1DSBA

Crystal structure of the dsba protein required for disulphide bond formation in vivo
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
188
structure length
188
Chain Sequence
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DSBA
publication title Crystal structure of the DsbA protein required for disulphide bond formation in vivo.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Disulfide oxidoreductase
total genus 69
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1dsbA00
4HUAA 4JU5A 3V1WA 4MMMA 2WDUA 4X43A 4K0GA 3ZMLA 2LRTA 1J08A 3F0IA 1TP9A 3TUEA 1Z7PA 2H71A 2LJAA 2DJ1A 1EGOA 3QR6A 3M0FA 1A2JA 3ZFBA 1VF1A 1T3BA 2M80A 3A2WA 3GX0A 1FB0A 1V2AA 5IQYA 22GSA 1B9XC 3RDWA 2L57A 3O3TA 3PH9A 5ECMB 1GRXA 2EIRA 2F51A 2VD0A 1ZL9A 2CAQA 3FRCA 1I9DA 4Q5NA 2VLVA 5G30A 1ERVA 3C1SA 1TW9A 3TKSA 4KSMA 1DE2A 3KM6A 1NW2A 3GKMA 5A4VA 3UARA 5HR0A 3BD2A 1WP0A 3CTFA 4TVEA 3GMFA 3FZ4A 2H6ZA 1JLWA 4ML1A 2P0GA 3PR8A 2NTOA 5ECSA 1BYEA 1EEJA 2C0DA 4OMVA 1N8JA 3VPTA 5JWOB 3JCML 2R6KA 3D4TA 17GSA 2LQOA 1H4OA 3EMXA 1GSSA 1N2AA 1X5DA 4PNGA 4MP4A 1ST9A 4F2IA 4L0UA 4TR0A 4KAEA 1UN2A 2I4AA 2R3XA 2C1YA 2HI7A 1G7OA 3I43A 3QPMA 4MCUA 5GAPD 2YN1A 5D9XA 2WJUA 2C3QA 1TXXA 3HDCA 1JZOA 4V2NA 5DJMA 4EKZA 3U6VA 2GSTA 1R5PA 4MABA 3F8UA 2JACA 4KH7A 3NIVA 4BPYA 2YP6A 4JE1A 4PNFA 5C04A 4BVYA 1GLQA 4LL1B 2JL4A 1KNGA 5IIZA 2X8GA 1AQVA 4N0VA 1M2AA 1GUKA 5G2ZA 1MD4A 2MBTA 2IPAA 5D96A 1F9MA 5JWQB 2GSSA 1OC3A 4GQCA 2IJYA 4GQFA 5ECNB 1VRSD 1T4YA 4O7HA 1OAZA 3VLNA 3F4SA 2GGTA 2K8VA 3PINA 2H1AA 1AXDA 2VCVA 4QL7A 1E2YA 2LNSA 1K3YA 3GKKA 1O7UA 5IPHA 1F6MC 3NOFA 3RPNA 5ECIB 5J4UA 2OJLA 2R37A 2C3NA 4ZL9A 3CSIA 2VM2A 2N5FA 2OE0A 4L8EA 2FWHA 4GRFA 1KTEA 1TI1A 2EC4A 2IFQB 2WGRA 3VK9A 2QC7A 2WS2A 3D4MA 1URMA 4ECBA 5LNKe 1ZZYA 2KUCA 5D9VA 1B9YC 1F3AA 1M0UA 4IKHA 3EYTA 2AYTA 5HR2A 3ME7A 3UAPA 2F8FA 3ME8A 1DUGA 3WGXA 2H72A 2LKUA 4N10A 3G7JA 5J41A 1WMJA 2H1GA 1YF0A 5LCZA 1A23A 4F0CA 2YJHA 1G6YA 5HFKA 1TJDA 2HRFA 3QMXA 5INYA 5FHIA 3UJ1A 3QDNA 2GVPA 4ZB9A 1K0CA 4XHMA 4MZCA 1K3LA 12GSA 4N11A 3DEXA 1BEDA 1JHBA 4IQAA 19GSA 2PN8A 1U3AA 1YEXA 4G9HA 4GCIA 2GTUA 3LFLA 3AY8A 3I9V2 3TJJA 4PUAA 4GSNA 3H4KA 3C7MA 1BJXA 4IQ1A 3BJ5A 3CBUA 1X9SB 2H0GA 3FR3A 3QOUA 1FB6A 2OACA 2JADA 4OCFA 1M9AA 3D5JA 3ZZXA 4E8EA 1F2EA 1Y6EA 2VCXA 1AQWA 3ZIVA 3FW2A 1XWCA 1JZWA 1QXHA 1GL8A 1BX9A 1A8LA 1CQHA 5DCGA 1DSBA 3L9UA 1F37A 3BBYA 1ZYEA 4TR4A 4WR4A 3WT1A 2MMOA 2IMIA 1FW1A 2OBKA 4ULXA 3HJMA 1I5GA 2NDOA 2YWNA 2A4VA 1U6TA 5D9TA 2GLRA 1XPVA 1CQGA 5F07A 1K0MA 1GSYA 1PKWA 3KJYA 2NVLA 1EZKA 2V6OA 4D73B 1X5CA 3KH7A 1QGVA 1THOA 4WF5A 4P3YB 1T7PB 3F9UA 1XOAA 1XW9A 2M46A 1YKCA 1X0RA 5KEJA 2HXKA 2XC2A 3C71A 2H73A 4HU7A 2MMAA 3DVXA 3DWVA 2FHEA 1PX6A 4CHSA 1EV4A 5EY6A 4J57E 1PA3A 2CX4A 2DJJA 2LJRA 4PQIA 4WBRD 4IELA 4MA9A 2REMA 3VI7A 3KZQA 1G6WA 2HT9A 6GSYA 5G1KA 4CW9A 1GTIA 3WGDA 4KDUA 3IOSA 2ON5A 2L5LA 4Q5QA 4K7OA 3HKRA 4ACSA 3A2VA 2KHPA 4TRXA 3TJFA 3FY7A 11GSA 4ZILA 3CXGA 1TOFA 2VOCA 3VWVA 1M99A 3VPQA 1OYJA 5DVBA 1OC9B 1YEPA 4MH3A 2PPTA 5GSTA 3FKFA 4KE3A 2I3YA 4G19A 2JZSA 1O85A 3ZITA 1J9BA 1OC9A 3LJRA 3LSZA 3QFAC 2LRNA 1WJKA 5CNWA 3ZRDA 2PWJA 5IMZA 5J9BA 2O8VB 1AW9A 1R26A 2IMDA 1R7HA 3LYPA 1IYIA 2CVBA 4TKYA 4GXZA 4PURA 3HD5A 4XIHA 3H93A 4TXOA 2WZ9A 1YJ6A 4IN0A 3VI5A 2AB6A 2VD1A 3MSZA 1QFNA 1XFLA 1MDJA 4L5OA 2WB9A 3FK8A 4KSOA 5DDLA 1T4ZA 1R5AA 2R4VA 2H70A 4MJCA 2VL3A 5H5SA 3KEBA 3RHCA 5KN0A 4TOPA 1R4WA 5IM9A 2N5AA 2H74A 2CX3A 1ZCPA 3M9JA 2IIYA 4MF5A 3VWXA 3MWHA 3K8NA 4FIWA 4MDCA 4IGJA 3GA4A 1HNBA 2LTKA 4LMVA 3HA9A 4YAVA 2B3SA 5GAND 2LJKA 4I2UA 1KEBA 5JCGA 1GUHA 4MK3A 2FY6A 1C72A 4WKWA 2LRCA 4MJEA 4RI6A 4V1Ap 1BG5A 4FO5A 4K1FA 3EWLA 5H5RA 1GNEA 2H66A 3E9JB 3G7YA 3CTGA 4YQMA 1TK0B 2KOKA 4TW5A 3QD9A 3L4NA 2GZZA 2AUVA 3EMPA 5G31A 4V2LA 2OKAA 2OBIA 4JR6A 5FT3A 2HLSA 3IC4A 1AUCA 3CRTA 1TDIA 2NPBA 3H79A 3GRXA 3TKPA 5AISA 1PGTA 1RK4A 1ERTA 5ECQB 3EE2A 2XBIA 2JU5A 2ALBA 4ZIJA 3VWWA 3HJPA 1GSFA 4KNDA 3CSHA 2B1LA 1TTZA 6GSUA 2FLSA 2X64A 3ZVJA 5ID2A 2RUEA 1WWJA 1QQ2A 1XWBA 2QKEA 4NV5A 1OC8A 5HR1A 4IW9A 5C00A 1NM3A 2HZEA 2FNOA 5DQSA 1BQ7A 1V40A 2PMTA 2CAIA 3GNJA 3HY2A 2IN3A 4POMA 3M8NA 1KBNA 1FAAA 3TJKA 3LYKA 5B8AA 3C73A 3S9FA 1NSWA 4IS0A 1NHOA 1XCCA 3IPZA 4J56E 4LMWA 2VO4A 3H1NA 4HEA2 5EPFA 3US3A 5IOWA 4PXOA 4EUYA 2LQQA 2LV3A 2H8LA 4OCEA 4PX1A 2GSRA 2DIYA 1H75A 2B7JA 2H30A 2GT5A 5G1LA 1W4VA 5F8BA 3KD0A 1XW5A 5G5EA 4OFMA 4JZQA 1VF4A 2WFCA 5CRHA 2FD3A 4YH2A 4YQUA 1XVQA 4X0XA 4OFTA 4ISDA 2A2SA 4XRAA 4IVFA 4G10A 3VWUA 5DALA 4BWQA 2R2JA 2TRCP 3IK9A 2ON7A 1Z5YE 3CYNA 3WD6A 3GUSA 3TKSC 3RPPA 5DBQA 4WF4A 1SL1B 2GZPA 1XWGA 4JEDA 5JCUA 3FZAA 4QL9A 3F4RA 3ZFLA 1GSEA 2CZ3A 2GQMA 5ABRA 4KA0A 5IMAA 2C3TA 5ECOB 1ZYQB 4HZ2A 2O7KA 2AHEA 1Z7RA 2L5OA 5ECHB 3W8JA 4LL4B 4PGTA 5J3RA 3IBHA 3CRUA 3LGCA 2PVOC 4KDYA 1FVJA 3QFBC 2L4CA 3WT2A 4GLTA 2HZFA 4ZXGA 4BVXA 5CYYA 4O92A 2C8UA 4PUFC 1LBKA 1T8EB 5GSSA 4ML6A 1X5EA 3GL3A 2MMZA 1TU7A 1WIKA 4ECIA 2GZYA 2YZUA 1XWKA 1U88A 3N9JA 5A4UA 5AIVA 2AJQB 3D0ZA 1DBYA 3L9SA 4HQZA 1X9WB 1PMTA 2BJXA 3ZTLA 1MTCA 1EEMA 2DLXA 4ZBBA 5IPGA 3ERWA 2YWMA 1PQNA 4LLRA 3H8QA 1O8XA 4CDOA 3IAM2 3M3MA 4RQRA 1DE1A 4H86A 1GTBA 3F3RA 2F9SA 3EVIA 3HYPA 5KN2A 5COHA 4MZWA 4HDEA 1A24A 1AAZA 2VL2A 3RAZA 2PBJA 1MEKA 5ECLB 1Z6MA 1YY7A 5B7CA 2K18A 3KMNA 2YANA 2CT6A 3GN3A 4HOJA 4WR5A 1OE8A 3IRAA 3KIJA 1GUMA 3J7Yk 1PL1A 3HVXA 3GTUA 3Q18A 4XRDA 1SU9A 4PQHA 3IHQA 1WE0A 4KGIA 3DYRA 1JFUA 1IYHA 3IXRA 3DVWA 4POBA 4TR1A 1S3AA 2HRNA 1K3OA 5CO3A 5HFGA 1TK5B 4K6XA 3ZL5A 3IV4A 2CZ2A 2H6XA 4AJ7A 5CRDA 2VCTA 4AJ6A 2L6CA 1SD8A 3J7Yb 2LUSA 2RIIA 4DSSB 2AAWA 2H0HA 2GQLA 3QCPA 1TKDB 2R5GA 1EOHA 3FEUA 4MJAA 4WBJA 4AJ8A 2DJ2A 1GLPA 2QGVA 2E2MA 5D9WA 4DSSA 4TXVA 1SJ6A 2AV4A 2VLTA 1EWXA 2VM1A 1RQMA 3G7IA 4IHUA 3HHVA 2OA7A 1MDKA 1OVNA 2VL2C 1PSQA 1K0DA 2YCDA 1PX7A 4ECCA 1LU4A 2JSZA 4FH8A 2L4QA 1O6JA 4HJ2A 3SBCA 1M2BA 2YWOA 1XWAA 3Q74A 4YAPA 2GSQA 2HSYA 2ES7A 2FWEA 3HZ4A 1O8WA 3L0HA 4Q5FA 1GULA 4KUNA 3E3EA 1K0BA 1A2MA 3FHKA 4XCSA 3RHBA 5IOXA 4K9ZA 1MD3A 2FA4A 2GQKA 3IA1A 4EO3A 2XBQA 2LNTA 2DJ3A 3DKSA 3UOMA 3M1GA 3A5WA 4X1UA 3VURA 3GKXA 4ILFA 2X8HA 2YOIA 1F3BA 5DQYA 5HQPA 2C0GA 4GSSA 4I2TA 3E0UA 1GH2A 4ECJA 2VCWA 1FOVA 3I6AA 3GL5A 3HJOA 1GNWA 4ZBAA 1EGRA 1FG4A 1S3DA 3C8EA 1EOGA 1FHEA 4NXIA 1TRSA 4NPBA 1SJIA 4AGSA 2FA8A 1V98A 3F3QA 3MNGA 2FCHA 1Q4JA 5HR3A 1PKZA 5IMCA 5H5QA 3ZIJA 3KTBA 2YWIA 3EU4A 4IP6A 5ELAA 1GWCA 4KCAA 5F06A 3APOA 4HJMA 3D6IA 4EDYA 4L0WA 1ABAA 4TXOB 6GSVA 3TJGA 3ZLPA 3GURA 4EE0A 1UC7A 2B5YA 2V1MA 2V6KA 3LQ7A 2DIZA 4XS6A 4ZBDA 4BL7A 3LWAA 2J23A 4F82A 4Z7XA 3KMOA 1A2LA 5B8BA 1GTUA 3C1RA 4ID0A 4JRRA 4FYBA 1B8XA 5F0GA 4L5LA 3UVHA 6GSSA 1T00A 1M7TA 3OR5A 3GSSA 2HSHA 1Y25A 1XBSA 1UA5A 4MLYA 3DRNA 1TI3A 4DSRA 6GSXA 3UVTA 1ZMAA 2C80A 1WPIA 2VIMA 3KP8A 3IDVA 1TK8B 3D21A 1QK8A 20GSA 3ZMKA 4POKA 1FO5A 1USBA 3KP9A 2VAFA 2B6MA 2F3MA 1ZGNA 2G2QA 3HVSA 1TRVA 5AGYA 4IP1A 1FVKA 2I81A 3D22A 2CV4A 4V1Ag 4BA7A 1M2DA 1HNAA 6GSTA 3DMLA 4EF0A 2P5RA 1Z3EA 1AIUA 1A0FA 3GSTA 4MF7A 4EDZA 4EL1A 5ID2B 4XS4A 1TRUA 2VCQA 3BCIA 2IL3A 1XIYA 3TJBA 3UEMA 3FZ9A 2H01A 1ILOA 2H0IA 1W89A 5IO2A 2YPMA 1PL2A 3HVVA 2IMEA 16GSA 1THXA 2G0FA 2HZEB 3ZVJD 2V41A 5ELGA 5DJLA 1SK1A 1GSDA 3N5OA 1QMVA 3GH9A 2K8SA 4KX4A 4ZL8A 5B6MA 4J2FA 3WGEA 1PN9A 5J5NA 2BTOT 5CAXA 4RI7A 3A2XA 1S3CA 1K0OA 4K8MA 3I69A 14GSA 2BMXA 5GZZB 4EXJA 4OO5A 1U87A 1ON4A 2DMMA 3GHAA 2HFDA 2O85A 2FGXA 2FWGA 3FZ5A 2H6YA 2CVDA 3FR9A 7GSSA 4K7IA 4MZBA 3QAGA 3TKRA 5D8IA 2E7PA 4HQSA 5ECKB 3SWLA 5IMVA 4I6XA 2B5EA 2DJ0A 3U5RE 1JLVA 1LJRA 1SL2B 4GTUA 5CREA 5DALB 4ZB6A 4OO4A 1VF3A 3W8SA 1ACVA 5CRWA 4EC0A 2KP1A 2MZCA 2A2RA 4WETA 3F4TA 1NHYA 1SYRA 3BCKA 2E0QA 2JZRA 3IE3A 4K7NA 3L78A 4N30A 5IO0A 4FYCA 1V9WA 2OE1A 1AQXA 2K9FA 2PU9C 1SENA 3GFKA 3EC3A 1EP8A 2B5XA 3A3TA 1YZXA 3EU3A 5IMDA 3IK7A 2N5BA 4HZ4A 3QAWA 3TOUA 5IMFA 1RW1A 3L9VA 5D93A 2IMFA 1SL0B 1U3IA 1ZOFA 3ED3A 3EINA 4RQXA 4F0BA 2B1KA 3G9BA 2GDRA 1AC1A 3GH6A 3UL3A 2TRXA 2I9HA 4ZL7A 3DXBA 2YJ7A 1SKSB 3TDGA 2DJKA 2RUFA 1V58A 4IJIA 1GP1A 2L59A 2ZUPA 3UBLA 5L71A 4WXTA 4I8BA 3W6GA 5B6NA 1O73A 2OADA 2DC5A 3IAS2 4KB3A 2GT6A 1GSUA 2YV7A 3ZREA 2C0EA 2XHFA 5EL8A 4DSQA 3HXSA 4F03A 2F8AA 1OE7A 5D73A 4NHWA 4NHZA 3DD3A 4Q5RA 2O87A 1WOUA 2YV9A 3GTUB 4NV2A 2IMKA 2IFQA 2GS3A 3FR6A 5JCWA 4HI7A 3PGTA 2PUKC 3F6FA 3KTLA 2X8CA 3UBKA 3TGZA 2IWTA 3ISOA 3RBTA 1A0RP 4TR1B 2RM6A 1SYXA 5EVOA 2I1UA 2CVKA 5ECPB 2H76A 3MDKA 4MF6A 4XS1A 4JR4A 4K0NA 2K6VA 4GF0A 2OE3A 3GIXA 4AF2A 3P8WA 2DBCA 2JSYA 2H1BA 1EV9A 2MBSA 5HFIA 1SJZA 2QSIA 2RLIA 4TR3A 4FYUA 1ERUA 4G2EA 4BWSA 1UVZA 3DGQA 5A4WA 1ML6A 2KP2A 4RUVA 5A5KA 2YNXA 1YDKA 1TRWA 1J0FA 1G0TA 3TCOA 4GSTA 3MAKA 1OKTA 4NWYA 3O6TA 1VF2A 2XPDA 1V57A 3TRPA 1PRXA 4ZB8A 4IBPA 2CQ9A 4MH2A 2CA8A 2X99A 2P31A 4N0ZA 3TB2A 2MYGA 1ERWA 3F63A 1GTAA 2E2GA 1M9BA 3ZYWA 1Q98A 3GKNA 3KXOA 1YF1A 2EIOA 4I5QA 2WRTA 1O81A 2PERA 4EVMA 3Q19A 3KCMA 3CMIA 1T1VA 1EP7A 1SK0A 3GV1A 4MPFA 3QAVA 4KW6A 1VGLA 3APQA 3EURA 5CP1A 4MPGA 1SKWB 4V2MA 1WRYA 5ENUA 1XXUA 8GSSA 3ERGA 3HZ8A 2XPEA 2Z9SA 1XZOA 13GSA 2HE3A 5DCHA 1SK2A 3DIEA 1XW6A 4OD7A 5DAKB 3P7XA 4D73A 4IJ3A 1YKAA 2C0FA 1SD9A 4NAXA 2HYXA 5KN1A 3TRXA 3LXZA 3O76A 4LA1A 3M9KA 1MDIA 2LEGA 5DAKA 1G7EA 2NBSA 4DEJA 2M72A 5E4WA 4MJBA 2VUPA 4YQVA 2ZNMA 1XOBA 2H19A 2ZCTA 4QQ7A 2HNLA 4XTSA 1PD21 2JZTA 2P5QA 4NMUA 2B7KA 2VCZA 5ECRB 3F6DA 2YZHA 4WEYA 5E59A 1TU8A 3CSJA 4KCEA 3KGKA 4I97A 1JZRA 2H75A 4O32A 3LORA 1K0NA 3UMAA 5J9CA 1JZDA 3GYKA 1K0AA 1HNCA 1HYUA 3VFIA 2VLUA 2PVQA 4GWRA 1YQ1A 4OWYA 3LG6A 4KDXA 1A8YA 4HU9A 3KH9A 5F05A 9GSSA 3APSA 10GSA 2FUG2 4DVCA 5JWRB 5CRGA 3NZNA 2C4JA 2DSAA 5KN3A 4JBBA 4O5RA 1Z9HA 1X9MB 2V32A 2H1DA 4OFNA 2V2GA 2RM5A 4E8HA 4HS1A 1OKDA 5FWGA 5G5FA 1B4QA 3TOTA 2PGTA 1E6BA 3TKSE 2FWFA 1HD2A 4K2DA 2MMNA 1B48A 3UIWA 2O89A 3R2QA 2LS5A 1SKRB 3BOAA 2LSTA 2WCIA 2J9HA 5AIXA 3WYWA 2VL9A 2KLXA 4PQ1A 3FYGA 1GSQA 5LD0A 3ERFA 3GX8A 3TKQA 18GSA 2TIRA 5AN1A 2DMLA 1Z6NA 3IR4A 2WULA 1HQOA 3Q6OA 3TRQA 2L6DA 4XS4B 1BAYA 2EIQA 4TN8A 3HCZA 2D2ZA 4F9ZA 1XVWA 3LXTA 3P90A 1QUWA 3LEFA 4POLA 6GSWA 1B4PA 3P2AA
chains in the Genus database with same CATH superfamily
4HUAA 4JU5A 3V1WA 4MMMA 2WDUA 4X43A 4K0GA 3ZMLA 2LRTA 1J08A 3F0IA 4HSCX 1TP9A 3TUEA 1Z7PA 2H71A 2LJAA 4X4JA 2DJ1A 1EGOA 3QR6A 3M0FA 2QA2A 1A2JA 3ZFBA 1VF1A 1T3BA 2M80A 3A2WA 3GX0A 1FB0A 1V2AA 5IQYA 22GSA 1B9XC 3RDWA 2L57A 3O3TA 3PH9A 5ECMB 1GRXA 2EIRA 2F51A 2VD0A 1ZL9A 2CAQA 3FRCA 1I9DA 4Q5NA 2VLVA 5G30A 1ERVA 3C1SA 1TW9A 3TKSA 4KSMA 1DE2A 3KM6A 1NW2A 3GKMA 5A4VA 3UARA 4CY8A 5HR0A 3BD2A 1WP0A 3CTFA 4TVEA 3GMFA 3FZ4A 2H6ZA 1JLWA 4ML1A 2P0GA 3PR8A 2NTOA 3A5IA 5ECSA 1BYEA 1EEJA 2C0DA 4OMVA 1N8JA 3VPTA 5JWOB 3JCML 5BMUA 2R6KA 3D4TA 17GSA 2LQOA 1H4OA 3EMXA 1GSSA 1N2AA 1X5DA 4PNGA 4MP4A 1ST9A 4F2IA 4L0UA 4TR0A 4KAEA 1UN2A 2X49A 2I4AA 2R3XA 2C1YA 2HI7A 1G7OA 3I43A 3QPMA 4MCUA 5GAPD 2YN1A 5D9XA 4BVYB 2WJUA 2C3QA 1TXXA 3HDCA 1JZOA 4V2NA 5DJMA 4K2XA 4EKZA 3U6VA 2GSTA 1R5PA 4MABA 3F8UA 2JACA 4KH7A 3NIVA 4BPYA 2YP6A 4JE1A 4PNFA 5C04A 4BVYA 1GLQA 4LL1B 2JL4A 1KNGA 5IIZA 2X8GA 1AQVA 4N0VA 4ICYA 1M2AA 1GUKA 5G2ZA 1MD4A 2MBTA 2IPAA 5D96A 1F9MA 5JWQB 2GSSA 1OC3A 4GQCA 2IJYA 4GQFA 5ECNB 1VRSD 1T4YA 4O7HA 1OAZA 3VLNA 3F4SA 2GGTA 2K8VA 3PINA 2H1AA 1AXDA 2VCVA 4QL7A 1E2YA 2LNSA 1K3YA 3GKKA 1O7UA 5IPHA 1F6MC 3NOFA 3RPNA 5ECIB 5J4UA 2OJLA 4G0KA 2R37A 2C3NA 4ZL9A 3CSIA 2VM2A 2N5FA 2OE0A 4L8EA 2FWHA 3IHGA 4GRFA 1KTEA 1TI1A 2EC4A 2IFQB 2WGRA 3VK9A 2QC7A 2WS2A 3D4MA 1URMA 4ECBA 5LNKe 1ZZYA 2KUCA 5D9VA 1B9YC 1F3AA 1M0UA 4IKHA 3EYTA 2AYTA 5HR2A 3ME7A 3UAPA 2F8FA 3HVNA 3ME8A 1DUGA 3WGXA 2H72A 2LKUA 4N10A 3G7JA 5J41A 1WMJA 2H1GA 1YF0A 5LCZA 1A23A 4F0CA 2YJHA 1G6YA 5HFKA 1TJDA 2HRFA 3QMXA 5INYA 5FHIA 3UJ1A 3QDNA 2GVPA 4ZB9A 1K0CA 4XHMA 4MZCA 1K3LA 12GSA 4N11A 3DEXA 1BEDA 1JHBA 4IQAA 19GSA 2PN8A 1U3AA 1YEXA 4G9HA 4GCIA 2GTUA 3LFLA 3AY8A 3I9V2 3TJJA 4PUAA 4GSNA 3H4KA 3C7MA 1BJXA 4IQ1A 3BJ5A 3CBUA 1X9SB 2H0GA 3FR3A 3QOUA 1FB6A 2OACA 2JADA 4OCFA 1M9AA 3D5JA 3ZZXA 4PTSA 4E8EA 1F2EA 1Y6EA 2VCXA 1AQWA 3ZIVA 3FW2A 1XWCA 1JZWA 1QXHA 1GL8A 1BX9A 1ZYPA 1A8LA 1CQHA 5DCGA 4A5PA 1DSBA 3L9UA 1F37A 3BBYA 1ZYEA 4TR4A 4WR4A 3WT1A 2MMOA 2IMIA 1FW1A 2OBKA 4ULXA 3HJMA 1I5GA 2NDOA 2YWNA 2A4VA 1U6TA 5D9TA 2GLRA 1XPVA 1CQGA 5F07A 1K0MA 1GSYA 4MNNA 1PKWA 3KJYA 2NVLA 1EZKA 2V6OA 4D73B 1X5CA 3KH7A 1QGVA 1THOA 4WF5A 4P3YB 1T7PB 3F9UA 1XOAA 1XW9A 2M46A 1YKCA 1X0RA 4K5SA 5KEJA 2HXKA 2XC2A 3C71A 2H73A 4HU7A 2MMAA 3DVXA 5BRTA 3DWVA 2FHEA 1PX6A 4CHSA 1EV4A 5EY6A 4J57E 1PA3A 2CX4A 2DJJA 2LJRA 4PQIA 4WBRD 4IELA 4MA9A 2REMA 3VI7A 3KZQA 1G6WA 2HT9A 6GSYA 5G1KA 1FOHA 4CW9A 1GTIA 3WGDA 4KDUA 1XG8A 3IOSA 2ON5A 2L5LA 4Q5QA 4K7OA 3HKRA 4ACSA 3A2VA 2KHPA 4TRXA 3TJFA 3FY7A 11GSA 4ZILA 3CXGA 4YKFA 1TOFA 1PN0A 2VOCA 3VWVA 1M99A 3VPQA 1OYJA 5DVBA 1OC9B 1YEPA 4MH3A 2PPTA 5GSTA 3FKFA 4KE3A 2I3YA 4G19A 2JZSA 1O85A 3ZITA 1J9BA 1OC9A 3LJRA 1ZYNA 3LSZA 3QFAC 2LRNA 1WJKA 5CNWA 3ZRDA 2PWJA 5IMZA 5J9BA 2O8VB 1AW9A 1R26A 2IMDA 1R7HA 3LYPA 1IYIA 2CVBA 4TKYA 4GXZA 4PURA 3HD5A 4XIHA 3H93A 4TXOA 4G0LA 2WZ9A 1YJ6A 4IN0A 3VI5A 2AB6A 2VD1A 3MSZA 1QFNA 1XFLA 1MDJA 4L5OA 2WB9A 3FK8A 4KSOA 5DDLA 1T4ZA 1R5AA 2R4VA 2H70A 4MJCA 2VL3A 5H5SA 3KEBA 3RHCA 5KN0A 4TOPA 1R4WA 5IM9A 2N5AA 2H74A 2CX3A 1ZCPA 3M9JA 2IIYA 4CY6A 4MF5A 3VWXA 3MWHA 3K8NA 4FIWA 4MDCA 4IGJA 3GA4A 1HNBA 2LTKA 4LMVA 3HA9A 4YAVA 2B3SA 5GAND 2LJKA 4I2UA 1KEBA 5JCGA 1GUHA 4MK3A 4YKGA 2FY6A 1C72A 4WKWA 2LRCA 4MJEA 4RI6A 4V1Ap 1BG5A 4FO5A 4K1FA 3EWLA 5H5RA 1GNEA 2H66A 3E9JB 3G7YA 3CTGA 4YQMA 1TK0B 2KOKA 4TW5A 3QD9A 3L4NA 2GZZA 2AUVA 3EMPA 5G31A 4V2LA 2OKAA 2OBIA 4JR6A 5FT3A 2HLSA 3IC4A 1AUCA 3CRTA 1TDIA 2NPBA 3H79A 3GRXA 3TKPA 5AISA 1PGTA 1RK4A 1ERTA 5ECQB 3EE2A 2XBIA 2JU5A 2ALBA 4ZIJA 3VWWA 3HJPA 1GSFA 4KNDA 3CSHA 2B1LA 1TTZA 6GSUA 2FLSA 2X64A 3ZVJA 5ID2A 2RUEA 1WWJA 1QQ2A 1XWBA 2QKEA 4NV5A 1OC8A 3CQFA 5HR1A 4IW9A 5C00A 1NM3A 2HZEA 2FNOA 5DQSA 1BQ7A 1V40A 2PMTA 2CAIA 3GNJA 3HY2A 2IN3A 4POMA 3M8NA 1KBNA 1FAAA 3TJKA 3LYKA 5B8AA 3C73A 3S9FA 1NSWA 4IS0A 1NHOA 1XCCA 3IPZA 4J56E 4LMWA 2VO4A 3H1NA 4HEA2 5EPFA 3US3A 5IOWA 4PXOA 4EUYA 2LQQA 2LV3A 2H8LA 4OCEA 4PX1A 2GSRA 2DIYA 1H75A 2B7JA 2H30A 2GT5A 5G1LA 2R0GA 1W4VA 5F8BA 3KD0A 1XW5A 5G5EA 4BIKA 4OFMA 4JZQA 1VF4A 2WFCA 5CRHA 2FD3A 4YH2A 4YQUA 1XVQA 4X0XA 4OFTA 4ISDA 2A2SA 4XRAA 4Z2UA 4IVFA 4G10A 3VWUA 5DALA 4BWQA 2R2JA 2TRCP 3IK9A 2ON7A 1Z5YE 3CYNA 3WD6A 3GUSA 3TKSC 3RPPA 5DBQA 4WF4A 1SL1B 2GZPA 1XWGA 4JEDA 4USSA 5JCUA 3FZAA 4QL9A 3F4RA 3ZFLA 1GSEA 2CZ3A 2GQMA 5ABRA 4KA0A 5IMAA 2C3TA 5ECOB 1ZYQB 1M3IA 4HZ2A 2O7KA 2AHEA 1Z7RA 2L5OA 5ECHB 3W8JA 4LL4B 4PGTA 5J3RA 3IBHA 3CRUA 3LGCA 2PVOC 4KDYA 1FVJA 3QFBC 2L4CA 3WT2A 4GLTA 3LW9A 2HZFA 4ZXGA 4BVXA 5CYYA 4O92A 2C8UA 4PUFC 1LBKA 1T8EB 5GSSA 4ML6A 1X5EA 3GL3A 2MMZA 1TU7A 1WIKA 4ECIA 2GZYA 2YZUA 1XWKA 1U88A 3N9JA 5A4UA 5AIVA 2AJQB 3D0ZA 1DBYA 2R0CA 3L9SA 4HQZA 1X9WB 3EPTA 1PMTA 2BJXA 3ZTLA 1MTCA 1EEMA 2DLXA 4ZBBA 5IPGA 3ERWA 2YWMA 1PQNA 4LLRA 3H8QA 1O8XA 4CDOA 3IAM2 3M3MA 4RQRA 1DE1A 4H86A 1GTBA 3F3RA 2F9SA 3EVIA 3HYPA 5KN2A 5COHA 4MZWA 4HDEA 1A24A 1AAZA 2VL2A 3RAZA 2PBJA 1MEKA 5ECLB 1Z6MA 1YY7A 5B7CA 2K18A 3KMNA 2YANA 2CT6A 3GN3A 4HOJA 4WR5A 1OE8A 3IRAA 3KIJA 1GUMA 3J7Yk 1PL1A 3HVXA 3GTUA 3Q18A 4XRDA 1SU9A 4PQHA 3IHQA 1WE0A 4KGIA 3DYRA 1JFUA 1IYHA 3IXRA 3DVWA 4POBA 4TR1A 1S3AA 2HRNA 1K3OA 5CO3A 5HFGA 1TK5B 4K6XA 3ZL5A 1M3JA 3IV4A 2CZ2A 2H6XA 4AJ7A 5CRDA 2VCTA 2HRKA 4AJ6A 2L6CA 1SD8A 3J7Yb 2LUSA 2RIIA 4DSSB 2AAWA 2H0HA 2GQLA 3QCPA 4FQUA 1TKDB 2R5GA 1EOHA 3FEUA 4MJAA 4WBJA 4AJ8A 2DJ2A 1GLPA 2QGVA 2E2MA 5D9WA 4DSSA 4TXVA 1SJ6A 2AV4A 2VLTA 1EWXA 2VM1A 1RQMA 3G7IA 4IHUA 3HHVA 2OA7A 2DKHA 1MDKA 1OVNA 2VL2C 1PSQA 1K0DA 2YCDA 1PX7A 4ECCA 1LU4A 2JSZA 4FH8A 2L4QA 1O6JA 4HJ2A 3SBCA 1M2BA 2YWOA 1XWAA 3Q74A 4YAPA 2GSQA 2HSYA 2ES7A 2FWEA 3HZ4A 1O8WA 3L0HA 4Q5FA 1GULA 4KUNA 3E3EA 1K0BA 1A2MA 3FHKA 4XCSA 3RHBA 5IOXA 4K9ZA 1MD3A 2FA4A 2GQKA 3IA1A 4EO3A 2XBQA 2LNTA 2DJ3A 3DKSA 3UOMA 3M1GA 3A5WA 4X1UA 3VURA 4EIQA 3GKXA 4ILFA 2X8HA 2YOIA 1F3BA 5DQYA 5HQPA 2C0GA 4GSSA 4I2TA 3E0UA 1GH2A 4ECJA 2VCWA 1FOVA 3I6AA 3GL5A 3HJOA 1GNWA 4ZBAA 1EGRA 1FG4A 1S3DA 3C8EA 1EOGA 1FHEA 4NXIA 1TRSA 4NPBA 1SJIA 4AGSA 2FA8A 1V98A 3F3QA 3MNGA 2FCHA 1Q4JA 5HR3A 1PKZA 5IMCA 5H5QA 2HSMA 3ZIJA 3KTBA 2YWIA 3EU4A 4IP6A 4BL7B 5ELAA 1GWCA 4KCAA 3PPUA 5F06A 3APOA 4HJMA 3D6IA 4EDYA 4L0WA 1ABAA 4TXOB 6GSVA 3TJGA 3ZLPA 3GURA 4EE0A 1UC7A 2B5YA 2V1MA 2V6KA 3LQ7A 2DIZA 4XS6A 4ZBDA 4BL7A 3LWAA 2J23A 4F82A 4Z7XA 3KMOA 1A2LA 5B8BA 1GTUA 3C1RA 4ID0A 4JRRA 4FYBA 1B8XA 5F0GA 4L5LA 3UVHA 6GSSA 1T00A 1M7TA 3OR5A 3GSSA 2HSHA 3IC8A 1Y25A 1XBSA 1UA5A 4MLYA 3DRNA 1TI3A 4DSRA 3R3EA 6GSXA 2R0PA 3UVTA 1ZMAA 2C80A 3MYDA 1WPIA 2VIMA 3KP8A 3IDVA 1TK8B 3D21A 1QK8A 20GSA 3ZMKA 4POKA 1FO5A 1USBA 2X4AA 3KP9A 2VAFA 2B6MA 2F3MA 1ZGNA 2G2QA 3HVSA 1TRVA 5AGYA 4IP1A 1FVKA 2I81A 3D22A 2CV4A 4V1Ag 4BA7A 1M2DA 1HNAA 6GSTA 3DMLA 4EF0A 2P5RA 1Z3EA 1AIUA 1A0FA 3GSTA 4MF7A 4EDZA 4EL1A 5ID2B 4XS4A 1TRUA 2VCQA 3BCIA 2IL3A 1XIYA 3TJBA 3UEMA 3FZ9A 2H01A 1ILOA 2H0IA 1W89A 5IO2A 2YPMA 1PL2A 3HVVA 2QA1A 2IMEA 16GSA 1THXA 2G0FA 2HZEB 3ZVJD 2V41A 5ELGA 5DJLA 1SK1A 1GSDA 3N5OA 1QMVA 3GH9A 2K8SA 4KX4A 4ZL8A 5B6MA 4J2FA 3WGEA 1PN9A 5J5NA 2BTOT 5CAXA 4RI7A 3A2XA 1S3CA 1K0OA 4K8MA 3I69A 14GSA 2BMXA 5GZZB 4EXJA 4K5RA 4OO5A 1U87A 1ON4A 2DMMA 3GHAA 2HFDA 2O85A 2FGXA 2FWGA 3FZ5A 2H6YA 2CVDA 3FR9A 7GSSA 4K7IA 4MZBA 3QAGA 3TKRA 5D8IA 2E7PA 4HQSA 5ECKB 3SWLA 5IMVA 4I6XA 2B5EA 2DJ0A 3U5RE 1JLVA 1LJRA 1SL2B 4GTUA 5CREA 5DALB 4ZB6A 4OO4A 1VF3A 3W8SA 1ACVA 5CRWA 4EC0A 2KP1A 2MZCA 2A2RA 2UZ8A 4WETA 3F4TA 1NHYA 1SYRA 3BCKA 2E0QA 2JZRA 3IE3A 4K7NA 3L78A 4N30A 5IO0A 4FYCA 1V9WA 2OE1A 1AQXA 2K9FA 2PU9C 1SENA 3GFKA 3EC3A 1EP8A 2B5XA 3A3TA 1YZXA 3FMWA 3EU3A 5IMDA 3IK7A 2N5BA 4HZ4A 3QAWA 3TOUA 5IMFA 4BVXB 1RW1A 3L9VA 5D93A 2IMFA 1SL0B 1U3IA 1ZOFA 3ED3A 3EINA 4RQXA 4F0BA 2B1KA 3G9BA 2GDRA 2A2PA 1AC1A 3GH6A 3UL3A 2TRXA 2I9HA 4ZL7A 3DXBA 2YJ7A 1SKSB 3TDGA 2DJKA 2RUFA 1V58A 4IJIA 1GP1A 2L59A 2ZUPA 3UBLA 5L71A 4WXTA 4I8BA 3W6GA 5B6NA 1O73A 2A4HA 2OADA 2DC5A 3IAS2 4KB3A 2GT6A 1GSUA 2YV7A 3ZREA 2C0EA 2XHFA 5EL8A 4DSQA 3HXSA 4F03A 2F8AA 1OE7A 5D73A 4NHWA 4NHZA 3DD3A 4Q5RA 2O87A 1WOUA 2YV9A 3GTUB 4NV2A 2IMKA 2IFQA 2GS3A 3FR6A 4Z2RA 5JCWA 4HI7A 3PGTA 2PUKC 3F6FA 3KTLA 2X8CA 3UBKA 3TGZA 2IWTA 3ISOA 3RBTA 1A0RP 4TR1B 2RM6A 1SYXA 5EVOA 2I1UA 2CVKA 4G0IA 5ECPB 2H76A 3MDKA 4MF6A 4XS1A 4JR4A 4K0NA 2K6VA 4GF0A 2OE3A 3GIXA 4AF2A 3P8WA 5KOWA 2DBCA 2JSYA 2H1BA 1EV9A 2MBSA 5HFIA 1SJZA 2QSIA 2RLIA 4TR3A 4FYUA 1ERUA 4G2EA 4BWSA 1UVZA 3DGQA 5A4WA 1ML6A 2KP2A 4RUVA 5A5KA 2YNXA 1YDKA 1TRWA 1J0FA 1G0TA 3TCOA 4GSTA 3MAKA 1OKTA 4NWYA 3O6TA 1VF2A 2XPDA 1V57A 3TRPA 1PRXA 4ZB8A 4IBPA 4EIPA 2CQ9A 4MH2A 1PFOA 2CA8A 2DKIA 2X99A 2P31A 4N0ZA 3TB2A 2MYGA 1ERWA 3F63A 1GTAA 2E2GA 1M9BA 3ZYWA 1Q98A 3GKNA 3KXOA 1YF1A 2EIOA 4I5QA 2WRTA 1O81A 2PERA 4EVMA 3Q19A 3KCMA 3CMIA 1T1VA 1EP7A 1SK0A 3GV1A 4MPFA 5KOXA 3QAVA 4KW6A 1VGLA 3APQA 3EURA 5CP1A 4MPGA 1SKWB 4V2MA 1WRYA 5ENUA 1XXUA 8GSSA 3ERGA 3HZ8A 2XPEA 2Z9SA 1XZOA 13GSA 2HE3A 5DCHA 1SK2A 3DIEA 1XW6A 4OD7A 5DAKB 3P7XA 4D73A 4IJ3A 1YKAA 2C0FA 1SD9A 4NAXA 2HYXA 5KN1A 3TRXA 3LXZA 3O76A 4LA1A 3M9KA 1MDIA 2LEGA 3MIXA 5DAKA 1G7EA 2NBSA 4DEJA 2M72A 5E4WA 4MJBA 2VUPA 4YQVA 2ZNMA 1XOBA 2H19A 2ZCTA 4QQ7A 2HNLA 4XTSA 1PD21 2JZTA 2P5QA 4NMUA 2B7KA 2VCZA 5ECRB 3F6DA 2YZHA 4WEYA 5E59A 1TU8A 3CSJA 4KCEA 3KGKA 4I97A 1JZRA 2H75A 4O32A 3LORA 1K0NA 3UMAA 5J9CA 1JZDA 3GYKA 1K0AA 1HNCA 1HYUA 3VFIA 2VLUA 2PVQA 4GWRA 1YQ1A 4OWYA 3LG6A 4KDXA 1A8YA 4HU9A 3KH9A 5F05A 9GSSA 3APSA 10GSA 2FUG2 4DVCA 5JWRB 5CRGA 3NZNA 2C4JA 2DSAA 5KN3A 4JBBA 4O5RA 1Z9HA 1X9MB 1S3RA 4O5UA 2V32A 2H1DA 4OFNA 2V2GA 2RM5A 4E8HA 4HS1A 1OKDA 5FWGA 5G5FA 1B4QA 3TOTA 2PGTA 1E6BA 3TKSE 2FWFA 1HD2A 4K2DA 2MMNA 1B48A 3UIWA 2O89A 3R2QA 4KF9A 2LS5A 1SKRB 3BOAA 2LSTA 2WCIA 2J9HA 5AIXA 3WYWA 2VL9A 2KLXA 4PQ1A 3FYGA 1GSQA 5LD0A 3ERFA 3GX8A 3TKQA 18GSA 2HRAA 2TIRA 5AN1A 2DMLA 4O5QA 1Z6NA 3IR4A 2WULA 3Q6OA 1HQOA 3TRQA 2L6DA 4XS4B 1BAYA 2EIQA 4TN8A 3HCZA 2D2ZA 4F9ZA 1XVWA 3LXTA 3P90A 1QUWA 4Z2TA 3LEFA 4POLA 6GSWA 1B4PA 3P2AA
chains in the Genus database with same CATH topology
4HUAA 4JU5A 3V1WA 4MMMA 2WDUA 4X43A 4K0GA 3ZMLA 2LRTA 1J08A 3F0IA 1TP9A 3TUEA 1Z7PA 2H71A 2LJAA 4X4JA 2DJ1A 1EGOA 3QR6A 3M0FA 2QA2A 1A2JA 3ZFBA 1VF1A 1T3BA 2M80A 3A2WA 3GX0A 1FB0A 1V2AA 5IQYA 22GSA 1B9XC 3RDWA 2L57A 3O3TA 3PH9A 5ECMB 1GRXA 2EIRA 2F51A 2VD0A 1ZL9A 2CAQA 3FRCA 1I9DA 4Q5NA 2VLVA 5G30A 1ERVA 3C1SA 1TW9A 3TKSA 4KSMA 1DE2A 3KM6A 1NW2A 3GKMA 5A4VA 3UARA 4CY8A 5HR0A 3BD2A 1WP0A 3CTFA 4TVEA 3GMFA 3FZ4A 2H6ZA 1JLWA 4ML1A 2P0GA 3PR8A 2NTOA 3A5IA 5ECSA 1BYEA 1EEJA 2C0DA 4OMVA 1N8JA 3VPTA 5JWOB 3JCML 5BMUA 2R6KA 3D4TA 17GSA 2LQOA 1H4OA 3EMXA 1GSSA 1N2AA 1X5DA 4PNGA 4MP4A 1ST9A 4F2IA 4L0UA 4TR0A 4KAEA 1UN2A 2X49A 2I4AA 2R3XA 2C1YA 2HI7A 1G7OA 3I43A 3QPMA 4MCUA 5GAPD 2YN1A 5D9XA 4BVYB 2WJUA 2C3QA 1TXXA 3HDCA 1JZOA 4V2NA 5DJMA 4K2XA 4EKZA 3U6VA 2GSTA 1R5PA 4MABA 3F8UA 2JACA 4KH7A 3NIVA 4BPYA 2YP6A 4JE1A 4PNFA 5C04A 4BVYA 1GLQA 4LL1B 2JL4A 1KNGA 5IIZA 2X8GA 1AQVA 4N0VA 4ICYA 1M2AA 1GUKA 5G2ZA 1MD4A 2MBTA 2IPAA 5D96A 1F9MA 5JWQB 2GSSA 1OC3A 4GQCA 2IJYA 4GQFA 5ECNB 1VRSD 1T4YA 4O7HA 1OAZA 3VLNA 3F4SA 2GGTA 2K8VA 3PINA 2H1AA 1AXDA 2VCVA 4QL7A 1E2YA 2LNSA 1K3YA 3GKKA 1O7UA 5IPHA 1F6MC 3NOFA 3RPNA 5ECIB 5J4UA 2OJLA 4G0KA 2R37A 2C3NA 4ZL9A 3CSIA 2VM2A 2N5FA 2OE0A 4L8EA 2FWHA 3IHGA 4GRFA 1KTEA 1TI1A 2EC4A 2IFQB 2WGRA 3VK9A 2QC7A 2WS2A 3D4MA 1URMA 4ECBA 5LNKe 1ZZYA 2KUCA 5D9VA 1B9YC 1F3AA 1M0UA 4IKHA 3EYTA 2AYTA 5HR2A 3ME7A 3UAPA 2F8FA 3ME8A 1DUGA 3WGXA 2H72A 2LKUA 4N10A 3G7JA 5J41A 1WMJA 2H1GA 1YF0A 5LCZA 1A23A 4F0CA 2YJHA 1G6YA 5HFKA 1TJDA 2HRFA 3QMXA 5INYA 5FHIA 3UJ1A 3QDNA 2GVPA 4ZB9A 1K0CA 4XHMA 4MZCA 1K3LA 12GSA 4N11A 3DEXA 1BEDA 1JHBA 4IQAA 19GSA 2PN8A 1U3AA 1YEXA 4G9HA 4GCIA 2GTUA 3LFLA 3AY8A 3I9V2 3TJJA 4PUAA 4GSNA 3H4KA 3C7MA 1BJXA 4IQ1A 3BJ5A 3CBUA 1X9SB 2H0GA 3FR3A 3QOUA 1FB6A 2OACA 2JADA 4OCFA 1M9AA 3D5JA 3ZZXA 4PTSA 4E8EA 1F2EA 1Y6EA 2VCXA 1AQWA 3ZIVA 3FW2A 1XWCA 1JZWA 1QXHA 1GL8A 1BX9A 1ZYPA 1A8LA 1CQHA 5DCGA 4A5PA 1DSBA 3L9UA 1F37A 3BBYA 1ZYEA 4TR4A 4WR4A 3WT1A 2MMOA 2IMIA 1FW1A 2OBKA 4ULXA 3HJMA 1I5GA 2NDOA 2YWNA 2A4VA 1U6TA 5D9TA 2GLRA 1XPVA 1CQGA 5F07A 1K0MA 1GSYA 4MNNA 1PKWA 3KJYA 2NVLA 1EZKA 2V6OA 4D73B 1X5CA 3KH7A 1QGVA 1THOA 4WF5A 4P3YB 1T7PB 3F9UA 1XOAA 1XW9A 2M46A 1YKCA 1X0RA 4K5SA 5KEJA 2HXKA 2XC2A 3C71A 2H73A 4HU7A 2MMAA 3DVXA 5BRTA 3DWVA 2FHEA 1PX6A 4CHSA 1EV4A 5EY6A 4J57E 1PA3A 2CX4A 2DJJA 2LJRA 4PQIA 4WBRD 4IELA 4MA9A 2REMA 3VI7A 3KZQA 1G6WA 2HT9A 6GSYA 5G1KA 1FOHA 4CW9A 1GTIA 3WGDA 4KDUA 3IOSA 2ON5A 2L5LA 4Q5QA 4K7OA 3HKRA 4ACSA 3A2VA 2KHPA 4TRXA 3TJFA 3FY7A 11GSA 4ZILA 3CXGA 4YKFA 1TOFA 1PN0A 2VOCA 3VWVA 1M99A 3VPQA 1OYJA 5DVBA 1OC9B 1YEPA 4MH3A 2PPTA 5GSTA 3FKFA 4KE3A 2I3YA 4G19A 2JZSA 1O85A 3ZITA 1J9BA 1OC9A 3LJRA 1ZYNA 3LSZA 3QFAC 2LRNA 1WJKA 5CNWA 3ZRDA 2PWJA 5IMZA 5J9BA 2O8VB 1AW9A 1R26A 2IMDA 1R7HA 3LYPA 1IYIA 2CVBA 4TKYA 4GXZA 4PURA 3HD5A 4XIHA 3H93A 4TXOA 4G0LA 2WZ9A 1YJ6A 4IN0A 3VI5A 2AB6A 2VD1A 3MSZA 1QFNA 1XFLA 1MDJA 4L5OA 2WB9A 3FK8A 4KSOA 5DDLA 1T4ZA 1R5AA 2R4VA 2H70A 4MJCA 2VL3A 5H5SA 3KEBA 3RHCA 5KN0A 4TOPA 1R4WA 5IM9A 2N5AA 2H74A 2CX3A 1ZCPA 3M9JA 2IIYA 4CY6A 4MF5A 3VWXA 3MWHA 3K8NA 4FIWA 4MDCA 4IGJA 3GA4A 1HNBA 2LTKA 4LMVA 3HA9A 4YAVA 2B3SA 5GAND 2LJKA 4I2UA 1KEBA 5JCGA 1GUHA 4MK3A 4YKGA 2FY6A 1C72A 4WKWA 2LRCA 4MJEA 4RI6A 4V1Ap 1BG5A 4FO5A 4K1FA 3EWLA 5H5RA 1GNEA 2H66A 3E9JB 3G7YA 3CTGA 4YQMA 1TK0B 2KOKA 4TW5A 3QD9A 3L4NA 2GZZA 2AUVA 3EMPA 5G31A 4V2LA 2OKAA 2OBIA 4JR6A 5FT3A 2HLSA 3IC4A 1AUCA 3CRTA 1TDIA 2NPBA 3H79A 3GRXA 3TKPA 5AISA 1PGTA 1RK4A 1ERTA 5ECQB 3EE2A 2XBIA 2JU5A 2ALBA 4ZIJA 3VWWA 3HJPA 1GSFA 4KNDA 3CSHA 2B1LA 1TTZA 6GSUA 2FLSA 2X64A 3ZVJA 5ID2A 2RUEA 1WWJA 1QQ2A 1XWBA 2QKEA 4NV5A 1OC8A 5HR1A 4IW9A 5C00A 1NM3A 2HZEA 2FNOA 5DQSA 1BQ7A 1V40A 2PMTA 2CAIA 3GNJA 3HY2A 2IN3A 4POMA 3M8NA 1KBNA 1FAAA 3TJKA 3LYKA 5B8AA 3C73A 3S9FA 1NSWA 4IS0A 1NHOA 1XCCA 3IPZA 4J56E 4LMWA 2VO4A 3H1NA 4HEA2 5EPFA 3US3A 5IOWA 4PXOA 4EUYA 2LQQA 2LV3A 2H8LA 4OCEA 4PX1A 2GSRA 2DIYA 1H75A 2B7JA 2H30A 2GT5A 5G1LA 2R0GA 1W4VA 5F8BA 3KD0A 1XW5A 5G5EA 4OFMA 4JZQA 1VF4A 2WFCA 5CRHA 2FD3A 4YH2A 4YQUA 1XVQA 4X0XA 4OFTA 4ISDA 2A2SA 4XRAA 4Z2UA 4IVFA 4G10A 3VWUA 5DALA 4BWQA 2R2JA 2TRCP 3IK9A 2ON7A 1Z5YE 3CYNA 3WD6A 3GUSA 3TKSC 3RPPA 5DBQA 4WF4A 1SL1B 2GZPA 1XWGA 4JEDA 4USSA 5JCUA 3FZAA 4QL9A 3F4RA 3ZFLA 1GSEA 2CZ3A 2GQMA 5ABRA 4KA0A 5IMAA 2C3TA 5ECOB 1ZYQB 4HZ2A 2O7KA 2AHEA 1Z7RA 2L5OA 5ECHB 3W8JA 4LL4B 4PGTA 5J3RA 3IBHA 3CRUA 3LGCA 2PVOC 4KDYA 1FVJA 3QFBC 2L4CA 3WT2A 4GLTA 3LW9A 2HZFA 4ZXGA 4BVXA 5CYYA 4O92A 2C8UA 4PUFC 1LBKA 1T8EB 5GSSA 4ML6A 1X5EA 3GL3A 2MMZA 1TU7A 1WIKA 4ECIA 2GZYA 2YZUA 1XWKA 1U88A 3N9JA 5A4UA 5AIVA 2AJQB 3D0ZA 1DBYA 2R0CA 3L9SA 4HQZA 1X9WB 3EPTA 1PMTA 2BJXA 3ZTLA 1MTCA 1EEMA 2DLXA 4ZBBA 5IPGA 3ERWA 2YWMA 1PQNA 4LLRA 3H8QA 1O8XA 4CDOA 3IAM2 3M3MA 4RQRA 1DE1A 4H86A 1GTBA 3F3RA 2F9SA 3EVIA 3HYPA 5KN2A 5COHA 4MZWA 4HDEA 1A24A 1AAZA 2VL2A 3RAZA 2PBJA 1MEKA 5ECLB 1Z6MA 1YY7A 5B7CA 2K18A 3KMNA 2YANA 2CT6A 3GN3A 4HOJA 4WR5A 1OE8A 3IRAA 3KIJA 1GUMA 3J7Yk 1PL1A 3HVXA 3GTUA 3Q18A 4XRDA 1SU9A 4PQHA 3IHQA 1WE0A 4KGIA 3DYRA 1JFUA 1IYHA 3IXRA 3DVWA 4POBA 4TR1A 1S3AA 2HRNA 1K3OA 5CO3A 5HFGA 1TK5B 4K6XA 3ZL5A 3IV4A 2CZ2A 2H6XA 4AJ7A 5CRDA 2VCTA 2HRKA 4AJ6A 2L6CA 1SD8A 3J7Yb 2LUSA 2RIIA 4DSSB 2AAWA 2H0HA 2GQLA 3QCPA 4FQUA 1TKDB 2R5GA 1EOHA 3FEUA 4MJAA 4WBJA 4AJ8A 2DJ2A 1GLPA 2QGVA 2E2MA 5D9WA 4DSSA 4TXVA 1SJ6A 2AV4A 2VLTA 1EWXA 2VM1A 1RQMA 3G7IA 4IHUA 3HHVA 2OA7A 2DKHA 1MDKA 1OVNA 2VL2C 1PSQA 1K0DA 2YCDA 1PX7A 4ECCA 1LU4A 2JSZA 4FH8A 2L4QA 1O6JA 4HJ2A 3SBCA 1M2BA 2YWOA 1XWAA 3Q74A 4YAPA 2GSQA 2HSYA 2ES7A 2FWEA 3HZ4A 1O8WA 3L0HA 4Q5FA 1GULA 4KUNA 3E3EA 1K0BA 1A2MA 3FHKA 4XCSA 3RHBA 5IOXA 4K9ZA 1MD3A 2FA4A 2GQKA 3IA1A 4EO3A 2XBQA 2LNTA 2DJ3A 3DKSA 3UOMA 3M1GA 3A5WA 4X1UA 3VURA 4EIQA 3GKXA 4ILFA 2X8HA 2YOIA 1F3BA 5DQYA 5HQPA 2C0GA 4GSSA 4I2TA 3E0UA 1GH2A 4ECJA 2VCWA 1FOVA 3I6AA 3GL5A 3HJOA 1GNWA 4ZBAA 1EGRA 1FG4A 1S3DA 3C8EA 1EOGA 1FHEA 4NXIA 1TRSA 4NPBA 1SJIA 4AGSA 2FA8A 1V98A 3F3QA 3MNGA 2FCHA 1Q4JA 5HR3A 1PKZA 5IMCA 5H5QA 2HSMA 3ZIJA 3KTBA 2YWIA 3EU4A 4IP6A 4BL7B 5ELAA 1GWCA 4KCAA 3PPUA 5F06A 3APOA 4HJMA 3D6IA 4EDYA 4L0WA 1ABAA 4TXOB 6GSVA 3TJGA 3ZLPA 3GURA 4EE0A 1UC7A 2B5YA 2V1MA 2V6KA 3LQ7A 2DIZA 4XS6A 4ZBDA 4BL7A 3LWAA 2J23A 4F82A 4Z7XA 3KMOA 1A2LA 5B8BA 1GTUA 3C1RA 4ID0A 4JRRA 4FYBA 1B8XA 5F0GA 4L5LA 3UVHA 6GSSA 1T00A 1M7TA 3OR5A 3GSSA 2HSHA 3IC8A 1Y25A 1XBSA 1UA5A 4MLYA 3DRNA 1TI3A 4DSRA 3R3EA 6GSXA 2R0PA 3UVTA 1ZMAA 2C80A 3MYDA 1WPIA 2VIMA 3KP8A 3IDVA 1TK8B 3D21A 1QK8A 20GSA 3ZMKA 4POKA 1FO5A 1USBA 2X4AA 3KP9A 2VAFA 2B6MA 2F3MA 1ZGNA 2G2QA 3HVSA 1TRVA 5AGYA 4IP1A 1FVKA 2I81A 3D22A 2CV4A 4V1Ag 4BA7A 1M2DA 1HNAA 6GSTA 3DMLA 4EF0A 2P5RA 1Z3EA 1AIUA 1A0FA 3GSTA 4MF7A 4EDZA 4EL1A 5ID2B 4XS4A 1TRUA 2VCQA 3BCIA 2IL3A 1XIYA 3TJBA 3UEMA 3FZ9A 2H01A 1ILOA 2H0IA 1W89A 5IO2A 2YPMA 1PL2A 3HVVA 2QA1A 2IMEA 16GSA 1THXA 2G0FA 2HZEB 3ZVJD 2V41A 5ELGA 5DJLA 1SK1A 1GSDA 3N5OA 1QMVA 3GH9A 2K8SA 4KX4A 4ZL8A 5B6MA 4J2FA 3WGEA 1PN9A 5J5NA 2BTOT 5CAXA 4RI7A 3A2XA 1S3CA 1K0OA 4K8MA 3I69A 14GSA 2BMXA 5GZZB 4EXJA 4K5RA 4OO5A 1U87A 1ON4A 2DMMA 3GHAA 2HFDA 2O85A 2FGXA 2FWGA 3FZ5A 2H6YA 2CVDA 3FR9A 7GSSA 4K7IA 4MZBA 3QAGA 3TKRA 5D8IA 2E7PA 4HQSA 5ECKB 3SWLA 5IMVA 4I6XA 2B5EA 2DJ0A 3U5RE 1JLVA 1LJRA 1SL2B 4GTUA 5CREA 5DALB 4ZB6A 4OO4A 1VF3A 3W8SA 1ACVA 5CRWA 4EC0A 2KP1A 2MZCA 2A2RA 2UZ8A 4WETA 3F4TA 1NHYA 1SYRA 3BCKA 2E0QA 2JZRA 3IE3A 4K7NA 3L78A 4N30A 5IO0A 4FYCA 1V9WA 2OE1A 1AQXA 2K9FA 2PU9C 1SENA 3GFKA 3EC3A 1EP8A 2B5XA 3A3TA 1YZXA 3FMWA 3EU3A 5IMDA 3IK7A 2N5BA 4HZ4A 3QAWA 3TOUA 5IMFA 4BVXB 1RW1A 3L9VA 5D93A 2IMFA 1SL0B 1U3IA 1ZOFA 3ED3A 3EINA 4RQXA 4F0BA 2B1KA 3G9BA 2GDRA 2A2PA 1AC1A 3GH6A 3UL3A 2TRXA 2I9HA 4ZL7A 3DXBA 2YJ7A 1SKSB 3TDGA 2DJKA 2RUFA 1V58A 4IJIA 1GP1A 2L59A 2ZUPA 3UBLA 5L71A 4WXTA 4I8BA 3W6GA 5B6NA 1O73A 2A4HA 2OADA 2DC5A 3IAS2 4KB3A 2GT6A 1GSUA 2YV7A 3ZREA 2C0EA 2XHFA 5EL8A 4DSQA 3HXSA 4F03A 2F8AA 1OE7A 5D73A 4NHWA 4NHZA 3DD3A 4Q5RA 2O87A 1WOUA 2YV9A 3GTUB 4NV2A 2IMKA 2IFQA 2GS3A 3FR6A 4Z2RA 5JCWA 4HI7A 3PGTA 2PUKC 3F6FA 3KTLA 2X8CA 3UBKA 3TGZA 2IWTA 3ISOA 3RBTA 1A0RP 4TR1B 2RM6A 1SYXA 5EVOA 2I1UA 2CVKA 4G0IA 5ECPB 2H76A 3MDKA 4MF6A 4XS1A 4JR4A 4K0NA 2K6VA 4GF0A 2OE3A 3GIXA 4AF2A 3P8WA 5KOWA 2DBCA 2JSYA 2H1BA 1EV9A 2MBSA 5HFIA 1SJZA 2QSIA 2RLIA 4TR3A 4FYUA 1ERUA 4G2EA 4BWSA 1UVZA 3DGQA 5A4WA 1ML6A 2KP2A 4RUVA 5A5KA 2YNXA 1YDKA 1TRWA 1J0FA 1G0TA 3TCOA 4GSTA 3MAKA 1OKTA 4NWYA 3O6TA 1VF2A 2XPDA 1V57A 3TRPA 1PRXA 4ZB8A 4IBPA 4EIPA 2CQ9A 4MH2A 2CA8A 2DKIA 2X99A 2P31A 4N0ZA 3TB2A 2MYGA 1ERWA 3F63A 1GTAA 2E2GA 1M9BA 3ZYWA 1Q98A 3GKNA 3KXOA 1YF1A 2EIOA 4I5QA 2WRTA 1O81A 2PERA 4EVMA 3Q19A 3KCMA 3CMIA 1T1VA 1EP7A 1SK0A 3GV1A 4MPFA 5KOXA 3QAVA 4KW6A 1VGLA 3APQA 3EURA 5CP1A 4MPGA 1SKWB 4V2MA 1WRYA 5ENUA 1XXUA 8GSSA 3ERGA 3HZ8A 2XPEA 2Z9SA 1XZOA 13GSA 2HE3A 5DCHA 1SK2A 3DIEA 1XW6A 4OD7A 5DAKB 3P7XA 4D73A 4IJ3A 1YKAA 2C0FA 1SD9A 4NAXA 2HYXA 5KN1A 3TRXA 3LXZA 3O76A 4LA1A 3M9KA 1MDIA 2LEGA 3MIXA 5DAKA 1G7EA 2NBSA 4DEJA 2M72A 5E4WA 4MJBA 2VUPA 4YQVA 2ZNMA 1XOBA 2H19A 2ZCTA 4QQ7A 2HNLA 4XTSA 1PD21 2JZTA 2P5QA 4NMUA 2B7KA 2VCZA 5ECRB 3F6DA 2YZHA 4WEYA 5E59A 1TU8A 3CSJA 4KCEA 3KGKA 4I97A 1JZRA 2H75A 4O32A 3LORA 1K0NA 3UMAA 5J9CA 1JZDA 3GYKA 1K0AA 1HNCA 1HYUA 3VFIA 2VLUA 2PVQA 4GWRA 1YQ1A 4OWYA 3LG6A 4KDXA 1A8YA 4HU9A 3KH9A 5F05A 9GSSA 3APSA 10GSA 2FUG2 4DVCA 5JWRB 5CRGA 3NZNA 2C4JA 2DSAA 5KN3A 4JBBA 4O5RA 1Z9HA 1X9MB 4O5UA 2V32A 2H1DA 4OFNA 2V2GA 2RM5A 4E8HA 4HS1A 1OKDA 5FWGA 5G5FA 1B4QA 3TOTA 2PGTA 1E6BA 3TKSE 2FWFA 1HD2A 4K2DA 2MMNA 1B48A 3UIWA 2O89A 3R2QA 4KF9A 2LS5A 1SKRB 3BOAA 2LSTA 2WCIA 2J9HA 5AIXA 3WYWA 2VL9A 2KLXA 4PQ1A 3FYGA 1GSQA 5LD0A 3ERFA 3GX8A 3TKQA 18GSA 2HRAA 2TIRA 5AN1A 2DMLA 4O5QA 1Z6NA 3IR4A 2WULA 3Q6OA 1HQOA 3TRQA 2L6DA 4XS4B 1BAYA 2EIQA 4TN8A 3HCZA 2D2ZA 4F9ZA 1XVWA 3LXTA 3P90A 1QUWA 4Z2TA 3LEFA 4POLA 6GSWA 1B4PA 3P2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HUA A;  4JU5 A;  3V1W A;  4MMM A;  2WDU A;  4X43 A;  4K0G A;  3ZML A;  2LRT A;  1J08 A;  3F0I A;  1TP9 A;  3TUE A;  1Z7P A;  2H71 A;  2LJA A;  2DJ1 A;  1EGO A;  3QR6 A;  3M0F A;  1A2J A;  3ZFB A;  1VF1 A;  1T3B A;  2M80 A;  3A2W A;  3GX0 A;  1FB0 A;  1V2A A;  5IQY A;  22GS A;  1B9X C;  3RDW A;  2L57 A;  3O3T A;  3PH9 A;  5ECM B;  1GRX A;  2EIR A;  2F51 A;  2VD0 A;  1ZL9 A;  2CAQ A;  3FRC A;  1I9D A;  4Q5N A;  2VLV A;  5G30 A;  1ERV A;  3C1S A;  1TW9 A;  3TKS A;  4KSM A;  1DE2 A;  3KM6 A;  1NW2 A;  3GKM A;  5A4V A;  3UAR A;  5HR0 A;  3BD2 A;  1WP0 A;  3CTF A;  4TVE A;  3GMF A;  3FZ4 A;  2H6Z A;  1JLW A;  4ML1 A;  2P0G A;  3PR8 A;  2NTO A;  5ECS A;  1BYE A;  1EEJ A;  2C0D A;  4OMV A;  1N8J A;  3VPT A;  5JWO B;  3JCM L;  2R6K A;  3D4T A;  17GS A;  2LQO A;  1H4O A;  3EMX A;  1GSS A;  1N2A A;  1X5D A;  4PNG A;  4MP4 A;  1ST9 A;  4F2I A;  4L0U A;  4TR0 A;  4KAE A;  1UN2 A;  2I4A A;  2R3X A;  2C1Y A;  2HI7 A;  1G7O A;  3I43 A;  3QPM A;  4MCU A;  5GAP D;  2YN1 A;  5D9X A;  2WJU A;  2C3Q A;  1TXX A;  3HDC A;  1JZO A;  4V2N A;  5DJM A;  4EKZ A;  3U6V A;  2GST A;  1R5P A;  4MAB A;  3F8U A;  2JAC A;  4KH7 A;  3NIV A;  4BPY A;  2YP6 A;  4JE1 A;  4PNF A;  5C04 A;  4BVY A;  1GLQ A;  4LL1 B;  2JL4 A;  1KNG A;  5IIZ A;  2X8G A;  1AQV A;  4N0V A;  1M2A A;  1GUK A;  5G2Z A;  1MD4 A;  2MBT A;  2IPA A;  5D96 A;  1F9M A;  5JWQ B;  2GSS A;  1OC3 A;  4GQC A;  2IJY A;  4GQF A;  5ECN B;  1VRS D;  1T4Y A;  4O7H A;  1OAZ A;  3VLN A;  3F4S A;  2GGT A;  2K8V A;  3PIN A;  2H1A A;  1AXD A;  2VCV A;  4QL7 A;  1E2Y A;  2LNS A;  1K3Y A;  3GKK A;  1O7U A;  5IPH A;  1F6M C;  3NOF A;  3RPN A;  5ECI B;  5J4U A;  2OJL A;  2R37 A;  2C3N A;  4ZL9 A;  3CSI A;  2VM2 A;  2N5F A;  2OE0 A;  4L8E A;  2FWH A;  4GRF A;  1KTE A;  1TI1 A;  2EC4 A;  2IFQ B;  2WGR A;  3VK9 A;  2QC7 A;  2WS2 A;  3D4M A;  1URM A;  4ECB A;  5LNK e;  1ZZY A;  2KUC A;  5D9V A;  1B9Y C;  1F3A A;  1M0U A;  4IKH A;  3EYT A;  2AYT A;  5HR2 A;  3ME7 A;  3UAP A;  2F8F A;  3ME8 A;  1DUG A;  3WGX A;  2H72 A;  2LKU A;  4N10 A;  3G7J A;  5J41 A;  1WMJ A;  2H1G A;  1YF0 A;  5LCZ A;  1A23 A;  4F0C A;  2YJH A;  1G6Y A;  5HFK A;  1TJD A;  2HRF A;  3QMX A;  5INY A;  5FHI A;  3UJ1 A;  3QDN A;  2GVP A;  4ZB9 A;  1K0C A;  4XHM A;  4MZC A;  1K3L A;  12GS A;  4N11 A;  3DEX A;  1BED A;  1JHB A;  4IQA A;  19GS A;  2PN8 A;  1U3A A;  1YEX A;  4G9H A;  4GCI A;  2GTU A;  3LFL A;  3AY8 A;  3I9V 2;  3TJJ A;  4PUA A;  4GSN A;  3H4K A;  3C7M A;  1BJX A;  4IQ1 A;  3BJ5 A;  3CBU A;  1X9S B;  2H0G A;  3FR3 A;  3QOU A;  1FB6 A;  2OAC A;  2JAD A;  4OCF A;  1M9A A;  3D5J A;  3ZZX A;  4E8E A;  1F2E A;  1Y6E A;  2VCX A;  1AQW A;  3ZIV A;  3FW2 A;  1XWC A;  1JZW A;  1QXH A;  1GL8 A;  1BX9 A;  1A8L A;  1CQH A;  5DCG A;  1DSB A;  3L9U A;  1F37 A;  3BBY A;  1ZYE A;  4TR4 A;  4WR4 A;  3WT1 A;  2MMO A;  2IMI A;  1FW1 A;  2OBK A;  4ULX A;  3HJM A;  1I5G A;  2NDO A;  2YWN A;  2A4V A;  1U6T A;  5D9T A;  2GLR A;  1XPV A;  1CQG A;  5F07 A;  1K0M A;  1GSY A;  1PKW A;  3KJY A;  2NVL A;  1EZK A;  2V6O A;  4D73 B;  1X5C A;  3KH7 A;  1QGV A;  1THO A;  4WF5 A;  4P3Y B;  1T7P B;  3F9U A;  1XOA A;  1XW9 A;  2M46 A;  1YKC A;  1X0R A;  5KEJ A;  2HXK A;  2XC2 A;  3C71 A;  2H73 A;  4HU7 A;  2MMA A;  3DVX A;  3DWV A;  2FHE A;  1PX6 A;  4CHS A;  1EV4 A;  5EY6 A;  4J57 E;  1PA3 A;  2CX4 A;  2DJJ A;  2LJR A;  4PQI A;  4WBR D;  4IEL A;  4MA9 A;  2REM A;  3VI7 A;  3KZQ A;  1G6W A;  2HT9 A;  6GSY A;  5G1K A;  4CW9 A;  1GTI A;  3WGD A;  4KDU A;  3IOS A;  2ON5 A;  2L5L A;  4Q5Q A;  4K7O A;  3HKR A;  4ACS A;  3A2V A;  2KHP A;  4TRX A;  3TJF A;  3FY7 A;  11GS A;  4ZIL A;  3CXG A;  1TOF A;  2VOC A;  3VWV A;  1M99 A;  3VPQ A;  1OYJ A;  5DVB A;  1OC9 B;  1YEP A;  4MH3 A;  2PPT A;  5GST A;  3FKF A;  4KE3 A;  2I3Y A;  4G19 A;  2JZS A;  1O85 A;  3ZIT A;  1J9B A;  1OC9 A;  3LJR A;  3LSZ A;  3QFA C;  2LRN A;  1WJK A;  5CNW A;  3ZRD A;  2PWJ A;  5IMZ A;  5J9B A;  2O8V B;  1AW9 A;  1R26 A;  2IMD A;  1R7H A;  3LYP A;  1IYI A;  2CVB A;  4TKY A;  4GXZ A;  4PUR A;  3HD5 A;  4XIH A;  3H93 A;  4TXO A;  2WZ9 A;  1YJ6 A;  4IN0 A;  3VI5 A;  2AB6 A;  2VD1 A;  3MSZ A;  1QFN A;  1XFL A;  1MDJ A;  4L5O A;  2WB9 A;  3FK8 A;  4KSO A;  5DDL A;  1T4Z A;  1R5A A;  2R4V A;  2H70 A;  4MJC A;  2VL3 A;  5H5S A;  3KEB A;  3RHC A;  5KN0 A;  4TOP A;  1R4W A;  5IM9 A;  2N5A A;  2H74 A;  2CX3 A;  1ZCP A;  3M9J A;  2IIY A;  4MF5 A;  3VWX A;  3MWH A;  3K8N A;  4FIW A;  4MDC A;  4IGJ A;  3GA4 A;  1HNB A;  2LTK A;  4LMV A;  3HA9 A;  4YAV A;  2B3S A;  5GAN D;  2LJK A;  4I2U A;  1KEB A;  5JCG A;  1GUH A;  4MK3 A;  2FY6 A;  1C72 A;  4WKW A;  2LRC A;  4MJE A;  4RI6 A;  4V1A p;  1BG5 A;  4FO5 A;  4K1F A;  3EWL A;  5H5R A;  1GNE A;  2H66 A;  3E9J B;  3G7Y A;  3CTG A;  4YQM A;  1TK0 B;  2KOK A;  4TW5 A;  3QD9 A;  3L4N A;  2GZZ A;  2AUV A;  3EMP A;  5G31 A;  4V2L A;  2OKA A;  2OBI A;  4JR6 A;  5FT3 A;  2HLS A;  3IC4 A;  1AUC A;  3CRT A;  1TDI A;  2NPB A;  3H79 A;  3GRX A;  3TKP A;  5AIS A;  1PGT A;  1RK4 A;  1ERT A;  5ECQ B;  3EE2 A;  2XBI A;  2JU5 A;  2ALB A;  4ZIJ A;  3VWW A;  3HJP A;  1GSF A;  4KND A;  3CSH A;  2B1L A;  1TTZ A;  6GSU A;  2FLS A;  2X64 A;  3ZVJ A;  5ID2 A;  2RUE A;  1WWJ A;  1QQ2 A;  1XWB A;  2QKE A;  4NV5 A;  1OC8 A;  5HR1 A;  4IW9 A;  5C00 A;  1NM3 A;  2HZE A;  2FNO A;  5DQS A;  1BQ7 A;  1V40 A;  2PMT A;  2CAI A;  3GNJ A;  3HY2 A;  2IN3 A;  4POM A;  3M8N A;  1KBN A;  1FAA A;  3TJK A;  3LYK A;  5B8A A;  3C73 A;  3S9F A;  1NSW A;  4IS0 A;  1NHO A;  1XCC A;  3IPZ A;  4J56 E;  4LMW A;  2VO4 A;  3H1N A;  4HEA 2;  5EPF A;  3US3 A;  5IOW A;  4PXO A;  4EUY A;  2LQQ A;  2LV3 A;  2H8L A;  4OCE A;  4PX1 A;  2GSR A;  2DIY A;  1H75 A;  2B7J A;  2H30 A;  2GT5 A;  5G1L A;  1W4V A;  5F8B A;  3KD0 A;  1XW5 A;  5G5E A;  4OFM A;  4JZQ A;  1VF4 A;  2WFC A;  5CRH A;  2FD3 A;  4YH2 A;  4YQU A;  1XVQ A;  4X0X A;  4OFT A;  4ISD A;  2A2S A;  4XRA A;  4IVF A;  4G10 A;  3VWU A;  5DAL A;  4BWQ A;  2R2J A;  2TRC P;  3IK9 A;  2ON7 A;  1Z5Y E;  3CYN A;  3WD6 A;  3GUS A;  3TKS C;  3RPP A;  5DBQ A;  4WF4 A;  1SL1 B;  2GZP A;  1XWG A;  4JED A;  5JCU A;  3FZA A;  4QL9 A;  3F4R A;  3ZFL A;  1GSE A;  2CZ3 A;  2GQM A;  5ABR A;  4KA0 A;  5IMA A;  2C3T A;  5ECO B;  1ZYQ B;  4HZ2 A;  2O7K A;  2AHE A;  1Z7R A;  2L5O A;  5ECH B;  3W8J A;  4LL4 B;  4PGT A;  5J3R A;  3IBH A;  3CRU A;  3LGC A;  2PVO C;  4KDY A;  1FVJ A;  3QFB C;  2L4C A;  3WT2 A;  4GLT A;  2HZF A;  4ZXG A;  4BVX A;  5CYY A;  4O92 A;  2C8U A;  4PUF C;  1LBK A;  1T8E B;  5GSS A;  4ML6 A;  1X5E A;  3GL3 A;  2MMZ A;  1TU7 A;  1WIK A;  4ECI A;  2GZY A;  2YZU A;  1XWK A;  1U88 A;  3N9J A;  5A4U A;  5AIV A;  2AJQ B;  3D0Z A;  1DBY A;  3L9S A;  4HQZ A;  1X9W B;  1PMT A;  2BJX A;  3ZTL A;  1MTC A;  1EEM A;  2DLX A;  4ZBB A;  5IPG A;  3ERW A;  2YWM A;  1PQN A;  4LLR A;  3H8Q A;  1O8X A;  4CDO A;  3IAM 2;  3M3M A;  4RQR A;  1DE1 A;  4H86 A;  1GTB A;  3F3R A;  2F9S A;  3EVI A;  3HYP A;  5KN2 A;  5COH A;  4MZW A;  4HDE A;  1A24 A;  1AAZ A;  2VL2 A;  3RAZ A;  2PBJ A;  1MEK A;  5ECL B;  1Z6M A;  1YY7 A;  5B7C A;  2K18 A;  3KMN A;  2YAN A;  2CT6 A;  3GN3 A;  4HOJ A;  4WR5 A;  1OE8 A;  3IRA A;  3KIJ A;  1GUM A;  3J7Y k;  1PL1 A;  3HVX A;  3GTU A;  3Q18 A;  4XRD A;  1SU9 A;  4PQH A;  3IHQ A;  1WE0 A;  4KGI A;  3DYR A;  1JFU A;  1IYH A;  3IXR A;  3DVW A;  4POB A;  4TR1 A;  1S3A A;  2HRN A;  1K3O A;  5CO3 A;  5HFG A;  1TK5 B;  4K6X A;  3ZL5 A;  3IV4 A;  2CZ2 A;  2H6X A;  4AJ7 A;  5CRD A;  2VCT A;  4AJ6 A;  2L6C A;  1SD8 A;  3J7Y b;  2LUS A;  2RII A;  4DSS B;  2AAW A;  2H0H A;  2GQL A;  3QCP A;  1TKD B;  2R5G A;  1EOH A;  3FEU A;  4MJA A;  4WBJ A;  4AJ8 A;  2DJ2 A;  1GLP A;  2QGV A;  2E2M A;  5D9W A;  4DSS A;  4TXV A;  1SJ6 A;  2AV4 A;  2VLT A;  1EWX A;  2VM1 A;  1RQM A;  3G7I A;  4IHU A;  3HHV A;  2OA7 A;  1MDK A;  1OVN A;  2VL2 C;  1PSQ A;  1K0D A;  2YCD A;  1PX7 A;  4ECC A;  1LU4 A;  2JSZ A;  4FH8 A;  2L4Q A;  1O6J A;  4HJ2 A;  3SBC A;  1M2B A;  2YWO A;  1XWA A;  3Q74 A;  4YAP A;  2GSQ A;  2HSY A;  2ES7 A;  2FWE A;  3HZ4 A;  1O8W A;  3L0H A;  4Q5F A;  1GUL A;  4KUN A;  3E3E A;  1K0B A;  1A2M A;  3FHK A;  4XCS A;  3RHB A;  5IOX A;  4K9Z A;  1MD3 A;  2FA4 A;  2GQK A;  3IA1 A;  4EO3 A;  2XBQ A;  2LNT A;  2DJ3 A;  3DKS A;  3UOM A;  3M1G A;  3A5W A;  4X1U A;  3VUR A;  3GKX A;  4ILF A;  2X8H A;  2YOI A;  1F3B A;  5DQY A;  5HQP A;  2C0G A;  4GSS A;  4I2T A;  3E0U A;  1GH2 A;  4ECJ A;  2VCW A;  1FOV A;  3I6A A;  3GL5 A;  3HJO A;  1GNW A;  4ZBA A;  1EGR A;  1FG4 A;  1S3D A;  3C8E A;  1EOG A;  1FHE A;  4NXI A;  1TRS A;  4NPB A;  1SJI A;  4AGS A;  2FA8 A;  1V98 A;  3F3Q A;  3MNG A;  2FCH A;  1Q4J A;  5HR3 A;  1PKZ A;  5IMC A;  5H5Q A;  3ZIJ A;  3KTB A;  2YWI A;  3EU4 A;  4IP6 A;  5ELA A;  1GWC A;  4KCA A;  5F06 A;  3APO A;  4HJM A;  3D6I A;  4EDY A;  4L0W A;  1ABA A;  4TXO B;  6GSV A;  3TJG A;  3ZLP A;  3GUR A;  4EE0 A;  1UC7 A;  2B5Y A;  2V1M A;  2V6K A;  3LQ7 A;  2DIZ A;  4XS6 A;  4ZBD A;  4BL7 A;  3LWA A;  2J23 A;  4F82 A;  4Z7X A;  3KMO A;  1A2L A;  5B8B A;  1GTU A;  3C1R A;  4ID0 A;  4JRR A;  4FYB A;  1B8X A;  5F0G A;  4L5L A;  3UVH A;  6GSS A;  1T00 A;  1M7T A;  3OR5 A;  3GSS A;  2HSH A;  1Y25 A;  1XBS A;  1UA5 A;  4MLY A;  3DRN A;  1TI3 A;  4DSR A;  6GSX A;  3UVT A;  1ZMA A;  2C80 A;  1WPI A;  2VIM A;  3KP8 A;  3IDV A;  1TK8 B;  3D21 A;  1QK8 A;  20GS A;  3ZMK A;  4POK A;  1FO5 A;  1USB A;  3KP9 A;  2VAF A;  2B6M A;  2F3M A;  1ZGN A;  2G2Q A;  3HVS A;  1TRV A;  5AGY A;  4IP1 A;  1FVK A;  2I81 A;  3D22 A;  2CV4 A;  4V1A g;  4BA7 A;  1M2D A;  1HNA A;  6GST A;  3DML A;  4EF0 A;  2P5R A;  1Z3E A;  1AIU A;  1A0F A;  3GST A;  4MF7 A;  4EDZ A;  4EL1 A;  5ID2 B;  4XS4 A;  1TRU A;  2VCQ A;  3BCI A;  2IL3 A;  1XIY A;  3TJB A;  3UEM A;  3FZ9 A;  2H01 A;  1ILO A;  2H0I A;  1W89 A;  5IO2 A;  2YPM A;  1PL2 A;  3HVV A;  2IME A;  16GS A;  1THX A;  2G0F A;  2HZE B;  3ZVJ D;  2V41 A;  5ELG A;  5DJL A;  1SK1 A;  1GSD A;  3N5O A;  1QMV A;  3GH9 A;  2K8S A;  4KX4 A;  4ZL8 A;  5B6M A;  4J2F A;  3WGE A;  1PN9 A;  5J5N A;  2BTO T;  5CAX A;  4RI7 A;  3A2X A;  1S3C A;  1K0O A;  4K8M A;  3I69 A;  14GS A;  2BMX A;  5GZZ B;  4EXJ A;  4OO5 A;  1U87 A;  1ON4 A;  2DMM A;  3GHA A;  2HFD A;  2O85 A;  2FGX A;  2FWG A;  3FZ5 A;  2H6Y A;  2CVD A;  3FR9 A;  7GSS A;  4K7I A;  4MZB A;  3QAG A;  3TKR A;  5D8I A;  2E7P A;  4HQS A;  5ECK B;  3SWL A;  5IMV A;  4I6X A;  2B5E A;  2DJ0 A;  3U5R E;  1JLV A;  1LJR A;  1SL2 B;  4GTU A;  5CRE A;  5DAL B;  4ZB6 A;  4OO4 A;  1VF3 A;  3W8S A;  1ACV A;  5CRW A;  4EC0 A;  2KP1 A;  2MZC A;  2A2R A;  4WET A;  3F4T A;  1NHY A;  1SYR A;  3BCK A;  2E0Q A;  2JZR A;  3IE3 A;  4K7N A;  3L78 A;  4N30 A;  5IO0 A;  4FYC A;  1V9W A;  2OE1 A;  1AQX A;  2K9F A;  2PU9 C;  1SEN A;  3GFK A;  3EC3 A;  1EP8 A;  2B5X A;  3A3T A;  1YZX A;  3EU3 A;  5IMD A;  3IK7 A;  2N5B A;  4HZ4 A;  3QAW A;  3TOU A;  5IMF A;  1RW1 A;  3L9V A;  5D93 A;  2IMF A;  1SL0 B;  1U3I A;  1ZOF A;  3ED3 A;  3EIN A;  4RQX A;  4F0B A;  2B1K A;  3G9B A;  2GDR A;  1AC1 A;  3GH6 A;  3UL3 A;  2TRX A;  2I9H A;  4ZL7 A;  3DXB A;  2YJ7 A;  1SKS B;  3TDG A;  2DJK A;  2RUF A;  1V58 A;  4IJI A;  1GP1 A;  2L59 A;  2ZUP A;  3UBL A;  5L71 A;  4WXT A;  4I8B A;  3W6G A;  5B6N A;  1O73 A;  2OAD A;  2DC5 A;  3IAS 2;  4KB3 A;  2GT6 A;  1GSU A;  2YV7 A;  3ZRE A;  2C0E A;  2XHF A;  5EL8 A;  4DSQ A;  3HXS A;  4F03 A;  2F8A A;  1OE7 A;  5D73 A;  4NHW A;  4NHZ A;  3DD3 A;  4Q5R A;  2O87 A;  1WOU A;  2YV9 A;  3GTU B;  4NV2 A;  2IMK A;  2IFQ A;  2GS3 A;  3FR6 A;  5JCW A;  4HI7 A;  3PGT A;  2PUK C;  3F6F A;  3KTL A;  2X8C A;  3UBK A;  3TGZ A;  2IWT A;  3ISO A;  3RBT A;  1A0R P;  4TR1 B;  2RM6 A;  1SYX A;  5EVO A;  2I1U A;  2CVK A;  5ECP B;  2H76 A;  3MDK A;  4MF6 A;  4XS1 A;  4JR4 A;  4K0N A;  2K6V A;  4GF0 A;  2OE3 A;  3GIX A;  4AF2 A;  3P8W A;  2DBC A;  2JSY A;  2H1B A;  1EV9 A;  2MBS A;  5HFI A;  1SJZ A;  2QSI A;  2RLI A;  4TR3 A;  4FYU A;  1ERU A;  4G2E A;  4BWS A;  1UVZ A;  3DGQ A;  5A4W A;  1ML6 A;  2KP2 A;  4RUV A;  5A5K A;  2YNX A;  1YDK A;  1TRW A;  1J0F A;  1G0T A;  3TCO A;  4GST A;  3MAK A;  1OKT A;  4NWY A;  3O6T A;  1VF2 A;  2XPD A;  1V57 A;  3TRP A;  1PRX A;  4ZB8 A;  4IBP A;  2CQ9 A;  4MH2 A;  2CA8 A;  2X99 A;  2P31 A;  4N0Z A;  3TB2 A;  2MYG A;  1ERW A;  3F63 A;  1GTA A;  2E2G A;  1M9B A;  3ZYW A;  1Q98 A;  3GKN A;  3KXO A;  1YF1 A;  2EIO A;  4I5Q A;  2WRT A;  1O81 A;  2PER A;  4EVM A;  3Q19 A;  3KCM A;  3CMI A;  1T1V A;  1EP7 A;  1SK0 A;  3GV1 A;  4MPF A;  3QAV A;  4KW6 A;  1VGL A;  3APQ A;  3EUR A;  5CP1 A;  4MPG A;  1SKW B;  4V2M A;  1WRY A;  5ENU A;  1XXU A;  8GSS A;  3ERG A;  3HZ8 A;  2XPE A;  2Z9S A;  1XZO A;  13GS A;  2HE3 A;  5DCH A;  1SK2 A;  3DIE A;  1XW6 A;  4OD7 A;  5DAK B;  3P7X A;  4D73 A;  4IJ3 A;  1YKA A;  2C0F A;  1SD9 A;  4NAX A;  2HYX A;  5KN1 A;  3TRX A;  3LXZ A;  3O76 A;  4LA1 A;  3M9K A;  1MDI A;  2LEG A;  5DAK A;  1G7E A;  2NBS A;  4DEJ A;  2M72 A;  5E4W A;  4MJB A;  2VUP A;  4YQV A;  2ZNM A;  1XOB A;  2H19 A;  2ZCT A;  4QQ7 A;  2HNL A;  4XTS A;  1PD2 1;  2JZT A;  2P5Q A;  4NMU A;  2B7K A;  2VCZ A;  5ECR B;  3F6D A;  2YZH A;  4WEY A;  5E59 A;  1TU8 A;  3CSJ A;  4KCE A;  3KGK A;  4I97 A;  1JZR A;  2H75 A;  4O32 A;  3LOR A;  1K0N A;  3UMA A;  5J9C A;  1JZD A;  3GYK A;  1K0A A;  1HNC A;  1HYU A;  3VFI A;  2VLU A;  2PVQ A;  4GWR A;  1YQ1 A;  4OWY A;  3LG6 A;  4KDX A;  1A8Y A;  4HU9 A;  3KH9 A;  5F05 A;  9GSS A;  3APS A;  10GS A;  2FUG 2;  4DVC A;  5JWR B;  5CRG A;  3NZN A;  2C4J A;  2DSA A;  5KN3 A;  4JBB A;  4O5R A;  1Z9H A;  1X9M B;  2V32 A;  2H1D A;  4OFN A;  2V2G A;  2RM5 A;  4E8H A;  4HS1 A;  1OKD A;  5FWG A;  5G5F A;  1B4Q A;  3TOT A;  2PGT A;  1E6B A;  3TKS E;  2FWF A;  1HD2 A;  4K2D A;  2MMN A;  1B48 A;  3UIW A;  2O89 A;  3R2Q A;  2LS5 A;  1SKR B;  3BOA A;  2LST A;  2WCI A;  2J9H A;  5AIX A;  3WYW A;  2VL9 A;  2KLX A;  4PQ1 A;  3FYG A;  1GSQ A;  5LD0 A;  3ERF A;  3GX8 A;  3TKQ A;  18GS A;  2TIR A;  5AN1 A;  2DML A;  1Z6N A;  3IR4 A;  2WUL A;  1HQO A;  3Q6O A;  3TRQ A;  2L6D A;  4XS4 B;  1BAY A;  2EIQ A;  4TN8 A;  3HCZ A;  2D2Z A;  4F9Z A;  1XVW A;  3LXT A;  3P90 A;  1QUW A;  3LEF A;  4POL A;  6GSW A;  1B4P A;  3P2A A; 
#chains in the Genus database with same CATH topology
 4HUA A;  4JU5 A;  3V1W A;  4MMM A;  2WDU A;  4X43 A;  4K0G A;  3ZML A;  2LRT A;  1J08 A;  3F0I A;  4HSC X;  1TP9 A;  3TUE A;  1Z7P A;  2H71 A;  2LJA A;  4X4J A;  2DJ1 A;  1EGO A;  3QR6 A;  3M0F A;  2QA2 A;  1A2J A;  3ZFB A;  1VF1 A;  1T3B A;  2M80 A;  3A2W A;  3GX0 A;  1FB0 A;  1V2A A;  5IQY A;  22GS A;  1B9X C;  3RDW A;  2L57 A;  3O3T A;  3PH9 A;  5ECM B;  1GRX A;  2EIR A;  2F51 A;  2VD0 A;  1ZL9 A;  2CAQ A;  3FRC A;  1I9D A;  4Q5N A;  2VLV A;  5G30 A;  1ERV A;  3C1S A;  1TW9 A;  3TKS A;  4KSM A;  1DE2 A;  3KM6 A;  1NW2 A;  3GKM A;  5A4V A;  3UAR A;  4CY8 A;  5HR0 A;  3BD2 A;  1WP0 A;  3CTF A;  4TVE A;  3GMF A;  3FZ4 A;  2H6Z A;  1JLW A;  4ML1 A;  2P0G A;  3PR8 A;  2NTO A;  3A5I A;  5ECS A;  1BYE A;  1EEJ A;  2C0D A;  4OMV A;  1N8J A;  3VPT A;  5JWO B;  3JCM L;  5BMU A;  2R6K A;  3D4T A;  17GS A;  2LQO A;  1H4O A;  3EMX A;  1GSS A;  1N2A A;  1X5D A;  4PNG A;  4MP4 A;  1ST9 A;  4F2I A;  4L0U A;  4TR0 A;  4KAE A;  1UN2 A;  2X49 A;  2I4A A;  2R3X A;  2C1Y A;  2HI7 A;  1G7O A;  3I43 A;  3QPM A;  4MCU A;  5GAP D;  2YN1 A;  5D9X A;  4BVY B;  2WJU A;  2C3Q A;  1TXX A;  3HDC A;  1JZO A;  4V2N A;  5DJM A;  4K2X A;  4EKZ A;  3U6V A;  2GST A;  1R5P A;  4MAB A;  3F8U A;  2JAC A;  4KH7 A;  3NIV A;  4BPY A;  2YP6 A;  4JE1 A;  4PNF A;  5C04 A;  4BVY A;  1GLQ A;  4LL1 B;  2JL4 A;  1KNG A;  5IIZ A;  2X8G A;  1AQV A;  4N0V A;  4ICY A;  1M2A A;  1GUK A;  5G2Z A;  1MD4 A;  2MBT A;  2IPA A;  5D96 A;  1F9M A;  5JWQ B;  2GSS A;  1OC3 A;  4GQC A;  2IJY A;  4GQF A;  5ECN B;  1VRS D;  1T4Y A;  4O7H A;  1OAZ A;  3VLN A;  3F4S A;  2GGT A;  2K8V A;  3PIN A;  2H1A A;  1AXD A;  2VCV A;  4QL7 A;  1E2Y A;  2LNS A;  1K3Y A;  3GKK A;  1O7U A;  5IPH A;  1F6M C;  3NOF A;  3RPN A;  5ECI B;  5J4U A;  2OJL A;  4G0K A;  2R37 A;  2C3N A;  4ZL9 A;  3CSI A;  2VM2 A;  2N5F A;  2OE0 A;  4L8E A;  2FWH A;  3IHG A;  4GRF A;  1KTE A;  1TI1 A;  2EC4 A;  2IFQ B;  2WGR A;  3VK9 A;  2QC7 A;  2WS2 A;  3D4M A;  1URM A;  4ECB A;  5LNK e;  1ZZY A;  2KUC A;  5D9V A;  1B9Y C;  1F3A A;  1M0U A;  4IKH A;  3EYT A;  2AYT A;  5HR2 A;  3ME7 A;  3UAP A;  2F8F A;  3HVN A;  3ME8 A;  1DUG A;  3WGX A;  2H72 A;  2LKU A;  4N10 A;  3G7J A;  5J41 A;  1WMJ A;  2H1G A;  1YF0 A;  5LCZ A;  1A23 A;  4F0C A;  2YJH A;  1G6Y A;  5HFK A;  1TJD A;  2HRF A;  3QMX A;  5INY A;  5FHI A;  3UJ1 A;  3QDN A;  2GVP A;  4ZB9 A;  1K0C A;  4XHM A;  4MZC A;  1K3L A;  12GS A;  4N11 A;  3DEX A;  1BED A;  1JHB A;  4IQA A;  19GS A;  2PN8 A;  1U3A A;  1YEX A;  4G9H A;  4GCI A;  2GTU A;  3LFL A;  3AY8 A;  3I9V 2;  3TJJ A;  4PUA A;  4GSN A;  3H4K A;  3C7M A;  1BJX A;  4IQ1 A;  3BJ5 A;  3CBU A;  1X9S B;  2H0G A;  3FR3 A;  3QOU A;  1FB6 A;  2OAC A;  2JAD A;  4OCF A;  1M9A A;  3D5J A;  3ZZX A;  4PTS A;  4E8E A;  1F2E A;  1Y6E A;  2VCX A;  1AQW A;  3ZIV A;  3FW2 A;  1XWC A;  1JZW A;  1QXH A;  1GL8 A;  1BX9 A;  1ZYP A;  1A8L A;  1CQH A;  5DCG A;  4A5P A;  1DSB A;  3L9U A;  1F37 A;  3BBY A;  1ZYE A;  4TR4 A;  4WR4 A;  3WT1 A;  2MMO A;  2IMI A;  1FW1 A;  2OBK A;  4ULX A;  3HJM A;  1I5G A;  2NDO A;  2YWN A;  2A4V A;  1U6T A;  5D9T A;  2GLR A;  1XPV A;  1CQG A;  5F07 A;  1K0M A;  1GSY A;  4MNN A;  1PKW A;  3KJY A;  2NVL A;  1EZK A;  2V6O A;  4D73 B;  1X5C A;  3KH7 A;  1QGV A;  1THO A;  4WF5 A;  4P3Y B;  1T7P B;  3F9U A;  1XOA A;  1XW9 A;  2M46 A;  1YKC A;  1X0R A;  4K5S A;  5KEJ A;  2HXK A;  2XC2 A;  3C71 A;  2H73 A;  4HU7 A;  2MMA A;  3DVX A;  5BRT A;  3DWV A;  2FHE A;  1PX6 A;  4CHS A;  1EV4 A;  5EY6 A;  4J57 E;  1PA3 A;  2CX4 A;  2DJJ A;  2LJR A;  4PQI A;  4WBR D;  4IEL A;  4MA9 A;  2REM A;  3VI7 A;  3KZQ A;  1G6W A;  2HT9 A;  6GSY A;  5G1K A;  1FOH A;  4CW9 A;  1GTI A;  3WGD A;  4KDU A;  1XG8 A;  3IOS A;  2ON5 A;  2L5L A;  4Q5Q A;  4K7O A;  3HKR A;  4ACS A;  3A2V A;  2KHP A;  4TRX A;  3TJF A;  3FY7 A;  11GS A;  4ZIL A;  3CXG A;  4YKF A;  1TOF A;  1PN0 A;  2VOC A;  3VWV A;  1M99 A;  3VPQ A;  1OYJ A;  5DVB A;  1OC9 B;  1YEP A;  4MH3 A;  2PPT A;  5GST A;  3FKF A;  4KE3 A;  2I3Y A;  4G19 A;  2JZS A;  1O85 A;  3ZIT A;  1J9B A;  1OC9 A;  3LJR A;  1ZYN A;  3LSZ A;  3QFA C;  2LRN A;  1WJK A;  5CNW A;  3ZRD A;  2PWJ A;  5IMZ A;  5J9B A;  2O8V B;  1AW9 A;  1R26 A;  2IMD A;  1R7H A;  3LYP A;  1IYI A;  2CVB A;  4TKY A;  4GXZ A;  4PUR A;  3HD5 A;  4XIH A;  3H93 A;  4TXO A;  4G0L A;  2WZ9 A;  1YJ6 A;  4IN0 A;  3VI5 A;  2AB6 A;  2VD1 A;  3MSZ A;  1QFN A;  1XFL A;  1MDJ A;  4L5O A;  2WB9 A;  3FK8 A;  4KSO A;  5DDL A;  1T4Z A;  1R5A A;  2R4V A;  2H70 A;  4MJC A;  2VL3 A;  5H5S A;  3KEB A;  3RHC A;  5KN0 A;  4TOP A;  1R4W A;  5IM9 A;  2N5A A;  2H74 A;  2CX3 A;  1ZCP A;  3M9J A;  2IIY A;  4CY6 A;  4MF5 A;  3VWX A;  3MWH A;  3K8N A;  4FIW A;  4MDC A;  4IGJ A;  3GA4 A;  1HNB A;  2LTK A;  4LMV A;  3HA9 A;  4YAV A;  2B3S A;  5GAN D;  2LJK A;  4I2U A;  1KEB A;  5JCG A;  1GUH A;  4MK3 A;  4YKG A;  2FY6 A;  1C72 A;  4WKW A;  2LRC A;  4MJE A;  4RI6 A;  4V1A p;  1BG5 A;  4FO5 A;  4K1F A;  3EWL A;  5H5R A;  1GNE A;  2H66 A;  3E9J B;  3G7Y A;  3CTG A;  4YQM A;  1TK0 B;  2KOK A;  4TW5 A;  3QD9 A;  3L4N A;  2GZZ A;  2AUV A;  3EMP A;  5G31 A;  4V2L A;  2OKA A;  2OBI A;  4JR6 A;  5FT3 A;  2HLS A;  3IC4 A;  1AUC A;  3CRT A;  1TDI A;  2NPB A;  3H79 A;  3GRX A;  3TKP A;  5AIS A;  1PGT A;  1RK4 A;  1ERT A;  5ECQ B;  3EE2 A;  2XBI A;  2JU5 A;  2ALB A;  4ZIJ A;  3VWW A;  3HJP A;  1GSF A;  4KND A;  3CSH A;  2B1L A;  1TTZ A;  6GSU A;  2FLS A;  2X64 A;  3ZVJ A;  5ID2 A;  2RUE A;  1WWJ A;  1QQ2 A;  1XWB A;  2QKE A;  4NV5 A;  1OC8 A;  3CQF A;  5HR1 A;  4IW9 A;  5C00 A;  1NM3 A;  2HZE A;  2FNO A;  5DQS A;  1BQ7 A;  1V40 A;  2PMT A;  2CAI A;  3GNJ A;  3HY2 A;  2IN3 A;  4POM A;  3M8N A;  1KBN A;  1FAA A;  3TJK A;  3LYK A;  5B8A A;  3C73 A;  3S9F A;  1NSW A;  4IS0 A;  1NHO A;  1XCC A;  3IPZ A;  4J56 E;  4LMW A;  2VO4 A;  3H1N A;  4HEA 2;  5EPF A;  3US3 A;  5IOW A;  4PXO A;  4EUY A;  2LQQ A;  2LV3 A;  2H8L A;  4OCE A;  4PX1 A;  2GSR A;  2DIY A;  1H75 A;  2B7J A;  2H30 A;  2GT5 A;  5G1L A;  2R0G A;  1W4V A;  5F8B A;  3KD0 A;  1XW5 A;  5G5E A;  4BIK A;  4OFM A;  4JZQ A;  1VF4 A;  2WFC A;  5CRH A;  2FD3 A;  4YH2 A;  4YQU A;  1XVQ A;  4X0X A;  4OFT A;  4ISD A;  2A2S A;  4XRA A;  4Z2U A;  4IVF A;  4G10 A;  3VWU A;  5DAL A;  4BWQ A;  2R2J A;  2TRC P;  3IK9 A;  2ON7 A;  1Z5Y E;  3CYN A;  3WD6 A;  3GUS A;  3TKS C;  3RPP A;  5DBQ A;  4WF4 A;  1SL1 B;  2GZP A;  1XWG A;  4JED A;  4USS A;  5JCU A;  3FZA A;  4QL9 A;  3F4R A;  3ZFL A;  1GSE A;  2CZ3 A;  2GQM A;  5ABR A;  4KA0 A;  5IMA A;  2C3T A;  5ECO B;  1ZYQ B;  1M3I A;  4HZ2 A;  2O7K A;  2AHE A;  1Z7R A;  2L5O A;  5ECH B;  3W8J A;  4LL4 B;  4PGT A;  5J3R A;  3IBH A;  3CRU A;  3LGC A;  2PVO C;  4KDY A;  1FVJ A;  3QFB C;  2L4C A;  3WT2 A;  4GLT A;  3LW9 A;  2HZF A;  4ZXG A;  4BVX A;  5CYY A;  4O92 A;  2C8U A;  4PUF C;  1LBK A;  1T8E B;  5GSS A;  4ML6 A;  1X5E A;  3GL3 A;  2MMZ A;  1TU7 A;  1WIK A;  4ECI A;  2GZY A;  2YZU A;  1XWK A;  1U88 A;  3N9J A;  5A4U A;  5AIV A;  2AJQ B;  3D0Z A;  1DBY A;  2R0C A;  3L9S A;  4HQZ A;  1X9W B;  3EPT A;  1PMT A;  2BJX A;  3ZTL A;  1MTC A;  1EEM A;  2DLX A;  4ZBB A;  5IPG A;  3ERW A;  2YWM A;  1PQN A;  4LLR A;  3H8Q A;  1O8X A;  4CDO A;  3IAM 2;  3M3M A;  4RQR A;  1DE1 A;  4H86 A;  1GTB A;  3F3R A;  2F9S A;  3EVI A;  3HYP A;  5KN2 A;  5COH A;  4MZW A;  4HDE A;  1A24 A;  1AAZ A;  2VL2 A;  3RAZ A;  2PBJ A;  1MEK A;  5ECL B;  1Z6M A;  1YY7 A;  5B7C A;  2K18 A;  3KMN A;  2YAN A;  2CT6 A;  3GN3 A;  4HOJ A;  4WR5 A;  1OE8 A;  3IRA A;  3KIJ A;  1GUM A;  3J7Y k;  1PL1 A;  3HVX A;  3GTU A;  3Q18 A;  4XRD A;  1SU9 A;  4PQH A;  3IHQ A;  1WE0 A;  4KGI A;  3DYR A;  1JFU A;  1IYH A;  3IXR A;  3DVW A;  4POB A;  4TR1 A;  1S3A A;  2HRN A;  1K3O A;  5CO3 A;  5HFG A;  1TK5 B;  4K6X A;  3ZL5 A;  1M3J A;  3IV4 A;  2CZ2 A;  2H6X A;  4AJ7 A;  5CRD A;  2VCT A;  2HRK A;  4AJ6 A;  2L6C A;  1SD8 A;  3J7Y b;  2LUS A;  2RII A;  4DSS B;  2AAW A;  2H0H A;  2GQL A;  3QCP A;  4FQU A;  1TKD B;  2R5G A;  1EOH A;  3FEU A;  4MJA A;  4WBJ A;  4AJ8 A;  2DJ2 A;  1GLP A;  2QGV A;  2E2M A;  5D9W A;  4DSS A;  4TXV A;  1SJ6 A;  2AV4 A;  2VLT A;  1EWX A;  2VM1 A;  1RQM A;  3G7I A;  4IHU A;  3HHV A;  2OA7 A;  2DKH A;  1MDK A;  1OVN A;  2VL2 C;  1PSQ A;  1K0D A;  2YCD A;  1PX7 A;  4ECC A;  1LU4 A;  2JSZ A;  4FH8 A;  2L4Q A;  1O6J A;  4HJ2 A;  3SBC A;  1M2B A;  2YWO A;  1XWA A;  3Q74 A;  4YAP A;  2GSQ A;  2HSY A;  2ES7 A;  2FWE A;  3HZ4 A;  1O8W A;  3L0H A;  4Q5F A;  1GUL A;  4KUN A;  3E3E A;  1K0B A;  1A2M A;  3FHK A;  4XCS A;  3RHB A;  5IOX A;  4K9Z A;  1MD3 A;  2FA4 A;  2GQK A;  3IA1 A;  4EO3 A;  2XBQ A;  2LNT A;  2DJ3 A;  3DKS A;  3UOM A;  3M1G A;  3A5W A;  4X1U A;  3VUR A;  4EIQ A;  3GKX A;  4ILF A;  2X8H A;  2YOI A;  1F3B A;  5DQY A;  5HQP A;  2C0G A;  4GSS A;  4I2T A;  3E0U A;  1GH2 A;  4ECJ A;  2VCW A;  1FOV A;  3I6A A;  3GL5 A;  3HJO A;  1GNW A;  4ZBA A;  1EGR A;  1FG4 A;  1S3D A;  3C8E A;  1EOG A;  1FHE A;  4NXI A;  1TRS A;  4NPB A;  1SJI A;  4AGS A;  2FA8 A;  1V98 A;  3F3Q A;  3MNG A;  2FCH A;  1Q4J A;  5HR3 A;  1PKZ A;  5IMC A;  5H5Q A;  2HSM A;  3ZIJ A;  3KTB A;  2YWI A;  3EU4 A;  4IP6 A;  4BL7 B;  5ELA A;  1GWC A;  4KCA A;  3PPU A;  5F06 A;  3APO A;  4HJM A;  3D6I A;  4EDY A;  4L0W A;  1ABA A;  4TXO B;  6GSV A;  3TJG A;  3ZLP A;  3GUR A;  4EE0 A;  1UC7 A;  2B5Y A;  2V1M A;  2V6K A;  3LQ7 A;  2DIZ A;  4XS6 A;  4ZBD A;  4BL7 A;  3LWA A;  2J23 A;  4F82 A;  4Z7X A;  3KMO A;  1A2L A;  5B8B A;  1GTU A;  3C1R A;  4ID0 A;  4JRR A;  4FYB A;  1B8X A;  5F0G A;  4L5L A;  3UVH A;  6GSS A;  1T00 A;  1M7T A;  3OR5 A;  3GSS A;  2HSH A;  3IC8 A;  1Y25 A;  1XBS A;  1UA5 A;  4MLY A;  3DRN A;  1TI3 A;  4DSR A;  3R3E A;  6GSX A;  2R0P A;  3UVT A;  1ZMA A;  2C80 A;  3MYD A;  1WPI A;  2VIM A;  3KP8 A;  3IDV A;  1TK8 B;  3D21 A;  1QK8 A;  20GS A;  3ZMK A;  4POK A;  1FO5 A;  1USB A;  2X4A A;  3KP9 A;  2VAF A;  2B6M A;  2F3M A;  1ZGN A;  2G2Q A;  3HVS A;  1TRV A;  5AGY A;  4IP1 A;  1FVK A;  2I81 A;  3D22 A;  2CV4 A;  4V1A g;  4BA7 A;  1M2D A;  1HNA A;  6GST A;  3DML A;  4EF0 A;  2P5R A;  1Z3E A;  1AIU A;  1A0F A;  3GST A;  4MF7 A;  4EDZ A;  4EL1 A;  5ID2 B;  4XS4 A;  1TRU A;  2VCQ A;  3BCI A;  2IL3 A;  1XIY A;  3TJB A;  3UEM A;  3FZ9 A;  2H01 A;  1ILO A;  2H0I A;  1W89 A;  5IO2 A;  2YPM A;  1PL2 A;  3HVV A;  2QA1 A;  2IME A;  16GS A;  1THX A;  2G0F A;  2HZE B;  3ZVJ D;  2V41 A;  5ELG A;  5DJL A;  1SK1 A;  1GSD A;  3N5O A;  1QMV A;  3GH9 A;  2K8S A;  4KX4 A;  4ZL8 A;  5B6M A;  4J2F A;  3WGE A;  1PN9 A;  5J5N A;  2BTO T;  5CAX A;  4RI7 A;  3A2X A;  1S3C A;  1K0O A;  4K8M A;  3I69 A;  14GS A;  2BMX A;  5GZZ B;  4EXJ A;  4K5R A;  4OO5 A;  1U87 A;  1ON4 A;  2DMM A;  3GHA A;  2HFD A;  2O85 A;  2FGX A;  2FWG A;  3FZ5 A;  2H6Y A;  2CVD A;  3FR9 A;  7GSS A;  4K7I A;  4MZB A;  3QAG A;  3TKR A;  5D8I A;  2E7P A;  4HQS A;  5ECK B;  3SWL A;  5IMV A;  4I6X A;  2B5E A;  2DJ0 A;  3U5R E;  1JLV A;  1LJR A;  1SL2 B;  4GTU A;  5CRE A;  5DAL B;  4ZB6 A;  4OO4 A;  1VF3 A;  3W8S A;  1ACV A;  5CRW A;  4EC0 A;  2KP1 A;  2MZC A;  2A2R A;  2UZ8 A;  4WET A;  3F4T A;  1NHY A;  1SYR A;  3BCK A;  2E0Q A;  2JZR A;  3IE3 A;  4K7N A;  3L78 A;  4N30 A;  5IO0 A;  4FYC A;  1V9W A;  2OE1 A;  1AQX A;  2K9F A;  2PU9 C;  1SEN A;  3GFK A;  3EC3 A;  1EP8 A;  2B5X A;  3A3T A;  1YZX A;  3FMW A;  3EU3 A;  5IMD A;  3IK7 A;  2N5B A;  4HZ4 A;  3QAW A;  3TOU A;  5IMF A;  4BVX B;  1RW1 A;  3L9V A;  5D93 A;  2IMF A;  1SL0 B;  1U3I A;  1ZOF A;  3ED3 A;  3EIN A;  4RQX A;  4F0B A;  2B1K A;  3G9B A;  2GDR A;  2A2P A;  1AC1 A;  3GH6 A;  3UL3 A;  2TRX A;  2I9H A;  4ZL7 A;  3DXB A;  2YJ7 A;  1SKS B;  3TDG A;  2DJK A;  2RUF A;  1V58 A;  4IJI A;  1GP1 A;  2L59 A;  2ZUP A;  3UBL A;  5L71 A;  4WXT A;  4I8B A;  3W6G A;  5B6N A;  1O73 A;  2A4H A;  2OAD A;  2DC5 A;  3IAS 2;  4KB3 A;  2GT6 A;  1GSU A;  2YV7 A;  3ZRE A;  2C0E A;  2XHF A;  5EL8 A;  4DSQ A;  3HXS A;  4F03 A;  2F8A A;  1OE7 A;  5D73 A;  4NHW A;  4NHZ A;  3DD3 A;  4Q5R A;  2O87 A;  1WOU A;  2YV9 A;  3GTU B;  4NV2 A;  2IMK A;  2IFQ A;  2GS3 A;  3FR6 A;  4Z2R A;  5JCW A;  4HI7 A;  3PGT A;  2PUK C;  3F6F A;  3KTL A;  2X8C A;  3UBK A;  3TGZ A;  2IWT A;  3ISO A;  3RBT A;  1A0R P;  4TR1 B;  2RM6 A;  1SYX A;  5EVO A;  2I1U A;  2CVK A;  4G0I A;  5ECP B;  2H76 A;  3MDK A;  4MF6 A;  4XS1 A;  4JR4 A;  4K0N A;  2K6V A;  4GF0 A;  2OE3 A;  3GIX A;  4AF2 A;  3P8W A;  5KOW A;  2DBC A;  2JSY A;  2H1B A;  1EV9 A;  2MBS A;  5HFI A;  1SJZ A;  2QSI A;  2RLI A;  4TR3 A;  4FYU A;  1ERU A;  4G2E A;  4BWS A;  1UVZ A;  3DGQ A;  5A4W A;  1ML6 A;  2KP2 A;  4RUV A;  5A5K A;  2YNX A;  1YDK A;  1TRW A;  1J0F A;  1G0T A;  3TCO A;  4GST A;  3MAK A;  1OKT A;  4NWY A;  3O6T A;  1VF2 A;  2XPD A;  1V57 A;  3TRP A;  1PRX A;  4ZB8 A;  4IBP A;  4EIP A;  2CQ9 A;  4MH2 A;  1PFO A;  2CA8 A;  2DKI A;  2X99 A;  2P31 A;  4N0Z A;  3TB2 A;  2MYG A;  1ERW A;  3F63 A;  1GTA A;  2E2G A;  1M9B A;  3ZYW A;  1Q98 A;  3GKN A;  3KXO A;  1YF1 A;  2EIO A;  4I5Q A;  2WRT A;  1O81 A;  2PER A;  4EVM A;  3Q19 A;  3KCM A;  3CMI A;  1T1V A;  1EP7 A;  1SK0 A;  3GV1 A;  4MPF A;  5KOX A;  3QAV A;  4KW6 A;  1VGL A;  3APQ A;  3EUR A;  5CP1 A;  4MPG A;  1SKW B;  4V2M A;  1WRY A;  5ENU A;  1XXU A;  8GSS A;  3ERG A;  3HZ8 A;  2XPE A;  2Z9S A;  1XZO A;  13GS A;  2HE3 A;  5DCH A;  1SK2 A;  3DIE A;  1XW6 A;  4OD7 A;  5DAK B;  3P7X A;  4D73 A;  4IJ3 A;  1YKA A;  2C0F A;  1SD9 A;  4NAX A;  2HYX A;  5KN1 A;  3TRX A;  3LXZ A;  3O76 A;  4LA1 A;  3M9K A;  1MDI A;  2LEG A;  3MIX A;  5DAK A;  1G7E A;  2NBS A;  4DEJ A;  2M72 A;  5E4W A;  4MJB A;  2VUP A;  4YQV A;  2ZNM A;  1XOB A;  2H19 A;  2ZCT A;  4QQ7 A;  2HNL A;  4XTS A;  1PD2 1;  2JZT A;  2P5Q A;  4NMU A;  2B7K A;  2VCZ A;  5ECR B;  3F6D A;  2YZH A;  4WEY A;  5E59 A;  1TU8 A;  3CSJ A;  4KCE A;  3KGK A;  4I97 A;  1JZR A;  2H75 A;  4O32 A;  3LOR A;  1K0N A;  3UMA A;  5J9C A;  1JZD A;  3GYK A;  1K0A A;  1HNC A;  1HYU A;  3VFI A;  2VLU A;  2PVQ A;  4GWR A;  1YQ1 A;  4OWY A;  3LG6 A;  4KDX A;  1A8Y A;  4HU9 A;  3KH9 A;  5F05 A;  9GSS A;  3APS A;  10GS A;  2FUG 2;  4DVC A;  5JWR B;  5CRG A;  3NZN A;  2C4J A;  2DSA A;  5KN3 A;  4JBB A;  4O5R A;  1Z9H A;  1X9M B;  1S3R A;  4O5U A;  2V32 A;  2H1D A;  4OFN A;  2V2G A;  2RM5 A;  4E8H A;  4HS1 A;  1OKD A;  5FWG A;  5G5F A;  1B4Q A;  3TOT A;  2PGT A;  1E6B A;  3TKS E;  2FWF A;  1HD2 A;  4K2D A;  2MMN A;  1B48 A;  3UIW A;  2O89 A;  3R2Q A;  4KF9 A;  2LS5 A;  1SKR B;  3BOA A;  2LST A;  2WCI A;  2J9H A;  5AIX A;  3WYW A;  2VL9 A;  2KLX A;  4PQ1 A;  3FYG A;  1GSQ A;  5LD0 A;  3ERF A;  3GX8 A;  3TKQ A;  18GS A;  2HRA A;  2TIR A;  5AN1 A;  2DML A;  4O5Q A;  1Z6N A;  3IR4 A;  2WUL A;  3Q6O A;  1HQO A;  3TRQ A;  2L6D A;  4XS4 B;  1BAY A;  2EIQ A;  4TN8 A;  3HCZ A;  2D2Z A;  4F9Z A;  1XVW A;  3LXT A;  3P90 A;  1QUW A;  4Z2T A;  3LEF A;  4POL A;  6GSW A;  1B4P A;  3P2A A; 
#chains in the Genus database with same CATH homology
 4HUA A;  4JU5 A;  3V1W A;  4MMM A;  2WDU A;  4X43 A;  4K0G A;  3ZML A;  2LRT A;  1J08 A;  3F0I A;  1TP9 A;  3TUE A;  1Z7P A;  2H71 A;  2LJA A;  4X4J A;  2DJ1 A;  1EGO A;  3QR6 A;  3M0F A;  2QA2 A;  1A2J A;  3ZFB A;  1VF1 A;  1T3B A;  2M80 A;  3A2W A;  3GX0 A;  1FB0 A;  1V2A A;  5IQY A;  22GS A;  1B9X C;  3RDW A;  2L57 A;  3O3T A;  3PH9 A;  5ECM B;  1GRX A;  2EIR A;  2F51 A;  2VD0 A;  1ZL9 A;  2CAQ A;  3FRC A;  1I9D A;  4Q5N A;  2VLV A;  5G30 A;  1ERV A;  3C1S A;  1TW9 A;  3TKS A;  4KSM A;  1DE2 A;  3KM6 A;  1NW2 A;  3GKM A;  5A4V A;  3UAR A;  4CY8 A;  5HR0 A;  3BD2 A;  1WP0 A;  3CTF A;  4TVE A;  3GMF A;  3FZ4 A;  2H6Z A;  1JLW A;  4ML1 A;  2P0G A;  3PR8 A;  2NTO A;  3A5I A;  5ECS A;  1BYE A;  1EEJ A;  2C0D A;  4OMV A;  1N8J A;  3VPT A;  5JWO B;  3JCM L;  5BMU A;  2R6K A;  3D4T A;  17GS A;  2LQO A;  1H4O A;  3EMX A;  1GSS A;  1N2A A;  1X5D A;  4PNG A;  4MP4 A;  1ST9 A;  4F2I A;  4L0U A;  4TR0 A;  4KAE A;  1UN2 A;  2X49 A;  2I4A A;  2R3X A;  2C1Y A;  2HI7 A;  1G7O A;  3I43 A;  3QPM A;  4MCU A;  5GAP D;  2YN1 A;  5D9X A;  4BVY B;  2WJU A;  2C3Q A;  1TXX A;  3HDC A;  1JZO A;  4V2N A;  5DJM A;  4K2X A;  4EKZ A;  3U6V A;  2GST A;  1R5P A;  4MAB A;  3F8U A;  2JAC A;  4KH7 A;  3NIV A;  4BPY A;  2YP6 A;  4JE1 A;  4PNF A;  5C04 A;  4BVY A;  1GLQ A;  4LL1 B;  2JL4 A;  1KNG A;  5IIZ A;  2X8G A;  1AQV A;  4N0V A;  4ICY A;  1M2A A;  1GUK A;  5G2Z A;  1MD4 A;  2MBT A;  2IPA A;  5D96 A;  1F9M A;  5JWQ B;  2GSS A;  1OC3 A;  4GQC A;  2IJY A;  4GQF A;  5ECN B;  1VRS D;  1T4Y A;  4O7H A;  1OAZ A;  3VLN A;  3F4S A;  2GGT A;  2K8V A;  3PIN A;  2H1A A;  1AXD A;  2VCV A;  4QL7 A;  1E2Y A;  2LNS A;  1K3Y A;  3GKK A;  1O7U A;  5IPH A;  1F6M C;  3NOF A;  3RPN A;  5ECI B;  5J4U A;  2OJL A;  4G0K A;  2R37 A;  2C3N A;  4ZL9 A;  3CSI A;  2VM2 A;  2N5F A;  2OE0 A;  4L8E A;  2FWH A;  3IHG A;  4GRF A;  1KTE A;  1TI1 A;  2EC4 A;  2IFQ B;  2WGR A;  3VK9 A;  2QC7 A;  2WS2 A;  3D4M A;  1URM A;  4ECB A;  5LNK e;  1ZZY A;  2KUC A;  5D9V A;  1B9Y C;  1F3A A;  1M0U A;  4IKH A;  3EYT A;  2AYT A;  5HR2 A;  3ME7 A;  3UAP A;  2F8F A;  3ME8 A;  1DUG A;  3WGX A;  2H72 A;  2LKU A;  4N10 A;  3G7J A;  5J41 A;  1WMJ A;  2H1G A;  1YF0 A;  5LCZ A;  1A23 A;  4F0C A;  2YJH A;  1G6Y A;  5HFK A;  1TJD A;  2HRF A;  3QMX A;  5INY A;  5FHI A;  3UJ1 A;  3QDN A;  2GVP A;  4ZB9 A;  1K0C A;  4XHM A;  4MZC A;  1K3L A;  12GS A;  4N11 A;  3DEX A;  1BED A;  1JHB A;  4IQA A;  19GS A;  2PN8 A;  1U3A A;  1YEX A;  4G9H A;  4GCI A;  2GTU A;  3LFL A;  3AY8 A;  3I9V 2;  3TJJ A;  4PUA A;  4GSN A;  3H4K A;  3C7M A;  1BJX A;  4IQ1 A;  3BJ5 A;  3CBU A;  1X9S B;  2H0G A;  3FR3 A;  3QOU A;  1FB6 A;  2OAC A;  2JAD A;  4OCF A;  1M9A A;  3D5J A;  3ZZX A;  4PTS A;  4E8E A;  1F2E A;  1Y6E A;  2VCX A;  1AQW A;  3ZIV A;  3FW2 A;  1XWC A;  1JZW A;  1QXH A;  1GL8 A;  1BX9 A;  1ZYP A;  1A8L A;  1CQH A;  5DCG A;  4A5P A;  1DSB A;  3L9U A;  1F37 A;  3BBY A;  1ZYE A;  4TR4 A;  4WR4 A;  3WT1 A;  2MMO A;  2IMI A;  1FW1 A;  2OBK A;  4ULX A;  3HJM A;  1I5G A;  2NDO A;  2YWN A;  2A4V A;  1U6T A;  5D9T A;  2GLR A;  1XPV A;  1CQG A;  5F07 A;  1K0M A;  1GSY A;  4MNN A;  1PKW A;  3KJY A;  2NVL A;  1EZK A;  2V6O A;  4D73 B;  1X5C A;  3KH7 A;  1QGV A;  1THO A;  4WF5 A;  4P3Y B;  1T7P B;  3F9U A;  1XOA A;  1XW9 A;  2M46 A;  1YKC A;  1X0R A;  4K5S A;  5KEJ A;  2HXK A;  2XC2 A;  3C71 A;  2H73 A;  4HU7 A;  2MMA A;  3DVX A;  5BRT A;  3DWV A;  2FHE A;  1PX6 A;  4CHS A;  1EV4 A;  5EY6 A;  4J57 E;  1PA3 A;  2CX4 A;  2DJJ A;  2LJR A;  4PQI A;  4WBR D;  4IEL A;  4MA9 A;  2REM A;  3VI7 A;  3KZQ A;  1G6W A;  2HT9 A;  6GSY A;  5G1K A;  1FOH A;  4CW9 A;  1GTI A;  3WGD A;  4KDU A;  3IOS A;  2ON5 A;  2L5L A;  4Q5Q A;  4K7O A;  3HKR A;  4ACS A;  3A2V A;  2KHP A;  4TRX A;  3TJF A;  3FY7 A;  11GS A;  4ZIL A;  3CXG A;  4YKF A;  1TOF A;  1PN0 A;  2VOC A;  3VWV A;  1M99 A;  3VPQ A;  1OYJ A;  5DVB A;  1OC9 B;  1YEP A;  4MH3 A;  2PPT A;  5GST A;  3FKF A;  4KE3 A;  2I3Y A;  4G19 A;  2JZS A;  1O85 A;  3ZIT A;  1J9B A;  1OC9 A;  3LJR A;  1ZYN A;  3LSZ A;  3QFA C;  2LRN A;  1WJK A;  5CNW A;  3ZRD A;  2PWJ A;  5IMZ A;  5J9B A;  2O8V B;  1AW9 A;  1R26 A;  2IMD A;  1R7H A;  3LYP A;  1IYI A;  2CVB A;  4TKY A;  4GXZ A;  4PUR A;  3HD5 A;  4XIH A;  3H93 A;  4TXO A;  4G0L A;  2WZ9 A;  1YJ6 A;  4IN0 A;  3VI5 A;  2AB6 A;  2VD1 A;  3MSZ A;  1QFN A;  1XFL A;  1MDJ A;  4L5O A;  2WB9 A;  3FK8 A;  4KSO A;  5DDL A;  1T4Z A;  1R5A A;  2R4V A;  2H70 A;  4MJC A;  2VL3 A;  5H5S A;  3KEB A;  3RHC A;  5KN0 A;  4TOP A;  1R4W A;  5IM9 A;  2N5A A;  2H74 A;  2CX3 A;  1ZCP A;  3M9J A;  2IIY A;  4CY6 A;  4MF5 A;  3VWX A;  3MWH A;  3K8N A;  4FIW A;  4MDC A;  4IGJ A;  3GA4 A;  1HNB A;  2LTK A;  4LMV A;  3HA9 A;  4YAV A;  2B3S A;  5GAN D;  2LJK A;  4I2U A;  1KEB A;  5JCG A;  1GUH A;  4MK3 A;  4YKG A;  2FY6 A;  1C72 A;  4WKW A;  2LRC A;  4MJE A;  4RI6 A;  4V1A p;  1BG5 A;  4FO5 A;  4K1F A;  3EWL A;  5H5R A;  1GNE A;  2H66 A;  3E9J B;  3G7Y A;  3CTG A;  4YQM A;  1TK0 B;  2KOK A;  4TW5 A;  3QD9 A;  3L4N A;  2GZZ A;  2AUV A;  3EMP A;  5G31 A;  4V2L A;  2OKA A;  2OBI A;  4JR6 A;  5FT3 A;  2HLS A;  3IC4 A;  1AUC A;  3CRT A;  1TDI A;  2NPB A;  3H79 A;  3GRX A;  3TKP A;  5AIS A;  1PGT A;  1RK4 A;  1ERT A;  5ECQ B;  3EE2 A;  2XBI A;  2JU5 A;  2ALB A;  4ZIJ A;  3VWW A;  3HJP A;  1GSF A;  4KND A;  3CSH A;  2B1L A;  1TTZ A;  6GSU A;  2FLS A;  2X64 A;  3ZVJ A;  5ID2 A;  2RUE A;  1WWJ A;  1QQ2 A;  1XWB A;  2QKE A;  4NV5 A;  1OC8 A;  5HR1 A;  4IW9 A;  5C00 A;  1NM3 A;  2HZE A;  2FNO A;  5DQS A;  1BQ7 A;  1V40 A;  2PMT A;  2CAI A;  3GNJ A;  3HY2 A;  2IN3 A;  4POM A;  3M8N A;  1KBN A;  1FAA A;  3TJK A;  3LYK A;  5B8A A;  3C73 A;  3S9F A;  1NSW A;  4IS0 A;  1NHO A;  1XCC A;  3IPZ A;  4J56 E;  4LMW A;  2VO4 A;  3H1N A;  4HEA 2;  5EPF A;  3US3 A;  5IOW A;  4PXO A;  4EUY A;  2LQQ A;  2LV3 A;  2H8L A;  4OCE A;  4PX1 A;  2GSR A;  2DIY A;  1H75 A;  2B7J A;  2H30 A;  2GT5 A;  5G1L A;  2R0G A;  1W4V A;  5F8B A;  3KD0 A;  1XW5 A;  5G5E A;  4OFM A;  4JZQ A;  1VF4 A;  2WFC A;  5CRH A;  2FD3 A;  4YH2 A;  4YQU A;  1XVQ A;  4X0X A;  4OFT A;  4ISD A;  2A2S A;  4XRA A;  4Z2U A;  4IVF A;  4G10 A;  3VWU A;  5DAL A;  4BWQ A;  2R2J A;  2TRC P;  3IK9 A;  2ON7 A;  1Z5Y E;  3CYN A;  3WD6 A;  3GUS A;  3TKS C;  3RPP A;  5DBQ A;  4WF4 A;  1SL1 B;  2GZP A;  1XWG A;  4JED A;  4USS A;  5JCU A;  3FZA A;  4QL9 A;  3F4R A;  3ZFL A;  1GSE A;  2CZ3 A;  2GQM A;  5ABR A;  4KA0 A;  5IMA A;  2C3T A;  5ECO B;  1ZYQ B;  4HZ2 A;  2O7K A;  2AHE A;  1Z7R A;  2L5O A;  5ECH B;  3W8J A;  4LL4 B;  4PGT A;  5J3R A;  3IBH A;  3CRU A;  3LGC A;  2PVO C;  4KDY A;  1FVJ A;  3QFB C;  2L4C A;  3WT2 A;  4GLT A;  3LW9 A;  2HZF A;  4ZXG A;  4BVX A;  5CYY A;  4O92 A;  2C8U A;  4PUF C;  1LBK A;  1T8E B;  5GSS A;  4ML6 A;  1X5E A;  3GL3 A;  2MMZ A;  1TU7 A;  1WIK A;  4ECI A;  2GZY A;  2YZU A;  1XWK A;  1U88 A;  3N9J A;  5A4U A;  5AIV A;  2AJQ B;  3D0Z A;  1DBY A;  2R0C A;  3L9S A;  4HQZ A;  1X9W B;  3EPT A;  1PMT A;  2BJX A;  3ZTL A;  1MTC A;  1EEM A;  2DLX A;  4ZBB A;  5IPG A;  3ERW A;  2YWM A;  1PQN A;  4LLR A;  3H8Q A;  1O8X A;  4CDO A;  3IAM 2;  3M3M A;  4RQR A;  1DE1 A;  4H86 A;  1GTB A;  3F3R A;  2F9S A;  3EVI A;  3HYP A;  5KN2 A;  5COH A;  4MZW A;  4HDE A;  1A24 A;  1AAZ A;  2VL2 A;  3RAZ A;  2PBJ A;  1MEK A;  5ECL B;  1Z6M A;  1YY7 A;  5B7C A;  2K18 A;  3KMN A;  2YAN A;  2CT6 A;  3GN3 A;  4HOJ A;  4WR5 A;  1OE8 A;  3IRA A;  3KIJ A;  1GUM A;  3J7Y k;  1PL1 A;  3HVX A;  3GTU A;  3Q18 A;  4XRD A;  1SU9 A;  4PQH A;  3IHQ A;  1WE0 A;  4KGI A;  3DYR A;  1JFU A;  1IYH A;  3IXR A;  3DVW A;  4POB A;  4TR1 A;  1S3A A;  2HRN A;  1K3O A;  5CO3 A;  5HFG A;  1TK5 B;  4K6X A;  3ZL5 A;  3IV4 A;  2CZ2 A;  2H6X A;  4AJ7 A;  5CRD A;  2VCT A;  2HRK A;  4AJ6 A;  2L6C A;  1SD8 A;  3J7Y b;  2LUS A;  2RII A;  4DSS B;  2AAW A;  2H0H A;  2GQL A;  3QCP A;  4FQU A;  1TKD B;  2R5G A;  1EOH A;  3FEU A;  4MJA A;  4WBJ A;  4AJ8 A;  2DJ2 A;  1GLP A;  2QGV A;  2E2M A;  5D9W A;  4DSS A;  4TXV A;  1SJ6 A;  2AV4 A;  2VLT A;  1EWX A;  2VM1 A;  1RQM A;  3G7I A;  4IHU A;  3HHV A;  2OA7 A;  2DKH A;  1MDK A;  1OVN A;  2VL2 C;  1PSQ A;  1K0D A;  2YCD A;  1PX7 A;  4ECC A;  1LU4 A;  2JSZ A;  4FH8 A;  2L4Q A;  1O6J A;  4HJ2 A;  3SBC A;  1M2B A;  2YWO A;  1XWA A;  3Q74 A;  4YAP A;  2GSQ A;  2HSY A;  2ES7 A;  2FWE A;  3HZ4 A;  1O8W A;  3L0H A;  4Q5F A;  1GUL A;  4KUN A;  3E3E A;  1K0B A;  1A2M A;  3FHK A;  4XCS A;  3RHB A;  5IOX A;  4K9Z A;  1MD3 A;  2FA4 A;  2GQK A;  3IA1 A;  4EO3 A;  2XBQ A;  2LNT A;  2DJ3 A;  3DKS A;  3UOM A;  3M1G A;  3A5W A;  4X1U A;  3VUR A;  4EIQ A;  3GKX A;  4ILF A;  2X8H A;  2YOI A;  1F3B A;  5DQY A;  5HQP A;  2C0G A;  4GSS A;  4I2T A;  3E0U A;  1GH2 A;  4ECJ A;  2VCW A;  1FOV A;  3I6A A;  3GL5 A;  3HJO A;  1GNW A;  4ZBA A;  1EGR A;  1FG4 A;  1S3D A;  3C8E A;  1EOG A;  1FHE A;  4NXI A;  1TRS A;  4NPB A;  1SJI A;  4AGS A;  2FA8 A;  1V98 A;  3F3Q A;  3MNG A;  2FCH A;  1Q4J A;  5HR3 A;  1PKZ A;  5IMC A;  5H5Q A;  2HSM A;  3ZIJ A;  3KTB A;  2YWI A;  3EU4 A;  4IP6 A;  4BL7 B;  5ELA A;  1GWC A;  4KCA A;  3PPU A;  5F06 A;  3APO A;  4HJM A;  3D6I A;  4EDY A;  4L0W A;  1ABA A;  4TXO B;  6GSV A;  3TJG A;  3ZLP A;  3GUR A;  4EE0 A;  1UC7 A;  2B5Y A;  2V1M A;  2V6K A;  3LQ7 A;  2DIZ A;  4XS6 A;  4ZBD A;  4BL7 A;  3LWA A;  2J23 A;  4F82 A;  4Z7X A;  3KMO A;  1A2L A;  5B8B A;  1GTU A;  3C1R A;  4ID0 A;  4JRR A;  4FYB A;  1B8X A;  5F0G A;  4L5L A;  3UVH A;  6GSS A;  1T00 A;  1M7T A;  3OR5 A;  3GSS A;  2HSH A;  3IC8 A;  1Y25 A;  1XBS A;  1UA5 A;  4MLY A;  3DRN A;  1TI3 A;  4DSR A;  3R3E A;  6GSX A;  2R0P A;  3UVT A;  1ZMA A;  2C80 A;  3MYD A;  1WPI A;  2VIM A;  3KP8 A;  3IDV A;  1TK8 B;  3D21 A;  1QK8 A;  20GS A;  3ZMK A;  4POK A;  1FO5 A;  1USB A;  2X4A A;  3KP9 A;  2VAF A;  2B6M A;  2F3M A;  1ZGN A;  2G2Q A;  3HVS A;  1TRV A;  5AGY A;  4IP1 A;  1FVK A;  2I81 A;  3D22 A;  2CV4 A;  4V1A g;  4BA7 A;  1M2D A;  1HNA A;  6GST A;  3DML A;  4EF0 A;  2P5R A;  1Z3E A;  1AIU A;  1A0F A;  3GST A;  4MF7 A;  4EDZ A;  4EL1 A;  5ID2 B;  4XS4 A;  1TRU A;  2VCQ A;  3BCI A;  2IL3 A;  1XIY A;  3TJB A;  3UEM A;  3FZ9 A;  2H01 A;  1ILO A;  2H0I A;  1W89 A;  5IO2 A;  2YPM A;  1PL2 A;  3HVV A;  2QA1 A;  2IME A;  16GS A;  1THX A;  2G0F A;  2HZE B;  3ZVJ D;  2V41 A;  5ELG A;  5DJL A;  1SK1 A;  1GSD A;  3N5O A;  1QMV A;  3GH9 A;  2K8S A;  4KX4 A;  4ZL8 A;  5B6M A;  4J2F A;  3WGE A;  1PN9 A;  5J5N A;  2BTO T;  5CAX A;  4RI7 A;  3A2X A;  1S3C A;  1K0O A;  4K8M A;  3I69 A;  14GS A;  2BMX A;  5GZZ B;  4EXJ A;  4K5R A;  4OO5 A;  1U87 A;  1ON4 A;  2DMM A;  3GHA A;  2HFD A;  2O85 A;  2FGX A;  2FWG A;  3FZ5 A;  2H6Y A;  2CVD A;  3FR9 A;  7GSS A;  4K7I A;  4MZB A;  3QAG A;  3TKR A;  5D8I A;  2E7P A;  4HQS A;  5ECK B;  3SWL A;  5IMV A;  4I6X A;  2B5E A;  2DJ0 A;  3U5R E;  1JLV A;  1LJR A;  1SL2 B;  4GTU A;  5CRE A;  5DAL B;  4ZB6 A;  4OO4 A;  1VF3 A;  3W8S A;  1ACV A;  5CRW A;  4EC0 A;  2KP1 A;  2MZC A;  2A2R A;  2UZ8 A;  4WET A;  3F4T A;  1NHY A;  1SYR A;  3BCK A;  2E0Q A;  2JZR A;  3IE3 A;  4K7N A;  3L78 A;  4N30 A;  5IO0 A;  4FYC A;  1V9W A;  2OE1 A;  1AQX A;  2K9F A;  2PU9 C;  1SEN A;  3GFK A;  3EC3 A;  1EP8 A;  2B5X A;  3A3T A;  1YZX A;  3FMW A;  3EU3 A;  5IMD A;  3IK7 A;  2N5B A;  4HZ4 A;  3QAW A;  3TOU A;  5IMF A;  4BVX B;  1RW1 A;  3L9V A;  5D93 A;  2IMF A;  1SL0 B;  1U3I A;  1ZOF A;  3ED3 A;  3EIN A;  4RQX A;  4F0B A;  2B1K A;  3G9B A;  2GDR A;  2A2P A;  1AC1 A;  3GH6 A;  3UL3 A;  2TRX A;  2I9H A;  4ZL7 A;  3DXB A;  2YJ7 A;  1SKS B;  3TDG A;  2DJK A;  2RUF A;  1V58 A;  4IJI A;  1GP1 A;  2L59 A;  2ZUP A;  3UBL A;  5L71 A;  4WXT A;  4I8B A;  3W6G A;  5B6N A;  1O73 A;  2A4H A;  2OAD A;  2DC5 A;  3IAS 2;  4KB3 A;  2GT6 A;  1GSU A;  2YV7 A;  3ZRE A;  2C0E A;  2XHF A;  5EL8 A;  4DSQ A;  3HXS A;  4F03 A;  2F8A A;  1OE7 A;  5D73 A;  4NHW A;  4NHZ A;  3DD3 A;  4Q5R A;  2O87 A;  1WOU A;  2YV9 A;  3GTU B;  4NV2 A;  2IMK A;  2IFQ A;  2GS3 A;  3FR6 A;  4Z2R A;  5JCW A;  4HI7 A;  3PGT A;  2PUK C;  3F6F A;  3KTL A;  2X8C A;  3UBK A;  3TGZ A;  2IWT A;  3ISO A;  3RBT A;  1A0R P;  4TR1 B;  2RM6 A;  1SYX A;  5EVO A;  2I1U A;  2CVK A;  4G0I A;  5ECP B;  2H76 A;  3MDK A;  4MF6 A;  4XS1 A;  4JR4 A;  4K0N A;  2K6V A;  4GF0 A;  2OE3 A;  3GIX A;  4AF2 A;  3P8W A;  5KOW A;  2DBC A;  2JSY A;  2H1B A;  1EV9 A;  2MBS A;  5HFI A;  1SJZ A;  2QSI A;  2RLI A;  4TR3 A;  4FYU A;  1ERU A;  4G2E A;  4BWS A;  1UVZ A;  3DGQ A;  5A4W A;  1ML6 A;  2KP2 A;  4RUV A;  5A5K A;  2YNX A;  1YDK A;  1TRW A;  1J0F A;  1G0T A;  3TCO A;  4GST A;  3MAK A;  1OKT A;  4NWY A;  3O6T A;  1VF2 A;  2XPD A;  1V57 A;  3TRP A;  1PRX A;  4ZB8 A;  4IBP A;  4EIP A;  2CQ9 A;  4MH2 A;  2CA8 A;  2DKI A;  2X99 A;  2P31 A;  4N0Z A;  3TB2 A;  2MYG A;  1ERW A;  3F63 A;  1GTA A;  2E2G A;  1M9B A;  3ZYW A;  1Q98 A;  3GKN A;  3KXO A;  1YF1 A;  2EIO A;  4I5Q A;  2WRT A;  1O81 A;  2PER A;  4EVM A;  3Q19 A;  3KCM A;  3CMI A;  1T1V A;  1EP7 A;  1SK0 A;  3GV1 A;  4MPF A;  5KOX A;  3QAV A;  4KW6 A;  1VGL A;  3APQ A;  3EUR A;  5CP1 A;  4MPG A;  1SKW B;  4V2M A;  1WRY A;  5ENU A;  1XXU A;  8GSS A;  3ERG A;  3HZ8 A;  2XPE A;  2Z9S A;  1XZO A;  13GS A;  2HE3 A;  5DCH A;  1SK2 A;  3DIE A;  1XW6 A;  4OD7 A;  5DAK B;  3P7X A;  4D73 A;  4IJ3 A;  1YKA A;  2C0F A;  1SD9 A;  4NAX A;  2HYX A;  5KN1 A;  3TRX A;  3LXZ A;  3O76 A;  4LA1 A;  3M9K A;  1MDI A;  2LEG A;  3MIX A;  5DAK A;  1G7E A;  2NBS A;  4DEJ A;  2M72 A;  5E4W A;  4MJB A;  2VUP A;  4YQV A;  2ZNM A;  1XOB A;  2H19 A;  2ZCT A;  4QQ7 A;  2HNL A;  4XTS A;  1PD2 1;  2JZT A;  2P5Q A;  4NMU A;  2B7K A;  2VCZ A;  5ECR B;  3F6D A;  2YZH A;  4WEY A;  5E59 A;  1TU8 A;  3CSJ A;  4KCE A;  3KGK A;  4I97 A;  1JZR A;  2H75 A;  4O32 A;  3LOR A;  1K0N A;  3UMA A;  5J9C A;  1JZD A;  3GYK A;  1K0A A;  1HNC A;  1HYU A;  3VFI A;  2VLU A;  2PVQ A;  4GWR A;  1YQ1 A;  4OWY A;  3LG6 A;  4KDX A;  1A8Y A;  4HU9 A;  3KH9 A;  5F05 A;  9GSS A;  3APS A;  10GS A;  2FUG 2;  4DVC A;  5JWR B;  5CRG A;  3NZN A;  2C4J A;  2DSA A;  5KN3 A;  4JBB A;  4O5R A;  1Z9H A;  1X9M B;  4O5U A;  2V32 A;  2H1D A;  4OFN A;  2V2G A;  2RM5 A;  4E8H A;  4HS1 A;  1OKD A;  5FWG A;  5G5F A;  1B4Q A;  3TOT A;  2PGT A;  1E6B A;  3TKS E;  2FWF A;  1HD2 A;  4K2D A;  2MMN A;  1B48 A;  3UIW A;  2O89 A;  3R2Q A;  4KF9 A;  2LS5 A;  1SKR B;  3BOA A;  2LST A;  2WCI A;  2J9H A;  5AIX A;  3WYW A;  2VL9 A;  2KLX A;  4PQ1 A;  3FYG A;  1GSQ A;  5LD0 A;  3ERF A;  3GX8 A;  3TKQ A;  18GS A;  2HRA A;  2TIR A;  5AN1 A;  2DML A;  4O5Q A;  1Z6N A;  3IR4 A;  2WUL A;  3Q6O A;  1HQO A;  3TRQ A;  2L6D A;  4XS4 B;  1BAY A;  2EIQ A;  4TN8 A;  3HCZ A;  2D2Z A;  4F9Z A;  1XVW A;  3LXT A;  3P90 A;  1QUW A;  4Z2T A;  3LEF A;  4POL A;  6GSW A;  1B4P A;  3P2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...