3C1RA

Crystal structure of oxidized grx1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
110
structure length
110
Chain Sequence
b'HMVSQETIKHVKDLIAENEIFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQRTVPNIYINGKHIGGNDDLQELRETGELEELLEPILA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin-1
publication title Glutathionylation-triggered conformational changes of glutaredoxin Grx1 from the yeast Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 40
structure length 110
sequence length 110
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3c1rA00
2H74A 3APSA 5G1LA 2AJQB 4JE1A 3KMOA 2WJUA 3C73A 3HJOA 3PH9A 4NHWA 2AUVA 4WETA 4CW9A 4DEJA 2IIYA 5IPGA 1O73A 4FYBA 4KGIA 3F8UA 5KN0A 2B5YA 1Z6MA 1H75A 1AAZA 18GSA 1B4PA 3ZYWA 1UN2A 2EIRA 1M7TA 2AAWA 1GSQA 6GSUA 5J3RA 2VM2A 3PINA 3IDVA 4TKYA 3HCZA 3CMIA 4XRDA 5HQPA 2R5GA 4DSQA 4Z7XA 3VI5A 4PNGA 1Z6NA 4XTSA 4MJBA 3ZFLA 2OE3A 1ERVA 3BJ5A 1A2JA 3EU4A 2GTUA 4MF5A 2WZ9A 2HRNA 3DGQA 2KHPA 3EVIA 13GSA 4NWYA 3GKXA 3U6VA 3ERFA 2VCQA 1GP1A 5DCGA 2GSTA 1TJDA 3GX0A 1T1VA 1FVKA 2GZZA 2JADA 2I4AA 2PPTA 1SKSB 2OJLA 2LEGA 1PQNA 1V58A 2LTKA 3F0IA 1G7OA 1F6MC 1LU4A 4KSMA 3FYGA 1ML6A 1K0DA 4ZIJA 3P7XA 2KOKA 4CHSA 3QOUA 2DSAA 3BD2A 3DEXA 5JWRB 1TK5B 2MZCA 1NHOA 3GKMA 2FWGA 2HLSA 1O6JA 3E0UA 1MD4A 4D73A 2CX4A 3VWVA 1YKCA 3IOSA 2B7JA 1GUHA 3CTFA 3HDCA 2LUSA 1FO5A 2YZHA 4AJ8A 4IN0A 5CREA 3U5RE 5JCUA 2VD0A 2H6YA 4JEDA 1I9DA 1T3BA 2KP1A 1YDKA 3US3A 4LLRA 1G7EA 1O8WA 3ERGA 2BJXA 8GSSA 2IFQA 1TDIA 3DXBA 2IMIA 4MJEA 2ZCTA 2VLTA 2YJHA 4NPBA 3HZ8A 3W8JA 2AV4A 2RM6A 2N5FA 4K7OA 1SJ6A 5IM9A 4BL7A 2H30A 5JWOB 5IMZA 4MK3A 3I6AA 1S3CA 2H6ZA 2LS5A 1CQGA 4OFMA 2GZPA 3VLNA 1WMJA 2DJ1A 3G7IA 4MZCA 4TW5A 1PKWA 1QMVA 1CQHA 2P5QA 1ILOA 2VCZA 5IMCA 3UAPA 1WIKA 1JLWA 2GSRA 3R2QA 4HZ4A 2FWFA 3TJJA 1KEBA 5F07A 1JZDA 4PX1A 3ZVJD 3C1SA 3ZTLA 1AUCA 3BBYA 3VI7A 1EP7A 4OFNA 3EINA 2C80A 5IMDA 4HUAA 4G9HA 1Z7RA 2H0GA 20GSA 5ECMB 4POMA 3ZFBA 4V2LA 1M99A 2F9SA 2R4VA 4OCEA 2J23A 4LMWA 4MABA 4ECBA 2FHEA 1OC3A 5CP1A 4EF0A 2VIMA 4PXOA 5B7CA 4MZBA 2NTOA 5G2ZA 3IAS2 2H8LA 2PERA 4XRAA 1S3AA 3CYNA 3NOFA 2G0FA 2C3QA 3FK8A 3LG6A 4TR1A 5C00A 2C0EA 5JCGA 3WT1A 5AISA 1PX6A 1QXHA 2ALBA 1JHBA 2Z9SA 4MA9A 3N5OA 4F0CA 4ZL9A 1O8XA 2B1KA 2OBIA 1SYXA 2LSTA 5G5FA 3KH7A 17GSA 3QAVA 1ACVA 2NDOA 3M8NA 1XVQA 4YQUA 4KX4A 3GHAA 1TRWA 4XS6A 2HXKA 4XS4A 3V1WA 4WBJA 3NZNA 2OADA 3LWAA 2P0GA 4ZL8A 2CAIA 2DC5A 2FY6A 3H1NA 5CRDA 2H0HA 4TVEA 5INYA 3GH6A 2VO4A 2DIZA 4IP1A 2M72A 1GSYA 2GZYA 3MNGA 1K0AA 2XHFA 2OACA 3M0FA 1GTBA 3GIXA 3Q74A 1WWJA 1W89A 3F6DA 5EY6A 2KUCA 5F05A 2O85A 3I9V2 4FIWA 1XOAA 5G31A 1OVNA 4PQ1A 2YNXA 1C72A 3RAZA 2X64A 2VOCA 1HNAA 5IQYA 1K0CA 2HZEA 2LRCA 4K0GA 1XPVA 3W8SA 1GNEA 3KEBA 5HFIA 3K8NA 3EE2A 3DMLA 1F2EA 3TB2A 3WGEA 4O32A 2A2SA 3WD6A 1MEKA 5IO2A 1YF0A 2LQOA 5J5NA 1PD21 1TI1A 2GSSA 4NXIA 1Q98A 2O8VB 4ECCA 3UVHA 4G10A 2CZ2A 5CAXA 3KMNA 1RK4A 5GZZB 2VM1A 1XWCA 4KH7A 2YCDA 4KDXA 3VURA 2WRTA 1I5GA 1ZGNA 4WF5A 2ON5A 3KTBA 5ECOB 4JZQA 4GTUA 4WEYA 3OR5A 3L9SA 1OKDA 2IJYA 1YQ1A 4PQIA 3QDNA 3FZ5A 1R4WA 2VCXA 2O87A 3F3QA 1SK2A 3MWHA 5D9TA 2FWEA 3QPMA 4QL7A 4BVXA 1M0UA 1AIUA 1URMA 5HR1A 3PR8A 4OD7A 2VCVA 1T7PB 5IMVA 1N8JA 5DQYA 1VRSD 2HYXA 4KB3A 1U6TA 4KW6A 4MP4A 4YAPA 3DWVA 3HVXA 4ISDA 1NM3A 4D73B 3A2XA 2K18A 2GS3A 2QC7A 2O89A 5A5KA 3UMAA 1TOFA 5LNKe 3ME7A 3TKRA 5D73A 5ECPB 2GT6A 1WOUA 2L4CA 1XW5A 1U88A 2IFQB 4EL1A 1OKTA 4ZBAA 3ZMKA 5GSSA 3L4NA 1XIYA 1K3LA 1ST9A 4AF2A 3M3MA 4MPGA 4OWYA 1IYHA 2E7PA 2MBSA 2NBSA 1XWAA 4MH2A 1YY7A 3FZ9A 6GSTA 2VL3A 3TKPA 1A23A 1JLVA 3QCPA 5E59A 1J0FA 2WDUA 3ISOA 2FNOA 4NMUA 2MYGA 2DMLA 3F3RA 4HQZA 3A3TA 1ABAA 4POBA 4IHUA 1TW9A 3BCKA 4GWRA 1Y6EA 2OE1A 3C7MA 3FR3A 1GSFA 2IMFA 6GSYA 5H5RA 3ERWA 4HU9A 3TOUA 3LYPA 5DJMA 4ID0A 4ZB9A 5KN2A 2YP6A 2K6VA 3CBUA 1QQ2A 1GNWA 3LFLA 4K7IA 3TUEA 2HNLA 3VK9A 3TRPA 2YPMA 2HSHA 3TKSE 3KJYA 3DD3A 1OC9B 2GDRA 4MZWA 1PMTA 2IMKA 4EE0A 5IMAA 1AQWA 1EOHA 6GSVA 2PWJA 2OA7A 3ZRDA 3A2VA 2PMTA 3UOMA 2YV7A 2YZUA 4GSSA 5HR2A 2F3MA 3S9FA 2X8GA 1Q4JA 4TXOB 2C0GA 1MD3A 4MDCA 1X9WB 1EV9A 2HT9A 3F4SA 1HNBA 1MDJA 4Q5QA 7GSSA 4KNDA 1XVWA 5KN1A 4FH8A 4ZB8A 5ECSA 3WT2A 4YH2A 5CO3A 6GSWA 4O7HA 3KP8A 4TR1B 2GQKA 4AJ7A 1ZYQB 3EMXA 3IR4A 2V2GA 3GYKA 4RUVA 2AHEA 4HS1A 4IQAA 4IBPA 1AXDA 5DCHA 1KNGA 2HI7A 4G2EA 1YJ6A 4N11A 3ZZXA 3GNJA 4XS4B 4ACSA 4O92A 2MMOA 3IE3A 1RQMA 4I8BA 2TRCP 4RI6A 3N9JA 1NW2A 3QFBC 3WGDA 4POKA 5B6MA 3DIEA 1SD9A 2YV9A 3APOA 3TKSC 3ZLPA 1TI3A 2KLXA 3F4RA 1FB0A 2DJ0A 4OFTA 2LQQA 4ZL7A 3HYPA 4QL9A 1X9MB 2QSIA 2IWTA 4TOPA 5G30A 5CYYA 1M2BA 2XBIA 5ABRA 3ZVJA 2GT5A 1K0BA 1HYUA 3IA1A 4HI7A 4YAVA 5ECLB 12GSA 2YJ7A 1NSWA 2AB6A 1R26A 4IS0A 2HZEB 1U87A 4F03A 4IKHA 1GSDA 3LEFA 1GUMA 5EL8A 1BX9A 1GUKA 2GGTA 1FW1A 2R2JA 5J4UA 4BWSA 3I43A 1LJRA 2DJJA 1PGTA 5J41A 1QFNA 3D22A 4JRRA 4TRXA 3KP9A 4X0XA 4XHMA 4OO5A 2C0FA 1ZL9A 2OE0A 4G19A 4GSTA 3TDGA 3UBLA 1AC1A 4KA0A 1T00A 1A2MA 1TP9A 2GQLA 3D5JA 3A5WA 4YQMA 3QMXA 1K3YA 4JU5A 5HFGA 2LNTA 3UIWA 3TJBA 5DVBA 1F9MA 1SYRA 1SL1B 3P2AA 2VD1A 3C1RA 4KDUA 1OC9A 3J7Yb 1BJXA 3ED3A 1J08A 2YOIA 4GCIA 3VWUA 4F82A 5L71A 4L0WA 1SK0A 2HZFA 3TGZA 6GSXA 2GQMA 1OE8A 1UC7A 4MLYA 5KN3A 4TXOA 1E2YA 2X99A 2JACA 3RBTA 3GKKA 1H4OA 2OBKA 4O5RA 1ON4A 2H0IA 4EC0A 3VFIA 3GV1A 3FEUA 2H1GA 1R5AA 4IW9A 2D2ZA 2B7KA 4WBRD 4K6XA 1FOVA 2EIOA 3HXSA 5CRGA 3HHVA 1TXXA 1VF4A 1BQ7A 1DE2A 3LSZA 3UARA 4HQSA 1UA5A 3LXTA 1ERUA 3ZREA 3TOTA 4KUNA 2K9FA 3F4TA 2RLIA 1TRUA 5DBQA 1B8XA 1BG5A 1M9AA 1T8EB 3O3TA 3FY7A 3GURA 3H79A 2GVPA 4ZXGA 4J56E 4DVCA 3EC3A 3FRCA 4P3YB 5C04A 4V1Ag 3TJKA 3L9VA 1T4ZA 3RPPA 2ON7A 2L6DA 5IOXA 3QAGA 4N10A 3TKSA 2DJ3A 1F37A 1X0RA 3O6TA 2LJAA 2FD3A 2H1DA 2QGVA 1FB6A 3MSZA 4E8EA 1BAYA 4IVFA 4N30A 1DE1A 2JSZA 3EWLA 3J7Yk 3CXGA 3KXOA 2TRXA 4MF6A 1EEJA 5LCZA 2I81A 3KIJA 5CRHA 1VF2A 4X1UA 4Q5NA 3IPZA 2JSYA 2VCWA 3DRNA 4I2TA 4JBBA 4N0ZA 2RIIA 2G2QA 5G5EA 4Q5RA 1O85A 5KEJA 4L8EA 2K8SA 3Q6OA 14GSA 3HVSA 2ES7A 4IELA 5DDLA 4AGSA 1EGRA 1GSSA 3TKQA 5FHIA 4H86A 5CRWA 1XFLA 3M9KA 4FYUA 4KE3A 2C8UA 5A4VA 4V2NA 3ZITA 5ECHB 1RW1A 4XIHA 1N2AA 3F63A 5EPFA 3DVXA 3KH9A 1V98A 1GH2A 2IMEA 2X8HA 4PUFC 4QQ7A 3D6IA 1TRVA 5F8BA 1K3OA 10GSA 1FVJA 3GL5A 4V2MA 1YEPA 5JWQB 1FAAA 4MMMA 2WFCA 1SU9A 3HKRA 2HFDA 4ZILA 3Q19A 2LNSA 5JCWA 3EURA 4ML1A 2H6XA 2JU5A 3L78A 2AYTA 3GMFA 4MCUA 1GL8A 3BOAA 3IRAA 5D96A 2DIYA 1R5PA 1TU7A 2I9HA 4FYCA 3JCML 4K0NA 3C8EA 2YANA 3DVWA 1TRSA 3L9UA 4KDYA 3GTUA 1B9XC 3WYWA 2CVBA 2MMZA 4ULXA 1G0TA 1GLPA 2P5RA 4LL4B 3HJPA 4KCAA 2L59A 3QD9A 3CSHA 3GKNA 3FZAA 4DSSA 1V57A 4BA7A 5ENUA 5ECKB 1GTIA 3Q18A 2MMAA 2VL9A 3SWLA 3HY2A 4BWQA 5IPHA 3NIVA 1J9BA 1OAZA 1B4QA 1HD2A 1K0OA 1JZWA 2REMA 5HR0A 2H66A 1QUWA 5DAKA 3ZMLA 4K7NA 1XCCA 1PN9A 3AY8A 1PX7A 4I6XA 4MJAA 1X5CA 3LXZA 2P31A 5AN1A 3LQ7A 2QKEA 4HU7A 2EC4A 4ILFA 2PGTA 1G6YA 2JZRA 3ME8A 4WXTA 5ELGA 2F8AA 2B5EA 4N0VA 2E2MA 2KP2A 2LRTA 3VPQA 4IP6A 1XZOA 3HD5A 1V9WA 4PGTA 3EMPA 5H5SA 3FR9A 19GSA 1SENA 5IOWA 2V32A 1U3IA 1EP8A 2VAFA 1YEXA 3RDWA 4ML6A 11GSA 4XS1A 1JFUA 1A0FA 1WJKA 2N5BA 1TKDB 1Z5YE 4F2IA 2VCTA 1GSUA 2WGRA 3HJMA 2VL2C 4TR3A 4OMVA 1XWGA 1F3BA 4ECJA 1M2DA 2X8CA 1KBNA 5ID2A 3FHKA 2E0QA 5FT3A 1OYJA 1Z9HA 4JR6A 2CVDA 4OO4A 1UVZA 2DMMA 5AIXA 2LV3A 2I3YA 5DALA 3VWXA 5GSTA 4PQHA 4IQ1A 1WPIA 1BYEA 4AJ6A 2L5LA 1K0NA 4L5LA 4I5QA 3CTGA 5D9XA 2DBCA 5LD0A 2ZNMA 4HJMA 4K8MA 4ECIA 3D0ZA 1WE0A 4KCEA 1TTZA 2K8VA 4EO3A 3H93A 3FR6A 2RUEA 5B8AA 2OKAA 1A2LA 2H1BA 2R6KA 4F9ZA 4MPFA 2CV4A 3IV4A 1TU8A 1QGVA 2C4JA 3HVVA 1MDKA 3IC4A 4TR4A 1XWBA 3APQA 2DJKA 1YF1A 2CX3A 3D21A 4GQFA 5B8BA 4KSOA 3TRXA 3FZ4A 4IJIA 1ZMAA 1M2AA 1M9BA 1X9SB 1TK8B 2YN1A 3A2WA 4LA1A 3IK9A 1XWKA 4NAXA 3CSJA 2E2GA 2CVKA 3RHCA 2MBTA 5F06A 1EWXA 4I2UA 4GRFA 4WKWA 3G7JA 1F3AA 1USBA 3IHQA 3KM6A 4POLA 2DLXA 2B5XA 1LBKA 4HJ2A 22GSA 3KD0A 1B48A 2VUPA 2F51A 4LL1B 2JL4A 5IO0A 2XBQA 3E9JB 3RHBA 5D8IA 2H01A 3C71A 3QR6A 4EUYA 1EZKA 1ERTA 2V6OA 5ECNB 2LJRA 1YKAA 2EIQA 2NVLA 2FWHA 3RPNA 1PA3A 4I97A 4MH3A 5ECQB 2RM5A 1V2AA 3L0HA 4WF4A 2WULA 3KGKA 1U3AA 5AGYA 3KTLA 3H8QA 5IIZA 1THOA 2LJKA 3FW2A 2CQ9A 3UEMA 5AIVA 3UBKA 3EU3A 1PRXA 2H76A 2L4QA 1GSEA 4FO5A 3GFKA 3MDKA 4TXVA 2C3NA 5HFKA 2PN8A 1WRYA 1OC8A 4ZB6A 1SD8A 3KZQA 1GTUA 1AW9A 3VPTA 2GSQA 1SJZA 3GH9A 4K9ZA 4BPYA 1Z7PA 2IMDA 1QK8A 2CZ3A 2BMXA 5H5QA 2HSYA 3F6FA 4IJ3A 5IMFA 3GTUB 1XW9A 3P8WA 1GULA 3LYKA 1EGOA 3M1GA 2YWNA 4RI7A 1B9YC 2PVQA 2C1YA 5GAPD 1O81A 2H19A 2VL2A 2WCIA 4DSSB 5D9WA 2BTOT 2M80A 1V40A 1MTCA 3P90A 3IBHA 4J2FA 1Y25A 1Z3EA 3HZ4A 2ZUPA 4ZBDA 5DJLA 2L57A 4EVMA 4CDOA 1ZYEA 2DJ2A 3GUSA 4PUAA 4PURA 5ECRB 2IPAA 4Q5FA 4HDEA 3ZIJA 4RQXA 5HR3A 2CT6A 4ZBBA 4E8HA 4KAEA 4K2DA 4RQRA 3MAKA 1FG4A 1EV4A 1X5DA 3CSIA 3GX8A 2IN3A 4EKZA 5DAKB 4MJCA 4NV5A 1PL1A 1EEMA 2CAQA 1XXUA 2H73A 4HOJA 2B3SA 4BVYA 4F0BA 1S3DA 1THXA 4MF7A 2YWOA 1XBSA 2H75A 4V1Ap 9GSSA 2I1UA 2R3XA 4L5OA 4IGJA 1EOGA 3TCOA 2WB9A 4GSNA 3UJ1A 3M9JA 2R37A 2H71A 3LGCA 4XCSA 1AQXA 2RUFA 4NHZA 4PNFA 1HNCA 4EDZA 4GF0A 1T4YA 3O76A 3KCMA 1IYIA 2J9HA 3F9UA 4HZ2A 3I69A 2XPDA 4WR4A 1ZOFA 4WR5A 3BCIA 2C3TA 3TJFA 1A8YA 2NPBA 2XC2A 3CRUA 1JZOA 4OCFA 1W4VA 3E3EA 3GN3A 3G9BA 16GSA 5ID2B 3IXRA 3QFAC 2B1LA 5EVOA 1TK0B 3H4KA 5E4WA 2FUG2 3CRTA 3LORA 3GL3A 4GLTA 3GSSA 1PKZA 1SKWB 3GRXA 3UVTA 5GAND 5D93A 1DSBA 5DALB 1SL2B 1YZXA 1FHEA 3DKSA 3IAM2 1A8LA 3IK7A 4LMVA 5J9BA 1VF3A 4HEA2 2H70A 4TR0A 1A24A 1G6WA 1R7HA 1BEDA 3ZL5A 4YQVA 2A2RA 4L0UA 2M46A 5COHA 2LRNA 2PVOC 2YWMA 1SL0B 2B6MA 2L5OA 3D4TA 1JZRA 2FCHA 2F8FA 3PGTA 3D4MA 5F0GA 3VWWA 2WS2A 3GSTA 1GRXA 3EYTA 2PBJA 1NHYA 6GSSA 5A4WA 1ZCPA 2FA4A 5FWGA 1GWCA 2N5AA 1SJIA 1OE7A 2XPEA 3WGXA 4DSRA 3TJGA 1A0RP 5J9CA 2GLRA 2FA8A 2C0DA 4J57E 2HRFA 1DUGA 1O7UA 3TRQA 1ERWA 2H72A 2FLSA 2PU9C 3QAWA 2JZSA 5A4UA 1VF1A 5D9VA 1SK1A 3DYRA 5B6NA 2IL3A 2L6CA 2LKUA 4EXJA 4EDYA 4JR4A 2FGXA 2TIRA 2JZTA 1PSQA 2O7KA 4NV2A 2PUKC 3HA9A 3LJRA 4X43A 1XW6A 5G1KA 5ELAA 4TN8A 1SKRB 1GLQA 2V1MA 2HE3A 1KTEA 2V6KA 1HQOA 5CNWA 1E6BA 4GXZA 3FKFA 1DBYA 3GA4A 2A4VA 2V41A 1GTAA 2YWIA 2VLUA 1ZZYA 3G7YA 2MMNA 2H1AA 1WP0A 4GQCA 4K1FA 1PL2A 5ECIB 1X5EA 1AQVA 1VGLA 3SBCA 1K0MA 3W6GA 1XOBA 3UL3A 5DQSA 2VLVA 1MDIA 2CA8A 3ZIVA
chains in the Genus database with same CATH superfamily
2H74A 3APSA 5G1LA 2AJQB 4JE1A 3KMOA 2WJUA 3C73A 3HJOA 3PH9A 4NHWA 2AUVA 4WETA 4CW9A 4DEJA 2IIYA 5IPGA 2R0CA 1O73A 4FYBA 4KGIA 3F8UA 4K2XA 5KN0A 2B5YA 1Z6MA 1H75A 1AAZA 18GSA 1B4PA 3ZYWA 1UN2A 2EIRA 1M7TA 2AAWA 1GSQA 6GSUA 2UZ8A 5J3RA 2VM2A 3PINA 3IDVA 4TKYA 3HCZA 3CMIA 4XRDA 5HQPA 2R5GA 4DSQA 4Z7XA 3VI5A 4PNGA 1Z6NA 4XTSA 4MJBA 3ZFLA 2OE3A 1ERVA 3BJ5A 1A2JA 3EU4A 2GTUA 4MF5A 2WZ9A 2HRNA 3DGQA 2KHPA 3EVIA 13GSA 4NWYA 3GKXA 3U6VA 3ERFA 2VCQA 1GP1A 5DCGA 2GSTA 1TJDA 3GX0A 1T1VA 1FVKA 2GZZA 2JADA 2I4AA 2PPTA 1SKSB 2OJLA 2LEGA 1PQNA 1V58A 2LTKA 3F0IA 1G7OA 1F6MC 1LU4A 4KSMA 3FYGA 1ML6A 1K0DA 4ZIJA 3P7XA 2KOKA 4CHSA 3QOUA 2DSAA 3BD2A 3DEXA 5JWRB 1TK5B 2MZCA 1NHOA 3GKMA 2FWGA 2HLSA 1O6JA 3E0UA 1MD4A 4BVYB 4D73A 4O5UA 2CX4A 3VWVA 1YKCA 3IOSA 2B7JA 1GUHA 3CTFA 3HDCA 2LUSA 1FO5A 2YZHA 4AJ8A 4IN0A 5CREA 3U5RE 5JCUA 2VD0A 2H6YA 4JEDA 1I9DA 1T3BA 2KP1A 1YDKA 3US3A 4LLRA 1G7EA 1O8WA 3ERGA 2BJXA 8GSSA 2IFQA 1TDIA 3DXBA 2IMIA 1M3JA 4MJEA 2ZCTA 2VLTA 2YJHA 4NPBA 3HZ8A 3W8JA 2AV4A 2RM6A 2N5FA 4K7OA 1SJ6A 5IM9A 4BL7A 2H30A 5JWOB 5IMZA 4MK3A 3FMWA 3I6AA 1S3CA 2H6ZA 2LS5A 1CQGA 2A2PA 4OFMA 2GZPA 3VLNA 1WMJA 2DJ1A 3G7IA 4MZCA 4TW5A 1PKWA 1QMVA 1CQHA 2P5QA 1ILOA 2VCZA 5IMCA 3UAPA 1WIKA 1JLWA 2GSRA 3R2QA 4HZ4A 2FWFA 3TJJA 1KEBA 4A5PA 5F07A 1JZDA 4PX1A 3ZVJD 4EIQA 3C1SA 3ZTLA 1AUCA 3BBYA 3VI7A 1EP7A 4OFNA 3EINA 3MIXA 2C80A 5IMDA 4HUAA 4G9HA 1Z7RA 2H0GA 20GSA 4PTSA 5ECMB 4POMA 3ZFBA 4V2LA 1M99A 4Z2UA 2F9SA 2R4VA 4OCEA 2J23A 4LMWA 4MABA 4ECBA 2FHEA 1OC3A 5CP1A 4EF0A 2VIMA 4PXOA 5B7CA 4MZBA 2NTOA 5G2ZA 3IAS2 2H8LA 2PERA 4XRAA 1S3AA 3CYNA 3NOFA 2G0FA 2C3QA 3FK8A 3LG6A 4TR1A 5C00A 2C0EA 5JCGA 3WT1A 5AISA 1PX6A 1QXHA 2ALBA 5KOWA 1JHBA 2Z9SA 4MA9A 3N5OA 4F0CA 4ZL9A 1O8XA 2B1KA 2OBIA 1SYXA 2LSTA 5G5FA 3KH7A 17GSA 3QAVA 1ACVA 2NDOA 3M8NA 1XVQA 4YQUA 4KX4A 3GHAA 1TRWA 4XS6A 2HXKA 4XS4A 3V1WA 4WBJA 3NZNA 2OADA 3LWAA 2P0GA 4ZL8A 2CAIA 2DC5A 2FY6A 3H1NA 5CRDA 2H0HA 4TVEA 5INYA 3GH6A 2VO4A 2DIZA 4IP1A 2M72A 1GSYA 2GZYA 3MNGA 1K0AA 4EIPA 2XHFA 2OACA 3M0FA 1GTBA 3GIXA 3Q74A 1WWJA 1W89A 3F6DA 5EY6A 2KUCA 5F05A 2O85A 3I9V2 4FIWA 1XOAA 5G31A 1OVNA 4PQ1A 2YNXA 1C72A 3RAZA 2X64A 2VOCA 1HNAA 5IQYA 1K0CA 2HZEA 2LRCA 4K0GA 1XPVA 2A4HA 3W8SA 1GNEA 3KEBA 5HFIA 3K8NA 3EE2A 3DMLA 1F2EA 4G0KA 3TB2A 3WGEA 4O32A 2A2SA 4KF9A 3WD6A 1MEKA 5IO2A 1YF0A 2LQOA 5J5NA 1PD21 1TI1A 2GSSA 4NXIA 1Q98A 2O8VB 2DKHA 4ECCA 3UVHA 4G10A 2CZ2A 5CAXA 3KMNA 1RK4A 5GZZB 2VM1A 1XWCA 4KH7A 2YCDA 4KDXA 4X4JA 3VURA 2WRTA 1I5GA 1ZGNA 4WF5A 2ON5A 3KTBA 5ECOB 4JZQA 4GTUA 4WEYA 3OR5A 3L9SA 1OKDA 2IJYA 1YQ1A 4PQIA 3QDNA 3FZ5A 1R4WA 2VCXA 2O87A 3F3QA 1SK2A 3MWHA 5D9TA 1M3IA 2FWEA 3QPMA 4QL7A 4BVXA 1M0UA 1AIUA 1URMA 5HR1A 3PR8A 4OD7A 2VCVA 1T7PB 5IMVA 1N8JA 5DQYA 1VRSD 2HYXA 4KB3A 1U6TA 4KW6A 4MP4A 4YAPA 3DWVA 3HVXA 4ISDA 1NM3A 4D73B 3A2XA 2K18A 2GS3A 2QC7A 2O89A 3PPUA 5A5KA 3UMAA 1TOFA 5LNKe 3ME7A 3TKRA 5D73A 5ECPB 2GT6A 1WOUA 2L4CA 1XW5A 1U88A 2IFQB 4EL1A 1OKTA 4ZBAA 3ZMKA 5GSSA 3L4NA 1XIYA 1K3LA 1ST9A 4AF2A 3M3MA 4MPGA 4OWYA 1IYHA 2E7PA 2MBSA 2NBSA 1XWAA 4MH2A 1YY7A 3FZ9A 6GSTA 2VL3A 3TKPA 1A23A 1JLVA 3QCPA 5E59A 1J0FA 2WDUA 3ISOA 2FNOA 4NMUA 5BMUA 2MYGA 2DMLA 3F3RA 4HQZA 3A3TA 1ABAA 4POBA 4IHUA 4YKGA 1TW9A 3BCKA 4GWRA 1Y6EA 2OE1A 3C7MA 3FR3A 1GSFA 2IMFA 6GSYA 5H5RA 3ERWA 4HU9A 3TOUA 3LYPA 5DJMA 4ID0A 4ZB9A 5KN2A 2YP6A 2K6VA 3CBUA 1QQ2A 1GNWA 3LFLA 4K7IA 3TUEA 2HNLA 3VK9A 3TRPA 2YPMA 2HSHA 3TKSE 3KJYA 3DD3A 1OC9B 2GDRA 4MZWA 1PMTA 2IMKA 4EE0A 5IMAA 1AQWA 1EOHA 6GSVA 2PWJA 2OA7A 3ZRDA 3A2VA 2PMTA 3UOMA 2YV7A 2YZUA 4GSSA 5HR2A 2F3MA 3S9FA 2X8GA 1Q4JA 4TXOB 2C0GA 1MD3A 4MDCA 4K5RA 1X9WB 1EV9A 2HT9A 3F4SA 1HNBA 1MDJA 4Q5QA 7GSSA 4KNDA 1XVWA 5KN1A 4FH8A 4ZB8A 5ECSA 3WT2A 4YH2A 5CO3A 6GSWA 4O7HA 3KP8A 4TR1B 2GQKA 4AJ7A 4BIKA 1ZYQB 3EMXA 2X4AA 3IR4A 2V2GA 3GYKA 4RUVA 2AHEA 4HS1A 4IQAA 4IBPA 1AXDA 5DCHA 1KNGA 2HI7A 4G2EA 1YJ6A 4N11A 3ZZXA 3GNJA 4XS4B 4ACSA 4O92A 2MMOA 3IE3A 1RQMA 4I8BA 2TRCP 4RI6A 3N9JA 1NW2A 3QFBC 4CY8A 3WGDA 4POKA 5B6MA 3DIEA 1SD9A 2YV9A 3APOA 3TKSC 3ZLPA 1TI3A 2KLXA 3F4RA 1FB0A 2DJ0A 4OFTA 2LQQA 4ZL7A 3HYPA 4QL9A 1X9MB 2QSIA 2IWTA 4TOPA 5G30A 1M2BA 2XBIA 5CYYA 5ABRA 3ZVJA 2GT5A 1K0BA 1HYUA 3IA1A 4HI7A 4YAVA 5ECLB 12GSA 2YJ7A 1NSWA 2AB6A 1R26A 4IS0A 2HZEB 1U87A 4F03A 4IKHA 1GSDA 3LEFA 1GUMA 5EL8A 1BX9A 1GUKA 2GGTA 1FW1A 2R2JA 5J4UA 4BWSA 3I43A 1LJRA 2DJJA 1PGTA 5J41A 1QFNA 3D22A 4JRRA 4TRXA 3KP9A 4X0XA 4XHMA 4OO5A 2C0FA 1ZL9A 2OE0A 4G19A 4GSTA 3TDGA 3UBLA 1AC1A 4KA0A 1T00A 1A2MA 1TP9A 2GQLA 3D5JA 4CY6A 3A5WA 3QMXA 1K3YA 4JU5A 4YQMA 5HFGA 2LNTA 3UIWA 3TJBA 5DVBA 1F9MA 1SYRA 1SL1B 3P2AA 4BVXB 2VD1A 3C1RA 4KDUA 1OC9A 3J7Yb 1BJXA 3ED3A 1J08A 2YOIA 4GCIA 3VWUA 4F82A 5L71A 4L0WA 1SK0A 2HZFA 3TGZA 6GSXA 2GQMA 1OE8A 1UC7A 4MLYA 5KN3A 4TXOA 1E2YA 2X99A 2JACA 3RBTA 3GKKA 1H4OA 2OBKA 4O5RA 1ON4A 2H0IA 4EC0A 3VFIA 3GV1A 3FEUA 2H1GA 1XG8A 1R5AA 4IW9A 2D2ZA 2B7KA 4WBRD 4K6XA 1FOVA 2EIOA 3HXSA 5CRGA 3HHVA 1TXXA 1VF4A 1BQ7A 1DE2A 3LSZA 3UARA 4HQSA 1UA5A 3LXTA 1ERUA 3ZREA 3TOTA 4KUNA 2K9FA 3F4TA 2RLIA 1TRUA 5DBQA 1B8XA 1BG5A 1M9AA 1T8EB 3O3TA 3FY7A 3GURA 3H79A 2GVPA 4ZXGA 4J56E 4DVCA 3EC3A 3FRCA 4P3YB 5C04A 4V1Ag 3TJKA 3L9VA 1T4ZA 3RPPA 2ON7A 2L6DA 5IOXA 3QAGA 4N10A 3TKSA 2DJ3A 1F37A 1X0RA 3O6TA 2LJAA 2FD3A 2H1DA 2QGVA 1FB6A 4YKFA 3MSZA 4E8EA 1BAYA 4IVFA 4N30A 1DE1A 2JSZA 3EWLA 3J7Yk 3CXGA 3KXOA 2TRXA 4MF6A 2HRAA 1EEJA 5LCZA 2I81A 3KIJA 5CRHA 1VF2A 4X1UA 3LW9A 4Q5NA 3IPZA 2JSYA 2VCWA 3DRNA 4I2TA 4JBBA 4N0ZA 4MNNA 2RIIA 2G2QA 4O5QA 5G5EA 4Q5RA 1O85A 5KEJA 4L8EA 2K8SA 3Q6OA 14GSA 3HVSA 2ES7A 4IELA 5DDLA 4AGSA 1EGRA 1GSSA 3TKQA 5FHIA 4H86A 5CRWA 1XFLA 3M9KA 4FYUA 4KE3A 2C8UA 5A4VA 4V2NA 3ZITA 5ECHB 1RW1A 4XIHA 1N2AA 3F63A 5EPFA 3DVXA 3KH9A 1V98A 1GH2A 2IMEA 2X8HA 4PUFC 4QQ7A 3D6IA 1TRVA 5F8BA 1K3OA 10GSA 1FVJA 3GL5A 4V2MA 3A5IA 1YEPA 3EPTA 4K5SA 5JWQB 1FAAA 4MMMA 2WFCA 1SU9A 3HKRA 2HFDA 4ZILA 3Q19A 2LNSA 5JCWA 3EURA 4ML1A 2H6XA 2JU5A 3L78A 2AYTA 3GMFA 4MCUA 1GL8A 3BOAA 3IRAA 5D96A 2DIYA 1R5PA 1TU7A 2I9HA 4FYCA 3JCML 4K0NA 3C8EA 2YANA 3DVWA 1TRSA 3L9UA 4KDYA 3GTUA 1B9XC 3WYWA 2CVBA 2MMZA 4ULXA 1G0TA 1GLPA 3R3EA 2P5RA 4LL4B 3HJPA 4KCAA 2L59A 3QD9A 3CSHA 3GKNA 3FZAA 1FOHA 4DSSA 1V57A 2DKIA 2R0PA 4BA7A 5ENUA 5ECKB 1GTIA 3Q18A 2MMAA 2VL9A 3SWLA 3HY2A 4BWQA 5IPHA 3NIVA 1J9BA 1OAZA 1B4QA 1HD2A 1K0OA 1JZWA 2REMA 5HR0A 2H66A 1QUWA 5DAKA 1PN0A 3ZMLA 4K7NA 1XCCA 1PN9A 2QA2A 3AY8A 1PX7A 4I6XA 4MJAA 1X5CA 3LXZA 2P31A 5AN1A 3LQ7A 2QKEA 4HU7A 2EC4A 4ILFA 2PGTA 1G6YA 2JZRA 2X49A 3ME8A 4WXTA 5ELGA 2F8AA 2B5EA 4N0VA 2E2MA 2KP2A 2LRTA 3VPQA 4IP6A 1XZOA 3HD5A 1V9WA 4PGTA 3EMPA 5H5SA 3FR9A 19GSA 1SENA 5IOWA 2V32A 3CQFA 1U3IA 1EP8A 2VAFA 1YEXA 3RDWA 4ML6A 11GSA 4XS1A 1JFUA 1A0FA 1WJKA 2N5BA 4Z2TA 1TKDB 1Z5YE 4F2IA 2VCTA 1GSUA 2WGRA 3HJMA 2VL2C 4TR3A 4OMVA 1XWGA 1F3BA 4ECJA 1M2DA 2X8CA 1KBNA 5ID2A 5BRTA 3FHKA 2E0QA 5FT3A 1OYJA 1Z9HA 4JR6A 2CVDA 4OO4A 1UVZA 2DMMA 5AIXA 2LV3A 2I3YA 5DALA 3VWXA 5GSTA 4PQHA 4IQ1A 1WPIA 2R0GA 1BYEA 4AJ6A 2L5LA 1K0NA 4L5LA 4I5QA 4USSA 3CTGA 5D9XA 2DBCA 5LD0A 2ZNMA 4HJMA 4K8MA 4ECIA 3D0ZA 1WE0A 4KCEA 1TTZA 2K8VA 4EO3A 3H93A 3FR6A 2RUEA 5B8AA 2OKAA 1A2LA 2H1BA 2R6KA 4F9ZA 4MPFA 2CV4A 3IV4A 1TU8A 1QGVA 2C4JA 3HVVA 1MDKA 3IC4A 4TR4A 1XWBA 3APQA 2DJKA 1YF1A 2CX3A 3D21A 4GQFA 5B8BA 4KSOA 3TRXA 3FZ4A 4IJIA 1ZMAA 1M2AA 1M9BA 1X9SB 1TK8B 2YN1A 3A2WA 4LA1A 3IK9A 1XWKA 4NAXA 3CSJA 2E2GA 2CVKA 3RHCA 2MBTA 5F06A 1EWXA 4I2UA 4GRFA 4WKWA 3G7JA 1F3AA 1USBA 3IHQA 3KM6A 4POLA 1ZYNA 2DLXA 2B5XA 1LBKA 4HJ2A 22GSA 3KD0A 1B48A 2VUPA 3HVNA 2F51A 4LL1B 2JL4A 5IO0A 2XBQA 3E9JB 3RHBA 5D8IA 2H01A 3C71A 3QR6A 4EUYA 1EZKA 1ERTA 4G0LA 2V6OA 5ECNB 2LJRA 1YKAA 2EIQA 2NVLA 2FWHA 3RPNA 1PA3A 4I97A 4MH3A 5ECQB 2RM5A 1V2AA 3L0HA 4WF4A 2WULA 3KGKA 1U3AA 5AGYA 3KTLA 3H8QA 5IIZA 1THOA 2LJKA 3FW2A 2CQ9A 3UEMA 5AIVA 3UBKA 3EU3A 1PRXA 2H76A 2L4QA 1GSEA 4FO5A 3GFKA 3MDKA 4TXVA 2C3NA 5HFKA 2PN8A 1WRYA 1OC8A 4ZB6A 1SD8A 3KZQA 1GTUA 1AW9A 3VPTA 2GSQA 1SJZA 3GH9A 4K9ZA 4BPYA 1Z7PA 2IMDA 2HSMA 1QK8A 2CZ3A 2BMXA 5H5QA 2HSYA 3F6FA 4IJ3A 5IMFA 3GTUB 1XW9A 3P8WA 1GULA 3LYKA 1EGOA 3M1GA 2YWNA 4RI7A 1B9YC 2PVQA 2C1YA 5GAPD 1O81A 2H19A 2VL2A 2WCIA 2QA1A 4DSSB 5D9WA 2BTOT 2M80A 1V40A 1MTCA 3P90A 3IBHA 4J2FA 1Y25A 1Z3EA 3HZ4A 2ZUPA 4ZBDA 5DJLA 2L57A 4EVMA 4CDOA 1ZYEA 2DJ2A 3GUSA 4PUAA 4PURA 5ECRB 2IPAA 4Q5FA 4HDEA 3ZIJA 4RQXA 5HR3A 2CT6A 4ZBBA 4E8HA 4KAEA 4K2DA 4RQRA 3MAKA 4G0IA 1FG4A 1EV4A 1X5DA 3CSIA 3GX8A 2IN3A 4EKZA 4FQUA 5DAKB 4MJCA 4NV5A 1PL1A 1EEMA 2CAQA 1XXUA 2H73A 4HOJA 2B3SA 4BVYA 4F0BA 1S3DA 1THXA 4MF7A 2YWOA 1XBSA 2H75A 4V1Ap 9GSSA 2I1UA 2R3XA 4L5OA 4IGJA 1EOGA 3TCOA 2WB9A 4GSNA 3UJ1A 3M9JA 2R37A 2H71A 3LGCA 4XCSA 1AQXA 2RUFA 4NHZA 4HSCX 4PNFA 1HNCA 4EDZA 4GF0A 1T4YA 3O76A 1PFOA 3KCMA 1IYIA 2J9HA 3F9UA 4HZ2A 3I69A 2XPDA 4WR4A 1ZOFA 4WR5A 3BCIA 2C3TA 3TJFA 1A8YA 2NPBA 2XC2A 1ZYPA 3CRUA 1JZOA 3IC8A 4OCFA 1W4VA 3E3EA 3GN3A 3G9BA 16GSA 3IHGA 5ID2B 3IXRA 3QFAC 2B1LA 5EVOA 1TK0B 3H4KA 5E4WA 2FUG2 3CRTA 3LORA 3GL3A 4GLTA 3GSSA 1PKZA 1SKWB 3GRXA 3UVTA 5GAND 5D93A 1DSBA 5DALB 1SL2B 1YZXA 1FHEA 3DKSA 3IAM2 1A8LA 3IK7A 4LMVA 5J9BA 1VF3A 4HEA2 2H70A 4TR0A 1A24A 1G6WA 1R7HA 1BEDA 3ZL5A 4YQVA 2A2RA 4L0UA 2M46A 5COHA 2LRNA 2PVOC 2HRKA 2YWMA 1SL0B 2B6MA 2L5OA 3D4TA 1JZRA 2FCHA 2F8FA 3PGTA 3D4MA 5F0GA 3VWWA 2WS2A 3GSTA 1GRXA 3EYTA 2PBJA 1NHYA 6GSSA 5A4WA 1ZCPA 2FA4A 5FWGA 1GWCA 2N5AA 1SJIA 1OE7A 2XPEA 3WGXA 4DSRA 3TJGA 1A0RP 5J9CA 2GLRA 2FA8A 2C0DA 4J57E 2HRFA 1DUGA 1O7UA 3TRQA 1ERWA 2H72A 2FLSA 1S3RA 2PU9C 3QAWA 2JZSA 5A4UA 1VF1A 5D9VA 1SK1A 3DYRA 5B6NA 2IL3A 2L6CA 2LKUA 4EXJA 4EDYA 4JR4A 2FGXA 4ICYA 2TIRA 2JZTA 1PSQA 2O7KA 4NV2A 2PUKC 3HA9A 3LJRA 4X43A 1XW6A 4BL7B 5G1KA 5ELAA 4TN8A 1SKRB 1GLQA 2V1MA 2HE3A 1KTEA 2V6KA 1HQOA 5CNWA 1E6BA 4GXZA 3FKFA 5KOXA 1DBYA 3GA4A 2A4VA 2V41A 1GTAA 2YWIA 2VLUA 1ZZYA 3G7YA 2MMNA 4Z2RA 2H1AA 1WP0A 4GQCA 4K1FA 1PL2A 5ECIB 1X5EA 1AQVA 1VGLA 3SBCA 1K0MA 3W6GA 1XOBA 3UL3A 3MYDA 2VLVA 5DQSA 1MDIA 2CA8A 3ZIVA
chains in the Genus database with same CATH topology
2H74A 3APSA 5G1LA 2AJQB 4JE1A 3KMOA 2WJUA 3C73A 3HJOA 3PH9A 4NHWA 2AUVA 4WETA 4CW9A 4DEJA 2IIYA 5IPGA 2R0CA 1O73A 4FYBA 4KGIA 3F8UA 4K2XA 5KN0A 2B5YA 1Z6MA 1H75A 1AAZA 18GSA 1B4PA 3ZYWA 1UN2A 2EIRA 1M7TA 2AAWA 1GSQA 6GSUA 2UZ8A 5J3RA 2VM2A 3PINA 3IDVA 4TKYA 3HCZA 3CMIA 4XRDA 5HQPA 2R5GA 4DSQA 4Z7XA 3VI5A 4PNGA 1Z6NA 4XTSA 4MJBA 3ZFLA 2OE3A 1ERVA 3BJ5A 1A2JA 3EU4A 2GTUA 4MF5A 2WZ9A 2HRNA 3DGQA 2KHPA 3EVIA 13GSA 4NWYA 3GKXA 3U6VA 3ERFA 2VCQA 1GP1A 5DCGA 2GSTA 1TJDA 3GX0A 1T1VA 1FVKA 2GZZA 2JADA 2I4AA 2PPTA 1SKSB 2OJLA 2LEGA 1PQNA 1V58A 2LTKA 3F0IA 1G7OA 1F6MC 1LU4A 4KSMA 3FYGA 1ML6A 1K0DA 4ZIJA 3P7XA 2KOKA 4CHSA 3QOUA 2DSAA 3BD2A 3DEXA 5JWRB 1TK5B 2MZCA 1NHOA 3GKMA 2FWGA 2HLSA 1O6JA 3E0UA 1MD4A 4BVYB 4D73A 4O5UA 2CX4A 3VWVA 1YKCA 3IOSA 2B7JA 1GUHA 3CTFA 3HDCA 2LUSA 1FO5A 2YZHA 4AJ8A 4IN0A 5CREA 3U5RE 5JCUA 2VD0A 2H6YA 4JEDA 1I9DA 1T3BA 2KP1A 1YDKA 3US3A 4LLRA 1G7EA 1O8WA 3ERGA 2BJXA 8GSSA 2IFQA 1TDIA 3DXBA 2IMIA 4MJEA 2ZCTA 2VLTA 2YJHA 4NPBA 3HZ8A 3W8JA 2AV4A 2RM6A 2N5FA 4K7OA 1SJ6A 5IM9A 4BL7A 2H30A 5JWOB 5IMZA 4MK3A 3FMWA 3I6AA 1S3CA 2H6ZA 2LS5A 1CQGA 2A2PA 4OFMA 2GZPA 3VLNA 1WMJA 2DJ1A 3G7IA 4MZCA 4TW5A 1PKWA 1QMVA 1CQHA 2P5QA 1ILOA 2VCZA 5IMCA 3UAPA 1WIKA 1JLWA 2GSRA 3R2QA 4HZ4A 2FWFA 3TJJA 1KEBA 4A5PA 5F07A 1JZDA 4PX1A 3ZVJD 4EIQA 3C1SA 3ZTLA 1AUCA 3BBYA 3VI7A 1EP7A 4OFNA 3EINA 3MIXA 2C80A 5IMDA 4HUAA 4G9HA 1Z7RA 2H0GA 20GSA 4PTSA 5ECMB 4POMA 3ZFBA 4V2LA 1M99A 4Z2UA 2F9SA 2R4VA 4OCEA 2J23A 4LMWA 4MABA 4ECBA 2FHEA 1OC3A 5CP1A 4EF0A 2VIMA 4PXOA 5B7CA 4MZBA 2NTOA 5G2ZA 3IAS2 2H8LA 2PERA 4XRAA 1S3AA 3CYNA 3NOFA 2G0FA 2C3QA 3FK8A 3LG6A 4TR1A 5C00A 2C0EA 5JCGA 3WT1A 5AISA 1PX6A 1QXHA 2ALBA 5KOWA 1JHBA 2Z9SA 4MA9A 3N5OA 4F0CA 4ZL9A 1O8XA 2B1KA 2OBIA 1SYXA 2LSTA 5G5FA 3KH7A 17GSA 3QAVA 1ACVA 2NDOA 3M8NA 1XVQA 4YQUA 4KX4A 3GHAA 1TRWA 4XS6A 2HXKA 4XS4A 3V1WA 4WBJA 3NZNA 2OADA 3LWAA 2P0GA 4ZL8A 2CAIA 2DC5A 2FY6A 3H1NA 5CRDA 2H0HA 4TVEA 5INYA 3GH6A 2VO4A 2DIZA 4IP1A 2M72A 1GSYA 2GZYA 3MNGA 1K0AA 4EIPA 2XHFA 2OACA 3M0FA 1GTBA 3GIXA 3Q74A 1WWJA 1W89A 3F6DA 5EY6A 2KUCA 5F05A 2O85A 3I9V2 4FIWA 1XOAA 5G31A 1OVNA 4PQ1A 2YNXA 1C72A 3RAZA 2X64A 2VOCA 1HNAA 5IQYA 1K0CA 2HZEA 2LRCA 4K0GA 1XPVA 2A4HA 3W8SA 1GNEA 3KEBA 5HFIA 3K8NA 3EE2A 3DMLA 1F2EA 4G0KA 3TB2A 3WGEA 4O32A 2A2SA 4KF9A 3WD6A 1MEKA 5IO2A 1YF0A 2LQOA 5J5NA 1PD21 1TI1A 2GSSA 4NXIA 1Q98A 2O8VB 2DKHA 4ECCA 3UVHA 4G10A 2CZ2A 5CAXA 3KMNA 1RK4A 5GZZB 2VM1A 1XWCA 4KH7A 2YCDA 4KDXA 4X4JA 3VURA 2WRTA 1I5GA 1ZGNA 4WF5A 2ON5A 3KTBA 5ECOB 4JZQA 4GTUA 4WEYA 3OR5A 3L9SA 1OKDA 2IJYA 1YQ1A 4PQIA 3QDNA 3FZ5A 1R4WA 2VCXA 2O87A 3F3QA 1SK2A 3MWHA 5D9TA 2FWEA 3QPMA 4QL7A 4BVXA 1M0UA 1AIUA 1URMA 5HR1A 3PR8A 4OD7A 2VCVA 1T7PB 5IMVA 1N8JA 5DQYA 1VRSD 2HYXA 4KB3A 1U6TA 4KW6A 4MP4A 4YAPA 3DWVA 3HVXA 4ISDA 1NM3A 4D73B 3A2XA 2K18A 2GS3A 2QC7A 2O89A 3PPUA 5A5KA 3UMAA 1TOFA 5LNKe 3ME7A 3TKRA 5D73A 5ECPB 2GT6A 1WOUA 2L4CA 1XW5A 1U88A 2IFQB 4EL1A 1OKTA 4ZBAA 3ZMKA 5GSSA 3L4NA 1XIYA 1K3LA 1ST9A 4AF2A 3M3MA 4MPGA 4OWYA 1IYHA 2E7PA 2MBSA 2NBSA 1XWAA 4MH2A 1YY7A 3FZ9A 6GSTA 2VL3A 3TKPA 1A23A 1JLVA 3QCPA 5E59A 1J0FA 2WDUA 3ISOA 2FNOA 4NMUA 5BMUA 2MYGA 2DMLA 3F3RA 4HQZA 3A3TA 1ABAA 4POBA 4IHUA 4YKGA 1TW9A 3BCKA 4GWRA 1Y6EA 2OE1A 3C7MA 3FR3A 1GSFA 2IMFA 6GSYA 5H5RA 3ERWA 4HU9A 3TOUA 3LYPA 5DJMA 4ID0A 4ZB9A 5KN2A 2YP6A 2K6VA 3CBUA 1QQ2A 1GNWA 3LFLA 4K7IA 3TUEA 2HNLA 3VK9A 3TRPA 2YPMA 2HSHA 3TKSE 3KJYA 3DD3A 1OC9B 2GDRA 4MZWA 1PMTA 2IMKA 4EE0A 5IMAA 1AQWA 1EOHA 6GSVA 2PWJA 2OA7A 3ZRDA 3A2VA 2PMTA 3UOMA 2YV7A 2YZUA 4GSSA 5HR2A 2F3MA 3S9FA 2X8GA 1Q4JA 4TXOB 2C0GA 1MD3A 4MDCA 4K5RA 1X9WB 1EV9A 2HT9A 3F4SA 1HNBA 1MDJA 4Q5QA 7GSSA 4KNDA 1XVWA 5KN1A 4FH8A 4ZB8A 5ECSA 3WT2A 4YH2A 5CO3A 6GSWA 4O7HA 3KP8A 4TR1B 2GQKA 4AJ7A 1ZYQB 3EMXA 2X4AA 3IR4A 2V2GA 3GYKA 4RUVA 2AHEA 4HS1A 4IQAA 4IBPA 1AXDA 5DCHA 1KNGA 2HI7A 4G2EA 1YJ6A 4N11A 3ZZXA 3GNJA 4XS4B 4ACSA 4O92A 2MMOA 3IE3A 1RQMA 4I8BA 2TRCP 4RI6A 3N9JA 1NW2A 3QFBC 4CY8A 3WGDA 4POKA 5B6MA 3DIEA 1SD9A 2YV9A 3APOA 3TKSC 3ZLPA 1TI3A 2KLXA 3F4RA 1FB0A 2DJ0A 4OFTA 2LQQA 4ZL7A 3HYPA 4QL9A 1X9MB 2QSIA 2IWTA 4TOPA 5G30A 5CYYA 1M2BA 2XBIA 5ABRA 3ZVJA 2GT5A 1K0BA 1HYUA 3IA1A 4HI7A 4YAVA 5ECLB 12GSA 2YJ7A 1NSWA 2AB6A 1R26A 4IS0A 2HZEB 1U87A 4F03A 4IKHA 1GSDA 3LEFA 1GUMA 5EL8A 1BX9A 1GUKA 2GGTA 1FW1A 2R2JA 5J4UA 4BWSA 3I43A 1LJRA 2DJJA 1PGTA 5J41A 1QFNA 3D22A 4JRRA 4TRXA 3KP9A 4X0XA 4XHMA 4OO5A 2C0FA 1ZL9A 2OE0A 4G19A 4GSTA 3TDGA 3UBLA 1AC1A 4KA0A 1T00A 1A2MA 1TP9A 2GQLA 3D5JA 4CY6A 3A5WA 4YQMA 3QMXA 1K3YA 4JU5A 5HFGA 2LNTA 3UIWA 3TJBA 5DVBA 1F9MA 1SYRA 1SL1B 3P2AA 4BVXB 2VD1A 3C1RA 4KDUA 1OC9A 3J7Yb 1BJXA 3ED3A 1J08A 2YOIA 4GCIA 3VWUA 4F82A 5L71A 4L0WA 1SK0A 2HZFA 3TGZA 6GSXA 2GQMA 1OE8A 1UC7A 4MLYA 5KN3A 4TXOA 1E2YA 2X99A 2JACA 3RBTA 3GKKA 1H4OA 2OBKA 4O5RA 1ON4A 2H0IA 4EC0A 3VFIA 3GV1A 3FEUA 2H1GA 1R5AA 4IW9A 2D2ZA 2B7KA 4WBRD 4K6XA 1FOVA 2EIOA 3HXSA 5CRGA 3HHVA 1TXXA 1VF4A 1BQ7A 1DE2A 3LSZA 3UARA 4HQSA 1UA5A 3LXTA 1ERUA 3ZREA 3TOTA 4KUNA 2K9FA 3F4TA 2RLIA 1TRUA 5DBQA 1B8XA 1BG5A 1M9AA 1T8EB 3O3TA 3FY7A 3GURA 3H79A 2GVPA 4ZXGA 4J56E 4DVCA 3EC3A 3FRCA 4P3YB 5C04A 4V1Ag 3TJKA 3L9VA 1T4ZA 3RPPA 2ON7A 2L6DA 5IOXA 3QAGA 4N10A 3TKSA 2DJ3A 1F37A 1X0RA 3O6TA 2LJAA 2FD3A 2H1DA 2QGVA 1FB6A 4YKFA 3MSZA 4E8EA 1BAYA 4IVFA 4N30A 1DE1A 2JSZA 3EWLA 3J7Yk 3CXGA 3KXOA 2TRXA 4MF6A 2HRAA 1EEJA 5LCZA 2I81A 3KIJA 5CRHA 1VF2A 4X1UA 3LW9A 4Q5NA 3IPZA 2JSYA 2VCWA 3DRNA 4I2TA 4JBBA 4N0ZA 4MNNA 2RIIA 2G2QA 4O5QA 5G5EA 4Q5RA 1O85A 5KEJA 4L8EA 2K8SA 3Q6OA 14GSA 3HVSA 2ES7A 4IELA 5DDLA 4AGSA 1EGRA 1GSSA 3TKQA 5FHIA 4H86A 5CRWA 1XFLA 3M9KA 4FYUA 4KE3A 2C8UA 5A4VA 4V2NA 3ZITA 5ECHB 1RW1A 4XIHA 1N2AA 3F63A 5EPFA 3DVXA 3KH9A 1V98A 1GH2A 2IMEA 2X8HA 4PUFC 4QQ7A 3D6IA 1TRVA 5F8BA 1K3OA 10GSA 1FVJA 3GL5A 4V2MA 3A5IA 1YEPA 3EPTA 4K5SA 5JWQB 1FAAA 4MMMA 2WFCA 1SU9A 3HKRA 2HFDA 4ZILA 3Q19A 2LNSA 5JCWA 3EURA 4ML1A 2H6XA 2JU5A 3L78A 2AYTA 3GMFA 4MCUA 1GL8A 3BOAA 3IRAA 5D96A 2DIYA 1R5PA 1TU7A 2I9HA 4FYCA 3JCML 4K0NA 3C8EA 2YANA 3DVWA 1TRSA 3L9UA 4KDYA 3GTUA 1B9XC 3WYWA 2CVBA 2MMZA 4ULXA 1G0TA 1GLPA 3R3EA 2P5RA 4LL4B 3HJPA 4KCAA 2L59A 3QD9A 3CSHA 3GKNA 3FZAA 1FOHA 4DSSA 1V57A 2DKIA 2R0PA 4BA7A 5ENUA 5ECKB 1GTIA 3Q18A 2MMAA 2VL9A 3SWLA 3HY2A 4BWQA 5IPHA 3NIVA 1J9BA 1OAZA 1B4QA 1HD2A 1K0OA 1JZWA 2REMA 5HR0A 2H66A 1QUWA 5DAKA 1PN0A 3ZMLA 4K7NA 1XCCA 1PN9A 2QA2A 3AY8A 1PX7A 4I6XA 4MJAA 1X5CA 3LXZA 2P31A 5AN1A 3LQ7A 2QKEA 4HU7A 2EC4A 4ILFA 2PGTA 1G6YA 2JZRA 2X49A 3ME8A 4WXTA 5ELGA 2F8AA 2B5EA 4N0VA 2E2MA 2KP2A 2LRTA 3VPQA 4IP6A 1XZOA 3HD5A 1V9WA 4PGTA 3EMPA 5H5SA 3FR9A 19GSA 1SENA 5IOWA 2V32A 1U3IA 1EP8A 2VAFA 1YEXA 3RDWA 4ML6A 11GSA 4XS1A 1JFUA 1A0FA 1WJKA 2N5BA 4Z2TA 1TKDB 1Z5YE 4F2IA 2VCTA 1GSUA 2WGRA 3HJMA 2VL2C 4TR3A 4OMVA 1XWGA 1F3BA 4ECJA 1M2DA 2X8CA 1KBNA 5ID2A 5BRTA 3FHKA 2E0QA 5FT3A 1OYJA 1Z9HA 4JR6A 2CVDA 4OO4A 1UVZA 2DMMA 5AIXA 2LV3A 2I3YA 5DALA 3VWXA 5GSTA 4PQHA 4IQ1A 1WPIA 2R0GA 1BYEA 4AJ6A 2L5LA 1K0NA 4L5LA 4I5QA 4USSA 3CTGA 5D9XA 2DBCA 5LD0A 2ZNMA 4HJMA 4K8MA 4ECIA 3D0ZA 1WE0A 4KCEA 1TTZA 2K8VA 4EO3A 3H93A 3FR6A 2RUEA 5B8AA 2OKAA 1A2LA 2H1BA 2R6KA 4F9ZA 4MPFA 2CV4A 3IV4A 1TU8A 1QGVA 2C4JA 3HVVA 1MDKA 3IC4A 4TR4A 1XWBA 3APQA 2DJKA 1YF1A 2CX3A 3D21A 4GQFA 5B8BA 4KSOA 3TRXA 3FZ4A 4IJIA 1ZMAA 1M2AA 1M9BA 1X9SB 1TK8B 2YN1A 3A2WA 4LA1A 3IK9A 1XWKA 4NAXA 3CSJA 2E2GA 2CVKA 3RHCA 2MBTA 5F06A 1EWXA 4I2UA 4GRFA 4WKWA 3G7JA 1F3AA 1USBA 3IHQA 3KM6A 4POLA 1ZYNA 2DLXA 2B5XA 1LBKA 4HJ2A 22GSA 3KD0A 1B48A 2VUPA 2F51A 4LL1B 2JL4A 5IO0A 2XBQA 3E9JB 3RHBA 5D8IA 2H01A 3C71A 3QR6A 4EUYA 1EZKA 1ERTA 4G0LA 2V6OA 5ECNB 2LJRA 1YKAA 2EIQA 2NVLA 2FWHA 3RPNA 1PA3A 4I97A 4MH3A 5ECQB 2RM5A 1V2AA 3L0HA 4WF4A 2WULA 3KGKA 1U3AA 5AGYA 3KTLA 3H8QA 5IIZA 1THOA 2LJKA 3FW2A 2CQ9A 3UEMA 5AIVA 3UBKA 3EU3A 1PRXA 2H76A 2L4QA 1GSEA 4FO5A 3GFKA 3MDKA 4TXVA 2C3NA 5HFKA 2PN8A 1WRYA 1OC8A 4ZB6A 1SD8A 3KZQA 1GTUA 1AW9A 3VPTA 2GSQA 1SJZA 3GH9A 4K9ZA 4BPYA 1Z7PA 2IMDA 2HSMA 1QK8A 2CZ3A 2BMXA 5H5QA 2HSYA 3F6FA 4IJ3A 5IMFA 3GTUB 1XW9A 3P8WA 1GULA 3LYKA 1EGOA 3M1GA 2YWNA 4RI7A 1B9YC 2PVQA 2C1YA 5GAPD 1O81A 2H19A 2VL2A 2WCIA 2QA1A 4DSSB 5D9WA 2BTOT 2M80A 1V40A 1MTCA 3P90A 3IBHA 4J2FA 1Y25A 1Z3EA 3HZ4A 2ZUPA 4ZBDA 5DJLA 2L57A 4EVMA 4CDOA 1ZYEA 2DJ2A 3GUSA 4PUAA 4PURA 5ECRB 2IPAA 4Q5FA 4HDEA 3ZIJA 4RQXA 5HR3A 2CT6A 4ZBBA 4E8HA 4KAEA 4K2DA 4RQRA 3MAKA 4G0IA 1FG4A 1EV4A 1X5DA 3CSIA 3GX8A 2IN3A 4EKZA 4FQUA 5DAKB 4MJCA 4NV5A 1PL1A 1EEMA 2CAQA 1XXUA 2H73A 4HOJA 2B3SA 4BVYA 4F0BA 1S3DA 1THXA 4MF7A 2YWOA 1XBSA 2H75A 4V1Ap 9GSSA 2I1UA 2R3XA 4L5OA 4IGJA 1EOGA 3TCOA 2WB9A 4GSNA 3UJ1A 3M9JA 2R37A 2H71A 3LGCA 4XCSA 1AQXA 2RUFA 4NHZA 4PNFA 1HNCA 4EDZA 4GF0A 1T4YA 3O76A 3KCMA 1IYIA 2J9HA 3F9UA 4HZ2A 3I69A 2XPDA 4WR4A 1ZOFA 4WR5A 3BCIA 2C3TA 3TJFA 1A8YA 2NPBA 2XC2A 1ZYPA 3CRUA 1JZOA 3IC8A 4OCFA 1W4VA 3E3EA 3GN3A 3G9BA 16GSA 3IHGA 5ID2B 3IXRA 3QFAC 2B1LA 5EVOA 1TK0B 3H4KA 5E4WA 2FUG2 3CRTA 3LORA 3GL3A 4GLTA 3GSSA 1PKZA 1SKWB 3GRXA 3UVTA 5GAND 5D93A 1DSBA 5DALB 1SL2B 1YZXA 1FHEA 3DKSA 3IAM2 1A8LA 3IK7A 4LMVA 5J9BA 1VF3A 4HEA2 2H70A 4TR0A 1A24A 1G6WA 1R7HA 1BEDA 3ZL5A 4YQVA 2A2RA 4L0UA 2M46A 5COHA 2LRNA 2PVOC 2HRKA 2YWMA 1SL0B 2B6MA 2L5OA 3D4TA 1JZRA 2FCHA 2F8FA 3PGTA 3D4MA 5F0GA 3VWWA 2WS2A 3GSTA 1GRXA 3EYTA 2PBJA 1NHYA 6GSSA 5A4WA 1ZCPA 2FA4A 5FWGA 1GWCA 2N5AA 1SJIA 1OE7A 2XPEA 3WGXA 4DSRA 3TJGA 1A0RP 5J9CA 2GLRA 2FA8A 2C0DA 4J57E 2HRFA 1DUGA 1O7UA 3TRQA 1ERWA 2H72A 2FLSA 2PU9C 3QAWA 2JZSA 5A4UA 1VF1A 5D9VA 1SK1A 3DYRA 5B6NA 2IL3A 2L6CA 2LKUA 4EXJA 4EDYA 4JR4A 2FGXA 4ICYA 2TIRA 2JZTA 1PSQA 2O7KA 4NV2A 2PUKC 3HA9A 3LJRA 4X43A 1XW6A 4BL7B 5G1KA 5ELAA 4TN8A 1SKRB 1GLQA 2V1MA 2HE3A 1KTEA 2V6KA 1HQOA 5CNWA 1E6BA 4GXZA 3FKFA 5KOXA 1DBYA 3GA4A 2A4VA 2V41A 1GTAA 2YWIA 2VLUA 1ZZYA 3G7YA 2MMNA 4Z2RA 2H1AA 1WP0A 4GQCA 4K1FA 1PL2A 5ECIB 1X5EA 1AQVA 1VGLA 3SBCA 1K0MA 3W6GA 1XOBA 3UL3A 3MYDA 2VLVA 5DQSA 1MDIA 2CA8A 3ZIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H74 A;  3APS A;  5G1L A;  2AJQ B;  4JE1 A;  3KMO A;  2WJU A;  3C73 A;  3HJO A;  3PH9 A;  4NHW A;  2AUV A;  4WET A;  4CW9 A;  4DEJ A;  2IIY A;  5IPG A;  1O73 A;  4FYB A;  4KGI A;  3F8U A;  5KN0 A;  2B5Y A;  1Z6M A;  1H75 A;  1AAZ A;  18GS A;  1B4P A;  3ZYW A;  1UN2 A;  2EIR A;  1M7T A;  2AAW A;  1GSQ A;  6GSU A;  5J3R A;  2VM2 A;  3PIN A;  3IDV A;  4TKY A;  3HCZ A;  3CMI A;  4XRD A;  5HQP A;  2R5G A;  4DSQ A;  4Z7X A;  3VI5 A;  4PNG A;  1Z6N A;  4XTS A;  4MJB A;  3ZFL A;  2OE3 A;  1ERV A;  3BJ5 A;  1A2J A;  3EU4 A;  2GTU A;  4MF5 A;  2WZ9 A;  2HRN A;  3DGQ A;  2KHP A;  3EVI A;  13GS A;  4NWY A;  3GKX A;  3U6V A;  3ERF A;  2VCQ A;  1GP1 A;  5DCG A;  2GST A;  1TJD A;  3GX0 A;  1T1V A;  1FVK A;  2GZZ A;  2JAD A;  2I4A A;  2PPT A;  1SKS B;  2OJL A;  2LEG A;  1PQN A;  1V58 A;  2LTK A;  3F0I A;  1G7O A;  1F6M C;  1LU4 A;  4KSM A;  3FYG A;  1ML6 A;  1K0D A;  4ZIJ A;  3P7X A;  2KOK A;  4CHS A;  3QOU A;  2DSA A;  3BD2 A;  3DEX A;  5JWR B;  1TK5 B;  2MZC A;  1NHO A;  3GKM A;  2FWG A;  2HLS A;  1O6J A;  3E0U A;  1MD4 A;  4D73 A;  2CX4 A;  3VWV A;  1YKC A;  3IOS A;  2B7J A;  1GUH A;  3CTF A;  3HDC A;  2LUS A;  1FO5 A;  2YZH A;  4AJ8 A;  4IN0 A;  5CRE A;  3U5R E;  5JCU A;  2VD0 A;  2H6Y A;  4JED A;  1I9D A;  1T3B A;  2KP1 A;  1YDK A;  3US3 A;  4LLR A;  1G7E A;  1O8W A;  3ERG A;  2BJX A;  8GSS A;  2IFQ A;  1TDI A;  3DXB A;  2IMI A;  4MJE A;  2ZCT A;  2VLT A;  2YJH A;  4NPB A;  3HZ8 A;  3W8J A;  2AV4 A;  2RM6 A;  2N5F A;  4K7O A;  1SJ6 A;  5IM9 A;  4BL7 A;  2H30 A;  5JWO B;  5IMZ A;  4MK3 A;  3I6A A;  1S3C A;  2H6Z A;  2LS5 A;  1CQG A;  4OFM A;  2GZP A;  3VLN A;  1WMJ A;  2DJ1 A;  3G7I A;  4MZC A;  4TW5 A;  1PKW A;  1QMV A;  1CQH A;  2P5Q A;  1ILO A;  2VCZ A;  5IMC A;  3UAP A;  1WIK A;  1JLW A;  2GSR A;  3R2Q A;  4HZ4 A;  2FWF A;  3TJJ A;  1KEB A;  5F07 A;  1JZD A;  4PX1 A;  3ZVJ D;  3C1S A;  3ZTL A;  1AUC A;  3BBY A;  3VI7 A;  1EP7 A;  4OFN A;  3EIN A;  2C80 A;  5IMD A;  4HUA A;  4G9H A;  1Z7R A;  2H0G A;  20GS A;  5ECM B;  4POM A;  3ZFB A;  4V2L A;  1M99 A;  2F9S A;  2R4V A;  4OCE A;  2J23 A;  4LMW A;  4MAB A;  4ECB A;  2FHE A;  1OC3 A;  5CP1 A;  4EF0 A;  2VIM A;  4PXO A;  5B7C A;  4MZB A;  2NTO A;  5G2Z A;  3IAS 2;  2H8L A;  2PER A;  4XRA A;  1S3A A;  3CYN A;  3NOF A;  2G0F A;  2C3Q A;  3FK8 A;  3LG6 A;  4TR1 A;  5C00 A;  2C0E A;  5JCG A;  3WT1 A;  5AIS A;  1PX6 A;  1QXH A;  2ALB A;  1JHB A;  2Z9S A;  4MA9 A;  3N5O A;  4F0C A;  4ZL9 A;  1O8X A;  2B1K A;  2OBI A;  1SYX A;  2LST A;  5G5F A;  3KH7 A;  17GS A;  3QAV A;  1ACV A;  2NDO A;  3M8N A;  1XVQ A;  4YQU A;  4KX4 A;  3GHA A;  1TRW A;  4XS6 A;  2HXK A;  4XS4 A;  3V1W A;  4WBJ A;  3NZN A;  2OAD A;  3LWA A;  2P0G A;  4ZL8 A;  2CAI A;  2DC5 A;  2FY6 A;  3H1N A;  5CRD A;  2H0H A;  4TVE A;  5INY A;  3GH6 A;  2VO4 A;  2DIZ A;  4IP1 A;  2M72 A;  1GSY A;  2GZY A;  3MNG A;  1K0A A;  2XHF A;  2OAC A;  3M0F A;  1GTB A;  3GIX A;  3Q74 A;  1WWJ A;  1W89 A;  3F6D A;  5EY6 A;  2KUC A;  5F05 A;  2O85 A;  3I9V 2;  4FIW A;  1XOA A;  5G31 A;  1OVN A;  4PQ1 A;  2YNX A;  1C72 A;  3RAZ A;  2X64 A;  2VOC A;  1HNA A;  5IQY A;  1K0C A;  2HZE A;  2LRC A;  4K0G A;  1XPV A;  3W8S A;  1GNE A;  3KEB A;  5HFI A;  3K8N A;  3EE2 A;  3DML A;  1F2E A;  3TB2 A;  3WGE A;  4O32 A;  2A2S A;  3WD6 A;  1MEK A;  5IO2 A;  1YF0 A;  2LQO A;  5J5N A;  1PD2 1;  1TI1 A;  2GSS A;  4NXI A;  1Q98 A;  2O8V B;  4ECC A;  3UVH A;  4G10 A;  2CZ2 A;  5CAX A;  3KMN A;  1RK4 A;  5GZZ B;  2VM1 A;  1XWC A;  4KH7 A;  2YCD A;  4KDX A;  3VUR A;  2WRT A;  1I5G A;  1ZGN A;  4WF5 A;  2ON5 A;  3KTB A;  5ECO B;  4JZQ A;  4GTU A;  4WEY A;  3OR5 A;  3L9S A;  1OKD A;  2IJY A;  1YQ1 A;  4PQI A;  3QDN A;  3FZ5 A;  1R4W A;  2VCX A;  2O87 A;  3F3Q A;  1SK2 A;  3MWH A;  5D9T A;  2FWE A;  3QPM A;  4QL7 A;  4BVX A;  1M0U A;  1AIU A;  1URM A;  5HR1 A;  3PR8 A;  4OD7 A;  2VCV A;  1T7P B;  5IMV A;  1N8J A;  5DQY A;  1VRS D;  2HYX A;  4KB3 A;  1U6T A;  4KW6 A;  4MP4 A;  4YAP A;  3DWV A;  3HVX A;  4ISD A;  1NM3 A;  4D73 B;  3A2X A;  2K18 A;  2GS3 A;  2QC7 A;  2O89 A;  5A5K A;  3UMA A;  1TOF A;  5LNK e;  3ME7 A;  3TKR A;  5D73 A;  5ECP B;  2GT6 A;  1WOU A;  2L4C A;  1XW5 A;  1U88 A;  2IFQ B;  4EL1 A;  1OKT A;  4ZBA A;  3ZMK A;  5GSS A;  3L4N A;  1XIY A;  1K3L A;  1ST9 A;  4AF2 A;  3M3M A;  4MPG A;  4OWY A;  1IYH A;  2E7P A;  2MBS A;  2NBS A;  1XWA A;  4MH2 A;  1YY7 A;  3FZ9 A;  6GST A;  2VL3 A;  3TKP A;  1A23 A;  1JLV A;  3QCP A;  5E59 A;  1J0F A;  2WDU A;  3ISO A;  2FNO A;  4NMU A;  2MYG A;  2DML A;  3F3R A;  4HQZ A;  3A3T A;  1ABA A;  4POB A;  4IHU A;  1TW9 A;  3BCK A;  4GWR A;  1Y6E A;  2OE1 A;  3C7M A;  3FR3 A;  1GSF A;  2IMF A;  6GSY A;  5H5R A;  3ERW A;  4HU9 A;  3TOU A;  3LYP A;  5DJM A;  4ID0 A;  4ZB9 A;  5KN2 A;  2YP6 A;  2K6V A;  3CBU A;  1QQ2 A;  1GNW A;  3LFL A;  4K7I A;  3TUE A;  2HNL A;  3VK9 A;  3TRP A;  2YPM A;  2HSH A;  3TKS E;  3KJY A;  3DD3 A;  1OC9 B;  2GDR A;  4MZW A;  1PMT A;  2IMK A;  4EE0 A;  5IMA A;  1AQW A;  1EOH A;  6GSV A;  2PWJ A;  2OA7 A;  3ZRD A;  3A2V A;  2PMT A;  3UOM A;  2YV7 A;  2YZU A;  4GSS A;  5HR2 A;  2F3M A;  3S9F A;  2X8G A;  1Q4J A;  4TXO B;  2C0G A;  1MD3 A;  4MDC A;  1X9W B;  1EV9 A;  2HT9 A;  3F4S A;  1HNB A;  1MDJ A;  4Q5Q A;  7GSS A;  4KND A;  1XVW A;  5KN1 A;  4FH8 A;  4ZB8 A;  5ECS A;  3WT2 A;  4YH2 A;  5CO3 A;  6GSW A;  4O7H A;  3KP8 A;  4TR1 B;  2GQK A;  4AJ7 A;  1ZYQ B;  3EMX A;  3IR4 A;  2V2G A;  3GYK A;  4RUV A;  2AHE A;  4HS1 A;  4IQA A;  4IBP A;  1AXD A;  5DCH A;  1KNG A;  2HI7 A;  4G2E A;  1YJ6 A;  4N11 A;  3ZZX A;  3GNJ A;  4XS4 B;  4ACS A;  4O92 A;  2MMO A;  3IE3 A;  1RQM A;  4I8B A;  2TRC P;  4RI6 A;  3N9J A;  1NW2 A;  3QFB C;  3WGD A;  4POK A;  5B6M A;  3DIE A;  1SD9 A;  2YV9 A;  3APO A;  3TKS C;  3ZLP A;  1TI3 A;  2KLX A;  3F4R A;  1FB0 A;  2DJ0 A;  4OFT A;  2LQQ A;  4ZL7 A;  3HYP A;  4QL9 A;  1X9M B;  2QSI A;  2IWT A;  4TOP A;  5G30 A;  5CYY A;  1M2B A;  2XBI A;  5ABR A;  3ZVJ A;  2GT5 A;  1K0B A;  1HYU A;  3IA1 A;  4HI7 A;  4YAV A;  5ECL B;  12GS A;  2YJ7 A;  1NSW A;  2AB6 A;  1R26 A;  4IS0 A;  2HZE B;  1U87 A;  4F03 A;  4IKH A;  1GSD A;  3LEF A;  1GUM A;  5EL8 A;  1BX9 A;  1GUK A;  2GGT A;  1FW1 A;  2R2J A;  5J4U A;  4BWS A;  3I43 A;  1LJR A;  2DJJ A;  1PGT A;  5J41 A;  1QFN A;  3D22 A;  4JRR A;  4TRX A;  3KP9 A;  4X0X A;  4XHM A;  4OO5 A;  2C0F A;  1ZL9 A;  2OE0 A;  4G19 A;  4GST A;  3TDG A;  3UBL A;  1AC1 A;  4KA0 A;  1T00 A;  1A2M A;  1TP9 A;  2GQL A;  3D5J A;  3A5W A;  4YQM A;  3QMX A;  1K3Y A;  4JU5 A;  5HFG A;  2LNT A;  3UIW A;  3TJB A;  5DVB A;  1F9M A;  1SYR A;  1SL1 B;  3P2A A;  2VD1 A;  3C1R A;  4KDU A;  1OC9 A;  3J7Y b;  1BJX A;  3ED3 A;  1J08 A;  2YOI A;  4GCI A;  3VWU A;  4F82 A;  5L71 A;  4L0W A;  1SK0 A;  2HZF A;  3TGZ A;  6GSX A;  2GQM A;  1OE8 A;  1UC7 A;  4MLY A;  5KN3 A;  4TXO A;  1E2Y A;  2X99 A;  2JAC A;  3RBT A;  3GKK A;  1H4O A;  2OBK A;  4O5R A;  1ON4 A;  2H0I A;  4EC0 A;  3VFI A;  3GV1 A;  3FEU A;  2H1G A;  1R5A A;  4IW9 A;  2D2Z A;  2B7K A;  4WBR D;  4K6X A;  1FOV A;  2EIO A;  3HXS A;  5CRG A;  3HHV A;  1TXX A;  1VF4 A;  1BQ7 A;  1DE2 A;  3LSZ A;  3UAR A;  4HQS A;  1UA5 A;  3LXT A;  1ERU A;  3ZRE A;  3TOT A;  4KUN A;  2K9F A;  3F4T A;  2RLI A;  1TRU A;  5DBQ A;  1B8X A;  1BG5 A;  1M9A A;  1T8E B;  3O3T A;  3FY7 A;  3GUR A;  3H79 A;  2GVP A;  4ZXG A;  4J56 E;  4DVC A;  3EC3 A;  3FRC A;  4P3Y B;  5C04 A;  4V1A g;  3TJK A;  3L9V A;  1T4Z A;  3RPP A;  2ON7 A;  2L6D A;  5IOX A;  3QAG A;  4N10 A;  3TKS A;  2DJ3 A;  1F37 A;  1X0R A;  3O6T A;  2LJA A;  2FD3 A;  2H1D A;  2QGV A;  1FB6 A;  3MSZ A;  4E8E A;  1BAY A;  4IVF A;  4N30 A;  1DE1 A;  2JSZ A;  3EWL A;  3J7Y k;  3CXG A;  3KXO A;  2TRX A;  4MF6 A;  1EEJ A;  5LCZ A;  2I81 A;  3KIJ A;  5CRH A;  1VF2 A;  4X1U A;  4Q5N A;  3IPZ A;  2JSY A;  2VCW A;  3DRN A;  4I2T A;  4JBB A;  4N0Z A;  2RII A;  2G2Q A;  5G5E A;  4Q5R A;  1O85 A;  5KEJ A;  4L8E A;  2K8S A;  3Q6O A;  14GS A;  3HVS A;  2ES7 A;  4IEL A;  5DDL A;  4AGS A;  1EGR A;  1GSS A;  3TKQ A;  5FHI A;  4H86 A;  5CRW A;  1XFL A;  3M9K A;  4FYU A;  4KE3 A;  2C8U A;  5A4V A;  4V2N A;  3ZIT A;  5ECH B;  1RW1 A;  4XIH A;  1N2A A;  3F63 A;  5EPF A;  3DVX A;  3KH9 A;  1V98 A;  1GH2 A;  2IME A;  2X8H A;  4PUF C;  4QQ7 A;  3D6I A;  1TRV A;  5F8B A;  1K3O A;  10GS A;  1FVJ A;  3GL5 A;  4V2M A;  1YEP A;  5JWQ B;  1FAA A;  4MMM A;  2WFC A;  1SU9 A;  3HKR A;  2HFD A;  4ZIL A;  3Q19 A;  2LNS A;  5JCW A;  3EUR A;  4ML1 A;  2H6X A;  2JU5 A;  3L78 A;  2AYT A;  3GMF A;  4MCU A;  1GL8 A;  3BOA A;  3IRA A;  5D96 A;  2DIY A;  1R5P A;  1TU7 A;  2I9H A;  4FYC A;  3JCM L;  4K0N A;  3C8E A;  2YAN A;  3DVW A;  1TRS A;  3L9U A;  4KDY A;  3GTU A;  1B9X C;  3WYW A;  2CVB A;  2MMZ A;  4ULX A;  1G0T A;  1GLP A;  2P5R A;  4LL4 B;  3HJP A;  4KCA A;  2L59 A;  3QD9 A;  3CSH A;  3GKN A;  3FZA A;  4DSS A;  1V57 A;  4BA7 A;  5ENU A;  5ECK B;  1GTI A;  3Q18 A;  2MMA A;  2VL9 A;  3SWL A;  3HY2 A;  4BWQ A;  5IPH A;  3NIV A;  1J9B A;  1OAZ A;  1B4Q A;  1HD2 A;  1K0O A;  1JZW A;  2REM A;  5HR0 A;  2H66 A;  1QUW A;  5DAK A;  3ZML A;  4K7N A;  1XCC A;  1PN9 A;  3AY8 A;  1PX7 A;  4I6X A;  4MJA A;  1X5C A;  3LXZ A;  2P31 A;  5AN1 A;  3LQ7 A;  2QKE A;  4HU7 A;  2EC4 A;  4ILF A;  2PGT A;  1G6Y A;  2JZR A;  3ME8 A;  4WXT A;  5ELG A;  2F8A A;  2B5E A;  4N0V A;  2E2M A;  2KP2 A;  2LRT A;  3VPQ A;  4IP6 A;  1XZO A;  3HD5 A;  1V9W A;  4PGT A;  3EMP A;  5H5S A;  3FR9 A;  19GS A;  1SEN A;  5IOW A;  2V32 A;  1U3I A;  1EP8 A;  2VAF A;  1YEX A;  3RDW A;  4ML6 A;  11GS A;  4XS1 A;  1JFU A;  1A0F A;  1WJK A;  2N5B A;  1TKD B;  1Z5Y E;  4F2I A;  2VCT A;  1GSU A;  2WGR A;  3HJM A;  2VL2 C;  4TR3 A;  4OMV A;  1XWG A;  1F3B A;  4ECJ A;  1M2D A;  2X8C A;  1KBN A;  5ID2 A;  3FHK A;  2E0Q A;  5FT3 A;  1OYJ A;  1Z9H A;  4JR6 A;  2CVD A;  4OO4 A;  1UVZ A;  2DMM A;  5AIX A;  2LV3 A;  2I3Y A;  5DAL A;  3VWX A;  5GST A;  4PQH A;  4IQ1 A;  1WPI A;  1BYE A;  4AJ6 A;  2L5L A;  1K0N A;  4L5L A;  4I5Q A;  3CTG A;  5D9X A;  2DBC A;  5LD0 A;  2ZNM A;  4HJM A;  4K8M A;  4ECI A;  3D0Z A;  1WE0 A;  4KCE A;  1TTZ A;  2K8V A;  4EO3 A;  3H93 A;  3FR6 A;  2RUE A;  5B8A A;  2OKA A;  1A2L A;  2H1B A;  2R6K A;  4F9Z A;  4MPF A;  2CV4 A;  3IV4 A;  1TU8 A;  1QGV A;  2C4J A;  3HVV A;  1MDK A;  3IC4 A;  4TR4 A;  1XWB A;  3APQ A;  2DJK A;  1YF1 A;  2CX3 A;  3D21 A;  4GQF A;  5B8B A;  4KSO A;  3TRX A;  3FZ4 A;  4IJI A;  1ZMA A;  1M2A A;  1M9B A;  1X9S B;  1TK8 B;  2YN1 A;  3A2W A;  4LA1 A;  3IK9 A;  1XWK A;  4NAX A;  3CSJ A;  2E2G A;  2CVK A;  3RHC A;  2MBT A;  5F06 A;  1EWX A;  4I2U A;  4GRF A;  4WKW A;  3G7J A;  1F3A A;  1USB A;  3IHQ A;  3KM6 A;  4POL A;  2DLX A;  2B5X A;  1LBK A;  4HJ2 A;  22GS A;  3KD0 A;  1B48 A;  2VUP A;  2F51 A;  4LL1 B;  2JL4 A;  5IO0 A;  2XBQ A;  3E9J B;  3RHB A;  5D8I A;  2H01 A;  3C71 A;  3QR6 A;  4EUY A;  1EZK A;  1ERT A;  2V6O A;  5ECN B;  2LJR A;  1YKA A;  2EIQ A;  2NVL A;  2FWH A;  3RPN A;  1PA3 A;  4I97 A;  4MH3 A;  5ECQ B;  2RM5 A;  1V2A A;  3L0H A;  4WF4 A;  2WUL A;  3KGK A;  1U3A A;  5AGY A;  3KTL A;  3H8Q A;  5IIZ A;  1THO A;  2LJK A;  3FW2 A;  2CQ9 A;  3UEM A;  5AIV A;  3UBK A;  3EU3 A;  1PRX A;  2H76 A;  2L4Q A;  1GSE A;  4FO5 A;  3GFK A;  3MDK A;  4TXV A;  2C3N A;  5HFK A;  2PN8 A;  1WRY A;  1OC8 A;  4ZB6 A;  1SD8 A;  3KZQ A;  1GTU A;  1AW9 A;  3VPT A;  2GSQ A;  1SJZ A;  3GH9 A;  4K9Z A;  4BPY A;  1Z7P A;  2IMD A;  1QK8 A;  2CZ3 A;  2BMX A;  5H5Q A;  2HSY A;  3F6F A;  4IJ3 A;  5IMF A;  3GTU B;  1XW9 A;  3P8W A;  1GUL A;  3LYK A;  1EGO A;  3M1G A;  2YWN A;  4RI7 A;  1B9Y C;  2PVQ A;  2C1Y A;  5GAP D;  1O81 A;  2H19 A;  2VL2 A;  2WCI A;  4DSS B;  5D9W A;  2BTO T;  2M80 A;  1V40 A;  1MTC A;  3P90 A;  3IBH A;  4J2F A;  1Y25 A;  1Z3E A;  3HZ4 A;  2ZUP A;  4ZBD A;  5DJL A;  2L57 A;  4EVM A;  4CDO A;  1ZYE A;  2DJ2 A;  3GUS A;  4PUA A;  4PUR A;  5ECR B;  2IPA A;  4Q5F A;  4HDE A;  3ZIJ A;  4RQX A;  5HR3 A;  2CT6 A;  4ZBB A;  4E8H A;  4KAE A;  4K2D A;  4RQR A;  3MAK A;  1FG4 A;  1EV4 A;  1X5D A;  3CSI A;  3GX8 A;  2IN3 A;  4EKZ A;  5DAK B;  4MJC A;  4NV5 A;  1PL1 A;  1EEM A;  2CAQ A;  1XXU A;  2H73 A;  4HOJ A;  2B3S A;  4BVY A;  4F0B A;  1S3D A;  1THX A;  4MF7 A;  2YWO A;  1XBS A;  2H75 A;  4V1A p;  9GSS A;  2I1U A;  2R3X A;  4L5O A;  4IGJ A;  1EOG A;  3TCO A;  2WB9 A;  4GSN A;  3UJ1 A;  3M9J A;  2R37 A;  2H71 A;  3LGC A;  4XCS A;  1AQX A;  2RUF A;  4NHZ A;  4PNF A;  1HNC A;  4EDZ A;  4GF0 A;  1T4Y A;  3O76 A;  3KCM A;  1IYI A;  2J9H A;  3F9U A;  4HZ2 A;  3I69 A;  2XPD A;  4WR4 A;  1ZOF A;  4WR5 A;  3BCI A;  2C3T A;  3TJF A;  1A8Y A;  2NPB A;  2XC2 A;  3CRU A;  1JZO A;  4OCF A;  1W4V A;  3E3E A;  3GN3 A;  3G9B A;  16GS A;  5ID2 B;  3IXR A;  3QFA C;  2B1L A;  5EVO A;  1TK0 B;  3H4K A;  5E4W A;  2FUG 2;  3CRT A;  3LOR A;  3GL3 A;  4GLT A;  3GSS A;  1PKZ A;  1SKW B;  3GRX A;  3UVT A;  5GAN D;  5D93 A;  1DSB A;  5DAL B;  1SL2 B;  1YZX A;  1FHE A;  3DKS A;  3IAM 2;  1A8L A;  3IK7 A;  4LMV A;  5J9B A;  1VF3 A;  4HEA 2;  2H70 A;  4TR0 A;  1A24 A;  1G6W A;  1R7H A;  1BED A;  3ZL5 A;  4YQV A;  2A2R A;  4L0U A;  2M46 A;  5COH A;  2LRN A;  2PVO C;  2YWM A;  1SL0 B;  2B6M A;  2L5O A;  3D4T A;  1JZR A;  2FCH A;  2F8F A;  3PGT A;  3D4M A;  5F0G A;  3VWW A;  2WS2 A;  3GST A;  1GRX A;  3EYT A;  2PBJ A;  1NHY A;  6GSS A;  5A4W A;  1ZCP A;  2FA4 A;  5FWG A;  1GWC A;  2N5A A;  1SJI A;  1OE7 A;  2XPE A;  3WGX A;  4DSR A;  3TJG A;  1A0R P;  5J9C A;  2GLR A;  2FA8 A;  2C0D A;  4J57 E;  2HRF A;  1DUG A;  1O7U A;  3TRQ A;  1ERW A;  2H72 A;  2FLS A;  2PU9 C;  3QAW A;  2JZS A;  5A4U A;  1VF1 A;  5D9V A;  1SK1 A;  3DYR A;  5B6N A;  2IL3 A;  2L6C A;  2LKU A;  4EXJ A;  4EDY A;  4JR4 A;  2FGX A;  2TIR A;  2JZT A;  1PSQ A;  2O7K A;  4NV2 A;  2PUK C;  3HA9 A;  3LJR A;  4X43 A;  1XW6 A;  5G1K A;  5ELA A;  4TN8 A;  1SKR B;  1GLQ A;  2V1M A;  2HE3 A;  1KTE A;  2V6K A;  1HQO A;  5CNW A;  1E6B A;  4GXZ A;  3FKF A;  1DBY A;  3GA4 A;  2A4V A;  2V41 A;  1GTA A;  2YWI A;  2VLU A;  1ZZY A;  3G7Y A;  2MMN A;  2H1A A;  1WP0 A;  4GQC A;  4K1F A;  1PL2 A;  5ECI B;  1X5E A;  1AQV A;  1VGL A;  3SBC A;  1K0M A;  3W6G A;  1XOB A;  3UL3 A;  5DQS A;  2VLV A;  1MDI A;  2CA8 A;  3ZIV A; 
#chains in the Genus database with same CATH topology
 2H74 A;  3APS A;  5G1L A;  2AJQ B;  4JE1 A;  3KMO A;  2WJU A;  3C73 A;  3HJO A;  3PH9 A;  4NHW A;  2AUV A;  4WET A;  4CW9 A;  4DEJ A;  2IIY A;  5IPG A;  2R0C A;  1O73 A;  4FYB A;  4KGI A;  3F8U A;  4K2X A;  5KN0 A;  2B5Y A;  1Z6M A;  1H75 A;  1AAZ A;  18GS A;  1B4P A;  3ZYW A;  1UN2 A;  2EIR A;  1M7T A;  2AAW A;  1GSQ A;  6GSU A;  2UZ8 A;  5J3R A;  2VM2 A;  3PIN A;  3IDV A;  4TKY A;  3HCZ A;  3CMI A;  4XRD A;  5HQP A;  2R5G A;  4DSQ A;  4Z7X A;  3VI5 A;  4PNG A;  1Z6N A;  4XTS A;  4MJB A;  3ZFL A;  2OE3 A;  1ERV A;  3BJ5 A;  1A2J A;  3EU4 A;  2GTU A;  4MF5 A;  2WZ9 A;  2HRN A;  3DGQ A;  2KHP A;  3EVI A;  13GS A;  4NWY A;  3GKX A;  3U6V A;  3ERF A;  2VCQ A;  1GP1 A;  5DCG A;  2GST A;  1TJD A;  3GX0 A;  1T1V A;  1FVK A;  2GZZ A;  2JAD A;  2I4A A;  2PPT A;  1SKS B;  2OJL A;  2LEG A;  1PQN A;  1V58 A;  2LTK A;  3F0I A;  1G7O A;  1F6M C;  1LU4 A;  4KSM A;  3FYG A;  1ML6 A;  1K0D A;  4ZIJ A;  3P7X A;  2KOK A;  4CHS A;  3QOU A;  2DSA A;  3BD2 A;  3DEX A;  5JWR B;  1TK5 B;  2MZC A;  1NHO A;  3GKM A;  2FWG A;  2HLS A;  1O6J A;  3E0U A;  1MD4 A;  4BVY B;  4D73 A;  4O5U A;  2CX4 A;  3VWV A;  1YKC A;  3IOS A;  2B7J A;  1GUH A;  3CTF A;  3HDC A;  2LUS A;  1FO5 A;  2YZH A;  4AJ8 A;  4IN0 A;  5CRE A;  3U5R E;  5JCU A;  2VD0 A;  2H6Y A;  4JED A;  1I9D A;  1T3B A;  2KP1 A;  1YDK A;  3US3 A;  4LLR A;  1G7E A;  1O8W A;  3ERG A;  2BJX A;  8GSS A;  2IFQ A;  1TDI A;  3DXB A;  2IMI A;  1M3J A;  4MJE A;  2ZCT A;  2VLT A;  2YJH A;  4NPB A;  3HZ8 A;  3W8J A;  2AV4 A;  2RM6 A;  2N5F A;  4K7O A;  1SJ6 A;  5IM9 A;  4BL7 A;  2H30 A;  5JWO B;  5IMZ A;  4MK3 A;  3FMW A;  3I6A A;  1S3C A;  2H6Z A;  2LS5 A;  1CQG A;  2A2P A;  4OFM A;  2GZP A;  3VLN A;  1WMJ A;  2DJ1 A;  3G7I A;  4MZC A;  4TW5 A;  1PKW A;  1QMV A;  1CQH A;  2P5Q A;  1ILO A;  2VCZ A;  5IMC A;  3UAP A;  1WIK A;  1JLW A;  2GSR A;  3R2Q A;  4HZ4 A;  2FWF A;  3TJJ A;  1KEB A;  4A5P A;  5F07 A;  1JZD A;  4PX1 A;  3ZVJ D;  4EIQ A;  3C1S A;  3ZTL A;  1AUC A;  3BBY A;  3VI7 A;  1EP7 A;  4OFN A;  3EIN A;  3MIX A;  2C80 A;  5IMD A;  4HUA A;  4G9H A;  1Z7R A;  2H0G A;  20GS A;  4PTS A;  5ECM B;  4POM A;  3ZFB A;  4V2L A;  1M99 A;  4Z2U A;  2F9S A;  2R4V A;  4OCE A;  2J23 A;  4LMW A;  4MAB A;  4ECB A;  2FHE A;  1OC3 A;  5CP1 A;  4EF0 A;  2VIM A;  4PXO A;  5B7C A;  4MZB A;  2NTO A;  5G2Z A;  3IAS 2;  2H8L A;  2PER A;  4XRA A;  1S3A A;  3CYN A;  3NOF A;  2G0F A;  2C3Q A;  3FK8 A;  3LG6 A;  4TR1 A;  5C00 A;  2C0E A;  5JCG A;  3WT1 A;  5AIS A;  1PX6 A;  1QXH A;  2ALB A;  5KOW A;  1JHB A;  2Z9S A;  4MA9 A;  3N5O A;  4F0C A;  4ZL9 A;  1O8X A;  2B1K A;  2OBI A;  1SYX A;  2LST A;  5G5F A;  3KH7 A;  17GS A;  3QAV A;  1ACV A;  2NDO A;  3M8N A;  1XVQ A;  4YQU A;  4KX4 A;  3GHA A;  1TRW A;  4XS6 A;  2HXK A;  4XS4 A;  3V1W A;  4WBJ A;  3NZN A;  2OAD A;  3LWA A;  2P0G A;  4ZL8 A;  2CAI A;  2DC5 A;  2FY6 A;  3H1N A;  5CRD A;  2H0H A;  4TVE A;  5INY A;  3GH6 A;  2VO4 A;  2DIZ A;  4IP1 A;  2M72 A;  1GSY A;  2GZY A;  3MNG A;  1K0A A;  4EIP A;  2XHF A;  2OAC A;  3M0F A;  1GTB A;  3GIX A;  3Q74 A;  1WWJ A;  1W89 A;  3F6D A;  5EY6 A;  2KUC A;  5F05 A;  2O85 A;  3I9V 2;  4FIW A;  1XOA A;  5G31 A;  1OVN A;  4PQ1 A;  2YNX A;  1C72 A;  3RAZ A;  2X64 A;  2VOC A;  1HNA A;  5IQY A;  1K0C A;  2HZE A;  2LRC A;  4K0G A;  1XPV A;  2A4H A;  3W8S A;  1GNE A;  3KEB A;  5HFI A;  3K8N A;  3EE2 A;  3DML A;  1F2E A;  4G0K A;  3TB2 A;  3WGE A;  4O32 A;  2A2S A;  4KF9 A;  3WD6 A;  1MEK A;  5IO2 A;  1YF0 A;  2LQO A;  5J5N A;  1PD2 1;  1TI1 A;  2GSS A;  4NXI A;  1Q98 A;  2O8V B;  2DKH A;  4ECC A;  3UVH A;  4G10 A;  2CZ2 A;  5CAX A;  3KMN A;  1RK4 A;  5GZZ B;  2VM1 A;  1XWC A;  4KH7 A;  2YCD A;  4KDX A;  4X4J A;  3VUR A;  2WRT A;  1I5G A;  1ZGN A;  4WF5 A;  2ON5 A;  3KTB A;  5ECO B;  4JZQ A;  4GTU A;  4WEY A;  3OR5 A;  3L9S A;  1OKD A;  2IJY A;  1YQ1 A;  4PQI A;  3QDN A;  3FZ5 A;  1R4W A;  2VCX A;  2O87 A;  3F3Q A;  1SK2 A;  3MWH A;  5D9T A;  1M3I A;  2FWE A;  3QPM A;  4QL7 A;  4BVX A;  1M0U A;  1AIU A;  1URM A;  5HR1 A;  3PR8 A;  4OD7 A;  2VCV A;  1T7P B;  5IMV A;  1N8J A;  5DQY A;  1VRS D;  2HYX A;  4KB3 A;  1U6T A;  4KW6 A;  4MP4 A;  4YAP A;  3DWV A;  3HVX A;  4ISD A;  1NM3 A;  4D73 B;  3A2X A;  2K18 A;  2GS3 A;  2QC7 A;  2O89 A;  3PPU A;  5A5K A;  3UMA A;  1TOF A;  5LNK e;  3ME7 A;  3TKR A;  5D73 A;  5ECP B;  2GT6 A;  1WOU A;  2L4C A;  1XW5 A;  1U88 A;  2IFQ B;  4EL1 A;  1OKT A;  4ZBA A;  3ZMK A;  5GSS A;  3L4N A;  1XIY A;  1K3L A;  1ST9 A;  4AF2 A;  3M3M A;  4MPG A;  4OWY A;  1IYH A;  2E7P A;  2MBS A;  2NBS A;  1XWA A;  4MH2 A;  1YY7 A;  3FZ9 A;  6GST A;  2VL3 A;  3TKP A;  1A23 A;  1JLV A;  3QCP A;  5E59 A;  1J0F A;  2WDU A;  3ISO A;  2FNO A;  4NMU A;  5BMU A;  2MYG A;  2DML A;  3F3R A;  4HQZ A;  3A3T A;  1ABA A;  4POB A;  4IHU A;  4YKG A;  1TW9 A;  3BCK A;  4GWR A;  1Y6E A;  2OE1 A;  3C7M A;  3FR3 A;  1GSF A;  2IMF A;  6GSY A;  5H5R A;  3ERW A;  4HU9 A;  3TOU A;  3LYP A;  5DJM A;  4ID0 A;  4ZB9 A;  5KN2 A;  2YP6 A;  2K6V A;  3CBU A;  1QQ2 A;  1GNW A;  3LFL A;  4K7I A;  3TUE A;  2HNL A;  3VK9 A;  3TRP A;  2YPM A;  2HSH A;  3TKS E;  3KJY A;  3DD3 A;  1OC9 B;  2GDR A;  4MZW A;  1PMT A;  2IMK A;  4EE0 A;  5IMA A;  1AQW A;  1EOH A;  6GSV A;  2PWJ A;  2OA7 A;  3ZRD A;  3A2V A;  2PMT A;  3UOM A;  2YV7 A;  2YZU A;  4GSS A;  5HR2 A;  2F3M A;  3S9F A;  2X8G A;  1Q4J A;  4TXO B;  2C0G A;  1MD3 A;  4MDC A;  4K5R A;  1X9W B;  1EV9 A;  2HT9 A;  3F4S A;  1HNB A;  1MDJ A;  4Q5Q A;  7GSS A;  4KND A;  1XVW A;  5KN1 A;  4FH8 A;  4ZB8 A;  5ECS A;  3WT2 A;  4YH2 A;  5CO3 A;  6GSW A;  4O7H A;  3KP8 A;  4TR1 B;  2GQK A;  4AJ7 A;  4BIK A;  1ZYQ B;  3EMX A;  2X4A A;  3IR4 A;  2V2G A;  3GYK A;  4RUV A;  2AHE A;  4HS1 A;  4IQA A;  4IBP A;  1AXD A;  5DCH A;  1KNG A;  2HI7 A;  4G2E A;  1YJ6 A;  4N11 A;  3ZZX A;  3GNJ A;  4XS4 B;  4ACS A;  4O92 A;  2MMO A;  3IE3 A;  1RQM A;  4I8B A;  2TRC P;  4RI6 A;  3N9J A;  1NW2 A;  3QFB C;  4CY8 A;  3WGD A;  4POK A;  5B6M A;  3DIE A;  1SD9 A;  2YV9 A;  3APO A;  3TKS C;  3ZLP A;  1TI3 A;  2KLX A;  3F4R A;  1FB0 A;  2DJ0 A;  4OFT A;  2LQQ A;  4ZL7 A;  3HYP A;  4QL9 A;  1X9M B;  2QSI A;  2IWT A;  4TOP A;  5G30 A;  1M2B A;  2XBI A;  5CYY A;  5ABR A;  3ZVJ A;  2GT5 A;  1K0B A;  1HYU A;  3IA1 A;  4HI7 A;  4YAV A;  5ECL B;  12GS A;  2YJ7 A;  1NSW A;  2AB6 A;  1R26 A;  4IS0 A;  2HZE B;  1U87 A;  4F03 A;  4IKH A;  1GSD A;  3LEF A;  1GUM A;  5EL8 A;  1BX9 A;  1GUK A;  2GGT A;  1FW1 A;  2R2J A;  5J4U A;  4BWS A;  3I43 A;  1LJR A;  2DJJ A;  1PGT A;  5J41 A;  1QFN A;  3D22 A;  4JRR A;  4TRX A;  3KP9 A;  4X0X A;  4XHM A;  4OO5 A;  2C0F A;  1ZL9 A;  2OE0 A;  4G19 A;  4GST A;  3TDG A;  3UBL A;  1AC1 A;  4KA0 A;  1T00 A;  1A2M A;  1TP9 A;  2GQL A;  3D5J A;  4CY6 A;  3A5W A;  3QMX A;  1K3Y A;  4JU5 A;  4YQM A;  5HFG A;  2LNT A;  3UIW A;  3TJB A;  5DVB A;  1F9M A;  1SYR A;  1SL1 B;  3P2A A;  4BVX B;  2VD1 A;  3C1R A;  4KDU A;  1OC9 A;  3J7Y b;  1BJX A;  3ED3 A;  1J08 A;  2YOI A;  4GCI A;  3VWU A;  4F82 A;  5L71 A;  4L0W A;  1SK0 A;  2HZF A;  3TGZ A;  6GSX A;  2GQM A;  1OE8 A;  1UC7 A;  4MLY A;  5KN3 A;  4TXO A;  1E2Y A;  2X99 A;  2JAC A;  3RBT A;  3GKK A;  1H4O A;  2OBK A;  4O5R A;  1ON4 A;  2H0I A;  4EC0 A;  3VFI A;  3GV1 A;  3FEU A;  2H1G A;  1XG8 A;  1R5A A;  4IW9 A;  2D2Z A;  2B7K A;  4WBR D;  4K6X A;  1FOV A;  2EIO A;  3HXS A;  5CRG A;  3HHV A;  1TXX A;  1VF4 A;  1BQ7 A;  1DE2 A;  3LSZ A;  3UAR A;  4HQS A;  1UA5 A;  3LXT A;  1ERU A;  3ZRE A;  3TOT A;  4KUN A;  2K9F A;  3F4T A;  2RLI A;  1TRU A;  5DBQ A;  1B8X A;  1BG5 A;  1M9A A;  1T8E B;  3O3T A;  3FY7 A;  3GUR A;  3H79 A;  2GVP A;  4ZXG A;  4J56 E;  4DVC A;  3EC3 A;  3FRC A;  4P3Y B;  5C04 A;  4V1A g;  3TJK A;  3L9V A;  1T4Z A;  3RPP A;  2ON7 A;  2L6D A;  5IOX A;  3QAG A;  4N10 A;  3TKS A;  2DJ3 A;  1F37 A;  1X0R A;  3O6T A;  2LJA A;  2FD3 A;  2H1D A;  2QGV A;  1FB6 A;  4YKF A;  3MSZ A;  4E8E A;  1BAY A;  4IVF A;  4N30 A;  1DE1 A;  2JSZ A;  3EWL A;  3J7Y k;  3CXG A;  3KXO A;  2TRX A;  4MF6 A;  2HRA A;  1EEJ A;  5LCZ A;  2I81 A;  3KIJ A;  5CRH A;  1VF2 A;  4X1U A;  3LW9 A;  4Q5N A;  3IPZ A;  2JSY A;  2VCW A;  3DRN A;  4I2T A;  4JBB A;  4N0Z A;  4MNN A;  2RII A;  2G2Q A;  4O5Q A;  5G5E A;  4Q5R A;  1O85 A;  5KEJ A;  4L8E A;  2K8S A;  3Q6O A;  14GS A;  3HVS A;  2ES7 A;  4IEL A;  5DDL A;  4AGS A;  1EGR A;  1GSS A;  3TKQ A;  5FHI A;  4H86 A;  5CRW A;  1XFL A;  3M9K A;  4FYU A;  4KE3 A;  2C8U A;  5A4V A;  4V2N A;  3ZIT A;  5ECH B;  1RW1 A;  4XIH A;  1N2A A;  3F63 A;  5EPF A;  3DVX A;  3KH9 A;  1V98 A;  1GH2 A;  2IME A;  2X8H A;  4PUF C;  4QQ7 A;  3D6I A;  1TRV A;  5F8B A;  1K3O A;  10GS A;  1FVJ A;  3GL5 A;  4V2M A;  3A5I A;  1YEP A;  3EPT A;  4K5S A;  5JWQ B;  1FAA A;  4MMM A;  2WFC A;  1SU9 A;  3HKR A;  2HFD A;  4ZIL A;  3Q19 A;  2LNS A;  5JCW A;  3EUR A;  4ML1 A;  2H6X A;  2JU5 A;  3L78 A;  2AYT A;  3GMF A;  4MCU A;  1GL8 A;  3BOA A;  3IRA A;  5D96 A;  2DIY A;  1R5P A;  1TU7 A;  2I9H A;  4FYC A;  3JCM L;  4K0N A;  3C8E A;  2YAN A;  3DVW A;  1TRS A;  3L9U A;  4KDY A;  3GTU A;  1B9X C;  3WYW A;  2CVB A;  2MMZ A;  4ULX A;  1G0T A;  1GLP A;  3R3E A;  2P5R A;  4LL4 B;  3HJP A;  4KCA A;  2L59 A;  3QD9 A;  3CSH A;  3GKN A;  3FZA A;  1FOH A;  4DSS A;  1V57 A;  2DKI A;  2R0P A;  4BA7 A;  5ENU A;  5ECK B;  1GTI A;  3Q18 A;  2MMA A;  2VL9 A;  3SWL A;  3HY2 A;  4BWQ A;  5IPH A;  3NIV A;  1J9B A;  1OAZ A;  1B4Q A;  1HD2 A;  1K0O A;  1JZW A;  2REM A;  5HR0 A;  2H66 A;  1QUW A;  5DAK A;  1PN0 A;  3ZML A;  4K7N A;  1XCC A;  1PN9 A;  2QA2 A;  3AY8 A;  1PX7 A;  4I6X A;  4MJA A;  1X5C A;  3LXZ A;  2P31 A;  5AN1 A;  3LQ7 A;  2QKE A;  4HU7 A;  2EC4 A;  4ILF A;  2PGT A;  1G6Y A;  2JZR A;  2X49 A;  3ME8 A;  4WXT A;  5ELG A;  2F8A A;  2B5E A;  4N0V A;  2E2M A;  2KP2 A;  2LRT A;  3VPQ A;  4IP6 A;  1XZO A;  3HD5 A;  1V9W A;  4PGT A;  3EMP A;  5H5S A;  3FR9 A;  19GS A;  1SEN A;  5IOW A;  2V32 A;  3CQF A;  1U3I A;  1EP8 A;  2VAF A;  1YEX A;  3RDW A;  4ML6 A;  11GS A;  4XS1 A;  1JFU A;  1A0F A;  1WJK A;  2N5B A;  4Z2T A;  1TKD B;  1Z5Y E;  4F2I A;  2VCT A;  1GSU A;  2WGR A;  3HJM A;  2VL2 C;  4TR3 A;  4OMV A;  1XWG A;  1F3B A;  4ECJ A;  1M2D A;  2X8C A;  1KBN A;  5ID2 A;  5BRT A;  3FHK A;  2E0Q A;  5FT3 A;  1OYJ A;  1Z9H A;  4JR6 A;  2CVD A;  4OO4 A;  1UVZ A;  2DMM A;  5AIX A;  2LV3 A;  2I3Y A;  5DAL A;  3VWX A;  5GST A;  4PQH A;  4IQ1 A;  1WPI A;  2R0G A;  1BYE A;  4AJ6 A;  2L5L A;  1K0N A;  4L5L A;  4I5Q A;  4USS A;  3CTG A;  5D9X A;  2DBC A;  5LD0 A;  2ZNM A;  4HJM A;  4K8M A;  4ECI A;  3D0Z A;  1WE0 A;  4KCE A;  1TTZ A;  2K8V A;  4EO3 A;  3H93 A;  3FR6 A;  2RUE A;  5B8A A;  2OKA A;  1A2L A;  2H1B A;  2R6K A;  4F9Z A;  4MPF A;  2CV4 A;  3IV4 A;  1TU8 A;  1QGV A;  2C4J A;  3HVV A;  1MDK A;  3IC4 A;  4TR4 A;  1XWB A;  3APQ A;  2DJK A;  1YF1 A;  2CX3 A;  3D21 A;  4GQF A;  5B8B A;  4KSO A;  3TRX A;  3FZ4 A;  4IJI A;  1ZMA A;  1M2A A;  1M9B A;  1X9S B;  1TK8 B;  2YN1 A;  3A2W A;  4LA1 A;  3IK9 A;  1XWK A;  4NAX A;  3CSJ A;  2E2G A;  2CVK A;  3RHC A;  2MBT A;  5F06 A;  1EWX A;  4I2U A;  4GRF A;  4WKW A;  3G7J A;  1F3A A;  1USB A;  3IHQ A;  3KM6 A;  4POL A;  1ZYN A;  2DLX A;  2B5X A;  1LBK A;  4HJ2 A;  22GS A;  3KD0 A;  1B48 A;  2VUP A;  3HVN A;  2F51 A;  4LL1 B;  2JL4 A;  5IO0 A;  2XBQ A;  3E9J B;  3RHB A;  5D8I A;  2H01 A;  3C71 A;  3QR6 A;  4EUY A;  1EZK A;  1ERT A;  4G0L A;  2V6O A;  5ECN B;  2LJR A;  1YKA A;  2EIQ A;  2NVL A;  2FWH A;  3RPN A;  1PA3 A;  4I97 A;  4MH3 A;  5ECQ B;  2RM5 A;  1V2A A;  3L0H A;  4WF4 A;  2WUL A;  3KGK A;  1U3A A;  5AGY A;  3KTL A;  3H8Q A;  5IIZ A;  1THO A;  2LJK A;  3FW2 A;  2CQ9 A;  3UEM A;  5AIV A;  3UBK A;  3EU3 A;  1PRX A;  2H76 A;  2L4Q A;  1GSE A;  4FO5 A;  3GFK A;  3MDK A;  4TXV A;  2C3N A;  5HFK A;  2PN8 A;  1WRY A;  1OC8 A;  4ZB6 A;  1SD8 A;  3KZQ A;  1GTU A;  1AW9 A;  3VPT A;  2GSQ A;  1SJZ A;  3GH9 A;  4K9Z A;  4BPY A;  1Z7P A;  2IMD A;  2HSM A;  1QK8 A;  2CZ3 A;  2BMX A;  5H5Q A;  2HSY A;  3F6F A;  4IJ3 A;  5IMF A;  3GTU B;  1XW9 A;  3P8W A;  1GUL A;  3LYK A;  1EGO A;  3M1G A;  2YWN A;  4RI7 A;  1B9Y C;  2PVQ A;  2C1Y A;  5GAP D;  1O81 A;  2H19 A;  2VL2 A;  2WCI A;  2QA1 A;  4DSS B;  5D9W A;  2BTO T;  2M80 A;  1V40 A;  1MTC A;  3P90 A;  3IBH A;  4J2F A;  1Y25 A;  1Z3E A;  3HZ4 A;  2ZUP A;  4ZBD A;  5DJL A;  2L57 A;  4EVM A;  4CDO A;  1ZYE A;  2DJ2 A;  3GUS A;  4PUA A;  4PUR A;  5ECR B;  2IPA A;  4Q5F A;  4HDE A;  3ZIJ A;  4RQX A;  5HR3 A;  2CT6 A;  4ZBB A;  4E8H A;  4KAE A;  4K2D A;  4RQR A;  3MAK A;  4G0I A;  1FG4 A;  1EV4 A;  1X5D A;  3CSI A;  3GX8 A;  2IN3 A;  4EKZ A;  4FQU A;  5DAK B;  4MJC A;  4NV5 A;  1PL1 A;  1EEM A;  2CAQ A;  1XXU A;  2H73 A;  4HOJ A;  2B3S A;  4BVY A;  4F0B A;  1S3D A;  1THX A;  4MF7 A;  2YWO A;  1XBS A;  2H75 A;  4V1A p;  9GSS A;  2I1U A;  2R3X A;  4L5O A;  4IGJ A;  1EOG A;  3TCO A;  2WB9 A;  4GSN A;  3UJ1 A;  3M9J A;  2R37 A;  2H71 A;  3LGC A;  4XCS A;  1AQX A;  2RUF A;  4NHZ A;  4HSC X;  4PNF A;  1HNC A;  4EDZ A;  4GF0 A;  1T4Y A;  3O76 A;  1PFO A;  3KCM A;  1IYI A;  2J9H A;  3F9U A;  4HZ2 A;  3I69 A;  2XPD A;  4WR4 A;  1ZOF A;  4WR5 A;  3BCI A;  2C3T A;  3TJF A;  1A8Y A;  2NPB A;  2XC2 A;  1ZYP A;  3CRU A;  1JZO A;  3IC8 A;  4OCF A;  1W4V A;  3E3E A;  3GN3 A;  3G9B A;  16GS A;  3IHG A;  5ID2 B;  3IXR A;  3QFA C;  2B1L A;  5EVO A;  1TK0 B;  3H4K A;  5E4W A;  2FUG 2;  3CRT A;  3LOR A;  3GL3 A;  4GLT A;  3GSS A;  1PKZ A;  1SKW B;  3GRX A;  3UVT A;  5GAN D;  5D93 A;  1DSB A;  5DAL B;  1SL2 B;  1YZX A;  1FHE A;  3DKS A;  3IAM 2;  1A8L A;  3IK7 A;  4LMV A;  5J9B A;  1VF3 A;  4HEA 2;  2H70 A;  4TR0 A;  1A24 A;  1G6W A;  1R7H A;  1BED A;  3ZL5 A;  4YQV A;  2A2R A;  4L0U A;  2M46 A;  5COH A;  2LRN A;  2PVO C;  2HRK A;  2YWM A;  1SL0 B;  2B6M A;  2L5O A;  3D4T A;  1JZR A;  2FCH A;  2F8F A;  3PGT A;  3D4M A;  5F0G A;  3VWW A;  2WS2 A;  3GST A;  1GRX A;  3EYT A;  2PBJ A;  1NHY A;  6GSS A;  5A4W A;  1ZCP A;  2FA4 A;  5FWG A;  1GWC A;  2N5A A;  1SJI A;  1OE7 A;  2XPE A;  3WGX A;  4DSR A;  3TJG A;  1A0R P;  5J9C A;  2GLR A;  2FA8 A;  2C0D A;  4J57 E;  2HRF A;  1DUG A;  1O7U A;  3TRQ A;  1ERW A;  2H72 A;  2FLS A;  1S3R A;  2PU9 C;  3QAW A;  2JZS A;  5A4U A;  1VF1 A;  5D9V A;  1SK1 A;  3DYR A;  5B6N A;  2IL3 A;  2L6C A;  2LKU A;  4EXJ A;  4EDY A;  4JR4 A;  2FGX A;  4ICY A;  2TIR A;  2JZT A;  1PSQ A;  2O7K A;  4NV2 A;  2PUK C;  3HA9 A;  3LJR A;  4X43 A;  1XW6 A;  4BL7 B;  5G1K A;  5ELA A;  4TN8 A;  1SKR B;  1GLQ A;  2V1M A;  2HE3 A;  1KTE A;  2V6K A;  1HQO A;  5CNW A;  1E6B A;  4GXZ A;  3FKF A;  5KOX A;  1DBY A;  3GA4 A;  2A4V A;  2V41 A;  1GTA A;  2YWI A;  2VLU A;  1ZZY A;  3G7Y A;  2MMN A;  4Z2R A;  2H1A A;  1WP0 A;  4GQC A;  4K1F A;  1PL2 A;  5ECI B;  1X5E A;  1AQV A;  1VGL A;  3SBC A;  1K0M A;  3W6G A;  1XOB A;  3UL3 A;  3MYD A;  2VLV A;  5DQS A;  1MDI A;  2CA8 A;  3ZIV A; 
#chains in the Genus database with same CATH homology
 2H74 A;  3APS A;  5G1L A;  2AJQ B;  4JE1 A;  3KMO A;  2WJU A;  3C73 A;  3HJO A;  3PH9 A;  4NHW A;  2AUV A;  4WET A;  4CW9 A;  4DEJ A;  2IIY A;  5IPG A;  2R0C A;  1O73 A;  4FYB A;  4KGI A;  3F8U A;  4K2X A;  5KN0 A;  2B5Y A;  1Z6M A;  1H75 A;  1AAZ A;  18GS A;  1B4P A;  3ZYW A;  1UN2 A;  2EIR A;  1M7T A;  2AAW A;  1GSQ A;  6GSU A;  2UZ8 A;  5J3R A;  2VM2 A;  3PIN A;  3IDV A;  4TKY A;  3HCZ A;  3CMI A;  4XRD A;  5HQP A;  2R5G A;  4DSQ A;  4Z7X A;  3VI5 A;  4PNG A;  1Z6N A;  4XTS A;  4MJB A;  3ZFL A;  2OE3 A;  1ERV A;  3BJ5 A;  1A2J A;  3EU4 A;  2GTU A;  4MF5 A;  2WZ9 A;  2HRN A;  3DGQ A;  2KHP A;  3EVI A;  13GS A;  4NWY A;  3GKX A;  3U6V A;  3ERF A;  2VCQ A;  1GP1 A;  5DCG A;  2GST A;  1TJD A;  3GX0 A;  1T1V A;  1FVK A;  2GZZ A;  2JAD A;  2I4A A;  2PPT A;  1SKS B;  2OJL A;  2LEG A;  1PQN A;  1V58 A;  2LTK A;  3F0I A;  1G7O A;  1F6M C;  1LU4 A;  4KSM A;  3FYG A;  1ML6 A;  1K0D A;  4ZIJ A;  3P7X A;  2KOK A;  4CHS A;  3QOU A;  2DSA A;  3BD2 A;  3DEX A;  5JWR B;  1TK5 B;  2MZC A;  1NHO A;  3GKM A;  2FWG A;  2HLS A;  1O6J A;  3E0U A;  1MD4 A;  4BVY B;  4D73 A;  4O5U A;  2CX4 A;  3VWV A;  1YKC A;  3IOS A;  2B7J A;  1GUH A;  3CTF A;  3HDC A;  2LUS A;  1FO5 A;  2YZH A;  4AJ8 A;  4IN0 A;  5CRE A;  3U5R E;  5JCU A;  2VD0 A;  2H6Y A;  4JED A;  1I9D A;  1T3B A;  2KP1 A;  1YDK A;  3US3 A;  4LLR A;  1G7E A;  1O8W A;  3ERG A;  2BJX A;  8GSS A;  2IFQ A;  1TDI A;  3DXB A;  2IMI A;  4MJE A;  2ZCT A;  2VLT A;  2YJH A;  4NPB A;  3HZ8 A;  3W8J A;  2AV4 A;  2RM6 A;  2N5F A;  4K7O A;  1SJ6 A;  5IM9 A;  4BL7 A;  2H30 A;  5JWO B;  5IMZ A;  4MK3 A;  3FMW A;  3I6A A;  1S3C A;  2H6Z A;  2LS5 A;  1CQG A;  2A2P A;  4OFM A;  2GZP A;  3VLN A;  1WMJ A;  2DJ1 A;  3G7I A;  4MZC A;  4TW5 A;  1PKW A;  1QMV A;  1CQH A;  2P5Q A;  1ILO A;  2VCZ A;  5IMC A;  3UAP A;  1WIK A;  1JLW A;  2GSR A;  3R2Q A;  4HZ4 A;  2FWF A;  3TJJ A;  1KEB A;  4A5P A;  5F07 A;  1JZD A;  4PX1 A;  3ZVJ D;  4EIQ A;  3C1S A;  3ZTL A;  1AUC A;  3BBY A;  3VI7 A;  1EP7 A;  4OFN A;  3EIN A;  3MIX A;  2C80 A;  5IMD A;  4HUA A;  4G9H A;  1Z7R A;  2H0G A;  20GS A;  4PTS A;  5ECM B;  4POM A;  3ZFB A;  4V2L A;  1M99 A;  4Z2U A;  2F9S A;  2R4V A;  4OCE A;  2J23 A;  4LMW A;  4MAB A;  4ECB A;  2FHE A;  1OC3 A;  5CP1 A;  4EF0 A;  2VIM A;  4PXO A;  5B7C A;  4MZB A;  2NTO A;  5G2Z A;  3IAS 2;  2H8L A;  2PER A;  4XRA A;  1S3A A;  3CYN A;  3NOF A;  2G0F A;  2C3Q A;  3FK8 A;  3LG6 A;  4TR1 A;  5C00 A;  2C0E A;  5JCG A;  3WT1 A;  5AIS A;  1PX6 A;  1QXH A;  2ALB A;  5KOW A;  1JHB A;  2Z9S A;  4MA9 A;  3N5O A;  4F0C A;  4ZL9 A;  1O8X A;  2B1K A;  2OBI A;  1SYX A;  2LST A;  5G5F A;  3KH7 A;  17GS A;  3QAV A;  1ACV A;  2NDO A;  3M8N A;  1XVQ A;  4YQU A;  4KX4 A;  3GHA A;  1TRW A;  4XS6 A;  2HXK A;  4XS4 A;  3V1W A;  4WBJ A;  3NZN A;  2OAD A;  3LWA A;  2P0G A;  4ZL8 A;  2CAI A;  2DC5 A;  2FY6 A;  3H1N A;  5CRD A;  2H0H A;  4TVE A;  5INY A;  3GH6 A;  2VO4 A;  2DIZ A;  4IP1 A;  2M72 A;  1GSY A;  2GZY A;  3MNG A;  1K0A A;  4EIP A;  2XHF A;  2OAC A;  3M0F A;  1GTB A;  3GIX A;  3Q74 A;  1WWJ A;  1W89 A;  3F6D A;  5EY6 A;  2KUC A;  5F05 A;  2O85 A;  3I9V 2;  4FIW A;  1XOA A;  5G31 A;  1OVN A;  4PQ1 A;  2YNX A;  1C72 A;  3RAZ A;  2X64 A;  2VOC A;  1HNA A;  5IQY A;  1K0C A;  2HZE A;  2LRC A;  4K0G A;  1XPV A;  2A4H A;  3W8S A;  1GNE A;  3KEB A;  5HFI A;  3K8N A;  3EE2 A;  3DML A;  1F2E A;  4G0K A;  3TB2 A;  3WGE A;  4O32 A;  2A2S A;  4KF9 A;  3WD6 A;  1MEK A;  5IO2 A;  1YF0 A;  2LQO A;  5J5N A;  1PD2 1;  1TI1 A;  2GSS A;  4NXI A;  1Q98 A;  2O8V B;  2DKH A;  4ECC A;  3UVH A;  4G10 A;  2CZ2 A;  5CAX A;  3KMN A;  1RK4 A;  5GZZ B;  2VM1 A;  1XWC A;  4KH7 A;  2YCD A;  4KDX A;  4X4J A;  3VUR A;  2WRT A;  1I5G A;  1ZGN A;  4WF5 A;  2ON5 A;  3KTB A;  5ECO B;  4JZQ A;  4GTU A;  4WEY A;  3OR5 A;  3L9S A;  1OKD A;  2IJY A;  1YQ1 A;  4PQI A;  3QDN A;  3FZ5 A;  1R4W A;  2VCX A;  2O87 A;  3F3Q A;  1SK2 A;  3MWH A;  5D9T A;  2FWE A;  3QPM A;  4QL7 A;  4BVX A;  1M0U A;  1AIU A;  1URM A;  5HR1 A;  3PR8 A;  4OD7 A;  2VCV A;  1T7P B;  5IMV A;  1N8J A;  5DQY A;  1VRS D;  2HYX A;  4KB3 A;  1U6T A;  4KW6 A;  4MP4 A;  4YAP A;  3DWV A;  3HVX A;  4ISD A;  1NM3 A;  4D73 B;  3A2X A;  2K18 A;  2GS3 A;  2QC7 A;  2O89 A;  3PPU A;  5A5K A;  3UMA A;  1TOF A;  5LNK e;  3ME7 A;  3TKR A;  5D73 A;  5ECP B;  2GT6 A;  1WOU A;  2L4C A;  1XW5 A;  1U88 A;  2IFQ B;  4EL1 A;  1OKT A;  4ZBA A;  3ZMK A;  5GSS A;  3L4N A;  1XIY A;  1K3L A;  1ST9 A;  4AF2 A;  3M3M A;  4MPG A;  4OWY A;  1IYH A;  2E7P A;  2MBS A;  2NBS A;  1XWA A;  4MH2 A;  1YY7 A;  3FZ9 A;  6GST A;  2VL3 A;  3TKP A;  1A23 A;  1JLV A;  3QCP A;  5E59 A;  1J0F A;  2WDU A;  3ISO A;  2FNO A;  4NMU A;  5BMU A;  2MYG A;  2DML A;  3F3R A;  4HQZ A;  3A3T A;  1ABA A;  4POB A;  4IHU A;  4YKG A;  1TW9 A;  3BCK A;  4GWR A;  1Y6E A;  2OE1 A;  3C7M A;  3FR3 A;  1GSF A;  2IMF A;  6GSY A;  5H5R A;  3ERW A;  4HU9 A;  3TOU A;  3LYP A;  5DJM A;  4ID0 A;  4ZB9 A;  5KN2 A;  2YP6 A;  2K6V A;  3CBU A;  1QQ2 A;  1GNW A;  3LFL A;  4K7I A;  3TUE A;  2HNL A;  3VK9 A;  3TRP A;  2YPM A;  2HSH A;  3TKS E;  3KJY A;  3DD3 A;  1OC9 B;  2GDR A;  4MZW A;  1PMT A;  2IMK A;  4EE0 A;  5IMA A;  1AQW A;  1EOH A;  6GSV A;  2PWJ A;  2OA7 A;  3ZRD A;  3A2V A;  2PMT A;  3UOM A;  2YV7 A;  2YZU A;  4GSS A;  5HR2 A;  2F3M A;  3S9F A;  2X8G A;  1Q4J A;  4TXO B;  2C0G A;  1MD3 A;  4MDC A;  4K5R A;  1X9W B;  1EV9 A;  2HT9 A;  3F4S A;  1HNB A;  1MDJ A;  4Q5Q A;  7GSS A;  4KND A;  1XVW A;  5KN1 A;  4FH8 A;  4ZB8 A;  5ECS A;  3WT2 A;  4YH2 A;  5CO3 A;  6GSW A;  4O7H A;  3KP8 A;  4TR1 B;  2GQK A;  4AJ7 A;  1ZYQ B;  3EMX A;  2X4A A;  3IR4 A;  2V2G A;  3GYK A;  4RUV A;  2AHE A;  4HS1 A;  4IQA A;  4IBP A;  1AXD A;  5DCH A;  1KNG A;  2HI7 A;  4G2E A;  1YJ6 A;  4N11 A;  3ZZX A;  3GNJ A;  4XS4 B;  4ACS A;  4O92 A;  2MMO A;  3IE3 A;  1RQM A;  4I8B A;  2TRC P;  4RI6 A;  3N9J A;  1NW2 A;  3QFB C;  4CY8 A;  3WGD A;  4POK A;  5B6M A;  3DIE A;  1SD9 A;  2YV9 A;  3APO A;  3TKS C;  3ZLP A;  1TI3 A;  2KLX A;  3F4R A;  1FB0 A;  2DJ0 A;  4OFT A;  2LQQ A;  4ZL7 A;  3HYP A;  4QL9 A;  1X9M B;  2QSI A;  2IWT A;  4TOP A;  5G30 A;  5CYY A;  1M2B A;  2XBI A;  5ABR A;  3ZVJ A;  2GT5 A;  1K0B A;  1HYU A;  3IA1 A;  4HI7 A;  4YAV A;  5ECL B;  12GS A;  2YJ7 A;  1NSW A;  2AB6 A;  1R26 A;  4IS0 A;  2HZE B;  1U87 A;  4F03 A;  4IKH A;  1GSD A;  3LEF A;  1GUM A;  5EL8 A;  1BX9 A;  1GUK A;  2GGT A;  1FW1 A;  2R2J A;  5J4U A;  4BWS A;  3I43 A;  1LJR A;  2DJJ A;  1PGT A;  5J41 A;  1QFN A;  3D22 A;  4JRR A;  4TRX A;  3KP9 A;  4X0X A;  4XHM A;  4OO5 A;  2C0F A;  1ZL9 A;  2OE0 A;  4G19 A;  4GST A;  3TDG A;  3UBL A;  1AC1 A;  4KA0 A;  1T00 A;  1A2M A;  1TP9 A;  2GQL A;  3D5J A;  4CY6 A;  3A5W A;  4YQM A;  3QMX A;  1K3Y A;  4JU5 A;  5HFG A;  2LNT A;  3UIW A;  3TJB A;  5DVB A;  1F9M A;  1SYR A;  1SL1 B;  3P2A A;  4BVX B;  2VD1 A;  3C1R A;  4KDU A;  1OC9 A;  3J7Y b;  1BJX A;  3ED3 A;  1J08 A;  2YOI A;  4GCI A;  3VWU A;  4F82 A;  5L71 A;  4L0W A;  1SK0 A;  2HZF A;  3TGZ A;  6GSX A;  2GQM A;  1OE8 A;  1UC7 A;  4MLY A;  5KN3 A;  4TXO A;  1E2Y A;  2X99 A;  2JAC A;  3RBT A;  3GKK A;  1H4O A;  2OBK A;  4O5R A;  1ON4 A;  2H0I A;  4EC0 A;  3VFI A;  3GV1 A;  3FEU A;  2H1G A;  1R5A A;  4IW9 A;  2D2Z A;  2B7K A;  4WBR D;  4K6X A;  1FOV A;  2EIO A;  3HXS A;  5CRG A;  3HHV A;  1TXX A;  1VF4 A;  1BQ7 A;  1DE2 A;  3LSZ A;  3UAR A;  4HQS A;  1UA5 A;  3LXT A;  1ERU A;  3ZRE A;  3TOT A;  4KUN A;  2K9F A;  3F4T A;  2RLI A;  1TRU A;  5DBQ A;  1B8X A;  1BG5 A;  1M9A A;  1T8E B;  3O3T A;  3FY7 A;  3GUR A;  3H79 A;  2GVP A;  4ZXG A;  4J56 E;  4DVC A;  3EC3 A;  3FRC A;  4P3Y B;  5C04 A;  4V1A g;  3TJK A;  3L9V A;  1T4Z A;  3RPP A;  2ON7 A;  2L6D A;  5IOX A;  3QAG A;  4N10 A;  3TKS A;  2DJ3 A;  1F37 A;  1X0R A;  3O6T A;  2LJA A;  2FD3 A;  2H1D A;  2QGV A;  1FB6 A;  4YKF A;  3MSZ A;  4E8E A;  1BAY A;  4IVF A;  4N30 A;  1DE1 A;  2JSZ A;  3EWL A;  3J7Y k;  3CXG A;  3KXO A;  2TRX A;  4MF6 A;  2HRA A;  1EEJ A;  5LCZ A;  2I81 A;  3KIJ A;  5CRH A;  1VF2 A;  4X1U A;  3LW9 A;  4Q5N A;  3IPZ A;  2JSY A;  2VCW A;  3DRN A;  4I2T A;  4JBB A;  4N0Z A;  4MNN A;  2RII A;  2G2Q A;  4O5Q A;  5G5E A;  4Q5R A;  1O85 A;  5KEJ A;  4L8E A;  2K8S A;  3Q6O A;  14GS A;  3HVS A;  2ES7 A;  4IEL A;  5DDL A;  4AGS A;  1EGR A;  1GSS A;  3TKQ A;  5FHI A;  4H86 A;  5CRW A;  1XFL A;  3M9K A;  4FYU A;  4KE3 A;  2C8U A;  5A4V A;  4V2N A;  3ZIT A;  5ECH B;  1RW1 A;  4XIH A;  1N2A A;  3F63 A;  5EPF A;  3DVX A;  3KH9 A;  1V98 A;  1GH2 A;  2IME A;  2X8H A;  4PUF C;  4QQ7 A;  3D6I A;  1TRV A;  5F8B A;  1K3O A;  10GS A;  1FVJ A;  3GL5 A;  4V2M A;  3A5I A;  1YEP A;  3EPT A;  4K5S A;  5JWQ B;  1FAA A;  4MMM A;  2WFC A;  1SU9 A;  3HKR A;  2HFD A;  4ZIL A;  3Q19 A;  2LNS A;  5JCW A;  3EUR A;  4ML1 A;  2H6X A;  2JU5 A;  3L78 A;  2AYT A;  3GMF A;  4MCU A;  1GL8 A;  3BOA A;  3IRA A;  5D96 A;  2DIY A;  1R5P A;  1TU7 A;  2I9H A;  4FYC A;  3JCM L;  4K0N A;  3C8E A;  2YAN A;  3DVW A;  1TRS A;  3L9U A;  4KDY A;  3GTU A;  1B9X C;  3WYW A;  2CVB A;  2MMZ A;  4ULX A;  1G0T A;  1GLP A;  3R3E A;  2P5R A;  4LL4 B;  3HJP A;  4KCA A;  2L59 A;  3QD9 A;  3CSH A;  3GKN A;  3FZA A;  1FOH A;  4DSS A;  1V57 A;  2DKI A;  2R0P A;  4BA7 A;  5ENU A;  5ECK B;  1GTI A;  3Q18 A;  2MMA A;  2VL9 A;  3SWL A;  3HY2 A;  4BWQ A;  5IPH A;  3NIV A;  1J9B A;  1OAZ A;  1B4Q A;  1HD2 A;  1K0O A;  1JZW A;  2REM A;  5HR0 A;  2H66 A;  1QUW A;  5DAK A;  1PN0 A;  3ZML A;  4K7N A;  1XCC A;  1PN9 A;  2QA2 A;  3AY8 A;  1PX7 A;  4I6X A;  4MJA A;  1X5C A;  3LXZ A;  2P31 A;  5AN1 A;  3LQ7 A;  2QKE A;  4HU7 A;  2EC4 A;  4ILF A;  2PGT A;  1G6Y A;  2JZR A;  2X49 A;  3ME8 A;  4WXT A;  5ELG A;  2F8A A;  2B5E A;  4N0V A;  2E2M A;  2KP2 A;  2LRT A;  3VPQ A;  4IP6 A;  1XZO A;  3HD5 A;  1V9W A;  4PGT A;  3EMP A;  5H5S A;  3FR9 A;  19GS A;  1SEN A;  5IOW A;  2V32 A;  1U3I A;  1EP8 A;  2VAF A;  1YEX A;  3RDW A;  4ML6 A;  11GS A;  4XS1 A;  1JFU A;  1A0F A;  1WJK A;  2N5B A;  4Z2T A;  1TKD B;  1Z5Y E;  4F2I A;  2VCT A;  1GSU A;  2WGR A;  3HJM A;  2VL2 C;  4TR3 A;  4OMV A;  1XWG A;  1F3B A;  4ECJ A;  1M2D A;  2X8C A;  1KBN A;  5ID2 A;  5BRT A;  3FHK A;  2E0Q A;  5FT3 A;  1OYJ A;  1Z9H A;  4JR6 A;  2CVD A;  4OO4 A;  1UVZ A;  2DMM A;  5AIX A;  2LV3 A;  2I3Y A;  5DAL A;  3VWX A;  5GST A;  4PQH A;  4IQ1 A;  1WPI A;  2R0G A;  1BYE A;  4AJ6 A;  2L5L A;  1K0N A;  4L5L A;  4I5Q A;  4USS A;  3CTG A;  5D9X A;  2DBC A;  5LD0 A;  2ZNM A;  4HJM A;  4K8M A;  4ECI A;  3D0Z A;  1WE0 A;  4KCE A;  1TTZ A;  2K8V A;  4EO3 A;  3H93 A;  3FR6 A;  2RUE A;  5B8A A;  2OKA A;  1A2L A;  2H1B A;  2R6K A;  4F9Z A;  4MPF A;  2CV4 A;  3IV4 A;  1TU8 A;  1QGV A;  2C4J A;  3HVV A;  1MDK A;  3IC4 A;  4TR4 A;  1XWB A;  3APQ A;  2DJK A;  1YF1 A;  2CX3 A;  3D21 A;  4GQF A;  5B8B A;  4KSO A;  3TRX A;  3FZ4 A;  4IJI A;  1ZMA A;  1M2A A;  1M9B A;  1X9S B;  1TK8 B;  2YN1 A;  3A2W A;  4LA1 A;  3IK9 A;  1XWK A;  4NAX A;  3CSJ A;  2E2G A;  2CVK A;  3RHC A;  2MBT A;  5F06 A;  1EWX A;  4I2U A;  4GRF A;  4WKW A;  3G7J A;  1F3A A;  1USB A;  3IHQ A;  3KM6 A;  4POL A;  1ZYN A;  2DLX A;  2B5X A;  1LBK A;  4HJ2 A;  22GS A;  3KD0 A;  1B48 A;  2VUP A;  2F51 A;  4LL1 B;  2JL4 A;  5IO0 A;  2XBQ A;  3E9J B;  3RHB A;  5D8I A;  2H01 A;  3C71 A;  3QR6 A;  4EUY A;  1EZK A;  1ERT A;  4G0L A;  2V6O A;  5ECN B;  2LJR A;  1YKA A;  2EIQ A;  2NVL A;  2FWH A;  3RPN A;  1PA3 A;  4I97 A;  4MH3 A;  5ECQ B;  2RM5 A;  1V2A A;  3L0H A;  4WF4 A;  2WUL A;  3KGK A;  1U3A A;  5AGY A;  3KTL A;  3H8Q A;  5IIZ A;  1THO A;  2LJK A;  3FW2 A;  2CQ9 A;  3UEM A;  5AIV A;  3UBK A;  3EU3 A;  1PRX A;  2H76 A;  2L4Q A;  1GSE A;  4FO5 A;  3GFK A;  3MDK A;  4TXV A;  2C3N A;  5HFK A;  2PN8 A;  1WRY A;  1OC8 A;  4ZB6 A;  1SD8 A;  3KZQ A;  1GTU A;  1AW9 A;  3VPT A;  2GSQ A;  1SJZ A;  3GH9 A;  4K9Z A;  4BPY A;  1Z7P A;  2IMD A;  2HSM A;  1QK8 A;  2CZ3 A;  2BMX A;  5H5Q A;  2HSY A;  3F6F A;  4IJ3 A;  5IMF A;  3GTU B;  1XW9 A;  3P8W A;  1GUL A;  3LYK A;  1EGO A;  3M1G A;  2YWN A;  4RI7 A;  1B9Y C;  2PVQ A;  2C1Y A;  5GAP D;  1O81 A;  2H19 A;  2VL2 A;  2WCI A;  2QA1 A;  4DSS B;  5D9W A;  2BTO T;  2M80 A;  1V40 A;  1MTC A;  3P90 A;  3IBH A;  4J2F A;  1Y25 A;  1Z3E A;  3HZ4 A;  2ZUP A;  4ZBD A;  5DJL A;  2L57 A;  4EVM A;  4CDO A;  1ZYE A;  2DJ2 A;  3GUS A;  4PUA A;  4PUR A;  5ECR B;  2IPA A;  4Q5F A;  4HDE A;  3ZIJ A;  4RQX A;  5HR3 A;  2CT6 A;  4ZBB A;  4E8H A;  4KAE A;  4K2D A;  4RQR A;  3MAK A;  4G0I A;  1FG4 A;  1EV4 A;  1X5D A;  3CSI A;  3GX8 A;  2IN3 A;  4EKZ A;  4FQU A;  5DAK B;  4MJC A;  4NV5 A;  1PL1 A;  1EEM A;  2CAQ A;  1XXU A;  2H73 A;  4HOJ A;  2B3S A;  4BVY A;  4F0B A;  1S3D A;  1THX A;  4MF7 A;  2YWO A;  1XBS A;  2H75 A;  4V1A p;  9GSS A;  2I1U A;  2R3X A;  4L5O A;  4IGJ A;  1EOG A;  3TCO A;  2WB9 A;  4GSN A;  3UJ1 A;  3M9J A;  2R37 A;  2H71 A;  3LGC A;  4XCS A;  1AQX A;  2RUF A;  4NHZ A;  4PNF A;  1HNC A;  4EDZ A;  4GF0 A;  1T4Y A;  3O76 A;  3KCM A;  1IYI A;  2J9H A;  3F9U A;  4HZ2 A;  3I69 A;  2XPD A;  4WR4 A;  1ZOF A;  4WR5 A;  3BCI A;  2C3T A;  3TJF A;  1A8Y A;  2NPB A;  2XC2 A;  1ZYP A;  3CRU A;  1JZO A;  3IC8 A;  4OCF A;  1W4V A;  3E3E A;  3GN3 A;  3G9B A;  16GS A;  3IHG A;  5ID2 B;  3IXR A;  3QFA C;  2B1L A;  5EVO A;  1TK0 B;  3H4K A;  5E4W A;  2FUG 2;  3CRT A;  3LOR A;  3GL3 A;  4GLT A;  3GSS A;  1PKZ A;  1SKW B;  3GRX A;  3UVT A;  5GAN D;  5D93 A;  1DSB A;  5DAL B;  1SL2 B;  1YZX A;  1FHE A;  3DKS A;  3IAM 2;  1A8L A;  3IK7 A;  4LMV A;  5J9B A;  1VF3 A;  4HEA 2;  2H70 A;  4TR0 A;  1A24 A;  1G6W A;  1R7H A;  1BED A;  3ZL5 A;  4YQV A;  2A2R A;  4L0U A;  2M46 A;  5COH A;  2LRN A;  2PVO C;  2HRK A;  2YWM A;  1SL0 B;  2B6M A;  2L5O A;  3D4T A;  1JZR A;  2FCH A;  2F8F A;  3PGT A;  3D4M A;  5F0G A;  3VWW A;  2WS2 A;  3GST A;  1GRX A;  3EYT A;  2PBJ A;  1NHY A;  6GSS A;  5A4W A;  1ZCP A;  2FA4 A;  5FWG A;  1GWC A;  2N5A A;  1SJI A;  1OE7 A;  2XPE A;  3WGX A;  4DSR A;  3TJG A;  1A0R P;  5J9C A;  2GLR A;  2FA8 A;  2C0D A;  4J57 E;  2HRF A;  1DUG A;  1O7U A;  3TRQ A;  1ERW A;  2H72 A;  2FLS A;  2PU9 C;  3QAW A;  2JZS A;  5A4U A;  1VF1 A;  5D9V A;  1SK1 A;  3DYR A;  5B6N A;  2IL3 A;  2L6C A;  2LKU A;  4EXJ A;  4EDY A;  4JR4 A;  2FGX A;  4ICY A;  2TIR A;  2JZT A;  1PSQ A;  2O7K A;  4NV2 A;  2PUK C;  3HA9 A;  3LJR A;  4X43 A;  1XW6 A;  4BL7 B;  5G1K A;  5ELA A;  4TN8 A;  1SKR B;  1GLQ A;  2V1M A;  2HE3 A;  1KTE A;  2V6K A;  1HQO A;  5CNW A;  1E6B A;  4GXZ A;  3FKF A;  5KOX A;  1DBY A;  3GA4 A;  2A4V A;  2V41 A;  1GTA A;  2YWI A;  2VLU A;  1ZZY A;  3G7Y A;  2MMN A;  4Z2R A;  2H1A A;  1WP0 A;  4GQC A;  4K1F A;  1PL2 A;  5ECI B;  1X5E A;  1AQV A;  1VGL A;  3SBC A;  1K0M A;  3W6G A;  1XOB A;  3UL3 A;  3MYD A;  2VLV A;  5DQS A;  1MDI A;  2CA8 A;  3ZIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...