5DQYA

A fully oxidized human thioredoxin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin
publication title Crystal structure of fully oxidized human thioredoxin.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2015-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5dqyA00
5D9TA 1V9WA 2YOIA 4ML6A 1B4PA 4L0WA 1V40A 3IRAA 2DBCA 3FEUA 2CA8A 2AJQB 1GP1A 2PBJA 3E9JB 2NTOA 3W8SA 1TP9A 4EVMA 2P5RA 4MP4A 5CO3A 1XBSA 4AJ8A 2V6OA 2H19A 4PNGA 1W89A 5COHA 18GSA 2QC7A 3FZ4A 4ECIA 4IKHA 1GNEA 2BMXA 4KDXA 3TOTA 5H5SA 2O8VB 4F2IA 3C8EA 4I6XA 2VLUA 4ZBBA 1Y25A 3EMPA 3ED3A 3EYTA 5CREA 1OVNA 2BJXA 3TJFA 4DEJA 2X8CA 2MMNA 4IQAA 1K3LA 2XC2A 5LD0A 3M9KA 3VWWA 3KH7A 2H74A 2B5YA 5JCGA 1T1VA 5ECPB 1TU7A 1HD2A 1T4YA 3M9JA 4HZ2A 2V1MA 17GSA 4GWRA 5ECNB 5D9WA 1Q98A 3IK9A 4TR1B 2HSHA 4MABA 4IQ1A 2WFCA 3DYRA 5ECLB 3D22A 3CSJA 2OE0A 2WJUA 4PXOA 4OMVA 5ENUA 2RM5A 4WKWA 2GS3A 1RK4A 1C72A 5CRGA 3I43A 3VWUA 1VGLA 5FHIA 2V2GA 5DAKA 3EWLA 1ZMAA 3NOFA 2LRNA 4MJBA 3ZIJA 4XHMA 2C3NA 1V57A 5HR2A 2MZCA 4MMMA 3H8QA 4ECJA 2B7KA 2EIRA 1OE7A 4YQUA 1G7EA 10GSA 2LEGA 3KZQA 3F6DA 1Z7RA 5G1KA 3GSTA 1OC9B 2MMOA 4X0XA 3I9V2 3TRQA 4IBPA 1GSEA 3F3QA 5CRWA 2AV4A 1A24A 1R5PA 4O5RA 4MJEA 4YQVA 3HVSA 2C0DA 3DRNA 1YEXA 5D93A 3GIXA 4TR0A 2IMDA 2H1AA 4KDYA 1GLQA 2KOKA 5J3RA 1R5AA 4EC0A 2GVPA 2PVQA 3DGQA 3UJ1A 4KCEA 1AIUA 5F0GA 3NIVA 4TRXA 2L6CA 3CMIA 4IP6A 2H76A 5IO0A 1XWAA 2K18A 1Z9HA 1EP7A 1FHEA 4L5OA 2HLSA 5A5KA 1OC8A 2H75A 3C71A 1GUKA 2I4AA 5D9XA 5DJMA 4IS0A 1XVWA 4MH2A 4ULXA 5F8BA 4BVYA 3EU4A 5JCUA 4HS1A 2GZZA 4TKYA 2GT6A 3UARA 3ZZXA 3EE2A 2FA8A 5B7CA 4Q5NA 4MPGA 4PUAA 3HXSA 3ERWA 4JBBA 2VAFA 1PN9A 1EOGA 1IYIA 1K0MA 4J56E 5CRHA 2L4CA 4Z7XA 1N8JA 3FW2A 3CRTA 2MYGA 2PWJA 3APQA 1A2MA 2RUEA 5G5EA 1V2AA 1ON4A 1YEPA 1XW5A 3APSA 4BPYA 4WR4A 1ZYEA 3F4RA 1GUHA 4LMWA 1WOUA 4ACSA 4BWQA 2HZFA 3LWAA 1TI1A 4MF5A 3FR6A 3HD5A 4ZL9A 1GSDA 4JR6A 4FIWA 3N5OA 4F82A 1NW2A 4K7OA 4MJAA 6GSWA 3U6VA 2FY6A 5CP1A 4LA1A 3VLNA 5HFKA 1DE1A 2IMIA 3ZTLA 2H6YA 4MA9A 4MDCA 3QFBC 2I81A 3O76A 4KUNA 2GDRA 4GSNA 3O3TA 3FZ9A 3A2WA 5H5RA 3GNJA 1AQXA 1Z6NA 4N11A 2OBIA 2ON5A 2IN3A 4Q5RA 1G7OA 2YWNA 1X0RA 3F4TA 1M2DA 1XFLA 2PMTA 2Z9SA 5DQYA 4EUYA 6GSYA 3KH9A 4X1UA 2IFQB 2QSIA 2WZ9A 3M0FA 1HYUA 1FW1A 2JACA 2IFQA 5DDLA 1OYJA 1BEDA 2DIZA 1EEMA 3VK9A 3KTBA 1N2AA 2FHEA 4OWYA 3TKQA 3G7JA 2C1YA 2HXKA 1TRWA 3Q6OA 1THXA 4RI7A 2GZPA 4KSMA 2OA7A 2R6KA 3CRUA 2YWMA 1AAZA 1TTZA 3UOMA 1X5CA 1F2EA 4POBA 4YAVA 3TKSE 2H30A 4MF7A 1YKCA 5EL8A 2IJYA 5AIVA 3TDGA 4LMVA 3LEFA 4DSQA 3F63A 2REMA 1UA5A 2OE1A 4CDOA 3VFIA 2CX3A 22GSA 3P8WA 3I6AA 1FVJA 1Q4JA 1ERVA 3HCZA 2ON7A 1PL1A 1U3AA 4J57E 2VM1A 3GTUA 4HOJA 1BG5A 3CBUA 4NV2A 3Q19A 3WT2A 4KA0A 3D21A 2N5AA 2KP2A 3W8JA 4Q5FA 2KLXA 4RQXA 5E59A 3KCMA 6GSSA 3TKSA 1XWGA 4E8HA 4OFMA 2GTUA 2GZYA 5AIXA 4GTUA 1W4VA 2K8SA 1GH2A 2JSYA 4WBJA 4ZXGA 1AW9A 3HKRA 4X43A 5IOWA 2OJLA 2EIOA 2XPDA 3IDVA 4AJ6A 1UN2A 3A5WA 3L9VA 1GLPA 2IMKA 2VCTA 1ST9A 2KP1A 3LYPA 5IMAA 1TW9A 3MNGA 3FZ5A 3PH9A 1U88A 4POMA 2CT6A 5DVBA 1O6JA 2AYTA 3RDWA 4EL1A 1X9SB 1X9WB 2X64A 4EDZA 3G7YA 5ECSA 2K6VA 5GAPD 1MEKA 3S9FA 3TB2A 4ZB8A 2ZUPA 4PNFA 3WGXA 2OKAA 1F3BA 1M99A 4F9ZA 3LSZA 1NHYA 4OFTA 4TVEA 3EURA 13GSA 2VL2A 3LXTA 3KEBA 1OKDA 4I5QA 2EIQA 1YDKA 2H6ZA 3CTFA 4NHZA 2M46A 2FCHA 3GUSA 3LXZA 1E6BA 2FWHA 2HYXA 3GSSA 3UL3A 3QOUA 5GSSA 3IAM2 1MTCA 2RIIA 2YV9A 2YZHA 3IBHA 3M3MA 4PQ1A 2A2RA 4FH8A 3UIWA 4P3YB 2O7KA 2R37A 2YV7A 2FUG2 16GSA 2F3MA 1TRUA 3TRPA 3ZMKA 4JRRA 4K0GA 3IOSA 5IO2A 4WEYA 5AGYA 3KP8A 5D9VA 1VF1A 1JZOA 5J41A 1PX7A 2ZNMA 3RPPA 3BCKA 5DQSA 5GZZB 1O8WA 5D96A 1WRYA 3ZRDA 4AJ7A 1KNGA 4BVXA 1SL1B 4WF4A 4K0NA 3VWVA 4LL1B 2DJJA 4I8BA 5ECMB 4TW5A 1Z6MA 2CZ2A 3GV1A 4D73B 2DJKA 3A3TA 2VUPA 4KDUA 4D73A 3V1WA 5J4UA 1R26A 2PERA 2VL9A 2DSAA 3QAGA 4XRAA 2PU9C 4IHUA 2IMFA 3ISOA 2C3QA 2V41A 3PGTA 4QL7A 4NAXA 3I69A 3F4SA 1PD21 1XPVA 2QKEA 4TR1A 2BTOT 1PX6A 3LFLA 4N0ZA 2LQOA 2GSSA 3GH6A 3IE3A 2CX4A 3FY7A 2DLXA 4V1Ap 3TCOA 3UVHA 2PN8A 2FGXA 2YWOA 4HJ2A 3GX0A 1SYXA 1OAZA 4N30A 5ELAA 3P7XA 3VI5A 5HR0A 4OCFA 4ID0A 3GMFA 1XCCA 1JZWA 1TJDA 1WMJA 1B8XA 2KUCA 3VURA 1SD9A 3EVIA 2VM2A 5B6MA 3PINA 5EPFA 4CW9A 2I3YA 3KJYA 1U3IA 2MMZA 3E0UA 1K3YA 1TK8B 5JWRB 5E4WA 2WCIA 5A4WA 2A4VA 1OC9A 3BD2A 5FWGA 4EO3A 2B1KA 3L9SA 4FYCA 2FWFA 1YZXA 3EINA 1QXHA 2HI7A 1NSWA 2IIYA 1BYEA 1QQ2A 1K3OA 1V98A 3QPMA 3IV4A 4K9ZA 4IJIA 2LJKA 2R5GA 5B8BA 2VCQA 14GSA 3TOUA 1GL8A 1G0TA 2P31A 5LCZA 1SKRB 2TRCP 4I97A 3GH9A 2EC4A 4I2UA 3DVWA 1X5EA 1GTAA 2YWIA 3KD0A 3ZREA 1JZDA 2IL3A 2C0FA 2DJ2A 2VL2C 4MLYA 5HR1A 2M80A 1ZOFA 1A2JA 12GSA 3H93A 5A4UA 2CQ9A 2L59A 2H71A 2H6XA 1BX9A 3HVVA 1XOBA 2F8AA 2DMMA 1FG4A 1FAAA 2B5XA 4NHWA 1EGRA 4L0UA 2AHEA 3BBYA 3ZFLA 1TKDB 5AISA 2H1BA 4XCSA 2F8FA 4KW6A 3EMXA 2J9HA 3HA9A 2YPMA 3C1SA 3J7Yk 1JHBA 3L78A 2NDOA 3L9UA 4ZB6A 4YH2A 1J08A 2DJ0A 1J9BA 4PQHA 3U5RE 1ERWA 1DBYA 2OADA 4K6XA 1SK0A 4TR3A 4KE3A 4GRFA 5IM9A 4K7IA 2GLRA 2PUKC 5ECKB 2OACA 2TRXA 1K0OA 1F37A 4KNDA 4ISDA 2FD3A 5IMCA 1GTBA 3BOAA 1PMTA 2O89A 1O85A 2K8VA 2YZUA 2L5LA 2NPBA 3G7IA 4DSSB 1GRXA 2C8UA 2DIYA 5ID2B 4IW9A 2H8LA 1JZRA 1YJ6A 2ALBA 2VO4A 20GSA 3TJKA 4F03A 1SL2B 3UAPA 1PRXA 1AUCA 4K2DA 4O32A 1PSQA 1UVZA 3HJOA 4FO5A 4J2FA 1FO5A 4PQIA 3P90A 1VF3A 2F9SA 2H73A 3MAKA 2WDUA 3D4TA 3LQ7A 4PURA 1O81A 2DJ1A 5FT3A 1PKWA 1SJIA 2GSTA 2GSQA 3GKMA 3TKRA 4KH7A 3A2VA 3F3RA 1HNBA 3N9JA 1XIYA 1YKAA 2CAIA 1XWCA 2R2JA 3GKXA 3W6GA 3QMXA 5DCGA 3FKFA 1T4ZA 5C00A 1THOA 3UVTA 2I9HA 2WRTA 5LNKe 2L6DA 1R4WA 2H72A 1OKTA 1OE8A 3K8NA 2B3SA 2LKUA 1FB0A 1GTIA 3GA4A 1VF2A 4L8EA 3HJPA 2G2QA 4KAEA 1T8EB 2M72A 3SWLA 4NMUA 2A2SA 4HQZA 2FNOA 3GRXA 1M2AA 3US3A 1ABAA 5ECIB 4EDYA 5IIZA 4HDEA 1ERTA 3HDCA 4XS6A 4K7NA 3KM6A 4N10A 4OO5A 1VF4A 2C4JA 1SD8A 4HEA2 3GURA 4G9HA 5IMDA 1TXXA 4FYUA 5KN0A 1ACVA 4ZBAA 5EVOA 3HZ4A 3KMOA 1FVKA 1SKWB 3GL5A 4DVCA 3GL3A 1LJRA 2P0GA 1R7HA 4XTSA 3H79A 2KHPA 1J0FA 1TRVA 5ABRA 2MMAA 1EV9A 5KN1A 4JEDA 3SBCA 1MDKA 3MWHA 4HUAA 5C04A 1WIKA 2FWEA 4LL4B 2HSYA 5IOXA 4ZL7A 3UBKA 3TGZA 1SJ6A 2LRCA 2YNXA 3DKSA 3IAS2 3ZFBA 3VWXA 2VD1A 4XS1A 2H1DA 3HVXA 3WD6A 3HYPA 3KTLA 5DBQA 1S3DA 5ELGA 1V58A 1QUWA 4NWYA 3MSZA 5F06A 4OFNA 1F6MC 3VPTA 5ECOB 5CNWA 1SJZA 3FZAA 1XXUA 4OO4A 4ZILA 4G10A 3IPZA 4MPFA 5ECQB 1CQGA 1SENA 4TOPA 4XS4B 1XOAA 3LJRA 4DSRA 2LNSA 3QFAC 5G31A 1H75A 3TUEA 1U6TA 1ILOA 2L57A 3Q74A 1MDJA 4LLRA 1KEBA 1AXDA 2VCVA 3KGKA 4FYBA 1GSSA 3FK8A 2H70A 5IMVA 1URMA 6GSUA 4HZ4A 5A4VA 1EZKA 2QGVA 2VL3A 4IVFA 4O92A 2NVLA 3C73A 2E2GA 4JU5A 1X9MB 4GQCA 1BAYA 5DCHA 2H1GA 3CSIA 3RAZA 1B4QA 2HRFA 4GQFA 5GSTA 4TXOB 4HI7A 2YP6A 2HFDA 4TXOA 4ZL8A 2LJRA 3DXBA 5DALB 1WE0A 1GULA 1Z5YE 4IJ3A 2R3XA 1XWKA 5DALA 3F8UA 1SK1A 3ZITA 1K0CA 2O87A 4N0VA 2RUFA 4JE1A 4BL7A 1ZCPA 1NHOA 2FLSA 4OCEA 3RBTA 1XZOA 2X99A 1F3AA 2JZRA 5J9BA 4ECCA 5KN3A 2H0GA 2PPTA 3C1RA 4IELA 2C3TA 2VCXA 1A0RP 2HE3A 2V32A 2WB9A 3GKKA 3TRXA 4IN0A 2B7JA 4GLTA 3FR9A 2HZEB 2PVOC 4NV5A 5G30A 4BWSA 1RW1A 2HZEA 1T7PB 2VCZA 3QR6A 4POLA 2RM6A 3DIEA 3JCML 5ECHB 3D6IA 3P2AA 1WWJA 1BQ7A 4H86A 1LBKA 3H4KA 1M9AA 3HY2A 3LG6A 3FHKA 3IC4A 5EY6A 3LORA 1PKZA 2DMLA 4ZIJA 2LTKA 1AC1A 2V6KA 1QK8A 3F9UA 4MCUA 1M0UA 1A0FA 2R4VA 19GSA 2B5EA 1AQVA 5F07A 3GX8A 1QFNA 1S3CA 1T00A 4GXZA 5INYA 1F9MA 4V2NA 4HU9A 3HHVA 3ME8A 2N5BA 2X8GA 1E2YA 3TKSC 1EP8A 4KB3A 5KEJA 5CAXA 2H0HA 1CQHA 3WGDA 3BCIA 3DEXA 2CVKA 1NM3A 2C80A 5DAKB 2XBQA 4TXVA 4MF6A 2AAWA 1EV4A 4AGSA 3IR4A 1GUMA 1A8YA 1K0DA 3RPNA 4GSSA 1A2LA 6GSVA 1S3AA 4GF0A 4MH3A 4V2MA 5B8AA 1MD3A 4NXIA 4PX1A 1SK2A 2GQKA 2B6MA 3FR3A 1M2BA 3L0HA 3M8NA 1M9BA 4YAPA 4WBRD 3A2XA 2JU5A 1K0NA 2YJHA 2CVDA 3PR8A 2AB6A 2GT5A 2G0FA 2L5OA 4TN8A 4I2TA 2J23A 3D0ZA 5D8IA 4MJCA 3UBLA 5JWQB 1ZL9A 1YF1A 4V2LA 1HNAA 4Q5QA 4EXJA 11GSA 4HJMA 3F6FA 3AY8A 1PL2A 3R2QA 3HZ8A 2JZTA 1SYRA 3HJMA 2VLTA 1OC3A 2LS5A 3TKPA 2CVBA 3NZNA 2RLIA 4YQMA 4G19A 1G6WA 4BA7A 2VLVA 2LJAA 2GGTA 1A8LA 8GSSA 1PGTA 4WR5A 4PGTA 2LSTA 2C0EA 2B1LA 1XW9A 2HRNA 4QL9A 1GSFA 3QD9A 1WPIA 1YQ1A 3M1GA 4XRDA 3VI7A 1ZGNA 5G1LA 3GHAA 1SKSB 2LV3A 3WT1A 4MZWA 1U87A 4EKZA 1SU9A 2E2MA 3QDNA 3ZLPA 2XBIA 2XPEA 4HU7A 3D4MA 1GNWA 3C7MA 1JLVA 2N5FA 2C0GA 4POKA 1Y6EA 3KXOA 2YN1A 3L4NA 2H01A 5ECRB 2E0QA 2LNTA 1O73A 3O6TA 4V1Ag 2LRTA 3WGEA 3KP9A 1SL0B 4DSSA 5H5QA 5IQYA 4KCAA 3ZVJD 1KTEA 1T3BA 2XHFA 2K9FA 3CYNA 2X8HA 1K0AA 5ID2A 3DD3A 1B9YC 2MBSA 1QMVA 3IXRA 1IYHA 1B48A 2CZ3A 6GSTA 1O8XA 2AUVA 1HNCA 2JL4A 3DVXA 3RHBA 4KSOA 4GSTA 4QQ7A 5IPGA 3ERFA 3UMAA 4F0BA 1B9XC 2O85A 3FRCA 1TOFA 2DJ3A 1TU8A 2GQMA 2GSRA 5J9CA 1MDIA 2MBTA 3QCPA 1RQMA 2VD0A 4ILFA 5DJLA 5D73A 3ZVJA 2WULA 1WP0A 1TDIA 2ES7A 4L5LA 1HQOA 5KN2A 5HFGA 3D5JA 1AQWA 5J5NA 1FOVA 4TR4A 2IMEA 2H0IA 5HFIA 2YCDA 2JZSA 3RHCA 3DMLA 2WGRA 2YJ7A 4NPBA 3WYWA 5CRDA 3LGCA 2OBKA 1ML6A 2TIRA 9GSSA 4O7HA 3APOA 2GQLA 3QAVA 1PQNA 2HNLA 2H66A 3TJBA 2ZCTA 2F51A 1I9DA 4K1FA 1YF0A 5B6NA 3Q18A 1TI3A 1EEJA 3CTGA 3OR5A 1GSQA 1XVQA 2JSZA 1M7TA 2IWTA 1EOHA 1YY7A 2L4QA 2LUSA 3GYKA 2WS2A 4KGIA 3GN3A 3LYKA 1X5DA 1VRSD 4EF0A 1ZZYA 3TJGA 2NBSA 3KMNA 2DC5A 1KBNA 1PA3A 1G6YA 4WXTA 2VCWA 4WETA 5JWOB 3BJ5A 1XWBA 3GTUB 1I5GA 4IGJA 1O7UA 5HQPA 2JADA 2OE3A 3GFKA 4OD7A 3FYGA 2VIMA 1GSYA 7GSSA 1ZYQB 2P5QA 5G5FA 3DWVA 3MDKA 5CYYA 1DSBA 1ERUA 1GWCA 3ZIVA 5L71A 4RQRA 1EGOA 3TJJA 1BJXA 2D2ZA 2CV4A 4ECBA 5GAND 4JR4A 5F05A 3IK7A 5G2ZA 1JFUA 3IA1A 4MK3A 1XW6A 4KX4A 2YANA 3ZL5A 3ZYWA 3G9BA 3KIJA 3ZMLA 1UC7A 2HT9A 4MZBA 3E3EA 1FB6A 1USBA 4RI6A 4K8MA 3EC3A 5IMFA 5HR3A 2CAQA 3EU3A 3VPQA 1GSUA 4GCIA 4IP1A 4MZCA 1LU4A 3ERGA 2I1UA 1Z3EA 4CHSA 5AN1A 1TK5B 3UEMA 3F0IA 3ME7A 1TRSA 2E7PA 4F0CA 3H1NA 4XS4A 2VOCA 3GKNA 1QGVA 4ML1A 1K0BA 2PGTA 4ZBDA 3CXGA 1JLWA 4EE0A 1DUGA 1TK0B 5IMZA 4RUVA 1GTUA 6GSXA 1Z7PA 4E8EA 1WJKA 2LQQA 4AF2A 3QAWA 5IPHA 4JZQA 4WF5A 1DE2A 3IHQA 1EWXA 4ZB9A 1MD4A 2FWGA 4HQSA 2IPAA 4PUFC 5JCWA 3CSHA 1H4OA 2FA4A 1A23A 3J7Yb 4G2EA 4XIHA
chains in the Genus database with same CATH superfamily
5D9TA 1V9WA 2YOIA 4ML6A 1B4PA 4L0WA 1V40A 3IRAA 2DBCA 3FEUA 2CA8A 2AJQB 1GP1A 2PBJA 3E9JB 2NTOA 3W8SA 1TP9A 4EVMA 2P5RA 4MP4A 5CO3A 2HRAA 1XBSA 4AJ8A 2V6OA 2H19A 4PNGA 1W89A 5COHA 3EPTA 18GSA 2QC7A 3FZ4A 4ECIA 4IKHA 1GNEA 2BMXA 4KDXA 4MNNA 3TOTA 5H5SA 2O8VB 4F2IA 3C8EA 4I6XA 2VLUA 4ZBBA 1Y25A 3EMPA 3ED3A 3EYTA 5CREA 2UZ8A 1OVNA 2BJXA 3TJFA 4DEJA 2X8CA 2MMNA 4IQAA 4BVXB 1K3LA 2XC2A 3IHGA 5LD0A 3M9KA 3VWWA 3KH7A 2H74A 2B5YA 5JCGA 1T1VA 5ECPB 1TU7A 1HD2A 1T4YA 3M9JA 4HZ2A 2V1MA 17GSA 4GWRA 5ECNB 5D9WA 1Q98A 3IK9A 4TR1B 2HSHA 4MABA 4IQ1A 2QA2A 2WFCA 3DYRA 5ECLB 3D22A 3CSJA 2OE0A 2WJUA 4PXOA 4OMVA 5ENUA 2RM5A 4WKWA 2GS3A 1RK4A 1C72A 5CRGA 3I43A 3VWUA 1VGLA 5FHIA 2V2GA 5DAKA 3EWLA 1ZMAA 1PFOA 3NOFA 2LRNA 4MJBA 3ZIJA 4XHMA 2C3NA 1V57A 5HR2A 2MZCA 4MMMA 3H8QA 2QA1A 4ECJA 2B7KA 2EIRA 1OE7A 4YQUA 1G7EA 5BRTA 2X4AA 10GSA 2LEGA 3KZQA 3F6DA 1Z7RA 5G1KA 3GSTA 1OC9B 2MMOA 4X0XA 3I9V2 3TRQA 4IBPA 1GSEA 3F3QA 5CRWA 2AV4A 1A24A 1R5PA 4O5RA 1PN0A 4MJEA 4YQVA 3HVSA 2C0DA 3DRNA 1YEXA 5D93A 3GIXA 4TR0A 2IMDA 2H1AA 4KDYA 1GLQA 2KOKA 5J3RA 1R5AA 4EC0A 2GVPA 2PVQA 3DGQA 3UJ1A 4KCEA 1AIUA 5F0GA 3NIVA 4TRXA 2L6CA 3CMIA 4IP6A 2H76A 5IO0A 1XWAA 2K18A 1Z9HA 1EP7A 1FHEA 4L5OA 2HLSA 5A5KA 1OC8A 2H75A 3C71A 1GUKA 2I4AA 2R0CA 5D9XA 5DJMA 4IS0A 1XVWA 4MH2A 4ULXA 5F8BA 4BVYA 3EU4A 5JCUA 4HS1A 2GZZA 4TKYA 2GT6A 3UARA 3ZZXA 3EE2A 2FA8A 5B7CA 4Q5NA 4MPGA 4PUAA 3HXSA 3ERWA 4JBBA 2VAFA 1PN9A 1EOGA 1IYIA 1K0MA 4J56E 5CRHA 2L4CA 4Z7XA 1N8JA 3FW2A 3CRTA 2MYGA 2PWJA 3APQA 1A2MA 2RUEA 5G5EA 1V2AA 1ON4A 1YEPA 2DKHA 5KOXA 1XW5A 3APSA 4BPYA 4WR4A 1ZYEA 3F4RA 1GUHA 4LMWA 1WOUA 4ACSA 4BWQA 2HZFA 3LWAA 1TI1A 4MF5A 3FR6A 3HD5A 4ZL9A 1GSDA 4JR6A 4FIWA 3N5OA 4F82A 1NW2A 4K7OA 4MJAA 6GSWA 3U6VA 2FY6A 5CP1A 4LA1A 3VLNA 5HFKA 1DE1A 2IMIA 3ZTLA 2X49A 2H6YA 4MA9A 4MDCA 3QFBC 2I81A 3O76A 4KUNA 2GDRA 4GSNA 3O3TA 3FZ9A 3A2WA 5H5RA 3GNJA 1AQXA 1Z6NA 4N11A 2OBIA 2ON5A 2IN3A 4Q5RA 1G7OA 2YWNA 1X0RA 3F4TA 1M2DA 1XFLA 2PMTA 2Z9SA 5DQYA 4EUYA 6GSYA 3KH9A 4X1UA 4YKGA 2IFQB 2QSIA 2WZ9A 3M0FA 1HYUA 1FW1A 2JACA 2IFQA 5DDLA 1OYJA 1BEDA 2DIZA 1EEMA 3VK9A 3KTBA 1N2AA 2FHEA 4OWYA 3TKQA 3G7JA 2C1YA 2HXKA 1TRWA 3Q6OA 1THXA 4RI7A 2GZPA 4KSMA 2OA7A 2R6KA 3CRUA 2YWMA 1AAZA 1TTZA 3UOMA 1X5CA 4Z2RA 1F2EA 4POBA 4YAVA 3R3EA 3TKSE 2H30A 4MF7A 1YKCA 5EL8A 2IJYA 5AIVA 3TDGA 4LMVA 3LEFA 4DSQA 3F63A 2REMA 4EIPA 1UA5A 2OE1A 4CDOA 3VFIA 2CX3A 22GSA 3P8WA 3I6AA 1FVJA 1Q4JA 1ERVA 3HCZA 2ON7A 1PL1A 1U3AA 4J57E 2VM1A 3GTUA 4HOJA 1BG5A 3CBUA 4NV2A 3Q19A 3WT2A 4KA0A 3D21A 3MYDA 2N5AA 2KP2A 3W8JA 4Q5FA 2KLXA 4RQXA 5E59A 3KCMA 6GSSA 3TKSA 1XWGA 4E8HA 4OFMA 2GTUA 2GZYA 4PTSA 5AIXA 4GTUA 1W4VA 2K8SA 1GH2A 2JSYA 4WBJA 4ZXGA 1AW9A 3HKRA 4HSCX 4X43A 5IOWA 2OJLA 2EIOA 2XPDA 3IDVA 4AJ6A 1UN2A 3A5WA 3L9VA 1GLPA 2IMKA 2VCTA 1S3RA 1ST9A 2KP1A 3LYPA 5IMAA 1TW9A 3MNGA 3FZ5A 3PH9A 1U88A 4POMA 2CT6A 5DVBA 1O6JA 2AYTA 3RDWA 4EL1A 1X9SB 1X9WB 2X64A 4EDZA 3G7YA 5ECSA 2K6VA 5GAPD 1MEKA 3S9FA 3TB2A 4ZB8A 2ZUPA 4PNFA 3WGXA 2OKAA 1F3BA 1M99A 4F9ZA 3LSZA 1NHYA 4OFTA 4TVEA 3EURA 5KOWA 13GSA 2VL2A 3LXTA 3KEBA 1OKDA 4I5QA 2EIQA 1YDKA 2H6ZA 3CTFA 4NHZA 2M46A 2FCHA 3GUSA 3LXZA 1E6BA 2FWHA 2HYXA 3GSSA 3UL3A 3QOUA 5GSSA 3IAM2 1MTCA 4BIKA 2RIIA 2YV9A 2YZHA 3IBHA 3M3MA 4PQ1A 2A2RA 4FH8A 3UIWA 4P3YB 2O7KA 2R37A 2YV7A 2FUG2 16GSA 2F3MA 1TRUA 4X4JA 3TRPA 3ZMKA 4JRRA 4K0GA 3IOSA 5IO2A 4WEYA 4BL7B 5AGYA 3KP8A 5D9VA 1VF1A 1JZOA 5J41A 1PX7A 2ZNMA 3RPPA 3BCKA 5DQSA 5GZZB 1O8WA 5D96A 1WRYA 3ZRDA 4AJ7A 1KNGA 4BVXA 1SL1B 4WF4A 4K0NA 3VWVA 4LL1B 2DJJA 4I8BA 5ECMB 4TW5A 1Z6MA 2CZ2A 3GV1A 4D73B 2DJKA 3A3TA 2VUPA 4KDUA 4D73A 3V1WA 5J4UA 1R26A 2PERA 2VL9A 2DSAA 3QAGA 4XRAA 2PU9C 4IHUA 2IMFA 3ISOA 2C3QA 2V41A 3PGTA 4QL7A 4NAXA 3I69A 3F4SA 1PD21 1XPVA 2QKEA 4TR1A 2BTOT 1PX6A 3LFLA 4N0ZA 2LQOA 2GSSA 3GH6A 3IE3A 4CY6A 2CX4A 3FY7A 2DLXA 4V1Ap 3TCOA 3UVHA 2PN8A 2FGXA 2YWOA 4HJ2A 3GX0A 1SYXA 1OAZA 4N30A 5ELAA 3P7XA 3VI5A 5HR0A 4OCFA 4ID0A 3GMFA 1XCCA 1JZWA 1TJDA 1WMJA 1B8XA 2KUCA 3VURA 1SD9A 3EVIA 2VM2A 5B6MA 3PINA 5EPFA 4CW9A 2I3YA 3KJYA 1U3IA 2MMZA 3E0UA 1K3YA 1TK8B 5JWRB 4FQUA 2A4HA 5E4WA 2WCIA 5A4WA 2A4VA 1OC9A 3BD2A 5FWGA 4EO3A 2B1KA 3L9SA 4FYCA 2FWFA 1YZXA 3EINA 1QXHA 2HI7A 1NSWA 2IIYA 1BYEA 1QQ2A 1K3OA 1V98A 3QPMA 3IV4A 4K9ZA 4IJIA 2LJKA 2R5GA 5B8BA 2VCQA 14GSA 3TOUA 1GL8A 1G0TA 2P31A 5LCZA 1SKRB 2TRCP 1ZYNA 4I97A 3GH9A 2EC4A 4I2UA 3DVWA 1X5EA 2DKIA 1GTAA 2YWIA 3KD0A 3ZREA 1JZDA 2IL3A 2C0FA 2DJ2A 2VL2C 4MLYA 5HR1A 2M80A 1ZOFA 5BMUA 1A2JA 12GSA 3H93A 5A4UA 2CQ9A 2L59A 2H71A 2H6XA 1BX9A 3HVVA 1XOBA 2F8AA 2DMMA 1FG4A 1FAAA 2B5XA 4NHWA 1EGRA 4L0UA 2AHEA 3BBYA 3ZFLA 1TKDB 5AISA 2H1BA 4XCSA 2F8FA 4KW6A 3EMXA 2J9HA 3HA9A 2YPMA 3C1SA 3J7Yk 1JHBA 3L78A 2NDOA 3L9UA 4ZB6A 4YH2A 1J08A 2A2PA 2DJ0A 1J9BA 4PQHA 3U5RE 1ERWA 1DBYA 2OADA 4K6XA 1SK0A 4TR3A 4KE3A 4GRFA 5IM9A 4K7IA 2GLRA 2PUKC 5ECKB 2OACA 2TRXA 1K0OA 1F37A 4KNDA 4ISDA 2FD3A 5IMCA 1GTBA 3BOAA 1PMTA 2O89A 1O85A 2K8VA 2YZUA 2L5LA 2NPBA 3G7IA 4DSSB 1GRXA 2C8UA 2DIYA 5ID2B 4IW9A 2H8LA 1JZRA 1YJ6A 2ALBA 2VO4A 20GSA 3TJKA 4F03A 1SL2B 3UAPA 1PRXA 1AUCA 4K2DA 4O32A 1PSQA 1UVZA 3HJOA 4FO5A 4J2FA 1FO5A 4PQIA 3P90A 1VF3A 2F9SA 2H73A 4G0LA 3MAKA 2WDUA 3D4TA 3LQ7A 4PURA 1O81A 2DJ1A 5FT3A 1PKWA 1SJIA 2GSTA 2GSQA 3GKMA 4USSA 3TKRA 4KH7A 3A2VA 3F3RA 1HNBA 3N9JA 1XIYA 1YKAA 2CAIA 1XWCA 2R2JA 3GKXA 3W6GA 3QMXA 5DCGA 3FKFA 4O5QA 2R0PA 1T4ZA 5C00A 1THOA 3UVTA 2I9HA 2WRTA 5LNKe 2L6DA 1R4WA 3MIXA 2H72A 4K2XA 1OKTA 1OE8A 3K8NA 2B3SA 2LKUA 1FB0A 1GTIA 3GA4A 1VF2A 4L8EA 3HJPA 2G2QA 4KAEA 1T8EB 2M72A 3SWLA 4NMUA 2A2SA 4HQZA 2FNOA 3GRXA 4Z2UA 1M2AA 3US3A 1ABAA 5ECIB 4EDYA 5IIZA 4HDEA 1ERTA 3HDCA 4XS6A 4K7NA 3KM6A 4N10A 4OO5A 1VF4A 2C4JA 1SD8A 4HEA2 3GURA 4G9HA 5IMDA 1TXXA 4FYUA 5KN0A 1ACVA 4ZBAA 1FOHA 5EVOA 3HZ4A 3KMOA 1FVKA 1SKWB 3GL5A 4DVCA 3GL3A 1LJRA 2P0GA 1R7HA 4XTSA 3H79A 2KHPA 1J0FA 1TRVA 4G0IA 5ABRA 2MMAA 1EV9A 5KN1A 4JEDA 3SBCA 1MDKA 3MWHA 4HUAA 5C04A 1WIKA 2FWEA 4LL4B 2HSYA 5IOXA 4ZL7A 3UBKA 3TGZA 1SJ6A 2LRCA 2YNXA 3DKSA 3IAS2 3ZFBA 3VWXA 2VD1A 4XS1A 2H1DA 3HVXA 3WD6A 3HYPA 3KTLA 5DBQA 1S3DA 5ELGA 1V58A 1QUWA 4NWYA 3MSZA 5F06A 4OFNA 1F6MC 3VPTA 3CQFA 5ECOB 5CNWA 1SJZA 3FZAA 1XXUA 4OO4A 4ZILA 4G10A 3IPZA 4MPFA 5ECQB 1CQGA 1SENA 4TOPA 4XS4B 1XOAA 3LJRA 4DSRA 2LNSA 3QFAC 5G31A 1H75A 3TUEA 1U6TA 1ILOA 2L57A 3Q74A 1MDJA 4LLRA 1KEBA 1AXDA 2VCVA 3KGKA 4FYBA 1GSSA 3FK8A 2H70A 5IMVA 1URMA 6GSUA 4HZ4A 5A4VA 1EZKA 2QGVA 2VL3A 4IVFA 4O92A 2NVLA 3C73A 2E2GA 4JU5A 1X9MB 4GQCA 1BAYA 5DCHA 2H1GA 3CSIA 3RAZA 1B4QA 2HRFA 4GQFA 5GSTA 4TXOB 4HI7A 2YP6A 2HFDA 4TXOA 4ZL8A 2LJRA 3DXBA 5DALB 1WE0A 1GULA 1Z5YE 4IJ3A 2R3XA 1XWKA 5DALA 3F8UA 1SK1A 3ZITA 1M3IA 1K0CA 2O87A 4N0VA 4O5UA 2RUFA 4JE1A 4BL7A 1ZCPA 1NHOA 2FLSA 4OCEA 3RBTA 1XZOA 2X99A 1F3AA 2JZRA 4K5SA 5J9BA 4ECCA 5KN3A 2H0GA 2PPTA 3C1RA 4IELA 2C3TA 2VCXA 1A0RP 2HE3A 2V32A 2WB9A 3GKKA 3TRXA 4IN0A 2B7JA 4GLTA 3FR9A 2HZEB 2PVOC 4NV5A 5G30A 4BWSA 1RW1A 3LW9A 2HZEA 1T7PB 2VCZA 3QR6A 4POLA 2RM6A 3DIEA 3JCML 5ECHB 3D6IA 3P2AA 1WWJA 1BQ7A 4H86A 1LBKA 3H4KA 1M9AA 3HY2A 3LG6A 3FHKA 3IC4A 5EY6A 3LORA 1PKZA 2DMLA 4ZIJA 2LTKA 1AC1A 2V6KA 1QK8A 3F9UA 4MCUA 1M0UA 1A0FA 2R4VA 19GSA 2B5EA 1AQVA 5F07A 3GX8A 1QFNA 1S3CA 1T00A 4GXZA 5INYA 1F9MA 4V2NA 4HU9A 3HHVA 3ME8A 2N5BA 2X8GA 1E2YA 3TKSC 1EP8A 4KB3A 5KEJA 5CAXA 2H0HA 1CQHA 3WGDA 3BCIA 3DEXA 2CVKA 1NM3A 2C80A 5DAKB 2XBQA 4TXVA 4MF6A 2AAWA 1EV4A 4AGSA 3IR4A 1GUMA 1A8YA 1K0DA 3RPNA 4GSSA 1A2LA 6GSVA 1XG8A 1S3AA 4GF0A 4MH3A 4V2MA 5B8AA 1MD3A 4NXIA 4PX1A 1SK2A 2GQKA 2B6MA 3FR3A 1M2BA 3L0HA 3M8NA 1M9BA 4YAPA 3PPUA 4WBRD 3A2XA 2JU5A 1K0NA 2YJHA 2CVDA 3PR8A 2AB6A 2GT5A 2G0FA 2L5OA 4TN8A 4I2TA 2J23A 3D0ZA 5D8IA 4MJCA 3UBLA 5JWQB 1ZL9A 1YF1A 4V2LA 1HNAA 4Q5QA 4EXJA 11GSA 4HJMA 3F6FA 3AY8A 1PL2A 3R2QA 3HZ8A 2JZTA 1SYRA 3HJMA 2VLTA 1OC3A 2LS5A 3TKPA 2CVBA 3NZNA 2RLIA 4YQMA 4G19A 1G6WA 4BA7A 2VLVA 2LJAA 4EIQA 2GGTA 1A8LA 8GSSA 1PGTA 4WR5A 4PGTA 2LSTA 4BVYB 2C0EA 2B1LA 1XW9A 2HRNA 4QL9A 1GSFA 4A5PA 3QD9A 1WPIA 1YQ1A 3M1GA 4XRDA 3VI7A 1ZGNA 4ICYA 5G1LA 3GHAA 1SKSB 2LV3A 3WT1A 4MZWA 1U87A 4EKZA 1SU9A 2E2MA 3QDNA 3ZLPA 2XBIA 2XPEA 4HU7A 3D4MA 1GNWA 3C7MA 1JLVA 2N5FA 2C0GA 4POKA 1Y6EA 3KXOA 2YN1A 3L4NA 2H01A 5ECRB 2E0QA 2LNTA 1O73A 3O6TA 4V1Ag 2LRTA 3WGEA 3KP9A 1SL0B 4DSSA 5H5QA 5IQYA 4KCAA 3ZVJD 1KTEA 1T3BA 2XHFA 2K9FA 3CYNA 2X8HA 1K0AA 5ID2A 3DD3A 1B9YC 2MBSA 1QMVA 4G0KA 3IXRA 1IYHA 1B48A 2CZ3A 6GSTA 1O8XA 2AUVA 1HNCA 2JL4A 3DVXA 3RHBA 4KSOA 4YKFA 4GSTA 4QQ7A 5IPGA 3ERFA 3UMAA 4F0BA 1B9XC 2O85A 3FRCA 1TOFA 2DJ3A 1TU8A 2GQMA 2GSRA 5J9CA 1MDIA 2MBTA 3QCPA 1RQMA 2VD0A 1ZYPA 4ILFA 5DJLA 1M3JA 5D73A 3ZVJA 2WULA 1WP0A 1TDIA 2ES7A 4L5LA 1HQOA 5KN2A 5HFGA 3D5JA 1AQWA 5J5NA 1FOVA 4TR4A 3HVNA 2IMEA 2H0IA 5HFIA 2YCDA 2JZSA 3RHCA 3DMLA 2WGRA 2YJ7A 4NPBA 3WYWA 5CRDA 3FMWA 3LGCA 2OBKA 1ML6A 2TIRA 9GSSA 4O7HA 3APOA 2GQLA 3QAVA 1PQNA 2HNLA 4CY8A 2H66A 3TJBA 2ZCTA 2F51A 1I9DA 4K1FA 1YF0A 5B6NA 3Q18A 1TI3A 1EEJA 3CTGA 3OR5A 1GSQA 1XVQA 2JSZA 1M7TA 2IWTA 1EOHA 1YY7A 2L4QA 2LUSA 3GYKA 2WS2A 4KGIA 3GN3A 3LYKA 1X5DA 1VRSD 4EF0A 1ZZYA 3TJGA 2NBSA 3KMNA 3A5IA 2DC5A 1KBNA 1PA3A 1G6YA 4WXTA 2VCWA 4WETA 5JWOB 3BJ5A 1XWBA 3GTUB 1I5GA 4IGJA 1O7UA 5HQPA 2JADA 2OE3A 4OD7A 3GFKA 3FYGA 2VIMA 1GSYA 7GSSA 1ZYQB 2P5QA 5G5FA 3DWVA 3MDKA 5CYYA 1DSBA 1ERUA 1GWCA 3ZIVA 5L71A 4RQRA 1EGOA 3TJJA 1BJXA 2D2ZA 2CV4A 4ECBA 5GAND 4JR4A 5F05A 3IK7A 2HRKA 5G2ZA 1JFUA 3IA1A 4MK3A 1XW6A 4KX4A 2R0GA 2YANA 3ZL5A 2HSMA 3ZYWA 3G9BA 3KIJA 3ZMLA 1UC7A 2HT9A 4MZBA 3E3EA 1FB6A 1USBA 4RI6A 4K8MA 3EC3A 5IMFA 5HR3A 3IC8A 2CAQA 4Z2TA 3EU3A 3VPQA 1GSUA 4GCIA 4IP1A 4MZCA 1LU4A 3ERGA 2I1UA 1Z3EA 4CHSA 5AN1A 1TK5B 3UEMA 3F0IA 3ME7A 1TRSA 2E7PA 4F0CA 4KF9A 3H1NA 4XS4A 2VOCA 3GKNA 1QGVA 4ML1A 1K0BA 2PGTA 4ZBDA 3CXGA 1JLWA 4EE0A 1DUGA 1TK0B 5IMZA 4RUVA 1GTUA 6GSXA 4K5RA 1Z7PA 4E8EA 1WJKA 2LQQA 4AF2A 3QAWA 5IPHA 4JZQA 4WF5A 1DE2A 3IHQA 1EWXA 4ZB9A 1MD4A 2FWGA 4HQSA 2IPAA 4PUFC 5JCWA 3CSHA 1H4OA 2FA4A 1A23A 3J7Yb 4G2EA 4XIHA
chains in the Genus database with same CATH topology
5D9TA 1V9WA 2YOIA 4ML6A 1B4PA 4L0WA 1V40A 3IRAA 2DBCA 3FEUA 2CA8A 2AJQB 1GP1A 2PBJA 3E9JB 2NTOA 3W8SA 1TP9A 4EVMA 2P5RA 4MP4A 5CO3A 2HRAA 1XBSA 4AJ8A 2V6OA 2H19A 4PNGA 1W89A 5COHA 3EPTA 18GSA 2QC7A 3FZ4A 4ECIA 4IKHA 1GNEA 2BMXA 4KDXA 4MNNA 3TOTA 5H5SA 2O8VB 4F2IA 3C8EA 4I6XA 2VLUA 4ZBBA 1Y25A 3EMPA 3ED3A 3EYTA 5CREA 2UZ8A 1OVNA 2BJXA 3TJFA 4DEJA 2X8CA 2MMNA 4IQAA 4BVXB 1K3LA 2XC2A 3IHGA 5LD0A 3M9KA 3VWWA 3KH7A 2H74A 2B5YA 5JCGA 1T1VA 5ECPB 1TU7A 1HD2A 1T4YA 3M9JA 4HZ2A 2V1MA 17GSA 4GWRA 5ECNB 5D9WA 1Q98A 3IK9A 4TR1B 2HSHA 4MABA 4IQ1A 2QA2A 2WFCA 3DYRA 5ECLB 3D22A 3CSJA 2OE0A 2WJUA 4PXOA 4OMVA 5ENUA 2RM5A 4WKWA 2GS3A 1RK4A 1C72A 5CRGA 3I43A 3VWUA 1VGLA 5FHIA 2V2GA 5DAKA 3EWLA 1ZMAA 3NOFA 2LRNA 4MJBA 3ZIJA 4XHMA 2C3NA 1V57A 5HR2A 2MZCA 4MMMA 3H8QA 2QA1A 4ECJA 2B7KA 2EIRA 1OE7A 4YQUA 1G7EA 5BRTA 2X4AA 10GSA 2LEGA 3KZQA 3F6DA 1Z7RA 5G1KA 3GSTA 1OC9B 2MMOA 4X0XA 3I9V2 3TRQA 4IBPA 1GSEA 3F3QA 5CRWA 2AV4A 1A24A 1R5PA 4O5RA 1PN0A 4MJEA 4YQVA 3HVSA 2C0DA 3DRNA 1YEXA 5D93A 3GIXA 4TR0A 2IMDA 2H1AA 4KDYA 1GLQA 2KOKA 5J3RA 1R5AA 4EC0A 2GVPA 2PVQA 3DGQA 3UJ1A 4KCEA 1AIUA 5F0GA 3NIVA 4TRXA 2L6CA 3CMIA 4IP6A 2H76A 5IO0A 1XWAA 2K18A 1Z9HA 1EP7A 1FHEA 4L5OA 2HLSA 5A5KA 1OC8A 2H75A 3C71A 1GUKA 2I4AA 2R0CA 5D9XA 5DJMA 4IS0A 1XVWA 4MH2A 4ULXA 5F8BA 4BVYA 3EU4A 5JCUA 4HS1A 2GZZA 4TKYA 2GT6A 3UARA 3ZZXA 3EE2A 2FA8A 5B7CA 4Q5NA 4MPGA 4PUAA 3HXSA 3ERWA 4JBBA 2VAFA 1PN9A 1EOGA 1IYIA 1K0MA 4J56E 5CRHA 2L4CA 4Z7XA 1N8JA 3FW2A 3CRTA 2MYGA 2PWJA 3APQA 1A2MA 2RUEA 5G5EA 1V2AA 1ON4A 1YEPA 2DKHA 5KOXA 1XW5A 3APSA 4BPYA 4WR4A 1ZYEA 3F4RA 1GUHA 4LMWA 1WOUA 4ACSA 4BWQA 2HZFA 3LWAA 1TI1A 4MF5A 3FR6A 3HD5A 4ZL9A 1GSDA 4JR6A 4FIWA 3N5OA 4F82A 1NW2A 4K7OA 4MJAA 6GSWA 3U6VA 2FY6A 5CP1A 4LA1A 3VLNA 5HFKA 1DE1A 2IMIA 3ZTLA 2X49A 2H6YA 4MA9A 4MDCA 3QFBC 2I81A 3O76A 4KUNA 2GDRA 4GSNA 3O3TA 3FZ9A 3A2WA 5H5RA 3GNJA 1AQXA 1Z6NA 4N11A 2OBIA 2ON5A 2IN3A 4Q5RA 1G7OA 2YWNA 1X0RA 3F4TA 1M2DA 1XFLA 2PMTA 2Z9SA 5DQYA 4EUYA 6GSYA 3KH9A 4X1UA 4YKGA 2IFQB 2QSIA 2WZ9A 3M0FA 1HYUA 1FW1A 2JACA 2IFQA 5DDLA 1OYJA 1BEDA 2DIZA 1EEMA 3VK9A 3KTBA 1N2AA 2FHEA 4OWYA 3TKQA 3G7JA 2C1YA 2HXKA 1TRWA 3Q6OA 1THXA 4RI7A 2GZPA 4KSMA 2OA7A 2R6KA 3CRUA 2YWMA 1AAZA 1TTZA 3UOMA 1X5CA 4Z2RA 1F2EA 4POBA 4YAVA 3R3EA 3TKSE 2H30A 4MF7A 1YKCA 5EL8A 2IJYA 5AIVA 3TDGA 4LMVA 3LEFA 4DSQA 3F63A 2REMA 4EIPA 1UA5A 2OE1A 4CDOA 3VFIA 2CX3A 22GSA 3P8WA 3I6AA 1FVJA 1Q4JA 1ERVA 3HCZA 2ON7A 1PL1A 1U3AA 4J57E 2VM1A 3GTUA 4HOJA 1BG5A 3CBUA 4NV2A 3Q19A 3WT2A 4KA0A 3D21A 3MYDA 2N5AA 2KP2A 3W8JA 4Q5FA 2KLXA 4RQXA 5E59A 3KCMA 6GSSA 3TKSA 1XWGA 4E8HA 4OFMA 2GTUA 2GZYA 4PTSA 5AIXA 4GTUA 1W4VA 2K8SA 1GH2A 2JSYA 4WBJA 4ZXGA 1AW9A 3HKRA 4X43A 5IOWA 2OJLA 2EIOA 2XPDA 3IDVA 4AJ6A 1UN2A 3A5WA 3L9VA 1GLPA 2IMKA 2VCTA 1ST9A 2KP1A 3LYPA 5IMAA 1TW9A 3MNGA 3FZ5A 3PH9A 1U88A 4POMA 2CT6A 5DVBA 1O6JA 2AYTA 3RDWA 4EL1A 1X9SB 1X9WB 2X64A 4EDZA 3G7YA 5ECSA 2K6VA 5GAPD 1MEKA 3S9FA 3TB2A 4ZB8A 2ZUPA 4PNFA 3WGXA 2OKAA 1F3BA 1M99A 4F9ZA 3LSZA 1NHYA 4OFTA 4TVEA 3EURA 5KOWA 13GSA 2VL2A 3LXTA 3KEBA 1OKDA 4I5QA 2EIQA 1YDKA 2H6ZA 3CTFA 4NHZA 2M46A 2FCHA 3GUSA 3LXZA 1E6BA 2FWHA 2HYXA 3GSSA 3UL3A 3QOUA 5GSSA 3IAM2 1MTCA 2RIIA 2YV9A 2YZHA 3IBHA 3M3MA 4PQ1A 2A2RA 4FH8A 3UIWA 4P3YB 2O7KA 2R37A 2YV7A 2FUG2 16GSA 2F3MA 1TRUA 4X4JA 3TRPA 3ZMKA 4JRRA 4K0GA 3IOSA 5IO2A 4WEYA 4BL7B 5AGYA 3KP8A 5D9VA 1VF1A 1JZOA 5J41A 1PX7A 2ZNMA 3RPPA 3BCKA 5DQSA 5GZZB 1O8WA 5D96A 1WRYA 3ZRDA 4AJ7A 1KNGA 4BVXA 1SL1B 4WF4A 4K0NA 3VWVA 4LL1B 2DJJA 4I8BA 5ECMB 4TW5A 1Z6MA 2CZ2A 3GV1A 4D73B 2DJKA 3A3TA 2VUPA 4KDUA 4D73A 3V1WA 5J4UA 1R26A 2PERA 2VL9A 2DSAA 3QAGA 4XRAA 2PU9C 4IHUA 2IMFA 3ISOA 2C3QA 2V41A 3PGTA 4QL7A 4NAXA 3I69A 3F4SA 1PD21 1XPVA 2QKEA 4TR1A 2BTOT 1PX6A 3LFLA 4N0ZA 2LQOA 2GSSA 3GH6A 3IE3A 4CY6A 2CX4A 3FY7A 2DLXA 4V1Ap 3TCOA 3UVHA 2PN8A 2FGXA 2YWOA 4HJ2A 3GX0A 1SYXA 1OAZA 4N30A 5ELAA 3P7XA 3VI5A 5HR0A 4OCFA 4ID0A 3GMFA 1XCCA 1JZWA 1TJDA 1WMJA 1B8XA 2KUCA 3VURA 1SD9A 3EVIA 2VM2A 5B6MA 3PINA 5EPFA 4CW9A 2I3YA 3KJYA 1U3IA 2MMZA 3E0UA 1K3YA 1TK8B 5JWRB 4FQUA 2A4HA 5E4WA 2WCIA 5A4WA 2A4VA 1OC9A 3BD2A 5FWGA 4EO3A 2B1KA 3L9SA 4FYCA 2FWFA 1YZXA 3EINA 1QXHA 2HI7A 1NSWA 2IIYA 1BYEA 1QQ2A 1K3OA 1V98A 3QPMA 3IV4A 4K9ZA 4IJIA 2LJKA 2R5GA 5B8BA 2VCQA 14GSA 3TOUA 1GL8A 1G0TA 2P31A 5LCZA 1SKRB 2TRCP 1ZYNA 4I97A 3GH9A 2EC4A 4I2UA 3DVWA 1X5EA 2DKIA 1GTAA 2YWIA 3KD0A 3ZREA 1JZDA 2IL3A 2C0FA 2DJ2A 2VL2C 4MLYA 5HR1A 2M80A 1ZOFA 5BMUA 1A2JA 12GSA 3H93A 5A4UA 2CQ9A 2L59A 2H71A 2H6XA 1BX9A 3HVVA 1XOBA 2F8AA 2DMMA 1FG4A 1FAAA 2B5XA 4NHWA 1EGRA 4L0UA 2AHEA 3BBYA 3ZFLA 1TKDB 5AISA 2H1BA 4XCSA 2F8FA 4KW6A 3EMXA 2J9HA 3HA9A 2YPMA 3C1SA 3J7Yk 1JHBA 3L78A 2NDOA 3L9UA 4ZB6A 4YH2A 1J08A 2A2PA 2DJ0A 1J9BA 4PQHA 3U5RE 1ERWA 1DBYA 2OADA 4K6XA 1SK0A 4TR3A 4KE3A 4GRFA 5IM9A 4K7IA 2GLRA 2PUKC 5ECKB 2OACA 2TRXA 1K0OA 1F37A 4KNDA 4ISDA 2FD3A 5IMCA 1GTBA 3BOAA 1PMTA 2O89A 1O85A 2K8VA 2YZUA 2L5LA 2NPBA 3G7IA 4DSSB 1GRXA 2C8UA 2DIYA 5ID2B 4IW9A 2H8LA 1JZRA 1YJ6A 2ALBA 2VO4A 20GSA 3TJKA 4F03A 1SL2B 3UAPA 1PRXA 1AUCA 4K2DA 4O32A 1PSQA 1UVZA 3HJOA 4FO5A 4J2FA 1FO5A 4PQIA 3P90A 1VF3A 2F9SA 2H73A 4G0LA 3MAKA 2WDUA 3D4TA 3LQ7A 4PURA 1O81A 2DJ1A 5FT3A 1PKWA 1SJIA 2GSTA 2GSQA 3GKMA 4USSA 3TKRA 4KH7A 3A2VA 3F3RA 1HNBA 3N9JA 1XIYA 1YKAA 2CAIA 1XWCA 2R2JA 3GKXA 3W6GA 3QMXA 5DCGA 3FKFA 4O5QA 2R0PA 1T4ZA 5C00A 1THOA 3UVTA 2I9HA 2WRTA 5LNKe 2L6DA 1R4WA 3MIXA 2H72A 4K2XA 1OKTA 1OE8A 3K8NA 2B3SA 2LKUA 1FB0A 1GTIA 3GA4A 1VF2A 4L8EA 3HJPA 2G2QA 4KAEA 1T8EB 2M72A 3SWLA 4NMUA 2A2SA 4HQZA 2FNOA 3GRXA 4Z2UA 1M2AA 3US3A 1ABAA 5ECIB 4EDYA 5IIZA 4HDEA 1ERTA 3HDCA 4XS6A 4K7NA 3KM6A 4N10A 4OO5A 1VF4A 2C4JA 1SD8A 4HEA2 3GURA 4G9HA 5IMDA 1TXXA 4FYUA 5KN0A 1ACVA 4ZBAA 1FOHA 5EVOA 3HZ4A 3KMOA 1FVKA 1SKWB 3GL5A 4DVCA 3GL3A 1LJRA 2P0GA 1R7HA 4XTSA 3H79A 2KHPA 1J0FA 1TRVA 4G0IA 5ABRA 2MMAA 1EV9A 5KN1A 4JEDA 3SBCA 1MDKA 3MWHA 4HUAA 5C04A 1WIKA 2FWEA 4LL4B 2HSYA 5IOXA 4ZL7A 3UBKA 3TGZA 1SJ6A 2LRCA 2YNXA 3DKSA 3IAS2 3ZFBA 3VWXA 2VD1A 4XS1A 2H1DA 3HVXA 3WD6A 3HYPA 3KTLA 5DBQA 1S3DA 5ELGA 1V58A 1QUWA 4NWYA 3MSZA 5F06A 4OFNA 1F6MC 3VPTA 5ECOB 5CNWA 1SJZA 3FZAA 1XXUA 4OO4A 4ZILA 4G10A 3IPZA 4MPFA 5ECQB 1CQGA 1SENA 4TOPA 4XS4B 1XOAA 3LJRA 4DSRA 2LNSA 3QFAC 5G31A 1H75A 3TUEA 1U6TA 1ILOA 2L57A 3Q74A 1MDJA 4LLRA 1KEBA 1AXDA 2VCVA 3KGKA 4FYBA 1GSSA 3FK8A 2H70A 5IMVA 1URMA 6GSUA 4HZ4A 5A4VA 1EZKA 2QGVA 2VL3A 4IVFA 4O92A 2NVLA 3C73A 2E2GA 4JU5A 1X9MB 4GQCA 1BAYA 5DCHA 2H1GA 3CSIA 3RAZA 1B4QA 2HRFA 4GQFA 5GSTA 4TXOB 4HI7A 2YP6A 2HFDA 4TXOA 4ZL8A 2LJRA 3DXBA 5DALB 1WE0A 1GULA 1Z5YE 4IJ3A 2R3XA 1XWKA 5DALA 3F8UA 1SK1A 3ZITA 1K0CA 2O87A 4N0VA 4O5UA 2RUFA 4JE1A 4BL7A 1ZCPA 1NHOA 2FLSA 4OCEA 3RBTA 1XZOA 2X99A 1F3AA 2JZRA 4K5SA 5J9BA 4ECCA 5KN3A 2H0GA 2PPTA 3C1RA 4IELA 2C3TA 2VCXA 1A0RP 2HE3A 2V32A 2WB9A 3GKKA 3TRXA 4IN0A 2B7JA 4GLTA 3FR9A 2HZEB 2PVOC 4NV5A 5G30A 4BWSA 1RW1A 3LW9A 2HZEA 1T7PB 2VCZA 3QR6A 4POLA 2RM6A 3DIEA 3JCML 5ECHB 3D6IA 3P2AA 1WWJA 1BQ7A 4H86A 1LBKA 3H4KA 1M9AA 3HY2A 3LG6A 3FHKA 3IC4A 5EY6A 3LORA 1PKZA 2DMLA 4ZIJA 2LTKA 1AC1A 2V6KA 1QK8A 3F9UA 4MCUA 1M0UA 1A0FA 2R4VA 19GSA 2B5EA 1AQVA 5F07A 3GX8A 1QFNA 1S3CA 1T00A 4GXZA 5INYA 1F9MA 4V2NA 4HU9A 3HHVA 3ME8A 2N5BA 2X8GA 1E2YA 3TKSC 1EP8A 4KB3A 5KEJA 5CAXA 2H0HA 1CQHA 3WGDA 3BCIA 3DEXA 2CVKA 1NM3A 2C80A 5DAKB 2XBQA 4TXVA 4MF6A 2AAWA 1EV4A 4AGSA 3IR4A 1GUMA 1A8YA 1K0DA 3RPNA 4GSSA 1A2LA 6GSVA 1S3AA 4GF0A 4MH3A 4V2MA 5B8AA 1MD3A 4NXIA 4PX1A 1SK2A 2GQKA 2B6MA 3FR3A 1M2BA 3L0HA 3M8NA 1M9BA 4YAPA 3PPUA 4WBRD 3A2XA 2JU5A 1K0NA 2YJHA 2CVDA 3PR8A 2AB6A 2GT5A 2G0FA 2L5OA 4TN8A 4I2TA 2J23A 3D0ZA 5D8IA 4MJCA 3UBLA 5JWQB 1ZL9A 1YF1A 4V2LA 1HNAA 4Q5QA 4EXJA 11GSA 4HJMA 3F6FA 3AY8A 1PL2A 3R2QA 3HZ8A 2JZTA 1SYRA 3HJMA 2VLTA 1OC3A 2LS5A 3TKPA 2CVBA 3NZNA 2RLIA 4YQMA 4G19A 1G6WA 4BA7A 2VLVA 2LJAA 4EIQA 2GGTA 1A8LA 8GSSA 1PGTA 4WR5A 4PGTA 2LSTA 4BVYB 2C0EA 2B1LA 1XW9A 2HRNA 4QL9A 1GSFA 4A5PA 3QD9A 1WPIA 1YQ1A 3M1GA 4XRDA 3VI7A 1ZGNA 4ICYA 5G1LA 3GHAA 1SKSB 2LV3A 3WT1A 4MZWA 1U87A 4EKZA 1SU9A 2E2MA 3QDNA 3ZLPA 2XBIA 2XPEA 4HU7A 3D4MA 1GNWA 3C7MA 1JLVA 2N5FA 2C0GA 4POKA 1Y6EA 3KXOA 2YN1A 3L4NA 2H01A 5ECRB 2E0QA 2LNTA 1O73A 3O6TA 4V1Ag 2LRTA 3WGEA 3KP9A 1SL0B 4DSSA 5H5QA 5IQYA 4KCAA 3ZVJD 1KTEA 1T3BA 2XHFA 2K9FA 3CYNA 2X8HA 1K0AA 5ID2A 3DD3A 1B9YC 2MBSA 1QMVA 4G0KA 3IXRA 1IYHA 1B48A 2CZ3A 6GSTA 1O8XA 2AUVA 1HNCA 2JL4A 3DVXA 3RHBA 4KSOA 4YKFA 4GSTA 4QQ7A 5IPGA 3ERFA 3UMAA 4F0BA 1B9XC 2O85A 3FRCA 1TOFA 2DJ3A 1TU8A 2GQMA 2GSRA 5J9CA 1MDIA 2MBTA 3QCPA 1RQMA 2VD0A 1ZYPA 4ILFA 5DJLA 5D73A 3ZVJA 2WULA 1WP0A 1TDIA 2ES7A 4L5LA 1HQOA 5KN2A 5HFGA 3D5JA 1AQWA 5J5NA 1FOVA 4TR4A 2IMEA 2H0IA 5HFIA 2YCDA 2JZSA 3RHCA 3DMLA 2WGRA 2YJ7A 4NPBA 3WYWA 5CRDA 3FMWA 3LGCA 2OBKA 1ML6A 2TIRA 9GSSA 4O7HA 3APOA 2GQLA 3QAVA 1PQNA 2HNLA 4CY8A 2H66A 3TJBA 2ZCTA 2F51A 1I9DA 4K1FA 1YF0A 5B6NA 3Q18A 1TI3A 1EEJA 3CTGA 3OR5A 1GSQA 1XVQA 2JSZA 1M7TA 2IWTA 1EOHA 1YY7A 2L4QA 2LUSA 3GYKA 2WS2A 4KGIA 3GN3A 3LYKA 1X5DA 1VRSD 4EF0A 1ZZYA 3TJGA 2NBSA 3KMNA 3A5IA 2DC5A 1KBNA 1PA3A 1G6YA 4WXTA 2VCWA 4WETA 5JWOB 3BJ5A 1XWBA 3GTUB 1I5GA 4IGJA 1O7UA 5HQPA 2JADA 2OE3A 3GFKA 4OD7A 3FYGA 2VIMA 1GSYA 7GSSA 1ZYQB 2P5QA 5G5FA 3DWVA 3MDKA 5CYYA 1DSBA 1ERUA 1GWCA 3ZIVA 5L71A 4RQRA 1EGOA 3TJJA 1BJXA 2D2ZA 2CV4A 4ECBA 5GAND 4JR4A 5F05A 3IK7A 2HRKA 5G2ZA 1JFUA 3IA1A 4MK3A 1XW6A 4KX4A 2R0GA 2YANA 3ZL5A 2HSMA 3ZYWA 3G9BA 3KIJA 3ZMLA 1UC7A 2HT9A 4MZBA 3E3EA 1FB6A 1USBA 4RI6A 4K8MA 3EC3A 5IMFA 5HR3A 3IC8A 2CAQA 4Z2TA 3EU3A 3VPQA 1GSUA 4GCIA 4IP1A 4MZCA 1LU4A 3ERGA 2I1UA 1Z3EA 4CHSA 5AN1A 1TK5B 3UEMA 3F0IA 3ME7A 1TRSA 2E7PA 4F0CA 4KF9A 3H1NA 4XS4A 2VOCA 3GKNA 1QGVA 4ML1A 1K0BA 2PGTA 4ZBDA 3CXGA 1JLWA 4EE0A 1DUGA 1TK0B 5IMZA 4RUVA 1GTUA 6GSXA 4K5RA 1Z7PA 4E8EA 1WJKA 2LQQA 4AF2A 3QAWA 5IPHA 4JZQA 4WF5A 1DE2A 3IHQA 1EWXA 4ZB9A 1MD4A 2FWGA 4HQSA 2IPAA 4PUFC 5JCWA 3CSHA 1H4OA 2FA4A 1A23A 3J7Yb 4G2EA 4XIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D9T A;  1V9W A;  2YOI A;  4ML6 A;  1B4P A;  4L0W A;  1V40 A;  3IRA A;  2DBC A;  3FEU A;  2CA8 A;  2AJQ B;  1GP1 A;  2PBJ A;  3E9J B;  2NTO A;  3W8S A;  1TP9 A;  4EVM A;  2P5R A;  4MP4 A;  5CO3 A;  1XBS A;  4AJ8 A;  2V6O A;  2H19 A;  4PNG A;  1W89 A;  5COH A;  18GS A;  2QC7 A;  3FZ4 A;  4ECI A;  4IKH A;  1GNE A;  2BMX A;  4KDX A;  3TOT A;  5H5S A;  2O8V B;  4F2I A;  3C8E A;  4I6X A;  2VLU A;  4ZBB A;  1Y25 A;  3EMP A;  3ED3 A;  3EYT A;  5CRE A;  1OVN A;  2BJX A;  3TJF A;  4DEJ A;  2X8C A;  2MMN A;  4IQA A;  1K3L A;  2XC2 A;  5LD0 A;  3M9K A;  3VWW A;  3KH7 A;  2H74 A;  2B5Y A;  5JCG A;  1T1V A;  5ECP B;  1TU7 A;  1HD2 A;  1T4Y A;  3M9J A;  4HZ2 A;  2V1M A;  17GS A;  4GWR A;  5ECN B;  5D9W A;  1Q98 A;  3IK9 A;  4TR1 B;  2HSH A;  4MAB A;  4IQ1 A;  2WFC A;  3DYR A;  5ECL B;  3D22 A;  3CSJ A;  2OE0 A;  2WJU A;  4PXO A;  4OMV A;  5ENU A;  2RM5 A;  4WKW A;  2GS3 A;  1RK4 A;  1C72 A;  5CRG A;  3I43 A;  3VWU A;  1VGL A;  5FHI A;  2V2G A;  5DAK A;  3EWL A;  1ZMA A;  3NOF A;  2LRN A;  4MJB A;  3ZIJ A;  4XHM A;  2C3N A;  1V57 A;  5HR2 A;  2MZC A;  4MMM A;  3H8Q A;  4ECJ A;  2B7K A;  2EIR A;  1OE7 A;  4YQU A;  1G7E A;  10GS A;  2LEG A;  3KZQ A;  3F6D A;  1Z7R A;  5G1K A;  3GST A;  1OC9 B;  2MMO A;  4X0X A;  3I9V 2;  3TRQ A;  4IBP A;  1GSE A;  3F3Q A;  5CRW A;  2AV4 A;  1A24 A;  1R5P A;  4O5R A;  4MJE A;  4YQV A;  3HVS A;  2C0D A;  3DRN A;  1YEX A;  5D93 A;  3GIX A;  4TR0 A;  2IMD A;  2H1A A;  4KDY A;  1GLQ A;  2KOK A;  5J3R A;  1R5A A;  4EC0 A;  2GVP A;  2PVQ A;  3DGQ A;  3UJ1 A;  4KCE A;  1AIU A;  5F0G A;  3NIV A;  4TRX A;  2L6C A;  3CMI A;  4IP6 A;  2H76 A;  5IO0 A;  1XWA A;  2K18 A;  1Z9H A;  1EP7 A;  1FHE A;  4L5O A;  2HLS A;  5A5K A;  1OC8 A;  2H75 A;  3C71 A;  1GUK A;  2I4A A;  5D9X A;  5DJM A;  4IS0 A;  1XVW A;  4MH2 A;  4ULX A;  5F8B A;  4BVY A;  3EU4 A;  5JCU A;  4HS1 A;  2GZZ A;  4TKY A;  2GT6 A;  3UAR A;  3ZZX A;  3EE2 A;  2FA8 A;  5B7C A;  4Q5N A;  4MPG A;  4PUA A;  3HXS A;  3ERW A;  4JBB A;  2VAF A;  1PN9 A;  1EOG A;  1IYI A;  1K0M A;  4J56 E;  5CRH A;  2L4C A;  4Z7X A;  1N8J A;  3FW2 A;  3CRT A;  2MYG A;  2PWJ A;  3APQ A;  1A2M A;  2RUE A;  5G5E A;  1V2A A;  1ON4 A;  1YEP A;  1XW5 A;  3APS A;  4BPY A;  4WR4 A;  1ZYE A;  3F4R A;  1GUH A;  4LMW A;  1WOU A;  4ACS A;  4BWQ A;  2HZF A;  3LWA A;  1TI1 A;  4MF5 A;  3FR6 A;  3HD5 A;  4ZL9 A;  1GSD A;  4JR6 A;  4FIW A;  3N5O A;  4F82 A;  1NW2 A;  4K7O A;  4MJA A;  6GSW A;  3U6V A;  2FY6 A;  5CP1 A;  4LA1 A;  3VLN A;  5HFK A;  1DE1 A;  2IMI A;  3ZTL A;  2H6Y A;  4MA9 A;  4MDC A;  3QFB C;  2I81 A;  3O76 A;  4KUN A;  2GDR A;  4GSN A;  3O3T A;  3FZ9 A;  3A2W A;  5H5R A;  3GNJ A;  1AQX A;  1Z6N A;  4N11 A;  2OBI A;  2ON5 A;  2IN3 A;  4Q5R A;  1G7O A;  2YWN A;  1X0R A;  3F4T A;  1M2D A;  1XFL A;  2PMT A;  2Z9S A;  5DQY A;  4EUY A;  6GSY A;  3KH9 A;  4X1U A;  2IFQ B;  2QSI A;  2WZ9 A;  3M0F A;  1HYU A;  1FW1 A;  2JAC A;  2IFQ A;  5DDL A;  1OYJ A;  1BED A;  2DIZ A;  1EEM A;  3VK9 A;  3KTB A;  1N2A A;  2FHE A;  4OWY A;  3TKQ A;  3G7J A;  2C1Y A;  2HXK A;  1TRW A;  3Q6O A;  1THX A;  4RI7 A;  2GZP A;  4KSM A;  2OA7 A;  2R6K A;  3CRU A;  2YWM A;  1AAZ A;  1TTZ A;  3UOM A;  1X5C A;  1F2E A;  4POB A;  4YAV A;  3TKS E;  2H30 A;  4MF7 A;  1YKC A;  5EL8 A;  2IJY A;  5AIV A;  3TDG A;  4LMV A;  3LEF A;  4DSQ A;  3F63 A;  2REM A;  1UA5 A;  2OE1 A;  4CDO A;  3VFI A;  2CX3 A;  22GS A;  3P8W A;  3I6A A;  1FVJ A;  1Q4J A;  1ERV A;  3HCZ A;  2ON7 A;  1PL1 A;  1U3A A;  4J57 E;  2VM1 A;  3GTU A;  4HOJ A;  1BG5 A;  3CBU A;  4NV2 A;  3Q19 A;  3WT2 A;  4KA0 A;  3D21 A;  2N5A A;  2KP2 A;  3W8J A;  4Q5F A;  2KLX A;  4RQX A;  5E59 A;  3KCM A;  6GSS A;  3TKS A;  1XWG A;  4E8H A;  4OFM A;  2GTU A;  2GZY A;  5AIX A;  4GTU A;  1W4V A;  2K8S A;  1GH2 A;  2JSY A;  4WBJ A;  4ZXG A;  1AW9 A;  3HKR A;  4X43 A;  5IOW A;  2OJL A;  2EIO A;  2XPD A;  3IDV A;  4AJ6 A;  1UN2 A;  3A5W A;  3L9V A;  1GLP A;  2IMK A;  2VCT A;  1ST9 A;  2KP1 A;  3LYP A;  5IMA A;  1TW9 A;  3MNG A;  3FZ5 A;  3PH9 A;  1U88 A;  4POM A;  2CT6 A;  5DVB A;  1O6J A;  2AYT A;  3RDW A;  4EL1 A;  1X9S B;  1X9W B;  2X64 A;  4EDZ A;  3G7Y A;  5ECS A;  2K6V A;  5GAP D;  1MEK A;  3S9F A;  3TB2 A;  4ZB8 A;  2ZUP A;  4PNF A;  3WGX A;  2OKA A;  1F3B A;  1M99 A;  4F9Z A;  3LSZ A;  1NHY A;  4OFT A;  4TVE A;  3EUR A;  13GS A;  2VL2 A;  3LXT A;  3KEB A;  1OKD A;  4I5Q A;  2EIQ A;  1YDK A;  2H6Z A;  3CTF A;  4NHZ A;  2M46 A;  2FCH A;  3GUS A;  3LXZ A;  1E6B A;  2FWH A;  2HYX A;  3GSS A;  3UL3 A;  3QOU A;  5GSS A;  3IAM 2;  1MTC A;  2RII A;  2YV9 A;  2YZH A;  3IBH A;  3M3M A;  4PQ1 A;  2A2R A;  4FH8 A;  3UIW A;  4P3Y B;  2O7K A;  2R37 A;  2YV7 A;  2FUG 2;  16GS A;  2F3M A;  1TRU A;  3TRP A;  3ZMK A;  4JRR A;  4K0G A;  3IOS A;  5IO2 A;  4WEY A;  5AGY A;  3KP8 A;  5D9V A;  1VF1 A;  1JZO A;  5J41 A;  1PX7 A;  2ZNM A;  3RPP A;  3BCK A;  5DQS A;  5GZZ B;  1O8W A;  5D96 A;  1WRY A;  3ZRD A;  4AJ7 A;  1KNG A;  4BVX A;  1SL1 B;  4WF4 A;  4K0N A;  3VWV A;  4LL1 B;  2DJJ A;  4I8B A;  5ECM B;  4TW5 A;  1Z6M A;  2CZ2 A;  3GV1 A;  4D73 B;  2DJK A;  3A3T A;  2VUP A;  4KDU A;  4D73 A;  3V1W A;  5J4U A;  1R26 A;  2PER A;  2VL9 A;  2DSA A;  3QAG A;  4XRA A;  2PU9 C;  4IHU A;  2IMF A;  3ISO A;  2C3Q A;  2V41 A;  3PGT A;  4QL7 A;  4NAX A;  3I69 A;  3F4S A;  1PD2 1;  1XPV A;  2QKE A;  4TR1 A;  2BTO T;  1PX6 A;  3LFL A;  4N0Z A;  2LQO A;  2GSS A;  3GH6 A;  3IE3 A;  2CX4 A;  3FY7 A;  2DLX A;  4V1A p;  3TCO A;  3UVH A;  2PN8 A;  2FGX A;  2YWO A;  4HJ2 A;  3GX0 A;  1SYX A;  1OAZ A;  4N30 A;  5ELA A;  3P7X A;  3VI5 A;  5HR0 A;  4OCF A;  4ID0 A;  3GMF A;  1XCC A;  1JZW A;  1TJD A;  1WMJ A;  1B8X A;  2KUC A;  3VUR A;  1SD9 A;  3EVI A;  2VM2 A;  5B6M A;  3PIN A;  5EPF A;  4CW9 A;  2I3Y A;  3KJY A;  1U3I A;  2MMZ A;  3E0U A;  1K3Y A;  1TK8 B;  5JWR B;  5E4W A;  2WCI A;  5A4W A;  2A4V A;  1OC9 A;  3BD2 A;  5FWG A;  4EO3 A;  2B1K A;  3L9S A;  4FYC A;  2FWF A;  1YZX A;  3EIN A;  1QXH A;  2HI7 A;  1NSW A;  2IIY A;  1BYE A;  1QQ2 A;  1K3O A;  1V98 A;  3QPM A;  3IV4 A;  4K9Z A;  4IJI A;  2LJK A;  2R5G A;  5B8B A;  2VCQ A;  14GS A;  3TOU A;  1GL8 A;  1G0T A;  2P31 A;  5LCZ A;  1SKR B;  2TRC P;  4I97 A;  3GH9 A;  2EC4 A;  4I2U A;  3DVW A;  1X5E A;  1GTA A;  2YWI A;  3KD0 A;  3ZRE A;  1JZD A;  2IL3 A;  2C0F A;  2DJ2 A;  2VL2 C;  4MLY A;  5HR1 A;  2M80 A;  1ZOF A;  1A2J A;  12GS A;  3H93 A;  5A4U A;  2CQ9 A;  2L59 A;  2H71 A;  2H6X A;  1BX9 A;  3HVV A;  1XOB A;  2F8A A;  2DMM A;  1FG4 A;  1FAA A;  2B5X A;  4NHW A;  1EGR A;  4L0U A;  2AHE A;  3BBY A;  3ZFL A;  1TKD B;  5AIS A;  2H1B A;  4XCS A;  2F8F A;  4KW6 A;  3EMX A;  2J9H A;  3HA9 A;  2YPM A;  3C1S A;  3J7Y k;  1JHB A;  3L78 A;  2NDO A;  3L9U A;  4ZB6 A;  4YH2 A;  1J08 A;  2DJ0 A;  1J9B A;  4PQH A;  3U5R E;  1ERW A;  1DBY A;  2OAD A;  4K6X A;  1SK0 A;  4TR3 A;  4KE3 A;  4GRF A;  5IM9 A;  4K7I A;  2GLR A;  2PUK C;  5ECK B;  2OAC A;  2TRX A;  1K0O A;  1F37 A;  4KND A;  4ISD A;  2FD3 A;  5IMC A;  1GTB A;  3BOA A;  1PMT A;  2O89 A;  1O85 A;  2K8V A;  2YZU A;  2L5L A;  2NPB A;  3G7I A;  4DSS B;  1GRX A;  2C8U A;  2DIY A;  5ID2 B;  4IW9 A;  2H8L A;  1JZR A;  1YJ6 A;  2ALB A;  2VO4 A;  20GS A;  3TJK A;  4F03 A;  1SL2 B;  3UAP A;  1PRX A;  1AUC A;  4K2D A;  4O32 A;  1PSQ A;  1UVZ A;  3HJO A;  4FO5 A;  4J2F A;  1FO5 A;  4PQI A;  3P90 A;  1VF3 A;  2F9S A;  2H73 A;  3MAK A;  2WDU A;  3D4T A;  3LQ7 A;  4PUR A;  1O81 A;  2DJ1 A;  5FT3 A;  1PKW A;  1SJI A;  2GST A;  2GSQ A;  3GKM A;  3TKR A;  4KH7 A;  3A2V A;  3F3R A;  1HNB A;  3N9J A;  1XIY A;  1YKA A;  2CAI A;  1XWC A;  2R2J A;  3GKX A;  3W6G A;  3QMX A;  5DCG A;  3FKF A;  1T4Z A;  5C00 A;  1THO A;  3UVT A;  2I9H A;  2WRT A;  5LNK e;  2L6D A;  1R4W A;  2H72 A;  1OKT A;  1OE8 A;  3K8N A;  2B3S A;  2LKU A;  1FB0 A;  1GTI A;  3GA4 A;  1VF2 A;  4L8E A;  3HJP A;  2G2Q A;  4KAE A;  1T8E B;  2M72 A;  3SWL A;  4NMU A;  2A2S A;  4HQZ A;  2FNO A;  3GRX A;  1M2A A;  3US3 A;  1ABA A;  5ECI B;  4EDY A;  5IIZ A;  4HDE A;  1ERT A;  3HDC A;  4XS6 A;  4K7N A;  3KM6 A;  4N10 A;  4OO5 A;  1VF4 A;  2C4J A;  1SD8 A;  4HEA 2;  3GUR A;  4G9H A;  5IMD A;  1TXX A;  4FYU A;  5KN0 A;  1ACV A;  4ZBA A;  5EVO A;  3HZ4 A;  3KMO A;  1FVK A;  1SKW B;  3GL5 A;  4DVC A;  3GL3 A;  1LJR A;  2P0G A;  1R7H A;  4XTS A;  3H79 A;  2KHP A;  1J0F A;  1TRV A;  5ABR A;  2MMA A;  1EV9 A;  5KN1 A;  4JED A;  3SBC A;  1MDK A;  3MWH A;  4HUA A;  5C04 A;  1WIK A;  2FWE A;  4LL4 B;  2HSY A;  5IOX A;  4ZL7 A;  3UBK A;  3TGZ A;  1SJ6 A;  2LRC A;  2YNX A;  3DKS A;  3IAS 2;  3ZFB A;  3VWX A;  2VD1 A;  4XS1 A;  2H1D A;  3HVX A;  3WD6 A;  3HYP A;  3KTL A;  5DBQ A;  1S3D A;  5ELG A;  1V58 A;  1QUW A;  4NWY A;  3MSZ A;  5F06 A;  4OFN A;  1F6M C;  3VPT A;  5ECO B;  5CNW A;  1SJZ A;  3FZA A;  1XXU A;  4OO4 A;  4ZIL A;  4G10 A;  3IPZ A;  4MPF A;  5ECQ B;  1CQG A;  1SEN A;  4TOP A;  4XS4 B;  1XOA A;  3LJR A;  4DSR A;  2LNS A;  3QFA C;  5G31 A;  1H75 A;  3TUE A;  1U6T A;  1ILO A;  2L57 A;  3Q74 A;  1MDJ A;  4LLR A;  1KEB A;  1AXD A;  2VCV A;  3KGK A;  4FYB A;  1GSS A;  3FK8 A;  2H70 A;  5IMV A;  1URM A;  6GSU A;  4HZ4 A;  5A4V A;  1EZK A;  2QGV A;  2VL3 A;  4IVF A;  4O92 A;  2NVL A;  3C73 A;  2E2G A;  4JU5 A;  1X9M B;  4GQC A;  1BAY A;  5DCH A;  2H1G A;  3CSI A;  3RAZ A;  1B4Q A;  2HRF A;  4GQF A;  5GST A;  4TXO B;  4HI7 A;  2YP6 A;  2HFD A;  4TXO A;  4ZL8 A;  2LJR A;  3DXB A;  5DAL B;  1WE0 A;  1GUL A;  1Z5Y E;  4IJ3 A;  2R3X A;  1XWK A;  5DAL A;  3F8U A;  1SK1 A;  3ZIT A;  1K0C A;  2O87 A;  4N0V A;  2RUF A;  4JE1 A;  4BL7 A;  1ZCP A;  1NHO A;  2FLS A;  4OCE A;  3RBT A;  1XZO A;  2X99 A;  1F3A A;  2JZR A;  5J9B A;  4ECC A;  5KN3 A;  2H0G A;  2PPT A;  3C1R A;  4IEL A;  2C3T A;  2VCX A;  1A0R P;  2HE3 A;  2V32 A;  2WB9 A;  3GKK A;  3TRX A;  4IN0 A;  2B7J A;  4GLT A;  3FR9 A;  2HZE B;  2PVO C;  4NV5 A;  5G30 A;  4BWS A;  1RW1 A;  2HZE A;  1T7P B;  2VCZ A;  3QR6 A;  4POL A;  2RM6 A;  3DIE A;  3JCM L;  5ECH B;  3D6I A;  3P2A A;  1WWJ A;  1BQ7 A;  4H86 A;  1LBK A;  3H4K A;  1M9A A;  3HY2 A;  3LG6 A;  3FHK A;  3IC4 A;  5EY6 A;  3LOR A;  1PKZ A;  2DML A;  4ZIJ A;  2LTK A;  1AC1 A;  2V6K A;  1QK8 A;  3F9U A;  4MCU A;  1M0U A;  1A0F A;  2R4V A;  19GS A;  2B5E A;  1AQV A;  5F07 A;  3GX8 A;  1QFN A;  1S3C A;  1T00 A;  4GXZ A;  5INY A;  1F9M A;  4V2N A;  4HU9 A;  3HHV A;  3ME8 A;  2N5B A;  2X8G A;  1E2Y A;  3TKS C;  1EP8 A;  4KB3 A;  5KEJ A;  5CAX A;  2H0H A;  1CQH A;  3WGD A;  3BCI A;  3DEX A;  2CVK A;  1NM3 A;  2C80 A;  5DAK B;  2XBQ A;  4TXV A;  4MF6 A;  2AAW A;  1EV4 A;  4AGS A;  3IR4 A;  1GUM A;  1A8Y A;  1K0D A;  3RPN A;  4GSS A;  1A2L A;  6GSV A;  1S3A A;  4GF0 A;  4MH3 A;  4V2M A;  5B8A A;  1MD3 A;  4NXI A;  4PX1 A;  1SK2 A;  2GQK A;  2B6M A;  3FR3 A;  1M2B A;  3L0H A;  3M8N A;  1M9B A;  4YAP A;  4WBR D;  3A2X A;  2JU5 A;  1K0N A;  2YJH A;  2CVD A;  3PR8 A;  2AB6 A;  2GT5 A;  2G0F A;  2L5O A;  4TN8 A;  4I2T A;  2J23 A;  3D0Z A;  5D8I A;  4MJC A;  3UBL A;  5JWQ B;  1ZL9 A;  1YF1 A;  4V2L A;  1HNA A;  4Q5Q A;  4EXJ A;  11GS A;  4HJM A;  3F6F A;  3AY8 A;  1PL2 A;  3R2Q A;  3HZ8 A;  2JZT A;  1SYR A;  3HJM A;  2VLT A;  1OC3 A;  2LS5 A;  3TKP A;  2CVB A;  3NZN A;  2RLI A;  4YQM A;  4G19 A;  1G6W A;  4BA7 A;  2VLV A;  2LJA A;  2GGT A;  1A8L A;  8GSS A;  1PGT A;  4WR5 A;  4PGT A;  2LST A;  2C0E A;  2B1L A;  1XW9 A;  2HRN A;  4QL9 A;  1GSF A;  3QD9 A;  1WPI A;  1YQ1 A;  3M1G A;  4XRD A;  3VI7 A;  1ZGN A;  5G1L A;  3GHA A;  1SKS B;  2LV3 A;  3WT1 A;  4MZW A;  1U87 A;  4EKZ A;  1SU9 A;  2E2M A;  3QDN A;  3ZLP A;  2XBI A;  2XPE A;  4HU7 A;  3D4M A;  1GNW A;  3C7M A;  1JLV A;  2N5F A;  2C0G A;  4POK A;  1Y6E A;  3KXO A;  2YN1 A;  3L4N A;  2H01 A;  5ECR B;  2E0Q A;  2LNT A;  1O73 A;  3O6T A;  4V1A g;  2LRT A;  3WGE A;  3KP9 A;  1SL0 B;  4DSS A;  5H5Q A;  5IQY A;  4KCA A;  3ZVJ D;  1KTE A;  1T3B A;  2XHF A;  2K9F A;  3CYN A;  2X8H A;  1K0A A;  5ID2 A;  3DD3 A;  1B9Y C;  2MBS A;  1QMV A;  3IXR A;  1IYH A;  1B48 A;  2CZ3 A;  6GST A;  1O8X A;  2AUV A;  1HNC A;  2JL4 A;  3DVX A;  3RHB A;  4KSO A;  4GST A;  4QQ7 A;  5IPG A;  3ERF A;  3UMA A;  4F0B A;  1B9X C;  2O85 A;  3FRC A;  1TOF A;  2DJ3 A;  1TU8 A;  2GQM A;  2GSR A;  5J9C A;  1MDI A;  2MBT A;  3QCP A;  1RQM A;  2VD0 A;  4ILF A;  5DJL A;  5D73 A;  3ZVJ A;  2WUL A;  1WP0 A;  1TDI A;  2ES7 A;  4L5L A;  1HQO A;  5KN2 A;  5HFG A;  3D5J A;  1AQW A;  5J5N A;  1FOV A;  4TR4 A;  2IME A;  2H0I A;  5HFI A;  2YCD A;  2JZS A;  3RHC A;  3DML A;  2WGR A;  2YJ7 A;  4NPB A;  3WYW A;  5CRD A;  3LGC A;  2OBK A;  1ML6 A;  2TIR A;  9GSS A;  4O7H A;  3APO A;  2GQL A;  3QAV A;  1PQN A;  2HNL A;  2H66 A;  3TJB A;  2ZCT A;  2F51 A;  1I9D A;  4K1F A;  1YF0 A;  5B6N A;  3Q18 A;  1TI3 A;  1EEJ A;  3CTG A;  3OR5 A;  1GSQ A;  1XVQ A;  2JSZ A;  1M7T A;  2IWT A;  1EOH A;  1YY7 A;  2L4Q A;  2LUS A;  3GYK A;  2WS2 A;  4KGI A;  3GN3 A;  3LYK A;  1X5D A;  1VRS D;  4EF0 A;  1ZZY A;  3TJG A;  2NBS A;  3KMN A;  2DC5 A;  1KBN A;  1PA3 A;  1G6Y A;  4WXT A;  2VCW A;  4WET A;  5JWO B;  3BJ5 A;  1XWB A;  3GTU B;  1I5G A;  4IGJ A;  1O7U A;  5HQP A;  2JAD A;  2OE3 A;  3GFK A;  4OD7 A;  3FYG A;  2VIM A;  1GSY A;  7GSS A;  1ZYQ B;  2P5Q A;  5G5F A;  3DWV A;  3MDK A;  5CYY A;  1DSB A;  1ERU A;  1GWC A;  3ZIV A;  5L71 A;  4RQR A;  1EGO A;  3TJJ A;  1BJX A;  2D2Z A;  2CV4 A;  4ECB A;  5GAN D;  4JR4 A;  5F05 A;  3IK7 A;  5G2Z A;  1JFU A;  3IA1 A;  4MK3 A;  1XW6 A;  4KX4 A;  2YAN A;  3ZL5 A;  3ZYW A;  3G9B A;  3KIJ A;  3ZML A;  1UC7 A;  2HT9 A;  4MZB A;  3E3E A;  1FB6 A;  1USB A;  4RI6 A;  4K8M A;  3EC3 A;  5IMF A;  5HR3 A;  2CAQ A;  3EU3 A;  3VPQ A;  1GSU A;  4GCI A;  4IP1 A;  4MZC A;  1LU4 A;  3ERG A;  2I1U A;  1Z3E A;  4CHS A;  5AN1 A;  1TK5 B;  3UEM A;  3F0I A;  3ME7 A;  1TRS A;  2E7P A;  4F0C A;  3H1N A;  4XS4 A;  2VOC A;  3GKN A;  1QGV A;  4ML1 A;  1K0B A;  2PGT A;  4ZBD A;  3CXG A;  1JLW A;  4EE0 A;  1DUG A;  1TK0 B;  5IMZ A;  4RUV A;  1GTU A;  6GSX A;  1Z7P A;  4E8E A;  1WJK A;  2LQQ A;  4AF2 A;  3QAW A;  5IPH A;  4JZQ A;  4WF5 A;  1DE2 A;  3IHQ A;  1EWX A;  4ZB9 A;  1MD4 A;  2FWG A;  4HQS A;  2IPA A;  4PUF C;  5JCW A;  3CSH A;  1H4O A;  2FA4 A;  1A23 A;  3J7Y b;  4G2E A;  4XIH A; 
#chains in the Genus database with same CATH topology
 5D9T A;  1V9W A;  2YOI A;  4ML6 A;  1B4P A;  4L0W A;  1V40 A;  3IRA A;  2DBC A;  3FEU A;  2CA8 A;  2AJQ B;  1GP1 A;  2PBJ A;  3E9J B;  2NTO A;  3W8S A;  1TP9 A;  4EVM A;  2P5R A;  4MP4 A;  5CO3 A;  2HRA A;  1XBS A;  4AJ8 A;  2V6O A;  2H19 A;  4PNG A;  1W89 A;  5COH A;  3EPT A;  18GS A;  2QC7 A;  3FZ4 A;  4ECI A;  4IKH A;  1GNE A;  2BMX A;  4KDX A;  4MNN A;  3TOT A;  5H5S A;  2O8V B;  4F2I A;  3C8E A;  4I6X A;  2VLU A;  4ZBB A;  1Y25 A;  3EMP A;  3ED3 A;  3EYT A;  5CRE A;  2UZ8 A;  1OVN A;  2BJX A;  3TJF A;  4DEJ A;  2X8C A;  2MMN A;  4IQA A;  4BVX B;  1K3L A;  2XC2 A;  3IHG A;  5LD0 A;  3M9K A;  3VWW A;  3KH7 A;  2H74 A;  2B5Y A;  5JCG A;  1T1V A;  5ECP B;  1TU7 A;  1HD2 A;  1T4Y A;  3M9J A;  4HZ2 A;  2V1M A;  17GS A;  4GWR A;  5ECN B;  5D9W A;  1Q98 A;  3IK9 A;  4TR1 B;  2HSH A;  4MAB A;  4IQ1 A;  2QA2 A;  2WFC A;  3DYR A;  5ECL B;  3D22 A;  3CSJ A;  2OE0 A;  2WJU A;  4PXO A;  4OMV A;  5ENU A;  2RM5 A;  4WKW A;  2GS3 A;  1RK4 A;  1C72 A;  5CRG A;  3I43 A;  3VWU A;  1VGL A;  5FHI A;  2V2G A;  5DAK A;  3EWL A;  1ZMA A;  1PFO A;  3NOF A;  2LRN A;  4MJB A;  3ZIJ A;  4XHM A;  2C3N A;  1V57 A;  5HR2 A;  2MZC A;  4MMM A;  3H8Q A;  2QA1 A;  4ECJ A;  2B7K A;  2EIR A;  1OE7 A;  4YQU A;  1G7E A;  5BRT A;  2X4A A;  10GS A;  2LEG A;  3KZQ A;  3F6D A;  1Z7R A;  5G1K A;  3GST A;  1OC9 B;  2MMO A;  4X0X A;  3I9V 2;  3TRQ A;  4IBP A;  1GSE A;  3F3Q A;  5CRW A;  2AV4 A;  1A24 A;  1R5P A;  4O5R A;  1PN0 A;  4MJE A;  4YQV A;  3HVS A;  2C0D A;  3DRN A;  1YEX A;  5D93 A;  3GIX A;  4TR0 A;  2IMD A;  2H1A A;  4KDY A;  1GLQ A;  2KOK A;  5J3R A;  1R5A A;  4EC0 A;  2GVP A;  2PVQ A;  3DGQ A;  3UJ1 A;  4KCE A;  1AIU A;  5F0G A;  3NIV A;  4TRX A;  2L6C A;  3CMI A;  4IP6 A;  2H76 A;  5IO0 A;  1XWA A;  2K18 A;  1Z9H A;  1EP7 A;  1FHE A;  4L5O A;  2HLS A;  5A5K A;  1OC8 A;  2H75 A;  3C71 A;  1GUK A;  2I4A A;  2R0C A;  5D9X A;  5DJM A;  4IS0 A;  1XVW A;  4MH2 A;  4ULX A;  5F8B A;  4BVY A;  3EU4 A;  5JCU A;  4HS1 A;  2GZZ A;  4TKY A;  2GT6 A;  3UAR A;  3ZZX A;  3EE2 A;  2FA8 A;  5B7C A;  4Q5N A;  4MPG A;  4PUA A;  3HXS A;  3ERW A;  4JBB A;  2VAF A;  1PN9 A;  1EOG A;  1IYI A;  1K0M A;  4J56 E;  5CRH A;  2L4C A;  4Z7X A;  1N8J A;  3FW2 A;  3CRT A;  2MYG A;  2PWJ A;  3APQ A;  1A2M A;  2RUE A;  5G5E A;  1V2A A;  1ON4 A;  1YEP A;  2DKH A;  5KOX A;  1XW5 A;  3APS A;  4BPY A;  4WR4 A;  1ZYE A;  3F4R A;  1GUH A;  4LMW A;  1WOU A;  4ACS A;  4BWQ A;  2HZF A;  3LWA A;  1TI1 A;  4MF5 A;  3FR6 A;  3HD5 A;  4ZL9 A;  1GSD A;  4JR6 A;  4FIW A;  3N5O A;  4F82 A;  1NW2 A;  4K7O A;  4MJA A;  6GSW A;  3U6V A;  2FY6 A;  5CP1 A;  4LA1 A;  3VLN A;  5HFK A;  1DE1 A;  2IMI A;  3ZTL A;  2X49 A;  2H6Y A;  4MA9 A;  4MDC A;  3QFB C;  2I81 A;  3O76 A;  4KUN A;  2GDR A;  4GSN A;  3O3T A;  3FZ9 A;  3A2W A;  5H5R A;  3GNJ A;  1AQX A;  1Z6N A;  4N11 A;  2OBI A;  2ON5 A;  2IN3 A;  4Q5R A;  1G7O A;  2YWN A;  1X0R A;  3F4T A;  1M2D A;  1XFL A;  2PMT A;  2Z9S A;  5DQY A;  4EUY A;  6GSY A;  3KH9 A;  4X1U A;  4YKG A;  2IFQ B;  2QSI A;  2WZ9 A;  3M0F A;  1HYU A;  1FW1 A;  2JAC A;  2IFQ A;  5DDL A;  1OYJ A;  1BED A;  2DIZ A;  1EEM A;  3VK9 A;  3KTB A;  1N2A A;  2FHE A;  4OWY A;  3TKQ A;  3G7J A;  2C1Y A;  2HXK A;  1TRW A;  3Q6O A;  1THX A;  4RI7 A;  2GZP A;  4KSM A;  2OA7 A;  2R6K A;  3CRU A;  2YWM A;  1AAZ A;  1TTZ A;  3UOM A;  1X5C A;  4Z2R A;  1F2E A;  4POB A;  4YAV A;  3R3E A;  3TKS E;  2H30 A;  4MF7 A;  1YKC A;  5EL8 A;  2IJY A;  5AIV A;  3TDG A;  4LMV A;  3LEF A;  4DSQ A;  3F63 A;  2REM A;  4EIP A;  1UA5 A;  2OE1 A;  4CDO A;  3VFI A;  2CX3 A;  22GS A;  3P8W A;  3I6A A;  1FVJ A;  1Q4J A;  1ERV A;  3HCZ A;  2ON7 A;  1PL1 A;  1U3A A;  4J57 E;  2VM1 A;  3GTU A;  4HOJ A;  1BG5 A;  3CBU A;  4NV2 A;  3Q19 A;  3WT2 A;  4KA0 A;  3D21 A;  3MYD A;  2N5A A;  2KP2 A;  3W8J A;  4Q5F A;  2KLX A;  4RQX A;  5E59 A;  3KCM A;  6GSS A;  3TKS A;  1XWG A;  4E8H A;  4OFM A;  2GTU A;  2GZY A;  4PTS A;  5AIX A;  4GTU A;  1W4V A;  2K8S A;  1GH2 A;  2JSY A;  4WBJ A;  4ZXG A;  1AW9 A;  3HKR A;  4HSC X;  4X43 A;  5IOW A;  2OJL A;  2EIO A;  2XPD A;  3IDV A;  4AJ6 A;  1UN2 A;  3A5W A;  3L9V A;  1GLP A;  2IMK A;  2VCT A;  1S3R A;  1ST9 A;  2KP1 A;  3LYP A;  5IMA A;  1TW9 A;  3MNG A;  3FZ5 A;  3PH9 A;  1U88 A;  4POM A;  2CT6 A;  5DVB A;  1O6J A;  2AYT A;  3RDW A;  4EL1 A;  1X9S B;  1X9W B;  2X64 A;  4EDZ A;  3G7Y A;  5ECS A;  2K6V A;  5GAP D;  1MEK A;  3S9F A;  3TB2 A;  4ZB8 A;  2ZUP A;  4PNF A;  3WGX A;  2OKA A;  1F3B A;  1M99 A;  4F9Z A;  3LSZ A;  1NHY A;  4OFT A;  4TVE A;  3EUR A;  5KOW A;  13GS A;  2VL2 A;  3LXT A;  3KEB A;  1OKD A;  4I5Q A;  2EIQ A;  1YDK A;  2H6Z A;  3CTF A;  4NHZ A;  2M46 A;  2FCH A;  3GUS A;  3LXZ A;  1E6B A;  2FWH A;  2HYX A;  3GSS A;  3UL3 A;  3QOU A;  5GSS A;  3IAM 2;  1MTC A;  4BIK A;  2RII A;  2YV9 A;  2YZH A;  3IBH A;  3M3M A;  4PQ1 A;  2A2R A;  4FH8 A;  3UIW A;  4P3Y B;  2O7K A;  2R37 A;  2YV7 A;  2FUG 2;  16GS A;  2F3M A;  1TRU A;  4X4J A;  3TRP A;  3ZMK A;  4JRR A;  4K0G A;  3IOS A;  5IO2 A;  4WEY A;  4BL7 B;  5AGY A;  3KP8 A;  5D9V A;  1VF1 A;  1JZO A;  5J41 A;  1PX7 A;  2ZNM A;  3RPP A;  3BCK A;  5DQS A;  5GZZ B;  1O8W A;  5D96 A;  1WRY A;  3ZRD A;  4AJ7 A;  1KNG A;  4BVX A;  1SL1 B;  4WF4 A;  4K0N A;  3VWV A;  4LL1 B;  2DJJ A;  4I8B A;  5ECM B;  4TW5 A;  1Z6M A;  2CZ2 A;  3GV1 A;  4D73 B;  2DJK A;  3A3T A;  2VUP A;  4KDU A;  4D73 A;  3V1W A;  5J4U A;  1R26 A;  2PER A;  2VL9 A;  2DSA A;  3QAG A;  4XRA A;  2PU9 C;  4IHU A;  2IMF A;  3ISO A;  2C3Q A;  2V41 A;  3PGT A;  4QL7 A;  4NAX A;  3I69 A;  3F4S A;  1PD2 1;  1XPV A;  2QKE A;  4TR1 A;  2BTO T;  1PX6 A;  3LFL A;  4N0Z A;  2LQO A;  2GSS A;  3GH6 A;  3IE3 A;  4CY6 A;  2CX4 A;  3FY7 A;  2DLX A;  4V1A p;  3TCO A;  3UVH A;  2PN8 A;  2FGX A;  2YWO A;  4HJ2 A;  3GX0 A;  1SYX A;  1OAZ A;  4N30 A;  5ELA A;  3P7X A;  3VI5 A;  5HR0 A;  4OCF A;  4ID0 A;  3GMF A;  1XCC A;  1JZW A;  1TJD A;  1WMJ A;  1B8X A;  2KUC A;  3VUR A;  1SD9 A;  3EVI A;  2VM2 A;  5B6M A;  3PIN A;  5EPF A;  4CW9 A;  2I3Y A;  3KJY A;  1U3I A;  2MMZ A;  3E0U A;  1K3Y A;  1TK8 B;  5JWR B;  4FQU A;  2A4H A;  5E4W A;  2WCI A;  5A4W A;  2A4V A;  1OC9 A;  3BD2 A;  5FWG A;  4EO3 A;  2B1K A;  3L9S A;  4FYC A;  2FWF A;  1YZX A;  3EIN A;  1QXH A;  2HI7 A;  1NSW A;  2IIY A;  1BYE A;  1QQ2 A;  1K3O A;  1V98 A;  3QPM A;  3IV4 A;  4K9Z A;  4IJI A;  2LJK A;  2R5G A;  5B8B A;  2VCQ A;  14GS A;  3TOU A;  1GL8 A;  1G0T A;  2P31 A;  5LCZ A;  1SKR B;  2TRC P;  1ZYN A;  4I97 A;  3GH9 A;  2EC4 A;  4I2U A;  3DVW A;  1X5E A;  2DKI A;  1GTA A;  2YWI A;  3KD0 A;  3ZRE A;  1JZD A;  2IL3 A;  2C0F A;  2DJ2 A;  2VL2 C;  4MLY A;  5HR1 A;  2M80 A;  1ZOF A;  5BMU A;  1A2J A;  12GS A;  3H93 A;  5A4U A;  2CQ9 A;  2L59 A;  2H71 A;  2H6X A;  1BX9 A;  3HVV A;  1XOB A;  2F8A A;  2DMM A;  1FG4 A;  1FAA A;  2B5X A;  4NHW A;  1EGR A;  4L0U A;  2AHE A;  3BBY A;  3ZFL A;  1TKD B;  5AIS A;  2H1B A;  4XCS A;  2F8F A;  4KW6 A;  3EMX A;  2J9H A;  3HA9 A;  2YPM A;  3C1S A;  3J7Y k;  1JHB A;  3L78 A;  2NDO A;  3L9U A;  4ZB6 A;  4YH2 A;  1J08 A;  2A2P A;  2DJ0 A;  1J9B A;  4PQH A;  3U5R E;  1ERW A;  1DBY A;  2OAD A;  4K6X A;  1SK0 A;  4TR3 A;  4KE3 A;  4GRF A;  5IM9 A;  4K7I A;  2GLR A;  2PUK C;  5ECK B;  2OAC A;  2TRX A;  1K0O A;  1F37 A;  4KND A;  4ISD A;  2FD3 A;  5IMC A;  1GTB A;  3BOA A;  1PMT A;  2O89 A;  1O85 A;  2K8V A;  2YZU A;  2L5L A;  2NPB A;  3G7I A;  4DSS B;  1GRX A;  2C8U A;  2DIY A;  5ID2 B;  4IW9 A;  2H8L A;  1JZR A;  1YJ6 A;  2ALB A;  2VO4 A;  20GS A;  3TJK A;  4F03 A;  1SL2 B;  3UAP A;  1PRX A;  1AUC A;  4K2D A;  4O32 A;  1PSQ A;  1UVZ A;  3HJO A;  4FO5 A;  4J2F A;  1FO5 A;  4PQI A;  3P90 A;  1VF3 A;  2F9S A;  2H73 A;  4G0L A;  3MAK A;  2WDU A;  3D4T A;  3LQ7 A;  4PUR A;  1O81 A;  2DJ1 A;  5FT3 A;  1PKW A;  1SJI A;  2GST A;  2GSQ A;  3GKM A;  4USS A;  3TKR A;  4KH7 A;  3A2V A;  3F3R A;  1HNB A;  3N9J A;  1XIY A;  1YKA A;  2CAI A;  1XWC A;  2R2J A;  3GKX A;  3W6G A;  3QMX A;  5DCG A;  3FKF A;  4O5Q A;  2R0P A;  1T4Z A;  5C00 A;  1THO A;  3UVT A;  2I9H A;  2WRT A;  5LNK e;  2L6D A;  1R4W A;  3MIX A;  2H72 A;  4K2X A;  1OKT A;  1OE8 A;  3K8N A;  2B3S A;  2LKU A;  1FB0 A;  1GTI A;  3GA4 A;  1VF2 A;  4L8E A;  3HJP A;  2G2Q A;  4KAE A;  1T8E B;  2M72 A;  3SWL A;  4NMU A;  2A2S A;  4HQZ A;  2FNO A;  3GRX A;  4Z2U A;  1M2A A;  3US3 A;  1ABA A;  5ECI B;  4EDY A;  5IIZ A;  4HDE A;  1ERT A;  3HDC A;  4XS6 A;  4K7N A;  3KM6 A;  4N10 A;  4OO5 A;  1VF4 A;  2C4J A;  1SD8 A;  4HEA 2;  3GUR A;  4G9H A;  5IMD A;  1TXX A;  4FYU A;  5KN0 A;  1ACV A;  4ZBA A;  1FOH A;  5EVO A;  3HZ4 A;  3KMO A;  1FVK A;  1SKW B;  3GL5 A;  4DVC A;  3GL3 A;  1LJR A;  2P0G A;  1R7H A;  4XTS A;  3H79 A;  2KHP A;  1J0F A;  1TRV A;  4G0I A;  5ABR A;  2MMA A;  1EV9 A;  5KN1 A;  4JED A;  3SBC A;  1MDK A;  3MWH A;  4HUA A;  5C04 A;  1WIK A;  2FWE A;  4LL4 B;  2HSY A;  5IOX A;  4ZL7 A;  3UBK A;  3TGZ A;  1SJ6 A;  2LRC A;  2YNX A;  3DKS A;  3IAS 2;  3ZFB A;  3VWX A;  2VD1 A;  4XS1 A;  2H1D A;  3HVX A;  3WD6 A;  3HYP A;  3KTL A;  5DBQ A;  1S3D A;  5ELG A;  1V58 A;  1QUW A;  4NWY A;  3MSZ A;  5F06 A;  4OFN A;  1F6M C;  3VPT A;  3CQF A;  5ECO B;  5CNW A;  1SJZ A;  3FZA A;  1XXU A;  4OO4 A;  4ZIL A;  4G10 A;  3IPZ A;  4MPF A;  5ECQ B;  1CQG A;  1SEN A;  4TOP A;  4XS4 B;  1XOA A;  3LJR A;  4DSR A;  2LNS A;  3QFA C;  5G31 A;  1H75 A;  3TUE A;  1U6T A;  1ILO A;  2L57 A;  3Q74 A;  1MDJ A;  4LLR A;  1KEB A;  1AXD A;  2VCV A;  3KGK A;  4FYB A;  1GSS A;  3FK8 A;  2H70 A;  5IMV A;  1URM A;  6GSU A;  4HZ4 A;  5A4V A;  1EZK A;  2QGV A;  2VL3 A;  4IVF A;  4O92 A;  2NVL A;  3C73 A;  2E2G A;  4JU5 A;  1X9M B;  4GQC A;  1BAY A;  5DCH A;  2H1G A;  3CSI A;  3RAZ A;  1B4Q A;  2HRF A;  4GQF A;  5GST A;  4TXO B;  4HI7 A;  2YP6 A;  2HFD A;  4TXO A;  4ZL8 A;  2LJR A;  3DXB A;  5DAL B;  1WE0 A;  1GUL A;  1Z5Y E;  4IJ3 A;  2R3X A;  1XWK A;  5DAL A;  3F8U A;  1SK1 A;  3ZIT A;  1M3I A;  1K0C A;  2O87 A;  4N0V A;  4O5U A;  2RUF A;  4JE1 A;  4BL7 A;  1ZCP A;  1NHO A;  2FLS A;  4OCE A;  3RBT A;  1XZO A;  2X99 A;  1F3A A;  2JZR A;  4K5S A;  5J9B A;  4ECC A;  5KN3 A;  2H0G A;  2PPT A;  3C1R A;  4IEL A;  2C3T A;  2VCX A;  1A0R P;  2HE3 A;  2V32 A;  2WB9 A;  3GKK A;  3TRX A;  4IN0 A;  2B7J A;  4GLT A;  3FR9 A;  2HZE B;  2PVO C;  4NV5 A;  5G30 A;  4BWS A;  1RW1 A;  3LW9 A;  2HZE A;  1T7P B;  2VCZ A;  3QR6 A;  4POL A;  2RM6 A;  3DIE A;  3JCM L;  5ECH B;  3D6I A;  3P2A A;  1WWJ A;  1BQ7 A;  4H86 A;  1LBK A;  3H4K A;  1M9A A;  3HY2 A;  3LG6 A;  3FHK A;  3IC4 A;  5EY6 A;  3LOR A;  1PKZ A;  2DML A;  4ZIJ A;  2LTK A;  1AC1 A;  2V6K A;  1QK8 A;  3F9U A;  4MCU A;  1M0U A;  1A0F A;  2R4V A;  19GS A;  2B5E A;  1AQV A;  5F07 A;  3GX8 A;  1QFN A;  1S3C A;  1T00 A;  4GXZ A;  5INY A;  1F9M A;  4V2N A;  4HU9 A;  3HHV A;  3ME8 A;  2N5B A;  2X8G A;  1E2Y A;  3TKS C;  1EP8 A;  4KB3 A;  5KEJ A;  5CAX A;  2H0H A;  1CQH A;  3WGD A;  3BCI A;  3DEX A;  2CVK A;  1NM3 A;  2C80 A;  5DAK B;  2XBQ A;  4TXV A;  4MF6 A;  2AAW A;  1EV4 A;  4AGS A;  3IR4 A;  1GUM A;  1A8Y A;  1K0D A;  3RPN A;  4GSS A;  1A2L A;  6GSV A;  1XG8 A;  1S3A A;  4GF0 A;  4MH3 A;  4V2M A;  5B8A A;  1MD3 A;  4NXI A;  4PX1 A;  1SK2 A;  2GQK A;  2B6M A;  3FR3 A;  1M2B A;  3L0H A;  3M8N A;  1M9B A;  4YAP A;  3PPU A;  4WBR D;  3A2X A;  2JU5 A;  1K0N A;  2YJH A;  2CVD A;  3PR8 A;  2AB6 A;  2GT5 A;  2G0F A;  2L5O A;  4TN8 A;  4I2T A;  2J23 A;  3D0Z A;  5D8I A;  4MJC A;  3UBL A;  5JWQ B;  1ZL9 A;  1YF1 A;  4V2L A;  1HNA A;  4Q5Q A;  4EXJ A;  11GS A;  4HJM A;  3F6F A;  3AY8 A;  1PL2 A;  3R2Q A;  3HZ8 A;  2JZT A;  1SYR A;  3HJM A;  2VLT A;  1OC3 A;  2LS5 A;  3TKP A;  2CVB A;  3NZN A;  2RLI A;  4YQM A;  4G19 A;  1G6W A;  4BA7 A;  2VLV A;  2LJA A;  4EIQ A;  2GGT A;  1A8L A;  8GSS A;  1PGT A;  4WR5 A;  4PGT A;  2LST A;  4BVY B;  2C0E A;  2B1L A;  1XW9 A;  2HRN A;  4QL9 A;  1GSF A;  4A5P A;  3QD9 A;  1WPI A;  1YQ1 A;  3M1G A;  4XRD A;  3VI7 A;  1ZGN A;  4ICY A;  5G1L A;  3GHA A;  1SKS B;  2LV3 A;  3WT1 A;  4MZW A;  1U87 A;  4EKZ A;  1SU9 A;  2E2M A;  3QDN A;  3ZLP A;  2XBI A;  2XPE A;  4HU7 A;  3D4M A;  1GNW A;  3C7M A;  1JLV A;  2N5F A;  2C0G A;  4POK A;  1Y6E A;  3KXO A;  2YN1 A;  3L4N A;  2H01 A;  5ECR B;  2E0Q A;  2LNT A;  1O73 A;  3O6T A;  4V1A g;  2LRT A;  3WGE A;  3KP9 A;  1SL0 B;  4DSS A;  5H5Q A;  5IQY A;  4KCA A;  3ZVJ D;  1KTE A;  1T3B A;  2XHF A;  2K9F A;  3CYN A;  2X8H A;  1K0A A;  5ID2 A;  3DD3 A;  1B9Y C;  2MBS A;  1QMV A;  4G0K A;  3IXR A;  1IYH A;  1B48 A;  2CZ3 A;  6GST A;  1O8X A;  2AUV A;  1HNC A;  2JL4 A;  3DVX A;  3RHB A;  4KSO A;  4YKF A;  4GST A;  4QQ7 A;  5IPG A;  3ERF A;  3UMA A;  4F0B A;  1B9X C;  2O85 A;  3FRC A;  1TOF A;  2DJ3 A;  1TU8 A;  2GQM A;  2GSR A;  5J9C A;  1MDI A;  2MBT A;  3QCP A;  1RQM A;  2VD0 A;  1ZYP A;  4ILF A;  5DJL A;  1M3J A;  5D73 A;  3ZVJ A;  2WUL A;  1WP0 A;  1TDI A;  2ES7 A;  4L5L A;  1HQO A;  5KN2 A;  5HFG A;  3D5J A;  1AQW A;  5J5N A;  1FOV A;  4TR4 A;  3HVN A;  2IME A;  2H0I A;  5HFI A;  2YCD A;  2JZS A;  3RHC A;  3DML A;  2WGR A;  2YJ7 A;  4NPB A;  3WYW A;  5CRD A;  3FMW A;  3LGC A;  2OBK A;  1ML6 A;  2TIR A;  9GSS A;  4O7H A;  3APO A;  2GQL A;  3QAV A;  1PQN A;  2HNL A;  4CY8 A;  2H66 A;  3TJB A;  2ZCT A;  2F51 A;  1I9D A;  4K1F A;  1YF0 A;  5B6N A;  3Q18 A;  1TI3 A;  1EEJ A;  3CTG A;  3OR5 A;  1GSQ A;  1XVQ A;  2JSZ A;  1M7T A;  2IWT A;  1EOH A;  1YY7 A;  2L4Q A;  2LUS A;  3GYK A;  2WS2 A;  4KGI A;  3GN3 A;  3LYK A;  1X5D A;  1VRS D;  4EF0 A;  1ZZY A;  3TJG A;  2NBS A;  3KMN A;  3A5I A;  2DC5 A;  1KBN A;  1PA3 A;  1G6Y A;  4WXT A;  2VCW A;  4WET A;  5JWO B;  3BJ5 A;  1XWB A;  3GTU B;  1I5G A;  4IGJ A;  1O7U A;  5HQP A;  2JAD A;  2OE3 A;  4OD7 A;  3GFK A;  3FYG A;  2VIM A;  1GSY A;  7GSS A;  1ZYQ B;  2P5Q A;  5G5F A;  3DWV A;  3MDK A;  5CYY A;  1DSB A;  1ERU A;  1GWC A;  3ZIV A;  5L71 A;  4RQR A;  1EGO A;  3TJJ A;  1BJX A;  2D2Z A;  2CV4 A;  4ECB A;  5GAN D;  4JR4 A;  5F05 A;  3IK7 A;  2HRK A;  5G2Z A;  1JFU A;  3IA1 A;  4MK3 A;  1XW6 A;  4KX4 A;  2R0G A;  2YAN A;  3ZL5 A;  2HSM A;  3ZYW A;  3G9B A;  3KIJ A;  3ZML A;  1UC7 A;  2HT9 A;  4MZB A;  3E3E A;  1FB6 A;  1USB A;  4RI6 A;  4K8M A;  3EC3 A;  5IMF A;  5HR3 A;  3IC8 A;  2CAQ A;  4Z2T A;  3EU3 A;  3VPQ A;  1GSU A;  4GCI A;  4IP1 A;  4MZC A;  1LU4 A;  3ERG A;  2I1U A;  1Z3E A;  4CHS A;  5AN1 A;  1TK5 B;  3UEM A;  3F0I A;  3ME7 A;  1TRS A;  2E7P A;  4F0C A;  4KF9 A;  3H1N A;  4XS4 A;  2VOC A;  3GKN A;  1QGV A;  4ML1 A;  1K0B A;  2PGT A;  4ZBD A;  3CXG A;  1JLW A;  4EE0 A;  1DUG A;  1TK0 B;  5IMZ A;  4RUV A;  1GTU A;  6GSX A;  4K5R A;  1Z7P A;  4E8E A;  1WJK A;  2LQQ A;  4AF2 A;  3QAW A;  5IPH A;  4JZQ A;  4WF5 A;  1DE2 A;  3IHQ A;  1EWX A;  4ZB9 A;  1MD4 A;  2FWG A;  4HQS A;  2IPA A;  4PUF C;  5JCW A;  3CSH A;  1H4O A;  2FA4 A;  1A23 A;  3J7Y b;  4G2E A;  4XIH A; 
#chains in the Genus database with same CATH homology
 5D9T A;  1V9W A;  2YOI A;  4ML6 A;  1B4P A;  4L0W A;  1V40 A;  3IRA A;  2DBC A;  3FEU A;  2CA8 A;  2AJQ B;  1GP1 A;  2PBJ A;  3E9J B;  2NTO A;  3W8S A;  1TP9 A;  4EVM A;  2P5R A;  4MP4 A;  5CO3 A;  2HRA A;  1XBS A;  4AJ8 A;  2V6O A;  2H19 A;  4PNG A;  1W89 A;  5COH A;  3EPT A;  18GS A;  2QC7 A;  3FZ4 A;  4ECI A;  4IKH A;  1GNE A;  2BMX A;  4KDX A;  4MNN A;  3TOT A;  5H5S A;  2O8V B;  4F2I A;  3C8E A;  4I6X A;  2VLU A;  4ZBB A;  1Y25 A;  3EMP A;  3ED3 A;  3EYT A;  5CRE A;  2UZ8 A;  1OVN A;  2BJX A;  3TJF A;  4DEJ A;  2X8C A;  2MMN A;  4IQA A;  4BVX B;  1K3L A;  2XC2 A;  3IHG A;  5LD0 A;  3M9K A;  3VWW A;  3KH7 A;  2H74 A;  2B5Y A;  5JCG A;  1T1V A;  5ECP B;  1TU7 A;  1HD2 A;  1T4Y A;  3M9J A;  4HZ2 A;  2V1M A;  17GS A;  4GWR A;  5ECN B;  5D9W A;  1Q98 A;  3IK9 A;  4TR1 B;  2HSH A;  4MAB A;  4IQ1 A;  2QA2 A;  2WFC A;  3DYR A;  5ECL B;  3D22 A;  3CSJ A;  2OE0 A;  2WJU A;  4PXO A;  4OMV A;  5ENU A;  2RM5 A;  4WKW A;  2GS3 A;  1RK4 A;  1C72 A;  5CRG A;  3I43 A;  3VWU A;  1VGL A;  5FHI A;  2V2G A;  5DAK A;  3EWL A;  1ZMA A;  3NOF A;  2LRN A;  4MJB A;  3ZIJ A;  4XHM A;  2C3N A;  1V57 A;  5HR2 A;  2MZC A;  4MMM A;  3H8Q A;  2QA1 A;  4ECJ A;  2B7K A;  2EIR A;  1OE7 A;  4YQU A;  1G7E A;  5BRT A;  2X4A A;  10GS A;  2LEG A;  3KZQ A;  3F6D A;  1Z7R A;  5G1K A;  3GST A;  1OC9 B;  2MMO A;  4X0X A;  3I9V 2;  3TRQ A;  4IBP A;  1GSE A;  3F3Q A;  5CRW A;  2AV4 A;  1A24 A;  1R5P A;  4O5R A;  1PN0 A;  4MJE A;  4YQV A;  3HVS A;  2C0D A;  3DRN A;  1YEX A;  5D93 A;  3GIX A;  4TR0 A;  2IMD A;  2H1A A;  4KDY A;  1GLQ A;  2KOK A;  5J3R A;  1R5A A;  4EC0 A;  2GVP A;  2PVQ A;  3DGQ A;  3UJ1 A;  4KCE A;  1AIU A;  5F0G A;  3NIV A;  4TRX A;  2L6C A;  3CMI A;  4IP6 A;  2H76 A;  5IO0 A;  1XWA A;  2K18 A;  1Z9H A;  1EP7 A;  1FHE A;  4L5O A;  2HLS A;  5A5K A;  1OC8 A;  2H75 A;  3C71 A;  1GUK A;  2I4A A;  2R0C A;  5D9X A;  5DJM A;  4IS0 A;  1XVW A;  4MH2 A;  4ULX A;  5F8B A;  4BVY A;  3EU4 A;  5JCU A;  4HS1 A;  2GZZ A;  4TKY A;  2GT6 A;  3UAR A;  3ZZX A;  3EE2 A;  2FA8 A;  5B7C A;  4Q5N A;  4MPG A;  4PUA A;  3HXS A;  3ERW A;  4JBB A;  2VAF A;  1PN9 A;  1EOG A;  1IYI A;  1K0M A;  4J56 E;  5CRH A;  2L4C A;  4Z7X A;  1N8J A;  3FW2 A;  3CRT A;  2MYG A;  2PWJ A;  3APQ A;  1A2M A;  2RUE A;  5G5E A;  1V2A A;  1ON4 A;  1YEP A;  2DKH A;  5KOX A;  1XW5 A;  3APS A;  4BPY A;  4WR4 A;  1ZYE A;  3F4R A;  1GUH A;  4LMW A;  1WOU A;  4ACS A;  4BWQ A;  2HZF A;  3LWA A;  1TI1 A;  4MF5 A;  3FR6 A;  3HD5 A;  4ZL9 A;  1GSD A;  4JR6 A;  4FIW A;  3N5O A;  4F82 A;  1NW2 A;  4K7O A;  4MJA A;  6GSW A;  3U6V A;  2FY6 A;  5CP1 A;  4LA1 A;  3VLN A;  5HFK A;  1DE1 A;  2IMI A;  3ZTL A;  2X49 A;  2H6Y A;  4MA9 A;  4MDC A;  3QFB C;  2I81 A;  3O76 A;  4KUN A;  2GDR A;  4GSN A;  3O3T A;  3FZ9 A;  3A2W A;  5H5R A;  3GNJ A;  1AQX A;  1Z6N A;  4N11 A;  2OBI A;  2ON5 A;  2IN3 A;  4Q5R A;  1G7O A;  2YWN A;  1X0R A;  3F4T A;  1M2D A;  1XFL A;  2PMT A;  2Z9S A;  5DQY A;  4EUY A;  6GSY A;  3KH9 A;  4X1U A;  4YKG A;  2IFQ B;  2QSI A;  2WZ9 A;  3M0F A;  1HYU A;  1FW1 A;  2JAC A;  2IFQ A;  5DDL A;  1OYJ A;  1BED A;  2DIZ A;  1EEM A;  3VK9 A;  3KTB A;  1N2A A;  2FHE A;  4OWY A;  3TKQ A;  3G7J A;  2C1Y A;  2HXK A;  1TRW A;  3Q6O A;  1THX A;  4RI7 A;  2GZP A;  4KSM A;  2OA7 A;  2R6K A;  3CRU A;  2YWM A;  1AAZ A;  1TTZ A;  3UOM A;  1X5C A;  4Z2R A;  1F2E A;  4POB A;  4YAV A;  3R3E A;  3TKS E;  2H30 A;  4MF7 A;  1YKC A;  5EL8 A;  2IJY A;  5AIV A;  3TDG A;  4LMV A;  3LEF A;  4DSQ A;  3F63 A;  2REM A;  4EIP A;  1UA5 A;  2OE1 A;  4CDO A;  3VFI A;  2CX3 A;  22GS A;  3P8W A;  3I6A A;  1FVJ A;  1Q4J A;  1ERV A;  3HCZ A;  2ON7 A;  1PL1 A;  1U3A A;  4J57 E;  2VM1 A;  3GTU A;  4HOJ A;  1BG5 A;  3CBU A;  4NV2 A;  3Q19 A;  3WT2 A;  4KA0 A;  3D21 A;  3MYD A;  2N5A A;  2KP2 A;  3W8J A;  4Q5F A;  2KLX A;  4RQX A;  5E59 A;  3KCM A;  6GSS A;  3TKS A;  1XWG A;  4E8H A;  4OFM A;  2GTU A;  2GZY A;  4PTS A;  5AIX A;  4GTU A;  1W4V A;  2K8S A;  1GH2 A;  2JSY A;  4WBJ A;  4ZXG A;  1AW9 A;  3HKR A;  4X43 A;  5IOW A;  2OJL A;  2EIO A;  2XPD A;  3IDV A;  4AJ6 A;  1UN2 A;  3A5W A;  3L9V A;  1GLP A;  2IMK A;  2VCT A;  1ST9 A;  2KP1 A;  3LYP A;  5IMA A;  1TW9 A;  3MNG A;  3FZ5 A;  3PH9 A;  1U88 A;  4POM A;  2CT6 A;  5DVB A;  1O6J A;  2AYT A;  3RDW A;  4EL1 A;  1X9S B;  1X9W B;  2X64 A;  4EDZ A;  3G7Y A;  5ECS A;  2K6V A;  5GAP D;  1MEK A;  3S9F A;  3TB2 A;  4ZB8 A;  2ZUP A;  4PNF A;  3WGX A;  2OKA A;  1F3B A;  1M99 A;  4F9Z A;  3LSZ A;  1NHY A;  4OFT A;  4TVE A;  3EUR A;  5KOW A;  13GS A;  2VL2 A;  3LXT A;  3KEB A;  1OKD A;  4I5Q A;  2EIQ A;  1YDK A;  2H6Z A;  3CTF A;  4NHZ A;  2M46 A;  2FCH A;  3GUS A;  3LXZ A;  1E6B A;  2FWH A;  2HYX A;  3GSS A;  3UL3 A;  3QOU A;  5GSS A;  3IAM 2;  1MTC A;  2RII A;  2YV9 A;  2YZH A;  3IBH A;  3M3M A;  4PQ1 A;  2A2R A;  4FH8 A;  3UIW A;  4P3Y B;  2O7K A;  2R37 A;  2YV7 A;  2FUG 2;  16GS A;  2F3M A;  1TRU A;  4X4J A;  3TRP A;  3ZMK A;  4JRR A;  4K0G A;  3IOS A;  5IO2 A;  4WEY A;  4BL7 B;  5AGY A;  3KP8 A;  5D9V A;  1VF1 A;  1JZO A;  5J41 A;  1PX7 A;  2ZNM A;  3RPP A;  3BCK A;  5DQS A;  5GZZ B;  1O8W A;  5D96 A;  1WRY A;  3ZRD A;  4AJ7 A;  1KNG A;  4BVX A;  1SL1 B;  4WF4 A;  4K0N A;  3VWV A;  4LL1 B;  2DJJ A;  4I8B A;  5ECM B;  4TW5 A;  1Z6M A;  2CZ2 A;  3GV1 A;  4D73 B;  2DJK A;  3A3T A;  2VUP A;  4KDU A;  4D73 A;  3V1W A;  5J4U A;  1R26 A;  2PER A;  2VL9 A;  2DSA A;  3QAG A;  4XRA A;  2PU9 C;  4IHU A;  2IMF A;  3ISO A;  2C3Q A;  2V41 A;  3PGT A;  4QL7 A;  4NAX A;  3I69 A;  3F4S A;  1PD2 1;  1XPV A;  2QKE A;  4TR1 A;  2BTO T;  1PX6 A;  3LFL A;  4N0Z A;  2LQO A;  2GSS A;  3GH6 A;  3IE3 A;  4CY6 A;  2CX4 A;  3FY7 A;  2DLX A;  4V1A p;  3TCO A;  3UVH A;  2PN8 A;  2FGX A;  2YWO A;  4HJ2 A;  3GX0 A;  1SYX A;  1OAZ A;  4N30 A;  5ELA A;  3P7X A;  3VI5 A;  5HR0 A;  4OCF A;  4ID0 A;  3GMF A;  1XCC A;  1JZW A;  1TJD A;  1WMJ A;  1B8X A;  2KUC A;  3VUR A;  1SD9 A;  3EVI A;  2VM2 A;  5B6M A;  3PIN A;  5EPF A;  4CW9 A;  2I3Y A;  3KJY A;  1U3I A;  2MMZ A;  3E0U A;  1K3Y A;  1TK8 B;  5JWR B;  4FQU A;  2A4H A;  5E4W A;  2WCI A;  5A4W A;  2A4V A;  1OC9 A;  3BD2 A;  5FWG A;  4EO3 A;  2B1K A;  3L9S A;  4FYC A;  2FWF A;  1YZX A;  3EIN A;  1QXH A;  2HI7 A;  1NSW A;  2IIY A;  1BYE A;  1QQ2 A;  1K3O A;  1V98 A;  3QPM A;  3IV4 A;  4K9Z A;  4IJI A;  2LJK A;  2R5G A;  5B8B A;  2VCQ A;  14GS A;  3TOU A;  1GL8 A;  1G0T A;  2P31 A;  5LCZ A;  1SKR B;  2TRC P;  1ZYN A;  4I97 A;  3GH9 A;  2EC4 A;  4I2U A;  3DVW A;  1X5E A;  2DKI A;  1GTA A;  2YWI A;  3KD0 A;  3ZRE A;  1JZD A;  2IL3 A;  2C0F A;  2DJ2 A;  2VL2 C;  4MLY A;  5HR1 A;  2M80 A;  1ZOF A;  5BMU A;  1A2J A;  12GS A;  3H93 A;  5A4U A;  2CQ9 A;  2L59 A;  2H71 A;  2H6X A;  1BX9 A;  3HVV A;  1XOB A;  2F8A A;  2DMM A;  1FG4 A;  1FAA A;  2B5X A;  4NHW A;  1EGR A;  4L0U A;  2AHE A;  3BBY A;  3ZFL A;  1TKD B;  5AIS A;  2H1B A;  4XCS A;  2F8F A;  4KW6 A;  3EMX A;  2J9H A;  3HA9 A;  2YPM A;  3C1S A;  3J7Y k;  1JHB A;  3L78 A;  2NDO A;  3L9U A;  4ZB6 A;  4YH2 A;  1J08 A;  2A2P A;  2DJ0 A;  1J9B A;  4PQH A;  3U5R E;  1ERW A;  1DBY A;  2OAD A;  4K6X A;  1SK0 A;  4TR3 A;  4KE3 A;  4GRF A;  5IM9 A;  4K7I A;  2GLR A;  2PUK C;  5ECK B;  2OAC A;  2TRX A;  1K0O A;  1F37 A;  4KND A;  4ISD A;  2FD3 A;  5IMC A;  1GTB A;  3BOA A;  1PMT A;  2O89 A;  1O85 A;  2K8V A;  2YZU A;  2L5L A;  2NPB A;  3G7I A;  4DSS B;  1GRX A;  2C8U A;  2DIY A;  5ID2 B;  4IW9 A;  2H8L A;  1JZR A;  1YJ6 A;  2ALB A;  2VO4 A;  20GS A;  3TJK A;  4F03 A;  1SL2 B;  3UAP A;  1PRX A;  1AUC A;  4K2D A;  4O32 A;  1PSQ A;  1UVZ A;  3HJO A;  4FO5 A;  4J2F A;  1FO5 A;  4PQI A;  3P90 A;  1VF3 A;  2F9S A;  2H73 A;  4G0L A;  3MAK A;  2WDU A;  3D4T A;  3LQ7 A;  4PUR A;  1O81 A;  2DJ1 A;  5FT3 A;  1PKW A;  1SJI A;  2GST A;  2GSQ A;  3GKM A;  4USS A;  3TKR A;  4KH7 A;  3A2V A;  3F3R A;  1HNB A;  3N9J A;  1XIY A;  1YKA A;  2CAI A;  1XWC A;  2R2J A;  3GKX A;  3W6G A;  3QMX A;  5DCG A;  3FKF A;  4O5Q A;  2R0P A;  1T4Z A;  5C00 A;  1THO A;  3UVT A;  2I9H A;  2WRT A;  5LNK e;  2L6D A;  1R4W A;  3MIX A;  2H72 A;  4K2X A;  1OKT A;  1OE8 A;  3K8N A;  2B3S A;  2LKU A;  1FB0 A;  1GTI A;  3GA4 A;  1VF2 A;  4L8E A;  3HJP A;  2G2Q A;  4KAE A;  1T8E B;  2M72 A;  3SWL A;  4NMU A;  2A2S A;  4HQZ A;  2FNO A;  3GRX A;  4Z2U A;  1M2A A;  3US3 A;  1ABA A;  5ECI B;  4EDY A;  5IIZ A;  4HDE A;  1ERT A;  3HDC A;  4XS6 A;  4K7N A;  3KM6 A;  4N10 A;  4OO5 A;  1VF4 A;  2C4J A;  1SD8 A;  4HEA 2;  3GUR A;  4G9H A;  5IMD A;  1TXX A;  4FYU A;  5KN0 A;  1ACV A;  4ZBA A;  1FOH A;  5EVO A;  3HZ4 A;  3KMO A;  1FVK A;  1SKW B;  3GL5 A;  4DVC A;  3GL3 A;  1LJR A;  2P0G A;  1R7H A;  4XTS A;  3H79 A;  2KHP A;  1J0F A;  1TRV A;  4G0I A;  5ABR A;  2MMA A;  1EV9 A;  5KN1 A;  4JED A;  3SBC A;  1MDK A;  3MWH A;  4HUA A;  5C04 A;  1WIK A;  2FWE A;  4LL4 B;  2HSY A;  5IOX A;  4ZL7 A;  3UBK A;  3TGZ A;  1SJ6 A;  2LRC A;  2YNX A;  3DKS A;  3IAS 2;  3ZFB A;  3VWX A;  2VD1 A;  4XS1 A;  2H1D A;  3HVX A;  3WD6 A;  3HYP A;  3KTL A;  5DBQ A;  1S3D A;  5ELG A;  1V58 A;  1QUW A;  4NWY A;  3MSZ A;  5F06 A;  4OFN A;  1F6M C;  3VPT A;  5ECO B;  5CNW A;  1SJZ A;  3FZA A;  1XXU A;  4OO4 A;  4ZIL A;  4G10 A;  3IPZ A;  4MPF A;  5ECQ B;  1CQG A;  1SEN A;  4TOP A;  4XS4 B;  1XOA A;  3LJR A;  4DSR A;  2LNS A;  3QFA C;  5G31 A;  1H75 A;  3TUE A;  1U6T A;  1ILO A;  2L57 A;  3Q74 A;  1MDJ A;  4LLR A;  1KEB A;  1AXD A;  2VCV A;  3KGK A;  4FYB A;  1GSS A;  3FK8 A;  2H70 A;  5IMV A;  1URM A;  6GSU A;  4HZ4 A;  5A4V A;  1EZK A;  2QGV A;  2VL3 A;  4IVF A;  4O92 A;  2NVL A;  3C73 A;  2E2G A;  4JU5 A;  1X9M B;  4GQC A;  1BAY A;  5DCH A;  2H1G A;  3CSI A;  3RAZ A;  1B4Q A;  2HRF A;  4GQF A;  5GST A;  4TXO B;  4HI7 A;  2YP6 A;  2HFD A;  4TXO A;  4ZL8 A;  2LJR A;  3DXB A;  5DAL B;  1WE0 A;  1GUL A;  1Z5Y E;  4IJ3 A;  2R3X A;  1XWK A;  5DAL A;  3F8U A;  1SK1 A;  3ZIT A;  1K0C A;  2O87 A;  4N0V A;  4O5U A;  2RUF A;  4JE1 A;  4BL7 A;  1ZCP A;  1NHO A;  2FLS A;  4OCE A;  3RBT A;  1XZO A;  2X99 A;  1F3A A;  2JZR A;  4K5S A;  5J9B A;  4ECC A;  5KN3 A;  2H0G A;  2PPT A;  3C1R A;  4IEL A;  2C3T A;  2VCX A;  1A0R P;  2HE3 A;  2V32 A;  2WB9 A;  3GKK A;  3TRX A;  4IN0 A;  2B7J A;  4GLT A;  3FR9 A;  2HZE B;  2PVO C;  4NV5 A;  5G30 A;  4BWS A;  1RW1 A;  3LW9 A;  2HZE A;  1T7P B;  2VCZ A;  3QR6 A;  4POL A;  2RM6 A;  3DIE A;  3JCM L;  5ECH B;  3D6I A;  3P2A A;  1WWJ A;  1BQ7 A;  4H86 A;  1LBK A;  3H4K A;  1M9A A;  3HY2 A;  3LG6 A;  3FHK A;  3IC4 A;  5EY6 A;  3LOR A;  1PKZ A;  2DML A;  4ZIJ A;  2LTK A;  1AC1 A;  2V6K A;  1QK8 A;  3F9U A;  4MCU A;  1M0U A;  1A0F A;  2R4V A;  19GS A;  2B5E A;  1AQV A;  5F07 A;  3GX8 A;  1QFN A;  1S3C A;  1T00 A;  4GXZ A;  5INY A;  1F9M A;  4V2N A;  4HU9 A;  3HHV A;  3ME8 A;  2N5B A;  2X8G A;  1E2Y A;  3TKS C;  1EP8 A;  4KB3 A;  5KEJ A;  5CAX A;  2H0H A;  1CQH A;  3WGD A;  3BCI A;  3DEX A;  2CVK A;  1NM3 A;  2C80 A;  5DAK B;  2XBQ A;  4TXV A;  4MF6 A;  2AAW A;  1EV4 A;  4AGS A;  3IR4 A;  1GUM A;  1A8Y A;  1K0D A;  3RPN A;  4GSS A;  1A2L A;  6GSV A;  1S3A A;  4GF0 A;  4MH3 A;  4V2M A;  5B8A A;  1MD3 A;  4NXI A;  4PX1 A;  1SK2 A;  2GQK A;  2B6M A;  3FR3 A;  1M2B A;  3L0H A;  3M8N A;  1M9B A;  4YAP A;  3PPU A;  4WBR D;  3A2X A;  2JU5 A;  1K0N A;  2YJH A;  2CVD A;  3PR8 A;  2AB6 A;  2GT5 A;  2G0F A;  2L5O A;  4TN8 A;  4I2T A;  2J23 A;  3D0Z A;  5D8I A;  4MJC A;  3UBL A;  5JWQ B;  1ZL9 A;  1YF1 A;  4V2L A;  1HNA A;  4Q5Q A;  4EXJ A;  11GS A;  4HJM A;  3F6F A;  3AY8 A;  1PL2 A;  3R2Q A;  3HZ8 A;  2JZT A;  1SYR A;  3HJM A;  2VLT A;  1OC3 A;  2LS5 A;  3TKP A;  2CVB A;  3NZN A;  2RLI A;  4YQM A;  4G19 A;  1G6W A;  4BA7 A;  2VLV A;  2LJA A;  4EIQ A;  2GGT A;  1A8L A;  8GSS A;  1PGT A;  4WR5 A;  4PGT A;  2LST A;  4BVY B;  2C0E A;  2B1L A;  1XW9 A;  2HRN A;  4QL9 A;  1GSF A;  4A5P A;  3QD9 A;  1WPI A;  1YQ1 A;  3M1G A;  4XRD A;  3VI7 A;  1ZGN A;  4ICY A;  5G1L A;  3GHA A;  1SKS B;  2LV3 A;  3WT1 A;  4MZW A;  1U87 A;  4EKZ A;  1SU9 A;  2E2M A;  3QDN A;  3ZLP A;  2XBI A;  2XPE A;  4HU7 A;  3D4M A;  1GNW A;  3C7M A;  1JLV A;  2N5F A;  2C0G A;  4POK A;  1Y6E A;  3KXO A;  2YN1 A;  3L4N A;  2H01 A;  5ECR B;  2E0Q A;  2LNT A;  1O73 A;  3O6T A;  4V1A g;  2LRT A;  3WGE A;  3KP9 A;  1SL0 B;  4DSS A;  5H5Q A;  5IQY A;  4KCA A;  3ZVJ D;  1KTE A;  1T3B A;  2XHF A;  2K9F A;  3CYN A;  2X8H A;  1K0A A;  5ID2 A;  3DD3 A;  1B9Y C;  2MBS A;  1QMV A;  4G0K A;  3IXR A;  1IYH A;  1B48 A;  2CZ3 A;  6GST A;  1O8X A;  2AUV A;  1HNC A;  2JL4 A;  3DVX A;  3RHB A;  4KSO A;  4YKF A;  4GST A;  4QQ7 A;  5IPG A;  3ERF A;  3UMA A;  4F0B A;  1B9X C;  2O85 A;  3FRC A;  1TOF A;  2DJ3 A;  1TU8 A;  2GQM A;  2GSR A;  5J9C A;  1MDI A;  2MBT A;  3QCP A;  1RQM A;  2VD0 A;  1ZYP A;  4ILF A;  5DJL A;  5D73 A;  3ZVJ A;  2WUL A;  1WP0 A;  1TDI A;  2ES7 A;  4L5L A;  1HQO A;  5KN2 A;  5HFG A;  3D5J A;  1AQW A;  5J5N A;  1FOV A;  4TR4 A;  2IME A;  2H0I A;  5HFI A;  2YCD A;  2JZS A;  3RHC A;  3DML A;  2WGR A;  2YJ7 A;  4NPB A;  3WYW A;  5CRD A;  3FMW A;  3LGC A;  2OBK A;  1ML6 A;  2TIR A;  9GSS A;  4O7H A;  3APO A;  2GQL A;  3QAV A;  1PQN A;  2HNL A;  4CY8 A;  2H66 A;  3TJB A;  2ZCT A;  2F51 A;  1I9D A;  4K1F A;  1YF0 A;  5B6N A;  3Q18 A;  1TI3 A;  1EEJ A;  3CTG A;  3OR5 A;  1GSQ A;  1XVQ A;  2JSZ A;  1M7T A;  2IWT A;  1EOH A;  1YY7 A;  2L4Q A;  2LUS A;  3GYK A;  2WS2 A;  4KGI A;  3GN3 A;  3LYK A;  1X5D A;  1VRS D;  4EF0 A;  1ZZY A;  3TJG A;  2NBS A;  3KMN A;  3A5I A;  2DC5 A;  1KBN A;  1PA3 A;  1G6Y A;  4WXT A;  2VCW A;  4WET A;  5JWO B;  3BJ5 A;  1XWB A;  3GTU B;  1I5G A;  4IGJ A;  1O7U A;  5HQP A;  2JAD A;  2OE3 A;  3GFK A;  4OD7 A;  3FYG A;  2VIM A;  1GSY A;  7GSS A;  1ZYQ B;  2P5Q A;  5G5F A;  3DWV A;  3MDK A;  5CYY A;  1DSB A;  1ERU A;  1GWC A;  3ZIV A;  5L71 A;  4RQR A;  1EGO A;  3TJJ A;  1BJX A;  2D2Z A;  2CV4 A;  4ECB A;  5GAN D;  4JR4 A;  5F05 A;  3IK7 A;  2HRK A;  5G2Z A;  1JFU A;  3IA1 A;  4MK3 A;  1XW6 A;  4KX4 A;  2R0G A;  2YAN A;  3ZL5 A;  2HSM A;  3ZYW A;  3G9B A;  3KIJ A;  3ZML A;  1UC7 A;  2HT9 A;  4MZB A;  3E3E A;  1FB6 A;  1USB A;  4RI6 A;  4K8M A;  3EC3 A;  5IMF A;  5HR3 A;  3IC8 A;  2CAQ A;  4Z2T A;  3EU3 A;  3VPQ A;  1GSU A;  4GCI A;  4IP1 A;  4MZC A;  1LU4 A;  3ERG A;  2I1U A;  1Z3E A;  4CHS A;  5AN1 A;  1TK5 B;  3UEM A;  3F0I A;  3ME7 A;  1TRS A;  2E7P A;  4F0C A;  4KF9 A;  3H1N A;  4XS4 A;  2VOC A;  3GKN A;  1QGV A;  4ML1 A;  1K0B A;  2PGT A;  4ZBD A;  3CXG A;  1JLW A;  4EE0 A;  1DUG A;  1TK0 B;  5IMZ A;  4RUV A;  1GTU A;  6GSX A;  4K5R A;  1Z7P A;  4E8E A;  1WJK A;  2LQQ A;  4AF2 A;  3QAW A;  5IPH A;  4JZQ A;  4WF5 A;  1DE2 A;  3IHQ A;  1EWX A;  4ZB9 A;  1MD4 A;  2FWG A;  4HQS A;  2IPA A;  4PUF C;  5JCW A;  3CSH A;  1H4O A;  2FA4 A;  1A23 A;  3J7Y b;  4G2E A;  4XIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...