3APSA

Crystal structure of trx4 domain of erdj5
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
114
structure length
114
Chain Sequence
PQASIDLTPQTFNEKVLQGKTHWVVDFYAPWCGPCQNFAPEFELLARMIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEQINSRDAKTIAALIYGKLETL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DnaJ homolog subfamily C member 10
publication title Structural basis of an ERAD pathway mediated by the ER-resident protein disulfide reductase ERdj5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 35
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apsA00
3C73A 8GSSA 2FA8A 4XS4A 1K0DA 1SL2B 5DCHA 5A4VA 2ZNMA 1EP7A 4MJAA 1F37A 4HUAA 1BX9A 1S3CA 3VWVA 2VLVA 4JRRA 3IRAA 3F63A 5G5FA 3CBUA 1BYEA 1ZOFA 2LV3A 2L5LA 2C0FA 3LGCA 3FZ9A 3TRPA 3FZ4A 4LMWA 3TKPA 4TKYA 1VGLA 2DJJA 4TOPA 4QQ7A 4L0UA 2N5AA 3APQA 5ECLB 2N5FA 1TDIA 2E0QA 3TOUA 1FHEA 2E2GA 3KH9A 1YEPA 2OJLA 2QSIA 4MJEA 1THOA 5CP1A 2Z9SA 3D0ZA 3M8NA 4EXJA 4CHSA 3TDGA 1OE7A 2KOKA 4YH2A 1AQVA 1J08A 3HCZA 3P8WA 4HOJA 3D4MA 4HJMA 3W8SA 5HR3A 4JE1A 4AJ6A 2C80A 5JWOB 4HS1A 1R7HA 1GTAA 3KP8A 1SD8A 3GUSA 3I9V2 3L78A 2LJKA 1PX7A 3KZQA 1ERVA 4Q5QA 1B8XA 1T00A 2H6ZA 4Q5NA 2YWNA 4D73A 3GH6A 1B4QA 4L5OA 2VUPA 5DBQA 2FNOA 1G0TA 4AGSA 2IL3A 3KMNA 2CT6A 3ZMLA 2LEGA 1U88A 4MABA 1T4ZA 1M2BA 3V1WA 3IOSA 3ZZXA 2GT6A 1XWBA 3FR9A 2I3YA 4RQXA 2IMIA 1ML6A 1ERUA 1XWAA 2VLUA 3FY7A 1O7UA 1GULA 1K3OA 1KBNA 1LU4A 2R2JA 1JZDA 1OC8A 4WR4A 3ZL5A 3TJFA 3M0FA 3P2AA 5HFIA 3NZNA 3GA4A 4K6XA 5CRGA 2F8FA 5DALB 4HU9A 1Z9HA 2GVPA 4ZIJA 2GLRA 3CXGA 3HA9A 2WCIA 2FD3A 4XCSA 5DQSA 3CYNA 1VF3A 2HRNA 1XZOA 3SWLA 2F9SA 1K0AA 3SBCA 2PVOC 2LRNA 4V1Ap 1X9WB 4KCEA 1A0FA 3DXBA 3TKSE 3RPNA 2IMKA 3GYKA 4I97A 1UC7A 4MJBA 1BJXA 4FH8A 4MCUA 2L5OA 3KD0A 5D9TA 1O6JA 1W89A 3CRUA 1TP9A 4IVFA 3HXSA 5FT3A 2XPEA 5CRDA 14GSA 4O32A 2FUG2 1O8WA 5DJLA 3VWUA 2ZUPA 1V58A 2L57A 3ZREA 2AB6A 5JWRB 1XXUA 3F4RA 3IAS2 1TXXA 5H5SA 2PERA 1DE2A 3GNJA 2NDOA 3APSA 4HZ2A 5B6NA 3F6DA 1YDKA 1GSQA 4WF5A 1TK8B 2HZEA 5DQYA 1FB6A 2JZTA 2VLTA 18GSA 1F9MA 2MBSA 1V40A 3FZAA 4IGJA 1EGOA 3MDKA 5EY6A 4XS1A 3HJMA 1WOUA 5LD0A 4GWRA 5DVBA 2PWJA 1X5EA 2X64A 4PUAA 1UN2A 5KN2A 3QAWA 4WBJA 3ERFA 3HVVA 4ECIA 4PXOA 2R5GA 4K2DA 5IMVA 1Y25A 4FYUA 9GSSA 1A2JA 4OD7A 5CRHA 4NHWA 5GSTA 1GLPA 2YWIA 2B1KA 1HQOA 3JCML 5D93A 4KSMA 4MLYA 1S3AA 3GKMA 4PNGA 1TI1A 1ACVA 1KTEA 4YAVA 3UVHA 3GKXA 3HZ8A 1WWJA 4LA1A 1QFNA 4DSSA 1XWKA 4NPBA 2A2RA 5G2ZA 1YEXA 2K6VA 3F8UA 1ZZYA 1UVZA 2LQQA 1FOVA 4LLRA 4V1Ag 3F4TA 2HZEB 1OC9A 3KCMA 4MZBA 4G9HA 2G2QA 3QAGA 2JACA 2C0DA 2H1GA 4N0ZA 4EC0A 2FA4A 4YQMA 2FY6A 5JWQB 3M9KA 4WEYA 5DCGA 5J9BA 1XOAA 3KM6A 1TRWA 3UIWA 2TRXA 3J7Yk 3QD9A 1YF0A 3FEUA 4QL9A 5ECNB 5HFKA 2VD0A 5KN1A 3LXZA 3DVXA 5IMDA 4IP6A 4WF4A 4YAPA 5E59A 2HRFA 2JU5A 4NV2A 2K8SA 2HYXA 2V41A 2JSZA 3KXOA 1TKDB 2FWHA 3GSTA 2IMEA 3UOMA 5GAPD 5ECSA 1WP0A 4HU7A 4K0GA 16GSA 1TRVA 1XVQA 1I9DA 1ST9A 2FWGA 4DSSB 2DBCA 3QDNA 2LKUA 3L9UA 4JBBA 2R37A 4ZXGA 2LNTA 4IQ1A 3F3QA 1GSSA 3ZVJD 4JZQA 2IWTA 5D96A 4BL7A 3GMFA 2WULA 6GSSA 2IMDA 3TKSC 3TRXA 4K7NA 3BJ5A 3FW2A 2XPDA 3RHBA 4F0BA 1A0RP 1OKDA 1WPIA 3HYPA 4JEDA 3LORA 4KSOA 3RAZA 1YY7A 3TJKA 3VURA 4IN0A 5ECRB 2PN8A 4DSQA 3W6GA 4GQCA 1IYIA 1SYXA 1GSEA 2R6KA 3FR6A 3IXRA 3CRTA 2H1BA 2BTOT 4TRXA 3WGXA 3GTUA 5ECKB 3QR6A 2CAQA 2I81A 2YNXA 5CAXA 1THXA 4PNFA 2WFCA 3ED3A 4MPGA 4F2IA 2L4CA 3WT1A 2K8VA 3RDWA 4I8BA 2I4AA 3FK8A 1ERWA 2B5EA 4ZL9A 3O76A 1OVNA 2VCTA 2PU9C 2AAWA 4L8EA 1J0FA 4I5QA 2DJ3A 5L71A 3PINA 4YQUA 3G7YA 4GLTA 4TR1A 2GS3A 1HNCA 4TR0A 4GF0A 2B6MA 4OO4A 1USBA 1VF2A 2GSTA 1PRXA 1B9YC 1XPVA 2F8AA 1PQNA 3WYWA 2V2GA 2OA7A 5H5RA 3E9JB 4H86A 1R5PA 4WETA 4MMMA 3HY2A 4OCFA 1WMJA 3EC3A 4RI7A 4TN8A 4GCIA 4MZWA 2DJ2A 2XBIA 4V2LA 2O87A 4DVCA 2K9FA 5A4WA 3GTUB 2LSTA 1ZCPA 4CDOA 1FVKA 1K0BA 1DBYA 3FRCA 5F0GA 1Z6NA 3FKFA 2OE3A 4KCAA 2MBTA 3F6FA 1ZL9A 3IBHA 4RI6A 4DEJA 4POKA 2L6CA 10GSA 1XCCA 2CX4A 5ENUA 4F0CA 1VRSD 2VCQA 4QL7A 2LJAA 5D8IA 1SL1B 2XC2A 2VL2A 4POLA 3TGZA 1R5AA 4G19A 4EE0A 5ID2A 4X0XA 2KP1A 4MK3A 4EL1A 3GFKA 6GSYA 2XBQA 3F4SA 5IQYA 4BWQA 4XS6A 1ZMAA 1SKRB 2PUKC 4KH7A 1UA5A 3H1NA 1ZYEA 3E0UA 6GSVA 2V32A 2PBJA 3TKRA 1WJKA 3S9FA 2VCWA 1TK5B 5B8AA 1XIYA 3QMXA 2QKEA 2DJ0A 1PN9A 2YZUA 3HZ4A 4LL1B 1SU9A 1PL2A 1QQ2A 2GQMA 1FB0A 2F3MA 1GP1A 2OACA 3W8JA 1X5CA 4GTUA 3H4KA 2IMFA 1SK0A 3F3RA 4HQSA 4XS4B 4IJ3A 1YJ6A 4IP1A 3FHKA 3I69A 4BPYA 2M80A 1GLQA 2REMA 5JCUA 3GV1A 3GSSA 4KB3A 1BEDA 4GSSA 3EU4A 5A4UA 3QFAC 4EO3A 3EINA 3IV4A 1FG4A 2OBKA 3TJJA 5J41A 1XW6A 2B3SA 3DIEA 2LS5A 2LQOA 1K0NA 1BQ7A 3ZFLA 1A2MA 5B7CA 1EV9A 1AXDA 2RM6A 4LL4B 2GDRA 2H0IA 1G6YA 1QUWA 1HYUA 2HXKA 1EZKA 1GTUA 3G7IA 3A2WA 5CYYA 5IPGA 1A24A 5CNWA 5AIXA 3ISOA 4E8EA 5J4UA 3TUEA 2V6OA 5AIVA 1V2AA 2GT5A 2C0GA 3WD6A 1URMA 3C1SA 2H66A 3ZIVA 4K9ZA 3ME8A 2VL3A 1MDKA 2C3QA 5DAKA 5AISA 3ERWA 4F9ZA 1GRXA 1EGRA 4KDXA 5INYA 1M9BA 2KUCA 4XRAA 5G1LA 4J57E 4NHZA 4EUYA 5B6MA 5F06A 3D22A 3VI7A 4D73B 2GZYA 4ECJA 3OR5A 3VPTA 2FWEA 3KIJA 3IK7A 3C1RA 2YANA 4BVXA 1GUKA 1KNGA 2JL4A 5IM9A 3NOFA 2FWFA 3R2QA 2H75A 5ABRA 1TI3A 3H93A 4ZB6A 2HLSA 3VK9A 4WR5A 2FCHA 3C8EA 1RW1A 4PQIA 1SK2A 2YJHA 3UBLA 2P31A 3Q18A 1MD3A 4K7OA 1QGVA 5D9XA 1F2EA 2M46A 3QPMA 4F82A 2QGVA 2MMNA 1O8XA 1V98A 2V1MA 4BA7A 3CTGA 3H79A 1GWCA 1U3IA 3LYKA 1Y6EA 3CSIA 3EE2A 3HDCA 2OADA 1PKWA 3U6VA 1JHBA 3Q19A 5IPHA 1FVJA 1OC3A 3G9BA 2VM1A 1SENA 4AJ7A 1T7PB 2HI7A 5HR1A 20GSA 4TR3A 3D6IA 5GSSA 2J9HA 2CZ2A 6GSXA 4DSRA 4XTSA 5ECIB 5LCZA 4OMVA 5IMFA 1MDJA 2H6YA 3UARA 4NWYA 2VAFA 5F8BA 2RUEA 3O3TA 4YQVA 3DRNA 4ZILA 1XW5A 5KN0A 1AUCA 2O7KA 1EWXA 3GKKA 4HDEA 4XIHA 2D2ZA 1K0CA 2ZCTA 2PVQA 3D4TA 1YKAA 2PPTA 4J56E 2C3NA 2KHPA 4POMA 4ACSA 2MYGA 5J9CA 3K8NA 1X0RA 2DMMA 3DD3A 3H8QA 2H6XA 3HKRA 2L59A 3IK9A 3EYTA 1PSQA 5HQPA 2VL9A 2H70A 4MF6A 2H74A 3LFLA 5HR2A 1SYRA 2CVKA 2AYTA 2F51A 2WGRA 1HNBA 3I6AA 1KEBA 3PR8A 3GURA 1XW9A 2MMAA 4N0VA 1A8YA 2CQ9A 5JCWA 3UL3A 2LNSA 3WT2A 3ZLPA 1M99A 1S3DA 2P5QA 4X1UA 3DGQA 1AIUA 3I43A 1PX6A 2P5RA 3PH9A 4FIWA 3TCOA 4ZB8A 3QOUA 1M2DA 1A23A 3BBYA 1SJ6A 4F03A 3HJOA 4XRDA 1AQXA 3KTLA 3L9SA 1CQHA 1K0OA 2C8UA 4EDZA 2WS2A 1OC9B 2X8HA 2RLIA 5ECHB 2L4QA 2GQKA 4MH2A 2BJXA 4Z7XA 2K18A 1NM3A 3UEMA 2EIOA 4N11A 3RPPA 5FHIA 4TXOA 1YKCA 5ELGA 1NW2A 2WRTA 4ZBAA 3TJGA 3F0IA 3KEBA 3WGEA 2ALBA 1JZRA 2CV4A 1O81A 3ERGA 2CVBA 4IBPA 1QK8A 2J23A 1GL8A 5GAND 3M1GA 2OKAA 2NBSA 3J7Yb 2B1LA 4IHUA 1FW1A 1GSFA 1E2YA 2TIRA 1O73A 2YWOA 4O5RA 1GSUA 17GSA 3AY8A 5ECMB 4ECCA 4AJ8A 2B5XA 4ZBBA 3KTBA 4TVEA 3P7XA 3EMPA 5KEJA 1V9WA 3CTFA 3VWWA 2R3XA 2C4JA 4Q5FA 2VOCA 1DUGA 2JZRA 1NHYA 3WGDA 4HJ2A 1OAZA 1SL0B 3VWXA 3IHQA 1B9XC 2M72A 4LMVA 2NVLA 1Z7PA 3HVXA 2P0GA 1JZWA 1GH2A 3QCPA 4KGIA 1K3LA 2OE1A 1PL1A 2DJKA 4BVYA 1YF1A 1ABAA 3LSZA 2HNLA 2MZCA 3ZTLA 5IMCA 4MF5A 3QAVA 4MJCA 2GTUA 3F9UA 4V2MA 4KNDA 3VI5A 4K0NA 1VF4A 2C3TA 4O7HA 1Z3EA 1XWGA 2H8LA 4PUFC 2JSYA 4MF7A 4OCEA 2H73A 1RQMA 2ES7A 3O6TA 6GSTA 4J2FA 2KP2A 4NXIA 1GUHA 2DIZA 4FO5A 3LEFA 1WE0A 1A2LA 4TR1B 3UAPA 4GXZA 3RHCA 2YZHA 1XFLA 3BOAA 1V57A 5D9VA 4G2EA 4OFMA 4MDCA 5E4WA 1GUMA 2CZ3A 4PGTA 3M9JA 4I2UA 4IJIA 4K1FA 1N8JA 3IR4A 5C00A 3TRQA 3ME7A 2X8CA 1U87A 3GIXA 2DIYA 2GZZA 4Q5RA 2MMOA 1TRUA 3IAM2 2CA8A 4TXVA 2GSSA 5IO0A 5C04A 3TKQA 12GSA 2HT9A 4IQAA 3D5JA 3QFBC 4PQHA 2H0GA 1QXHA 3GL3A 3ZRDA 4IELA 3TKSA 4KDYA 2YPMA 4JR4A 4E8HA 3ZFBA 2PMTA 4G10A 4IW9A 3GN3A 2HSYA 2LRCA 1ERTA 1K3YA 1DSBA 1HNAA 1X9MB 3RBTA 2DJ1A 5DALA 1PD21 2FHEA 1YZXA 3GH9A 2JZSA 4IKHA 2HSHA 4RQRA 5ID2B 1GSYA 1Q98A 4XHMA 4K7IA 3EMXA 2HFDA 1O85A 1OE8A 3UMAA 2C0EA 1MEKA 1AC1A 3DEXA 3N5OA 1GNEA 3NIVA 4GSTA 5IMZA 4JR6A 4KX4A 2WZ9A 1SK1A 4MZCA 3GKNA 3ZVJA 1G7EA 4EF0A 2AV4A 3C7MA 1PKZA 3CMIA 1EV4A 1SKWB 1TU8A 4N30A 4ZB9A 2VCZA 1MDIA 3DMLA 3LG6A 1T4YA 3EVIA 3IA1A 5B8BA 1XWCA 3MNGA 1JZOA 4P3YB 1GTIA 2AHEA 2XHFA 6GSWA 3ZYWA 5IMAA 2A4VA 1TU7A 3EURA 3GRXA 4GSNA 1A8LA 1FO5A 2ON7A 1CQGA 11GSA 4NMUA 3KMOA 3Q6OA 3HVSA 1F3AA 4KAEA 4X43A 4POBA 1AW9A 4WXTA 2IPAA 3IDVA 2YWMA 5DDLA 2HE3A 1SJZA 1H75A 1TJDA 2H30A 3TOTA 4WBRD 4ID0A 3GL5A 4ZL8A 2GSQA 5A5KA 2NPBA 4MPFA 2CX3A 3L0HA 1W4VA 1NSWA 2RUFA 4KDUA 1X5DA 3A5WA 2B5YA 7GSSA 1AQWA 2IN3A 2FLSA 1Z6MA 2LUSA 3DWVA 2GSRA 1ILOA 4PX1A 1XVWA 1N2AA 5JCGA 2EIQA 1K0MA 4K8MA 2H1DA 1OYJA 1OKTA 2E7PA 3CSHA 2OE0A 4HZ4A 5F05A 1EP8A 5AGYA 1PA3A 1WIKA 1IYHA 1M0UA 1T3BA 3UJ1A 3IE3A 1Z5YE 2O8VB 4FYBA 2GQLA 5EVOA 4EDYA 4GQFA 2YOIA 4I2TA 5DAKB 1ZGNA 3G7JA 3TB2A 2WB9A 13GSA 3FYGA 5F07A 3HHVA 1ZYQB 2RIIA 3TJBA 2YN1A 2H0HA 1BG5A 1JLVA 2H71A 5ELAA 19GSA 2AUVA 2LTKA 3L4NA 2C1YA 5CRWA 3DVWA 1Z7RA 3BCKA 2DSAA 3HJPA 3P90A 3DYRA 3VLNA 1T8EB 3GHAA 2EIRA 3ZMKA 2TRCP 5J5NA 5D73A 4NAXA 2YCDA 4I6XA 2LRTA 2YJ7A 4V2NA 1MTCA 2YV7A 1R26A 1T1VA 2GGTA 1Q4JA 4OFNA 5DJMA 1FAAA 3N9JA 5COHA 4L5LA 1F3BA 2OBIA 2RM5A 2VCXA 4ULXA 3BCIA 2HZFA 2WDUA 5AN1A 1NHOA 5ECPB 1XOBA 2X99A 4PQ1A 5G31A 1C72A 5FWGA 2NTOA 2WJUA 2ON5A 3C71A 4GRFA 1EEMA 3EWLA 3A3TA 5HR0A 2PGTA 3M3MA 2O89A 2V6KA 4ML6A 2O85A 1R4WA 3ZIJA 3UVTA 4NV5A 4JU5A 2B7JA 3APOA 5G30A 1E6BA 2VM2A 3Q74A 3FZ5A 3MSZA 2H1AA 2VL2C 5CO3A 5J3RA 2I9HA 2A2SA 4ISDA 2DLXA 3IC4A 1HD2A 1DE1A 2VD1A 3LJRA 2X8GA 4TR4A 2VIMA 3ZITA 4KW6A 2GZPA 4KA0A 1TOFA 5IOXA 5EPFA 2YP6A 1PMTA 4RUVA 1WRYA 4MH3A 2IIYA 2DC5A 4OO5A 2E2MA 4TW5A 4WKWA 2FGXA 1EOHA 3A2VA 2R4VA 4ZBDA 4N10A 3E3EA 3CSJA 1EOGA 3MAKA 1M2AA 1JLWA 1F6MC 2H01A 2YV9A 1G6WA 1QMVA 2LJRA 3U5RE 3VFIA 1TK0B 1U3AA 2N5BA 2VCVA 3GX8A 2EC4A 5D9WA 3UBKA 4ILFA 5H5QA 3LQ7A 1GTBA 2H72A 2H19A 1LBKA 4CW9A 3LXTA 4AF2A 5EL8A 1B4PA 2IFQA 1J9BA 1I5GA 1XBSA 1AAZA 6GSUA 2KLXA 2VO4A 1LJRA 1SKSB 3LYPA 3PGTA 5IO2A 1G7OA 4OFTA 4EVMA 2JADA 1JFUA 3US3A 1M7TA 3KP9A 4IS0A 2L6DA 5G1KA 4MP4A 3EU3A 4ML1A 3D21A 4HEA2 1M9AA 4HQZA 1YQ1A 2DMLA 1VF1A 1ON4A 2CAIA 3L9VA 3LWAA 1H4OA 2I1UA 4OWYA 1EEJA 4PURA 22GSA 3KH7A 2AJQB 5G5EA 5LNKe 3VPQA 5IOWA 4KE3A 2QC7A 4O92A 4TXOB 2IJYA 4FYCA 5CREA 5HFGA 1TTZA 5GZZB 4L0WA 1X9SB 4KUNA 3IPZA 1SJIA 3A2XA 3BD2A 1BAYA 3FR3A 2MMZA 4ZL7A 2G0FA 1GSDA 3KJYA 2IFQB 2CVDA 1B48A 3GX0A 4ECBA 1TW9A 1SD9A 1TRSA 3KGKA 5ECQB 1MD4A 2B7KA 4EKZA 1PGTA 3DKSA 1GNWA 5IIZA 1U6TA 5KN3A 2BMXA 2H76A 4HI7A 3HD5A 3MWHA 1RK4A 4MA9A 4BWSA 5ECOB
chains in the Genus database with same CATH superfamily
3C73A 8GSSA 2FA8A 4XS4A 1K0DA 1SL2B 5DCHA 4EIQA 5A4VA 2ZNMA 1EP7A 4MJAA 1F37A 4HUAA 1BX9A 1S3CA 3VWVA 2VLVA 4JRRA 3IRAA 3F63A 5G5FA 3CBUA 1BYEA 1ZOFA 2LV3A 2L5LA 2C0FA 3LGCA 3FZ9A 2R0CA 3FZ4A 3TRPA 4LMWA 3TKPA 3PPUA 4TKYA 1VGLA 2DJJA 4BVYB 4TOPA 4QQ7A 5ECOB 4L0UA 2N5AA 3APQA 5ECLB 2N5FA 1TDIA 2E0QA 3TOUA 1FHEA 4G0LA 2E2GA 3KH9A 1YEPA 2OJLA 2QSIA 4MJEA 1THOA 5CP1A 2Z9SA 3D0ZA 3M8NA 4EXJA 5KOWA 4CHSA 3TDGA 1OE7A 2KOKA 4YH2A 1AQVA 1J08A 3HCZA 3P8WA 4HOJA 3D4MA 4HJMA 3W8SA 5HR3A 4JE1A 4AJ6A 2C80A 5JWOB 4HS1A 1R7HA 1GTAA 3KP8A 1SD8A 3GUSA 3I9V2 3L78A 4O5QA 2LJKA 1PX7A 3KZQA 1ERVA 4Q5QA 1B8XA 1T00A 4ICYA 2H6ZA 4Q5NA 2YWNA 4D73A 3GH6A 1B4QA 4L5OA 2VUPA 5DBQA 2FNOA 1G0TA 4AGSA 2IL3A 3KMNA 2CT6A 3ZMLA 2LEGA 1U88A 4MABA 1T4ZA 1M2BA 3V1WA 3IOSA 3ZZXA 2QA2A 2GT6A 4O5UA 1XWBA 3FR9A 2I3YA 4RQXA 2IMIA 1ML6A 1ERUA 1XWAA 2VLUA 3FY7A 1O7UA 1GULA 1K3OA 1KBNA 1LU4A 2R2JA 1JZDA 1OC8A 4WR4A 3ZL5A 3R3EA 3TJFA 3M0FA 3P2AA 5HFIA 1S3RA 3GA4A 3NZNA 4K6XA 5CRGA 2F8FA 5DALB 4HU9A 4Z2TA 1Z9HA 2GVPA 4ZIJA 2GLRA 3CXGA 3HA9A 4Z2RA 2WCIA 2FD3A 4XCSA 5DQSA 3CYNA 1VF3A 2HRNA 1XZOA 3SWLA 2F9SA 1K0AA 3SBCA 4KF9A 2PVOC 2LRNA 4V1Ap 1X9WB 4KCEA 1A0FA 3DXBA 3TKSE 3RPNA 2IMKA 3GYKA 4I97A 1UC7A 4MJBA 1BJXA 4FH8A 4MCUA 2L5OA 3KD0A 5D9TA 1O6JA 1W89A 3CRUA 1TP9A 4IVFA 3HXSA 5FT3A 3IHGA 2XPEA 5CRDA 14GSA 4O32A 2FUG2 1O8WA 5DJLA 3VWUA 2ZUPA 1V58A 2L57A 3ZREA 2AB6A 3HVNA 5JWRB 1XXUA 3F4RA 3IAS2 1TXXA 5H5SA 2PERA 1DE2A 3GNJA 2NDOA 3APSA 4HZ2A 5B6NA 3F6DA 1YDKA 1GSQA 4WF5A 1TK8B 2HZEA 5DQYA 1FB6A 2JZTA 2VLTA 18GSA 1F9MA 2MBSA 1V40A 3FZAA 3IC8A 4IGJA 1EGOA 3MDKA 5EY6A 4XS1A 3HJMA 1WOUA 5LD0A 4GWRA 5DVBA 2PWJA 1X5EA 2X64A 4PUAA 1UN2A 5KN2A 3QAWA 4WBJA 3ERFA 3HVVA 4ECIA 4PXOA 2R5GA 4K2DA 5IMVA 1Y25A 4FYUA 9GSSA 1A2JA 4OD7A 5CRHA 4NHWA 5GSTA 1GLPA 2YWIA 2B1KA 1HQOA 3JCML 5D93A 4KSMA 4MLYA 1S3AA 3GKMA 4Z2UA 4PNGA 1TI1A 1ACVA 1KTEA 4YAVA 3UVHA 3GKXA 3HZ8A 1WWJA 4LA1A 1QFNA 4DSSA 1XWKA 4NPBA 2A2RA 5G2ZA 1YEXA 2K6VA 3F8UA 1ZZYA 1UVZA 2LQQA 1FOVA 4LLRA 4V1Ag 3F4TA 2X49A 2HZEB 1OC9A 3KCMA 4MZBA 4G9HA 2G2QA 3QAGA 2JACA 2C0DA 2H1GA 4N0ZA 4EC0A 2FA4A 4YQMA 2FY6A 5JWQB 3M9KA 4WEYA 5DCGA 5J9BA 1XOAA 3KM6A 1TRWA 3UIWA 2TRXA 3J7Yk 3QD9A 1YF0A 3FEUA 4QL9A 5ECNB 5HFKA 2VD0A 5KN1A 3LXZA 3DVXA 5IMDA 4IP6A 4WF4A 4YAPA 5E59A 2HRFA 2JU5A 4NV2A 2K8SA 2HYXA 4PTSA 2V41A 2JSZA 3KXOA 1TKDB 2FWHA 3GSTA 2IMEA 3UOMA 5GAPD 5ECSA 1WP0A 4HU7A 4K0GA 16GSA 1TRVA 1XVQA 1I9DA 1ST9A 2FWGA 4DSSB 2DBCA 3QDNA 2LKUA 3L9UA 4JBBA 2R37A 4ZXGA 2LNTA 4IQ1A 3F3QA 1GSSA 3ZVJD 4JZQA 2IWTA 5D96A 4BL7A 3GMFA 2WULA 6GSSA 2IMDA 3TKSC 3TRXA 4K7NA 3BJ5A 3FW2A 2XPDA 1M3JA 3RHBA 4F0BA 1A0RP 1OKDA 1WPIA 3HYPA 4JEDA 3LORA 4KSOA 3RAZA 1YY7A 3TJKA 3VURA 4IN0A 2A4HA 5ECRB 2PN8A 4DSQA 3W6GA 4GQCA 1IYIA 1SYXA 1GSEA 2R6KA 3FR6A 3IXRA 3CRTA 2H1BA 2BTOT 4TRXA 3EPTA 3WGXA 3GTUA 5ECKB 3QR6A 2CAQA 2R0GA 2I81A 2YNXA 5CAXA 1THXA 4PNFA 2WFCA 3ED3A 4MPGA 4F2IA 2L4CA 3WT1A 2K8VA 3RDWA 4I8BA 2I4AA 3FK8A 1ERWA 2B5EA 4ZL9A 3O76A 1OVNA 2VCTA 2PU9C 2AAWA 4L8EA 1J0FA 4I5QA 2DJ3A 5L71A 3PINA 4YQUA 3G7YA 4GLTA 4TR1A 2GS3A 4BL7B 1FOHA 1HNCA 4TR0A 4GF0A 2B6MA 4OO4A 1USBA 1VF2A 2GSTA 1PRXA 4YKFA 1B9YC 1XPVA 2F8AA 2QA1A 1PQNA 3WYWA 2V2GA 2OA7A 5H5RA 3MIXA 3E9JB 4H86A 1R5PA 4WETA 4MMMA 3HY2A 4OCFA 1WMJA 3EC3A 4RI7A 4TN8A 5BRTA 4G0KA 4GCIA 4MZWA 2DJ2A 2XBIA 4V2LA 2O87A 4DVCA 2K9FA 5A4WA 3GTUB 4A5PA 2LSTA 1ZCPA 4CDOA 1FVKA 1K0BA 1DBYA 3FRCA 5F0GA 1Z6NA 3FKFA 2OE3A 4KCAA 2MBTA 3F6FA 1ZL9A 3IBHA 4RI6A 4DEJA 4POKA 2L6CA 10GSA 1XCCA 2CX4A 5ENUA 4F0CA 1VRSD 2VCQA 4QL7A 2LJAA 5D8IA 1SL1B 2XC2A 2VL2A 4POLA 3TGZA 1R5AA 4G19A 4EE0A 1PFOA 5ID2A 4X0XA 2KP1A 4MK3A 4EL1A 3GFKA 6GSYA 2XBQA 3F4SA 4FQUA 5IQYA 4BWQA 4XS6A 1ZMAA 1SKRB 2PUKC 4KH7A 1UA5A 3H1NA 1ZYEA 3E0UA 6GSVA 2V32A 2PBJA 3TKRA 1WJKA 3S9FA 2VCWA 1TK5B 5B8AA 1XIYA 3A5IA 2QKEA 3QMXA 2DJ0A 1PN9A 2YZUA 3HZ4A 4LL1B 1SU9A 1PL2A 1QQ2A 2GQMA 1FB0A 2F3MA 1GP1A 2OACA 4BIKA 3W8JA 1X5CA 4GTUA 3H4KA 2IMFA 1SK0A 3F3RA 4HQSA 4XS4B 4IJ3A 1YJ6A 4IP1A 3FHKA 5KOXA 3I69A 4BPYA 2M80A 1GLQA 2REMA 5JCUA 3GV1A 3GSSA 4KB3A 1BEDA 4GSSA 3EU4A 5A4UA 3QFAC 4EO3A 3EINA 3IV4A 1FG4A 2OBKA 3TJJA 5J41A 1XW6A 2B3SA 3DIEA 2LS5A 2LQOA 1K0NA 1BQ7A 3ZFLA 1A2MA 5B7CA 1EV9A 1AXDA 2RM6A 4MNNA 4LL4B 2GDRA 2H0IA 1G6YA 1QUWA 1HYUA 2HXKA 1EZKA 1GTUA 3G7IA 1ZYNA 3A2WA 5CYYA 5IPGA 1A24A 5CNWA 5AIXA 3ISOA 4E8EA 5J4UA 3TUEA 2V6OA 5AIVA 1V2AA 2GT5A 2C0GA 3WD6A 1URMA 3C1SA 2H66A 3ZIVA 4K9ZA 3ME8A 2VL3A 1MDKA 4YKGA 2C3QA 5DAKA 2X4AA 5AISA 3ERWA 4F9ZA 1GRXA 1EGRA 4KDXA 5INYA 1M9BA 2KUCA 4XRAA 5G1LA 4J57E 4NHZA 4EUYA 5B6MA 5F06A 3D22A 5BMUA 3VI7A 4D73B 2GZYA 4ECJA 3OR5A 3VPTA 2FWEA 3KIJA 3IK7A 3C1RA 2YANA 2R0PA 4BVXA 1GUKA 1KNGA 2JL4A 5IM9A 3NOFA 2FWFA 3R2QA 2H75A 5ABRA 1TI3A 3H93A 4ZB6A 2HLSA 3VK9A 4WR5A 2FCHA 3C8EA 1RW1A 4PQIA 1SK2A 2YJHA 1XG8A 3UBLA 2P31A 4HSCX 3Q18A 1MD3A 4K7OA 1QGVA 5D9XA 1F2EA 2M46A 3QPMA 4F82A 2QGVA 2MMNA 1O8XA 1V98A 2V1MA 4BA7A 3CTGA 3H79A 1GWCA 1U3IA 3LYKA 1Y6EA 3CSIA 3EE2A 3HDCA 2OADA 1PKWA 3U6VA 1JHBA 3Q19A 5IPHA 1FVJA 1OC3A 3G9BA 2VM1A 1SENA 4AJ7A 1T7PB 2HI7A 5HR1A 20GSA 4TR3A 3D6IA 5GSSA 2J9HA 2CZ2A 6GSXA 4DSRA 4XTSA 5ECIB 5LCZA 4OMVA 5IMFA 4BVXB 1MDJA 2H6YA 3UARA 4NWYA 2VAFA 5F8BA 2RUEA 3O3TA 4YQVA 3DRNA 4X4JA 4ZILA 1XW5A 5KN0A 1AUCA 2O7KA 1EWXA 3GKKA 4HDEA 4XIHA 2D2ZA 1K0CA 2ZCTA 2PVQA 3D4TA 1YKAA 2PPTA 4USSA 4J56E 2C3NA 2KHPA 4POMA 4ACSA 2MYGA 5J9CA 3K8NA 1X0RA 2DMMA 3DD3A 3H8QA 2H6XA 3HKRA 2L59A 3IK9A 3EYTA 1PSQA 5HQPA 2VL9A 2H70A 4MF6A 2H74A 3LFLA 5HR2A 1SYRA 2CVKA 2AYTA 2F51A 4EIPA 2WGRA 1HNBA 3I6AA 1KEBA 3PR8A 3GURA 1XW9A 2MMAA 4N0VA 1A8YA 2CQ9A 5JCWA 3UL3A 2LNSA 3WT2A 3ZLPA 1M99A 1S3DA 2P5QA 4X1UA 3DGQA 1AIUA 3I43A 1PX6A 2P5RA 3PH9A 4FIWA 3TCOA 4ZB8A 2A2PA 3QOUA 1M2DA 1A23A 3BBYA 1SJ6A 4F03A 3HJOA 4K5SA 4XRDA 1AQXA 3KTLA 3L9SA 1CQHA 1K0OA 2C8UA 4EDZA 2WS2A 1OC9B 2X8HA 2RLIA 5ECHB 2DKIA 2L4QA 2GQKA 4MH2A 2BJXA 3LW9A 4Z7XA 2K18A 1NM3A 3UEMA 2EIOA 4N11A 3RPPA 5FHIA 4TXOA 1YKCA 5ELGA 1NW2A 2WRTA 4ZBAA 3TJGA 3F0IA 3KEBA 3WGEA 2ALBA 1JZRA 2CV4A 1O81A 3ERGA 2CVBA 4IBPA 1QK8A 2J23A 1GL8A 5GAND 3M1GA 2OKAA 2NBSA 3J7Yb 2B1LA 4IHUA 1FW1A 1GSFA 1E2YA 2TIRA 1O73A 2YWOA 4O5RA 1GSUA 17GSA 3AY8A 5ECMB 4ECCA 4AJ8A 2B5XA 4ZBBA 3KTBA 4TVEA 3P7XA 3EMPA 5KEJA 1V9WA 3CTFA 3VWWA 2R3XA 2C4JA 4Q5FA 2VOCA 1DUGA 2JZRA 1NHYA 3WGDA 4HJ2A 1OAZA 1SL0B 3VWXA 3IHQA 1B9XC 2M72A 2UZ8A 4LMVA 2NVLA 1Z7PA 3HVXA 2P0GA 1JZWA 1GH2A 3QCPA 4KGIA 1K3LA 2OE1A 1PL1A 2DJKA 4BVYA 1YF1A 1ABAA 3LSZA 2HNLA 2MZCA 3ZTLA 5IMCA 4MF5A 3QAVA 4MJCA 2GTUA 3F9UA 4V2MA 4KNDA 3VI5A 4K0NA 1VF4A 2C3TA 4O7HA 1Z3EA 1XWGA 2H8LA 4PUFC 2JSYA 4MF7A 4OCEA 2H73A 1RQMA 2ES7A 3O6TA 6GSTA 4J2FA 2KP2A 4NXIA 1GUHA 2DIZA 4FO5A 3LEFA 1WE0A 1A2LA 4TR1B 3UAPA 4GXZA 3RHCA 2YZHA 1XFLA 3BOAA 1V57A 4K5RA 5D9VA 4G2EA 4OFMA 4MDCA 5E4WA 1GUMA 2CZ3A 4PGTA 3M9JA 4I2UA 4IJIA 4K1FA 1N8JA 3IR4A 5C00A 3TRQA 3ME7A 2X8CA 1U87A 3GIXA 2DIYA 2GZZA 4Q5RA 2MMOA 3MYDA 1TRUA 3IAM2 2CA8A 4TXVA 2GSSA 5IO0A 5C04A 3TKQA 12GSA 2HT9A 4IQAA 3D5JA 3QFBC 4PQHA 2H0GA 1QXHA 3GL3A 3ZRDA 4IELA 3TKSA 4KDYA 2YPMA 4JR4A 4E8HA 3ZFBA 2PMTA 4G10A 4IW9A 3GN3A 2HSYA 2LRCA 1ERTA 1K3YA 1DSBA 1HNAA 1X9MB 3RBTA 2DJ1A 5DALA 1PD21 2FHEA 1YZXA 3GH9A 2JZSA 4IKHA 2HSHA 4RQRA 5ID2B 1GSYA 1Q98A 4XHMA 4K7IA 3EMXA 2HFDA 1O85A 1OE8A 3UMAA 2C0EA 1MEKA 1AC1A 3DEXA 3N5OA 1GNEA 3NIVA 4GSTA 5IMZA 1ZYPA 4JR6A 4KX4A 2WZ9A 1SK1A 4MZCA 3GKNA 3ZVJA 1G7EA 4EF0A 2AV4A 3C7MA 1PKZA 3CMIA 1EV4A 1SKWB 1TU8A 4N30A 4ZB9A 2VCZA 1MDIA 3DMLA 3LG6A 1T4YA 3EVIA 3IA1A 5B8BA 1XWCA 3MNGA 1JZOA 4P3YB 1GTIA 2AHEA 2XHFA 6GSWA 3ZYWA 5IMAA 2A4VA 1TU7A 3EURA 3GRXA 4GSNA 1A8LA 4CY8A 1FO5A 2ON7A 1CQGA 11GSA 4NMUA 3KMOA 3Q6OA 3HVSA 1F3AA 4KAEA 4X43A 4POBA 1AW9A 4WXTA 2IPAA 3IDVA 2YWMA 5DDLA 2HE3A 1SJZA 1H75A 1TJDA 2H30A 3TOTA 4WBRD 4ID0A 3GL5A 4K2XA 4ZL8A 2GSQA 5A5KA 2NPBA 4MPFA 2CX3A 3L0HA 1W4VA 1NSWA 2RUFA 4KDUA 1X5DA 3A5WA 2B5YA 7GSSA 1AQWA 2IN3A 2FLSA 1Z6MA 2LUSA 3DWVA 2GSRA 1ILOA 4PX1A 1XVWA 1N2AA 5JCGA 2EIQA 1K0MA 4K8MA 2H1DA 1OYJA 1OKTA 2E7PA 3CSHA 2OE0A 4HZ4A 5F05A 1EP8A 5AGYA 1PA3A 1WIKA 1IYHA 1M0UA 1T3BA 3UJ1A 3IE3A 1Z5YE 2O8VB 4FYBA 2GQLA 5EVOA 4EDYA 4GQFA 2YOIA 4I2TA 5DAKB 1ZGNA 3G7JA 3TB2A 2WB9A 13GSA 3FYGA 5F07A 3HHVA 1ZYQB 2RIIA 3TJBA 2YN1A 2H0HA 1BG5A 1JLVA 2H71A 5ELAA 19GSA 2AUVA 2LTKA 3L4NA 2C1YA 5CRWA 3DVWA 1Z7RA 3BCKA 2DSAA 3HJPA 3P90A 3DYRA 3VLNA 1T8EB 3GHAA 4G0IA 2HRAA 2EIRA 3ZMKA 2TRCP 5J5NA 5D73A 4NAXA 2YCDA 4I6XA 2LRTA 2YJ7A 4V2NA 1MTCA 2YV7A 1R26A 1T1VA 2GGTA 1Q4JA 4OFNA 5DJMA 1FAAA 3N9JA 5COHA 4L5LA 1F3BA 2OBIA 2RM5A 2VCXA 4ULXA 3BCIA 2HZFA 2WDUA 5AN1A 1NHOA 5ECPB 1XOBA 2X99A 4PQ1A 5G31A 1C72A 5FWGA 2NTOA 2WJUA 2ON5A 3C71A 4GRFA 1EEMA 3EWLA 3A3TA 5HR0A 2PGTA 3M3MA 2O89A 2V6KA 4ML6A 2O85A 1R4WA 3CQFA 3ZIJA 3UVTA 4NV5A 4JU5A 2B7JA 3APOA 5G30A 1E6BA 2VM2A 3Q74A 3FZ5A 3MSZA 2H1AA 2VL2C 5CO3A 5J3RA 2I9HA 2A2SA 4ISDA 2DLXA 3IC4A 1HD2A 1DE1A 2VD1A 3LJRA 2X8GA 4TR4A 2VIMA 3ZITA 4KW6A 2GZPA 4KA0A 1TOFA 5IOXA 5EPFA 2YP6A 1PMTA 4RUVA 1WRYA 4MH3A 4WKWA 2DC5A 2IIYA 2E2MA 4OO5A 4TW5A 2FGXA 1EOHA 3A2VA 2R4VA 4ZBDA 4N10A 3E3EA 3CSJA 1EOGA 3MAKA 1M2AA 1JLWA 1F6MC 2H01A 2YV9A 1G6WA 1QMVA 2LJRA 3U5RE 3VFIA 1TK0B 1U3AA 2N5BA 1PN0A 2VCVA 3GX8A 2EC4A 5D9WA 3UBKA 4ILFA 5H5QA 3LQ7A 1GTBA 2H72A 2H19A 1LBKA 4CW9A 3LXTA 4AF2A 2DKHA 5EL8A 2IFQA 1J9BA 1I5GA 1XBSA 1AAZA 6GSUA 2KLXA 2VO4A 1LJRA 1SKSB 3LYPA 3PGTA 5IO2A 1G7OA 4OFTA 4EVMA 2JADA 1JFUA 3US3A 1M7TA 3KP9A 4IS0A 2L6DA 5G1KA 4MP4A 3EU3A 4ML1A 3D21A 4HEA2 1M9AA 4HQZA 1YQ1A 2DMLA 1VF1A 1ON4A 2CAIA 4CY6A 3L9VA 3LWAA 1H4OA 3FMWA 2I1UA 4OWYA 1EEJA 4PURA 22GSA 3KH7A 2AJQB 5G5EA 2HSMA 5LNKe 3VPQA 5IOWA 4KE3A 2QC7A 4O92A 4TXOB 2IJYA 4FYCA 5CREA 5HFGA 1TTZA 5GZZB 4L0WA 1X9SB 4KUNA 3IPZA 1SJIA 3A2XA 3BD2A 1BAYA 3FR3A 2MMZA 4ZL7A 2G0FA 1GSDA 3KJYA 2IFQB 2CVDA 1B48A 3GX0A 4ECBA 1TW9A 1SD9A 1TRSA 3KGKA 5ECQB 1MD4A 2HRKA 2B7KA 4EKZA 1PGTA 3DKSA 1GNWA 5IIZA 1U6TA 5KN3A 2BMXA 2H76A 4HI7A 3HD5A 3MWHA 1RK4A 4MA9A 4BWSA 1M3IA 1B4PA
chains in the Genus database with same CATH topology
3C73A 8GSSA 2FA8A 4XS4A 1K0DA 1SL2B 5DCHA 4EIQA 5A4VA 2ZNMA 1EP7A 4MJAA 1F37A 4HUAA 1BX9A 1S3CA 3VWVA 2VLVA 4JRRA 3IRAA 3F63A 5G5FA 3CBUA 1BYEA 1ZOFA 2LV3A 2L5LA 2C0FA 3LGCA 3FZ9A 2R0CA 3FZ4A 3TRPA 4LMWA 3TKPA 3PPUA 4TKYA 1VGLA 2DJJA 4BVYB 4TOPA 4QQ7A 5ECOB 4L0UA 2N5AA 3APQA 5ECLB 2N5FA 1TDIA 2E0QA 3TOUA 1FHEA 4G0LA 2E2GA 3KH9A 1YEPA 2OJLA 2QSIA 4MJEA 1THOA 5CP1A 2Z9SA 3D0ZA 3M8NA 4EXJA 5KOWA 4CHSA 3TDGA 1OE7A 2KOKA 4YH2A 1AQVA 1J08A 3HCZA 3P8WA 4HOJA 3D4MA 4HJMA 3W8SA 5HR3A 4JE1A 4AJ6A 2C80A 5JWOB 4HS1A 1R7HA 1GTAA 3KP8A 1SD8A 3GUSA 3I9V2 3L78A 4O5QA 2LJKA 1PX7A 3KZQA 1ERVA 4Q5QA 1B8XA 1T00A 4ICYA 2H6ZA 4Q5NA 2YWNA 4D73A 3GH6A 1B4QA 4L5OA 2VUPA 5DBQA 2FNOA 1G0TA 4AGSA 2IL3A 3KMNA 2CT6A 3ZMLA 2LEGA 1U88A 4MABA 1T4ZA 1M2BA 3V1WA 3IOSA 3ZZXA 2QA2A 2GT6A 4O5UA 1XWBA 3FR9A 2I3YA 4RQXA 2IMIA 1ML6A 1ERUA 1XWAA 2VLUA 3FY7A 1O7UA 1GULA 1K3OA 1KBNA 1LU4A 2R2JA 1JZDA 1OC8A 4WR4A 3ZL5A 3R3EA 3TJFA 3M0FA 3P2AA 5HFIA 3NZNA 3GA4A 4K6XA 5CRGA 2F8FA 5DALB 4HU9A 4Z2TA 1Z9HA 2GVPA 4ZIJA 2GLRA 3CXGA 3HA9A 4Z2RA 2WCIA 2FD3A 4XCSA 5DQSA 3CYNA 1VF3A 2HRNA 1XZOA 3SWLA 2F9SA 1K0AA 3SBCA 4KF9A 2PVOC 2LRNA 4V1Ap 1X9WB 4KCEA 1A0FA 3DXBA 3TKSE 3RPNA 2IMKA 3GYKA 4I97A 1UC7A 4MJBA 1BJXA 4FH8A 4MCUA 2L5OA 3KD0A 5D9TA 1O6JA 1W89A 3CRUA 1TP9A 4IVFA 3HXSA 5FT3A 3IHGA 2XPEA 5CRDA 14GSA 4O32A 2FUG2 1O8WA 5DJLA 3VWUA 2ZUPA 1V58A 2L57A 3ZREA 2AB6A 5JWRB 1XXUA 3F4RA 3IAS2 1TXXA 5H5SA 2PERA 1DE2A 3GNJA 2NDOA 3APSA 4HZ2A 5B6NA 3F6DA 1YDKA 1GSQA 4WF5A 1TK8B 2HZEA 5DQYA 1FB6A 2JZTA 2VLTA 18GSA 1F9MA 2MBSA 1V40A 3FZAA 3IC8A 4IGJA 1EGOA 3MDKA 5EY6A 4XS1A 3HJMA 1WOUA 5LD0A 4GWRA 5DVBA 2PWJA 1X5EA 2X64A 4PUAA 1UN2A 5KN2A 3QAWA 4WBJA 3ERFA 3HVVA 4ECIA 4PXOA 2R5GA 4K2DA 5IMVA 1Y25A 4FYUA 9GSSA 1A2JA 4OD7A 5CRHA 4NHWA 5GSTA 1GLPA 2YWIA 2B1KA 1HQOA 3JCML 5D93A 4KSMA 4MLYA 1S3AA 3GKMA 4Z2UA 4PNGA 1TI1A 1ACVA 1KTEA 4YAVA 3UVHA 3GKXA 3HZ8A 1WWJA 4LA1A 1QFNA 4DSSA 1XWKA 4NPBA 2A2RA 5G2ZA 1YEXA 2K6VA 3F8UA 1ZZYA 1UVZA 2LQQA 1FOVA 4LLRA 4V1Ag 3F4TA 2X49A 2HZEB 1OC9A 3KCMA 4MZBA 4G9HA 2G2QA 3QAGA 2JACA 2C0DA 2H1GA 4N0ZA 4EC0A 2FA4A 4YQMA 2FY6A 5JWQB 3M9KA 4WEYA 5DCGA 5J9BA 1XOAA 3KM6A 1TRWA 3UIWA 2TRXA 3J7Yk 3QD9A 1YF0A 3FEUA 4QL9A 5ECNB 5HFKA 2VD0A 5KN1A 3LXZA 3DVXA 5IMDA 4IP6A 4WF4A 4YAPA 5E59A 2HRFA 2JU5A 4NV2A 2K8SA 2HYXA 4PTSA 2V41A 2JSZA 3KXOA 1TKDB 2FWHA 3GSTA 2IMEA 3UOMA 5GAPD 5ECSA 1WP0A 4HU7A 4K0GA 16GSA 1TRVA 1XVQA 1I9DA 1ST9A 2FWGA 4DSSB 2DBCA 3QDNA 2LKUA 3L9UA 4JBBA 2R37A 4ZXGA 2LNTA 4IQ1A 3F3QA 1GSSA 3ZVJD 4JZQA 2IWTA 5D96A 4BL7A 3GMFA 2WULA 6GSSA 2IMDA 3TKSC 3TRXA 4K7NA 3BJ5A 3FW2A 2XPDA 3RHBA 4F0BA 1A0RP 1OKDA 1WPIA 3HYPA 4JEDA 3LORA 4KSOA 3RAZA 1YY7A 3TJKA 3VURA 4IN0A 2A4HA 5ECRB 2PN8A 4DSQA 3W6GA 4GQCA 1IYIA 1SYXA 1GSEA 2R6KA 3FR6A 3IXRA 3CRTA 2H1BA 2BTOT 4TRXA 3EPTA 3WGXA 3GTUA 5ECKB 3QR6A 2CAQA 2R0GA 2I81A 2YNXA 5CAXA 1THXA 4PNFA 2WFCA 3ED3A 4MPGA 4F2IA 2L4CA 3WT1A 2K8VA 3RDWA 4I8BA 2I4AA 3FK8A 1ERWA 2B5EA 4ZL9A 3O76A 1OVNA 2VCTA 2PU9C 2AAWA 4L8EA 1J0FA 4I5QA 2DJ3A 5L71A 3PINA 4YQUA 3G7YA 4GLTA 4TR1A 2GS3A 4BL7B 1FOHA 1HNCA 4TR0A 4GF0A 2B6MA 4OO4A 1USBA 1VF2A 2GSTA 1PRXA 4YKFA 1B9YC 1XPVA 2F8AA 2QA1A 1PQNA 3WYWA 2V2GA 2OA7A 5H5RA 3MIXA 3E9JB 4H86A 1R5PA 4WETA 4MMMA 3HY2A 4OCFA 1WMJA 3EC3A 4RI7A 4TN8A 5BRTA 4G0KA 4GCIA 4MZWA 2DJ2A 2XBIA 4V2LA 2O87A 4DVCA 2K9FA 5A4WA 3GTUB 4A5PA 2LSTA 1ZCPA 4CDOA 1FVKA 1K0BA 1DBYA 3FRCA 5F0GA 1Z6NA 3FKFA 2OE3A 4KCAA 2MBTA 3F6FA 1ZL9A 3IBHA 4RI6A 4DEJA 4POKA 2L6CA 10GSA 1XCCA 2CX4A 5ENUA 4F0CA 1VRSD 2VCQA 4QL7A 2LJAA 5D8IA 1SL1B 2XC2A 2VL2A 4POLA 3TGZA 1R5AA 4G19A 4EE0A 5ID2A 4X0XA 2KP1A 4MK3A 4EL1A 3GFKA 6GSYA 2XBQA 3F4SA 4FQUA 5IQYA 4BWQA 4XS6A 1ZMAA 1SKRB 2PUKC 4KH7A 1UA5A 3H1NA 1ZYEA 3E0UA 6GSVA 2V32A 2PBJA 3TKRA 1WJKA 3S9FA 2VCWA 1TK5B 5B8AA 1XIYA 3A5IA 2QKEA 3QMXA 2DJ0A 1PN9A 2YZUA 3HZ4A 4LL1B 1SU9A 1PL2A 1QQ2A 2GQMA 1FB0A 2F3MA 1GP1A 2OACA 3W8JA 1X5CA 4GTUA 3H4KA 2IMFA 1SK0A 3F3RA 4HQSA 4XS4B 4IJ3A 1YJ6A 4IP1A 3FHKA 5KOXA 3I69A 4BPYA 2M80A 1GLQA 2REMA 5JCUA 3GV1A 3GSSA 4KB3A 1BEDA 4GSSA 3EU4A 5A4UA 3QFAC 4EO3A 3EINA 3IV4A 1FG4A 2OBKA 3TJJA 5J41A 1XW6A 2B3SA 3DIEA 2LS5A 2LQOA 1K0NA 1BQ7A 3ZFLA 1A2MA 5B7CA 1EV9A 1AXDA 2RM6A 4MNNA 4LL4B 2GDRA 2H0IA 1G6YA 1QUWA 1HYUA 2HXKA 1EZKA 1GTUA 3G7IA 1ZYNA 3A2WA 5CYYA 5IPGA 1A24A 5CNWA 5AIXA 3ISOA 4E8EA 5J4UA 3TUEA 2V6OA 5AIVA 1V2AA 2GT5A 2C0GA 3WD6A 1URMA 3C1SA 2H66A 3ZIVA 4K9ZA 3ME8A 2VL3A 1MDKA 4YKGA 2C3QA 5DAKA 2X4AA 5AISA 3ERWA 4F9ZA 1GRXA 1EGRA 4KDXA 5INYA 1M9BA 2KUCA 4XRAA 5G1LA 4J57E 4NHZA 4EUYA 5B6MA 5F06A 3D22A 5BMUA 3VI7A 4D73B 2GZYA 4ECJA 3OR5A 3VPTA 2FWEA 3KIJA 3IK7A 3C1RA 2YANA 2R0PA 4BVXA 1GUKA 1KNGA 2JL4A 5IM9A 3NOFA 2FWFA 3R2QA 2H75A 5ABRA 1TI3A 3H93A 4ZB6A 2HLSA 3VK9A 4WR5A 2FCHA 3C8EA 1RW1A 4PQIA 1SK2A 2YJHA 3UBLA 2P31A 3Q18A 1MD3A 4K7OA 1QGVA 5D9XA 1F2EA 2M46A 3QPMA 4F82A 2QGVA 2MMNA 1O8XA 1V98A 2V1MA 4BA7A 3CTGA 3H79A 1GWCA 1U3IA 3LYKA 1Y6EA 3CSIA 3EE2A 3HDCA 2OADA 1PKWA 3U6VA 1JHBA 3Q19A 5IPHA 1FVJA 1OC3A 3G9BA 2VM1A 1SENA 4AJ7A 1T7PB 2HI7A 5HR1A 20GSA 4TR3A 3D6IA 5GSSA 2J9HA 2CZ2A 6GSXA 4DSRA 4XTSA 5ECIB 5LCZA 4OMVA 5IMFA 4BVXB 1MDJA 2H6YA 3UARA 4NWYA 2VAFA 5F8BA 2RUEA 3O3TA 4YQVA 3DRNA 4X4JA 4ZILA 1XW5A 5KN0A 1AUCA 2O7KA 1EWXA 3GKKA 4HDEA 4XIHA 2D2ZA 1K0CA 2ZCTA 2PVQA 3D4TA 1YKAA 2PPTA 4USSA 4J56E 2C3NA 2KHPA 4POMA 4ACSA 2MYGA 5J9CA 3K8NA 1X0RA 2DMMA 3DD3A 3H8QA 2H6XA 3HKRA 2L59A 3IK9A 3EYTA 1PSQA 5HQPA 2VL9A 2H70A 4MF6A 2H74A 3LFLA 5HR2A 1SYRA 2CVKA 2AYTA 2F51A 4EIPA 2WGRA 1HNBA 3I6AA 1KEBA 3PR8A 3GURA 1XW9A 2MMAA 4N0VA 1A8YA 2CQ9A 5JCWA 3UL3A 2LNSA 3WT2A 3ZLPA 1M99A 1S3DA 2P5QA 4X1UA 3DGQA 1AIUA 3I43A 1PX6A 2P5RA 3PH9A 4FIWA 3TCOA 4ZB8A 2A2PA 3QOUA 1M2DA 1A23A 3BBYA 1SJ6A 4F03A 3HJOA 4K5SA 4XRDA 1AQXA 3KTLA 3L9SA 1CQHA 1K0OA 2C8UA 4EDZA 2WS2A 1OC9B 2X8HA 2RLIA 5ECHB 2DKIA 2L4QA 2GQKA 4MH2A 2BJXA 3LW9A 4Z7XA 2K18A 1NM3A 3UEMA 2EIOA 4N11A 3RPPA 5FHIA 4TXOA 1YKCA 5ELGA 1NW2A 2WRTA 4ZBAA 3TJGA 3F0IA 3KEBA 3WGEA 2ALBA 1JZRA 2CV4A 1O81A 3ERGA 2CVBA 4IBPA 1QK8A 2J23A 1GL8A 5GAND 3M1GA 2OKAA 2NBSA 3J7Yb 2B1LA 4IHUA 1FW1A 1GSFA 1E2YA 2TIRA 1O73A 2YWOA 4O5RA 1GSUA 17GSA 3AY8A 5ECMB 4ECCA 4AJ8A 2B5XA 4ZBBA 3KTBA 4TVEA 3P7XA 3EMPA 5KEJA 1V9WA 3CTFA 3VWWA 2R3XA 2C4JA 4Q5FA 2VOCA 1DUGA 2JZRA 1NHYA 3WGDA 4HJ2A 1OAZA 1SL0B 3VWXA 3IHQA 1B9XC 2M72A 2UZ8A 4LMVA 2NVLA 1Z7PA 3HVXA 2P0GA 1JZWA 1GH2A 3QCPA 4KGIA 1K3LA 2OE1A 1PL1A 2DJKA 4BVYA 1YF1A 1ABAA 3LSZA 2HNLA 2MZCA 3ZTLA 5IMCA 4MF5A 3QAVA 4MJCA 2GTUA 3F9UA 4V2MA 4KNDA 3VI5A 4K0NA 1VF4A 2C3TA 4O7HA 1Z3EA 1XWGA 2H8LA 4PUFC 2JSYA 4MF7A 4OCEA 2H73A 1RQMA 2ES7A 3O6TA 6GSTA 4J2FA 2KP2A 4NXIA 1GUHA 2DIZA 4FO5A 3LEFA 1WE0A 1A2LA 4TR1B 3UAPA 4GXZA 3RHCA 2YZHA 1XFLA 3BOAA 1V57A 4K5RA 5D9VA 4G2EA 4OFMA 4MDCA 5E4WA 1GUMA 2CZ3A 4PGTA 3M9JA 4I2UA 4IJIA 4K1FA 1N8JA 3IR4A 5C00A 3TRQA 3ME7A 2X8CA 1U87A 3GIXA 2DIYA 2GZZA 4Q5RA 2MMOA 3MYDA 1TRUA 3IAM2 2CA8A 4TXVA 2GSSA 5IO0A 5C04A 3TKQA 12GSA 2HT9A 4IQAA 3D5JA 3QFBC 4PQHA 2H0GA 1QXHA 3GL3A 3ZRDA 4IELA 3TKSA 4KDYA 2YPMA 4JR4A 4E8HA 3ZFBA 2PMTA 4G10A 4IW9A 3GN3A 2HSYA 2LRCA 1ERTA 1K3YA 1DSBA 1HNAA 1X9MB 3RBTA 2DJ1A 5DALA 1PD21 2FHEA 1YZXA 3GH9A 2JZSA 4IKHA 2HSHA 4RQRA 5ID2B 1GSYA 1Q98A 4XHMA 4K7IA 3EMXA 2HFDA 1O85A 1OE8A 3UMAA 2C0EA 1MEKA 1AC1A 3DEXA 3N5OA 1GNEA 3NIVA 4GSTA 5IMZA 1ZYPA 4JR6A 4KX4A 2WZ9A 1SK1A 4MZCA 3GKNA 3ZVJA 1G7EA 4EF0A 2AV4A 3C7MA 1PKZA 3CMIA 1EV4A 1SKWB 1TU8A 4N30A 4ZB9A 2VCZA 1MDIA 3DMLA 3LG6A 1T4YA 3EVIA 3IA1A 5B8BA 1XWCA 3MNGA 1JZOA 4P3YB 1GTIA 2AHEA 2XHFA 6GSWA 3ZYWA 5IMAA 2A4VA 1TU7A 3EURA 3GRXA 4GSNA 1A8LA 4CY8A 1FO5A 2ON7A 1CQGA 11GSA 4NMUA 3KMOA 3Q6OA 3HVSA 1F3AA 4KAEA 4X43A 4POBA 1AW9A 4WXTA 2IPAA 3IDVA 2YWMA 5DDLA 2HE3A 1SJZA 1H75A 1TJDA 2H30A 3TOTA 4WBRD 4ID0A 3GL5A 4K2XA 4ZL8A 2GSQA 5A5KA 2NPBA 4MPFA 2CX3A 3L0HA 1W4VA 1NSWA 2RUFA 4KDUA 1X5DA 3A5WA 2B5YA 7GSSA 1AQWA 2IN3A 2FLSA 1Z6MA 2LUSA 3DWVA 2GSRA 1ILOA 4PX1A 1XVWA 1N2AA 5JCGA 2EIQA 1K0MA 4K8MA 2H1DA 1OYJA 1OKTA 2E7PA 3CSHA 2OE0A 4HZ4A 5F05A 1EP8A 5AGYA 1PA3A 1WIKA 1IYHA 1M0UA 1T3BA 3UJ1A 3IE3A 1Z5YE 2O8VB 4FYBA 2GQLA 5EVOA 4EDYA 4GQFA 2YOIA 4I2TA 5DAKB 1ZGNA 3G7JA 3TB2A 2WB9A 13GSA 3FYGA 5F07A 3HHVA 1ZYQB 2RIIA 3TJBA 2YN1A 2H0HA 1BG5A 1JLVA 2H71A 5ELAA 19GSA 2AUVA 2LTKA 3L4NA 2C1YA 5CRWA 3DVWA 1Z7RA 3BCKA 2DSAA 3HJPA 3P90A 3DYRA 3VLNA 1T8EB 3GHAA 4G0IA 2HRAA 2EIRA 3ZMKA 2TRCP 5J5NA 5D73A 4NAXA 2YCDA 4I6XA 2LRTA 2YJ7A 4V2NA 1MTCA 2YV7A 1R26A 1T1VA 2GGTA 1Q4JA 4OFNA 5DJMA 1FAAA 3N9JA 5COHA 4L5LA 1F3BA 2OBIA 2RM5A 2VCXA 4ULXA 3BCIA 2HZFA 2WDUA 5AN1A 1NHOA 5ECPB 1XOBA 2X99A 4PQ1A 5G31A 1C72A 5FWGA 2NTOA 2WJUA 2ON5A 3C71A 4GRFA 1EEMA 3EWLA 3A3TA 5HR0A 2PGTA 3M3MA 2O89A 2V6KA 4ML6A 2O85A 1R4WA 3ZIJA 3UVTA 4NV5A 4JU5A 2B7JA 3APOA 5G30A 1E6BA 2VM2A 3Q74A 3FZ5A 3MSZA 2H1AA 2VL2C 5CO3A 5J3RA 2I9HA 2A2SA 4ISDA 2DLXA 3IC4A 1HD2A 1DE1A 2VD1A 3LJRA 2X8GA 4TR4A 2VIMA 3ZITA 4KW6A 2GZPA 4KA0A 1TOFA 5IOXA 5EPFA 2YP6A 1PMTA 4RUVA 1WRYA 4MH3A 4WKWA 2DC5A 2IIYA 2E2MA 4OO5A 4TW5A 2FGXA 1EOHA 3A2VA 2R4VA 4ZBDA 4N10A 3E3EA 3CSJA 1EOGA 3MAKA 1M2AA 1JLWA 1F6MC 2H01A 2YV9A 1G6WA 1QMVA 2LJRA 3U5RE 3VFIA 1TK0B 1U3AA 2N5BA 1PN0A 2VCVA 3GX8A 2EC4A 5D9WA 3UBKA 4ILFA 5H5QA 3LQ7A 1GTBA 2H72A 2H19A 1LBKA 4CW9A 3LXTA 4AF2A 2DKHA 5EL8A 2IFQA 1J9BA 1I5GA 1XBSA 1AAZA 6GSUA 2KLXA 2VO4A 1LJRA 1SKSB 3LYPA 3PGTA 5IO2A 1G7OA 4OFTA 4EVMA 2JADA 1JFUA 3US3A 1M7TA 3KP9A 4IS0A 2L6DA 5G1KA 4MP4A 3EU3A 4ML1A 3D21A 4HEA2 1M9AA 4HQZA 1YQ1A 2DMLA 1VF1A 1ON4A 2CAIA 4CY6A 3L9VA 3LWAA 1H4OA 3FMWA 2I1UA 4OWYA 1EEJA 4PURA 22GSA 3KH7A 2AJQB 5G5EA 2HSMA 5LNKe 3VPQA 5IOWA 4KE3A 2QC7A 4O92A 4TXOB 2IJYA 4FYCA 5CREA 5HFGA 1TTZA 5GZZB 4L0WA 1X9SB 4KUNA 3IPZA 1SJIA 3A2XA 3BD2A 1BAYA 3FR3A 2MMZA 4ZL7A 2G0FA 1GSDA 3KJYA 2IFQB 2CVDA 1B48A 3GX0A 4ECBA 1TW9A 1SD9A 1TRSA 3KGKA 5ECQB 1MD4A 2HRKA 2B7KA 4EKZA 1PGTA 3DKSA 1GNWA 5IIZA 1U6TA 5KN3A 2BMXA 2H76A 4HI7A 3HD5A 3MWHA 1RK4A 4MA9A 4BWSA 1B4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C73 A;  8GSS A;  2FA8 A;  4XS4 A;  1K0D A;  1SL2 B;  5DCH A;  5A4V A;  2ZNM A;  1EP7 A;  4MJA A;  1F37 A;  4HUA A;  1BX9 A;  1S3C A;  3VWV A;  2VLV A;  4JRR A;  3IRA A;  3F63 A;  5G5F A;  3CBU A;  1BYE A;  1ZOF A;  2LV3 A;  2L5L A;  2C0F A;  3LGC A;  3FZ9 A;  3TRP A;  3FZ4 A;  4LMW A;  3TKP A;  4TKY A;  1VGL A;  2DJJ A;  4TOP A;  4QQ7 A;  4L0U A;  2N5A A;  3APQ A;  5ECL B;  2N5F A;  1TDI A;  2E0Q A;  3TOU A;  1FHE A;  2E2G A;  3KH9 A;  1YEP A;  2OJL A;  2QSI A;  4MJE A;  1THO A;  5CP1 A;  2Z9S A;  3D0Z A;  3M8N A;  4EXJ A;  4CHS A;  3TDG A;  1OE7 A;  2KOK A;  4YH2 A;  1AQV A;  1J08 A;  3HCZ A;  3P8W A;  4HOJ A;  3D4M A;  4HJM A;  3W8S A;  5HR3 A;  4JE1 A;  4AJ6 A;  2C80 A;  5JWO B;  4HS1 A;  1R7H A;  1GTA A;  3KP8 A;  1SD8 A;  3GUS A;  3I9V 2;  3L78 A;  2LJK A;  1PX7 A;  3KZQ A;  1ERV A;  4Q5Q A;  1B8X A;  1T00 A;  2H6Z A;  4Q5N A;  2YWN A;  4D73 A;  3GH6 A;  1B4Q A;  4L5O A;  2VUP A;  5DBQ A;  2FNO A;  1G0T A;  4AGS A;  2IL3 A;  3KMN A;  2CT6 A;  3ZML A;  2LEG A;  1U88 A;  4MAB A;  1T4Z A;  1M2B A;  3V1W A;  3IOS A;  3ZZX A;  2GT6 A;  1XWB A;  3FR9 A;  2I3Y A;  4RQX A;  2IMI A;  1ML6 A;  1ERU A;  1XWA A;  2VLU A;  3FY7 A;  1O7U A;  1GUL A;  1K3O A;  1KBN A;  1LU4 A;  2R2J A;  1JZD A;  1OC8 A;  4WR4 A;  3ZL5 A;  3TJF A;  3M0F A;  3P2A A;  5HFI A;  3NZN A;  3GA4 A;  4K6X A;  5CRG A;  2F8F A;  5DAL B;  4HU9 A;  1Z9H A;  2GVP A;  4ZIJ A;  2GLR A;  3CXG A;  3HA9 A;  2WCI A;  2FD3 A;  4XCS A;  5DQS A;  3CYN A;  1VF3 A;  2HRN A;  1XZO A;  3SWL A;  2F9S A;  1K0A A;  3SBC A;  2PVO C;  2LRN A;  4V1A p;  1X9W B;  4KCE A;  1A0F A;  3DXB A;  3TKS E;  3RPN A;  2IMK A;  3GYK A;  4I97 A;  1UC7 A;  4MJB A;  1BJX A;  4FH8 A;  4MCU A;  2L5O A;  3KD0 A;  5D9T A;  1O6J A;  1W89 A;  3CRU A;  1TP9 A;  4IVF A;  3HXS A;  5FT3 A;  2XPE A;  5CRD A;  14GS A;  4O32 A;  2FUG 2;  1O8W A;  5DJL A;  3VWU A;  2ZUP A;  1V58 A;  2L57 A;  3ZRE A;  2AB6 A;  5JWR B;  1XXU A;  3F4R A;  3IAS 2;  1TXX A;  5H5S A;  2PER A;  1DE2 A;  3GNJ A;  2NDO A;  3APS A;  4HZ2 A;  5B6N A;  3F6D A;  1YDK A;  1GSQ A;  4WF5 A;  1TK8 B;  2HZE A;  5DQY A;  1FB6 A;  2JZT A;  2VLT A;  18GS A;  1F9M A;  2MBS A;  1V40 A;  3FZA A;  4IGJ A;  1EGO A;  3MDK A;  5EY6 A;  4XS1 A;  3HJM A;  1WOU A;  5LD0 A;  4GWR A;  5DVB A;  2PWJ A;  1X5E A;  2X64 A;  4PUA A;  1UN2 A;  5KN2 A;  3QAW A;  4WBJ A;  3ERF A;  3HVV A;  4ECI A;  4PXO A;  2R5G A;  4K2D A;  5IMV A;  1Y25 A;  4FYU A;  9GSS A;  1A2J A;  4OD7 A;  5CRH A;  4NHW A;  5GST A;  1GLP A;  2YWI A;  2B1K A;  1HQO A;  3JCM L;  5D93 A;  4KSM A;  4MLY A;  1S3A A;  3GKM A;  4PNG A;  1TI1 A;  1ACV A;  1KTE A;  4YAV A;  3UVH A;  3GKX A;  3HZ8 A;  1WWJ A;  4LA1 A;  1QFN A;  4DSS A;  1XWK A;  4NPB A;  2A2R A;  5G2Z A;  1YEX A;  2K6V A;  3F8U A;  1ZZY A;  1UVZ A;  2LQQ A;  1FOV A;  4LLR A;  4V1A g;  3F4T A;  2HZE B;  1OC9 A;  3KCM A;  4MZB A;  4G9H A;  2G2Q A;  3QAG A;  2JAC A;  2C0D A;  2H1G A;  4N0Z A;  4EC0 A;  2FA4 A;  4YQM A;  2FY6 A;  5JWQ B;  3M9K A;  4WEY A;  5DCG A;  5J9B A;  1XOA A;  3KM6 A;  1TRW A;  3UIW A;  2TRX A;  3J7Y k;  3QD9 A;  1YF0 A;  3FEU A;  4QL9 A;  5ECN B;  5HFK A;  2VD0 A;  5KN1 A;  3LXZ A;  3DVX A;  5IMD A;  4IP6 A;  4WF4 A;  4YAP A;  5E59 A;  2HRF A;  2JU5 A;  4NV2 A;  2K8S A;  2HYX A;  2V41 A;  2JSZ A;  3KXO A;  1TKD B;  2FWH A;  3GST A;  2IME A;  3UOM A;  5GAP D;  5ECS A;  1WP0 A;  4HU7 A;  4K0G A;  16GS A;  1TRV A;  1XVQ A;  1I9D A;  1ST9 A;  2FWG A;  4DSS B;  2DBC A;  3QDN A;  2LKU A;  3L9U A;  4JBB A;  2R37 A;  4ZXG A;  2LNT A;  4IQ1 A;  3F3Q A;  1GSS A;  3ZVJ D;  4JZQ A;  2IWT A;  5D96 A;  4BL7 A;  3GMF A;  2WUL A;  6GSS A;  2IMD A;  3TKS C;  3TRX A;  4K7N A;  3BJ5 A;  3FW2 A;  2XPD A;  3RHB A;  4F0B A;  1A0R P;  1OKD A;  1WPI A;  3HYP A;  4JED A;  3LOR A;  4KSO A;  3RAZ A;  1YY7 A;  3TJK A;  3VUR A;  4IN0 A;  5ECR B;  2PN8 A;  4DSQ A;  3W6G A;  4GQC A;  1IYI A;  1SYX A;  1GSE A;  2R6K A;  3FR6 A;  3IXR A;  3CRT A;  2H1B A;  2BTO T;  4TRX A;  3WGX A;  3GTU A;  5ECK B;  3QR6 A;  2CAQ A;  2I81 A;  2YNX A;  5CAX A;  1THX A;  4PNF A;  2WFC A;  3ED3 A;  4MPG A;  4F2I A;  2L4C A;  3WT1 A;  2K8V A;  3RDW A;  4I8B A;  2I4A A;  3FK8 A;  1ERW A;  2B5E A;  4ZL9 A;  3O76 A;  1OVN A;  2VCT A;  2PU9 C;  2AAW A;  4L8E A;  1J0F A;  4I5Q A;  2DJ3 A;  5L71 A;  3PIN A;  4YQU A;  3G7Y A;  4GLT A;  4TR1 A;  2GS3 A;  1HNC A;  4TR0 A;  4GF0 A;  2B6M A;  4OO4 A;  1USB A;  1VF2 A;  2GST A;  1PRX A;  1B9Y C;  1XPV A;  2F8A A;  1PQN A;  3WYW A;  2V2G A;  2OA7 A;  5H5R A;  3E9J B;  4H86 A;  1R5P A;  4WET A;  4MMM A;  3HY2 A;  4OCF A;  1WMJ A;  3EC3 A;  4RI7 A;  4TN8 A;  4GCI A;  4MZW A;  2DJ2 A;  2XBI A;  4V2L A;  2O87 A;  4DVC A;  2K9F A;  5A4W A;  3GTU B;  2LST A;  1ZCP A;  4CDO A;  1FVK A;  1K0B A;  1DBY A;  3FRC A;  5F0G A;  1Z6N A;  3FKF A;  2OE3 A;  4KCA A;  2MBT A;  3F6F A;  1ZL9 A;  3IBH A;  4RI6 A;  4DEJ A;  4POK A;  2L6C A;  10GS A;  1XCC A;  2CX4 A;  5ENU A;  4F0C A;  1VRS D;  2VCQ A;  4QL7 A;  2LJA A;  5D8I A;  1SL1 B;  2XC2 A;  2VL2 A;  4POL A;  3TGZ A;  1R5A A;  4G19 A;  4EE0 A;  5ID2 A;  4X0X A;  2KP1 A;  4MK3 A;  4EL1 A;  3GFK A;  6GSY A;  2XBQ A;  3F4S A;  5IQY A;  4BWQ A;  4XS6 A;  1ZMA A;  1SKR B;  2PUK C;  4KH7 A;  1UA5 A;  3H1N A;  1ZYE A;  3E0U A;  6GSV A;  2V32 A;  2PBJ A;  3TKR A;  1WJK A;  3S9F A;  2VCW A;  1TK5 B;  5B8A A;  1XIY A;  3QMX A;  2QKE A;  2DJ0 A;  1PN9 A;  2YZU A;  3HZ4 A;  4LL1 B;  1SU9 A;  1PL2 A;  1QQ2 A;  2GQM A;  1FB0 A;  2F3M A;  1GP1 A;  2OAC A;  3W8J A;  1X5C A;  4GTU A;  3H4K A;  2IMF A;  1SK0 A;  3F3R A;  4HQS A;  4XS4 B;  4IJ3 A;  1YJ6 A;  4IP1 A;  3FHK A;  3I69 A;  4BPY A;  2M80 A;  1GLQ A;  2REM A;  5JCU A;  3GV1 A;  3GSS A;  4KB3 A;  1BED A;  4GSS A;  3EU4 A;  5A4U A;  3QFA C;  4EO3 A;  3EIN A;  3IV4 A;  1FG4 A;  2OBK A;  3TJJ A;  5J41 A;  1XW6 A;  2B3S A;  3DIE A;  2LS5 A;  2LQO A;  1K0N A;  1BQ7 A;  3ZFL A;  1A2M A;  5B7C A;  1EV9 A;  1AXD A;  2RM6 A;  4LL4 B;  2GDR A;  2H0I A;  1G6Y A;  1QUW A;  1HYU A;  2HXK A;  1EZK A;  1GTU A;  3G7I A;  3A2W A;  5CYY A;  5IPG A;  1A24 A;  5CNW A;  5AIX A;  3ISO A;  4E8E A;  5J4U A;  3TUE A;  2V6O A;  5AIV A;  1V2A A;  2GT5 A;  2C0G A;  3WD6 A;  1URM A;  3C1S A;  2H66 A;  3ZIV A;  4K9Z A;  3ME8 A;  2VL3 A;  1MDK A;  2C3Q A;  5DAK A;  5AIS A;  3ERW A;  4F9Z A;  1GRX A;  1EGR A;  4KDX A;  5INY A;  1M9B A;  2KUC A;  4XRA A;  5G1L A;  4J57 E;  4NHZ A;  4EUY A;  5B6M A;  5F06 A;  3D22 A;  3VI7 A;  4D73 B;  2GZY A;  4ECJ A;  3OR5 A;  3VPT A;  2FWE A;  3KIJ A;  3IK7 A;  3C1R A;  2YAN A;  4BVX A;  1GUK A;  1KNG A;  2JL4 A;  5IM9 A;  3NOF A;  2FWF A;  3R2Q A;  2H75 A;  5ABR A;  1TI3 A;  3H93 A;  4ZB6 A;  2HLS A;  3VK9 A;  4WR5 A;  2FCH A;  3C8E A;  1RW1 A;  4PQI A;  1SK2 A;  2YJH A;  3UBL A;  2P31 A;  3Q18 A;  1MD3 A;  4K7O A;  1QGV A;  5D9X A;  1F2E A;  2M46 A;  3QPM A;  4F82 A;  2QGV A;  2MMN A;  1O8X A;  1V98 A;  2V1M A;  4BA7 A;  3CTG A;  3H79 A;  1GWC A;  1U3I A;  3LYK A;  1Y6E A;  3CSI A;  3EE2 A;  3HDC A;  2OAD A;  1PKW A;  3U6V A;  1JHB A;  3Q19 A;  5IPH A;  1FVJ A;  1OC3 A;  3G9B A;  2VM1 A;  1SEN A;  4AJ7 A;  1T7P B;  2HI7 A;  5HR1 A;  20GS A;  4TR3 A;  3D6I A;  5GSS A;  2J9H A;  2CZ2 A;  6GSX A;  4DSR A;  4XTS A;  5ECI B;  5LCZ A;  4OMV A;  5IMF A;  1MDJ A;  2H6Y A;  3UAR A;  4NWY A;  2VAF A;  5F8B A;  2RUE A;  3O3T A;  4YQV A;  3DRN A;  4ZIL A;  1XW5 A;  5KN0 A;  1AUC A;  2O7K A;  1EWX A;  3GKK A;  4HDE A;  4XIH A;  2D2Z A;  1K0C A;  2ZCT A;  2PVQ A;  3D4T A;  1YKA A;  2PPT A;  4J56 E;  2C3N A;  2KHP A;  4POM A;  4ACS A;  2MYG A;  5J9C A;  3K8N A;  1X0R A;  2DMM A;  3DD3 A;  3H8Q A;  2H6X A;  3HKR A;  2L59 A;  3IK9 A;  3EYT A;  1PSQ A;  5HQP A;  2VL9 A;  2H70 A;  4MF6 A;  2H74 A;  3LFL A;  5HR2 A;  1SYR A;  2CVK A;  2AYT A;  2F51 A;  2WGR A;  1HNB A;  3I6A A;  1KEB A;  3PR8 A;  3GUR A;  1XW9 A;  2MMA A;  4N0V A;  1A8Y A;  2CQ9 A;  5JCW A;  3UL3 A;  2LNS A;  3WT2 A;  3ZLP A;  1M99 A;  1S3D A;  2P5Q A;  4X1U A;  3DGQ A;  1AIU A;  3I43 A;  1PX6 A;  2P5R A;  3PH9 A;  4FIW A;  3TCO A;  4ZB8 A;  3QOU A;  1M2D A;  1A23 A;  3BBY A;  1SJ6 A;  4F03 A;  3HJO A;  4XRD A;  1AQX A;  3KTL A;  3L9S A;  1CQH A;  1K0O A;  2C8U A;  4EDZ A;  2WS2 A;  1OC9 B;  2X8H A;  2RLI A;  5ECH B;  2L4Q A;  2GQK A;  4MH2 A;  2BJX A;  4Z7X A;  2K18 A;  1NM3 A;  3UEM A;  2EIO A;  4N11 A;  3RPP A;  5FHI A;  4TXO A;  1YKC A;  5ELG A;  1NW2 A;  2WRT A;  4ZBA A;  3TJG A;  3F0I A;  3KEB A;  3WGE A;  2ALB A;  1JZR A;  2CV4 A;  1O81 A;  3ERG A;  2CVB A;  4IBP A;  1QK8 A;  2J23 A;  1GL8 A;  5GAN D;  3M1G A;  2OKA A;  2NBS A;  3J7Y b;  2B1L A;  4IHU A;  1FW1 A;  1GSF A;  1E2Y A;  2TIR A;  1O73 A;  2YWO A;  4O5R A;  1GSU A;  17GS A;  3AY8 A;  5ECM B;  4ECC A;  4AJ8 A;  2B5X A;  4ZBB A;  3KTB A;  4TVE A;  3P7X A;  3EMP A;  5KEJ A;  1V9W A;  3CTF A;  3VWW A;  2R3X A;  2C4J A;  4Q5F A;  2VOC A;  1DUG A;  2JZR A;  1NHY A;  3WGD A;  4HJ2 A;  1OAZ A;  1SL0 B;  3VWX A;  3IHQ A;  1B9X C;  2M72 A;  4LMV A;  2NVL A;  1Z7P A;  3HVX A;  2P0G A;  1JZW A;  1GH2 A;  3QCP A;  4KGI A;  1K3L A;  2OE1 A;  1PL1 A;  2DJK A;  4BVY A;  1YF1 A;  1ABA A;  3LSZ A;  2HNL A;  2MZC A;  3ZTL A;  5IMC A;  4MF5 A;  3QAV A;  4MJC A;  2GTU A;  3F9U A;  4V2M A;  4KND A;  3VI5 A;  4K0N A;  1VF4 A;  2C3T A;  4O7H A;  1Z3E A;  1XWG A;  2H8L A;  4PUF C;  2JSY A;  4MF7 A;  4OCE A;  2H73 A;  1RQM A;  2ES7 A;  3O6T A;  6GST A;  4J2F A;  2KP2 A;  4NXI A;  1GUH A;  2DIZ A;  4FO5 A;  3LEF A;  1WE0 A;  1A2L A;  4TR1 B;  3UAP A;  4GXZ A;  3RHC A;  2YZH A;  1XFL A;  3BOA A;  1V57 A;  5D9V A;  4G2E A;  4OFM A;  4MDC A;  5E4W A;  1GUM A;  2CZ3 A;  4PGT A;  3M9J A;  4I2U A;  4IJI A;  4K1F A;  1N8J A;  3IR4 A;  5C00 A;  3TRQ A;  3ME7 A;  2X8C A;  1U87 A;  3GIX A;  2DIY A;  2GZZ A;  4Q5R A;  2MMO A;  1TRU A;  3IAM 2;  2CA8 A;  4TXV A;  2GSS A;  5IO0 A;  5C04 A;  3TKQ A;  12GS A;  2HT9 A;  4IQA A;  3D5J A;  3QFB C;  4PQH A;  2H0G A;  1QXH A;  3GL3 A;  3ZRD A;  4IEL A;  3TKS A;  4KDY A;  2YPM A;  4JR4 A;  4E8H A;  3ZFB A;  2PMT A;  4G10 A;  4IW9 A;  3GN3 A;  2HSY A;  2LRC A;  1ERT A;  1K3Y A;  1DSB A;  1HNA A;  1X9M B;  3RBT A;  2DJ1 A;  5DAL A;  1PD2 1;  2FHE A;  1YZX A;  3GH9 A;  2JZS A;  4IKH A;  2HSH A;  4RQR A;  5ID2 B;  1GSY A;  1Q98 A;  4XHM A;  4K7I A;  3EMX A;  2HFD A;  1O85 A;  1OE8 A;  3UMA A;  2C0E A;  1MEK A;  1AC1 A;  3DEX A;  3N5O A;  1GNE A;  3NIV A;  4GST A;  5IMZ A;  4JR6 A;  4KX4 A;  2WZ9 A;  1SK1 A;  4MZC A;  3GKN A;  3ZVJ A;  1G7E A;  4EF0 A;  2AV4 A;  3C7M A;  1PKZ A;  3CMI A;  1EV4 A;  1SKW B;  1TU8 A;  4N30 A;  4ZB9 A;  2VCZ A;  1MDI A;  3DML A;  3LG6 A;  1T4Y A;  3EVI A;  3IA1 A;  5B8B A;  1XWC A;  3MNG A;  1JZO A;  4P3Y B;  1GTI A;  2AHE A;  2XHF A;  6GSW A;  3ZYW A;  5IMA A;  2A4V A;  1TU7 A;  3EUR A;  3GRX A;  4GSN A;  1A8L A;  1FO5 A;  2ON7 A;  1CQG A;  11GS A;  4NMU A;  3KMO A;  3Q6O A;  3HVS A;  1F3A A;  4KAE A;  4X43 A;  4POB A;  1AW9 A;  4WXT A;  2IPA A;  3IDV A;  2YWM A;  5DDL A;  2HE3 A;  1SJZ A;  1H75 A;  1TJD A;  2H30 A;  3TOT A;  4WBR D;  4ID0 A;  3GL5 A;  4ZL8 A;  2GSQ A;  5A5K A;  2NPB A;  4MPF A;  2CX3 A;  3L0H A;  1W4V A;  1NSW A;  2RUF A;  4KDU A;  1X5D A;  3A5W A;  2B5Y A;  7GSS A;  1AQW A;  2IN3 A;  2FLS A;  1Z6M A;  2LUS A;  3DWV A;  2GSR A;  1ILO A;  4PX1 A;  1XVW A;  1N2A A;  5JCG A;  2EIQ A;  1K0M A;  4K8M A;  2H1D A;  1OYJ A;  1OKT A;  2E7P A;  3CSH A;  2OE0 A;  4HZ4 A;  5F05 A;  1EP8 A;  5AGY A;  1PA3 A;  1WIK A;  1IYH A;  1M0U A;  1T3B A;  3UJ1 A;  3IE3 A;  1Z5Y E;  2O8V B;  4FYB A;  2GQL A;  5EVO A;  4EDY A;  4GQF A;  2YOI A;  4I2T A;  5DAK B;  1ZGN A;  3G7J A;  3TB2 A;  2WB9 A;  13GS A;  3FYG A;  5F07 A;  3HHV A;  1ZYQ B;  2RII A;  3TJB A;  2YN1 A;  2H0H A;  1BG5 A;  1JLV A;  2H71 A;  5ELA A;  19GS A;  2AUV A;  2LTK A;  3L4N A;  2C1Y A;  5CRW A;  3DVW A;  1Z7R A;  3BCK A;  2DSA A;  3HJP A;  3P90 A;  3DYR A;  3VLN A;  1T8E B;  3GHA A;  2EIR A;  3ZMK A;  2TRC P;  5J5N A;  5D73 A;  4NAX A;  2YCD A;  4I6X A;  2LRT A;  2YJ7 A;  4V2N A;  1MTC A;  2YV7 A;  1R26 A;  1T1V A;  2GGT A;  1Q4J A;  4OFN A;  5DJM A;  1FAA A;  3N9J A;  5COH A;  4L5L A;  1F3B A;  2OBI A;  2RM5 A;  2VCX A;  4ULX A;  3BCI A;  2HZF A;  2WDU A;  5AN1 A;  1NHO A;  5ECP B;  1XOB A;  2X99 A;  4PQ1 A;  5G31 A;  1C72 A;  5FWG A;  2NTO A;  2WJU A;  2ON5 A;  3C71 A;  4GRF A;  1EEM A;  3EWL A;  3A3T A;  5HR0 A;  2PGT A;  3M3M A;  2O89 A;  2V6K A;  4ML6 A;  2O85 A;  1R4W A;  3ZIJ A;  3UVT A;  4NV5 A;  4JU5 A;  2B7J A;  3APO A;  5G30 A;  1E6B A;  2VM2 A;  3Q74 A;  3FZ5 A;  3MSZ A;  2H1A A;  2VL2 C;  5CO3 A;  5J3R A;  2I9H A;  2A2S A;  4ISD A;  2DLX A;  3IC4 A;  1HD2 A;  1DE1 A;  2VD1 A;  3LJR A;  2X8G A;  4TR4 A;  2VIM A;  3ZIT A;  4KW6 A;  2GZP A;  4KA0 A;  1TOF A;  5IOX A;  5EPF A;  2YP6 A;  1PMT A;  4RUV A;  1WRY A;  4MH3 A;  2IIY A;  2DC5 A;  4OO5 A;  2E2M A;  4TW5 A;  4WKW A;  2FGX A;  1EOH A;  3A2V A;  2R4V A;  4ZBD A;  4N10 A;  3E3E A;  3CSJ A;  1EOG A;  3MAK A;  1M2A A;  1JLW A;  1F6M C;  2H01 A;  2YV9 A;  1G6W A;  1QMV A;  2LJR A;  3U5R E;  3VFI A;  1TK0 B;  1U3A A;  2N5B A;  2VCV A;  3GX8 A;  2EC4 A;  5D9W A;  3UBK A;  4ILF A;  5H5Q A;  3LQ7 A;  1GTB A;  2H72 A;  2H19 A;  1LBK A;  4CW9 A;  3LXT A;  4AF2 A;  5EL8 A;  1B4P A;  2IFQ A;  1J9B A;  1I5G A;  1XBS A;  1AAZ A;  6GSU A;  2KLX A;  2VO4 A;  1LJR A;  1SKS B;  3LYP A;  3PGT A;  5IO2 A;  1G7O A;  4OFT A;  4EVM A;  2JAD A;  1JFU A;  3US3 A;  1M7T A;  3KP9 A;  4IS0 A;  2L6D A;  5G1K A;  4MP4 A;  3EU3 A;  4ML1 A;  3D21 A;  4HEA 2;  1M9A A;  4HQZ A;  1YQ1 A;  2DML A;  1VF1 A;  1ON4 A;  2CAI A;  3L9V A;  3LWA A;  1H4O A;  2I1U A;  4OWY A;  1EEJ A;  4PUR A;  22GS A;  3KH7 A;  2AJQ B;  5G5E A;  5LNK e;  3VPQ A;  5IOW A;  4KE3 A;  2QC7 A;  4O92 A;  4TXO B;  2IJY A;  4FYC A;  5CRE A;  5HFG A;  1TTZ A;  5GZZ B;  4L0W A;  1X9S B;  4KUN A;  3IPZ A;  1SJI A;  3A2X A;  3BD2 A;  1BAY A;  3FR3 A;  2MMZ A;  4ZL7 A;  2G0F A;  1GSD A;  3KJY A;  2IFQ B;  2CVD A;  1B48 A;  3GX0 A;  4ECB A;  1TW9 A;  1SD9 A;  1TRS A;  3KGK A;  5ECQ B;  1MD4 A;  2B7K A;  4EKZ A;  1PGT A;  3DKS A;  1GNW A;  5IIZ A;  1U6T A;  5KN3 A;  2BMX A;  2H76 A;  4HI7 A;  3HD5 A;  3MWH A;  1RK4 A;  4MA9 A;  4BWS A;  5ECO B; 
#chains in the Genus database with same CATH topology
 3C73 A;  8GSS A;  2FA8 A;  4XS4 A;  1K0D A;  1SL2 B;  5DCH A;  4EIQ A;  5A4V A;  2ZNM A;  1EP7 A;  4MJA A;  1F37 A;  4HUA A;  1BX9 A;  1S3C A;  3VWV A;  2VLV A;  4JRR A;  3IRA A;  3F63 A;  5G5F A;  3CBU A;  1BYE A;  1ZOF A;  2LV3 A;  2L5L A;  2C0F A;  3LGC A;  3FZ9 A;  2R0C A;  3FZ4 A;  3TRP A;  4LMW A;  3TKP A;  3PPU A;  4TKY A;  1VGL A;  2DJJ A;  4BVY B;  4TOP A;  4QQ7 A;  5ECO B;  4L0U A;  2N5A A;  3APQ A;  5ECL B;  2N5F A;  1TDI A;  2E0Q A;  3TOU A;  1FHE A;  4G0L A;  2E2G A;  3KH9 A;  1YEP A;  2OJL A;  2QSI A;  4MJE A;  1THO A;  5CP1 A;  2Z9S A;  3D0Z A;  3M8N A;  4EXJ A;  5KOW A;  4CHS A;  3TDG A;  1OE7 A;  2KOK A;  4YH2 A;  1AQV A;  1J08 A;  3HCZ A;  3P8W A;  4HOJ A;  3D4M A;  4HJM A;  3W8S A;  5HR3 A;  4JE1 A;  4AJ6 A;  2C80 A;  5JWO B;  4HS1 A;  1R7H A;  1GTA A;  3KP8 A;  1SD8 A;  3GUS A;  3I9V 2;  3L78 A;  4O5Q A;  2LJK A;  1PX7 A;  3KZQ A;  1ERV A;  4Q5Q A;  1B8X A;  1T00 A;  4ICY A;  2H6Z A;  4Q5N A;  2YWN A;  4D73 A;  3GH6 A;  1B4Q A;  4L5O A;  2VUP A;  5DBQ A;  2FNO A;  1G0T A;  4AGS A;  2IL3 A;  3KMN A;  2CT6 A;  3ZML A;  2LEG A;  1U88 A;  4MAB A;  1T4Z A;  1M2B A;  3V1W A;  3IOS A;  3ZZX A;  2QA2 A;  2GT6 A;  4O5U A;  1XWB A;  3FR9 A;  2I3Y A;  4RQX A;  2IMI A;  1ML6 A;  1ERU A;  1XWA A;  2VLU A;  3FY7 A;  1O7U A;  1GUL A;  1K3O A;  1KBN A;  1LU4 A;  2R2J A;  1JZD A;  1OC8 A;  4WR4 A;  3ZL5 A;  3R3E A;  3TJF A;  3M0F A;  3P2A A;  5HFI A;  1S3R A;  3GA4 A;  3NZN A;  4K6X A;  5CRG A;  2F8F A;  5DAL B;  4HU9 A;  4Z2T A;  1Z9H A;  2GVP A;  4ZIJ A;  2GLR A;  3CXG A;  3HA9 A;  4Z2R A;  2WCI A;  2FD3 A;  4XCS A;  5DQS A;  3CYN A;  1VF3 A;  2HRN A;  1XZO A;  3SWL A;  2F9S A;  1K0A A;  3SBC A;  4KF9 A;  2PVO C;  2LRN A;  4V1A p;  1X9W B;  4KCE A;  1A0F A;  3DXB A;  3TKS E;  3RPN A;  2IMK A;  3GYK A;  4I97 A;  1UC7 A;  4MJB A;  1BJX A;  4FH8 A;  4MCU A;  2L5O A;  3KD0 A;  5D9T A;  1O6J A;  1W89 A;  3CRU A;  1TP9 A;  4IVF A;  3HXS A;  5FT3 A;  3IHG A;  2XPE A;  5CRD A;  14GS A;  4O32 A;  2FUG 2;  1O8W A;  5DJL A;  3VWU A;  2ZUP A;  1V58 A;  2L57 A;  3ZRE A;  2AB6 A;  3HVN A;  5JWR B;  1XXU A;  3F4R A;  3IAS 2;  1TXX A;  5H5S A;  2PER A;  1DE2 A;  3GNJ A;  2NDO A;  3APS A;  4HZ2 A;  5B6N A;  3F6D A;  1YDK A;  1GSQ A;  4WF5 A;  1TK8 B;  2HZE A;  5DQY A;  1FB6 A;  2JZT A;  2VLT A;  18GS A;  1F9M A;  2MBS A;  1V40 A;  3FZA A;  3IC8 A;  4IGJ A;  1EGO A;  3MDK A;  5EY6 A;  4XS1 A;  3HJM A;  1WOU A;  5LD0 A;  4GWR A;  5DVB A;  2PWJ A;  1X5E A;  2X64 A;  4PUA A;  1UN2 A;  5KN2 A;  3QAW A;  4WBJ A;  3ERF A;  3HVV A;  4ECI A;  4PXO A;  2R5G A;  4K2D A;  5IMV A;  1Y25 A;  4FYU A;  9GSS A;  1A2J A;  4OD7 A;  5CRH A;  4NHW A;  5GST A;  1GLP A;  2YWI A;  2B1K A;  1HQO A;  3JCM L;  5D93 A;  4KSM A;  4MLY A;  1S3A A;  3GKM A;  4Z2U A;  4PNG A;  1TI1 A;  1ACV A;  1KTE A;  4YAV A;  3UVH A;  3GKX A;  3HZ8 A;  1WWJ A;  4LA1 A;  1QFN A;  4DSS A;  1XWK A;  4NPB A;  2A2R A;  5G2Z A;  1YEX A;  2K6V A;  3F8U A;  1ZZY A;  1UVZ A;  2LQQ A;  1FOV A;  4LLR A;  4V1A g;  3F4T A;  2X49 A;  2HZE B;  1OC9 A;  3KCM A;  4MZB A;  4G9H A;  2G2Q A;  3QAG A;  2JAC A;  2C0D A;  2H1G A;  4N0Z A;  4EC0 A;  2FA4 A;  4YQM A;  2FY6 A;  5JWQ B;  3M9K A;  4WEY A;  5DCG A;  5J9B A;  1XOA A;  3KM6 A;  1TRW A;  3UIW A;  2TRX A;  3J7Y k;  3QD9 A;  1YF0 A;  3FEU A;  4QL9 A;  5ECN B;  5HFK A;  2VD0 A;  5KN1 A;  3LXZ A;  3DVX A;  5IMD A;  4IP6 A;  4WF4 A;  4YAP A;  5E59 A;  2HRF A;  2JU5 A;  4NV2 A;  2K8S A;  2HYX A;  4PTS A;  2V41 A;  2JSZ A;  3KXO A;  1TKD B;  2FWH A;  3GST A;  2IME A;  3UOM A;  5GAP D;  5ECS A;  1WP0 A;  4HU7 A;  4K0G A;  16GS A;  1TRV A;  1XVQ A;  1I9D A;  1ST9 A;  2FWG A;  4DSS B;  2DBC A;  3QDN A;  2LKU A;  3L9U A;  4JBB A;  2R37 A;  4ZXG A;  2LNT A;  4IQ1 A;  3F3Q A;  1GSS A;  3ZVJ D;  4JZQ A;  2IWT A;  5D96 A;  4BL7 A;  3GMF A;  2WUL A;  6GSS A;  2IMD A;  3TKS C;  3TRX A;  4K7N A;  3BJ5 A;  3FW2 A;  2XPD A;  1M3J A;  3RHB A;  4F0B A;  1A0R P;  1OKD A;  1WPI A;  3HYP A;  4JED A;  3LOR A;  4KSO A;  3RAZ A;  1YY7 A;  3TJK A;  3VUR A;  4IN0 A;  2A4H A;  5ECR B;  2PN8 A;  4DSQ A;  3W6G A;  4GQC A;  1IYI A;  1SYX A;  1GSE A;  2R6K A;  3FR6 A;  3IXR A;  3CRT A;  2H1B A;  2BTO T;  4TRX A;  3EPT A;  3WGX A;  3GTU A;  5ECK B;  3QR6 A;  2CAQ A;  2R0G A;  2I81 A;  2YNX A;  5CAX A;  1THX A;  4PNF A;  2WFC A;  3ED3 A;  4MPG A;  4F2I A;  2L4C A;  3WT1 A;  2K8V A;  3RDW A;  4I8B A;  2I4A A;  3FK8 A;  1ERW A;  2B5E A;  4ZL9 A;  3O76 A;  1OVN A;  2VCT A;  2PU9 C;  2AAW A;  4L8E A;  1J0F A;  4I5Q A;  2DJ3 A;  5L71 A;  3PIN A;  4YQU A;  3G7Y A;  4GLT A;  4TR1 A;  2GS3 A;  4BL7 B;  1FOH A;  1HNC A;  4TR0 A;  4GF0 A;  2B6M A;  4OO4 A;  1USB A;  1VF2 A;  2GST A;  1PRX A;  4YKF A;  1B9Y C;  1XPV A;  2F8A A;  2QA1 A;  1PQN A;  3WYW A;  2V2G A;  2OA7 A;  5H5R A;  3MIX A;  3E9J B;  4H86 A;  1R5P A;  4WET A;  4MMM A;  3HY2 A;  4OCF A;  1WMJ A;  3EC3 A;  4RI7 A;  4TN8 A;  5BRT A;  4G0K A;  4GCI A;  4MZW A;  2DJ2 A;  2XBI A;  4V2L A;  2O87 A;  4DVC A;  2K9F A;  5A4W A;  3GTU B;  4A5P A;  2LST A;  1ZCP A;  4CDO A;  1FVK A;  1K0B A;  1DBY A;  3FRC A;  5F0G A;  1Z6N A;  3FKF A;  2OE3 A;  4KCA A;  2MBT A;  3F6F A;  1ZL9 A;  3IBH A;  4RI6 A;  4DEJ A;  4POK A;  2L6C A;  10GS A;  1XCC A;  2CX4 A;  5ENU A;  4F0C A;  1VRS D;  2VCQ A;  4QL7 A;  2LJA A;  5D8I A;  1SL1 B;  2XC2 A;  2VL2 A;  4POL A;  3TGZ A;  1R5A A;  4G19 A;  4EE0 A;  1PFO A;  5ID2 A;  4X0X A;  2KP1 A;  4MK3 A;  4EL1 A;  3GFK A;  6GSY A;  2XBQ A;  3F4S A;  4FQU A;  5IQY A;  4BWQ A;  4XS6 A;  1ZMA A;  1SKR B;  2PUK C;  4KH7 A;  1UA5 A;  3H1N A;  1ZYE A;  3E0U A;  6GSV A;  2V32 A;  2PBJ A;  3TKR A;  1WJK A;  3S9F A;  2VCW A;  1TK5 B;  5B8A A;  1XIY A;  3A5I A;  2QKE A;  3QMX A;  2DJ0 A;  1PN9 A;  2YZU A;  3HZ4 A;  4LL1 B;  1SU9 A;  1PL2 A;  1QQ2 A;  2GQM A;  1FB0 A;  2F3M A;  1GP1 A;  2OAC A;  4BIK A;  3W8J A;  1X5C A;  4GTU A;  3H4K A;  2IMF A;  1SK0 A;  3F3R A;  4HQS A;  4XS4 B;  4IJ3 A;  1YJ6 A;  4IP1 A;  3FHK A;  5KOX A;  3I69 A;  4BPY A;  2M80 A;  1GLQ A;  2REM A;  5JCU A;  3GV1 A;  3GSS A;  4KB3 A;  1BED A;  4GSS A;  3EU4 A;  5A4U A;  3QFA C;  4EO3 A;  3EIN A;  3IV4 A;  1FG4 A;  2OBK A;  3TJJ A;  5J41 A;  1XW6 A;  2B3S A;  3DIE A;  2LS5 A;  2LQO A;  1K0N A;  1BQ7 A;  3ZFL A;  1A2M A;  5B7C A;  1EV9 A;  1AXD A;  2RM6 A;  4MNN A;  4LL4 B;  2GDR A;  2H0I A;  1G6Y A;  1QUW A;  1HYU A;  2HXK A;  1EZK A;  1GTU A;  3G7I A;  1ZYN A;  3A2W A;  5CYY A;  5IPG A;  1A24 A;  5CNW A;  5AIX A;  3ISO A;  4E8E A;  5J4U A;  3TUE A;  2V6O A;  5AIV A;  1V2A A;  2GT5 A;  2C0G A;  3WD6 A;  1URM A;  3C1S A;  2H66 A;  3ZIV A;  4K9Z A;  3ME8 A;  2VL3 A;  1MDK A;  4YKG A;  2C3Q A;  5DAK A;  2X4A A;  5AIS A;  3ERW A;  4F9Z A;  1GRX A;  1EGR A;  4KDX A;  5INY A;  1M9B A;  2KUC A;  4XRA A;  5G1L A;  4J57 E;  4NHZ A;  4EUY A;  5B6M A;  5F06 A;  3D22 A;  5BMU A;  3VI7 A;  4D73 B;  2GZY A;  4ECJ A;  3OR5 A;  3VPT A;  2FWE A;  3KIJ A;  3IK7 A;  3C1R A;  2YAN A;  2R0P A;  4BVX A;  1GUK A;  1KNG A;  2JL4 A;  5IM9 A;  3NOF A;  2FWF A;  3R2Q A;  2H75 A;  5ABR A;  1TI3 A;  3H93 A;  4ZB6 A;  2HLS A;  3VK9 A;  4WR5 A;  2FCH A;  3C8E A;  1RW1 A;  4PQI A;  1SK2 A;  2YJH A;  1XG8 A;  3UBL A;  2P31 A;  4HSC X;  3Q18 A;  1MD3 A;  4K7O A;  1QGV A;  5D9X A;  1F2E A;  2M46 A;  3QPM A;  4F82 A;  2QGV A;  2MMN A;  1O8X A;  1V98 A;  2V1M A;  4BA7 A;  3CTG A;  3H79 A;  1GWC A;  1U3I A;  3LYK A;  1Y6E A;  3CSI A;  3EE2 A;  3HDC A;  2OAD A;  1PKW A;  3U6V A;  1JHB A;  3Q19 A;  5IPH A;  1FVJ A;  1OC3 A;  3G9B A;  2VM1 A;  1SEN A;  4AJ7 A;  1T7P B;  2HI7 A;  5HR1 A;  20GS A;  4TR3 A;  3D6I A;  5GSS A;  2J9H A;  2CZ2 A;  6GSX A;  4DSR A;  4XTS A;  5ECI B;  5LCZ A;  4OMV A;  5IMF A;  4BVX B;  1MDJ A;  2H6Y A;  3UAR A;  4NWY A;  2VAF A;  5F8B A;  2RUE A;  3O3T A;  4YQV A;  3DRN A;  4X4J A;  4ZIL A;  1XW5 A;  5KN0 A;  1AUC A;  2O7K A;  1EWX A;  3GKK A;  4HDE A;  4XIH A;  2D2Z A;  1K0C A;  2ZCT A;  2PVQ A;  3D4T A;  1YKA A;  2PPT A;  4USS A;  4J56 E;  2C3N A;  2KHP A;  4POM A;  4ACS A;  2MYG A;  5J9C A;  3K8N A;  1X0R A;  2DMM A;  3DD3 A;  3H8Q A;  2H6X A;  3HKR A;  2L59 A;  3IK9 A;  3EYT A;  1PSQ A;  5HQP A;  2VL9 A;  2H70 A;  4MF6 A;  2H74 A;  3LFL A;  5HR2 A;  1SYR A;  2CVK A;  2AYT A;  2F51 A;  4EIP A;  2WGR A;  1HNB A;  3I6A A;  1KEB A;  3PR8 A;  3GUR A;  1XW9 A;  2MMA A;  4N0V A;  1A8Y A;  2CQ9 A;  5JCW A;  3UL3 A;  2LNS A;  3WT2 A;  3ZLP A;  1M99 A;  1S3D A;  2P5Q A;  4X1U A;  3DGQ A;  1AIU A;  3I43 A;  1PX6 A;  2P5R A;  3PH9 A;  4FIW A;  3TCO A;  4ZB8 A;  2A2P A;  3QOU A;  1M2D A;  1A23 A;  3BBY A;  1SJ6 A;  4F03 A;  3HJO A;  4K5S A;  4XRD A;  1AQX A;  3KTL A;  3L9S A;  1CQH A;  1K0O A;  2C8U A;  4EDZ A;  2WS2 A;  1OC9 B;  2X8H A;  2RLI A;  5ECH B;  2DKI A;  2L4Q A;  2GQK A;  4MH2 A;  2BJX A;  3LW9 A;  4Z7X A;  2K18 A;  1NM3 A;  3UEM A;  2EIO A;  4N11 A;  3RPP A;  5FHI A;  4TXO A;  1YKC A;  5ELG A;  1NW2 A;  2WRT A;  4ZBA A;  3TJG A;  3F0I A;  3KEB A;  3WGE A;  2ALB A;  1JZR A;  2CV4 A;  1O81 A;  3ERG A;  2CVB A;  4IBP A;  1QK8 A;  2J23 A;  1GL8 A;  5GAN D;  3M1G A;  2OKA A;  2NBS A;  3J7Y b;  2B1L A;  4IHU A;  1FW1 A;  1GSF A;  1E2Y A;  2TIR A;  1O73 A;  2YWO A;  4O5R A;  1GSU A;  17GS A;  3AY8 A;  5ECM B;  4ECC A;  4AJ8 A;  2B5X A;  4ZBB A;  3KTB A;  4TVE A;  3P7X A;  3EMP A;  5KEJ A;  1V9W A;  3CTF A;  3VWW A;  2R3X A;  2C4J A;  4Q5F A;  2VOC A;  1DUG A;  2JZR A;  1NHY A;  3WGD A;  4HJ2 A;  1OAZ A;  1SL0 B;  3VWX A;  3IHQ A;  1B9X C;  2M72 A;  2UZ8 A;  4LMV A;  2NVL A;  1Z7P A;  3HVX A;  2P0G A;  1JZW A;  1GH2 A;  3QCP A;  4KGI A;  1K3L A;  2OE1 A;  1PL1 A;  2DJK A;  4BVY A;  1YF1 A;  1ABA A;  3LSZ A;  2HNL A;  2MZC A;  3ZTL A;  5IMC A;  4MF5 A;  3QAV A;  4MJC A;  2GTU A;  3F9U A;  4V2M A;  4KND A;  3VI5 A;  4K0N A;  1VF4 A;  2C3T A;  4O7H A;  1Z3E A;  1XWG A;  2H8L A;  4PUF C;  2JSY A;  4MF7 A;  4OCE A;  2H73 A;  1RQM A;  2ES7 A;  3O6T A;  6GST A;  4J2F A;  2KP2 A;  4NXI A;  1GUH A;  2DIZ A;  4FO5 A;  3LEF A;  1WE0 A;  1A2L A;  4TR1 B;  3UAP A;  4GXZ A;  3RHC A;  2YZH A;  1XFL A;  3BOA A;  1V57 A;  4K5R A;  5D9V A;  4G2E A;  4OFM A;  4MDC A;  5E4W A;  1GUM A;  2CZ3 A;  4PGT A;  3M9J A;  4I2U A;  4IJI A;  4K1F A;  1N8J A;  3IR4 A;  5C00 A;  3TRQ A;  3ME7 A;  2X8C A;  1U87 A;  3GIX A;  2DIY A;  2GZZ A;  4Q5R A;  2MMO A;  3MYD A;  1TRU A;  3IAM 2;  2CA8 A;  4TXV A;  2GSS A;  5IO0 A;  5C04 A;  3TKQ A;  12GS A;  2HT9 A;  4IQA A;  3D5J A;  3QFB C;  4PQH A;  2H0G A;  1QXH A;  3GL3 A;  3ZRD A;  4IEL A;  3TKS A;  4KDY A;  2YPM A;  4JR4 A;  4E8H A;  3ZFB A;  2PMT A;  4G10 A;  4IW9 A;  3GN3 A;  2HSY A;  2LRC A;  1ERT A;  1K3Y A;  1DSB A;  1HNA A;  1X9M B;  3RBT A;  2DJ1 A;  5DAL A;  1PD2 1;  2FHE A;  1YZX A;  3GH9 A;  2JZS A;  4IKH A;  2HSH A;  4RQR A;  5ID2 B;  1GSY A;  1Q98 A;  4XHM A;  4K7I A;  3EMX A;  2HFD A;  1O85 A;  1OE8 A;  3UMA A;  2C0E A;  1MEK A;  1AC1 A;  3DEX A;  3N5O A;  1GNE A;  3NIV A;  4GST A;  5IMZ A;  1ZYP A;  4JR6 A;  4KX4 A;  2WZ9 A;  1SK1 A;  4MZC A;  3GKN A;  3ZVJ A;  1G7E A;  4EF0 A;  2AV4 A;  3C7M A;  1PKZ A;  3CMI A;  1EV4 A;  1SKW B;  1TU8 A;  4N30 A;  4ZB9 A;  2VCZ A;  1MDI A;  3DML A;  3LG6 A;  1T4Y A;  3EVI A;  3IA1 A;  5B8B A;  1XWC A;  3MNG A;  1JZO A;  4P3Y B;  1GTI A;  2AHE A;  2XHF A;  6GSW A;  3ZYW A;  5IMA A;  2A4V A;  1TU7 A;  3EUR A;  3GRX A;  4GSN A;  1A8L A;  4CY8 A;  1FO5 A;  2ON7 A;  1CQG A;  11GS A;  4NMU A;  3KMO A;  3Q6O A;  3HVS A;  1F3A A;  4KAE A;  4X43 A;  4POB A;  1AW9 A;  4WXT A;  2IPA A;  3IDV A;  2YWM A;  5DDL A;  2HE3 A;  1SJZ A;  1H75 A;  1TJD A;  2H30 A;  3TOT A;  4WBR D;  4ID0 A;  3GL5 A;  4K2X A;  4ZL8 A;  2GSQ A;  5A5K A;  2NPB A;  4MPF A;  2CX3 A;  3L0H A;  1W4V A;  1NSW A;  2RUF A;  4KDU A;  1X5D A;  3A5W A;  2B5Y A;  7GSS A;  1AQW A;  2IN3 A;  2FLS A;  1Z6M A;  2LUS A;  3DWV A;  2GSR A;  1ILO A;  4PX1 A;  1XVW A;  1N2A A;  5JCG A;  2EIQ A;  1K0M A;  4K8M A;  2H1D A;  1OYJ A;  1OKT A;  2E7P A;  3CSH A;  2OE0 A;  4HZ4 A;  5F05 A;  1EP8 A;  5AGY A;  1PA3 A;  1WIK A;  1IYH A;  1M0U A;  1T3B A;  3UJ1 A;  3IE3 A;  1Z5Y E;  2O8V B;  4FYB A;  2GQL A;  5EVO A;  4EDY A;  4GQF A;  2YOI A;  4I2T A;  5DAK B;  1ZGN A;  3G7J A;  3TB2 A;  2WB9 A;  13GS A;  3FYG A;  5F07 A;  3HHV A;  1ZYQ B;  2RII A;  3TJB A;  2YN1 A;  2H0H A;  1BG5 A;  1JLV A;  2H71 A;  5ELA A;  19GS A;  2AUV A;  2LTK A;  3L4N A;  2C1Y A;  5CRW A;  3DVW A;  1Z7R A;  3BCK A;  2DSA A;  3HJP A;  3P90 A;  3DYR A;  3VLN A;  1T8E B;  3GHA A;  4G0I A;  2HRA A;  2EIR A;  3ZMK A;  2TRC P;  5J5N A;  5D73 A;  4NAX A;  2YCD A;  4I6X A;  2LRT A;  2YJ7 A;  4V2N A;  1MTC A;  2YV7 A;  1R26 A;  1T1V A;  2GGT A;  1Q4J A;  4OFN A;  5DJM A;  1FAA A;  3N9J A;  5COH A;  4L5L A;  1F3B A;  2OBI A;  2RM5 A;  2VCX A;  4ULX A;  3BCI A;  2HZF A;  2WDU A;  5AN1 A;  1NHO A;  5ECP B;  1XOB A;  2X99 A;  4PQ1 A;  5G31 A;  1C72 A;  5FWG A;  2NTO A;  2WJU A;  2ON5 A;  3C71 A;  4GRF A;  1EEM A;  3EWL A;  3A3T A;  5HR0 A;  2PGT A;  3M3M A;  2O89 A;  2V6K A;  4ML6 A;  2O85 A;  1R4W A;  3CQF A;  3ZIJ A;  3UVT A;  4NV5 A;  4JU5 A;  2B7J A;  3APO A;  5G30 A;  1E6B A;  2VM2 A;  3Q74 A;  3FZ5 A;  3MSZ A;  2H1A A;  2VL2 C;  5CO3 A;  5J3R A;  2I9H A;  2A2S A;  4ISD A;  2DLX A;  3IC4 A;  1HD2 A;  1DE1 A;  2VD1 A;  3LJR A;  2X8G A;  4TR4 A;  2VIM A;  3ZIT A;  4KW6 A;  2GZP A;  4KA0 A;  1TOF A;  5IOX A;  5EPF A;  2YP6 A;  1PMT A;  4RUV A;  1WRY A;  4MH3 A;  4WKW A;  2DC5 A;  2IIY A;  2E2M A;  4OO5 A;  4TW5 A;  2FGX A;  1EOH A;  3A2V A;  2R4V A;  4ZBD A;  4N10 A;  3E3E A;  3CSJ A;  1EOG A;  3MAK A;  1M2A A;  1JLW A;  1F6M C;  2H01 A;  2YV9 A;  1G6W A;  1QMV A;  2LJR A;  3U5R E;  3VFI A;  1TK0 B;  1U3A A;  2N5B A;  1PN0 A;  2VCV A;  3GX8 A;  2EC4 A;  5D9W A;  3UBK A;  4ILF A;  5H5Q A;  3LQ7 A;  1GTB A;  2H72 A;  2H19 A;  1LBK A;  4CW9 A;  3LXT A;  4AF2 A;  2DKH A;  5EL8 A;  2IFQ A;  1J9B A;  1I5G A;  1XBS A;  1AAZ A;  6GSU A;  2KLX A;  2VO4 A;  1LJR A;  1SKS B;  3LYP A;  3PGT A;  5IO2 A;  1G7O A;  4OFT A;  4EVM A;  2JAD A;  1JFU A;  3US3 A;  1M7T A;  3KP9 A;  4IS0 A;  2L6D A;  5G1K A;  4MP4 A;  3EU3 A;  4ML1 A;  3D21 A;  4HEA 2;  1M9A A;  4HQZ A;  1YQ1 A;  2DML A;  1VF1 A;  1ON4 A;  2CAI A;  4CY6 A;  3L9V A;  3LWA A;  1H4O A;  3FMW A;  2I1U A;  4OWY A;  1EEJ A;  4PUR A;  22GS A;  3KH7 A;  2AJQ B;  5G5E A;  2HSM A;  5LNK e;  3VPQ A;  5IOW A;  4KE3 A;  2QC7 A;  4O92 A;  4TXO B;  2IJY A;  4FYC A;  5CRE A;  5HFG A;  1TTZ A;  5GZZ B;  4L0W A;  1X9S B;  4KUN A;  3IPZ A;  1SJI A;  3A2X A;  3BD2 A;  1BAY A;  3FR3 A;  2MMZ A;  4ZL7 A;  2G0F A;  1GSD A;  3KJY A;  2IFQ B;  2CVD A;  1B48 A;  3GX0 A;  4ECB A;  1TW9 A;  1SD9 A;  1TRS A;  3KGK A;  5ECQ B;  1MD4 A;  2HRK A;  2B7K A;  4EKZ A;  1PGT A;  3DKS A;  1GNW A;  5IIZ A;  1U6T A;  5KN3 A;  2BMX A;  2H76 A;  4HI7 A;  3HD5 A;  3MWH A;  1RK4 A;  4MA9 A;  4BWS A;  1M3I A;  1B4P A; 
#chains in the Genus database with same CATH homology
 3C73 A;  8GSS A;  2FA8 A;  4XS4 A;  1K0D A;  1SL2 B;  5DCH A;  4EIQ A;  5A4V A;  2ZNM A;  1EP7 A;  4MJA A;  1F37 A;  4HUA A;  1BX9 A;  1S3C A;  3VWV A;  2VLV A;  4JRR A;  3IRA A;  3F63 A;  5G5F A;  3CBU A;  1BYE A;  1ZOF A;  2LV3 A;  2L5L A;  2C0F A;  3LGC A;  3FZ9 A;  2R0C A;  3FZ4 A;  3TRP A;  4LMW A;  3TKP A;  3PPU A;  4TKY A;  1VGL A;  2DJJ A;  4BVY B;  4TOP A;  4QQ7 A;  5ECO B;  4L0U A;  2N5A A;  3APQ A;  5ECL B;  2N5F A;  1TDI A;  2E0Q A;  3TOU A;  1FHE A;  4G0L A;  2E2G A;  3KH9 A;  1YEP A;  2OJL A;  2QSI A;  4MJE A;  1THO A;  5CP1 A;  2Z9S A;  3D0Z A;  3M8N A;  4EXJ A;  5KOW A;  4CHS A;  3TDG A;  1OE7 A;  2KOK A;  4YH2 A;  1AQV A;  1J08 A;  3HCZ A;  3P8W A;  4HOJ A;  3D4M A;  4HJM A;  3W8S A;  5HR3 A;  4JE1 A;  4AJ6 A;  2C80 A;  5JWO B;  4HS1 A;  1R7H A;  1GTA A;  3KP8 A;  1SD8 A;  3GUS A;  3I9V 2;  3L78 A;  4O5Q A;  2LJK A;  1PX7 A;  3KZQ A;  1ERV A;  4Q5Q A;  1B8X A;  1T00 A;  4ICY A;  2H6Z A;  4Q5N A;  2YWN A;  4D73 A;  3GH6 A;  1B4Q A;  4L5O A;  2VUP A;  5DBQ A;  2FNO A;  1G0T A;  4AGS A;  2IL3 A;  3KMN A;  2CT6 A;  3ZML A;  2LEG A;  1U88 A;  4MAB A;  1T4Z A;  1M2B A;  3V1W A;  3IOS A;  3ZZX A;  2QA2 A;  2GT6 A;  4O5U A;  1XWB A;  3FR9 A;  2I3Y A;  4RQX A;  2IMI A;  1ML6 A;  1ERU A;  1XWA A;  2VLU A;  3FY7 A;  1O7U A;  1GUL A;  1K3O A;  1KBN A;  1LU4 A;  2R2J A;  1JZD A;  1OC8 A;  4WR4 A;  3ZL5 A;  3R3E A;  3TJF A;  3M0F A;  3P2A A;  5HFI A;  3NZN A;  3GA4 A;  4K6X A;  5CRG A;  2F8F A;  5DAL B;  4HU9 A;  4Z2T A;  1Z9H A;  2GVP A;  4ZIJ A;  2GLR A;  3CXG A;  3HA9 A;  4Z2R A;  2WCI A;  2FD3 A;  4XCS A;  5DQS A;  3CYN A;  1VF3 A;  2HRN A;  1XZO A;  3SWL A;  2F9S A;  1K0A A;  3SBC A;  4KF9 A;  2PVO C;  2LRN A;  4V1A p;  1X9W B;  4KCE A;  1A0F A;  3DXB A;  3TKS E;  3RPN A;  2IMK A;  3GYK A;  4I97 A;  1UC7 A;  4MJB A;  1BJX A;  4FH8 A;  4MCU A;  2L5O A;  3KD0 A;  5D9T A;  1O6J A;  1W89 A;  3CRU A;  1TP9 A;  4IVF A;  3HXS A;  5FT3 A;  3IHG A;  2XPE A;  5CRD A;  14GS A;  4O32 A;  2FUG 2;  1O8W A;  5DJL A;  3VWU A;  2ZUP A;  1V58 A;  2L57 A;  3ZRE A;  2AB6 A;  5JWR B;  1XXU A;  3F4R A;  3IAS 2;  1TXX A;  5H5S A;  2PER A;  1DE2 A;  3GNJ A;  2NDO A;  3APS A;  4HZ2 A;  5B6N A;  3F6D A;  1YDK A;  1GSQ A;  4WF5 A;  1TK8 B;  2HZE A;  5DQY A;  1FB6 A;  2JZT A;  2VLT A;  18GS A;  1F9M A;  2MBS A;  1V40 A;  3FZA A;  3IC8 A;  4IGJ A;  1EGO A;  3MDK A;  5EY6 A;  4XS1 A;  3HJM A;  1WOU A;  5LD0 A;  4GWR A;  5DVB A;  2PWJ A;  1X5E A;  2X64 A;  4PUA A;  1UN2 A;  5KN2 A;  3QAW A;  4WBJ A;  3ERF A;  3HVV A;  4ECI A;  4PXO A;  2R5G A;  4K2D A;  5IMV A;  1Y25 A;  4FYU A;  9GSS A;  1A2J A;  4OD7 A;  5CRH A;  4NHW A;  5GST A;  1GLP A;  2YWI A;  2B1K A;  1HQO A;  3JCM L;  5D93 A;  4KSM A;  4MLY A;  1S3A A;  3GKM A;  4Z2U A;  4PNG A;  1TI1 A;  1ACV A;  1KTE A;  4YAV A;  3UVH A;  3GKX A;  3HZ8 A;  1WWJ A;  4LA1 A;  1QFN A;  4DSS A;  1XWK A;  4NPB A;  2A2R A;  5G2Z A;  1YEX A;  2K6V A;  3F8U A;  1ZZY A;  1UVZ A;  2LQQ A;  1FOV A;  4LLR A;  4V1A g;  3F4T A;  2X49 A;  2HZE B;  1OC9 A;  3KCM A;  4MZB A;  4G9H A;  2G2Q A;  3QAG A;  2JAC A;  2C0D A;  2H1G A;  4N0Z A;  4EC0 A;  2FA4 A;  4YQM A;  2FY6 A;  5JWQ B;  3M9K A;  4WEY A;  5DCG A;  5J9B A;  1XOA A;  3KM6 A;  1TRW A;  3UIW A;  2TRX A;  3J7Y k;  3QD9 A;  1YF0 A;  3FEU A;  4QL9 A;  5ECN B;  5HFK A;  2VD0 A;  5KN1 A;  3LXZ A;  3DVX A;  5IMD A;  4IP6 A;  4WF4 A;  4YAP A;  5E59 A;  2HRF A;  2JU5 A;  4NV2 A;  2K8S A;  2HYX A;  4PTS A;  2V41 A;  2JSZ A;  3KXO A;  1TKD B;  2FWH A;  3GST A;  2IME A;  3UOM A;  5GAP D;  5ECS A;  1WP0 A;  4HU7 A;  4K0G A;  16GS A;  1TRV A;  1XVQ A;  1I9D A;  1ST9 A;  2FWG A;  4DSS B;  2DBC A;  3QDN A;  2LKU A;  3L9U A;  4JBB A;  2R37 A;  4ZXG A;  2LNT A;  4IQ1 A;  3F3Q A;  1GSS A;  3ZVJ D;  4JZQ A;  2IWT A;  5D96 A;  4BL7 A;  3GMF A;  2WUL A;  6GSS A;  2IMD A;  3TKS C;  3TRX A;  4K7N A;  3BJ5 A;  3FW2 A;  2XPD A;  3RHB A;  4F0B A;  1A0R P;  1OKD A;  1WPI A;  3HYP A;  4JED A;  3LOR A;  4KSO A;  3RAZ A;  1YY7 A;  3TJK A;  3VUR A;  4IN0 A;  2A4H A;  5ECR B;  2PN8 A;  4DSQ A;  3W6G A;  4GQC A;  1IYI A;  1SYX A;  1GSE A;  2R6K A;  3FR6 A;  3IXR A;  3CRT A;  2H1B A;  2BTO T;  4TRX A;  3EPT A;  3WGX A;  3GTU A;  5ECK B;  3QR6 A;  2CAQ A;  2R0G A;  2I81 A;  2YNX A;  5CAX A;  1THX A;  4PNF A;  2WFC A;  3ED3 A;  4MPG A;  4F2I A;  2L4C A;  3WT1 A;  2K8V A;  3RDW A;  4I8B A;  2I4A A;  3FK8 A;  1ERW A;  2B5E A;  4ZL9 A;  3O76 A;  1OVN A;  2VCT A;  2PU9 C;  2AAW A;  4L8E A;  1J0F A;  4I5Q A;  2DJ3 A;  5L71 A;  3PIN A;  4YQU A;  3G7Y A;  4GLT A;  4TR1 A;  2GS3 A;  4BL7 B;  1FOH A;  1HNC A;  4TR0 A;  4GF0 A;  2B6M A;  4OO4 A;  1USB A;  1VF2 A;  2GST A;  1PRX A;  4YKF A;  1B9Y C;  1XPV A;  2F8A A;  2QA1 A;  1PQN A;  3WYW A;  2V2G A;  2OA7 A;  5H5R A;  3MIX A;  3E9J B;  4H86 A;  1R5P A;  4WET A;  4MMM A;  3HY2 A;  4OCF A;  1WMJ A;  3EC3 A;  4RI7 A;  4TN8 A;  5BRT A;  4G0K A;  4GCI A;  4MZW A;  2DJ2 A;  2XBI A;  4V2L A;  2O87 A;  4DVC A;  2K9F A;  5A4W A;  3GTU B;  4A5P A;  2LST A;  1ZCP A;  4CDO A;  1FVK A;  1K0B A;  1DBY A;  3FRC A;  5F0G A;  1Z6N A;  3FKF A;  2OE3 A;  4KCA A;  2MBT A;  3F6F A;  1ZL9 A;  3IBH A;  4RI6 A;  4DEJ A;  4POK A;  2L6C A;  10GS A;  1XCC A;  2CX4 A;  5ENU A;  4F0C A;  1VRS D;  2VCQ A;  4QL7 A;  2LJA A;  5D8I A;  1SL1 B;  2XC2 A;  2VL2 A;  4POL A;  3TGZ A;  1R5A A;  4G19 A;  4EE0 A;  5ID2 A;  4X0X A;  2KP1 A;  4MK3 A;  4EL1 A;  3GFK A;  6GSY A;  2XBQ A;  3F4S A;  4FQU A;  5IQY A;  4BWQ A;  4XS6 A;  1ZMA A;  1SKR B;  2PUK C;  4KH7 A;  1UA5 A;  3H1N A;  1ZYE A;  3E0U A;  6GSV A;  2V32 A;  2PBJ A;  3TKR A;  1WJK A;  3S9F A;  2VCW A;  1TK5 B;  5B8A A;  1XIY A;  3A5I A;  2QKE A;  3QMX A;  2DJ0 A;  1PN9 A;  2YZU A;  3HZ4 A;  4LL1 B;  1SU9 A;  1PL2 A;  1QQ2 A;  2GQM A;  1FB0 A;  2F3M A;  1GP1 A;  2OAC A;  3W8J A;  1X5C A;  4GTU A;  3H4K A;  2IMF A;  1SK0 A;  3F3R A;  4HQS A;  4XS4 B;  4IJ3 A;  1YJ6 A;  4IP1 A;  3FHK A;  5KOX A;  3I69 A;  4BPY A;  2M80 A;  1GLQ A;  2REM A;  5JCU A;  3GV1 A;  3GSS A;  4KB3 A;  1BED A;  4GSS A;  3EU4 A;  5A4U A;  3QFA C;  4EO3 A;  3EIN A;  3IV4 A;  1FG4 A;  2OBK A;  3TJJ A;  5J41 A;  1XW6 A;  2B3S A;  3DIE A;  2LS5 A;  2LQO A;  1K0N A;  1BQ7 A;  3ZFL A;  1A2M A;  5B7C A;  1EV9 A;  1AXD A;  2RM6 A;  4MNN A;  4LL4 B;  2GDR A;  2H0I A;  1G6Y A;  1QUW A;  1HYU A;  2HXK A;  1EZK A;  1GTU A;  3G7I A;  1ZYN A;  3A2W A;  5CYY A;  5IPG A;  1A24 A;  5CNW A;  5AIX A;  3ISO A;  4E8E A;  5J4U A;  3TUE A;  2V6O A;  5AIV A;  1V2A A;  2GT5 A;  2C0G A;  3WD6 A;  1URM A;  3C1S A;  2H66 A;  3ZIV A;  4K9Z A;  3ME8 A;  2VL3 A;  1MDK A;  4YKG A;  2C3Q A;  5DAK A;  2X4A A;  5AIS A;  3ERW A;  4F9Z A;  1GRX A;  1EGR A;  4KDX A;  5INY A;  1M9B A;  2KUC A;  4XRA A;  5G1L A;  4J57 E;  4NHZ A;  4EUY A;  5B6M A;  5F06 A;  3D22 A;  5BMU A;  3VI7 A;  4D73 B;  2GZY A;  4ECJ A;  3OR5 A;  3VPT A;  2FWE A;  3KIJ A;  3IK7 A;  3C1R A;  2YAN A;  2R0P A;  4BVX A;  1GUK A;  1KNG A;  2JL4 A;  5IM9 A;  3NOF A;  2FWF A;  3R2Q A;  2H75 A;  5ABR A;  1TI3 A;  3H93 A;  4ZB6 A;  2HLS A;  3VK9 A;  4WR5 A;  2FCH A;  3C8E A;  1RW1 A;  4PQI A;  1SK2 A;  2YJH A;  3UBL A;  2P31 A;  3Q18 A;  1MD3 A;  4K7O A;  1QGV A;  5D9X A;  1F2E A;  2M46 A;  3QPM A;  4F82 A;  2QGV A;  2MMN A;  1O8X A;  1V98 A;  2V1M A;  4BA7 A;  3CTG A;  3H79 A;  1GWC A;  1U3I A;  3LYK A;  1Y6E A;  3CSI A;  3EE2 A;  3HDC A;  2OAD A;  1PKW A;  3U6V A;  1JHB A;  3Q19 A;  5IPH A;  1FVJ A;  1OC3 A;  3G9B A;  2VM1 A;  1SEN A;  4AJ7 A;  1T7P B;  2HI7 A;  5HR1 A;  20GS A;  4TR3 A;  3D6I A;  5GSS A;  2J9H A;  2CZ2 A;  6GSX A;  4DSR A;  4XTS A;  5ECI B;  5LCZ A;  4OMV A;  5IMF A;  4BVX B;  1MDJ A;  2H6Y A;  3UAR A;  4NWY A;  2VAF A;  5F8B A;  2RUE A;  3O3T A;  4YQV A;  3DRN A;  4X4J A;  4ZIL A;  1XW5 A;  5KN0 A;  1AUC A;  2O7K A;  1EWX A;  3GKK A;  4HDE A;  4XIH A;  2D2Z A;  1K0C A;  2ZCT A;  2PVQ A;  3D4T A;  1YKA A;  2PPT A;  4USS A;  4J56 E;  2C3N A;  2KHP A;  4POM A;  4ACS A;  2MYG A;  5J9C A;  3K8N A;  1X0R A;  2DMM A;  3DD3 A;  3H8Q A;  2H6X A;  3HKR A;  2L59 A;  3IK9 A;  3EYT A;  1PSQ A;  5HQP A;  2VL9 A;  2H70 A;  4MF6 A;  2H74 A;  3LFL A;  5HR2 A;  1SYR A;  2CVK A;  2AYT A;  2F51 A;  4EIP A;  2WGR A;  1HNB A;  3I6A A;  1KEB A;  3PR8 A;  3GUR A;  1XW9 A;  2MMA A;  4N0V A;  1A8Y A;  2CQ9 A;  5JCW A;  3UL3 A;  2LNS A;  3WT2 A;  3ZLP A;  1M99 A;  1S3D A;  2P5Q A;  4X1U A;  3DGQ A;  1AIU A;  3I43 A;  1PX6 A;  2P5R A;  3PH9 A;  4FIW A;  3TCO A;  4ZB8 A;  2A2P A;  3QOU A;  1M2D A;  1A23 A;  3BBY A;  1SJ6 A;  4F03 A;  3HJO A;  4K5S A;  4XRD A;  1AQX A;  3KTL A;  3L9S A;  1CQH A;  1K0O A;  2C8U A;  4EDZ A;  2WS2 A;  1OC9 B;  2X8H A;  2RLI A;  5ECH B;  2DKI A;  2L4Q A;  2GQK A;  4MH2 A;  2BJX A;  3LW9 A;  4Z7X A;  2K18 A;  1NM3 A;  3UEM A;  2EIO A;  4N11 A;  3RPP A;  5FHI A;  4TXO A;  1YKC A;  5ELG A;  1NW2 A;  2WRT A;  4ZBA A;  3TJG A;  3F0I A;  3KEB A;  3WGE A;  2ALB A;  1JZR A;  2CV4 A;  1O81 A;  3ERG A;  2CVB A;  4IBP A;  1QK8 A;  2J23 A;  1GL8 A;  5GAN D;  3M1G A;  2OKA A;  2NBS A;  3J7Y b;  2B1L A;  4IHU A;  1FW1 A;  1GSF A;  1E2Y A;  2TIR A;  1O73 A;  2YWO A;  4O5R A;  1GSU A;  17GS A;  3AY8 A;  5ECM B;  4ECC A;  4AJ8 A;  2B5X A;  4ZBB A;  3KTB A;  4TVE A;  3P7X A;  3EMP A;  5KEJ A;  1V9W A;  3CTF A;  3VWW A;  2R3X A;  2C4J A;  4Q5F A;  2VOC A;  1DUG A;  2JZR A;  1NHY A;  3WGD A;  4HJ2 A;  1OAZ A;  1SL0 B;  3VWX A;  3IHQ A;  1B9X C;  2M72 A;  2UZ8 A;  4LMV A;  2NVL A;  1Z7P A;  3HVX A;  2P0G A;  1JZW A;  1GH2 A;  3QCP A;  4KGI A;  1K3L A;  2OE1 A;  1PL1 A;  2DJK A;  4BVY A;  1YF1 A;  1ABA A;  3LSZ A;  2HNL A;  2MZC A;  3ZTL A;  5IMC A;  4MF5 A;  3QAV A;  4MJC A;  2GTU A;  3F9U A;  4V2M A;  4KND A;  3VI5 A;  4K0N A;  1VF4 A;  2C3T A;  4O7H A;  1Z3E A;  1XWG A;  2H8L A;  4PUF C;  2JSY A;  4MF7 A;  4OCE A;  2H73 A;  1RQM A;  2ES7 A;  3O6T A;  6GST A;  4J2F A;  2KP2 A;  4NXI A;  1GUH A;  2DIZ A;  4FO5 A;  3LEF A;  1WE0 A;  1A2L A;  4TR1 B;  3UAP A;  4GXZ A;  3RHC A;  2YZH A;  1XFL A;  3BOA A;  1V57 A;  4K5R A;  5D9V A;  4G2E A;  4OFM A;  4MDC A;  5E4W A;  1GUM A;  2CZ3 A;  4PGT A;  3M9J A;  4I2U A;  4IJI A;  4K1F A;  1N8J A;  3IR4 A;  5C00 A;  3TRQ A;  3ME7 A;  2X8C A;  1U87 A;  3GIX A;  2DIY A;  2GZZ A;  4Q5R A;  2MMO A;  3MYD A;  1TRU A;  3IAM 2;  2CA8 A;  4TXV A;  2GSS A;  5IO0 A;  5C04 A;  3TKQ A;  12GS A;  2HT9 A;  4IQA A;  3D5J A;  3QFB C;  4PQH A;  2H0G A;  1QXH A;  3GL3 A;  3ZRD A;  4IEL A;  3TKS A;  4KDY A;  2YPM A;  4JR4 A;  4E8H A;  3ZFB A;  2PMT A;  4G10 A;  4IW9 A;  3GN3 A;  2HSY A;  2LRC A;  1ERT A;  1K3Y A;  1DSB A;  1HNA A;  1X9M B;  3RBT A;  2DJ1 A;  5DAL A;  1PD2 1;  2FHE A;  1YZX A;  3GH9 A;  2JZS A;  4IKH A;  2HSH A;  4RQR A;  5ID2 B;  1GSY A;  1Q98 A;  4XHM A;  4K7I A;  3EMX A;  2HFD A;  1O85 A;  1OE8 A;  3UMA A;  2C0E A;  1MEK A;  1AC1 A;  3DEX A;  3N5O A;  1GNE A;  3NIV A;  4GST A;  5IMZ A;  1ZYP A;  4JR6 A;  4KX4 A;  2WZ9 A;  1SK1 A;  4MZC A;  3GKN A;  3ZVJ A;  1G7E A;  4EF0 A;  2AV4 A;  3C7M A;  1PKZ A;  3CMI A;  1EV4 A;  1SKW B;  1TU8 A;  4N30 A;  4ZB9 A;  2VCZ A;  1MDI A;  3DML A;  3LG6 A;  1T4Y A;  3EVI A;  3IA1 A;  5B8B A;  1XWC A;  3MNG A;  1JZO A;  4P3Y B;  1GTI A;  2AHE A;  2XHF A;  6GSW A;  3ZYW A;  5IMA A;  2A4V A;  1TU7 A;  3EUR A;  3GRX A;  4GSN A;  1A8L A;  4CY8 A;  1FO5 A;  2ON7 A;  1CQG A;  11GS A;  4NMU A;  3KMO A;  3Q6O A;  3HVS A;  1F3A A;  4KAE A;  4X43 A;  4POB A;  1AW9 A;  4WXT A;  2IPA A;  3IDV A;  2YWM A;  5DDL A;  2HE3 A;  1SJZ A;  1H75 A;  1TJD A;  2H30 A;  3TOT A;  4WBR D;  4ID0 A;  3GL5 A;  4K2X A;  4ZL8 A;  2GSQ A;  5A5K A;  2NPB A;  4MPF A;  2CX3 A;  3L0H A;  1W4V A;  1NSW A;  2RUF A;  4KDU A;  1X5D A;  3A5W A;  2B5Y A;  7GSS A;  1AQW A;  2IN3 A;  2FLS A;  1Z6M A;  2LUS A;  3DWV A;  2GSR A;  1ILO A;  4PX1 A;  1XVW A;  1N2A A;  5JCG A;  2EIQ A;  1K0M A;  4K8M A;  2H1D A;  1OYJ A;  1OKT A;  2E7P A;  3CSH A;  2OE0 A;  4HZ4 A;  5F05 A;  1EP8 A;  5AGY A;  1PA3 A;  1WIK A;  1IYH A;  1M0U A;  1T3B A;  3UJ1 A;  3IE3 A;  1Z5Y E;  2O8V B;  4FYB A;  2GQL A;  5EVO A;  4EDY A;  4GQF A;  2YOI A;  4I2T A;  5DAK B;  1ZGN A;  3G7J A;  3TB2 A;  2WB9 A;  13GS A;  3FYG A;  5F07 A;  3HHV A;  1ZYQ B;  2RII A;  3TJB A;  2YN1 A;  2H0H A;  1BG5 A;  1JLV A;  2H71 A;  5ELA A;  19GS A;  2AUV A;  2LTK A;  3L4N A;  2C1Y A;  5CRW A;  3DVW A;  1Z7R A;  3BCK A;  2DSA A;  3HJP A;  3P90 A;  3DYR A;  3VLN A;  1T8E B;  3GHA A;  4G0I A;  2HRA A;  2EIR A;  3ZMK A;  2TRC P;  5J5N A;  5D73 A;  4NAX A;  2YCD A;  4I6X A;  2LRT A;  2YJ7 A;  4V2N A;  1MTC A;  2YV7 A;  1R26 A;  1T1V A;  2GGT A;  1Q4J A;  4OFN A;  5DJM A;  1FAA A;  3N9J A;  5COH A;  4L5L A;  1F3B A;  2OBI A;  2RM5 A;  2VCX A;  4ULX A;  3BCI A;  2HZF A;  2WDU A;  5AN1 A;  1NHO A;  5ECP B;  1XOB A;  2X99 A;  4PQ1 A;  5G31 A;  1C72 A;  5FWG A;  2NTO A;  2WJU A;  2ON5 A;  3C71 A;  4GRF A;  1EEM A;  3EWL A;  3A3T A;  5HR0 A;  2PGT A;  3M3M A;  2O89 A;  2V6K A;  4ML6 A;  2O85 A;  1R4W A;  3ZIJ A;  3UVT A;  4NV5 A;  4JU5 A;  2B7J A;  3APO A;  5G30 A;  1E6B A;  2VM2 A;  3Q74 A;  3FZ5 A;  3MSZ A;  2H1A A;  2VL2 C;  5CO3 A;  5J3R A;  2I9H A;  2A2S A;  4ISD A;  2DLX A;  3IC4 A;  1HD2 A;  1DE1 A;  2VD1 A;  3LJR A;  2X8G A;  4TR4 A;  2VIM A;  3ZIT A;  4KW6 A;  2GZP A;  4KA0 A;  1TOF A;  5IOX A;  5EPF A;  2YP6 A;  1PMT A;  4RUV A;  1WRY A;  4MH3 A;  4WKW A;  2DC5 A;  2IIY A;  2E2M A;  4OO5 A;  4TW5 A;  2FGX A;  1EOH A;  3A2V A;  2R4V A;  4ZBD A;  4N10 A;  3E3E A;  3CSJ A;  1EOG A;  3MAK A;  1M2A A;  1JLW A;  1F6M C;  2H01 A;  2YV9 A;  1G6W A;  1QMV A;  2LJR A;  3U5R E;  3VFI A;  1TK0 B;  1U3A A;  2N5B A;  1PN0 A;  2VCV A;  3GX8 A;  2EC4 A;  5D9W A;  3UBK A;  4ILF A;  5H5Q A;  3LQ7 A;  1GTB A;  2H72 A;  2H19 A;  1LBK A;  4CW9 A;  3LXT A;  4AF2 A;  2DKH A;  5EL8 A;  2IFQ A;  1J9B A;  1I5G A;  1XBS A;  1AAZ A;  6GSU A;  2KLX A;  2VO4 A;  1LJR A;  1SKS B;  3LYP A;  3PGT A;  5IO2 A;  1G7O A;  4OFT A;  4EVM A;  2JAD A;  1JFU A;  3US3 A;  1M7T A;  3KP9 A;  4IS0 A;  2L6D A;  5G1K A;  4MP4 A;  3EU3 A;  4ML1 A;  3D21 A;  4HEA 2;  1M9A A;  4HQZ A;  1YQ1 A;  2DML A;  1VF1 A;  1ON4 A;  2CAI A;  4CY6 A;  3L9V A;  3LWA A;  1H4O A;  3FMW A;  2I1U A;  4OWY A;  1EEJ A;  4PUR A;  22GS A;  3KH7 A;  2AJQ B;  5G5E A;  2HSM A;  5LNK e;  3VPQ A;  5IOW A;  4KE3 A;  2QC7 A;  4O92 A;  4TXO B;  2IJY A;  4FYC A;  5CRE A;  5HFG A;  1TTZ A;  5GZZ B;  4L0W A;  1X9S B;  4KUN A;  3IPZ A;  1SJI A;  3A2X A;  3BD2 A;  1BAY A;  3FR3 A;  2MMZ A;  4ZL7 A;  2G0F A;  1GSD A;  3KJY A;  2IFQ B;  2CVD A;  1B48 A;  3GX0 A;  4ECB A;  1TW9 A;  1SD9 A;  1TRS A;  3KGK A;  5ECQ B;  1MD4 A;  2HRK A;  2B7K A;  4EKZ A;  1PGT A;  3DKS A;  1GNW A;  5IIZ A;  1U6T A;  5KN3 A;  2BMX A;  2H76 A;  4HI7 A;  3HD5 A;  3MWH A;  1RK4 A;  4MA9 A;  4BWS A;  1B4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...