3APSA

Crystal structure of trx4 domain of erdj5
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
114
structure length
114
Chain Sequence
PQASIDLTPQTFNEKVLQGKTHWVVDFYAPWCGPCQNFAPEFELLARMIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEQINSRDAKTIAALIYGKLETL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords DnaJ homolog subfamily C member 10
publication title Structural basis of an ERAD pathway mediated by the ER-resident protein disulfide reductase ERdj5.
pubmed doi rcsb
source organism Mus musculus
total genus 35
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apsA00
2H6XA 3GX0A 2JSYA 2DBCA 4Q5NA 4ZL9A 5IMVA 2HT9A 3MAKA 2KP2A 2IN3A 2HLSA 3FR3A 2VCTA 4BVXA 3H79A 2OBIA 1EEJA 2M80A 1PN9A 3LGCA 3LSZA 2LRNA 3EYTA 2HSHA 3HJOA 1Z9HA 1ZOFA 4D73A 2GZZA 4QQ7A 2V1MA 2VUPA 1AW9A 3HVVA 3M9JA 2IMFA 3TKSA 3WT2A 3ME8A 2R3XA 1PX6A 4FYBA 4O7HA 2REMA 3GH6A 2H71A 4LL1B 4KDUA 1B48A 4YAVA 3DIEA 4MJAA 4G9HA 3QAVA 4OCEA 1TKDB 3TOUA 3GL5A 3FZ4A 3M9KA 4IQ1A 1XZOA 1BYEA 1GSYA 4G19A 5G5FA 1ON4A 4GRFA 1XWAA 3RPPA 2XBIA 4PUAA 3ZZXA 4MPFA 1NM3A 2GS3A 2HZEA 3H93A 1G7OA 1JZDA 4FO5A 2K18A 4JZQA 3Q6OA 2N5BA 3VPTA 5LCZA 2NVLA 4HU9A 3U6VA 1F37A 1YF0A 2L4QA 2K8VA 1OKDA 4HEA2 2R37A 3LYPA 1J0FA 4X1UA 3L78A 3HD5A 2RUFA 2GTUA 4MZCA 3JCML 1GP1A 2P31A 2V32A 3M3MA 4J2FA 3TRXA 1ERUA 4EDZA 4NXIA 4L5OA 4BL7A 1XVWA 2H6YA 5IOWA 3CSHA 3CSIA 3D0ZA 4LL4B 5COHA 1ZCPA 2LNSA 4IBPA 4K2DA 4WF4A 2JADA 1X9SB 3TKSC 3F9UA 4MA9A 4WKWA 3FYGA 3H8QA 2VL9A 2KUCA 1FW1A 4PNGA 4XS4B 5ABRA 4MF6A 4MMMA 4RI7A 3RAZA 4KA0A 1LU4A 2R5GA 1YY7A 2E2MA 1FB0A 1USBA 2H73A 4ECIA 2ALBA 6GSTA 4O5RA 4L5LA 3MDKA 1S3DA 3VURA 4KNDA 3KMOA 1AIUA 4P3YB 4V2MA 3CYNA 1GTUA 2YJHA 4HI7A 2PMTA 4OFTA 2L59A 4KGIA 5HR3A 2B5YA 3GFKA 3EMXA 1XWKA 1GLPA 1U3AA 1Z5YE 1H4OA 2WJUA 5ELGA 4WBRD 4V1Ap 2H19A 5EVOA 5IMZA 2JACA 3G9BA 5HFGA 5JWQB 4TXOA 2OJLA 3QR6A 4K1FA 4GQFA 3O76A 1AXDA 3HZ8A 4MPGA 2HRFA 5G30A 4KSMA 4IQAA 3IBHA 2CZ2A 3UL3A 2C3TA 3VI5A 3WYWA 2ON5A 4IKHA 4MCUA 1Z7RA 5JCWA 3QAWA 1Y6EA 2A2RA 5D9XA 2WDUA 5GSSA 2DMMA 4MABA 2FNOA 2TRCP 3PGTA 2H0HA 1NSWA 2J23A 1X5DA 4WBJA 3LWAA 4EO3A 4ECCA 3ERGA 1M2DA 3TB2A 4V2NA 5EL8A 5IPGA 2B7KA 1PGTA 4PQHA 2TIRA 1X0RA 3KIJA 2CX3A 4EF0A 3FK8A 3RPNA 2OA7A 2YANA 2FUG2 2BJXA 3KH9A 4NHWA 5FHIA 4ML6A 1X5EA 2I9HA 1G6WA 1T00A 1J08A 4PUFC 1UC7A 2VCWA 4YAPA 5J4UA 3H4KA 2CVBA 5AIVA 4N11A 2LUSA 5ECMB 3WT1A 1WWJA 3FY7A 3UBLA 2ZNMA 2OBKA 2GGTA 2DC5A 1O73A 2J9HA 2CVKA 4E8HA 3MNGA 3I43A 1TTZA 2AYTA 2H75A 4ISDA 1HNCA 1R26A 5IMCA 4EVMA 3GTUA 3GYKA 3DVWA 3DEXA 3TUEA 2YCDA 4JR4A 2B3SA 2DSAA 4F82A 1JZWA 1SYXA 2AUVA 1K3OA 4GWRA 3DKSA 4POLA 1RK4A 2X8CA 1ILOA 5ECNB 4EE0A 5F0GA 1CQGA 1PMTA 2HNLA 1N8JA 3WGEA 3RHBA 1A2MA 3N5OA 2GSRA 2JU5A 2WULA 1OE7A 1YJ6A 3U5RE 3EURA 4KCEA 4WF5A 2A2SA 1M2BA 2I3YA 4IELA 3V1WA 4OFMA 5CP1A 4F0CA 1THXA 4OFNA 2HFDA 1U6TA 2DJ3A 4LMVA 2I4AA 3VWXA 2AB6A 4GTUA 3I69A 4ZBBA 4ZL7A 1XWCA 1SKWB 3ZTLA 4K6XA 2CQ9A 3VWVA 1QFNA 5CAXA 5G1KA 2GQMA 3W6GA 2GLRA 1JZOA 1T7PB 3GKXA 1ERTA 2L5OA 2VIMA 1GULA 4LA1A 4TR4A 1T8EB 2DIZA 4IP1A 1HD2A 3A2WA 3F4SA 4EUYA 1TRSA 3M1GA 5J41A 1NW2A 4Q5FA 1RQMA 4JU5A 4YQMA 5DQSA 2QGVA 4TR0A 3D4MA 2H1BA 1OYJA 3H1NA 4F0BA 4D73B 1M9AA 4K8MA 2H76A 1GL8A 4ZB8A 3DD3A 2C3NA 2FHEA 2V2GA 2P0GA 5DALA 2K9FA 4GXZA 3KXOA 2LV3A 2XBQA 5DAKA 2L4CA 4FIWA 2LQOA 1SL1B 4POMA 4YH2A 1GSUA 4POKA 2IIYA 4TR1A 1PD21 2PPTA 3GV1A 4ML1A 1W89A 4IP6A 5FWGA 3ZRDA 4F03A 1GTIA 3S9FA 2VCXA 1U3IA 3C73A 2MYGA 1DBYA 5KEJA 1MDKA 2HZEB 2VM1A 4JRRA 2CA8A 1OKTA 3M0FA 4O92A 4RQXA 3Q19A 4L0WA 1BX9A 2H72A 2GZPA 2WGRA 4ZB6A 3HYPA 2X64A 4H86A 2MMNA 4OCFA 1WMJA 2NTOA 3ZVJA 1DSBA 5D8IA 2K8SA 1ZMAA 2IWTA 4KX4A 3CSJA 2N5AA 4ZB9A 4KDYA 5J9BA 1M99A 1N2AA 2VL3A 5IMAA 2H6ZA 5DJLA 3TGZA 4NAXA 2HYXA 2NDOA 2QC7A 5IM9A 4IJIA 3DMLA 4ACSA 2H01A 1R5PA 1B4PA 4BWQA 2DIYA 1E2YA 4I8BA 1G7EA 4ECJA 2O85A 3QAGA 1A23A 4RQRA 3BBYA 6GSSA 2V41A 1F9MA 2YZUA 3DRNA 1V58A 3FRCA 3UVTA 4MJEA 2B5XA 2GSTA 2OE1A 4GLTA 2VLUA 2YP6A 5AISA 5HR2A 1XIYA 5ECRB 5B6NA 4IVFA 1TK5B 3C8EA 1QQ2A 4RUVA 5CO3A 1R7HA 3KMNA 4GSNA 5E59A 1HQOA 4EL1A 3L9VA 2GT5A 3IHQA 5EPFA 2R2JA 1F2EA 1F6MC 1XW5A 2WZ9A 1ST9A 2H0GA 1SL2B 1VF2A 4BVYA 4MLYA 4TXVA 1XCCA 3HZ4A 3P7XA 5J3RA 5LD0A 4BPYA 1H75A 1SYRA 2I1UA 1SK1A 3QFBC 5G2ZA 2BTOT 1FVJA 2GT6A 3UARA 2OE3A 4ID0A 4NWYA 3BJ5A 1S3AA 2ES7A 2XC2A 4OO4A 5IO0A 4IHUA 4V2LA 4TXOB 4FYCA 1TJDA 2P5RA 3OR5A 4I97A 1SU9A 1IYHA 3TJFA 1E6BA 1QGVA 5IMDA 3EMPA 5B8BA 4I2UA 1X9WB 2GSSA 1PRXA 3DGQA 2ZUPA 2IMKA 4HZ2A 3GH9A 4TOPA 2PVOC 6GSYA 2OADA 1K3LA 1G0TA 4HS1A 4OWYA 2IFQA 4DSRA 5CRHA 2HSYA 2FWFA 4I2TA 3FEUA 6GSVA 1SL0B 2YV7A 4X0XA 5CRDA 2F51A 3UIWA 1LBKA 4ZL8A 3G7JA 3LFLA 1YKAA 2H1DA 2VD1A 2DJ0A 5CYYA 2VAFA 1TK8B 2MMAA 4AJ8A 1K0MA 3HDCA 2WFCA 4WETA 3EC3A 2C4JA 4MF7A 5IO2A 5GZZB 3LEFA 3UJ1A 2X8GA 3VK9A 4LMWA 1ZL9A 1FHEA 1MDJA 5B7CA 1VGLA 2D2ZA 2E0QA 4IW9A 2PU9C 1PKWA 1ABAA 3ERFA 1GSFA 1B4QA 4FYUA 4AGSA 2FCHA 5CREA 5G31A 4BWSA 1B8XA 1SK2A 1XWGA 3UVHA 2WB9A 5A4UA 1SENA 3FKFA 4PNFA 4KW6A 3CRTA 4KSOA 4JR6A 5D96A 1BEDA 2LJAA 1MTCA 2FD3A 2WS2A 1PL2A 2KLXA 3F3RA 1XXUA 2B6MA 1XW6A 3GTUB 2VD0A 3TJGA 1JLVA 3D4TA 5JWRB 1KEBA 4XCSA 1SK0A 2H30A 4XIHA 5DVBA 3RBTA 3WD6A 2Z9SA 3WGDA 5GSTA 1X9MB 4K9ZA 2GVPA 1MD4A 3TJJA 2G2QA 3ERWA 2HRNA 3SWLA 1UVZA 3VPQA 1NHYA 4EC0A 2L5LA 1PX7A 4HOJA 5GAPD 3QFAC 4G2EA 5DBQA 3ISOA 3LG6A 3GKMA 1JHBA 5B6MA 1T4ZA 2YNXA 1YQ1A 1XBSA 3FZAA 4EXJA 5J9CA 2LEGA 4DEJA 2F3MA 4ULXA 2V6KA 4J57E 1XFLA 1RW1A 1YDKA 4ILFA 1LJRA 3GSTA 2VLVA 3TJKA 2H1GA 4ZBDA 2VOCA 3GKKA 1QXHA 1ERVA 3HY2A 3TKQA 1V2AA 4K0NA 2XHFA 1EP8A 2C0FA 3TKSE 3ME7A 4PXOA 1OC9A 3ZFBA 4KE3A 4GSTA 3ZL5A 2LTKA 1KNGA 5ECPB 4RI6A 3EWLA 1V98A 3IOSA 1Z6MA 2DJJA 4F2IA 5DALB 17GSA 4MK3A 1YEXA 1S3CA 1EOHA 1WIKA 2CAQA 3IV4A 5DAKB 3HCZA 5A4WA 5KN3A 5HR0A 1TRUA 3IA1A 2RUEA 1OE8A 3C7MA 4TR1B 2NPBA 1PL1A 6GSXA 3LXZA 4WR5A 5INYA 3GMFA 1VRSD 2AHEA 2GZYA 1GSDA 1GUMA 2CVDA 3IK7A 1ZGNA 3GX8A 2XPDA 1TU7A 2HZFA 10GSA 1ACVA 1AAZA 4MP4A 2H74A 2ON7A 5C04A 2FA4A 2R4VA 4I5QA 3KD0A 3LXTA 2C1YA 1Z3EA 1WE0A 5JWOB 1GTAA 1G6YA 3TOTA 3VI7A 4XHMA 3FW2A 2E2GA 4KCAA 2C0DA 3PH9A 1VF3A 3UAPA 3HJPA 5IIZA 1EEMA 1AQVA 2M72A 2EIOA 3F4RA 1HNBA 3F8UA 1GUKA 1K0BA 4XS6A 2AJQB 5CNWA 2O7KA 1DUGA 2LRCA 2PUKC 3NZNA 4N30A 3VFIA 2B5EA 1V57A 2M46A 4IGJA 4F9ZA 5DDLA 2IJYA 4L8EA 3D21A 1BG5A 11GSA 4MJBA 3BCKA 3ZYWA 20GSA 3ZFLA 3A3TA 3EU4A 1JLWA 1FAAA 2H70A 2YWOA 5GAND 5ECHB 2IPAA 2X8HA 4OD7A 5IQYA 5D9WA 3LORA 3APSA 3N9JA 1ZYEA 4TW5A 2GQLA 4NV2A 1FOVA 1TDIA 2VCVA 3D6IA 5HFIA 1YEPA 4NMUA 4KDXA 1HNAA 4N0ZA 3HVXA 5DQYA 1TOFA 1A0RP 4EDYA 2CX4A 5EY6A 1U87A 3D22A 2JL4A 1QUWA 4DVCA 1FVKA 2L6CA 5ECSA 3KJYA 4V1Ag 1I9DA 5H5QA 3O6TA 3R2QA 3WGXA 1GH2A 3UOMA 4KB3A 2OKAA 1MEKA 5HQPA 3L0HA 2V6OA 1SD8A 1K0AA 4GF0A 1TRVA 2IFQB 1O8WA 3L9UA 1SJIA 5G1LA 2LJKA 3KEBA 2L57A 2RM5A 2XPEA 5ECIB 5DJMA 2IMDA 2VL2A 4IJ3A 5ENUA 7GSSA 1BJXA 4TVEA 4OMVA 1EZKA 1O85A 2VCQA 1ML6A 2YWIA 1WP0A 2N5FA 3GHAA 3UEMA 3L4NA 1O7UA 1XVQA 4AJ7A 1PQNA 2FY6A 3LJRA 2VCZA 3P2AA 3LQ7A 1T1VA 1K3YA 5KN1A 4YQVA 1GSQA 1SKSB 1GSSA 5B8AA 2G0FA 4BA7A 1A8YA 2YJ7A 2O8VB 2YOIA 2OE0A 5IOXA 3CXGA 5F8BA 22GSA 1WPIA 4KAEA 4HZ4A 5IMFA 2BMXA 4E8EA 1THOA 4TKYA 5A5KA 3IPZA 9GSSA 1EGOA 3DVXA 5CRWA 4JEDA 5DCHA 2DMLA 2F8AA 1SJ6A 4WXTA 3E3EA 2CT6A 2JSZA 2FWEA 3A5WA 2EIQA 1JFUA 1TP9A 2PWJA 3CBUA 3BD2A 2F9SA 3CTGA 1GTBA 1TI3A 3TCOA 2HE3A 1DE2A 1IYIA 4XTSA 1EOGA 3VWUA 2DJKA 1K0DA 4ECBA 5ID2A 1AQXA 2VL2C 2HI7A 3BCIA 1O6JA 2IMEA 2LSTA 1YKCA 3HHVA 1SKRB 18GSA 3A2XA 1F3AA 3IK9A 5JCUA 2KHPA 1WJKA 4ZXGA 4DSSA 4TN8A 2VO4A 4PQ1A 4WEYA 5KN2A 1YF1A 3TDGA 2YN1A 1A24A 3FZ5A 4PX1A 3HJMA 1TI1A 3TKRA 3FR9A 3G7IA 4EKZA 2L6DA 5D93A 2DLXA 3F6DA 4K7NA 5FT3A 16GSA 3F0IA 4MF5A 2P5QA 5CRGA 3F4TA 2B1LA 1Y25A 2EC4A 2QKEA 2YWNA 1I5GA 1URMA 1OC8A 1OVNA 1TU8A 3FR6A 3APOA 1OC9B 3CTFA 5JCGA 1PSQA 2JZSA 2IL3A 2R6KA 3EU3A 2HXKA 1HYUA 3HKRA 1W4VA 1XOBA 1F3BA 2K6VA 3AY8A 3IDVA 2YV9A 4IN0A 3E9JB 5D73A 1OC3A 3ZMLA 1T4YA 3G7YA 4AJ6A 2FWGA 2A4VA 6GSUA 1NHOA 6GSWA 3KGKA 3DXBA 2H8LA 4N0VA 1M2AA 3J7Yk 4XRDA 3ZLPA 1K0NA 3FHKA 3QOUA 2I81A 2B1KA 3GKNA 1GWCA 2YZHA 2AAWA 14GSA 2MBTA 4HJMA 1O81A 3CMIA 4DSQA 3KH7A 4I6XA 2C0GA 1YZXA 1FB6A 4HJ2A 2PBJA 4HQZA 3GUSA 3FZ9A 2LKUA 4K0GA 4CDOA 1M9BA 2GQKA 4MDCA 3KP8A 1R4WA 3IR4A 3QD9A 2GSQA 1U88A 3W8SA 2MMZA 1TXXA 3PINA 2LQQA 5DCGA 1MDIA 1CQHA 4ZBAA 2C80A 3KP9A 4NV5A 4GSSA 2DJ1A 3D5JA 2O89A 3IE3A 1C72A 1GRXA 2CAIA 4X43A 3A2VA 4TRXA 2PVQA 1A0FA 2GDRA 2CZ3A 3I6AA 2MMOA 2PN8A 2RIIA 1FG4A 2FLSA 2MBSA 2VM2A 3TRQA 3KM6A 4G10A 2IMIA 5G5EA 2X99A 5J5NA 2LJRA 2KP1A 1FO5A 2LRTA 3DYRA 2LS5A 5L71A 2JZTA 3UMAA 3GURA 4FH8A 1GSEA 4MZBA 4MZWA 1Z6NA 2QSIA 3F3QA 4XS4A 4NPBA 2H66A 4NHZA 1B9XC 1QMVA 3ED3A 4ZILA 3W8JA 3APQA 4K7OA 5KN0A 3DWVA 3SBCA 2FA8A 3HXSA 3GN3A 5ECKB 3GL3A 5D9TA 5LNKe 3GNJA 4GCIA 3ZMKA 1EV4A 3EE2A 1PKZA 2B7JA 3QPMA 4Q5RA 8GSSA 3QCPA 2FWHA 3UBKA 3C71A 5HFKA 3EVIA 3ZVJD 4AF2A 1K0OA 2F8FA 5HR1A 4IS0A 5H5SA 1WOUA 4KH7A 3K8NA 1A8LA 1UN2A 1AUCA 3ZREA 3KTBA 2O87A 1A2JA 2KOKA 3GA4A 2YPMA 4N10A 2JZRA 1ZYQB 3ZITA 1GNEA 1UA5A 3MSZA 3CRUA 3O3TA 4MH3A 3E0UA 3F6FA 2LNTA 2H1AA 3TKPA 1M0UA 5ECQB 3Q74A 1X5CA 2H0IA 1GUHA 5F06A 4Q5QA 1K0CA 1VF1A 4MH2A 3RDWA 4MJCA 4HDEA 4CW9A 3HVSA 3KZQA 2AV4A 3C1SA 3GSSA 3IC4A 2MZCA 3P90A 1KBNA 4LLRA 3NOFA 3Q18A 1VF4A 1GNWA 3C1RA 4PGTA 2E7PA 3GRXA 3IXRA 3PR8A 2RLIA 3RHCA 2WCIA 1OAZA 5AIXA 4PQIA 1EP7A 1XOAA 3TJBA 1JZRA 3EINA 1V40A 5H5RA 3L9SA 1B9YC 4YQUA 2DJ2A 3P8WA 4JBBA 3BOAA 3ZIJA 1V9WA 4QL9A 1DE1A 1EGRA 3M8NA 5A4VA 4ZIJA 2VLTA 3IRAA 2ZCTA 1ERWA 1T3BA 3TRPA 2EIRA 4HUAA 1EV9A 5AGYA 4O32A 4QL7A 3QDNA 1AQWA 2FGXA 1TRWA 2C3QA 4WR4A 1GLQA 1XW9A 5C00A 4HQSA 2PERA 3IAS2 3IAM2 2NBSA 4JE1A 4XRAA 3HA9A 1AC1A 5ID2B 12GSA 19GSA 4POBA 4PURA 4GQCA 5ELAA 1PA3A 1Z7PA 1Q4JA 5ECLB 3F63A 2CV4A 2OACA 1MD3A 1ZZYA 3LYKA 1XPVA 4HU7A 3KCMA 3I9V2 5IPHA 1XWBA 2WRTA 3VLNA 3VWWA 4Z7XA 1BQ7A 5AN1A 1SD9A 2C8UA 4XS1A 4DSSB 5E4WA 4OO5A 13GSA 1A2LA 1M7TA 4K7IA 1R5AA 5F05A 4CHSA 3US3A 3GIXA 3MWHA 2YWMA 5D9VA 1BAYA 2RM6A 1Q98A 1EWXA 1KTEA 1J9BA 5ECOB 2TRXA 1TK0B 3NIVA 3ZIVA 4TR3A 5F07A 3KTLA 3J7Yb 4J56E 2PGTA 1SJZA 1WRYA 1QK8A 3QMXA 1TW9A 2C0EA 4KUNA 1O8XA 4L0UA
chains in the Genus database with same CATH superfamily
2H6XA 3GX0A 2JSYA 2DBCA 4Q5NA 4ZL9A 5IMVA 2HT9A 3MAKA 2KP2A 2IN3A 2HLSA 3FR3A 2VCTA 4BVXA 3H79A 2OBIA 1EEJA 2M80A 1PN9A 1ZYPA 3LGCA 3LSZA 2LRNA 3EYTA 2HSHA 3HJOA 1Z9HA 1ZOFA 4D73A 2GZZA 4QQ7A 2V1MA 2VUPA 1AW9A 3HVVA 3M9JA 2IMFA 3TKSA 3WT2A 3ME8A 2R3XA 3R3EA 1PX6A 4FYBA 4O7HA 2REMA 3GH6A 2H71A 4LL1B 4KDUA 1B48A 4YAVA 3DIEA 4MJAA 4G9HA 3QAVA 4OCEA 1TKDB 3TOUA 3GL5A 3FZ4A 1XG8A 4YKFA 3M9KA 4IQ1A 1XZOA 1BYEA 1GSYA 4G19A 5G5FA 1ON4A 4GRFA 1XWAA 3RPPA 2XBIA 4PUAA 3ZZXA 4MPFA 1NM3A 2GS3A 2HZEA 3H93A 1G7OA 1JZDA 4FO5A 2K18A 4JZQA 3Q6OA 2N5BA 3VPTA 5LCZA 2NVLA 4HU9A 3U6VA 1F37A 1YF0A 4Z2UA 2L4QA 2K8VA 1OKDA 4HEA2 2R37A 3LYPA 1J0FA 4X1UA 3L78A 3HD5A 2RUFA 2GTUA 4MZCA 3JCML 1GP1A 2P31A 2V32A 3M3MA 4J2FA 3TRXA 1ERUA 4EDZA 4NXIA 4L5OA 4BL7A 1XVWA 2X49A 2H6YA 5IOWA 3CSHA 3CSIA 3D0ZA 4LL4B 5COHA 1ZCPA 2LNSA 4IBPA 4K2DA 4WF4A 2JADA 1X9SB 3TKSC 3F9UA 4MA9A 4WKWA 3FYGA 3H8QA 2VL9A 2KUCA 1FW1A 4PNGA 4XS4B 5ABRA 4MF6A 4MMMA 4RI7A 3RAZA 4KA0A 1LU4A 5KOWA 2R5GA 1YY7A 2E2MA 1FB0A 1USBA 2H73A 4ECIA 2ALBA 6GSTA 4O5RA 4L5LA 3MDKA 1S3DA 3VURA 4KNDA 3KMOA 1AIUA 4P3YB 4V2MA 1M3IA 3CYNA 1GTUA 2YJHA 4HI7A 2PMTA 4OFTA 2L59A 2QA1A 4KGIA 5HR3A 2B5YA 3GFKA 3EMXA 1XWKA 1GLPA 1U3AA 1Z5YE 1H4OA 2WJUA 5ELGA 4WBRD 4V1Ap 2H19A 5EVOA 2QA2A 5IMZA 2JACA 3G9BA 5HFGA 5JWQB 4TXOA 2OJLA 3QR6A 4K1FA 4GQFA 3O76A 1AXDA 3HZ8A 4MPGA 2HRFA 5G30A 4KSMA 4IQAA 3IBHA 2CZ2A 3UL3A 2C3TA 3VI5A 3WYWA 2ON5A 4IKHA 4MCUA 1Z7RA 5JCWA 3QAWA 1Y6EA 2A2RA 5D9XA 2WDUA 5GSSA 2DMMA 4MABA 4ICYA 2FNOA 2TRCP 3PGTA 2H0HA 1NSWA 2A2PA 1X5DA 2J23A 3LWAA 4WBJA 4EO3A 4ECCA 3ERGA 1M2DA 3TB2A 4V2NA 5EL8A 5IPGA 2B7KA 1PGTA 4PQHA 2TIRA 1X0RA 3KIJA 2CX3A 4EF0A 3FK8A 3RPNA 2OA7A 2YANA 2FUG2 2BJXA 3KH9A 4NHWA 5FHIA 4ML6A 1X5EA 2I9HA 1G6WA 1T00A 1J08A 4PUFC 1UC7A 2VCWA 4YAPA 4O5UA 5J4UA 3H4KA 2CVBA 5AIVA 4N11A 2LUSA 5ECMB 3WT1A 1WWJA 3FY7A 3UBLA 2ZNMA 2OBKA 2GGTA 2DC5A 1O73A 2J9HA 2CVKA 4E8HA 3MNGA 4K5SA 3I43A 1TTZA 2AYTA 2H75A 4ISDA 1HNCA 1R26A 5IMCA 4EVMA 3GTUA 3GYKA 3DVWA 3DEXA 3TUEA 4O5QA 2YCDA 4JR4A 2B3SA 2DSAA 4F82A 1JZWA 1SYXA 2AUVA 1K3OA 4GWRA 3DKSA 4POLA 2A4HA 1RK4A 2X8CA 1ILOA 5ECNB 4EE0A 5F0GA 1CQGA 1PMTA 2HNLA 1N8JA 3WGEA 3RHBA 1A2MA 3N5OA 2GSRA 2JU5A 2WULA 1OE7A 1YJ6A 3U5RE 3EURA 4KCEA 4WF5A 2A2SA 1M2BA 2I3YA 4IELA 3V1WA 4OFMA 5CP1A 4F0CA 1THXA 4OFNA 2HFDA 1U6TA 2DJ3A 4LMVA 2I4AA 3VWXA 2AB6A 4GTUA 3I69A 4ZBBA 4ZL7A 1XWCA 1SKWB 3ZTLA 4K6XA 2CQ9A 2HRAA 3VWVA 1QFNA 5CAXA 5G1KA 2GQMA 3W6GA 2GLRA 1JZOA 1T7PB 3GKXA 1ERTA 2L5OA 2VIMA 1GULA 4LA1A 4TR4A 1T8EB 2DIZA 4IP1A 1HD2A 3A2WA 3F4SA 4EUYA 1TRSA 3M1GA 5J41A 1NW2A 4Q5FA 1RQMA 4JU5A 4YQMA 5DQSA 2QGVA 4TR0A 3D4MA 2H1BA 1OYJA 3H1NA 4F0BA 4D73B 1M9AA 4K8MA 2H76A 1GL8A 3CQFA 4ZB8A 3DD3A 2C3NA 2FHEA 2V2GA 2P0GA 5DALA 2K9FA 4GXZA 3KXOA 2LV3A 2XBQA 5DAKA 2L4CA 4FIWA 2LQOA 1M3JA 1SL1B 4POMA 4YH2A 1GSUA 4POKA 2IIYA 4TR1A 1PD21 2PPTA 3GV1A 4ML1A 1W89A 4IP6A 5FWGA 3ZRDA 4F03A 1GTIA 3S9FA 2VCXA 1U3IA 3C73A 2MYGA 1DBYA 5KEJA 1MDKA 2HZEB 2VM1A 4JRRA 2CA8A 1OKTA 3M0FA 4O92A 4RQXA 3Q19A 4L0WA 1BX9A 2H72A 2GZPA 2WGRA 4ZB6A 3HYPA 2X64A 4H86A 2MMNA 4OCFA 1WMJA 2NTOA 3ZVJA 1DSBA 5D8IA 2K8SA 1ZMAA 2IWTA 4KX4A 3CSJA 5BMUA 2N5AA 4ZB9A 4YKGA 4KDYA 5J9BA 1M99A 1N2AA 2VL3A 5IMAA 4MNNA 2H6ZA 5DJLA 3TGZA 4NAXA 4X4JA 2HYXA 2NDOA 2QC7A 5IM9A 4IJIA 3DMLA 4ACSA 2H01A 1R5PA 3MIXA 1B4PA 4BWQA 2DIYA 1E2YA 4I8BA 1G7EA 4BL7B 4ECJA 2O85A 1FOHA 3QAGA 1A23A 4RQRA 3BBYA 6GSSA 2V41A 1F9MA 2YZUA 3DRNA 1V58A 3FRCA 3UVTA 4MJEA 2B5XA 2GSTA 2OE1A 4GLTA 2VLUA 2YP6A 5AISA 5HR2A 1XIYA 5ECRB 5B6NA 4IVFA 1TK5B 3C8EA 1QQ2A 4RUVA 5CO3A 1R7HA 3KMNA 4GSNA 5E59A 1HQOA 4EL1A 3L9VA 2GT5A 3IHQA 5EPFA 2R2JA 1F2EA 1F6MC 1XW5A 2WZ9A 1ST9A 2H0GA 1SL2B 1VF2A 4BVYA 4MLYA 4TXVA 1XCCA 3HZ4A 3P7XA 5J3RA 5LD0A 4BPYA 1H75A 1SYRA 2I1UA 1SK1A 3QFBC 5G2ZA 2BTOT 1FVJA 2GT6A 3UARA 2OE3A 4ID0A 4NWYA 3BJ5A 1S3AA 2ES7A 1ZYNA 2XC2A 4OO4A 5IO0A 4IHUA 4V2LA 4TXOB 4FYCA 3LW9A 1TJDA 2P5RA 3OR5A 4I97A 1SU9A 1IYHA 2HRKA 3TJFA 1E6BA 1QGVA 5IMDA 3EMPA 5B8BA 4I2UA 1X9WB 2GSSA 1PRXA 3DGQA 2ZUPA 2IMKA 4HZ2A 3GH9A 4TOPA 2PVOC 6GSYA 4USSA 2OADA 1K3LA 1G0TA 4HS1A 4OWYA 2IFQA 4DSRA 5CRHA 2HSYA 2FWFA 4I2TA 3FEUA 6GSVA 1SL0B 2YV7A 4X0XA 5CRDA 2HSMA 2F51A 3UIWA 1LBKA 4ZL8A 3G7JA 3LFLA 1YKAA 2H1DA 2VD1A 2DJ0A 5CYYA 2VAFA 1TK8B 2MMAA 4AJ8A 1K0MA 3HDCA 2WFCA 4WETA 3EC3A 2C4JA 4MF7A 5IO2A 5GZZB 3LEFA 3UJ1A 2X8GA 3VK9A 4LMWA 1ZL9A 1FHEA 1MDJA 5B7CA 1VGLA 2D2ZA 2E0QA 4IW9A 2PU9C 1PKWA 1ABAA 3ERFA 1GSFA 1B4QA 4FYUA 4AGSA 2FCHA 5CREA 5G31A 4BWSA 1B8XA 1SK2A 1XWGA 3UVHA 2WB9A 5A4UA 1SENA 3FKFA 4PNFA 4KW6A 3CRTA 4KSOA 4JR6A 5D96A 1BEDA 2LJAA 1MTCA 2FD3A 2WS2A 1PL2A 2KLXA 3F3RA 1XXUA 2B6MA 1XW6A 3GTUB 2VD0A 3TJGA 1JLVA 3D4TA 5JWRB 1KEBA 4XCSA 1SK0A 2H30A 4XIHA 5DVBA 3RBTA 3WD6A 2Z9SA 3WGDA 5GSTA 1X9MB 4K9ZA 2GVPA 3EPTA 1MD4A 3TJJA 3HVNA 2G2QA 3ERWA 2HRNA 3SWLA 1UVZA 3VPQA 1NHYA 4EC0A 2L5LA 1PX7A 4HOJA 5GAPD 3QFAC 4G2EA 5DBQA 3ISOA 3LG6A 3GKMA 1JHBA 5B6MA 1T4ZA 2YNXA 1YQ1A 1XBSA 3FZAA 4EXJA 5J9CA 2LEGA 4DEJA 2F3MA 4ULXA 2V6KA 4J57E 1XFLA 1RW1A 1YDKA 4ILFA 1LJRA 4Z2RA 3GSTA 2VLVA 3TJKA 2H1GA 4ZBDA 2VOCA 3GKKA 1QXHA 1ERVA 3HY2A 3TKQA 1V2AA 4K0NA 2XHFA 1EP8A 4EIPA 2C0FA 3TKSE 3ME7A 4PXOA 1OC9A 3ZFBA 4KE3A 4GSTA 3ZL5A 2LTKA 1KNGA 5ECPB 4RI6A 3EWLA 1V98A 3IOSA 1Z6MA 2DJJA 4F2IA 5DALB 17GSA 4MK3A 1YEXA 1S3CA 1EOHA 1WIKA 2CAQA 3IV4A 5DAKB 2R0CA 3HCZA 3IC8A 5A4WA 5KN3A 5HR0A 1TRUA 3IA1A 4CY6A 2RUEA 1OE8A 3C7MA 4TR1B 2NPBA 1PL1A 6GSXA 3LXZA 3FMWA 4WR5A 5INYA 3GMFA 1VRSD 2AHEA 2GZYA 1GSDA 1GUMA 2CVDA 3IK7A 1ZGNA 3GX8A 2XPDA 1TU7A 2HZFA 10GSA 1ACVA 1AAZA 4MP4A 2H74A 2ON7A 5C04A 2FA4A 2R4VA 4I5QA 3KD0A 3LXTA 2C1YA 1Z3EA 1WE0A 5JWOB 1GTAA 1G6YA 3TOTA 3VI7A 4XHMA 3FW2A 2E2GA 4KCAA 2C0DA 3PH9A 1VF3A 3UAPA 3HJPA 5IIZA 1EEMA 1AQVA 2M72A 2EIOA 3F4RA 1HNBA 3F8UA 1GUKA 1K0BA 4XS6A 4A5PA 2AJQB 5CNWA 2O7KA 1DUGA 2LRCA 2PUKC 3NZNA 4N30A 3VFIA 2B5EA 1V57A 2M46A 4IGJA 4F9ZA 5DDLA 2IJYA 4L8EA 3D21A 2R0GA 1BG5A 4K2XA 11GSA 4MJBA 3BCKA 3ZYWA 20GSA 3ZFLA 3A3TA 3EU4A 1JLWA 1FAAA 2H70A 2YWOA 5GAND 5ECHB 2IPAA 2X8HA 4OD7A 4BVYB 5IQYA 4BIKA 5D9WA 3LORA 3APSA 3N9JA 1ZYEA 4TW5A 2GQLA 4NV2A 1FOVA 1TDIA 2VCVA 3D6IA 4PTSA 5HFIA 1YEPA 4NMUA 4KDXA 1HNAA 4N0ZA 3HVXA 5DQYA 1TOFA 1A0RP 4EDYA 1PN0A 2CX4A 5EY6A 1U87A 3D22A 2JL4A 3MYDA 1QUWA 4DVCA 1FVKA 2L6CA 5ECSA 3KJYA 4V1Ag 1I9DA 5H5QA 3O6TA 3R2QA 3WGXA 1GH2A 3UOMA 4KB3A 2OKAA 1MEKA 5HQPA 3L0HA 2V6OA 1SD8A 1K0AA 4GF0A 1TRVA 2IFQB 1O8WA 3L9UA 1SJIA 5G1LA 2LJKA 3KEBA 2L57A 2RM5A 1PFOA 2XPEA 5ECIB 5DJMA 2IMDA 2R0PA 2VL2A 4IJ3A 5ENUA 7GSSA 1BJXA 4TVEA 4OMVA 1EZKA 1O85A 2VCQA 1ML6A 2YWIA 1WP0A 2N5FA 3GHAA 3UEMA 3L4NA 1O7UA 1XVQA 4AJ7A 1PQNA 2FY6A 3LJRA 2VCZA 3P2AA 3LQ7A 1T1VA 1K3YA 5KN1A 4YQVA 1GSQA 1SKSB 1GSSA 5B8AA 2G0FA 4BA7A 1A8YA 2YJ7A 2O8VB 2YOIA 2OE0A 5IOXA 3CXGA 5F8BA 22GSA 1WPIA 4G0LA 4KAEA 4HZ4A 5IMFA 2BMXA 4E8EA 1THOA 4TKYA 5A5KA 3IPZA 9GSSA 1EGOA 3DVXA 5CRWA 4JEDA 5DCHA 2DMLA 2F8AA 1SJ6A 4WXTA 3E3EA 2CT6A 2JSZA 2FWEA 3A5WA 2EIQA 1JFUA 1TP9A 2PWJA 3CBUA 3BD2A 2F9SA 3CTGA 1GTBA 1TI3A 3TCOA 2HE3A 1DE2A 1IYIA 4XTSA 1EOGA 3VWUA 2DJKA 1K0DA 4ECBA 5ID2A 1AQXA 2VL2C 2HI7A 3BCIA 1O6JA 2IMEA 2LSTA 1YKCA 3HHVA 1SKRB 18GSA 3A2XA 1F3AA 3IK9A 5JCUA 2KHPA 1WJKA 4ZXGA 4DSSA 4TN8A 2VO4A 4PQ1A 4WEYA 5KN2A 1YF1A 3TDGA 2YN1A 1A24A 3FZ5A 4PX1A 3HJMA 1TI1A 3TKRA 4EIQA 3FR9A 3G7IA 4EKZA 4K5RA 2L6DA 5D93A 2DLXA 3F6DA 4K7NA 5FT3A 16GSA 3F0IA 4MF5A 2P5QA 5CRGA 3F4TA 2B1LA 1Y25A 2EC4A 2QKEA 2YWNA 1I5GA 1URMA 1OC8A 1OVNA 1TU8A 3FR6A 3APOA 1OC9B 3CTFA 5JCGA 1PSQA 2JZSA 2IL3A 2R6KA 3EU3A 2HXKA 1HYUA 3HKRA 1W4VA 1XOBA 1F3BA 2K6VA 3AY8A 3IDVA 2YV9A 4IN0A 3E9JB 5KOXA 5D73A 1OC3A 3ZMLA 3A5IA 1T4YA 3G7YA 4AJ6A 2FWGA 2A4VA 6GSUA 1NHOA 6GSWA 3KGKA 3DXBA 2H8LA 4N0VA 1M2AA 3J7Yk 4XRDA 3ZLPA 1K0NA 3FHKA 3QOUA 2I81A 2B1KA 4Z2TA 3GKNA 1GWCA 2YZHA 2AAWA 14GSA 2MBTA 4HJMA 1O81A 3CMIA 4DSQA 3KH7A 4I6XA 2C0GA 1YZXA 1FB6A 4HJ2A 2PBJA 4HQZA 3GUSA 3FZ9A 2LKUA 4K0GA 4CDOA 1M9BA 2GQKA 4MDCA 3KP8A 1R4WA 3IR4A 3QD9A 2GSQA 1U88A 3W8SA 2MMZA 1TXXA 3PINA 2DKHA 2LQQA 5DCGA 1MDIA 1CQHA 4ZBAA 2C80A 3KP9A 4NV5A 4GSSA 2DJ1A 3D5JA 2O89A 3IE3A 1C72A 1GRXA 2CAIA 4X43A 3A2VA 4TRXA 2PVQA 1A0FA 2GDRA 2CZ3A 3I6AA 2MMOA 2PN8A 2RIIA 1FG4A 2FLSA 2MBSA 2VM2A 3TRQA 3KM6A 4G10A 2IMIA 5G5EA 2X99A 5J5NA 2LJRA 2KP1A 1FO5A 1S3RA 2LRTA 3DYRA 2LS5A 5L71A 2JZTA 3UMAA 3GURA 4FH8A 1GSEA 4MZBA 4MZWA 1Z6NA 2QSIA 3F3QA 4XS4A 4NPBA 2H66A 4NHZA 1B9XC 1QMVA 3ED3A 4ZILA 3W8JA 3APQA 4K7OA 5KN0A 3DWVA 3SBCA 4FQUA 2FA8A 3HXSA 3GN3A 5ECKB 3GL3A 5D9TA 5LNKe 3GNJA 4GCIA 3ZMKA 1EV4A 3EE2A 1PKZA 2B7JA 3QPMA 4Q5RA 8GSSA 3QCPA 2FWHA 3UBKA 3C71A 5HFKA 3EVIA 3ZVJD 4AF2A 1K0OA 2F8FA 5HR1A 4IS0A 5H5SA 1WOUA 4KH7A 3K8NA 1A8LA 1UN2A 1AUCA 3PPUA 3ZREA 3KTBA 2O87A 1A2JA 2KOKA 3GA4A 2YPMA 2UZ8A 4N10A 2JZRA 1ZYQB 3ZITA 1GNEA 1UA5A 3MSZA 3CRUA 3O3TA 4MH3A 3E0UA 3F6FA 2LNTA 2H1AA 3TKPA 1M0UA 5ECQB 3Q74A 1X5CA 2X4AA 2H0IA 1GUHA 5F06A 4Q5QA 1K0CA 4KF9A 4CY8A 1VF1A 4MH2A 3RDWA 4MJCA 4HDEA 4CW9A 3HVSA 3KZQA 2AV4A 3C1SA 3GSSA 3IC4A 2MZCA 3P90A 4G0KA 1KBNA 4LLRA 3NOFA 3Q18A 1VF4A 1GNWA 3C1RA 4PGTA 2E7PA 3GRXA 3IXRA 3PR8A 2RLIA 3RHCA 2WCIA 1OAZA 5AIXA 4PQIA 1EP7A 1XOAA 3TJBA 1JZRA 3EINA 4BVXB 1V40A 5H5RA 3L9SA 1B9YC 4YQUA 2DJ2A 3P8WA 4JBBA 3BOAA 3ZIJA 1V9WA 4QL9A 1DE1A 1EGRA 3M8NA 5A4VA 4ZIJA 2VLTA 3IRAA 2ZCTA 1ERWA 1T3BA 3TRPA 2EIRA 2DKIA 4HUAA 1EV9A 5AGYA 4O32A 4QL7A 3QDNA 1AQWA 2FGXA 1TRWA 2C3QA 4WR4A 1GLQA 1XW9A 5C00A 4HQSA 2PERA 3IAS2 3IAM2 2NBSA 4JE1A 4XRAA 3HA9A 1AC1A 5ID2B 12GSA 19GSA 4POBA 4PURA 4GQCA 5ELAA 1PA3A 1Z7PA 1Q4JA 5ECLB 3F63A 2CV4A 2OACA 1MD3A 1ZZYA 3LYKA 1XPVA 4HU7A 3KCMA 3I9V2 5IPHA 1XWBA 2WRTA 3VLNA 3VWWA 4Z7XA 1BQ7A 5AN1A 1SD9A 2C8UA 3IHGA 4XS1A 4DSSB 5E4WA 4OO5A 13GSA 1A2LA 1M7TA 4K7IA 1R5AA 5F05A 4CHSA 3US3A 3GIXA 3MWHA 2YWMA 5D9VA 1BAYA 2RM6A 1Q98A 1EWXA 1KTEA 1J9BA 5ECOB 2TRXA 1TK0B 3NIVA 3ZIVA 4TR3A 5F07A 4G0IA 3KTLA 4HSCX 3J7Yb 4J56E 2PGTA 1SJZA 1WRYA 1QK8A 3QMXA 5BRTA 1TW9A 2C0EA 4KUNA 1O8XA 4L0UA
chains in the Genus database with same CATH topology
2H6XA 3GX0A 2JSYA 2DBCA 4Q5NA 4ZL9A 5IMVA 2HT9A 3MAKA 2KP2A 2IN3A 2HLSA 3FR3A 2VCTA 4BVXA 3H79A 2OBIA 1EEJA 2M80A 1PN9A 1ZYPA 3LGCA 3LSZA 2LRNA 3EYTA 2HSHA 3HJOA 1Z9HA 1ZOFA 4D73A 2GZZA 4QQ7A 2V1MA 2VUPA 1AW9A 3HVVA 3M9JA 2IMFA 3TKSA 3WT2A 3ME8A 2R3XA 3R3EA 1PX6A 4FYBA 4O7HA 2REMA 3GH6A 2H71A 4LL1B 4KDUA 1B48A 4YAVA 3DIEA 4MJAA 4G9HA 3QAVA 4OCEA 1TKDB 3TOUA 3GL5A 3FZ4A 4YKFA 3M9KA 4IQ1A 1XZOA 1BYEA 1GSYA 4G19A 5G5FA 1ON4A 4GRFA 1XWAA 3RPPA 2XBIA 4PUAA 3ZZXA 4MPFA 1NM3A 2GS3A 2HZEA 3H93A 1G7OA 1JZDA 4FO5A 2K18A 4JZQA 3Q6OA 2N5BA 3VPTA 5LCZA 2NVLA 4HU9A 3U6VA 1F37A 1YF0A 4Z2UA 2L4QA 2K8VA 1OKDA 4HEA2 2R37A 3LYPA 1J0FA 4X1UA 3L78A 3HD5A 2RUFA 2GTUA 4MZCA 3JCML 1GP1A 2P31A 2V32A 3M3MA 4J2FA 3TRXA 1ERUA 4EDZA 4NXIA 4L5OA 4BL7A 1XVWA 2X49A 2H6YA 5IOWA 3CSHA 3CSIA 3D0ZA 4LL4B 5COHA 1ZCPA 2LNSA 4IBPA 4K2DA 4WF4A 2JADA 1X9SB 3TKSC 3F9UA 4MA9A 4WKWA 3FYGA 3H8QA 2VL9A 2KUCA 1FW1A 4PNGA 4XS4B 5ABRA 4MF6A 4MMMA 4RI7A 3RAZA 4KA0A 1LU4A 5KOWA 2R5GA 1YY7A 2E2MA 1FB0A 1USBA 2H73A 4ECIA 2ALBA 6GSTA 4O5RA 4L5LA 3MDKA 1S3DA 3VURA 4KNDA 3KMOA 1AIUA 4P3YB 4V2MA 3CYNA 1GTUA 2YJHA 4HI7A 2PMTA 4OFTA 2L59A 2QA1A 4KGIA 5HR3A 2B5YA 3GFKA 3EMXA 1XWKA 1GLPA 1U3AA 1Z5YE 1H4OA 2WJUA 5ELGA 4WBRD 4V1Ap 2H19A 5EVOA 2QA2A 5IMZA 2JACA 3G9BA 5HFGA 5JWQB 4TXOA 2OJLA 3QR6A 4K1FA 4GQFA 3O76A 1AXDA 3HZ8A 4MPGA 2HRFA 5G30A 4KSMA 4IQAA 3IBHA 2CZ2A 3UL3A 2C3TA 3VI5A 3WYWA 2ON5A 4IKHA 4MCUA 1Z7RA 5JCWA 3QAWA 1Y6EA 2A2RA 5D9XA 2WDUA 5GSSA 2DMMA 4MABA 4ICYA 2FNOA 2TRCP 3PGTA 2H0HA 1NSWA 2A2PA 1X5DA 2J23A 3LWAA 4WBJA 4EO3A 4ECCA 3ERGA 1M2DA 3TB2A 4V2NA 5EL8A 5IPGA 2B7KA 1PGTA 4PQHA 2TIRA 1X0RA 3KIJA 2CX3A 4EF0A 3FK8A 3RPNA 2OA7A 2YANA 2FUG2 2BJXA 3KH9A 4NHWA 5FHIA 4ML6A 1X5EA 2I9HA 1G6WA 1T00A 1J08A 4PUFC 1UC7A 2VCWA 4YAPA 4O5UA 5J4UA 3H4KA 2CVBA 5AIVA 4N11A 2LUSA 5ECMB 3WT1A 1WWJA 3FY7A 3UBLA 2ZNMA 2OBKA 2GGTA 2DC5A 1O73A 2J9HA 2CVKA 4E8HA 3MNGA 4K5SA 3I43A 1TTZA 2AYTA 2H75A 4ISDA 1HNCA 1R26A 5IMCA 4EVMA 3GTUA 3GYKA 3DVWA 3DEXA 3TUEA 4O5QA 2YCDA 4JR4A 2B3SA 2DSAA 4F82A 1JZWA 1SYXA 2AUVA 1K3OA 4GWRA 3DKSA 4POLA 2A4HA 1RK4A 2X8CA 1ILOA 5ECNB 4EE0A 5F0GA 1CQGA 1PMTA 2HNLA 1N8JA 3WGEA 3RHBA 1A2MA 3N5OA 2GSRA 2JU5A 2WULA 1OE7A 1YJ6A 3U5RE 3EURA 4KCEA 4WF5A 2A2SA 1M2BA 2I3YA 4IELA 3V1WA 4OFMA 5CP1A 4F0CA 1THXA 4OFNA 2HFDA 1U6TA 2DJ3A 4LMVA 2I4AA 3VWXA 2AB6A 4GTUA 3I69A 4ZBBA 4ZL7A 1XWCA 1SKWB 3ZTLA 4K6XA 2CQ9A 2HRAA 3VWVA 1QFNA 5CAXA 5G1KA 2GQMA 3W6GA 2GLRA 1JZOA 1T7PB 3GKXA 1ERTA 2L5OA 2VIMA 1GULA 4LA1A 4TR4A 1T8EB 2DIZA 4IP1A 1HD2A 3A2WA 3F4SA 4EUYA 1TRSA 3M1GA 5J41A 1NW2A 4Q5FA 1RQMA 4JU5A 4YQMA 5DQSA 2QGVA 4TR0A 3D4MA 2H1BA 1OYJA 3H1NA 4F0BA 4D73B 1M9AA 4K8MA 2H76A 1GL8A 4ZB8A 3DD3A 2C3NA 2FHEA 2V2GA 2P0GA 5DALA 2K9FA 4GXZA 3KXOA 2LV3A 2XBQA 5DAKA 2L4CA 4FIWA 2LQOA 1SL1B 4POMA 4YH2A 1GSUA 4POKA 2IIYA 4TR1A 1PD21 2PPTA 3GV1A 4ML1A 1W89A 4IP6A 5FWGA 3ZRDA 4F03A 1GTIA 3S9FA 2VCXA 1U3IA 3C73A 2MYGA 1DBYA 5KEJA 1MDKA 2HZEB 2VM1A 4JRRA 2CA8A 1OKTA 3M0FA 4O92A 4RQXA 3Q19A 4L0WA 1BX9A 2H72A 2GZPA 2WGRA 4ZB6A 3HYPA 2X64A 4H86A 2MMNA 4OCFA 1WMJA 2NTOA 3ZVJA 1DSBA 5D8IA 2K8SA 1ZMAA 2IWTA 4KX4A 3CSJA 5BMUA 2N5AA 4ZB9A 4YKGA 4KDYA 5J9BA 1M99A 1N2AA 2VL3A 5IMAA 4MNNA 2H6ZA 5DJLA 3TGZA 4NAXA 4X4JA 2HYXA 2NDOA 2QC7A 5IM9A 4IJIA 3DMLA 4ACSA 2H01A 1R5PA 3MIXA 1B4PA 4BWQA 2DIYA 1E2YA 4I8BA 1G7EA 4BL7B 4ECJA 2O85A 1FOHA 3QAGA 1A23A 4RQRA 3BBYA 6GSSA 2V41A 1F9MA 2YZUA 3DRNA 1V58A 3FRCA 3UVTA 4MJEA 2B5XA 2GSTA 2OE1A 4GLTA 2VLUA 2YP6A 5AISA 5HR2A 1XIYA 5ECRB 5B6NA 4IVFA 1TK5B 3C8EA 1QQ2A 4RUVA 5CO3A 1R7HA 3KMNA 4GSNA 5E59A 1HQOA 4EL1A 3L9VA 2GT5A 3IHQA 5EPFA 2R2JA 1F2EA 1F6MC 1XW5A 2WZ9A 1ST9A 2H0GA 1SL2B 1VF2A 4BVYA 4MLYA 4TXVA 1XCCA 3HZ4A 3P7XA 5J3RA 5LD0A 4BPYA 1H75A 1SYRA 2I1UA 1SK1A 3QFBC 5G2ZA 2BTOT 1FVJA 2GT6A 3UARA 2OE3A 4ID0A 4NWYA 3BJ5A 1S3AA 2ES7A 1ZYNA 2XC2A 4OO4A 5IO0A 4IHUA 4V2LA 4TXOB 4FYCA 3LW9A 1TJDA 2P5RA 3OR5A 4I97A 1SU9A 1IYHA 2HRKA 3TJFA 1E6BA 1QGVA 5IMDA 3EMPA 5B8BA 4I2UA 1X9WB 2GSSA 1PRXA 3DGQA 2ZUPA 2IMKA 4HZ2A 3GH9A 4TOPA 2PVOC 6GSYA 4USSA 2OADA 1K3LA 1G0TA 4HS1A 4OWYA 2IFQA 4DSRA 5CRHA 2HSYA 2FWFA 4I2TA 3FEUA 6GSVA 1SL0B 2YV7A 4X0XA 5CRDA 2HSMA 2F51A 3UIWA 1LBKA 4ZL8A 3G7JA 3LFLA 1YKAA 2H1DA 2VD1A 2DJ0A 5CYYA 2VAFA 1TK8B 2MMAA 4AJ8A 1K0MA 3HDCA 2WFCA 4WETA 3EC3A 2C4JA 4MF7A 5IO2A 5GZZB 3LEFA 3UJ1A 2X8GA 3VK9A 4LMWA 1ZL9A 1FHEA 1MDJA 5B7CA 1VGLA 2D2ZA 2E0QA 4IW9A 2PU9C 1PKWA 1ABAA 3ERFA 1GSFA 1B4QA 4FYUA 4AGSA 2FCHA 5CREA 5G31A 4BWSA 1B8XA 1SK2A 1XWGA 3UVHA 2WB9A 5A4UA 1SENA 3FKFA 4PNFA 4KW6A 3CRTA 4KSOA 4JR6A 5D96A 1BEDA 2LJAA 1MTCA 2FD3A 2WS2A 1PL2A 2KLXA 3F3RA 1XXUA 2B6MA 1XW6A 3GTUB 2VD0A 3TJGA 1JLVA 3D4TA 5JWRB 1KEBA 4XCSA 1SK0A 2H30A 4XIHA 5DVBA 3RBTA 3WD6A 2Z9SA 3WGDA 5GSTA 1X9MB 4K9ZA 2GVPA 3EPTA 1MD4A 3TJJA 2G2QA 3ERWA 2HRNA 3SWLA 1UVZA 3VPQA 1NHYA 4EC0A 2L5LA 1PX7A 4HOJA 5GAPD 3QFAC 4G2EA 5DBQA 3ISOA 3LG6A 3GKMA 1JHBA 5B6MA 1T4ZA 2YNXA 1YQ1A 1XBSA 3FZAA 4EXJA 5J9CA 2LEGA 4DEJA 2F3MA 4ULXA 2V6KA 4J57E 1XFLA 1RW1A 1YDKA 4ILFA 1LJRA 4Z2RA 3GSTA 2VLVA 3TJKA 2H1GA 4ZBDA 2VOCA 3GKKA 1QXHA 1ERVA 3HY2A 3TKQA 1V2AA 4K0NA 2XHFA 1EP8A 4EIPA 2C0FA 3TKSE 3ME7A 4PXOA 1OC9A 3ZFBA 4KE3A 4GSTA 3ZL5A 2LTKA 1KNGA 5ECPB 4RI6A 3EWLA 1V98A 3IOSA 1Z6MA 2DJJA 4F2IA 5DALB 17GSA 4MK3A 1YEXA 1S3CA 1EOHA 1WIKA 2CAQA 3IV4A 5DAKB 2R0CA 3HCZA 3IC8A 5A4WA 5KN3A 5HR0A 1TRUA 3IA1A 4CY6A 2RUEA 1OE8A 3C7MA 4TR1B 2NPBA 1PL1A 6GSXA 3LXZA 3FMWA 4WR5A 5INYA 3GMFA 1VRSD 2AHEA 2GZYA 1GSDA 1GUMA 2CVDA 3IK7A 1ZGNA 3GX8A 2XPDA 1TU7A 2HZFA 10GSA 1ACVA 1AAZA 4MP4A 2H74A 2ON7A 5C04A 2FA4A 2R4VA 4I5QA 3KD0A 3LXTA 2C1YA 1Z3EA 1WE0A 5JWOB 1GTAA 1G6YA 3TOTA 3VI7A 4XHMA 3FW2A 2E2GA 4KCAA 2C0DA 3PH9A 1VF3A 3UAPA 3HJPA 5IIZA 1EEMA 1AQVA 2M72A 2EIOA 3F4RA 1HNBA 3F8UA 1GUKA 1K0BA 4XS6A 4A5PA 2AJQB 5CNWA 2O7KA 1DUGA 2LRCA 2PUKC 3NZNA 4N30A 3VFIA 2B5EA 1V57A 2M46A 4IGJA 4F9ZA 5DDLA 2IJYA 4L8EA 3D21A 2R0GA 1BG5A 4K2XA 11GSA 4MJBA 3BCKA 3ZYWA 20GSA 3ZFLA 3A3TA 3EU4A 1JLWA 1FAAA 2H70A 2YWOA 5GAND 5ECHB 2IPAA 2X8HA 4OD7A 4BVYB 5IQYA 5D9WA 3LORA 3APSA 3N9JA 1ZYEA 4TW5A 2GQLA 4NV2A 1FOVA 1TDIA 2VCVA 3D6IA 4PTSA 5HFIA 1YEPA 4NMUA 4KDXA 1HNAA 4N0ZA 3HVXA 5DQYA 1TOFA 1A0RP 4EDYA 1PN0A 2CX4A 5EY6A 1U87A 3D22A 2JL4A 3MYDA 1QUWA 4DVCA 1FVKA 2L6CA 5ECSA 3KJYA 4V1Ag 1I9DA 5H5QA 3O6TA 3R2QA 3WGXA 1GH2A 3UOMA 4KB3A 2OKAA 1MEKA 5HQPA 3L0HA 2V6OA 1SD8A 1K0AA 4GF0A 1TRVA 2IFQB 1O8WA 3L9UA 1SJIA 5G1LA 2LJKA 3KEBA 2L57A 2RM5A 2XPEA 5ECIB 5DJMA 2IMDA 2R0PA 2VL2A 4IJ3A 5ENUA 7GSSA 1BJXA 4TVEA 4OMVA 1EZKA 1O85A 2VCQA 1ML6A 2YWIA 1WP0A 2N5FA 3GHAA 3UEMA 3L4NA 1O7UA 1XVQA 4AJ7A 1PQNA 2FY6A 3LJRA 2VCZA 3P2AA 3LQ7A 1T1VA 1K3YA 5KN1A 4YQVA 1GSQA 1SKSB 1GSSA 5B8AA 2G0FA 4BA7A 1A8YA 2YJ7A 2O8VB 2YOIA 2OE0A 5IOXA 3CXGA 5F8BA 22GSA 1WPIA 4G0LA 4KAEA 4HZ4A 5IMFA 2BMXA 4E8EA 1THOA 4TKYA 5A5KA 3IPZA 9GSSA 1EGOA 3DVXA 5CRWA 4JEDA 5DCHA 2DMLA 2F8AA 1SJ6A 4WXTA 3E3EA 2CT6A 2JSZA 2FWEA 3A5WA 2EIQA 1JFUA 1TP9A 2PWJA 3CBUA 3BD2A 2F9SA 3CTGA 1GTBA 1TI3A 3TCOA 2HE3A 1DE2A 1IYIA 4XTSA 1EOGA 3VWUA 2DJKA 1K0DA 4ECBA 5ID2A 1AQXA 2VL2C 2HI7A 3BCIA 1O6JA 2IMEA 2LSTA 1YKCA 3HHVA 1SKRB 18GSA 3A2XA 1F3AA 3IK9A 5JCUA 2KHPA 1WJKA 4ZXGA 4DSSA 4TN8A 2VO4A 4PQ1A 4WEYA 5KN2A 1YF1A 3TDGA 2YN1A 1A24A 3FZ5A 4PX1A 3HJMA 1TI1A 3TKRA 4EIQA 3FR9A 3G7IA 4EKZA 4K5RA 2L6DA 5D93A 2DLXA 3F6DA 4K7NA 5FT3A 16GSA 3F0IA 4MF5A 2P5QA 5CRGA 3F4TA 2B1LA 1Y25A 2EC4A 2QKEA 2YWNA 1I5GA 1URMA 1OC8A 1OVNA 1TU8A 3FR6A 3APOA 1OC9B 3CTFA 5JCGA 1PSQA 2JZSA 2IL3A 2R6KA 3EU3A 2HXKA 1HYUA 3HKRA 1W4VA 1XOBA 1F3BA 2K6VA 3AY8A 3IDVA 2YV9A 4IN0A 3E9JB 5KOXA 5D73A 1OC3A 3ZMLA 3A5IA 1T4YA 3G7YA 4AJ6A 2FWGA 2A4VA 6GSUA 1NHOA 6GSWA 3KGKA 3DXBA 2H8LA 4N0VA 1M2AA 3J7Yk 4XRDA 3ZLPA 1K0NA 3FHKA 3QOUA 2I81A 2B1KA 4Z2TA 3GKNA 1GWCA 2YZHA 2AAWA 14GSA 2MBTA 4HJMA 1O81A 3CMIA 4DSQA 3KH7A 4I6XA 2C0GA 1YZXA 1FB6A 4HJ2A 2PBJA 4HQZA 3GUSA 3FZ9A 2LKUA 4K0GA 4CDOA 1M9BA 2GQKA 4MDCA 3KP8A 1R4WA 3IR4A 3QD9A 2GSQA 1U88A 3W8SA 2MMZA 1TXXA 3PINA 2DKHA 2LQQA 5DCGA 1MDIA 1CQHA 4ZBAA 2C80A 3KP9A 4NV5A 4GSSA 2DJ1A 3D5JA 2O89A 3IE3A 1C72A 1GRXA 2CAIA 4X43A 3A2VA 4TRXA 2PVQA 1A0FA 2GDRA 2CZ3A 3I6AA 2MMOA 2PN8A 2RIIA 1FG4A 2FLSA 2MBSA 2VM2A 3TRQA 3KM6A 4G10A 2IMIA 5G5EA 2X99A 5J5NA 2LJRA 2KP1A 1FO5A 2LRTA 3DYRA 2LS5A 5L71A 2JZTA 3UMAA 3GURA 4FH8A 1GSEA 4MZBA 4MZWA 1Z6NA 2QSIA 3F3QA 4XS4A 4NPBA 2H66A 4NHZA 1B9XC 1QMVA 3ED3A 4ZILA 3W8JA 3APQA 4K7OA 5KN0A 3DWVA 3SBCA 4FQUA 2FA8A 3HXSA 3GN3A 5ECKB 3GL3A 5D9TA 5LNKe 3GNJA 4GCIA 3ZMKA 1EV4A 3EE2A 1PKZA 2B7JA 3QPMA 4Q5RA 8GSSA 3QCPA 2FWHA 3UBKA 3C71A 5HFKA 3EVIA 3ZVJD 4AF2A 1K0OA 2F8FA 5HR1A 4IS0A 5H5SA 1WOUA 4KH7A 3K8NA 1A8LA 1UN2A 1AUCA 3PPUA 3ZREA 3KTBA 2O87A 1A2JA 2KOKA 3GA4A 2YPMA 2UZ8A 4N10A 2JZRA 1ZYQB 3ZITA 1GNEA 1UA5A 3MSZA 3CRUA 3O3TA 4MH3A 3E0UA 3F6FA 2LNTA 2H1AA 3TKPA 1M0UA 5ECQB 3Q74A 1X5CA 2X4AA 2H0IA 1GUHA 5F06A 4Q5QA 1K0CA 4KF9A 4CY8A 1VF1A 4MH2A 3RDWA 4MJCA 4HDEA 4CW9A 3HVSA 3KZQA 2AV4A 3C1SA 3GSSA 3IC4A 2MZCA 3P90A 4G0KA 1KBNA 4LLRA 3NOFA 3Q18A 1VF4A 1GNWA 3C1RA 4PGTA 2E7PA 3GRXA 3IXRA 3PR8A 2RLIA 3RHCA 2WCIA 1OAZA 5AIXA 4PQIA 1EP7A 1XOAA 3TJBA 1JZRA 3EINA 4BVXB 1V40A 5H5RA 3L9SA 1B9YC 4YQUA 2DJ2A 3P8WA 4JBBA 3BOAA 3ZIJA 1V9WA 4QL9A 1DE1A 1EGRA 3M8NA 5A4VA 4ZIJA 2VLTA 3IRAA 2ZCTA 1ERWA 1T3BA 3TRPA 2EIRA 2DKIA 4HUAA 1EV9A 5AGYA 4O32A 4QL7A 3QDNA 1AQWA 2FGXA 1TRWA 2C3QA 4WR4A 1GLQA 1XW9A 5C00A 4HQSA 2PERA 3IAS2 3IAM2 2NBSA 4JE1A 4XRAA 3HA9A 1AC1A 5ID2B 12GSA 19GSA 4POBA 4PURA 4GQCA 5ELAA 1PA3A 1Z7PA 1Q4JA 5ECLB 3F63A 2CV4A 2OACA 1MD3A 1ZZYA 3LYKA 1XPVA 4HU7A 3KCMA 3I9V2 5IPHA 1XWBA 2WRTA 3VLNA 3VWWA 4Z7XA 1BQ7A 5AN1A 1SD9A 2C8UA 3IHGA 4XS1A 4DSSB 5E4WA 4OO5A 13GSA 1A2LA 1M7TA 4K7IA 1R5AA 5F05A 4CHSA 3US3A 3GIXA 3MWHA 2YWMA 5D9VA 1BAYA 2RM6A 1Q98A 1EWXA 1KTEA 1J9BA 5ECOB 2TRXA 1TK0B 3NIVA 3ZIVA 4TR3A 5F07A 4G0IA 3KTLA 3J7Yb 4J56E 2PGTA 1SJZA 1WRYA 1QK8A 3QMXA 5BRTA 1TW9A 2C0EA 4KUNA 1O8XA 4L0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6X A;  3GX0 A;  2JSY A;  2DBC A;  4Q5N A;  4ZL9 A;  5IMV A;  2HT9 A;  3MAK A;  2KP2 A;  2IN3 A;  2HLS A;  3FR3 A;  2VCT A;  4BVX A;  3H79 A;  2OBI A;  1EEJ A;  2M80 A;  1PN9 A;  3LGC A;  3LSZ A;  2LRN A;  3EYT A;  2HSH A;  3HJO A;  1Z9H A;  1ZOF A;  4D73 A;  2GZZ A;  4QQ7 A;  2V1M A;  2VUP A;  1AW9 A;  3HVV A;  3M9J A;  2IMF A;  3TKS A;  3WT2 A;  3ME8 A;  2R3X A;  1PX6 A;  4FYB A;  4O7H A;  2REM A;  3GH6 A;  2H71 A;  4LL1 B;  4KDU A;  1B48 A;  4YAV A;  3DIE A;  4MJA A;  4G9H A;  3QAV A;  4OCE A;  1TKD B;  3TOU A;  3GL5 A;  3FZ4 A;  3M9K A;  4IQ1 A;  1XZO A;  1BYE A;  1GSY A;  4G19 A;  5G5F A;  1ON4 A;  4GRF A;  1XWA A;  3RPP A;  2XBI A;  4PUA A;  3ZZX A;  4MPF A;  1NM3 A;  2GS3 A;  2HZE A;  3H93 A;  1G7O A;  1JZD A;  4FO5 A;  2K18 A;  4JZQ A;  3Q6O A;  2N5B A;  3VPT A;  5LCZ A;  2NVL A;  4HU9 A;  3U6V A;  1F37 A;  1YF0 A;  2L4Q A;  2K8V A;  1OKD A;  4HEA 2;  2R37 A;  3LYP A;  1J0F A;  4X1U A;  3L78 A;  3HD5 A;  2RUF A;  2GTU A;  4MZC A;  3JCM L;  1GP1 A;  2P31 A;  2V32 A;  3M3M A;  4J2F A;  3TRX A;  1ERU A;  4EDZ A;  4NXI A;  4L5O A;  4BL7 A;  1XVW A;  2H6Y A;  5IOW A;  3CSH A;  3CSI A;  3D0Z A;  4LL4 B;  5COH A;  1ZCP A;  2LNS A;  4IBP A;  4K2D A;  4WF4 A;  2JAD A;  1X9S B;  3TKS C;  3F9U A;  4MA9 A;  4WKW A;  3FYG A;  3H8Q A;  2VL9 A;  2KUC A;  1FW1 A;  4PNG A;  4XS4 B;  5ABR A;  4MF6 A;  4MMM A;  4RI7 A;  3RAZ A;  4KA0 A;  1LU4 A;  2R5G A;  1YY7 A;  2E2M A;  1FB0 A;  1USB A;  2H73 A;  4ECI A;  2ALB A;  6GST A;  4O5R A;  4L5L A;  3MDK A;  1S3D A;  3VUR A;  4KND A;  3KMO A;  1AIU A;  4P3Y B;  4V2M A;  3CYN A;  1GTU A;  2YJH A;  4HI7 A;  2PMT A;  4OFT A;  2L59 A;  4KGI A;  5HR3 A;  2B5Y A;  3GFK A;  3EMX A;  1XWK A;  1GLP A;  1U3A A;  1Z5Y E;  1H4O A;  2WJU A;  5ELG A;  4WBR D;  4V1A p;  2H19 A;  5EVO A;  5IMZ A;  2JAC A;  3G9B A;  5HFG A;  5JWQ B;  4TXO A;  2OJL A;  3QR6 A;  4K1F A;  4GQF A;  3O76 A;  1AXD A;  3HZ8 A;  4MPG A;  2HRF A;  5G30 A;  4KSM A;  4IQA A;  3IBH A;  2CZ2 A;  3UL3 A;  2C3T A;  3VI5 A;  3WYW A;  2ON5 A;  4IKH A;  4MCU A;  1Z7R A;  5JCW A;  3QAW A;  1Y6E A;  2A2R A;  5D9X A;  2WDU A;  5GSS A;  2DMM A;  4MAB A;  2FNO A;  2TRC P;  3PGT A;  2H0H A;  1NSW A;  2J23 A;  1X5D A;  4WBJ A;  3LWA A;  4EO3 A;  4ECC A;  3ERG A;  1M2D A;  3TB2 A;  4V2N A;  5EL8 A;  5IPG A;  2B7K A;  1PGT A;  4PQH A;  2TIR A;  1X0R A;  3KIJ A;  2CX3 A;  4EF0 A;  3FK8 A;  3RPN A;  2OA7 A;  2YAN A;  2FUG 2;  2BJX A;  3KH9 A;  4NHW A;  5FHI A;  4ML6 A;  1X5E A;  2I9H A;  1G6W A;  1T00 A;  1J08 A;  4PUF C;  1UC7 A;  2VCW A;  4YAP A;  5J4U A;  3H4K A;  2CVB A;  5AIV A;  4N11 A;  2LUS A;  5ECM B;  3WT1 A;  1WWJ A;  3FY7 A;  3UBL A;  2ZNM A;  2OBK A;  2GGT A;  2DC5 A;  1O73 A;  2J9H A;  2CVK A;  4E8H A;  3MNG A;  3I43 A;  1TTZ A;  2AYT A;  2H75 A;  4ISD A;  1HNC A;  1R26 A;  5IMC A;  4EVM A;  3GTU A;  3GYK A;  3DVW A;  3DEX A;  3TUE A;  2YCD A;  4JR4 A;  2B3S A;  2DSA A;  4F82 A;  1JZW A;  1SYX A;  2AUV A;  1K3O A;  4GWR A;  3DKS A;  4POL A;  1RK4 A;  2X8C A;  1ILO A;  5ECN B;  4EE0 A;  5F0G A;  1CQG A;  1PMT A;  2HNL A;  1N8J A;  3WGE A;  3RHB A;  1A2M A;  3N5O A;  2GSR A;  2JU5 A;  2WUL A;  1OE7 A;  1YJ6 A;  3U5R E;  3EUR A;  4KCE A;  4WF5 A;  2A2S A;  1M2B A;  2I3Y A;  4IEL A;  3V1W A;  4OFM A;  5CP1 A;  4F0C A;  1THX A;  4OFN A;  2HFD A;  1U6T A;  2DJ3 A;  4LMV A;  2I4A A;  3VWX A;  2AB6 A;  4GTU A;  3I69 A;  4ZBB A;  4ZL7 A;  1XWC A;  1SKW B;  3ZTL A;  4K6X A;  2CQ9 A;  3VWV A;  1QFN A;  5CAX A;  5G1K A;  2GQM A;  3W6G A;  2GLR A;  1JZO A;  1T7P B;  3GKX A;  1ERT A;  2L5O A;  2VIM A;  1GUL A;  4LA1 A;  4TR4 A;  1T8E B;  2DIZ A;  4IP1 A;  1HD2 A;  3A2W A;  3F4S A;  4EUY A;  1TRS A;  3M1G A;  5J41 A;  1NW2 A;  4Q5F A;  1RQM A;  4JU5 A;  4YQM A;  5DQS A;  2QGV A;  4TR0 A;  3D4M A;  2H1B A;  1OYJ A;  3H1N A;  4F0B A;  4D73 B;  1M9A A;  4K8M A;  2H76 A;  1GL8 A;  4ZB8 A;  3DD3 A;  2C3N A;  2FHE A;  2V2G A;  2P0G A;  5DAL A;  2K9F A;  4GXZ A;  3KXO A;  2LV3 A;  2XBQ A;  5DAK A;  2L4C A;  4FIW A;  2LQO A;  1SL1 B;  4POM A;  4YH2 A;  1GSU A;  4POK A;  2IIY A;  4TR1 A;  1PD2 1;  2PPT A;  3GV1 A;  4ML1 A;  1W89 A;  4IP6 A;  5FWG A;  3ZRD A;  4F03 A;  1GTI A;  3S9F A;  2VCX A;  1U3I A;  3C73 A;  2MYG A;  1DBY A;  5KEJ A;  1MDK A;  2HZE B;  2VM1 A;  4JRR A;  2CA8 A;  1OKT A;  3M0F A;  4O92 A;  4RQX A;  3Q19 A;  4L0W A;  1BX9 A;  2H72 A;  2GZP A;  2WGR A;  4ZB6 A;  3HYP A;  2X64 A;  4H86 A;  2MMN A;  4OCF A;  1WMJ A;  2NTO A;  3ZVJ A;  1DSB A;  5D8I A;  2K8S A;  1ZMA A;  2IWT A;  4KX4 A;  3CSJ A;  2N5A A;  4ZB9 A;  4KDY A;  5J9B A;  1M99 A;  1N2A A;  2VL3 A;  5IMA A;  2H6Z A;  5DJL A;  3TGZ A;  4NAX A;  2HYX A;  2NDO A;  2QC7 A;  5IM9 A;  4IJI A;  3DML A;  4ACS A;  2H01 A;  1R5P A;  1B4P A;  4BWQ A;  2DIY A;  1E2Y A;  4I8B A;  1G7E A;  4ECJ A;  2O85 A;  3QAG A;  1A23 A;  4RQR A;  3BBY A;  6GSS A;  2V41 A;  1F9M A;  2YZU A;  3DRN A;  1V58 A;  3FRC A;  3UVT A;  4MJE A;  2B5X A;  2GST A;  2OE1 A;  4GLT A;  2VLU A;  2YP6 A;  5AIS A;  5HR2 A;  1XIY A;  5ECR B;  5B6N A;  4IVF A;  1TK5 B;  3C8E A;  1QQ2 A;  4RUV A;  5CO3 A;  1R7H A;  3KMN A;  4GSN A;  5E59 A;  1HQO A;  4EL1 A;  3L9V A;  2GT5 A;  3IHQ A;  5EPF A;  2R2J A;  1F2E A;  1F6M C;  1XW5 A;  2WZ9 A;  1ST9 A;  2H0G A;  1SL2 B;  1VF2 A;  4BVY A;  4MLY A;  4TXV A;  1XCC A;  3HZ4 A;  3P7X A;  5J3R A;  5LD0 A;  4BPY A;  1H75 A;  1SYR A;  2I1U A;  1SK1 A;  3QFB C;  5G2Z A;  2BTO T;  1FVJ A;  2GT6 A;  3UAR A;  2OE3 A;  4ID0 A;  4NWY A;  3BJ5 A;  1S3A A;  2ES7 A;  2XC2 A;  4OO4 A;  5IO0 A;  4IHU A;  4V2L A;  4TXO B;  4FYC A;  1TJD A;  2P5R A;  3OR5 A;  4I97 A;  1SU9 A;  1IYH A;  3TJF A;  1E6B A;  1QGV A;  5IMD A;  3EMP A;  5B8B A;  4I2U A;  1X9W B;  2GSS A;  1PRX A;  3DGQ A;  2ZUP A;  2IMK A;  4HZ2 A;  3GH9 A;  4TOP A;  2PVO C;  6GSY A;  2OAD A;  1K3L A;  1G0T A;  4HS1 A;  4OWY A;  2IFQ A;  4DSR A;  5CRH A;  2HSY A;  2FWF A;  4I2T A;  3FEU A;  6GSV A;  1SL0 B;  2YV7 A;  4X0X A;  5CRD A;  2F51 A;  3UIW A;  1LBK A;  4ZL8 A;  3G7J A;  3LFL A;  1YKA A;  2H1D A;  2VD1 A;  2DJ0 A;  5CYY A;  2VAF A;  1TK8 B;  2MMA A;  4AJ8 A;  1K0M A;  3HDC A;  2WFC A;  4WET A;  3EC3 A;  2C4J A;  4MF7 A;  5IO2 A;  5GZZ B;  3LEF A;  3UJ1 A;  2X8G A;  3VK9 A;  4LMW A;  1ZL9 A;  1FHE A;  1MDJ A;  5B7C A;  1VGL A;  2D2Z A;  2E0Q A;  4IW9 A;  2PU9 C;  1PKW A;  1ABA A;  3ERF A;  1GSF A;  1B4Q A;  4FYU A;  4AGS A;  2FCH A;  5CRE A;  5G31 A;  4BWS A;  1B8X A;  1SK2 A;  1XWG A;  3UVH A;  2WB9 A;  5A4U A;  1SEN A;  3FKF A;  4PNF A;  4KW6 A;  3CRT A;  4KSO A;  4JR6 A;  5D96 A;  1BED A;  2LJA A;  1MTC A;  2FD3 A;  2WS2 A;  1PL2 A;  2KLX A;  3F3R A;  1XXU A;  2B6M A;  1XW6 A;  3GTU B;  2VD0 A;  3TJG A;  1JLV A;  3D4T A;  5JWR B;  1KEB A;  4XCS A;  1SK0 A;  2H30 A;  4XIH A;  5DVB A;  3RBT A;  3WD6 A;  2Z9S A;  3WGD A;  5GST A;  1X9M B;  4K9Z A;  2GVP A;  1MD4 A;  3TJJ A;  2G2Q A;  3ERW A;  2HRN A;  3SWL A;  1UVZ A;  3VPQ A;  1NHY A;  4EC0 A;  2L5L A;  1PX7 A;  4HOJ A;  5GAP D;  3QFA C;  4G2E A;  5DBQ A;  3ISO A;  3LG6 A;  3GKM A;  1JHB A;  5B6M A;  1T4Z A;  2YNX A;  1YQ1 A;  1XBS A;  3FZA A;  4EXJ A;  5J9C A;  2LEG A;  4DEJ A;  2F3M A;  4ULX A;  2V6K A;  4J57 E;  1XFL A;  1RW1 A;  1YDK A;  4ILF A;  1LJR A;  3GST A;  2VLV A;  3TJK A;  2H1G A;  4ZBD A;  2VOC A;  3GKK A;  1QXH A;  1ERV A;  3HY2 A;  3TKQ A;  1V2A A;  4K0N A;  2XHF A;  1EP8 A;  2C0F A;  3TKS E;  3ME7 A;  4PXO A;  1OC9 A;  3ZFB A;  4KE3 A;  4GST A;  3ZL5 A;  2LTK A;  1KNG A;  5ECP B;  4RI6 A;  3EWL A;  1V98 A;  3IOS A;  1Z6M A;  2DJJ A;  4F2I A;  5DAL B;  17GS A;  4MK3 A;  1YEX A;  1S3C A;  1EOH A;  1WIK A;  2CAQ A;  3IV4 A;  5DAK B;  3HCZ A;  5A4W A;  5KN3 A;  5HR0 A;  1TRU A;  3IA1 A;  2RUE A;  1OE8 A;  3C7M A;  4TR1 B;  2NPB A;  1PL1 A;  6GSX A;  3LXZ A;  4WR5 A;  5INY A;  3GMF A;  1VRS D;  2AHE A;  2GZY A;  1GSD A;  1GUM A;  2CVD A;  3IK7 A;  1ZGN A;  3GX8 A;  2XPD A;  1TU7 A;  2HZF A;  10GS A;  1ACV A;  1AAZ A;  4MP4 A;  2H74 A;  2ON7 A;  5C04 A;  2FA4 A;  2R4V A;  4I5Q A;  3KD0 A;  3LXT A;  2C1Y A;  1Z3E A;  1WE0 A;  5JWO B;  1GTA A;  1G6Y A;  3TOT A;  3VI7 A;  4XHM A;  3FW2 A;  2E2G A;  4KCA A;  2C0D A;  3PH9 A;  1VF3 A;  3UAP A;  3HJP A;  5IIZ A;  1EEM A;  1AQV A;  2M72 A;  2EIO A;  3F4R A;  1HNB A;  3F8U A;  1GUK A;  1K0B A;  4XS6 A;  2AJQ B;  5CNW A;  2O7K A;  1DUG A;  2LRC A;  2PUK C;  3NZN A;  4N30 A;  3VFI A;  2B5E A;  1V57 A;  2M46 A;  4IGJ A;  4F9Z A;  5DDL A;  2IJY A;  4L8E A;  3D21 A;  1BG5 A;  11GS A;  4MJB A;  3BCK A;  3ZYW A;  20GS A;  3ZFL A;  3A3T A;  3EU4 A;  1JLW A;  1FAA A;  2H70 A;  2YWO A;  5GAN D;  5ECH B;  2IPA A;  2X8H A;  4OD7 A;  5IQY A;  5D9W A;  3LOR A;  3APS A;  3N9J A;  1ZYE A;  4TW5 A;  2GQL A;  4NV2 A;  1FOV A;  1TDI A;  2VCV A;  3D6I A;  5HFI A;  1YEP A;  4NMU A;  4KDX A;  1HNA A;  4N0Z A;  3HVX A;  5DQY A;  1TOF A;  1A0R P;  4EDY A;  2CX4 A;  5EY6 A;  1U87 A;  3D22 A;  2JL4 A;  1QUW A;  4DVC A;  1FVK A;  2L6C A;  5ECS A;  3KJY A;  4V1A g;  1I9D A;  5H5Q A;  3O6T A;  3R2Q A;  3WGX A;  1GH2 A;  3UOM A;  4KB3 A;  2OKA A;  1MEK A;  5HQP A;  3L0H A;  2V6O A;  1SD8 A;  1K0A A;  4GF0 A;  1TRV A;  2IFQ B;  1O8W A;  3L9U A;  1SJI A;  5G1L A;  2LJK A;  3KEB A;  2L57 A;  2RM5 A;  2XPE A;  5ECI B;  5DJM A;  2IMD A;  2VL2 A;  4IJ3 A;  5ENU A;  7GSS A;  1BJX A;  4TVE A;  4OMV A;  1EZK A;  1O85 A;  2VCQ A;  1ML6 A;  2YWI A;  1WP0 A;  2N5F A;  3GHA A;  3UEM A;  3L4N A;  1O7U A;  1XVQ A;  4AJ7 A;  1PQN A;  2FY6 A;  3LJR A;  2VCZ A;  3P2A A;  3LQ7 A;  1T1V A;  1K3Y A;  5KN1 A;  4YQV A;  1GSQ A;  1SKS B;  1GSS A;  5B8A A;  2G0F A;  4BA7 A;  1A8Y A;  2YJ7 A;  2O8V B;  2YOI A;  2OE0 A;  5IOX A;  3CXG A;  5F8B A;  22GS A;  1WPI A;  4KAE A;  4HZ4 A;  5IMF A;  2BMX A;  4E8E A;  1THO A;  4TKY A;  5A5K A;  3IPZ A;  9GSS A;  1EGO A;  3DVX A;  5CRW A;  4JED A;  5DCH A;  2DML A;  2F8A A;  1SJ6 A;  4WXT A;  3E3E A;  2CT6 A;  2JSZ A;  2FWE A;  3A5W A;  2EIQ A;  1JFU A;  1TP9 A;  2PWJ A;  3CBU A;  3BD2 A;  2F9S A;  3CTG A;  1GTB A;  1TI3 A;  3TCO A;  2HE3 A;  1DE2 A;  1IYI A;  4XTS A;  1EOG A;  3VWU A;  2DJK A;  1K0D A;  4ECB A;  5ID2 A;  1AQX A;  2VL2 C;  2HI7 A;  3BCI A;  1O6J A;  2IME A;  2LST A;  1YKC A;  3HHV A;  1SKR B;  18GS A;  3A2X A;  1F3A A;  3IK9 A;  5JCU A;  2KHP A;  1WJK A;  4ZXG A;  4DSS A;  4TN8 A;  2VO4 A;  4PQ1 A;  4WEY A;  5KN2 A;  1YF1 A;  3TDG A;  2YN1 A;  1A24 A;  3FZ5 A;  4PX1 A;  3HJM A;  1TI1 A;  3TKR A;  3FR9 A;  3G7I A;  4EKZ A;  2L6D A;  5D93 A;  2DLX A;  3F6D A;  4K7N A;  5FT3 A;  16GS A;  3F0I A;  4MF5 A;  2P5Q A;  5CRG A;  3F4T A;  2B1L A;  1Y25 A;  2EC4 A;  2QKE A;  2YWN A;  1I5G A;  1URM A;  1OC8 A;  1OVN A;  1TU8 A;  3FR6 A;  3APO A;  1OC9 B;  3CTF A;  5JCG A;  1PSQ A;  2JZS A;  2IL3 A;  2R6K A;  3EU3 A;  2HXK A;  1HYU A;  3HKR A;  1W4V A;  1XOB A;  1F3B A;  2K6V A;  3AY8 A;  3IDV A;  2YV9 A;  4IN0 A;  3E9J B;  5D73 A;  1OC3 A;  3ZML A;  1T4Y A;  3G7Y A;  4AJ6 A;  2FWG A;  2A4V A;  6GSU A;  1NHO A;  6GSW A;  3KGK A;  3DXB A;  2H8L A;  4N0V A;  1M2A A;  3J7Y k;  4XRD A;  3ZLP A;  1K0N A;  3FHK A;  3QOU A;  2I81 A;  2B1K A;  3GKN A;  1GWC A;  2YZH A;  2AAW A;  14GS A;  2MBT A;  4HJM A;  1O81 A;  3CMI A;  4DSQ A;  3KH7 A;  4I6X A;  2C0G A;  1YZX A;  1FB6 A;  4HJ2 A;  2PBJ A;  4HQZ A;  3GUS A;  3FZ9 A;  2LKU A;  4K0G A;  4CDO A;  1M9B A;  2GQK A;  4MDC A;  3KP8 A;  1R4W A;  3IR4 A;  3QD9 A;  2GSQ A;  1U88 A;  3W8S A;  2MMZ A;  1TXX A;  3PIN A;  2LQQ A;  5DCG A;  1MDI A;  1CQH A;  4ZBA A;  2C80 A;  3KP9 A;  4NV5 A;  4GSS A;  2DJ1 A;  3D5J A;  2O89 A;  3IE3 A;  1C72 A;  1GRX A;  2CAI A;  4X43 A;  3A2V A;  4TRX A;  2PVQ A;  1A0F A;  2GDR A;  2CZ3 A;  3I6A A;  2MMO A;  2PN8 A;  2RII A;  1FG4 A;  2FLS A;  2MBS A;  2VM2 A;  3TRQ A;  3KM6 A;  4G10 A;  2IMI A;  5G5E A;  2X99 A;  5J5N A;  2LJR A;  2KP1 A;  1FO5 A;  2LRT A;  3DYR A;  2LS5 A;  5L71 A;  2JZT A;  3UMA A;  3GUR A;  4FH8 A;  1GSE A;  4MZB A;  4MZW A;  1Z6N A;  2QSI A;  3F3Q A;  4XS4 A;  4NPB A;  2H66 A;  4NHZ A;  1B9X C;  1QMV A;  3ED3 A;  4ZIL A;  3W8J A;  3APQ A;  4K7O A;  5KN0 A;  3DWV A;  3SBC A;  2FA8 A;  3HXS A;  3GN3 A;  5ECK B;  3GL3 A;  5D9T A;  5LNK e;  3GNJ A;  4GCI A;  3ZMK A;  1EV4 A;  3EE2 A;  1PKZ A;  2B7J A;  3QPM A;  4Q5R A;  8GSS A;  3QCP A;  2FWH A;  3UBK A;  3C71 A;  5HFK A;  3EVI A;  3ZVJ D;  4AF2 A;  1K0O A;  2F8F A;  5HR1 A;  4IS0 A;  5H5S A;  1WOU A;  4KH7 A;  3K8N A;  1A8L A;  1UN2 A;  1AUC A;  3ZRE A;  3KTB A;  2O87 A;  1A2J A;  2KOK A;  3GA4 A;  2YPM A;  4N10 A;  2JZR A;  1ZYQ B;  3ZIT A;  1GNE A;  1UA5 A;  3MSZ A;  3CRU A;  3O3T A;  4MH3 A;  3E0U A;  3F6F A;  2LNT A;  2H1A A;  3TKP A;  1M0U A;  5ECQ B;  3Q74 A;  1X5C A;  2H0I A;  1GUH A;  5F06 A;  4Q5Q A;  1K0C A;  1VF1 A;  4MH2 A;  3RDW A;  4MJC A;  4HDE A;  4CW9 A;  3HVS A;  3KZQ A;  2AV4 A;  3C1S A;  3GSS A;  3IC4 A;  2MZC A;  3P90 A;  1KBN A;  4LLR A;  3NOF A;  3Q18 A;  1VF4 A;  1GNW A;  3C1R A;  4PGT A;  2E7P A;  3GRX A;  3IXR A;  3PR8 A;  2RLI A;  3RHC A;  2WCI A;  1OAZ A;  5AIX A;  4PQI A;  1EP7 A;  1XOA A;  3TJB A;  1JZR A;  3EIN A;  1V40 A;  5H5R A;  3L9S A;  1B9Y C;  4YQU A;  2DJ2 A;  3P8W A;  4JBB A;  3BOA A;  3ZIJ A;  1V9W A;  4QL9 A;  1DE1 A;  1EGR A;  3M8N A;  5A4V A;  4ZIJ A;  2VLT A;  3IRA A;  2ZCT A;  1ERW A;  1T3B A;  3TRP A;  2EIR A;  4HUA A;  1EV9 A;  5AGY A;  4O32 A;  4QL7 A;  3QDN A;  1AQW A;  2FGX A;  1TRW A;  2C3Q A;  4WR4 A;  1GLQ A;  1XW9 A;  5C00 A;  4HQS A;  2PER A;  3IAS 2;  3IAM 2;  2NBS A;  4JE1 A;  4XRA A;  3HA9 A;  1AC1 A;  5ID2 B;  12GS A;  19GS A;  4POB A;  4PUR A;  4GQC A;  5ELA A;  1PA3 A;  1Z7P A;  1Q4J A;  5ECL B;  3F63 A;  2CV4 A;  2OAC A;  1MD3 A;  1ZZY A;  3LYK A;  1XPV A;  4HU7 A;  3KCM A;  3I9V 2;  5IPH A;  1XWB A;  2WRT A;  3VLN A;  3VWW A;  4Z7X A;  1BQ7 A;  5AN1 A;  1SD9 A;  2C8U A;  4XS1 A;  4DSS B;  5E4W A;  4OO5 A;  13GS A;  1A2L A;  1M7T A;  4K7I A;  1R5A A;  5F05 A;  4CHS A;  3US3 A;  3GIX A;  3MWH A;  2YWM A;  5D9V A;  1BAY A;  2RM6 A;  1Q98 A;  1EWX A;  1KTE A;  1J9B A;  5ECO B;  2TRX A;  1TK0 B;  3NIV A;  3ZIV A;  4TR3 A;  5F07 A;  3KTL A;  3J7Y b;  4J56 E;  2PGT A;  1SJZ A;  1WRY A;  1QK8 A;  3QMX A;  1TW9 A;  2C0E A;  4KUN A;  1O8X A;  4L0U A; 
#chains in the Genus database with same CATH topology
 2H6X A;  3GX0 A;  2JSY A;  2DBC A;  4Q5N A;  4ZL9 A;  5IMV A;  2HT9 A;  3MAK A;  2KP2 A;  2IN3 A;  2HLS A;  3FR3 A;  2VCT A;  4BVX A;  3H79 A;  2OBI A;  1EEJ A;  2M80 A;  1PN9 A;  1ZYP A;  3LGC A;  3LSZ A;  2LRN A;  3EYT A;  2HSH A;  3HJO A;  1Z9H A;  1ZOF A;  4D73 A;  2GZZ A;  4QQ7 A;  2V1M A;  2VUP A;  1AW9 A;  3HVV A;  3M9J A;  2IMF A;  3TKS A;  3WT2 A;  3ME8 A;  2R3X A;  3R3E A;  1PX6 A;  4FYB A;  4O7H A;  2REM A;  3GH6 A;  2H71 A;  4LL1 B;  4KDU A;  1B48 A;  4YAV A;  3DIE A;  4MJA A;  4G9H A;  3QAV A;  4OCE A;  1TKD B;  3TOU A;  3GL5 A;  3FZ4 A;  1XG8 A;  4YKF A;  3M9K A;  4IQ1 A;  1XZO A;  1BYE A;  1GSY A;  4G19 A;  5G5F A;  1ON4 A;  4GRF A;  1XWA A;  3RPP A;  2XBI A;  4PUA A;  3ZZX A;  4MPF A;  1NM3 A;  2GS3 A;  2HZE A;  3H93 A;  1G7O A;  1JZD A;  4FO5 A;  2K18 A;  4JZQ A;  3Q6O A;  2N5B A;  3VPT A;  5LCZ A;  2NVL A;  4HU9 A;  3U6V A;  1F37 A;  1YF0 A;  4Z2U A;  2L4Q A;  2K8V A;  1OKD A;  4HEA 2;  2R37 A;  3LYP A;  1J0F A;  4X1U A;  3L78 A;  3HD5 A;  2RUF A;  2GTU A;  4MZC A;  3JCM L;  1GP1 A;  2P31 A;  2V32 A;  3M3M A;  4J2F A;  3TRX A;  1ERU A;  4EDZ A;  4NXI A;  4L5O A;  4BL7 A;  1XVW A;  2X49 A;  2H6Y A;  5IOW A;  3CSH A;  3CSI A;  3D0Z A;  4LL4 B;  5COH A;  1ZCP A;  2LNS A;  4IBP A;  4K2D A;  4WF4 A;  2JAD A;  1X9S B;  3TKS C;  3F9U A;  4MA9 A;  4WKW A;  3FYG A;  3H8Q A;  2VL9 A;  2KUC A;  1FW1 A;  4PNG A;  4XS4 B;  5ABR A;  4MF6 A;  4MMM A;  4RI7 A;  3RAZ A;  4KA0 A;  1LU4 A;  5KOW A;  2R5G A;  1YY7 A;  2E2M A;  1FB0 A;  1USB A;  2H73 A;  4ECI A;  2ALB A;  6GST A;  4O5R A;  4L5L A;  3MDK A;  1S3D A;  3VUR A;  4KND A;  3KMO A;  1AIU A;  4P3Y B;  4V2M A;  1M3I A;  3CYN A;  1GTU A;  2YJH A;  4HI7 A;  2PMT A;  4OFT A;  2L59 A;  2QA1 A;  4KGI A;  5HR3 A;  2B5Y A;  3GFK A;  3EMX A;  1XWK A;  1GLP A;  1U3A A;  1Z5Y E;  1H4O A;  2WJU A;  5ELG A;  4WBR D;  4V1A p;  2H19 A;  5EVO A;  2QA2 A;  5IMZ A;  2JAC A;  3G9B A;  5HFG A;  5JWQ B;  4TXO A;  2OJL A;  3QR6 A;  4K1F A;  4GQF A;  3O76 A;  1AXD A;  3HZ8 A;  4MPG A;  2HRF A;  5G30 A;  4KSM A;  4IQA A;  3IBH A;  2CZ2 A;  3UL3 A;  2C3T A;  3VI5 A;  3WYW A;  2ON5 A;  4IKH A;  4MCU A;  1Z7R A;  5JCW A;  3QAW A;  1Y6E A;  2A2R A;  5D9X A;  2WDU A;  5GSS A;  2DMM A;  4MAB A;  4ICY A;  2FNO A;  2TRC P;  3PGT A;  2H0H A;  1NSW A;  2A2P A;  1X5D A;  2J23 A;  3LWA A;  4WBJ A;  4EO3 A;  4ECC A;  3ERG A;  1M2D A;  3TB2 A;  4V2N A;  5EL8 A;  5IPG A;  2B7K A;  1PGT A;  4PQH A;  2TIR A;  1X0R A;  3KIJ A;  2CX3 A;  4EF0 A;  3FK8 A;  3RPN A;  2OA7 A;  2YAN A;  2FUG 2;  2BJX A;  3KH9 A;  4NHW A;  5FHI A;  4ML6 A;  1X5E A;  2I9H A;  1G6W A;  1T00 A;  1J08 A;  4PUF C;  1UC7 A;  2VCW A;  4YAP A;  4O5U A;  5J4U A;  3H4K A;  2CVB A;  5AIV A;  4N11 A;  2LUS A;  5ECM B;  3WT1 A;  1WWJ A;  3FY7 A;  3UBL A;  2ZNM A;  2OBK A;  2GGT A;  2DC5 A;  1O73 A;  2J9H A;  2CVK A;  4E8H A;  3MNG A;  4K5S A;  3I43 A;  1TTZ A;  2AYT A;  2H75 A;  4ISD A;  1HNC A;  1R26 A;  5IMC A;  4EVM A;  3GTU A;  3GYK A;  3DVW A;  3DEX A;  3TUE A;  4O5Q A;  2YCD A;  4JR4 A;  2B3S A;  2DSA A;  4F82 A;  1JZW A;  1SYX A;  2AUV A;  1K3O A;  4GWR A;  3DKS A;  4POL A;  2A4H A;  1RK4 A;  2X8C A;  1ILO A;  5ECN B;  4EE0 A;  5F0G A;  1CQG A;  1PMT A;  2HNL A;  1N8J A;  3WGE A;  3RHB A;  1A2M A;  3N5O A;  2GSR A;  2JU5 A;  2WUL A;  1OE7 A;  1YJ6 A;  3U5R E;  3EUR A;  4KCE A;  4WF5 A;  2A2S A;  1M2B A;  2I3Y A;  4IEL A;  3V1W A;  4OFM A;  5CP1 A;  4F0C A;  1THX A;  4OFN A;  2HFD A;  1U6T A;  2DJ3 A;  4LMV A;  2I4A A;  3VWX A;  2AB6 A;  4GTU A;  3I69 A;  4ZBB A;  4ZL7 A;  1XWC A;  1SKW B;  3ZTL A;  4K6X A;  2CQ9 A;  2HRA A;  3VWV A;  1QFN A;  5CAX A;  5G1K A;  2GQM A;  3W6G A;  2GLR A;  1JZO A;  1T7P B;  3GKX A;  1ERT A;  2L5O A;  2VIM A;  1GUL A;  4LA1 A;  4TR4 A;  1T8E B;  2DIZ A;  4IP1 A;  1HD2 A;  3A2W A;  3F4S A;  4EUY A;  1TRS A;  3M1G A;  5J41 A;  1NW2 A;  4Q5F A;  1RQM A;  4JU5 A;  4YQM A;  5DQS A;  2QGV A;  4TR0 A;  3D4M A;  2H1B A;  1OYJ A;  3H1N A;  4F0B A;  4D73 B;  1M9A A;  4K8M A;  2H76 A;  1GL8 A;  3CQF A;  4ZB8 A;  3DD3 A;  2C3N A;  2FHE A;  2V2G A;  2P0G A;  5DAL A;  2K9F A;  4GXZ A;  3KXO A;  2LV3 A;  2XBQ A;  5DAK A;  2L4C A;  4FIW A;  2LQO A;  1M3J A;  1SL1 B;  4POM A;  4YH2 A;  1GSU A;  4POK A;  2IIY A;  4TR1 A;  1PD2 1;  2PPT A;  3GV1 A;  4ML1 A;  1W89 A;  4IP6 A;  5FWG A;  3ZRD A;  4F03 A;  1GTI A;  3S9F A;  2VCX A;  1U3I A;  3C73 A;  2MYG A;  1DBY A;  5KEJ A;  1MDK A;  2HZE B;  2VM1 A;  4JRR A;  2CA8 A;  1OKT A;  3M0F A;  4O92 A;  4RQX A;  3Q19 A;  4L0W A;  1BX9 A;  2H72 A;  2GZP A;  2WGR A;  4ZB6 A;  3HYP A;  2X64 A;  4H86 A;  2MMN A;  4OCF A;  1WMJ A;  2NTO A;  3ZVJ A;  1DSB A;  5D8I A;  2K8S A;  1ZMA A;  2IWT A;  4KX4 A;  3CSJ A;  5BMU A;  2N5A A;  4ZB9 A;  4YKG A;  4KDY A;  5J9B A;  1M99 A;  1N2A A;  2VL3 A;  5IMA A;  4MNN A;  2H6Z A;  5DJL A;  3TGZ A;  4NAX A;  4X4J A;  2HYX A;  2NDO A;  2QC7 A;  5IM9 A;  4IJI A;  3DML A;  4ACS A;  2H01 A;  1R5P A;  3MIX A;  1B4P A;  4BWQ A;  2DIY A;  1E2Y A;  4I8B A;  1G7E A;  4BL7 B;  4ECJ A;  2O85 A;  1FOH A;  3QAG A;  1A23 A;  4RQR A;  3BBY A;  6GSS A;  2V41 A;  1F9M A;  2YZU A;  3DRN A;  1V58 A;  3FRC A;  3UVT A;  4MJE A;  2B5X A;  2GST A;  2OE1 A;  4GLT A;  2VLU A;  2YP6 A;  5AIS A;  5HR2 A;  1XIY A;  5ECR B;  5B6N A;  4IVF A;  1TK5 B;  3C8E A;  1QQ2 A;  4RUV A;  5CO3 A;  1R7H A;  3KMN A;  4GSN A;  5E59 A;  1HQO A;  4EL1 A;  3L9V A;  2GT5 A;  3IHQ A;  5EPF A;  2R2J A;  1F2E A;  1F6M C;  1XW5 A;  2WZ9 A;  1ST9 A;  2H0G A;  1SL2 B;  1VF2 A;  4BVY A;  4MLY A;  4TXV A;  1XCC A;  3HZ4 A;  3P7X A;  5J3R A;  5LD0 A;  4BPY A;  1H75 A;  1SYR A;  2I1U A;  1SK1 A;  3QFB C;  5G2Z A;  2BTO T;  1FVJ A;  2GT6 A;  3UAR A;  2OE3 A;  4ID0 A;  4NWY A;  3BJ5 A;  1S3A A;  2ES7 A;  1ZYN A;  2XC2 A;  4OO4 A;  5IO0 A;  4IHU A;  4V2L A;  4TXO B;  4FYC A;  3LW9 A;  1TJD A;  2P5R A;  3OR5 A;  4I97 A;  1SU9 A;  1IYH A;  2HRK A;  3TJF A;  1E6B A;  1QGV A;  5IMD A;  3EMP A;  5B8B A;  4I2U A;  1X9W B;  2GSS A;  1PRX A;  3DGQ A;  2ZUP A;  2IMK A;  4HZ2 A;  3GH9 A;  4TOP A;  2PVO C;  6GSY A;  4USS A;  2OAD A;  1K3L A;  1G0T A;  4HS1 A;  4OWY A;  2IFQ A;  4DSR A;  5CRH A;  2HSY A;  2FWF A;  4I2T A;  3FEU A;  6GSV A;  1SL0 B;  2YV7 A;  4X0X A;  5CRD A;  2HSM A;  2F51 A;  3UIW A;  1LBK A;  4ZL8 A;  3G7J A;  3LFL A;  1YKA A;  2H1D A;  2VD1 A;  2DJ0 A;  5CYY A;  2VAF A;  1TK8 B;  2MMA A;  4AJ8 A;  1K0M A;  3HDC A;  2WFC A;  4WET A;  3EC3 A;  2C4J A;  4MF7 A;  5IO2 A;  5GZZ B;  3LEF A;  3UJ1 A;  2X8G A;  3VK9 A;  4LMW A;  1ZL9 A;  1FHE A;  1MDJ A;  5B7C A;  1VGL A;  2D2Z A;  2E0Q A;  4IW9 A;  2PU9 C;  1PKW A;  1ABA A;  3ERF A;  1GSF A;  1B4Q A;  4FYU A;  4AGS A;  2FCH A;  5CRE A;  5G31 A;  4BWS A;  1B8X A;  1SK2 A;  1XWG A;  3UVH A;  2WB9 A;  5A4U A;  1SEN A;  3FKF A;  4PNF A;  4KW6 A;  3CRT A;  4KSO A;  4JR6 A;  5D96 A;  1BED A;  2LJA A;  1MTC A;  2FD3 A;  2WS2 A;  1PL2 A;  2KLX A;  3F3R A;  1XXU A;  2B6M A;  1XW6 A;  3GTU B;  2VD0 A;  3TJG A;  1JLV A;  3D4T A;  5JWR B;  1KEB A;  4XCS A;  1SK0 A;  2H30 A;  4XIH A;  5DVB A;  3RBT A;  3WD6 A;  2Z9S A;  3WGD A;  5GST A;  1X9M B;  4K9Z A;  2GVP A;  3EPT A;  1MD4 A;  3TJJ A;  3HVN A;  2G2Q A;  3ERW A;  2HRN A;  3SWL A;  1UVZ A;  3VPQ A;  1NHY A;  4EC0 A;  2L5L A;  1PX7 A;  4HOJ A;  5GAP D;  3QFA C;  4G2E A;  5DBQ A;  3ISO A;  3LG6 A;  3GKM A;  1JHB A;  5B6M A;  1T4Z A;  2YNX A;  1YQ1 A;  1XBS A;  3FZA A;  4EXJ A;  5J9C A;  2LEG A;  4DEJ A;  2F3M A;  4ULX A;  2V6K A;  4J57 E;  1XFL A;  1RW1 A;  1YDK A;  4ILF A;  1LJR A;  4Z2R A;  3GST A;  2VLV A;  3TJK A;  2H1G A;  4ZBD A;  2VOC A;  3GKK A;  1QXH A;  1ERV A;  3HY2 A;  3TKQ A;  1V2A A;  4K0N A;  2XHF A;  1EP8 A;  4EIP A;  2C0F A;  3TKS E;  3ME7 A;  4PXO A;  1OC9 A;  3ZFB A;  4KE3 A;  4GST A;  3ZL5 A;  2LTK A;  1KNG A;  5ECP B;  4RI6 A;  3EWL A;  1V98 A;  3IOS A;  1Z6M A;  2DJJ A;  4F2I A;  5DAL B;  17GS A;  4MK3 A;  1YEX A;  1S3C A;  1EOH A;  1WIK A;  2CAQ A;  3IV4 A;  5DAK B;  2R0C A;  3HCZ A;  3IC8 A;  5A4W A;  5KN3 A;  5HR0 A;  1TRU A;  3IA1 A;  4CY6 A;  2RUE A;  1OE8 A;  3C7M A;  4TR1 B;  2NPB A;  1PL1 A;  6GSX A;  3LXZ A;  3FMW A;  4WR5 A;  5INY A;  3GMF A;  1VRS D;  2AHE A;  2GZY A;  1GSD A;  1GUM A;  2CVD A;  3IK7 A;  1ZGN A;  3GX8 A;  2XPD A;  1TU7 A;  2HZF A;  10GS A;  1ACV A;  1AAZ A;  4MP4 A;  2H74 A;  2ON7 A;  5C04 A;  2FA4 A;  2R4V A;  4I5Q A;  3KD0 A;  3LXT A;  2C1Y A;  1Z3E A;  1WE0 A;  5JWO B;  1GTA A;  1G6Y A;  3TOT A;  3VI7 A;  4XHM A;  3FW2 A;  2E2G A;  4KCA A;  2C0D A;  3PH9 A;  1VF3 A;  3UAP A;  3HJP A;  5IIZ A;  1EEM A;  1AQV A;  2M72 A;  2EIO A;  3F4R A;  1HNB A;  3F8U A;  1GUK A;  1K0B A;  4XS6 A;  4A5P A;  2AJQ B;  5CNW A;  2O7K A;  1DUG A;  2LRC A;  2PUK C;  3NZN A;  4N30 A;  3VFI A;  2B5E A;  1V57 A;  2M46 A;  4IGJ A;  4F9Z A;  5DDL A;  2IJY A;  4L8E A;  3D21 A;  2R0G A;  1BG5 A;  4K2X A;  11GS A;  4MJB A;  3BCK A;  3ZYW A;  20GS A;  3ZFL A;  3A3T A;  3EU4 A;  1JLW A;  1FAA A;  2H70 A;  2YWO A;  5GAN D;  5ECH B;  2IPA A;  2X8H A;  4OD7 A;  4BVY B;  5IQY A;  4BIK A;  5D9W A;  3LOR A;  3APS A;  3N9J A;  1ZYE A;  4TW5 A;  2GQL A;  4NV2 A;  1FOV A;  1TDI A;  2VCV A;  3D6I A;  4PTS A;  5HFI A;  1YEP A;  4NMU A;  4KDX A;  1HNA A;  4N0Z A;  3HVX A;  5DQY A;  1TOF A;  1A0R P;  4EDY A;  1PN0 A;  2CX4 A;  5EY6 A;  1U87 A;  3D22 A;  2JL4 A;  3MYD A;  1QUW A;  4DVC A;  1FVK A;  2L6C A;  5ECS A;  3KJY A;  4V1A g;  1I9D A;  5H5Q A;  3O6T A;  3R2Q A;  3WGX A;  1GH2 A;  3UOM A;  4KB3 A;  2OKA A;  1MEK A;  5HQP A;  3L0H A;  2V6O A;  1SD8 A;  1K0A A;  4GF0 A;  1TRV A;  2IFQ B;  1O8W A;  3L9U A;  1SJI A;  5G1L A;  2LJK A;  3KEB A;  2L57 A;  2RM5 A;  1PFO A;  2XPE A;  5ECI B;  5DJM A;  2IMD A;  2R0P A;  2VL2 A;  4IJ3 A;  5ENU A;  7GSS A;  1BJX A;  4TVE A;  4OMV A;  1EZK A;  1O85 A;  2VCQ A;  1ML6 A;  2YWI A;  1WP0 A;  2N5F A;  3GHA A;  3UEM A;  3L4N A;  1O7U A;  1XVQ A;  4AJ7 A;  1PQN A;  2FY6 A;  3LJR A;  2VCZ A;  3P2A A;  3LQ7 A;  1T1V A;  1K3Y A;  5KN1 A;  4YQV A;  1GSQ A;  1SKS B;  1GSS A;  5B8A A;  2G0F A;  4BA7 A;  1A8Y A;  2YJ7 A;  2O8V B;  2YOI A;  2OE0 A;  5IOX A;  3CXG A;  5F8B A;  22GS A;  1WPI A;  4G0L A;  4KAE A;  4HZ4 A;  5IMF A;  2BMX A;  4E8E A;  1THO A;  4TKY A;  5A5K A;  3IPZ A;  9GSS A;  1EGO A;  3DVX A;  5CRW A;  4JED A;  5DCH A;  2DML A;  2F8A A;  1SJ6 A;  4WXT A;  3E3E A;  2CT6 A;  2JSZ A;  2FWE A;  3A5W A;  2EIQ A;  1JFU A;  1TP9 A;  2PWJ A;  3CBU A;  3BD2 A;  2F9S A;  3CTG A;  1GTB A;  1TI3 A;  3TCO A;  2HE3 A;  1DE2 A;  1IYI A;  4XTS A;  1EOG A;  3VWU A;  2DJK A;  1K0D A;  4ECB A;  5ID2 A;  1AQX A;  2VL2 C;  2HI7 A;  3BCI A;  1O6J A;  2IME A;  2LST A;  1YKC A;  3HHV A;  1SKR B;  18GS A;  3A2X A;  1F3A A;  3IK9 A;  5JCU A;  2KHP A;  1WJK A;  4ZXG A;  4DSS A;  4TN8 A;  2VO4 A;  4PQ1 A;  4WEY A;  5KN2 A;  1YF1 A;  3TDG A;  2YN1 A;  1A24 A;  3FZ5 A;  4PX1 A;  3HJM A;  1TI1 A;  3TKR A;  4EIQ A;  3FR9 A;  3G7I A;  4EKZ A;  4K5R A;  2L6D A;  5D93 A;  2DLX A;  3F6D A;  4K7N A;  5FT3 A;  16GS A;  3F0I A;  4MF5 A;  2P5Q A;  5CRG A;  3F4T A;  2B1L A;  1Y25 A;  2EC4 A;  2QKE A;  2YWN A;  1I5G A;  1URM A;  1OC8 A;  1OVN A;  1TU8 A;  3FR6 A;  3APO A;  1OC9 B;  3CTF A;  5JCG A;  1PSQ A;  2JZS A;  2IL3 A;  2R6K A;  3EU3 A;  2HXK A;  1HYU A;  3HKR A;  1W4V A;  1XOB A;  1F3B A;  2K6V A;  3AY8 A;  3IDV A;  2YV9 A;  4IN0 A;  3E9J B;  5KOX A;  5D73 A;  1OC3 A;  3ZML A;  3A5I A;  1T4Y A;  3G7Y A;  4AJ6 A;  2FWG A;  2A4V A;  6GSU A;  1NHO A;  6GSW A;  3KGK A;  3DXB A;  2H8L A;  4N0V A;  1M2A A;  3J7Y k;  4XRD A;  3ZLP A;  1K0N A;  3FHK A;  3QOU A;  2I81 A;  2B1K A;  4Z2T A;  3GKN A;  1GWC A;  2YZH A;  2AAW A;  14GS A;  2MBT A;  4HJM A;  1O81 A;  3CMI A;  4DSQ A;  3KH7 A;  4I6X A;  2C0G A;  1YZX A;  1FB6 A;  4HJ2 A;  2PBJ A;  4HQZ A;  3GUS A;  3FZ9 A;  2LKU A;  4K0G A;  4CDO A;  1M9B A;  2GQK A;  4MDC A;  3KP8 A;  1R4W A;  3IR4 A;  3QD9 A;  2GSQ A;  1U88 A;  3W8S A;  2MMZ A;  1TXX A;  3PIN A;  2DKH A;  2LQQ A;  5DCG A;  1MDI A;  1CQH A;  4ZBA A;  2C80 A;  3KP9 A;  4NV5 A;  4GSS A;  2DJ1 A;  3D5J A;  2O89 A;  3IE3 A;  1C72 A;  1GRX A;  2CAI A;  4X43 A;  3A2V A;  4TRX A;  2PVQ A;  1A0F A;  2GDR A;  2CZ3 A;  3I6A A;  2MMO A;  2PN8 A;  2RII A;  1FG4 A;  2FLS A;  2MBS A;  2VM2 A;  3TRQ A;  3KM6 A;  4G10 A;  2IMI A;  5G5E A;  2X99 A;  5J5N A;  2LJR A;  2KP1 A;  1FO5 A;  1S3R A;  2LRT A;  3DYR A;  2LS5 A;  5L71 A;  2JZT A;  3UMA A;  3GUR A;  4FH8 A;  1GSE A;  4MZB A;  4MZW A;  1Z6N A;  2QSI A;  3F3Q A;  4XS4 A;  4NPB A;  2H66 A;  4NHZ A;  1B9X C;  1QMV A;  3ED3 A;  4ZIL A;  3W8J A;  3APQ A;  4K7O A;  5KN0 A;  3DWV A;  3SBC A;  4FQU A;  2FA8 A;  3HXS A;  3GN3 A;  5ECK B;  3GL3 A;  5D9T A;  5LNK e;  3GNJ A;  4GCI A;  3ZMK A;  1EV4 A;  3EE2 A;  1PKZ A;  2B7J A;  3QPM A;  4Q5R A;  8GSS A;  3QCP A;  2FWH A;  3UBK A;  3C71 A;  5HFK A;  3EVI A;  3ZVJ D;  4AF2 A;  1K0O A;  2F8F A;  5HR1 A;  4IS0 A;  5H5S A;  1WOU A;  4KH7 A;  3K8N A;  1A8L A;  1UN2 A;  1AUC A;  3PPU A;  3ZRE A;  3KTB A;  2O87 A;  1A2J A;  2KOK A;  3GA4 A;  2YPM A;  2UZ8 A;  4N10 A;  2JZR A;  1ZYQ B;  3ZIT A;  1GNE A;  1UA5 A;  3MSZ A;  3CRU A;  3O3T A;  4MH3 A;  3E0U A;  3F6F A;  2LNT A;  2H1A A;  3TKP A;  1M0U A;  5ECQ B;  3Q74 A;  1X5C A;  2X4A A;  2H0I A;  1GUH A;  5F06 A;  4Q5Q A;  1K0C A;  4KF9 A;  4CY8 A;  1VF1 A;  4MH2 A;  3RDW A;  4MJC A;  4HDE A;  4CW9 A;  3HVS A;  3KZQ A;  2AV4 A;  3C1S A;  3GSS A;  3IC4 A;  2MZC A;  3P90 A;  4G0K A;  1KBN A;  4LLR A;  3NOF A;  3Q18 A;  1VF4 A;  1GNW A;  3C1R A;  4PGT A;  2E7P A;  3GRX A;  3IXR A;  3PR8 A;  2RLI A;  3RHC A;  2WCI A;  1OAZ A;  5AIX A;  4PQI A;  1EP7 A;  1XOA A;  3TJB A;  1JZR A;  3EIN A;  4BVX B;  1V40 A;  5H5R A;  3L9S A;  1B9Y C;  4YQU A;  2DJ2 A;  3P8W A;  4JBB A;  3BOA A;  3ZIJ A;  1V9W A;  4QL9 A;  1DE1 A;  1EGR A;  3M8N A;  5A4V A;  4ZIJ A;  2VLT A;  3IRA A;  2ZCT A;  1ERW A;  1T3B A;  3TRP A;  2EIR A;  2DKI A;  4HUA A;  1EV9 A;  5AGY A;  4O32 A;  4QL7 A;  3QDN A;  1AQW A;  2FGX A;  1TRW A;  2C3Q A;  4WR4 A;  1GLQ A;  1XW9 A;  5C00 A;  4HQS A;  2PER A;  3IAS 2;  3IAM 2;  2NBS A;  4JE1 A;  4XRA A;  3HA9 A;  1AC1 A;  5ID2 B;  12GS A;  19GS A;  4POB A;  4PUR A;  4GQC A;  5ELA A;  1PA3 A;  1Z7P A;  1Q4J A;  5ECL B;  3F63 A;  2CV4 A;  2OAC A;  1MD3 A;  1ZZY A;  3LYK A;  1XPV A;  4HU7 A;  3KCM A;  3I9V 2;  5IPH A;  1XWB A;  2WRT A;  3VLN A;  3VWW A;  4Z7X A;  1BQ7 A;  5AN1 A;  1SD9 A;  2C8U A;  3IHG A;  4XS1 A;  4DSS B;  5E4W A;  4OO5 A;  13GS A;  1A2L A;  1M7T A;  4K7I A;  1R5A A;  5F05 A;  4CHS A;  3US3 A;  3GIX A;  3MWH A;  2YWM A;  5D9V A;  1BAY A;  2RM6 A;  1Q98 A;  1EWX A;  1KTE A;  1J9B A;  5ECO B;  2TRX A;  1TK0 B;  3NIV A;  3ZIV A;  4TR3 A;  5F07 A;  4G0I A;  3KTL A;  4HSC X;  3J7Y b;  4J56 E;  2PGT A;  1SJZ A;  1WRY A;  1QK8 A;  3QMX A;  5BRT A;  1TW9 A;  2C0E A;  4KUN A;  1O8X A;  4L0U A; 
#chains in the Genus database with same CATH homology
 2H6X A;  3GX0 A;  2JSY A;  2DBC A;  4Q5N A;  4ZL9 A;  5IMV A;  2HT9 A;  3MAK A;  2KP2 A;  2IN3 A;  2HLS A;  3FR3 A;  2VCT A;  4BVX A;  3H79 A;  2OBI A;  1EEJ A;  2M80 A;  1PN9 A;  1ZYP A;  3LGC A;  3LSZ A;  2LRN A;  3EYT A;  2HSH A;  3HJO A;  1Z9H A;  1ZOF A;  4D73 A;  2GZZ A;  4QQ7 A;  2V1M A;  2VUP A;  1AW9 A;  3HVV A;  3M9J A;  2IMF A;  3TKS A;  3WT2 A;  3ME8 A;  2R3X A;  3R3E A;  1PX6 A;  4FYB A;  4O7H A;  2REM A;  3GH6 A;  2H71 A;  4LL1 B;  4KDU A;  1B48 A;  4YAV A;  3DIE A;  4MJA A;  4G9H A;  3QAV A;  4OCE A;  1TKD B;  3TOU A;  3GL5 A;  3FZ4 A;  4YKF A;  3M9K A;  4IQ1 A;  1XZO A;  1BYE A;  1GSY A;  4G19 A;  5G5F A;  1ON4 A;  4GRF A;  1XWA A;  3RPP A;  2XBI A;  4PUA A;  3ZZX A;  4MPF A;  1NM3 A;  2GS3 A;  2HZE A;  3H93 A;  1G7O A;  1JZD A;  4FO5 A;  2K18 A;  4JZQ A;  3Q6O A;  2N5B A;  3VPT A;  5LCZ A;  2NVL A;  4HU9 A;  3U6V A;  1F37 A;  1YF0 A;  4Z2U A;  2L4Q A;  2K8V A;  1OKD A;  4HEA 2;  2R37 A;  3LYP A;  1J0F A;  4X1U A;  3L78 A;  3HD5 A;  2RUF A;  2GTU A;  4MZC A;  3JCM L;  1GP1 A;  2P31 A;  2V32 A;  3M3M A;  4J2F A;  3TRX A;  1ERU A;  4EDZ A;  4NXI A;  4L5O A;  4BL7 A;  1XVW A;  2X49 A;  2H6Y A;  5IOW A;  3CSH A;  3CSI A;  3D0Z A;  4LL4 B;  5COH A;  1ZCP A;  2LNS A;  4IBP A;  4K2D A;  4WF4 A;  2JAD A;  1X9S B;  3TKS C;  3F9U A;  4MA9 A;  4WKW A;  3FYG A;  3H8Q A;  2VL9 A;  2KUC A;  1FW1 A;  4PNG A;  4XS4 B;  5ABR A;  4MF6 A;  4MMM A;  4RI7 A;  3RAZ A;  4KA0 A;  1LU4 A;  5KOW A;  2R5G A;  1YY7 A;  2E2M A;  1FB0 A;  1USB A;  2H73 A;  4ECI A;  2ALB A;  6GST A;  4O5R A;  4L5L A;  3MDK A;  1S3D A;  3VUR A;  4KND A;  3KMO A;  1AIU A;  4P3Y B;  4V2M A;  3CYN A;  1GTU A;  2YJH A;  4HI7 A;  2PMT A;  4OFT A;  2L59 A;  2QA1 A;  4KGI A;  5HR3 A;  2B5Y A;  3GFK A;  3EMX A;  1XWK A;  1GLP A;  1U3A A;  1Z5Y E;  1H4O A;  2WJU A;  5ELG A;  4WBR D;  4V1A p;  2H19 A;  5EVO A;  2QA2 A;  5IMZ A;  2JAC A;  3G9B A;  5HFG A;  5JWQ B;  4TXO A;  2OJL A;  3QR6 A;  4K1F A;  4GQF A;  3O76 A;  1AXD A;  3HZ8 A;  4MPG A;  2HRF A;  5G30 A;  4KSM A;  4IQA A;  3IBH A;  2CZ2 A;  3UL3 A;  2C3T A;  3VI5 A;  3WYW A;  2ON5 A;  4IKH A;  4MCU A;  1Z7R A;  5JCW A;  3QAW A;  1Y6E A;  2A2R A;  5D9X A;  2WDU A;  5GSS A;  2DMM A;  4MAB A;  4ICY A;  2FNO A;  2TRC P;  3PGT A;  2H0H A;  1NSW A;  2A2P A;  1X5D A;  2J23 A;  3LWA A;  4WBJ A;  4EO3 A;  4ECC A;  3ERG A;  1M2D A;  3TB2 A;  4V2N A;  5EL8 A;  5IPG A;  2B7K A;  1PGT A;  4PQH A;  2TIR A;  1X0R A;  3KIJ A;  2CX3 A;  4EF0 A;  3FK8 A;  3RPN A;  2OA7 A;  2YAN A;  2FUG 2;  2BJX A;  3KH9 A;  4NHW A;  5FHI A;  4ML6 A;  1X5E A;  2I9H A;  1G6W A;  1T00 A;  1J08 A;  4PUF C;  1UC7 A;  2VCW A;  4YAP A;  4O5U A;  5J4U A;  3H4K A;  2CVB A;  5AIV A;  4N11 A;  2LUS A;  5ECM B;  3WT1 A;  1WWJ A;  3FY7 A;  3UBL A;  2ZNM A;  2OBK A;  2GGT A;  2DC5 A;  1O73 A;  2J9H A;  2CVK A;  4E8H A;  3MNG A;  4K5S A;  3I43 A;  1TTZ A;  2AYT A;  2H75 A;  4ISD A;  1HNC A;  1R26 A;  5IMC A;  4EVM A;  3GTU A;  3GYK A;  3DVW A;  3DEX A;  3TUE A;  4O5Q A;  2YCD A;  4JR4 A;  2B3S A;  2DSA A;  4F82 A;  1JZW A;  1SYX A;  2AUV A;  1K3O A;  4GWR A;  3DKS A;  4POL A;  2A4H A;  1RK4 A;  2X8C A;  1ILO A;  5ECN B;  4EE0 A;  5F0G A;  1CQG A;  1PMT A;  2HNL A;  1N8J A;  3WGE A;  3RHB A;  1A2M A;  3N5O A;  2GSR A;  2JU5 A;  2WUL A;  1OE7 A;  1YJ6 A;  3U5R E;  3EUR A;  4KCE A;  4WF5 A;  2A2S A;  1M2B A;  2I3Y A;  4IEL A;  3V1W A;  4OFM A;  5CP1 A;  4F0C A;  1THX A;  4OFN A;  2HFD A;  1U6T A;  2DJ3 A;  4LMV A;  2I4A A;  3VWX A;  2AB6 A;  4GTU A;  3I69 A;  4ZBB A;  4ZL7 A;  1XWC A;  1SKW B;  3ZTL A;  4K6X A;  2CQ9 A;  2HRA A;  3VWV A;  1QFN A;  5CAX A;  5G1K A;  2GQM A;  3W6G A;  2GLR A;  1JZO A;  1T7P B;  3GKX A;  1ERT A;  2L5O A;  2VIM A;  1GUL A;  4LA1 A;  4TR4 A;  1T8E B;  2DIZ A;  4IP1 A;  1HD2 A;  3A2W A;  3F4S A;  4EUY A;  1TRS A;  3M1G A;  5J41 A;  1NW2 A;  4Q5F A;  1RQM A;  4JU5 A;  4YQM A;  5DQS A;  2QGV A;  4TR0 A;  3D4M A;  2H1B A;  1OYJ A;  3H1N A;  4F0B A;  4D73 B;  1M9A A;  4K8M A;  2H76 A;  1GL8 A;  4ZB8 A;  3DD3 A;  2C3N A;  2FHE A;  2V2G A;  2P0G A;  5DAL A;  2K9F A;  4GXZ A;  3KXO A;  2LV3 A;  2XBQ A;  5DAK A;  2L4C A;  4FIW A;  2LQO A;  1SL1 B;  4POM A;  4YH2 A;  1GSU A;  4POK A;  2IIY A;  4TR1 A;  1PD2 1;  2PPT A;  3GV1 A;  4ML1 A;  1W89 A;  4IP6 A;  5FWG A;  3ZRD A;  4F03 A;  1GTI A;  3S9F A;  2VCX A;  1U3I A;  3C73 A;  2MYG A;  1DBY A;  5KEJ A;  1MDK A;  2HZE B;  2VM1 A;  4JRR A;  2CA8 A;  1OKT A;  3M0F A;  4O92 A;  4RQX A;  3Q19 A;  4L0W A;  1BX9 A;  2H72 A;  2GZP A;  2WGR A;  4ZB6 A;  3HYP A;  2X64 A;  4H86 A;  2MMN A;  4OCF A;  1WMJ A;  2NTO A;  3ZVJ A;  1DSB A;  5D8I A;  2K8S A;  1ZMA A;  2IWT A;  4KX4 A;  3CSJ A;  5BMU A;  2N5A A;  4ZB9 A;  4YKG A;  4KDY A;  5J9B A;  1M99 A;  1N2A A;  2VL3 A;  5IMA A;  4MNN A;  2H6Z A;  5DJL A;  3TGZ A;  4NAX A;  4X4J A;  2HYX A;  2NDO A;  2QC7 A;  5IM9 A;  4IJI A;  3DML A;  4ACS A;  2H01 A;  1R5P A;  3MIX A;  1B4P A;  4BWQ A;  2DIY A;  1E2Y A;  4I8B A;  1G7E A;  4BL7 B;  4ECJ A;  2O85 A;  1FOH A;  3QAG A;  1A23 A;  4RQR A;  3BBY A;  6GSS A;  2V41 A;  1F9M A;  2YZU A;  3DRN A;  1V58 A;  3FRC A;  3UVT A;  4MJE A;  2B5X A;  2GST A;  2OE1 A;  4GLT A;  2VLU A;  2YP6 A;  5AIS A;  5HR2 A;  1XIY A;  5ECR B;  5B6N A;  4IVF A;  1TK5 B;  3C8E A;  1QQ2 A;  4RUV A;  5CO3 A;  1R7H A;  3KMN A;  4GSN A;  5E59 A;  1HQO A;  4EL1 A;  3L9V A;  2GT5 A;  3IHQ A;  5EPF A;  2R2J A;  1F2E A;  1F6M C;  1XW5 A;  2WZ9 A;  1ST9 A;  2H0G A;  1SL2 B;  1VF2 A;  4BVY A;  4MLY A;  4TXV A;  1XCC A;  3HZ4 A;  3P7X A;  5J3R A;  5LD0 A;  4BPY A;  1H75 A;  1SYR A;  2I1U A;  1SK1 A;  3QFB C;  5G2Z A;  2BTO T;  1FVJ A;  2GT6 A;  3UAR A;  2OE3 A;  4ID0 A;  4NWY A;  3BJ5 A;  1S3A A;  2ES7 A;  1ZYN A;  2XC2 A;  4OO4 A;  5IO0 A;  4IHU A;  4V2L A;  4TXO B;  4FYC A;  3LW9 A;  1TJD A;  2P5R A;  3OR5 A;  4I97 A;  1SU9 A;  1IYH A;  2HRK A;  3TJF A;  1E6B A;  1QGV A;  5IMD A;  3EMP A;  5B8B A;  4I2U A;  1X9W B;  2GSS A;  1PRX A;  3DGQ A;  2ZUP A;  2IMK A;  4HZ2 A;  3GH9 A;  4TOP A;  2PVO C;  6GSY A;  4USS A;  2OAD A;  1K3L A;  1G0T A;  4HS1 A;  4OWY A;  2IFQ A;  4DSR A;  5CRH A;  2HSY A;  2FWF A;  4I2T A;  3FEU A;  6GSV A;  1SL0 B;  2YV7 A;  4X0X A;  5CRD A;  2HSM A;  2F51 A;  3UIW A;  1LBK A;  4ZL8 A;  3G7J A;  3LFL A;  1YKA A;  2H1D A;  2VD1 A;  2DJ0 A;  5CYY A;  2VAF A;  1TK8 B;  2MMA A;  4AJ8 A;  1K0M A;  3HDC A;  2WFC A;  4WET A;  3EC3 A;  2C4J A;  4MF7 A;  5IO2 A;  5GZZ B;  3LEF A;  3UJ1 A;  2X8G A;  3VK9 A;  4LMW A;  1ZL9 A;  1FHE A;  1MDJ A;  5B7C A;  1VGL A;  2D2Z A;  2E0Q A;  4IW9 A;  2PU9 C;  1PKW A;  1ABA A;  3ERF A;  1GSF A;  1B4Q A;  4FYU A;  4AGS A;  2FCH A;  5CRE A;  5G31 A;  4BWS A;  1B8X A;  1SK2 A;  1XWG A;  3UVH A;  2WB9 A;  5A4U A;  1SEN A;  3FKF A;  4PNF A;  4KW6 A;  3CRT A;  4KSO A;  4JR6 A;  5D96 A;  1BED A;  2LJA A;  1MTC A;  2FD3 A;  2WS2 A;  1PL2 A;  2KLX A;  3F3R A;  1XXU A;  2B6M A;  1XW6 A;  3GTU B;  2VD0 A;  3TJG A;  1JLV A;  3D4T A;  5JWR B;  1KEB A;  4XCS A;  1SK0 A;  2H30 A;  4XIH A;  5DVB A;  3RBT A;  3WD6 A;  2Z9S A;  3WGD A;  5GST A;  1X9M B;  4K9Z A;  2GVP A;  3EPT A;  1MD4 A;  3TJJ A;  2G2Q A;  3ERW A;  2HRN A;  3SWL A;  1UVZ A;  3VPQ A;  1NHY A;  4EC0 A;  2L5L A;  1PX7 A;  4HOJ A;  5GAP D;  3QFA C;  4G2E A;  5DBQ A;  3ISO A;  3LG6 A;  3GKM A;  1JHB A;  5B6M A;  1T4Z A;  2YNX A;  1YQ1 A;  1XBS A;  3FZA A;  4EXJ A;  5J9C A;  2LEG A;  4DEJ A;  2F3M A;  4ULX A;  2V6K A;  4J57 E;  1XFL A;  1RW1 A;  1YDK A;  4ILF A;  1LJR A;  4Z2R A;  3GST A;  2VLV A;  3TJK A;  2H1G A;  4ZBD A;  2VOC A;  3GKK A;  1QXH A;  1ERV A;  3HY2 A;  3TKQ A;  1V2A A;  4K0N A;  2XHF A;  1EP8 A;  4EIP A;  2C0F A;  3TKS E;  3ME7 A;  4PXO A;  1OC9 A;  3ZFB A;  4KE3 A;  4GST A;  3ZL5 A;  2LTK A;  1KNG A;  5ECP B;  4RI6 A;  3EWL A;  1V98 A;  3IOS A;  1Z6M A;  2DJJ A;  4F2I A;  5DAL B;  17GS A;  4MK3 A;  1YEX A;  1S3C A;  1EOH A;  1WIK A;  2CAQ A;  3IV4 A;  5DAK B;  2R0C A;  3HCZ A;  3IC8 A;  5A4W A;  5KN3 A;  5HR0 A;  1TRU A;  3IA1 A;  4CY6 A;  2RUE A;  1OE8 A;  3C7M A;  4TR1 B;  2NPB A;  1PL1 A;  6GSX A;  3LXZ A;  3FMW A;  4WR5 A;  5INY A;  3GMF A;  1VRS D;  2AHE A;  2GZY A;  1GSD A;  1GUM A;  2CVD A;  3IK7 A;  1ZGN A;  3GX8 A;  2XPD A;  1TU7 A;  2HZF A;  10GS A;  1ACV A;  1AAZ A;  4MP4 A;  2H74 A;  2ON7 A;  5C04 A;  2FA4 A;  2R4V A;  4I5Q A;  3KD0 A;  3LXT A;  2C1Y A;  1Z3E A;  1WE0 A;  5JWO B;  1GTA A;  1G6Y A;  3TOT A;  3VI7 A;  4XHM A;  3FW2 A;  2E2G A;  4KCA A;  2C0D A;  3PH9 A;  1VF3 A;  3UAP A;  3HJP A;  5IIZ A;  1EEM A;  1AQV A;  2M72 A;  2EIO A;  3F4R A;  1HNB A;  3F8U A;  1GUK A;  1K0B A;  4XS6 A;  4A5P A;  2AJQ B;  5CNW A;  2O7K A;  1DUG A;  2LRC A;  2PUK C;  3NZN A;  4N30 A;  3VFI A;  2B5E A;  1V57 A;  2M46 A;  4IGJ A;  4F9Z A;  5DDL A;  2IJY A;  4L8E A;  3D21 A;  2R0G A;  1BG5 A;  4K2X A;  11GS A;  4MJB A;  3BCK A;  3ZYW A;  20GS A;  3ZFL A;  3A3T A;  3EU4 A;  1JLW A;  1FAA A;  2H70 A;  2YWO A;  5GAN D;  5ECH B;  2IPA A;  2X8H A;  4OD7 A;  4BVY B;  5IQY A;  5D9W A;  3LOR A;  3APS A;  3N9J A;  1ZYE A;  4TW5 A;  2GQL A;  4NV2 A;  1FOV A;  1TDI A;  2VCV A;  3D6I A;  4PTS A;  5HFI A;  1YEP A;  4NMU A;  4KDX A;  1HNA A;  4N0Z A;  3HVX A;  5DQY A;  1TOF A;  1A0R P;  4EDY A;  1PN0 A;  2CX4 A;  5EY6 A;  1U87 A;  3D22 A;  2JL4 A;  3MYD A;  1QUW A;  4DVC A;  1FVK A;  2L6C A;  5ECS A;  3KJY A;  4V1A g;  1I9D A;  5H5Q A;  3O6T A;  3R2Q A;  3WGX A;  1GH2 A;  3UOM A;  4KB3 A;  2OKA A;  1MEK A;  5HQP A;  3L0H A;  2V6O A;  1SD8 A;  1K0A A;  4GF0 A;  1TRV A;  2IFQ B;  1O8W A;  3L9U A;  1SJI A;  5G1L A;  2LJK A;  3KEB A;  2L57 A;  2RM5 A;  2XPE A;  5ECI B;  5DJM A;  2IMD A;  2R0P A;  2VL2 A;  4IJ3 A;  5ENU A;  7GSS A;  1BJX A;  4TVE A;  4OMV A;  1EZK A;  1O85 A;  2VCQ A;  1ML6 A;  2YWI A;  1WP0 A;  2N5F A;  3GHA A;  3UEM A;  3L4N A;  1O7U A;  1XVQ A;  4AJ7 A;  1PQN A;  2FY6 A;  3LJR A;  2VCZ A;  3P2A A;  3LQ7 A;  1T1V A;  1K3Y A;  5KN1 A;  4YQV A;  1GSQ A;  1SKS B;  1GSS A;  5B8A A;  2G0F A;  4BA7 A;  1A8Y A;  2YJ7 A;  2O8V B;  2YOI A;  2OE0 A;  5IOX A;  3CXG A;  5F8B A;  22GS A;  1WPI A;  4G0L A;  4KAE A;  4HZ4 A;  5IMF A;  2BMX A;  4E8E A;  1THO A;  4TKY A;  5A5K A;  3IPZ A;  9GSS A;  1EGO A;  3DVX A;  5CRW A;  4JED A;  5DCH A;  2DML A;  2F8A A;  1SJ6 A;  4WXT A;  3E3E A;  2CT6 A;  2JSZ A;  2FWE A;  3A5W A;  2EIQ A;  1JFU A;  1TP9 A;  2PWJ A;  3CBU A;  3BD2 A;  2F9S A;  3CTG A;  1GTB A;  1TI3 A;  3TCO A;  2HE3 A;  1DE2 A;  1IYI A;  4XTS A;  1EOG A;  3VWU A;  2DJK A;  1K0D A;  4ECB A;  5ID2 A;  1AQX A;  2VL2 C;  2HI7 A;  3BCI A;  1O6J A;  2IME A;  2LST A;  1YKC A;  3HHV A;  1SKR B;  18GS A;  3A2X A;  1F3A A;  3IK9 A;  5JCU A;  2KHP A;  1WJK A;  4ZXG A;  4DSS A;  4TN8 A;  2VO4 A;  4PQ1 A;  4WEY A;  5KN2 A;  1YF1 A;  3TDG A;  2YN1 A;  1A24 A;  3FZ5 A;  4PX1 A;  3HJM A;  1TI1 A;  3TKR A;  4EIQ A;  3FR9 A;  3G7I A;  4EKZ A;  4K5R A;  2L6D A;  5D93 A;  2DLX A;  3F6D A;  4K7N A;  5FT3 A;  16GS A;  3F0I A;  4MF5 A;  2P5Q A;  5CRG A;  3F4T A;  2B1L A;  1Y25 A;  2EC4 A;  2QKE A;  2YWN A;  1I5G A;  1URM A;  1OC8 A;  1OVN A;  1TU8 A;  3FR6 A;  3APO A;  1OC9 B;  3CTF A;  5JCG A;  1PSQ A;  2JZS A;  2IL3 A;  2R6K A;  3EU3 A;  2HXK A;  1HYU A;  3HKR A;  1W4V A;  1XOB A;  1F3B A;  2K6V A;  3AY8 A;  3IDV A;  2YV9 A;  4IN0 A;  3E9J B;  5KOX A;  5D73 A;  1OC3 A;  3ZML A;  3A5I A;  1T4Y A;  3G7Y A;  4AJ6 A;  2FWG A;  2A4V A;  6GSU A;  1NHO A;  6GSW A;  3KGK A;  3DXB A;  2H8L A;  4N0V A;  1M2A A;  3J7Y k;  4XRD A;  3ZLP A;  1K0N A;  3FHK A;  3QOU A;  2I81 A;  2B1K A;  4Z2T A;  3GKN A;  1GWC A;  2YZH A;  2AAW A;  14GS A;  2MBT A;  4HJM A;  1O81 A;  3CMI A;  4DSQ A;  3KH7 A;  4I6X A;  2C0G A;  1YZX A;  1FB6 A;  4HJ2 A;  2PBJ A;  4HQZ A;  3GUS A;  3FZ9 A;  2LKU A;  4K0G A;  4CDO A;  1M9B A;  2GQK A;  4MDC A;  3KP8 A;  1R4W A;  3IR4 A;  3QD9 A;  2GSQ A;  1U88 A;  3W8S A;  2MMZ A;  1TXX A;  3PIN A;  2DKH A;  2LQQ A;  5DCG A;  1MDI A;  1CQH A;  4ZBA A;  2C80 A;  3KP9 A;  4NV5 A;  4GSS A;  2DJ1 A;  3D5J A;  2O89 A;  3IE3 A;  1C72 A;  1GRX A;  2CAI A;  4X43 A;  3A2V A;  4TRX A;  2PVQ A;  1A0F A;  2GDR A;  2CZ3 A;  3I6A A;  2MMO A;  2PN8 A;  2RII A;  1FG4 A;  2FLS A;  2MBS A;  2VM2 A;  3TRQ A;  3KM6 A;  4G10 A;  2IMI A;  5G5E A;  2X99 A;  5J5N A;  2LJR A;  2KP1 A;  1FO5 A;  2LRT A;  3DYR A;  2LS5 A;  5L71 A;  2JZT A;  3UMA A;  3GUR A;  4FH8 A;  1GSE A;  4MZB A;  4MZW A;  1Z6N A;  2QSI A;  3F3Q A;  4XS4 A;  4NPB A;  2H66 A;  4NHZ A;  1B9X C;  1QMV A;  3ED3 A;  4ZIL A;  3W8J A;  3APQ A;  4K7O A;  5KN0 A;  3DWV A;  3SBC A;  4FQU A;  2FA8 A;  3HXS A;  3GN3 A;  5ECK B;  3GL3 A;  5D9T A;  5LNK e;  3GNJ A;  4GCI A;  3ZMK A;  1EV4 A;  3EE2 A;  1PKZ A;  2B7J A;  3QPM A;  4Q5R A;  8GSS A;  3QCP A;  2FWH A;  3UBK A;  3C71 A;  5HFK A;  3EVI A;  3ZVJ D;  4AF2 A;  1K0O A;  2F8F A;  5HR1 A;  4IS0 A;  5H5S A;  1WOU A;  4KH7 A;  3K8N A;  1A8L A;  1UN2 A;  1AUC A;  3PPU A;  3ZRE A;  3KTB A;  2O87 A;  1A2J A;  2KOK A;  3GA4 A;  2YPM A;  2UZ8 A;  4N10 A;  2JZR A;  1ZYQ B;  3ZIT A;  1GNE A;  1UA5 A;  3MSZ A;  3CRU A;  3O3T A;  4MH3 A;  3E0U A;  3F6F A;  2LNT A;  2H1A A;  3TKP A;  1M0U A;  5ECQ B;  3Q74 A;  1X5C A;  2X4A A;  2H0I A;  1GUH A;  5F06 A;  4Q5Q A;  1K0C A;  4KF9 A;  4CY8 A;  1VF1 A;  4MH2 A;  3RDW A;  4MJC A;  4HDE A;  4CW9 A;  3HVS A;  3KZQ A;  2AV4 A;  3C1S A;  3GSS A;  3IC4 A;  2MZC A;  3P90 A;  4G0K A;  1KBN A;  4LLR A;  3NOF A;  3Q18 A;  1VF4 A;  1GNW A;  3C1R A;  4PGT A;  2E7P A;  3GRX A;  3IXR A;  3PR8 A;  2RLI A;  3RHC A;  2WCI A;  1OAZ A;  5AIX A;  4PQI A;  1EP7 A;  1XOA A;  3TJB A;  1JZR A;  3EIN A;  4BVX B;  1V40 A;  5H5R A;  3L9S A;  1B9Y C;  4YQU A;  2DJ2 A;  3P8W A;  4JBB A;  3BOA A;  3ZIJ A;  1V9W A;  4QL9 A;  1DE1 A;  1EGR A;  3M8N A;  5A4V A;  4ZIJ A;  2VLT A;  3IRA A;  2ZCT A;  1ERW A;  1T3B A;  3TRP A;  2EIR A;  2DKI A;  4HUA A;  1EV9 A;  5AGY A;  4O32 A;  4QL7 A;  3QDN A;  1AQW A;  2FGX A;  1TRW A;  2C3Q A;  4WR4 A;  1GLQ A;  1XW9 A;  5C00 A;  4HQS A;  2PER A;  3IAS 2;  3IAM 2;  2NBS A;  4JE1 A;  4XRA A;  3HA9 A;  1AC1 A;  5ID2 B;  12GS A;  19GS A;  4POB A;  4PUR A;  4GQC A;  5ELA A;  1PA3 A;  1Z7P A;  1Q4J A;  5ECL B;  3F63 A;  2CV4 A;  2OAC A;  1MD3 A;  1ZZY A;  3LYK A;  1XPV A;  4HU7 A;  3KCM A;  3I9V 2;  5IPH A;  1XWB A;  2WRT A;  3VLN A;  3VWW A;  4Z7X A;  1BQ7 A;  5AN1 A;  1SD9 A;  2C8U A;  3IHG A;  4XS1 A;  4DSS B;  5E4W A;  4OO5 A;  13GS A;  1A2L A;  1M7T A;  4K7I A;  1R5A A;  5F05 A;  4CHS A;  3US3 A;  3GIX A;  3MWH A;  2YWM A;  5D9V A;  1BAY A;  2RM6 A;  1Q98 A;  1EWX A;  1KTE A;  1J9B A;  5ECO B;  2TRX A;  1TK0 B;  3NIV A;  3ZIV A;  4TR3 A;  5F07 A;  4G0I A;  3KTL A;  3J7Y b;  4J56 E;  2PGT A;  1SJZ A;  1WRY A;  1QK8 A;  3QMX A;  5BRT A;  1TW9 A;  2C0E A;  4KUN A;  1O8X A;  4L0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...