  2H74 A;  2OKA A;  3HZ4 A;  4GQC A;  3ZTL A;  3ZIJ A;  3ME8 A;  1ERW A;  3I69 A;  4NV2 A;  1K3Y A;  1EEM A;  4JED A;  5IO0 A;  5DJL A;  5KN0 A;  5IMC A;  5C04 A;  2RUF A;  3FK8 A;  2N5B A;  3CBU A;  3WGX A;  2WZ9 A;  4MH2 A;  5IMZ A;  5D8I A;  4I2U A;  1B9X C;  3UEM A;  1RK4 A;  2R6K A;  3FZA A;  2MBS A;  4IHU A;  4MJB A;  3ISO A;  4I8B A;  2DIY A;  3PR8 A;  3GMF A;  2GDR A;  3P7X A;  1V57 A;  2H1A A;  2P5Q A;  3QAW A;  3WGE A;  2JU5 A;  4J2F A;  3H93 A;  1QUW A;  2YWM A;  4V2N A;  4KCA A;  2GTU A;  1W4V A;  1HNC A;  5GAP D;  4I5Q A;  4K0N A;  1QXH A;  1TW9 A;  3A3T A;  3KEB A;  16GS A;  4HUA A;  1YQ1 A;  1FB6 A;  4TW5 A;  1TDI A;  4HJM A;  4HZ4 A;  1GSU A;  4YH2 A;  2YV7 A;  1PQN A;  4JRR A;  3F9U A;  3VI5 A;  3TJB A;  4MA9 A;  4I6X A;  4YAV A;  1V98 A;  1O73 A;  1VF3 A;  2PER A;  3ZZX A;  4GLT A;  1V58 A;  2C8U A;  1M0U A;  1XWG A;  2AYT A;  3MNG A;  4ECC A;  5JCW A;  3IK9 A;  5FWG A;  2HSH A;  2TIR A;  4I97 A;  3PH9 A;  2BMX A;  1ON4 A;  1THO A;  1GSY A;  3VPT A;  1T4Z A;  5HR0 A;  1M9A A;  2IMI A;  2K18 A;  1VF2 A;  4GST A;  3WT2 A;  4TXO B;  4Z7X A;  5F06 A;  3E3E A;  4XS4 A;  6GSX A;  2CQ9 A;  2HZF A;  1LBK A;  3SBC A;  1MDK A;  3IPZ A;  3TRQ A;  2MZC A;  3U5R E;  4K8M A;  2RUE A;  1WRY A;  17GS A;  3ED3 A;  3F6F A;  1ZMA A;  2X8C A;  3NIV A;  2VCV A;  1Z7P A;  3F0I A;  4RI6 A;  4MJA A;  3DEX A;  2H0H A;  1EGR A;  4ZL8 A;  4IQA A;  3KMN A;  2NDO A;  4KDX A;  2H73 A;  4WEY A;  4EF0 A;  3JCM L;  4JBB A;  2IFQ A;  3P90 A;  2AV4 A;  4YQV A;  3TB2 A;  1Y6E A;  2IMD A;  4X43 A;  4KDY A;  1EOG A;  4BL7 A;  4DSS A;  4K1F A;  5ID2 A;  1R4W A;  4IS0 A;  1K3O A;  2GLR A;  4XS1 A;  3W8S A;  5CO3 A;  2LUS A;  1QK8 A;  1HQO A;  4IQ1 A;  3E0U A;  3ERW A;  2OE0 A;  5CRE A;  1T3B A;  3M9J A;  4YAP A;  3IE3 A;  5G31 A;  3TCO A;  3HJO A;  2H30 A;  1ZL9 A;  3S9F A;  1GTA A;  2GSQ A;  1A8L A;  4AJ7 A;  2J23 A;  1A8Y A;  2MMA A;  2F9S A;  2GT5 A;  4TR1 B;  1NSW A;  4MZC A;  4Q5R A;  1QGV A;  1DUG A;  4NV5 A;  2YJH A;  4O32 A;  5GAN D;  1ZYE A;  3IXR A;  3LXT A;  2CT6 A;  2LKU A;  5D9T A;  5DAK B;  2A2S A;  4ZB8 A;  2FCH A;  3FR3 A;  4MCU A;  2REM A;  3FZ9 A;  3IR4 A;  2EIR A;  1MEK A;  1F37 A;  5F05 A;  3HXS A;  5EVO A;  3M1G A;  5IMD A;  4GTU A;  4HDE A;  4L5L A;  1XWC A;  3EVI A;  3LJR A;  3LOR A;  2XC2 A;  4EL1 A;  1O85 A;  1X5D A;  3IV4 A;  1BED A;  3GUR A;  3QFB C;  4XTS A;  2YN1 A;  4YQM A;  2HZE A;  1DE1 A;  2H70 A;  1EZK A;  3HVV A;  2KP2 A;  1JFU A;  1SK2 A;  4QL7 A;  2FWG A;  4LLR A;  4TRX A;  2DJ0 A;  2LRN A;  4J56 E;  1S3C A;  1V2A A;  4HS1 A;  2BTO T;  1B48 A;  2XHF A;  2RLI A;  3F63 A;  20GS A;  2VLV A;  2HE3 A;  2NTO A;  5G5E A;  4MZB A;  1S3A A;  1VGL A;  1XXU A;  2EIO A;  3US3 A;  1K0D A;  4OFT A;  4DSQ A;  3KTB A;  3TJK A;  5ENU A;  3KMO A;  4NWY A;  3F4T A;  3BJ5 A;  1XBS A;  3TKS C;  4K7N A;  1UVZ A;  4NAX A;  3I9V 2;  2VOC A;  3KD0 A;  1BAY A;  3ERF A;  5DQY A;  3APS A;  3GH9 A;  13GS A;  5AGY A;  2CVD A;  3VLN A;  1Z3E A;  1T8E B;  1U88 A;  3P2A A;  6GST A;  3C7M A;  1XVW A;  3BCK A;  3LYK A;  4P3Y B;  2VIM A;  1OC9 A;  4DSR A;  3EE2 A;  1EV9 A;  3FEU A;  1NM3 A;  1Y25 A;  1I9D A;  3CRU A;  4ZBB A;  4LA1 A;  2HT9 A;  1YY7 A;  3G9B A;  4KDU A;  4KND A;  3K8N A;  4HOJ A;  3WT1 A;  3ZLP A;  3J7Y k;  1GP1 A;  1SK1 A;  4ML6 A;  3QFA C;  2QGV A;  3R2Q A;  1M99 A;  2L6D A;  1ZYQ B;  3IDV A;  3APO A;  4YQU A;  1Q98 A;  2XBQ A;  3G7J A;  2VL2 C;  4GXZ A;  3FY7 A;  4ZBA A;  3ZRD A;  3UAR A;  4PGT A;  4KX4 A;  3G7Y A;  3GKX A;  2IL3 A;  4OCE A;  3MDK A;  2VL3 A;  5D93 A;  2VL9 A;  4ISD A;  3UBK A;  1WOU A;  1TKD B;  4HI7 A;  1U6T A;  4LMV A;  3O76 A;  2LTK A;  3CYN A;  1TRS A;  3GSS A;  4BA7 A;  1A0F A;  3FKF A;  2DJJ A;  4OD7 A;  5CRW A;  3EU4 A;  5ECR B;  3ZFB A;  4XHM A;  3HJM A;  1FVJ A;  3GX8 A;  1A2M A;  4MH3 A;  14GS A;  3KH9 A;  4WKW A;  4HU9 A;  1OAZ A;  2AHE A;  2XBI A;  3BCI A;  4G19 A;  4ECI A;  4TKY A;  2I3Y A;  4EXJ A;  4KSO A;  1VRS D;  1ACV A;  3QCP A;  2F51 A;  2GGT A;  5H5R A;  5IQY A;  1K0B A;  3RHB A;  4ZXG A;  4XS6 A;  2YWO A;  5H5Q A;  1KTE A;  1B8X A;  1ERU A;  4MPG A;  1HNB A;  2VM2 A;  2FNO A;  2FUG 2;  1A24 A;  1J08 A;  4D73 B;  9GSS A;  3EWL A;  3GNJ A;  2D2Z A;  1SL0 B;  2NPB A;  1XOB A;  1W89 A;  1C72 A;  2OBI A;  3RPP A;  2C0G A;  3I6A A;  1OVN A;  3LG6 A;  2JSY A;  3TUE A;  3RDW A;  1SYR A;  4IVF A;  1EGO A;  4N0V A;  2BJX A;  1JHB A;  4N30 A;  4K7I A;  1J9B A;  2QC7 A;  4IJI A;  3HVX A;  3EYT A;  4RQR A;  1SD9 A;  5G2Z A;  1PKW A;  1ZZY A;  5EPF A;  1I5G A;  2C0D A;  4F0C A;  3U6V A;  4HJ2 A;  5AIX A;  3F3Q A;  3CMI A;  1KEB A;  1JZR A;  1HNA A;  3H8Q A;  1TRU A;  2H1D A;  22GS A;  2MMZ A;  3GUS A;  3IAM 2;  3UIW A;  3D4M A;  2HRN A;  4EE0 A;  4GSS A;  3APQ A;  1XIY A;  1XZO A;  3D21 A;  5C00 A;  3IRA A;  4V1A p;  2J9H A;  4OFM A;  2X64 A;  4IJ3 A;  6GSW A;  2C0F A;  3FW2 A;  4N11 A;  3WYW A;  1M2B A;  5HR1 A;  1K0C A;  1VF4 A;  3EMP A;  1QQ2 A;  4JR4 A;  2JZS A;  1URM A;  3F3R A;  6GSU A;  5L71 A;  3F4S A;  1GSS A;  3ZL5 A;  2H71 A;  3CSH A;  4ECB A;  3RPN A;  3F4R A;  3SWL A;  2B1K A;  1B4P A;  1N2A A;  3O6T A;  4KH7 A; 
#chains in the Genus database with same CATH topology
 3LWA A;  2WCI A;  4DEJ A;  3UJ1 A;  1G6W A;  3ZFL A;  5DAL A;  1AIU A;  3IC8 A;  1DBY A;  2VO4 A;  3D4T A;  3C8E A;  3W8J A;  5KN2 A;  3LW9 A;  3EU3 A;  4ECJ A;  2GQM A;  1G7E A;  3D5J A;  1U3A A;  3RBT A;  4IW9 A;  2C1Y A;  3D22 A;  5D73 A;  10GS A;  2JZT A;  5F0G A;  1UA5 A;  4G0L A;  2M46 A;  4TR4 A;  3EMX A;  4KW6 A;  1MD3 A;  3Q6O A;  2I81 A;  2MMN A;  1MD4 A;  2RII A;  5ECQ B;  3FZ5 A;  2B5Y A;  5J41 A;  3C71 A;  3GL3 A;  1Z7R A;  1TP9 A;  3IK7 A;  2HYX A;  5FHI A;  3F8U A;  3TKP A;  1Z6M A;  2OE3 A;  2VUP A;  1PSQ A;  3KTL A;  3TJJ A;  3HD5 A;  4PXO A;  5IIZ A;  1OE8 A;  4AJ8 A;  1R5P A;  1SKS B;  1OC8 A;  1XOA A;  4KGI A;  5HFI A;  2PGT A;  4O5R A;  1EP7 A;  4JE1 A;  4CW9 A;  1X9M B;  1OE7 A;  2OAC A;  2P31 A;  2YCD A;  3EIN A;  3IHQ A;  5CRH A;  1ST9 A;  2O8V B;  4FH8 A;  4WXT A;  3GA4 A;  2E0Q A;  4FIW A;  4WBJ A;  4EO3 A;  4IGJ A;  4K2X A;  1F2E A;  2HFD A;  2PPT A;  2EIQ A;  2X8H A;  2V6O A;  3ZMK A;  4MF7 A;  2FLS A;  2YPM A;  1AQX A;  4KSM A;  2X99 A;  1JLW A;  5ELA A;  2DLX A;  3VFI A;  2QSI A;  4X4J A;  3ERG A;  1QFN A;  2PMT A;  2OBK A;  2PBJ A;  3M0F A;  1SJ6 A;  2AJQ B;  1A2L A;  2F8A A;  1BX9 A;  3GTU A;  1USB A;  5LCZ A;  2GS3 A;  4OO4 A;  1FVK A;  12GS A;  1K3L A;  4EDZ A;  2JZR A;  1X5C A;  2AAW A;  1YEP A;  3L9V A;  2C0E A;  5B8A A;  2E2G A;  3A2W A;  1E6B A;  5CNW A;  1TTZ A;  1K0M A;  2B5E A;  1M9B A;  1GH2 A;  1S3D A;  2X4A A;  4ZBD A;  2X49 A;  4F03 A;  4HQZ A;  4YKG A;  2DJ2 A;  4BVX A;  1T7P B;  2L5L A;  3N9J A;  2LQQ A;  5JCU A;  1PGT A;  1OKD A;  4WF4 A;  4KCE A;  2PU9 C;  3QD9 A;  2N5A A;  4GWR A;  1NW2 A;  5DVB A;  5IOW A;  3KGK A;  1SD8 A;  2H1G A;  2CVB A;  2KOK A;  5JWQ B;  4TN8 A;  1SK0 A;  5ECL B;  2LV3 A;  1SU9 A;  4GQF A;  5KN3 A;  3QAV A;  3GH6 A;  2R37 A;  4POB A;  4MP4 A;  2O89 A;  2ON7 A;  3CQF A;  3HA9 A;  2O7K A;  3VWX A;  5BRT A;  4PUA A;  5GZZ B;  2LJK A;  1KBN A;  2V6K A;  2VD1 A;  4I2T A;  1SJI A;  2HRK A;  8GSS A;  3HCZ A;  4CY6 A;  2B1L A;  2WRT A;  1K0A A;  5ECK B;  5J4U A;  2LNT A;  3MIX A;  3LEF A;  4F9Z A;  3QPM A;  1XWA A;  3TOT A;  4AGS A;  2PN8 A;  5F07 A;  4RQX A;  2GQK A;  5BMU A;  2AB6 A;  4EKZ A;  2B7J A;  4ZL9 A;  4EDY A;  19GS A;  2DMM A;  1TJD A;  1H75 A;  3PPU A;  2VCQ A;  3HJP A;  4ZB6 A;  4JU5 A;  4NHW A;  4BWQ A;  3CTF A;  2H76 A;  4KAE A;  5EL8 A;  4HU7 A;  1DE2 A;  3DML A;  1PFO A;  2LNS A;  3GFK A;  4KB3 A;  5LNK e;  2ES7 A;  1YEX A;  1SKW B;  3VWV A;  3DXB A;  1YF0 A;  5KOW A;  4TXO A;  2GT6 A;  5A5K A;  5DBQ A;  2PVQ A;  4PUF C;  2YNX A;  1LJR A;  4BVY A;  4EIP A;  3LQ7 A;  4FQU A;  3QMX A;  1X0R A;  4G10 A;  1H4O A;  4XIH A;  1X9W B;  1AAZ A;  2GZY A;  3TRX A;  4ULX A;  1U3I A;  4Q5F A;  4F2I A;  4HEA 2;  4V1A g;  1Z5Y E;  1FW1 A;  1AQW A;  3QR6 A;  3GKM A;  4OWY A;  2YOI A;  1ZCP A;  2G2Q A;  5IMF A;  3L78 A;  4N10 A;  5G5F A;  5ECI B;  3FR6 A;  3WGD A;  1GLQ A;  2WDU A;  2C3N A;  4GSN A;  4GRF A;  2JL4 A;  1GNW A;  1J0F A;  2AUV A;  2VM1 A;  3D0Z A;  2OAD A;  2LRC A;  1TXX A;  2DJK A;  2DKH A;  1WP0 A;  2YP6 A;  4EIQ A;  5B8B A;  3DKS A;  3KM6 A;  3FZ4 A;  2IMF A;  3Q19 A;  4ACS A;  2L6C A;  5GSS A;  5ECH B;  1O81 A;  5CP1 A;  5J9C A;  4K0G A;  3L9U A;  5D9X A;  2MMO A;  3GV1 A;  3TJF A;  3KH7 A;  1U87 A;  3GX0 A;  3ZVJ D;  1PD2 1;  1GL8 A;  5B6N A;  3IC4 A;  4AF2 A;  2R4V A;  4WBR D;  3ZIT A;  1R26 A;  2P0G A;  4MPF A;  4TR1 A;  3HKR A;  2ZUP A;  2JAD A;  1PL1 A;  3A5W A;  3IOS A;  2ALB A;  1SEN A;  1NHO A;  5B6M A;  4FYC A;  4TR0 A;  5HFG A;  1K0O A;  2L4Q A;  5DAK A;  2IMK A;  1HD2 A;  4AJ6 A;  2ZCT A;  1FOH A;  1PN9 A;  4NMU A;  1AXD A;  1T1V A;  4TOP A;  3DVW A;  1FG4 A;  4PQI A;  1GWC A;  2HLS A;  2TRX A;  2A4V A;  2MBT A;  5D9V A;  2GSR A;  5ECN B;  4O92 A;  2E2M A;  2H01 A;  3FR9 A;  4F0B A;  2NVL A;  2OA7 A;  5LD0 A;  4MZW A;  1V9W A;  4K9Z A;  4EVM A;  3C1R A;  4JZQ A;  4NPB A;  5G1L A;  1ML6 A;  5D9W A;  1R7H A;  5J9B A;  3ME7 A;  4MNN A;  3H4K A;  3ZML A;  4ZIJ A;  1PA3 A;  1NHY A;  4V2M A;  4NXI A;  3M9K A;  3LXZ A;  5IPH A;  2IN3 A;  4LL4 B;  4ZIL A;  1PKZ A;  2YAN A;  2B7K A;  2HI7 A;  5HQP A;  2FWE A;  2LEG A;  1GSF A;  5B7C A;  6GSS A;  4XS4 B;  2IJY A;  1X9S B;  5F8B A;  3HY2 A;  3FYG A;  3QAG A;  2LJA A;  2B3S A;  4WF5 A;  2H19 A;  5GST A;  2H72 A;  3N5O A;  2V2G A;  2H0G A;  2CV4 A;  4BWS A;  2O85 A;  1Q4J A;  4XRA A;  1TI1 A;  3W6G A;  4ID0 A;  1HYU A;  4F82 A;  1A23 A;  4DVC A;  3VWW A;  1JZD A;  1PL2 A;  3VPQ A;  1XCC A;  2R2J A;  2WJU A;  1Z6N A;  3DGQ A;  2IFQ B;  2HRF A;  4FYU A;  2FWH A;  3KCM A;  2KLX A;  3O3T A;  2ZNM A;  3TKQ A;  2CZ2 A;  3R3E A;  4BL7 B;  3HYP A;  2GVP A;  1YKC A;  4DSS B;  5ID2 B;  3PIN A;  1OYJ A;  3GST A;  5E4W A;  5AIV A;  1BYE A;  4N0Z A;  5E59 A;  2DIZ A;  2K8S A;  5ELG A;  3TKS E;  2L57 A;  2L5O A;  2YZU A;  2GZZ A;  3AY8 A;  4MF5 A;  4MK3 A;  1M7T A;  4RI7 A;  5AIS A;  3H79 A;  3TKR A;  2WUL A;  2YZH A;  3EC3 A;  1SYX A;  4X0X A;  1FB0 A;  1MDJ A;  3C73 A;  1TRW A;  2MYG A;  2IIY A;  1GLP A;  2X8G A;  4ICY A;  3ZIV A;  3DD3 A;  4MJC A;  2FHE A;  4TR3 A;  2LRT A;  1YZX A;  3CXG A;  5IOX A;  4PNG A;  1RQM A;  3DYR A;  3MSZ A;  4L5O A;  4IN0 A;  5KN1 A;  1AUC A;  1PMT A;  2FWF A;  1ILO A;  1QMV A;  1XW6 A;  3G7I A;  3J7Y b;  2CX4 A;  2KUC A;  3DRN A;  3HHV A;  1Z9H A;  2OE1 A;  1WJK A;  4L0W A;  3ZRE A;  2CZ3 A;  1JZW A;  1F6M C;  1M2A A;  3LSZ A;  4PTS A;  5HR2 A;  1GUH A;  1EP8 A;  1T4Y A;  4D73 A;  3I43 A;  4MDC A;  3BOA A;  3UAP A;  1FO5 A;  2HZE B;  3TKS A;  4NHZ A;  2C3Q A;  3A2V A;  1GRX A;  3EUR A;  2TRC P;  1YJ6 A;  4OFN A;  4PQH A;  4MAB A;  5J5N A;  1TK0 B;  3CRT A;  4ZB9 A;  3MYD A;  4MLY A;  1GTI A;  5JCG A;  2GZP A;  2H66 A;  3FHK A;  4CHS A;  4XRD A;  3TRP A;  2PWJ A;  5IMA A;  2JAC A;  2ON5 A;  1XPV A;  4HZ2 A;  5ABR A;  4BPY A;  5A4V A;  1GUL A;  1UN2 A;  5CYY A;  5FT3 A;  2WB9 A;  5DJM A;  3UMA A;  3CSJ A;  4H86 A;  2O87 A;  3HDC A;  1XFL A;  4Q5Q A;  4Q5N A;  1ZGN A;  2V32 A;  3OR5 A;  4WR4 A;  3E9J B;  4WET A;  3VUR A;  1EWX A;  4ILF A;  1GSD A;  4CY8 A;  1OC9 B;  5JWR B;  4MMM A;  4K5S A;  1ERT A;  2GQL A;  18GS A;  2DKI A;  1B9Y C;  1CQG A;  2LQO A;  1THX A;  1WIK A;  2H6Y A;  1UC7 A;  1T00 A;  4KE3 A;  2VL2 A;  2HNL A;  2XPD A;  3UVT A;  1IYH A;  3BBY A;  4MF6 A;  4QL9 A;  2YWI A;  3IHG A;  1O7U A;  2PUK C;  4LL1 B;  3MWH A;  5A4U A;  1A2J A;  1F3A A;  2K9F A;  4WR5 A;  1S3R A;  4OCF A;  3CSI A;  2IME A;  1G0T A;  3DWV A;  5INY A;  4QQ7 A;  5IMV A;  1EV4 A;  2E7P A;  3Q18 A;  3RAZ A;  1TU8 A;  2EC4 A;  2LS5 A;  1BG5 A;  3TGZ A;  2CVK A;  3F6D A;  2H75 A;  4TVE A;  2FY6 A;  1O6J A;  4FO5 A;  5G30 A;  3LYP A;  2LJR A;  5G1K A;  1XG8 A;  4G9H A;  4OO5 A;  1R5A A;  1WMJ A;  2DJ3 A;  4JR6 A;  4J57 E;  3FRC A;  2DBC A;  1OC3 A;  5AN1 A;  4EC0 A;  4KUN A;  4RUV A;  2CAI A;  3LFL A;  3LGC A;  3HVS A;  3GN3 A;  2Z9S A;  1MDI A;  2R0G A;  4O5U A;  1TK8 B;  1XVQ A;  3VWU A;  2I1U A;  3V1W A;  2GST A;  1K0N A;  1AQV A;  3UOM A;  2LST A;  2A2R A;  5DCG A;  3ZVJ A;  1YKA A;  1XW9 A;  1GTU A;  2RM6 A;  1SL2 B;  1X5E A;  5H5S A;  5IM9 A;  3VI7 A;  1XWB A;  3UVH A;  2GSS A;  1MTC A;  5KEJ A;  2FA4 A;  2VLU A;  4IP6 A;  3WD6 A;  3P8W A;  4ZL7 A;  1BQ7 A;  1SJZ A;  2RM5 A;  1KNG A;  1AC1 A;  2OJL A;  1GSE A;  1O8W A;  6GSY A;  3C1S A;  1DSB A;  1V40 A;  1AW9 A;  4L8E A;  2R3X A;  4POL A;  2R5G A;  3EPT A;  4IBP A;  2M80 A;  3L9S A;  4KA0 A;  4V2L A;  5CAX A;  2IPA A;  5ECS A;  4MJE A;  1JLV A;  4HSC X;  4K2D A;  4EUY A;  2H0I A;  3Q74 A;  5JWO B;  4IP1 A;  3KIJ A;  3CTG A;  3DVX A;  5DCH A;  3HZ8 A;  4HQS A;  1YF1 A;  1VF1 A;  3NZN A;  4POK A;  5IO2 A;  2C4J A;  4FYB A;  1B4Q A;  5EY6 A;  1FHE A;  3IA1 A;  2DSA A;  3KJY A;  2K6V A;  3GKN A;  3QOU A;  3DIE A;  2WFC A;  2PVO C;  4L0U A;  2VCT A;  2WGR A;  4PNF A;  2VCW A;  1TRV A;  4GF0 A;  4O7H A;  2VCZ A;  3KZQ A;  4XCS A;  5ECP B;  1ERV A;  2VD0 A;  2V1M A;  2H6Z A;  1OKT A;  4POM A;  11GS A;  2WS2 A;  3GL5 A;  3MAK A;  7GSS A;  1GNE A;  6GSV A;  4PQ1 A;  2HXK A;  1M2D A;  2YJ7 A;  3A2X A;  2H8L A;  2B6M A;  4PX1 A;  1GSQ A;  1IYI A;  5ECM B;  1G6Y A;  5CRD A;  2DJ1 A;  2L4C A;  1TK5 B;  1GUM A;  4GCI A;  4TXV A;  5DAL B;  3M8N A;  1JZO A;  2KP1 A;  4G0K A;  3M3M A;  3H1N A;  2NBS A;  2M72 A;  1EOH A;  2FA8 A;  2F3M A;  5J3R A;  3NOF A;  1G7O A;  1RW1 A;  3TOU A;  3TJG A;  2I4A A;  1A0R P;  4E8H A;  3GKK A;  2CA8 A;  2VCX A;  2JSZ A;  4E8E A;  4X1U A;  3KP9 A;  2FGX A;  3L0H A;  2VLT A;  4PUR A;  1SKR B;  1TI3 A;  3GRX A;  4IKH A;  1YDK A;  3GIX A;  3VK9 A;  2FD3 A;  1PN0 A;  1EEJ A;  1GTB A;  1XWK A;  2XPE A;  2VAF A;  2CAQ A;  5IPG A;  4K7O A;  3IBH A;  1F9M A;  1GUK A;  3RHC A;  2H1B A;  2IWT A;  3KXO A;  1LU4 A;  4K6X A;  3UL3 A;  4G0I A;  4CDO A;  3TDG A;  4LMW A;  5D96 A;  3GYK A;  2KHP A;  2N5F A;  2YV9 A;  4G2E A;  1TOF A;  1E2Y A;  5HFK A;  1WPI A;  1BJX A;  2CX3 A;  5DQS A;  2QA1 A;  1TU7 A;  1WWJ A;  2H6X A;  2V41 A;  3BD2 A;  1XW5 A;  2HSY A;  3KP8 A;  2C80 A;  3ZYW A;  3QDN A;  1F3B A;  1ABA A;  3GHA A;  1CQH A;  2DML A;  1PX7 A;  2L59 A;  5COH A;  1WE0 A;  2C3T A;  4OMV A;  1PX6 A;  2DC5 A;  2QKE A;  1FOV A;  2K8V A;  3PGT A;  4ML1 A;  1O8X A;  5HR3 A;  1SL1 B;  3L4N A;  3UBL A;  4IEL A;  5DDL A;  3D6I A;  3IAS 2;  5A4W A;  1FAA A;  1PRX A;  1N8J A;  5CRG A;  2G0F A;  1ZOF A;  2P5R A;  2F8F A;  2YWN A;  2B5X A;  3GTU B;  2I9H A;  5ECO B;  2H74 A;  2OKA A;  3HZ4 A;  4GQC A;  3ZTL A;  3ZIJ A;  3ME8 A;  1ERW A;  3I69 A;  4NV2 A;  1K3Y A;  1EEM A;  4JED A;  5IO0 A;  5DJL A;  5KN0 A;  1M3J A;  5IMC A;  5C04 A;  2RUF A;  3FK8 A;  2N5B A;  3CBU A;  3WGX A;  2WZ9 A;  4MH2 A;  4BVX B;  5IMZ A;  5D8I A;  4I2U A;  1B9X C;  3UEM A;  1RK4 A;  2R6K A;  3FZA A;  2MBS A;  4IHU A;  4Z2U A;  4MJB A;  3ISO A;  4I8B A;  2DIY A;  3PR8 A;  3GMF A;  2GDR A;  3P7X A;  1V57 A;  2H1A A;  4YKF A;  2P5Q A;  3QAW A;  3WGE A;  2JU5 A;  4J2F A;  3H93 A;  4BIK A;  1QUW A;  2YWM A;  4V2N A;  4KCA A;  2GTU A;  1W4V A;  1HNC A;  5GAP D;  4I5Q A;  4K0N A;  1QXH A;  1TW9 A;  3A3T A;  3KEB A;  16GS A;  4HUA A;  1YQ1 A;  1FB6 A;  4TW5 A;  1M3I A;  1TDI A;  4HJM A;  4HZ4 A;  1GSU A;  4YH2 A;  2YV7 A;  1PQN A;  4JRR A;  3F9U A;  3VI5 A;  3TJB A;  4MA9 A;  4I6X A;  4Z2R A;  4YAV A;  1V98 A;  1O73 A;  1VF3 A;  2PER A;  3ZZX A;  4GLT A;  1V58 A;  4O5Q A;  2C8U A;  1M0U A;  1XWG A;  2AYT A;  3MNG A;  4ECC A;  5JCW A;  3IK9 A;  5FWG A;  2HSH A;  2TIR A;  4I97 A;  4A5P A;  3PH9 A;  2BMX A;  1ON4 A;  1THO A;  1GSY A;  3VPT A;  1T4Z A;  5HR0 A;  1M9A A;  2IMI A;  2K18 A;  1VF2 A;  4GST A;  3WT2 A;  4TXO B;  4Z7X A;  5F06 A;  3E3E A;  2UZ8 A;  4XS4 A;  2QA2 A;  6GSX A;  2CQ9 A;  2HZF A;  4BVY B;  1LBK A;  3SBC A;  1MDK A;  3IPZ A;  3TRQ A;  2MZC A;  4K5R A;  3U5R E;  4K8M A;  2RUE A;  1WRY A;  17GS A;  3ED3 A;  3F6F A;  1ZMA A;  2X8C A;  3NIV A;  2VCV A;  4USS A;  1Z7P A;  3F0I A;  4RI6 A;  4MJA A;  3DEX A;  2H0H A;  1EGR A;  4ZL8 A;  4IQA A;  3KMN A;  2NDO A;  4KDX A;  2H73 A;  4WEY A;  4EF0 A;  3JCM L;  4JBB A;  2IFQ A;  3P90 A;  2AV4 A;  4YQV A;  3TB2 A;  1Y6E A;  2IMD A;  4X43 A;  4KDY A;  1EOG A;  4BL7 A;  4DSS A;  4K1F A;  5ID2 A;  1R4W A;  4IS0 A;  1K3O A;  2GLR A;  2HRA A;  4XS1 A;  3W8S A;  5CO3 A;  2LUS A;  1QK8 A;  1HQO A;  4IQ1 A;  3E0U A;  3ERW A;  2OE0 A;  2A4H A;  5CRE A;  1T3B A;  3M9J A;  4YAP A;  3IE3 A;  5G31 A;  3TCO A;  3HJO A;  2H30 A;  1ZL9 A;  3S9F A;  1GTA A;  2GSQ A;  1A8L A;  4AJ7 A;  2J23 A;  1A8Y A;  2MMA A;  2F9S A;  2GT5 A;  4TR1 B;  1NSW A;  4MZC A;  4Q5R A;  1QGV A;  1DUG A;  4NV5 A;  2YJH A;  4O32 A;  5GAN D;  1ZYE A;  3IXR A;  3LXT A;  2CT6 A;  2LKU A;  5D9T A;  5DAK B;  2A2S A;  4ZB8 A;  2FCH A;  3FR3 A;  4MCU A;  2REM A;  3FZ9 A;  4Z2T A;  3IR4 A;  2EIR A;  1MEK A;  1F37 A;  5F05 A;  1ZYP A;  3HXS A;  5EVO A;  3M1G A;  5IMD A;  4GTU A;  2A2P A;  4HDE A;  4L5L A;  1XWC A;  3EVI A;  3LJR A;  3LOR A;  2XC2 A;  1ZYN A;  4EL1 A;  5KOX A;  1O85 A;  1X5D A;  3IV4 A;  1BED A;  3GUR A;  3QFB C;  4XTS A;  2YN1 A;  4YQM A;  2HZE A;  1DE1 A;  2H70 A;  1EZK A;  3HVV A;  2KP2 A;  1JFU A;  1SK2 A;  4QL7 A;  2FWG A;  4LLR A;  4TRX A;  2DJ0 A;  2LRN A;  4J56 E;  1S3C A;  1V2A A;  4HS1 A;  2BTO T;  1B48 A;  2XHF A;  2RLI A;  3F63 A;  20GS A;  2VLV A;  2HE3 A;  2NTO A;  5G5E A;  4MZB A;  1S3A A;  1VGL A;  1XXU A;  2EIO A;  3US3 A;  1K0D A;  4OFT A;  3A5I A;  2R0P A;  4DSQ A;  3KTB A;  3TJK A;  5ENU A;  3KMO A;  4NWY A;  3F4T A;  3BJ5 A;  1XBS A;  3TKS C;  4K7N A;  1UVZ A;  4NAX A;  3I9V 2;  2VOC A;  3KD0 A;  1BAY A;  3ERF A;  5DQY A;  3APS A;  3GH9 A;  13GS A;  5AGY A;  2CVD A;  3VLN A;  1Z3E A;  1T8E B;  1U88 A;  3P2A A;  6GST A;  3C7M A;  1XVW A;  3BCK A;  3LYK A;  4P3Y B;  2VIM A;  1OC9 A;  4DSR A;  3EE2 A;  1EV9 A;  3FEU A;  1NM3 A;  1Y25 A;  1I9D A;  3CRU A;  4ZBB A;  4LA1 A;  2HT9 A;  1YY7 A;  3G9B A;  4KDU A;  4KND A;  3K8N A;  4HOJ A;  3WT1 A;  3ZLP A;  3J7Y k;  1GP1 A;  1SK1 A;  4ML6 A;  4KF9 A;  3QFA C;  2QGV A;  3R2Q A;  1M99 A;  2L6D A;  1ZYQ B;  3IDV A;  3APO A;  3FMW A;  4YQU A;  1Q98 A;  2XBQ A;  3G7J A;  2VL2 C;  4GXZ A;  3FY7 A;  4ZBA A;  3ZRD A;  2HSM A;  4PGT A;  3UAR A;  4KX4 A;  3G7Y A;  3GKX A;  2IL3 A;  4OCE A;  3MDK A;  2VL3 A;  5D93 A;  2VL9 A;  4ISD A;  3UBK A;  1WOU A;  1TKD B;  4HI7 A;  1U6T A;  4LMV A;  3O76 A;  2LTK A;  3CYN A;  1TRS A;  3GSS A;  4BA7 A;  1A0F A;  3FKF A;  2DJJ A;  4OD7 A;  5CRW A;  3EU4 A;  5ECR B;  3ZFB A;  4XHM A;  3HJM A;  1FVJ A;  3GX8 A;  1A2M A;  4MH3 A;  14GS A;  3KH9 A;  4WKW A;  4HU9 A;  1OAZ A;  2AHE A;  2XBI A;  3BCI A;  4G19 A;  4ECI A;  4TKY A;  2I3Y A;  4EXJ A;  3HVN A;  4KSO A;  1VRS D;  1ACV A;  3QCP A;  2F51 A;  2GGT A;  2R0C A;  5H5R A;  5IQY A;  1K0B A;  3RHB A;  4ZXG A;  4XS6 A;  2YWO A;  5H5Q A;  1KTE A;  1B8X A;  1ERU A;  4MPG A;  1HNB A;  2VM2 A;  2FNO A;  2FUG 2;  1A24 A;  1J08 A;  4D73 B;  9GSS A;  3EWL A;  3GNJ A;  2D2Z A;  1SL0 B;  2NPB A;  1XOB A;  1W89 A;  1C72 A;  2OBI A;  3RPP A;  2C0G A;  3I6A A;  1OVN A;  3LG6 A;  2JSY A;  3TUE A;  3RDW A;  1SYR A;  4IVF A;  1EGO A;  4N0V A;  2BJX A;  1JHB A;  4N30 A;  4K7I A;  1J9B A;  2QC7 A;  4IJI A;  3HVX A;  3EYT A;  4RQR A;  1SD9 A;  5G2Z A;  1PKW A;  1ZZY A;  5EPF A;  1I5G A;  2C0D A;  4F0C A;  3U6V A;  4HJ2 A;  5AIX A;  3F3Q A;  3CMI A;  1KEB A;  1JZR A;  1HNA A;  3H8Q A;  1TRU A;  2H1D A;  22GS A;  2MMZ A;  3GUS A;  3IAM 2;  3UIW A;  3D4M A;  2HRN A;  4EE0 A;  4GSS A;  3APQ A;  1XIY A;  1XZO A;  3D21 A;  5C00 A;  3IRA A;  4V1A p;  2J9H A;  4OFM A;  2X64 A;  4IJ3 A;  6GSW A;  2C0F A;  3FW2 A;  4N11 A;  3WYW A;  1M2B A;  5HR1 A;  1K0C A;  1VF4 A;  3EMP A;  1QQ2 A;  4JR4 A;  2JZS A;  1URM A;  3F3R A;  6GSU A;  5L71 A;  3F4S A;  1GSS A;  3ZL5 A;  2H71 A;  3CSH A;  4ECB A;  3RPN A;  3F4R A;  3SWL A;  2B1K A;  1B4P A;  1N2A A;  3O6T A;  4KH7 A; 
#chains in the Genus database with same CATH homology
 3LWA A;  2WCI A;  4DEJ A;  3UJ1 A;  1G6W A;  3ZFL A;  5DAL A;  1AIU A;  3IC8 A;  1DBY A;  2VO4 A;  3D4T A;  3C8E A;  3W8J A;  5KN2 A;  3LW9 A;  3EU3 A;  4ECJ A;  2GQM A;  1G7E A;  3D5J A;  1U3A A;  3RBT A;  4IW9 A;  2C1Y A;  3D22 A;  5D73 A;  10GS A;  2JZT A;  5F0G A;  1UA5 A;  4G0L A;  2M46 A;  4TR4 A;  3EMX A;  4KW6 A;  1MD3 A;  3Q6O A;  2I81 A;  2MMN A;  1MD4 A;  2RII A;  5ECQ B;  3FZ5 A;  2B5Y A;  5J41 A;  3C71 A;  3GL3 A;  1Z7R A;  1TP9 A;  3IK7 A;  2HYX A;  5FHI A;  3F8U A;  3TKP A;  1Z6M A;  2OE3 A;  2VUP A;  1PSQ A;  3KTL A;  3TJJ A;  3HD5 A;  4PXO A;  5IIZ A;  1OE8 A;  4AJ8 A;  1R5P A;  1SKS B;  1OC8 A;  1XOA A;  4KGI A;  5HFI A;  2PGT A;  4O5R A;  1EP7 A;  4JE1 A;  4CW9 A;  1X9M B;  1OE7 A;  2OAC A;  2P31 A;  2YCD A;  3EIN A;  3IHQ A;  5CRH A;  1ST9 A;  2O8V B;  4FH8 A;  4WXT A;  3GA4 A;  2E0Q A;  4FIW A;  4WBJ A;  4EO3 A;  4IGJ A;  4K2X A;  1F2E A;  2HFD A;  2PPT A;  2EIQ A;  2X8H A;  2V6O A;  3ZMK A;  4MF7 A;  2FLS A;  2YPM A;  1AQX A;  4KSM A;  2X99 A;  1JLW A;  5ELA A;  2DLX A;  3VFI A;  2QSI A;  4X4J A;  3ERG A;  1QFN A;  2PMT A;  2OBK A;  2PBJ A;  3M0F A;  1SJ6 A;  2AJQ B;  1A2L A;  2F8A A;  1BX9 A;  3GTU A;  1USB A;  5LCZ A;  2GS3 A;  4OO4 A;  1FVK A;  12GS A;  1K3L A;  4EDZ A;  2JZR A;  1X5C A;  2AAW A;  1YEP A;  3L9V A;  2C0E A;  5B8A A;  2E2G A;  3A2W A;  1E6B A;  5CNW A;  1TTZ A;  1K0M A;  2B5E A;  1M9B A;  1GH2 A;  1S3D A;  2X4A A;  4ZBD A;  2X49 A;  4F03 A;  4HQZ A;  4YKG A;  2DJ2 A;  4BVX A;  1T7P B;  2L5L A;  3N9J A;  2LQQ A;  5JCU A;  1PGT A;  1OKD A;  4WF4 A;  4KCE A;  2PU9 C;  3QD9 A;  2N5A A;  4GWR A;  1NW2 A;  5DVB A;  5IOW A;  3KGK A;  1SD8 A;  2H1G A;  2CVB A;  2KOK A;  5JWQ B;  4TN8 A;  1SK0 A;  5ECL B;  2LV3 A;  1SU9 A;  4GQF A;  5KN3 A;  3QAV A;  3GH6 A;  2R37 A;  4POB A;  4MP4 A;  2O89 A;  2ON7 A;  3HA9 A;  2O7K A;  3VWX A;  5BRT A;  4PUA A;  5GZZ B;  2LJK A;  1KBN A;  2V6K A;  2VD1 A;  4I2T A;  1SJI A;  2HRK A;  8GSS A;  3HCZ A;  4CY6 A;  2B1L A;  2WRT A;  1K0A A;  5ECK B;  5J4U A;  2LNT A;  3MIX A;  3LEF A;  4F9Z A;  3QPM A;  1XWA A;  3TOT A;  4AGS A;  2PN8 A;  5F07 A;  4RQX A;  2GQK A;  5BMU A;  2AB6 A;  4EKZ A;  2B7J A;  4ZL9 A;  4EDY A;  19GS A;  2DMM A;  1TJD A;  1H75 A;  3PPU A;  2VCQ A;  3HJP A;  4ZB6 A;  4JU5 A;  4NHW A;  4BWQ A;  3CTF A;  2H76 A;  4KAE A;  5EL8 A;  4HU7 A;  1DE2 A;  3DML A;  2LNS A;  3GFK A;  4KB3 A;  5LNK e;  2ES7 A;  1YEX A;  1SKW B;  3VWV A;  3DXB A;  1YF0 A;  5KOW A;  4TXO A;  2GT6 A;  5A5K A;  5DBQ A;  2PVQ A;  4PUF C;  2YNX A;  1LJR A;  4BVY A;  4EIP A;  3LQ7 A;  4FQU A;  3QMX A;  1X0R A;  4G10 A;  1H4O A;  4XIH A;  1X9W B;  1AAZ A;  2GZY A;  3TRX A;  4ULX A;  1U3I A;  4Q5F A;  4F2I A;  4HEA 2;  4V1A g;  1Z5Y E;  1FW1 A;  1AQW A;  3QR6 A;  3GKM A;  4OWY A;  2YOI A;  1ZCP A;  2G2Q A;  5IMF A;  3L78 A;  4N10 A;  5G5F A;  5ECI B;  3FR6 A;  3WGD A;  1GLQ A;  2WDU A;  2C3N A;  4GSN A;  4GRF A;  2JL4 A;  1GNW A;  1J0F A;  2AUV A;  2VM1 A;  3D0Z A;  2OAD A;  2LRC A;  1TXX A;  2DJK A;  2DKH A;  1WP0 A;  2YP6 A;  4EIQ A;  5B8B A;  3DKS A;  3KM6 A;  3FZ4 A;  2IMF A;  3Q19 A;  4ACS A;  2L6C A;  5GSS A;  5ECH B;  1O81 A;  5CP1 A;  5J9C A;  4K0G A;  3L9U A;  5D9X A;  2MMO A;  3GV1 A;  3TJF A;  3KH7 A;  1U87 A;  3GX0 A;  3ZVJ D;  1PD2 1;  1GL8 A;  5B6N A;  3IC4 A;  4AF2 A;  2R4V A;  4WBR D;  3ZIT A;  1R26 A;  2P0G A;  4MPF A;  4TR1 A;  3HKR A;  2ZUP A;  2JAD A;  1PL1 A;  3A5W A;  3IOS A;  2ALB A;  1SEN A;  1NHO A;  5B6M A;  4FYC A;  4TR0 A;  5HFG A;  1K0O A;  2L4Q A;  5DAK A;  2IMK A;  1HD2 A;  4AJ6 A;  2ZCT A;  1FOH A;  1PN9 A;  4NMU A;  1AXD A;  1T1V A;  4TOP A;  3DVW A;  1FG4 A;  4PQI A;  1GWC A;  2HLS A;  2TRX A;  2A4V A;  2MBT A;  5D9V A;  2GSR A;  5ECN B;  4O92 A;  2E2M A;  2H01 A;  3FR9 A;  4F0B A;  2NVL A;  2OA7 A;  5LD0 A;  4MZW A;  1V9W A;  4K9Z A;  4EVM A;  3C1R A;  4JZQ A;  4NPB A;  5G1L A;  1ML6 A;  5D9W A;  1R7H A;  5J9B A;  3ME7 A;  4MNN A;  3H4K A;  3ZML A;  4ZIJ A;  1PA3 A;  1NHY A;  4V2M A;  4NXI A;  3M9K A;  3LXZ A;  5IPH A;  2IN3 A;  4LL4 B;  4ZIL A;  1PKZ A;  2YAN A;  2B7K A;  2HI7 A;  5HQP A;  2FWE A;  2LEG A;  1GSF A;  5B7C A;  6GSS A;  4XS4 B;  2IJY A;  1X9S B;  5F8B A;  3HY2 A;  3FYG A;  3QAG A;  2LJA A;  2B3S A;  4WF5 A;  2H19 A;  5GST A;  2H72 A;  3N5O A;  2V2G A;  2H0G A;  2CV4 A;  4BWS A;  2O85 A;  1Q4J A;  4XRA A;  1TI1 A;  3W6G A;  4ID0 A;  1HYU A;  4F82 A;  1A23 A;  4DVC A;  3VWW A;  1JZD A;  1PL2 A;  3VPQ A;  1XCC A;  2R2J A;  2WJU A;  1Z6N A;  3DGQ A;  2IFQ B;  2HRF A;  4FYU A;  2FWH A;  3KCM A;  2KLX A;  3O3T A;  2ZNM A;  3TKQ A;  2CZ2 A;  3R3E A;  4BL7 B;  3HYP A;  2GVP A;  1YKC A;  4DSS B;  5ID2 B;  3PIN A;  1OYJ A;  3GST A;  5E4W A;  5AIV A;  1BYE A;  4N0Z A;  5E59 A;  2DIZ A;  2K8S A;  5ELG A;  3TKS E;  2L57 A;  2L5O A;  2YZU A;  2GZZ A;  3AY8 A;  4MF5 A;  4MK3 A;  1M7T A;  4RI7 A;  5AIS A;  3H79 A;  3TKR A;  2WUL A;  2YZH A;  3EC3 A;  1SYX A;  4X0X A;  1FB0 A;  1MDJ A;  3C73 A;  1TRW A;  2MYG A;  2IIY A;  1GLP A;  2X8G A;  4ICY A;  3ZIV A;  3DD3 A;  4MJC A;  2FHE A;  4TR3 A;  2LRT A;  1YZX A;  3CXG A;  5IOX A;  4PNG A;  1RQM A;  3DYR A;  3MSZ A;  4L5O A;  4IN0 A;  5KN1 A;  1AUC A;  1PMT A;  2FWF A;  1ILO A;  1QMV A;  1XW6 A;  3G7I A;  3J7Y b;  2CX4 A;  2KUC A;  3DRN A;  3HHV A;  1Z9H A;  2OE1 A;  1WJK A;  4L0W A;  3ZRE A;  2CZ3 A;  1JZW A;  1F6M C;  1M2A A;  3LSZ A;  4PTS A;  5HR2 A;  1GUH A;  1EP8 A;  1T4Y A;  4D73 A;  3I43 A;  4MDC A;  3BOA A;  3UAP A;  1FO5 A;  2HZE B;  3TKS A;  4NHZ A;  2C3Q A;  3A2V A;  1GRX A;  3EUR A;  2TRC P;  1YJ6 A;  4OFN A;  4PQH A;  4MAB A;  5J5N A;  1TK0 B;  3CRT A;  4ZB9 A;  3MYD A;  4MLY A;  1GTI A;  5JCG A;  2GZP A;  2H66 A;  3FHK A;  4CHS A;  4XRD A;  3TRP A;  2PWJ A;  5IMA A;  2JAC A;  2ON5 A;  1XPV A;  4HZ2 A;  5ABR A;  4BPY A;  5A4V A;  1GUL A;  1UN2 A;  5CYY A;  5FT3 A;  2WB9 A;  5DJM A;  3UMA A;  3CSJ A;  4H86 A;  2O87 A;  3HDC A;  1XFL A;  4Q5Q A;  4Q5N A;  1ZGN A;  2V32 A;  3OR5 A;  4WR4 A;  3E9J B;  4WET A;  3VUR A;  1EWX A;  4ILF A;  1GSD A;  4CY8 A;  1OC9 B;  5JWR B;  4MMM A;  4K5S A;  1ERT A;  2GQL A;  18GS A;  2DKI A;  1B9Y C;  1CQG A;  2LQO A;  1THX A;  1WIK A;  2H6Y A;  1UC7 A;  1T00 A;  4KE3 A;  2VL2 A;  2HNL A;  2XPD A;  3UVT A;  1IYH A;  3BBY A;  4MF6 A;  4QL9 A;  2YWI A;  3IHG A;  1O7U A;  2PUK C;  4LL1 B;  3MWH A;  5A4U A;  1A2J A;  1F3A A;  2K9F A;  4WR5 A;  4OCF A;  3CSI A;  2IME A;  1G0T A;  3DWV A;  5INY A;  4QQ7 A;  5IMV A;  1EV4 A;  2E7P A;  3Q18 A;  3RAZ A;  1TU8 A;  2EC4 A;  2LS5 A;  1BG5 A;  3TGZ A;  2CVK A;  3F6D A;  2H75 A;  4TVE A;  2FY6 A;  1O6J A;  4FO5 A;  5G30 A;  3LYP A;  2LJR A;  5G1K A;  4G9H A;  4OO5 A;  1R5A A;  1WMJ A;  2DJ3 A;  4JR6 A;  4J57 E;  3FRC A;  2DBC A;  1OC3 A;  5AN1 A;  4EC0 A;  4KUN A;  4RUV A;  2CAI A;  3LFL A;  3LGC A;  3HVS A;  3GN3 A;  2Z9S A;  1MDI A;  2R0G A;  4O5U A;  1TK8 B;  1XVQ A;  3VWU A;  2I1U A;  3V1W A;  2GST A;  1K0N A;  1AQV A;  3UOM A;  2LST A;  2A2R A;  5DCG A;  3ZVJ A;  1YKA A;  1XW9 A;  1GTU A;  2RM6 A;  1SL2 B;  1X5E A;  5H5S A;  5IM9 A;  3VI7 A;  1XWB A;  3UVH A;  2GSS A;  1MTC A;  5KEJ A;  2FA4 A;  2VLU A;  4IP6 A;  3WD6 A;  3P8W A;  4ZL7 A;  1BQ7 A;  1SJZ A;  2RM5 A;  1KNG A;  1AC1 A;  2OJL A;  1GSE A;  1O8W A;  6GSY A;  3C1S A;  1DSB A;  1V40 A;  1AW9 A;  4L8E A;  2R3X A;  4POL A;  2R5G A;  3EPT A;  4IBP A;  2M80 A;  3L9S A;  4KA0 A;  4V2L A;  5CAX A;  2IPA A;  5ECS A;  4MJE A;  1JLV A;  4K2D A;  4EUY A;  2H0I A;  3Q74 A;  5JWO B;  4IP1 A;  3KIJ A;  3CTG A;  3DVX A;  5DCH A;  3HZ8 A;  4HQS A;  1YF1 A;  1VF1 A;  3NZN A;  4POK A;  5IO2 A;  2C4J A;  4FYB A;  1B4Q A;  5EY6 A;  1FHE A;  3IA1 A;  2DSA A;  3KJY A;  2K6V A;  3GKN A;  3QOU A;  3DIE A;  2WFC A;  2PVO C;  4L0U A;  2VCT A;  2WGR A;  4PNF A;  2VCW A;  1TRV A;  4GF0 A;  4O7H A;  2VCZ A;  3KZQ A;  4XCS A;  5ECP B;  1ERV A;  2VD0 A;  2V1M A;  2H6Z A;  1OKT A;  4POM A;  11GS A;  2WS2 A;  3GL5 A;  3MAK A;  7GSS A;  1GNE A;  6GSV A;  4PQ1 A;  2HXK A;  1M2D A;  2YJ7 A;  3A2X A;  2H8L A;  2B6M A;  4PX1 A;  1GSQ A;  1IYI A;  5ECM B;  1G6Y A;  5CRD A;  2DJ1 A;  2L4C A;  1TK5 B;  1GUM A;  4GCI A;  4TXV A;  5DAL B;  3M8N A;  1JZO A;  2KP1 A;  4G0K A;  3M3M A;  3H1N A;  2NBS A;  2M72 A;  1EOH A;  2FA8 A;  2F3M A;  5J3R A;  3NOF A;  1G7O A;  1RW1 A;  3TOU A;  3TJG A;  2I4A A;  1A0R P;  4E8H A;  3GKK A;  2CA8 A;  2VCX A;  2JSZ A;  4E8E A;  4X1U A;  3KP9 A;  2FGX A;  3L0H A;  2VLT A;  4PUR A;  1SKR B;  1TI3 A;  3GRX A;  4IKH A;  1YDK A;  3GIX A;  3VK9 A;  2FD3 A;  1PN0 A;  1EEJ A;  1GTB A;  1XWK A;  2XPE A;  2VAF A;  2CAQ A;  5IPG A;  4K7O A;  3IBH A;  1F9M A;  1GUK A;  3RHC A;  2H1B A;  2IWT A;  3KXO A;  1LU4 A;  4K6X A;  3UL3 A;  4G0I A;  4CDO A;  3TDG A;  4LMW A;  5D96 A;  3GYK A;  2KHP A;  2N5F A;  2YV9 A;  4G2E A;  1TOF A;  1E2Y A;  5HFK A;  1WPI A;  1BJX A;  2CX3 A;  5DQS A;  2QA1 A;  1TU7 A;  1WWJ A;  2H6X A;  2V41 A;  3BD2 A;  1XW5 A;  2HSY A;  3KP8 A;  2C80 A;  3ZYW A;  3QDN A;  1F3B A;  1ABA A;  3GHA A;  1CQH A;  2DML A;  1PX7 A;  2L59 A;  5COH A;  1WE0 A;  2C3T A;  4OMV A;  1PX6 A;  2DC5 A;  2QKE A;  1FOV A;  2K8V A;  3PGT A;  4ML1 A;  1O8X A;  5HR3 A;  1SL1 B;  3L4N A;  3UBL A;  4IEL A;  5DDL A;  3D6I A;  3IAS 2;  5A4W A;  1FAA A;  1PRX A;  1N8J A;  5CRG A;  2G0F A;  1ZOF A;  2P5R A;  2F8F A;  2YWN A;  2B5X A;  3GTU B;  2I9H A;  5ECO B;  2H74 A;  2OKA A;  3HZ4 A;  4GQC A;  3ZTL A;  3ZIJ A;  3ME8 A;  1ERW A;  3I69 A;  4NV2 A;  1K3Y A;  1EEM A;  4JED A;  5IO0 A;  5DJL A;  5KN0 A;  5IMC A;  5C04 A;  2RUF A;  3FK8 A;  2N5B A;  3CBU A;  3WGX A;  2WZ9 A;  4MH2 A;  4BVX B;  5IMZ A;  5D8I A;  4I2U A;  1B9X C;  3UEM A;  1RK4 A;  2R6K A;  3FZA A;  2MBS A;  4IHU A;  4Z2U A;  4MJB A;  3ISO A;  4I8B A;  2DIY A;  3PR8 A;  3GMF A;  2GDR A;  3P7X A;  1V57 A;  2H1A A;  4YKF A;  2P5Q A;  3QAW A;  3WGE A;  2JU5 A;  4J2F A;  3H93 A;  1QUW A;  2YWM A;  4V2N A;  4KCA A;  2GTU A;  1W4V A;  1HNC A;  5GAP D;  4I5Q A;  4K0N A;  1QXH A;  1TW9 A;  3A3T A;  3KEB A;  16GS A;  4HUA A;  1YQ1 A;  1FB6 A;  4TW5 A;  1TDI A;  4HJM A;  4HZ4 A;  1GSU A;  4YH2 A;  2YV7 A;  1PQN A;  4JRR A;  3F9U A;  3VI5 A;  3TJB A;  4MA9 A;  4I6X A;  4Z2R A;  4YAV A;  1V98 A;  1O73 A;  1VF3 A;  2PER A;  3ZZX A;  4GLT A;  1V58 A;  4O5Q A;  2C8U A;  1M0U A;  1XWG A;  2AYT A;  3MNG A;  4ECC A;  5JCW A;  3IK9 A;  5FWG A;  2HSH A;  2TIR A;  4I97 A;  4A5P A;  3PH9 A;  2BMX A;  1ON4 A;  1THO A;  1GSY A;  3VPT A;  1T4Z A;  5HR0 A;  1M9A A;  2IMI A;  2K18 A;  1VF2 A;  4GST A;  3WT2 A;  4TXO B;  4Z7X A;  5F06 A;  3E3E A;  2UZ8 A;  4XS4 A;  2QA2 A;  6GSX A;  2CQ9 A;  2HZF A;  4BVY B;  1LBK A;  3SBC A;  1MDK A;  3IPZ A;  3TRQ A;  2MZC A;  4K5R A;  3U5R E;  4K8M A;  2RUE A;  1WRY A;  17GS A;  3ED3 A;  3F6F A;  1ZMA A;  2X8C A;  3NIV A;  2VCV A;  4USS A;  1Z7P A;  3F0I A;  4RI6 A;  4MJA A;  3DEX A;  2H0H A;  1EGR A;  4ZL8 A;  4IQA A;  3KMN A;  2NDO A;  4KDX A;  2H73 A;  4WEY A;  4EF0 A;  3JCM L;  4JBB A;  2IFQ A;  3P90 A;  2AV4 A;  4YQV A;  3TB2 A;  1Y6E A;  2IMD A;  4X43 A;  4KDY A;  1EOG A;  4BL7 A;  4DSS A;  4K1F A;  5ID2 A;  1R4W A;  4IS0 A;  1K3O A;  2GLR A;  2HRA A;  4XS1 A;  3W8S A;  5CO3 A;  2LUS A;  1QK8 A;  1HQO A;  4IQ1 A;  3E0U A;  3ERW A;  2OE0 A;  2A4H A;  5CRE A;  1T3B A;  3M9J A;  4YAP A;  3IE3 A;  5G31 A;  3TCO A;  3HJO A;  2H30 A;  1ZL9 A;  3S9F A;  1GTA A;  2GSQ A;  1A8L A;  4AJ7 A;  2J23 A;  1A8Y A;  2MMA A;  2F9S A;  2GT5 A;  4TR1 B;  1NSW A;  4MZC A;  4Q5R A;  1QGV A;  1DUG A;  4NV5 A;  2YJH A;  4O32 A;  5GAN D;  1ZYE A;  3IXR A;  3LXT A;  2CT6 A;  2LKU A;  5D9T A;  5DAK B;  2A2S A;  4ZB8 A;  2FCH A;  3FR3 A;  4MCU A;  2REM A;  3FZ9 A;  4Z2T A;  3IR4 A;  2EIR A;  1MEK A;  1F37 A;  5F05 A;  1ZYP A;  3HXS A;  5EVO A;  3M1G A;  5IMD A;  4GTU A;  2A2P A;  4HDE A;  4L5L A;  1XWC A;  3EVI A;  3LJR A;  3LOR A;  2XC2 A;  1ZYN A;  4EL1 A;  5KOX A;  1O85 A;  1X5D A;  3IV4 A;  1BED A;  3GUR A;  3QFB C;  4XTS A;  2YN1 A;  4YQM A;  2HZE A;  1DE1 A;  2H70 A;  1EZK A;  3HVV A;  2KP2 A;  1JFU A;  1SK2 A;  4QL7 A;  2FWG A;  4LLR A;  4TRX A;  2DJ0 A;  2LRN A;  4J56 E;  1S3C A;  1V2A A;  4HS1 A;  2BTO T;  1B48 A;  2XHF A;  2RLI A;  3F63 A;  20GS A;  2VLV A;  2HE3 A;  2NTO A;  5G5E A;  4MZB A;  1S3A A;  1VGL A;  1XXU A;  2EIO A;  3US3 A;  1K0D A;  4OFT A;  3A5I A;  2R0P A;  4DSQ A;  3KTB A;  3TJK A;  5ENU A;  3KMO A;  4NWY A;  3F4T A;  3BJ5 A;  1XBS A;  3TKS C;  4K7N A;  1UVZ A;  4NAX A;  3I9V 2;  2VOC A;  3KD0 A;  1BAY A;  3ERF A;  5DQY A;  3APS A;  3GH9 A;  13GS A;  5AGY A;  2CVD A;  3VLN A;  1Z3E A;  1T8E B;  1U88 A;  3P2A A;  6GST A;  3C7M A;  1XVW A;  3BCK A;  3LYK A;  4P3Y B;  2VIM A;  1OC9 A;  4DSR A;  3EE2 A;  1EV9 A;  3FEU A;  1NM3 A;  1Y25 A;  1I9D A;  3CRU A;  4ZBB A;  4LA1 A;  2HT9 A;  1YY7 A;  3G9B A;  4KDU A;  4KND A;  3K8N A;  4HOJ A;  3WT1 A;  3ZLP A;  3J7Y k;  1GP1 A;  1SK1 A;  4ML6 A;  4KF9 A;  3QFA C;  2QGV A;  3R2Q A;  1M99 A;  2L6D A;  1ZYQ B;  3IDV A;  3APO A;  3FMW A;  4YQU A;  1Q98 A;  2XBQ A;  3G7J A;  2VL2 C;  4GXZ A;  3FY7 A;  4ZBA A;  3ZRD A;  2HSM A;  4PGT A;  3UAR A;  4KX4 A;  3G7Y A;  3GKX A;  2IL3 A;  4OCE A;  3MDK A;  2VL3 A;  5D93 A;  2VL9 A;  4ISD A;  3UBK A;  1WOU A;  1TKD B;  4HI7 A;  1U6T A;  4LMV A;  3O76 A;  2LTK A;  3CYN A;  1TRS A;  3GSS A;  4BA7 A;  1A0F A;  3FKF A;  2DJJ A;  4OD7 A;  5CRW A;  3EU4 A;  5ECR B;  3ZFB A;  4XHM A;  3HJM A;  1FVJ A;  3GX8 A;  1A2M A;  4MH3 A;  14GS A;  3KH9 A;  4WKW A;  4HU9 A;  1OAZ A;  2AHE A;  2XBI A;  3BCI A;  4G19 A;  4ECI A;  4TKY A;  2I3Y A;  4EXJ A;  4KSO A;  1VRS D;  1ACV A;  3QCP A;  2F51 A;  2GGT A;  2R0C A;  5H5R A;  5IQY A;  1K0B A;  3RHB A;  4ZXG A;  4XS6 A;  2YWO A;  5H5Q A;  1KTE A;  1B8X A;  1ERU A;  4MPG A;  1HNB A;  2VM2 A;  2FNO A;  2FUG 2;  1A24 A;  1J08 A;  4D73 B;  9GSS A;  3EWL A;  3GNJ A;  2D2Z A;  1SL0 B;  2NPB A;  1XOB A;  1W89 A;  1C72 A;  2OBI A;  3RPP A;  2C0G A;  3I6A A;  1OVN A;  3LG6 A;  2JSY A;  3TUE A;  3RDW A;  1SYR A;  4IVF A;  1EGO A;  4N0V A;  2BJX A;  1JHB A;  4N30 A;  4K7I A;  1J9B A;  2QC7 A;  4IJI A;  3HVX A;  3EYT A;  4RQR A;  1SD9 A;  5G2Z A;  1PKW A;  1ZZY A;  5EPF A;  1I5G A;  2C0D A;  4F0C A;  3U6V A;  4HJ2 A;  5AIX A;  3F3Q A;  3CMI A;  1KEB A;  1JZR A;  1HNA A;  3H8Q A;  1TRU A;  2H1D A;  22GS A;  2MMZ A;  3GUS A;  3IAM 2;  3UIW A;  3D4M A;  2HRN A;  4EE0 A;  4GSS A;  3APQ A;  1XIY A;  1XZO A;  3D21 A;  5C00 A;  3IRA A;  4V1A p;  2J9H A;  4OFM A;  2X64 A;  4IJ3 A;  6GSW A;  2C0F A;  3FW2 A;  4N11 A;  3WYW A;  1M2B A;  5HR1 A;  1K0C A;  1VF4 A;  3EMP A;  1QQ2 A;  4JR4 A;  2JZS A;  1URM A;  3F3R A;  6GSU A;  5L71 A;  3F4S A;  1GSS A;  3ZL5 A;  2H71 A;  3CSH A;  4ECB A;  3RPN A;  3F4R A;  3SWL A;  2B1K A;  1B4P A;  1N2A A;  3O6T A;  4KH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...