3C1RA

Crystal structure of oxidized grx1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
110
structure length
110
Chain Sequence
HMVSQETIKHVKDLIAENEIFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQRTVPNIYINGKHIGGNDDLQELRETGELEELLEPILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin-1
publication title Glutathionylation-triggered conformational changes of glutaredoxin Grx1 from the yeast Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 40
structure length 110
sequence length 110
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3c1rA00
4IP1A 3G7JA 2WGRA 2KP2A 4HQSA 4G10A 4EUYA 5J41A 1TI1A 2WZ9A 4LL1B 2PPTA 3FRCA 5KEJA 2DIYA 2PMTA 2F8AA 2L4CA 1Y6EA 4TR1A 4PNGA 6GSVA 1AUCA 2JZTA 1GLPA 1LBKA 1TXXA 2C3TA 2FA4A 1USBA 2OE0A 3QDNA 2B5XA 1FO5A 1PKZA 5G1KA 4EO3A 4IKHA 5IMDA 4POMA 1TOFA 2PERA 1AXDA 2OA7A 5IMFA 5AISA 4EDZA 5HR0A 3APOA 3UVTA 4PX1A 4MA9A 4NHWA 2CT6A 3AY8A 3DYRA 2C0GA 4F0BA 2YV9A 2LUSA 3M1GA 3L9VA 3W8SA 1OVNA 1VF4A 2E0QA 3NZNA 4EF0A 3IHQA 3DIEA 3LWAA 1OC9A 1OKTA 2DMMA 2MBSA 2L5LA 2G0FA 5FHIA 3GRXA 3KM6A 1O8XA 4PXOA 11GSA 1O81A 2V32A 4GSSA 2N5AA 3EU4A 3P2AA 1YQ1A 1OC8A 2HNLA 3R2QA 2FLSA 3ZLPA 1QFNA 1WE0A 5KN3A 2PUKC 1DSBA 4KB3A 2HRNA 4ECJA 2M72A 3DVXA 3TJJA 5INYA 5GSTA 3DGQA 2HZEB 1YY7A 2VM1A 3IRAA 4L0WA 3GMFA 1SJ6A 6GSYA 3TOTA 1XWAA 4RI6A 2YZUA 3APQA 3P8WA 5D9WA 1A8LA 3D4MA 3A2XA 3ZZXA 4FO5A 1U88A 2IPAA 2H0GA 4K6XA 4HU9A 3HKRA 3VI7A 2MZCA 2FA8A 3LORA 2GLRA 1XWGA 4QQ7A 1AC1A 2C3QA 1O6JA 2O7KA 1CQGA 1RK4A 4BWSA 1PL2A 1XIYA 1BX9A 3HVSA 1T7PB 6GSSA 3ZITA 2HSHA 4TR4A 4OFNA 2JSYA 1PX6A 4FYBA 2K18A 2IFQA 4PURA 3QFBC 5KN0A 2VL2A 1SD9A 4ISDA 3Q6OA 2OKAA 4F9ZA 5CP1A 2K6VA 4GRFA 2ZNMA 3US3A 2VIMA 1PA3A 3ME7A 2HE3A 2WS2A 3KEBA 1XXUA 4ZBAA 3TDGA 1ERUA 4MZCA 4PQIA 1K0OA 4MH3A 1F2EA 3F8UA 1F3BA 1HYUA 1K3OA 1ERWA 2WB9A 3IR4A 2LJKA 4XS4B 3EINA 4WR5A 1XZOA 3TGZA 1R5PA 3P7XA 4ZL7A 3ZRDA 4XTSA 1GTIA 5ECOB 1YEXA 2QKEA 4E8EA 4Q5FA 1G6YA 2JZRA 4ZBDA 1R5AA 4TXVA 3SBCA 4MH2A 5F8BA 1X9MB 2A2RA 1U3IA 1JLWA 3NIVA 1KEBA 1VF3A 1MD4A 4TRXA 1THXA 3HVVA 1FVJA 1TK5B 1MDKA 3QAVA 4ML6A 4DVCA 4O92A 3G7IA 3BJ5A 1ZYQB 1AW9A 2QSIA 3UMAA 4K9ZA 3D22A 4BL7A 1VF2A 3LEFA 3GURA 2H73A 3RBTA 3VPTA 2D2ZA 3IAM2 3F4SA 5D96A 3UJ1A 3RHCA 2L59A 3GH9A 1V57A 3C1SA 3C73A 4O7HA 1BQ7A 20GSA 2R6KA 2I1UA 3ZVJD 4MZWA 2WCIA 4OCFA 4WF5A 3ZIJA 1F6MC 2KUCA 2V1MA 2R2JA 1FVKA 4HS1A 4DEJA 4J2FA 1TI3A 1F9MA 3UEMA 4V2NA 3FK8A 4POLA 1T4ZA 3D6IA 3SWLA 2E2MA 4IJIA 5EVOA 5F05A 2C4JA 4TOPA 1R26A 3BOAA 2LNTA 3UOMA 4FYCA 2IMDA 3QOUA 1ILOA 3MWHA 1R7HA 2YWMA 4GQCA 4JZQA 1H75A 1AQVA 2O87A 4LMVA 1Z5YE 3FYGA 3APSA 4JBBA 2GQLA 3VWWA 2NTOA 4MPFA 4KDXA 2DJ2A 1A2JA 4TN8A 3H4KA 3IK7A 3L0HA 2VCXA 5B7CA 1SJZA 2GZYA 1A0RP 4HUAA 3MNGA 5IIZA 1UN2A 3UAPA 3TRXA 5DJMA 3L78A 4OD7A 4L0UA 1F3AA 2Z9SA 2EIOA 3IXRA 1TRUA 3TJKA 1JHBA 4WXTA 4V1Ag 4Z7XA 2B7JA 3GH6A 1DUGA 2LQOA 2GSRA 2WULA 3H1NA 4MLYA 4NWYA 3TKPA 2GSSA 2TRCP 1QXHA 1GSQA 5A4UA 4GCIA 1M0UA 4K2DA 3GV1A 3F9UA 1TK0B 4YQUA 3CRTA 3FR3A 1ERTA 2X8CA 1AIUA 1S3AA 1SK0A 1PD21 3A2WA 2IJYA 2MMZA 3GIXA 5IOXA 5ECQB 1JZRA 2NPBA 1HNCA 2X99A 2OE3A 2B1KA 1O7UA 2B1LA 4D73B 1SK2A 3LQ7A 2RIIA 5B8AA 1SKSB 2BJXA 1YDKA 1ZCPA 3L9UA 4PNFA 5L71A 3ZMLA 3GL3A 1YJ6A 2X64A 4IW9A 1QUWA 5AIXA 5IMVA 4KSMA 2CQ9A 1XW6A 1FW1A 2LNSA 5LNKe 1RW1A 5ELAA 1WP0A 3E9JB 4CW9A 3LYKA 4BVYA 3IE3A 2OACA 3ISOA 4TR3A 3HYPA 1E6BA 4DSSB 2P31A 2YZHA 1N2AA 1HNAA 1M2DA 1YF0A 4BPYA 4FH8A 5FWGA 1A2MA 2FGXA 5ECLB 4OFTA 5G5EA 1SKRB 4CDOA 3EMXA 4RI7A 2P5RA 4N11A 2B6MA 2O85A 1ABAA 5ELGA 2AV4A 4ULXA 3N9JA 3KTBA 1Z6NA 3F4RA 3FZ5A 2YNXA 2VCZA 1SKWB 1NHOA 1YKAA 4IQAA 4AJ7A 3CRUA 3HHVA 3KCMA 2VD1A 5KN1A 1SL2B 1U3AA 1PMTA 4YAVA 5E4WA 4GQFA 2GS3A 13GSA 2F51A 5AGYA 3ZL5A 3IPZA 4EDYA 2H1BA 2RM6A 1JZWA 2HI7A 2LRTA 3EC3A 4G9HA 1TTZA 3Q74A 4TR1B 2PN8A 7GSSA 1K3LA 1UC7A 5ECKB 3TB2A 1I5GA 4N0ZA 1MEKA 1TKDB 1T00A 4ZL9A 2YANA 3EE2A 4ECCA 2IMFA 1TW9A 4HZ2A 6GSUA 1A0FA 3H93A 5G2ZA 5DDLA 1T4YA 1EOHA 3ZFLA 4ZXGA 3F63A 5DAKA 1SYRA 1V2AA 3TKRA 2ES7A 1GSUA 1WWJA 3GNJA 5HR1A 1SJIA 1GP1A 3DD3A 4NV2A 4AJ6A 3GSSA 1YZXA 3ERGA 2F9SA 1OC9B 4GLTA 3IAS2 3GKNA 3EVIA 1DE1A 1ZL9A 3LFLA 4I2TA 3FZ9A 5D9VA 2B5EA 4XS1A 1A2LA 4OMVA 1LJRA 3FR6A 1EV4A 3KMOA 3GKXA 5ENUA 4MF7A 2P0GA 3GTUA 2KLXA 2LQQA 1WMJA 4V2LA 3IV4A 3GA4A 3KTLA 4WKWA 3J7Yk 5J9BA 4ZIJA 1TRVA 4BA7A 2CAIA 2RUFA 3VK9A 3HXSA 1OE8A 4DSQA 2C80A 2HRFA 4OO4A 3QPMA 2AAWA 1XFLA 1V9WA 1X5CA 4HJMA 4JR4A 3S9FA 2H1AA 2REMA 3U5RE 5JWQB 5ECSA 2TRXA 2CAQA 5JCGA 2RM5A 3GYKA 2IMEA 2KOKA 1BYEA 3QAWA 1M2AA 2CA8A 4ZB6A 3CTFA 1FB0A 1KNGA 4KDYA 2HFDA 3OR5A 4MJBA 2MMOA 3TKQA 2AUVA 2FNOA 2HZEA 3UARA 4PUAA 1KBNA 5IO0A 2V6OA 14GSA 3A3TA 4ZL8A 3TJGA 4IQ1A 5GZZB 1GSSA 2DC5A 5HR3A 5J3RA 3TCOA 1GLQA 5HR2A 2V41A 2MMNA 1H4OA 5DALB 2JU5A 1SD8A 2C0FA 5D73A 1ZOFA 2L57A 3M9JA 1ML6A 3GKMA 5ECPB 4N30A 1ZMAA 2H1GA 3ZMKA 1X9SB 4KGIA 3KMNA 4YH2A 2YV7A 3KP9A 1AAZA 1F37A 2E2GA 3IBHA 3LSZA 5HQPA 5GSSA 1K0BA 2B7KA 3BCKA 2EIQA 4EVMA 2GT5A 4MP4A 3UL3A 4JU5A 1XPVA 3WT1A 1WPIA 3UIWA 2X8GA 1XCCA 2DIZA 2H30A 3LYPA 1IYHA 3HVXA 2OADA 1FHEA 5G1LA 5J5NA 4I6XA 3EWLA 3EU3A 3NOFA 1Z7PA 3VFIA 1K0MA 1J08A 2WFCA 2GSQA 1X9WB 1OYJA 2VCQA 4KCAA 4HZ4A 4ZB9A 3LXTA 2YWNA 2FY6A 8GSSA 3GX8A 2AB6A 3HCZA 2R37A 1G6WA 3HZ4A 3TJFA 4MF5A 4J56E 3L9SA 4CHSA 3DKSA 5DQSA 6GSWA 5HFGA 1TJDA 1W4VA 2ZUPA 4K7NA 5D9TA 2CX3A 2FWHA 2H66A 3PGTA 5KN2A 4YQVA 4TKYA 4K0GA 3G7YA 5ECMB 1QK8A 1VGLA 5B6NA 2ON5A 4EL1A 1EOGA 3VLNA 1CQHA 4TR0A 2GTUA 2G2QA 2YJ7A 3RDWA 4K7IA 1BG5A 2I81A 2YN1A 1PL1A 1Q98A 4OCEA 2IIYA 2B3SA 1X5DA 1M9BA 2H0IA 1ON4A 2IN3A 4NHZA 5ID2A 5H5RA 4NAXA 1IYIA 2H1DA 1T8EB 2GQMA 5ECRB 5JCWA 5C04A 3C7MA 1TP9A 4MJEA 1WJKA 3C1RA 3CSJA 5EPFA 1GUMA 4JE1A 3I9V2 2H76A 3GKKA 2VLUA 3U6VA 1V98A 2VLTA 2NDOA 4K0NA 4GXZA 2K8VA 4OWYA 2LRCA 3WGDA 5A4VA 4I2UA 2EC4A 5HFIA 2M46A 2OJLA 1FOVA 1I9DA 3DVWA 3LJRA 4IGJA 4HOJA 1MD3A 5JCUA 3LGCA 5F07A 4PUFC 3KD0A 5AIVA 3DEXA 4PGTA 2DJ0A 3ZYWA 4BVXA 4YAPA 2O89A 4IHUA 3A5WA 4OO5A 5C00A 3KH7A 1Z7RA 5DJLA 3DXBA 2AJQB 1JZOA 2DLXA 1QMVA 2DSAA 1PKWA 2L6CA 1DE2A 1M9AA 3EMPA 3FEUA 1HQOA 3D5JA 4KUNA 2DJKA 2J23A 2HT9A 1B9YC 2VL3A 3TOUA 4ECIA 2VCWA 3M9KA 1ERVA 4HI7A 10GSA 5CRDA 2AHEA 2GZZA 2NBSA 1VF1A 4HDEA 4EKZA 2YP6A 1MDIA 1EEMA 3ZTLA 3HJOA 1R4WA 1MDJA 2LJAA 5GAND 1V58A 3WT2A 5LD0A 2P5QA 1QGVA 2PGTA 1BEDA 3CSHA 3PINA 3GSTA 2GSTA 1ZYEA 5JWRB 4KH7A 1PN9A 2FWEA 4KNDA 2IL3A 3ZREA 1XBSA 3JCML 2HZFA 1WIKA 3TKSA 3LXZA 2F3MA 3IA1A 2VCTA 3TRQA 4POKA 1FG4A 3G9BA 4FIWA 4WR4A 2H74A 2JSZA 5H5QA 2IMKA 3TKSE 5J9CA 4YQMA 3VWXA 3DMLA 4L8EA 3GL5A 1U6TA 4LMWA 3L4NA 3W6GA 1JZDA 4XCSA 4X1UA 3CXGA 2C0DA 1T1VA 5IO2A 3QAGA 3VWUA 3F4TA 4MMMA 3BBYA 2R5GA 3K8NA 3H79A 2MMAA 4WBJA 2VOCA 4G19A 4MK3A 1EGRA 3QMXA 3TJBA 4ECBA 1MTCA 1EWXA 3KGKA 3F6DA 3Q19A 1XOAA 4V1Ap 4DSSA 1ZGNA 2H8LA 4MJCA 1Z9HA 1YEPA 4PQ1A 3HZ8A 2O8VB 1OAZA 4LLRA 1BJXA 3BD2A 2QC7A 5ABRA 1NSWA 1EP7A 4TVEA 2PVQA 4WF4A 4KCEA 5DAKB 3ZFBA 1GRXA 4MJAA 3J7Yb 2WJUA 1GTBA 3ED3A 4TXOA 4GSNA 3HD5A 1GL8A 2H0HA 2YWIA 1TRSA 3CYNA 4L5OA 2EIRA 1X5EA 2HXKA 1JFUA 22GSA 5A5KA 2I4AA 4WEYA 1FAAA 3W8JA 3ZVJA 5D8IA 3HA9A 2XPEA 19GSA 1HD2A 4GWRA 2DBCA 2VD0A 2XPDA 9GSSA 3GTUB 3FZ4A 4X43A 3RAZA 16GSA 1SU9A 1ST9A 4BWQA 1WOUA 1ACVA 3MAKA 4QL9A 2WRTA 3PH9A 5EY6A 4KDUA 1NW2A 4JEDA 2V6KA 4ID0A 1AQWA 3FHKA 1GWCA 5HFKA 2YCDA 5G30A 5CNWA 2L6DA 3WYWA 5IQYA 2VM2A 4F03A 1PRXA 2LJRA 5DCGA 2H6YA 4IJ3A 4KW6A 1TU7A 4NMUA 2VL9A 4K7OA 3GFKA 3WD6A 4RUVA 1LU4A 2DJJA 2H6ZA 1A24A 2KP1A 1GNEA 1VRSD 2VCVA 4KAEA 1GH2A 2I3YA 3VI5A 1K0DA 5CO3A 2LS5A 4H86A 5G31A 1YF1A 4FYUA 4WETA 2OBIA 1K3YA 4GF0A 5DQYA 1TU8A 1XWKA 4RQRA 3CMIA 5CREA 1X0RA 3BCIA 4EE0A 3A2VA 2ALBA 2FUG2 1EP8A 4NXIA 5IM9A 2PU9C 2FCHA 2IFQB 2A2SA 1EV9A 1SL0B 2DJ1A 4NPBA 1O73A 6GSTA 2CZ3A 3WGXA 3QD9A 5AN1A 2VL2C 4RQXA 2LTKA 1GSEA 2MYGA 5CAXA 1J0FA 3PR8A 3M0FA 1XOBA 3O6TA 5DBQA 3CBUA 1QQ2A 2N5FA 3F6FA 4DSRA 5D93A 1E2YA 3ME8A 4E8HA 1PX7A 2JZSA 5ECIB 1M99A 3IK9A 2DMLA 4AF2A 5B6MA 3F3QA 2BMXA 5DVBA 5E59A 2M80A 5GAPD 3KP8A 2GQKA 18GSA 1Z3EA 2GGTA 1S3CA 2AYTA 5EL8A 3RHBA 1Q4JA 2VO4A 5IMZA 2H72A 5COHA 4KE3A 4HQZA 2H70A 1XVWA 3ZIVA 3DRNA 5CRHA 2LSTA 3F0IA 5CRWA 3FY7A 1WRYA 1K0CA 2CV4A 3V1WA 1SYXA 1GULA 5ECHB 1GUHA 1A23A 4P3YB 5IMCA 1SK1A 2LRNA 5JWOB 1Z6MA 4O32A 4MDCA 5F0GA 4KA0A 5DALA 2CVKA 4WBRD 1GNWA 3D4TA 3VWVA 2K9FA 4I8BA 5G5FA 2CZ2A 4GSTA 5ECNB 5H5SA 3F3RA 4LL4B 4XS4A 4HU7A 2R3XA 2VAFA 1EGOA 2DJ3A 4ZILA 4K8MA 2F8FA 2HLSA 3CSIA 3ERWA 4ILFA 3C8EA 2GDRA 2C3NA 1PSQA 3HJPA 3M8NA 2PVOC 2OE1A 1FB6A 2VUPA 3HJMA 1PGTA 1OKDA 1O85A 1B8XA 3VPQA 4IVFA 4ZBBA 2FWFA 4POBA 2CVDA 2R4VA 17GSA 3D0ZA 2IWTA 1EZKA 3TUEA 5ID2B 3HDCA 3E0UA 2L5OA 1G7EA 3ERFA 5IOWA 1GSFA 1J9BA 2YPMA 3GUSA 4NV5A 4EXJA 4MZBA 2L4QA 4K1FA 3EYTA 4GTUA 4XIHA 4HJ2A 4Q5RA 1RQMA 1C72A 4HEA2 1B4QA 1B9XC 1THOA 2V2GA 5IPHA 1PQNA 1ZZYA 4ML1A 4Q5NA 1G7OA 2MBTA 3DWVA 3P90A 6GSXA 2YWOA 2HSYA 5CRGA 4X0XA 1B48A 1TK8B 2XBIA 4MABA 4LA1A 1OE7A 4IP6A 3GHAA 12GSA 2B5YA 2FD3A 1UA5A 3M3MA 3D21A 1DBYA 2C0EA 2K8SA 2N5BA 2CVBA 2GZPA 1B4PA 3H8QA 2XBQA 4IELA 2KHPA 2H6XA 2C8UA 2PBJA 1A8YA 2H01A 1URMA 1K0AA 1KTEA 1GTUA 4N10A 3O76A 4XRDA 3TRPA 2WDUA 1M7TA 1N8JA 2LEGA 3FR9A 1YKCA 4TW5A 2YOIA 3QFAC 1SENA 3RPPA 4N0VA 2LKUA 3GN3A 3VURA 4Q5QA 2RUEA 1O8WA 4MPGA 3I69A 1NHYA 3KZQA 5J4UA 1GTAA 4V2MA 4QL7A 3HY2A 2HYXA 2PWJA 4ACSA 2BTOT 1HNBA 1OC3A 3Q18A 3LG6A 1V40A 3I6AA 5IPGA 3MDKA 1GSDA 1UVZA 1TRWA 3IOSA 3TKSC 5D9XA 5F06A 1BAYA 3FZAA 4AJ8A 2TIRA 4O5RA 2H19A 4F2IA 4PQHA 2VLVA 1XW9A 2FWGA 1S3DA 1Y25A 3O3TA 4XS6A 3E3EA 1U87A 1EEJA 4D73A 3UVHA 1NM3A 4OFMA 2NVLA 3UBKA 3CTGA 4EC0A 5FT3A 5DCHA 2LV3A 1XVQA 2I9HA 2GVPA 3RPNA 2X8HA 4L5LA 2ON7A 2JL4A 4JR6A 3KJYA 4AGSA 4F0CA 2RLIA 2GT6A 4MF6A 2CX4A 4IBPA 4IN0A 3GX0A 1T3BA 1M2BA 2ZCTA 2IMIA 3UBLA 4G2EA 2E7PA 4F82A 4MCUA 2JADA 3WGEA 1G0TA 1JLVA 2A4VA 4KSOA 5A4WA 2C1YA 4IS0A 1W89A 4XRAA 3KIJA 2J9HA 5CYYA 2QGVA 1XWCA 4TXOB 4I97A 3MSZA 2FHEA 2XC2A 3N5OA 2H71A 2YJHA 3I43A 2JACA 1K0NA 3KXOA 5IMAA 1XWBA 2OBKA 4J57E 3C71A 2XHFA 3KH9A 1SL1B 4KX4A 3QR6A 3FW2A 1GSYA 5LCZA 1AQXA 4I5QA 2H75A 1TDIA 1GUKA 4ZB8A 4JRRA 3EURA 5B8BA 3QCPA 3FKFA 3IC4A 1XW5A 3IDVA 4XHMA
chains in the Genus database with same CATH superfamily
1PFOA 4IP1A 3G7JA 2WGRA 2KP2A 4HQSA 4G10A 4EUYA 5J41A 1TI1A 2WZ9A 4LL1B 2PPTA 3FRCA 5KEJA 2DIYA 2PMTA 2F8AA 2L4CA 1Y6EA 4TR1A 4PNGA 6GSVA 2A2PA 1AUCA 2JZTA 1GLPA 1LBKA 2HSMA 1TXXA 2C3TA 2FA4A 1USBA 2OE0A 3QDNA 2B5XA 1FO5A 1PKZA 5G1KA 4EO3A 3CQFA 4IKHA 5IMDA 4POMA 4Z2UA 1TOFA 2PERA 1AXDA 3HVNA 2OA7A 5IMFA 5AISA 4EDZA 5HR0A 3APOA 3UVTA 4PX1A 4MA9A 4NHWA 2CT6A 3AY8A 3DYRA 2C0GA 4F0BA 2YV9A 2LUSA 3M1GA 3L9VA 3W8SA 1OVNA 1VF4A 2E0QA 3NZNA 4EF0A 3IHQA 3DIEA 3LWAA 1OC9A 1OKTA 2DMMA 2MBSA 2L5LA 2A4HA 2G0FA 5FHIA 3GRXA 3KM6A 1O8XA 4PXOA 11GSA 1O81A 2V32A 4GSSA 2N5AA 3EU4A 3P2AA 1YQ1A 1OC8A 2HNLA 3R2QA 2FLSA 3ZLPA 1QFNA 1WE0A 5KN3A 2PUKC 1DSBA 4KB3A 2HRNA 4ECJA 2M72A 3DVXA 3TJJA 5INYA 5GSTA 3DGQA 2HZEB 4PTSA 1YY7A 2VM1A 3IRAA 4L0WA 3GMFA 1SJ6A 6GSYA 3TOTA 4USSA 1XWAA 4RI6A 2YZUA 3APQA 3P8WA 5D9WA 1A8LA 3D4MA 3A2XA 3ZZXA 4FO5A 1U88A 2IPAA 2H0GA 4K6XA 4HU9A 3HKRA 3VI7A 2MZCA 2FA8A 3LORA 2GLRA 1XWGA 4QQ7A 1AC1A 2C3QA 1O6JA 2O7KA 1CQGA 1RK4A 2QA1A 4BWSA 1PL2A 1XIYA 1BX9A 3HVSA 1T7PB 6GSSA 3ZITA 2HSHA 4TR4A 4OFNA 2JSYA 1PX6A 4FYBA 2K18A 2IFQA 4PURA 3QFBC 5KN0A 2VL2A 1SD9A 4ISDA 4K5RA 3Q6OA 2OKAA 4F9ZA 5CP1A 2K6VA 4GRFA 2ZNMA 4FQUA 3A5IA 3US3A 2VIMA 1PA3A 3ME7A 2HE3A 2WS2A 3KEBA 1XXUA 4ZBAA 3TDGA 1ERUA 4MZCA 4PQIA 1ZYPA 1K0OA 4MH3A 1F2EA 3F8UA 1F3BA 1HYUA 1K3OA 1ERWA 2WB9A 3IR4A 2LJKA 4XS4B 4WR5A 3EINA 2R0CA 1XZOA 3TGZA 1R5PA 3P7XA 4ZL7A 3ZRDA 4XTSA 1GTIA 5ECOB 1YEXA 2QKEA 4E8EA 4Q5FA 1G6YA 2JZRA 4ZBDA 1R5AA 4TXVA 3SBCA 4MH2A 5F8BA 1X9MB 2A2RA 1U3IA 1JLWA 3NIVA 1KEBA 1VF3A 1MD4A 4TRXA 1THXA 3HVVA 1FVJA 1TK5B 1MDKA 3QAVA 4ML6A 4DVCA 4O92A 3G7IA 3BJ5A 1ZYQB 1AW9A 2QSIA 3UMAA 4K9ZA 3D22A 4BL7A 1VF2A 2DKIA 3LEFA 3GURA 2H73A 3RBTA 3VPTA 2D2ZA 3IAM2 3F4SA 5D96A 3UJ1A 3RHCA 2L59A 3GH9A 1V57A 3C1SA 3C73A 4O7HA 1BQ7A 20GSA 2R6KA 2I1UA 3ZVJD 4MZWA 2WCIA 4OCFA 4WF5A 3ZIJA 4G0KA 1F6MC 2KUCA 2V1MA 2R2JA 1FVKA 4HS1A 4DEJA 4J2FA 1TI3A 1F9MA 3UEMA 4V2NA 3FK8A 4POLA 4YKGA 1T4ZA 3D6IA 3SWLA 2E2MA 4IJIA 4BIKA 5EVOA 2R0GA 5F05A 2C4JA 4TOPA 1R26A 3BOAA 2LNTA 3UOMA 4FYCA 2IMDA 3QOUA 1ILOA 3MWHA 1R7HA 2YWMA 4GQCA 4JZQA 1H75A 1AQVA 2O87A 4LMVA 1Z5YE 3FYGA 3MIXA 3APSA 4JBBA 2GQLA 3VWWA 2NTOA 4MPFA 4KDXA 2DJ2A 1A2JA 4TN8A 3H4KA 3IK7A 3L0HA 2VCXA 5B7CA 1SJZA 5KOXA 2GZYA 1A0RP 4HUAA 3MNGA 5IIZA 1UN2A 1ZYNA 3UAPA 3TRXA 3IHGA 5DJMA 3L78A 2QA2A 4OD7A 4L0UA 1F3AA 2Z9SA 2EIOA 3IXRA 1TRUA 3TJKA 1JHBA 4WXTA 4V1Ag 4Z7XA 2B7JA 3GH6A 1DUGA 2LQOA 2GSRA 2WULA 5BMUA 3H1NA 4MLYA 4NWYA 3TKPA 2GSSA 2TRCP 1QXHA 1GSQA 5A4UA 4GCIA 1M0UA 4K2DA 3GV1A 3F9UA 1TK0B 4K5SA 4YQUA 3CRTA 3FR3A 1ERTA 2X8CA 1AIUA 1S3AA 1SK0A 1PD21 3A2WA 2IJYA 2MMZA 3GIXA 5IOXA 5ECQB 1JZRA 2NPBA 1HNCA 2X99A 2OE3A 2B1KA 1O7UA 2B1LA 4D73B 1SK2A 3LQ7A 2RIIA 5B8AA 1SKSB 2BJXA 1YDKA 1ZCPA 3L9UA 4PNFA 5L71A 3ZMLA 3GL3A 1YJ6A 2X64A 4IW9A 1QUWA 5AIXA 5IMVA 4KSMA 2CQ9A 1XW6A 1FW1A 2LNSA 5LNKe 1RW1A 5ELAA 1WP0A 3E9JB 4CW9A 3LYKA 4BVYA 3IE3A 2OACA 3ISOA 4TR3A 3HYPA 1E6BA 4DSSB 2P31A 2YZHA 1N2AA 1HNAA 1M2DA 1YF0A 4BPYA 4FH8A 5FWGA 1A2MA 2FGXA 5ECLB 4OFTA 5G5EA 1SKRB 4CDOA 3EMXA 4RI7A 2P5RA 4N11A 2B6MA 2O85A 1ABAA 5ELGA 2AV4A 4ULXA 3N9JA 3KTBA 1Z6NA 3F4RA 4X4JA 3FZ5A 2YNXA 2VCZA 1SKWB 1NHOA 1YKAA 4IQAA 4AJ7A 3CRUA 3HHVA 3KCMA 2VD1A 5KN1A 1SL2B 1U3AA 1PMTA 4YAVA 5E4WA 4GQFA 2GS3A 13GSA 2F51A 5AGYA 3ZL5A 3IPZA 4EDYA 2H1BA 2RM6A 1JZWA 2HI7A 2LRTA 4HSCX 3EC3A 4G9HA 1TTZA 3Q74A 4TR1B 2PN8A 7GSSA 1K3LA 1UC7A 5ECKB 3TB2A 1I5GA 4N0ZA 2R0PA 1MEKA 1TKDB 1T00A 4ZL9A 2YANA 3EE2A 4ECCA 2IMFA 1TW9A 4HZ2A 6GSUA 1A0FA 3H93A 5G2ZA 5DDLA 1T4YA 1EOHA 3ZFLA 4ZXGA 3F63A 4Z2RA 5DAKA 1SYRA 1V2AA 3TKRA 2ES7A 1GSUA 1WWJA 3GNJA 5HR1A 1SJIA 1GP1A 3DD3A 4NV2A 4AJ6A 3GSSA 1YZXA 3ERGA 2F9SA 1OC9B 3R3EA 4GLTA 3IAS2 3GKNA 3EVIA 2HRKA 1DE1A 1ZL9A 3LFLA 4I2TA 3FZ9A 5D9VA 2B5EA 4XS1A 3MYDA 1A2LA 4OMVA 1LJRA 3FR6A 1EV4A 3KMOA 3GKXA 5ENUA 4MF7A 2P0GA 3GTUA 2KLXA 2LQQA 1WMJA 4V2LA 3IV4A 3GA4A 3KTLA 4WKWA 3J7Yk 5J9BA 4ZIJA 1TRVA 4BA7A 2CAIA 2RUFA 3VK9A 3HXSA 1OE8A 4DSQA 2C80A 2HRFA 5KOWA 4OO4A 3QPMA 2AAWA 1XFLA 1V9WA 1X5CA 4HJMA 4JR4A 3S9FA 2H1AA 2REMA 3U5RE 5JWQB 5ECSA 2TRXA 2CAQA 5JCGA 2RM5A 3GYKA 4MNNA 2IMEA 2KOKA 1BYEA 3QAWA 1M2AA 2CA8A 4ZB6A 3CTFA 1FB0A 1KNGA 4KDYA 2HFDA 3OR5A 4MJBA 5BRTA 2MMOA 3TKQA 2AUVA 4YKFA 2FNOA 2HZEA 3UARA 4G0LA 4PUAA 1KBNA 5IO0A 2V6OA 14GSA 3A3TA 4ZL8A 3TJGA 4IQ1A 4A5PA 5GZZB 1GSSA 2DC5A 5HR3A 5J3RA 3TCOA 1GLQA 5HR2A 2V41A 2MMNA 1H4OA 5DALB 2JU5A 1SD8A 2C0FA 5D73A 1ZOFA 2L57A 3M9JA 1ML6A 3GKMA 5ECPB 4N30A 1ZMAA 2H1GA 3ZMKA 1X9SB 4KGIA 3KMNA 4YH2A 2YV7A 3KP9A 1AAZA 1F37A 2E2GA 3IBHA 3LSZA 4Z2TA 5HQPA 5GSSA 1K0BA 2B7KA 3BCKA 2EIQA 4EVMA 2GT5A 4MP4A 3UL3A 4JU5A 1XPVA 4BL7B 3WT1A 1WPIA 3UIWA 2X8GA 1XCCA 2DIZA 2H30A 3LYPA 1IYHA 3HVXA 2OADA 1FHEA 5G1LA 5J5NA 4O5QA 4I6XA 3EWLA 3EU3A 3NOFA 1Z7PA 3VFIA 1K0MA 1J08A 2WFCA 2GSQA 1X9WB 1OYJA 2VCQA 4CY8A 4KCAA 4HZ4A 4ZB9A 3LXTA 2YWNA 2FY6A 8GSSA 3GX8A 2AB6A 3HCZA 2R37A 1G6WA 3HZ4A 3TJFA 4MF5A 4J56E 3L9SA 4CHSA 3DKSA 5DQSA 6GSWA 5HFGA 1TJDA 1W4VA 2ZUPA 4K7NA 5D9TA 2CX3A 2FWHA 2H66A 3PGTA 5KN2A 4YQVA 1M3JA 4TKYA 4K0GA 3G7YA 5ECMB 1QK8A 1VGLA 5B6NA 2ON5A 4EL1A 1EOGA 3VLNA 1CQHA 4TR0A 2GTUA 2G2QA 2YJ7A 3RDWA 4K7IA 1BG5A 2I81A 2YN1A 1PL1A 1Q98A 4OCEA 2IIYA 2B3SA 1X5DA 1M9BA 2H0IA 1ON4A 2IN3A 4NHZA 5ID2A 4CY6A 5H5RA 4NAXA 1IYIA 2H1DA 1T8EB 2GQMA 5ECRB 5JCWA 5C04A 3C7MA 1TP9A 4MJEA 1WJKA 3C1RA 3CSJA 5EPFA 1GUMA 4JE1A 3I9V2 2H76A 3GKKA 2VLUA 3U6VA 1V98A 2VLTA 2NDOA 4K0NA 4GXZA 2K8VA 4OWYA 2LRCA 3WGDA 5A4VA 4I2UA 2EC4A 5HFIA 2M46A 2OJLA 1FOVA 1I9DA 3DVWA 3LJRA 4IGJA 4HOJA 1MD3A 5JCUA 3LGCA 5F07A 4PUFC 3KD0A 5AIVA 3DEXA 4PGTA 2DJ0A 3ZYWA 4BVXA 4YAPA 2O89A 4IHUA 3A5WA 4OO5A 5C00A 3KH7A 1Z7RA 5DJLA 3DXBA 2AJQB 1JZOA 2DLXA 1QMVA 2DSAA 1PKWA 2L6CA 1DE2A 3EPTA 2X49A 1M9AA 3EMPA 3FEUA 1HQOA 3D5JA 4KUNA 2DJKA 2J23A 2HT9A 1B9YC 2VL3A 3TOUA 4ECIA 2VCWA 3M9KA 1ERVA 4HI7A 10GSA 5CRDA 2AHEA 2GZZA 2NBSA 1VF1A 4HDEA 4EKZA 2YP6A 1MDIA 1EEMA 3ZTLA 3HJOA 1R4WA 1MDJA 2LJAA 5GAND 1V58A 3WT2A 5LD0A 2P5QA 1QGVA 2PGTA 1BEDA 3CSHA 3PINA 3GSTA 2GSTA 1ZYEA 5JWRB 4KH7A 1PN9A 2FWEA 4KNDA 2IL3A 3ZREA 1XBSA 3JCML 2HZFA 1WIKA 3TKSA 3LXZA 2F3MA 3IA1A 2VCTA 3TRQA 4POKA 1FG4A 3G9BA 4FIWA 4WR4A 2H74A 2JSZA 5H5QA 2IMKA 3TKSE 4EIQA 5J9CA 4YQMA 3VWXA 3DMLA 4L8EA 3GL5A 1U6TA 4LMWA 3L4NA 3W6GA 1JZDA 4XCSA 4X1UA 3CXGA 2C0DA 1T1VA 5IO2A 3QAGA 3VWUA 3F4TA 4MMMA 3BBYA 2R5GA 3K8NA 3H79A 2MMAA 4WBJA 2VOCA 4G19A 4MK3A 1EGRA 3QMXA 3TJBA 4ECBA 1MTCA 1EWXA 3KGKA 3F6DA 3Q19A 1XOAA 3LW9A 4V1Ap 4DSSA 1S3RA 1ZGNA 2H8LA 4MJCA 1Z9HA 1YEPA 4PQ1A 3HZ8A 2O8VB 3PPUA 1OAZA 4LLRA 1BJXA 3BD2A 2QC7A 5ABRA 1NSWA 1EP7A 4TVEA 2PVQA 4WF4A 4KCEA 5DAKB 3ZFBA 1XG8A 1GRXA 4MJAA 3J7Yb 2WJUA 1GTBA 3ED3A 4TXOA 4GSNA 3HD5A 1GL8A 3IC8A 2H0HA 2YWIA 1TRSA 3CYNA 4L5OA 2EIRA 1X5EA 2HXKA 1JFUA 22GSA 2X4AA 5A5KA 2I4AA 4WEYA 1FAAA 3W8JA 3ZVJA 5D8IA 3HA9A 2XPEA 19GSA 1HD2A 4GWRA 2DBCA 2VD0A 2XPDA 9GSSA 3GTUB 3FZ4A 4X43A 3RAZA 16GSA 1SU9A 1ST9A 4BWQA 2UZ8A 1WOUA 1ACVA 3MAKA 4QL9A 2WRTA 3PH9A 5EY6A 4KDUA 1NW2A 4JEDA 2V6KA 4ID0A 1AQWA 3FHKA 1GWCA 5HFKA 2YCDA 5G30A 5CNWA 2L6DA 3WYWA 5IQYA 2VM2A 4F03A 1PRXA 2LJRA 5DCGA 2H6YA 4IJ3A 4KW6A 1TU7A 4NMUA 2VL9A 4K7OA 3GFKA 3WD6A 4RUVA 1LU4A 2DJJA 4EIPA 2H6ZA 1PN0A 1A24A 2KP1A 1GNEA 1VRSD 2VCVA 4KAEA 1GH2A 2I3YA 3VI5A 1K0DA 5CO3A 2LS5A 4H86A 5G31A 1YF1A 4FYUA 4WETA 2OBIA 1K3YA 4GF0A 5DQYA 1TU8A 1XWKA 4RQRA 3CMIA 5CREA 1X0RA 3BCIA 4EE0A 3A2VA 2ALBA 2FUG2 1EP8A 4NXIA 5IM9A 2PU9C 2FCHA 2IFQB 2A2SA 1EV9A 1SL0B 2DJ1A 4NPBA 1O73A 6GSTA 2CZ3A 3WGXA 3QD9A 5AN1A 2VL2C 4RQXA 2LTKA 1GSEA 2MYGA 5CAXA 1J0FA 3PR8A 3M0FA 1XOBA 3O6TA 5DBQA 3CBUA 1QQ2A 2N5FA 4G0IA 3F6FA 4DSRA 5D93A 1E2YA 3ME8A 4E8HA 1PX7A 2JZSA 5ECIB 1M99A 3IK9A 2DMLA 4AF2A 5B6MA 3F3QA 2BMXA 3FMWA 5DVBA 5E59A 2M80A 5GAPD 3KP8A 2GQKA 18GSA 1Z3EA 2GGTA 1S3CA 2AYTA 5EL8A 3RHBA 1Q4JA 2VO4A 5IMZA 2H72A 5COHA 4KE3A 4HQZA 2H70A 1XVWA 3ZIVA 3DRNA 5CRHA 2LSTA 3F0IA 5CRWA 3FY7A 1WRYA 1K0CA 2CV4A 3V1WA 1SYXA 1GULA 5ECHB 1GUHA 1A23A 4P3YB 5IMCA 1SK1A 2LRNA 5JWOB 1Z6MA 4O32A 4MDCA 5F0GA 4KA0A 5DALA 2CVKA 4WBRD 1GNWA 3D4TA 3VWVA 2K9FA 4I8BA 5G5FA 2CZ2A 4GSTA 5ECNB 5H5SA 3F3RA 4LL4B 4XS4A 4HU7A 2R3XA 2VAFA 1EGOA 2DJ3A 4ZILA 4K8MA 2F8FA 2HLSA 3CSIA 3ERWA 4ILFA 3C8EA 2GDRA 2C3NA 1PSQA 3HJPA 3M8NA 2PVOC 2OE1A 1FB6A 2VUPA 3HJMA 1PGTA 1OKDA 1O85A 1B8XA 3VPQA 4IVFA 4ZBBA 2FWFA 4POBA 2CVDA 2R4VA 17GSA 3D0ZA 2IWTA 1EZKA 3TUEA 5ID2B 3HDCA 3E0UA 2L5OA 1G7EA 3ERFA 5IOWA 1GSFA 1J9BA 2YPMA 3GUSA 4NV5A 4EXJA 4MZBA 2L4QA 4K1FA 3EYTA 4GTUA 4XIHA 4HJ2A 4Q5RA 1RQMA 1C72A 4HEA2 1B4QA 1B9XC 1THOA 2V2GA 5IPHA 1PQNA 1ZZYA 4ML1A 4Q5NA 1G7OA 2MBTA 3DWVA 3P90A 6GSXA 2YWOA 2HSYA 5CRGA 4X0XA 1B48A 1TK8B 2XBIA 4MABA 4LA1A 1OE7A 4IP6A 3GHAA 12GSA 2HRAA 2B5YA 2FD3A 1UA5A 3M3MA 3D21A 1DBYA 2C0EA 2K8SA 4BVXB 2N5BA 2CVBA 2GZPA 1B4PA 3H8QA 2XBQA 4IELA 4ICYA 2KHPA 2H6XA 2C8UA 2PBJA 1A8YA 2H01A 1URMA 1K0AA 1KTEA 1GTUA 4N10A 3O76A 4XRDA 3TRPA 2WDUA 1M7TA 1N8JA 2LEGA 3FR9A 1YKCA 4TW5A 2YOIA 3QFAC 1SENA 2DKHA 3RPPA 4N0VA 2LKUA 1FOHA 3GN3A 3VURA 4Q5QA 2RUEA 1O8WA 4MPGA 3I69A 1NHYA 3KZQA 5J4UA 1GTAA 4V2MA 4QL7A 3HY2A 2HYXA 2PWJA 4ACSA 2BTOT 1HNBA 1OC3A 4BVYB 3Q18A 3LG6A 1V40A 3I6AA 5IPGA 3MDKA 1GSDA 1UVZA 1TRWA 3IOSA 3TKSC 5D9XA 5F06A 1BAYA 3FZAA 4AJ8A 2TIRA 4O5RA 2H19A 4F2IA 4PQHA 2VLVA 1XW9A 2FWGA 1S3DA 1Y25A 3O3TA 4XS6A 3E3EA 1U87A 4K2XA 1EEJA 4D73A 3UVHA 1NM3A 4OFMA 2NVLA 3UBKA 3CTGA 4EC0A 5FT3A 5DCHA 2LV3A 1XVQA 2I9HA 2GVPA 3RPNA 2X8HA 4L5LA 2ON7A 1M3IA 2JL4A 4JR6A 3KJYA 4AGSA 4O5UA 2RLIA 4F0CA 2GT6A 4MF6A 2CX4A 4IBPA 4IN0A 3GX0A 1T3BA 1M2BA 2ZCTA 2IMIA 3UBLA 4G2EA 2E7PA 4F82A 4MCUA 2JADA 3WGEA 1G0TA 1JLVA 2A4VA 4KSOA 5A4WA 2C1YA 4IS0A 1W89A 4XRAA 3KIJA 2J9HA 5CYYA 2QGVA 1XWCA 4TXOB 4I97A 3MSZA 4KF9A 2FHEA 2XC2A 3N5OA 2H71A 2YJHA 3I43A 2JACA 1K0NA 3KXOA 5IMAA 1XWBA 2OBKA 4J57E 3C71A 2XHFA 3KH9A 1SL1B 4KX4A 3QR6A 3FW2A 1GSYA 5LCZA 1AQXA 4I5QA 2H75A 1TDIA 1GUKA 4ZB8A 4JRRA 3EURA 5B8BA 3QCPA 3FKFA 3IC4A 1XW5A 3IDVA 4XHMA
chains in the Genus database with same CATH topology
4IP1A 3G7JA 2WGRA 2KP2A 4HQSA 4G10A 4EUYA 5J41A 1TI1A 2WZ9A 4LL1B 2PPTA 3FRCA 5KEJA 2DIYA 2PMTA 2F8AA 2L4CA 1Y6EA 4TR1A 4PNGA 6GSVA 2A2PA 1AUCA 2JZTA 1GLPA 1LBKA 2HSMA 1TXXA 2C3TA 2FA4A 1USBA 2OE0A 3QDNA 2B5XA 1FO5A 1PKZA 5G1KA 4EO3A 4IKHA 5IMDA 4POMA 4Z2UA 1TOFA 2PERA 1AXDA 2OA7A 5IMFA 5AISA 4EDZA 5HR0A 3APOA 3UVTA 4PX1A 4MA9A 4NHWA 2CT6A 3AY8A 3DYRA 2C0GA 4F0BA 2YV9A 2LUSA 3M1GA 3L9VA 3W8SA 1OVNA 1VF4A 2E0QA 3NZNA 4EF0A 3IHQA 3DIEA 3LWAA 1OC9A 1OKTA 2DMMA 2MBSA 2L5LA 2A4HA 2G0FA 5FHIA 3GRXA 3KM6A 1O8XA 4PXOA 11GSA 1O81A 2V32A 4GSSA 2N5AA 3EU4A 3P2AA 1YQ1A 1OC8A 2HNLA 3R2QA 2FLSA 3ZLPA 1QFNA 1WE0A 5KN3A 2PUKC 1DSBA 4KB3A 2HRNA 4ECJA 2M72A 3DVXA 3TJJA 5INYA 5GSTA 3DGQA 2HZEB 4PTSA 1YY7A 2VM1A 3IRAA 4L0WA 3GMFA 1SJ6A 6GSYA 3TOTA 4USSA 1XWAA 4RI6A 2YZUA 3APQA 3P8WA 5D9WA 1A8LA 3D4MA 3A2XA 3ZZXA 4FO5A 1U88A 2IPAA 2H0GA 4K6XA 4HU9A 3HKRA 3VI7A 2MZCA 2FA8A 3LORA 2GLRA 1XWGA 4QQ7A 1AC1A 2C3QA 1O6JA 2O7KA 1CQGA 1RK4A 2QA1A 4BWSA 1PL2A 1XIYA 1BX9A 3HVSA 1T7PB 6GSSA 3ZITA 2HSHA 4TR4A 4OFNA 2JSYA 1PX6A 4FYBA 2K18A 2IFQA 4PURA 3QFBC 5KN0A 2VL2A 1SD9A 4ISDA 4K5RA 3Q6OA 2OKAA 4F9ZA 5CP1A 2K6VA 4GRFA 2ZNMA 4FQUA 3A5IA 3US3A 2VIMA 1PA3A 3ME7A 2HE3A 2WS2A 3KEBA 1XXUA 4ZBAA 3TDGA 1ERUA 4MZCA 4PQIA 1ZYPA 1K0OA 4MH3A 1F2EA 3F8UA 1F3BA 1HYUA 1K3OA 1ERWA 2WB9A 3IR4A 2LJKA 4XS4B 4WR5A 3EINA 2R0CA 1XZOA 3TGZA 1R5PA 3P7XA 4ZL7A 3ZRDA 4XTSA 1GTIA 5ECOB 1YEXA 2QKEA 4E8EA 4Q5FA 1G6YA 2JZRA 4ZBDA 1R5AA 4TXVA 3SBCA 4MH2A 5F8BA 1X9MB 2A2RA 1U3IA 1JLWA 3NIVA 1KEBA 1VF3A 1MD4A 4TRXA 1THXA 3HVVA 1FVJA 1TK5B 1MDKA 3QAVA 4ML6A 4DVCA 4O92A 3G7IA 3BJ5A 1ZYQB 1AW9A 2QSIA 3UMAA 4K9ZA 3D22A 4BL7A 1VF2A 2DKIA 3LEFA 3GURA 2H73A 3RBTA 3VPTA 2D2ZA 3IAM2 3F4SA 5D96A 3UJ1A 3RHCA 2L59A 3GH9A 1V57A 3C1SA 3C73A 4O7HA 1BQ7A 20GSA 2R6KA 2I1UA 3ZVJD 4MZWA 2WCIA 4OCFA 4WF5A 3ZIJA 4G0KA 1F6MC 2KUCA 2V1MA 2R2JA 1FVKA 4HS1A 4DEJA 4J2FA 1TI3A 1F9MA 3UEMA 4V2NA 3FK8A 4POLA 4YKGA 1T4ZA 3D6IA 3SWLA 2E2MA 4IJIA 5EVOA 2R0GA 5F05A 2C4JA 4TOPA 1R26A 3BOAA 2LNTA 3UOMA 4FYCA 2IMDA 3QOUA 1ILOA 3MWHA 1R7HA 2YWMA 4GQCA 4JZQA 1H75A 1AQVA 2O87A 4LMVA 1Z5YE 3FYGA 3MIXA 3APSA 4JBBA 2GQLA 3VWWA 2NTOA 4MPFA 4KDXA 2DJ2A 1A2JA 4TN8A 3H4KA 3IK7A 3L0HA 2VCXA 5B7CA 1SJZA 5KOXA 2GZYA 1A0RP 4HUAA 3MNGA 5IIZA 1UN2A 1ZYNA 3UAPA 3TRXA 3IHGA 5DJMA 3L78A 2QA2A 4OD7A 4L0UA 1F3AA 2Z9SA 2EIOA 3IXRA 1TRUA 3TJKA 1JHBA 4WXTA 4V1Ag 4Z7XA 2B7JA 3GH6A 1DUGA 2LQOA 2GSRA 2WULA 5BMUA 3H1NA 4MLYA 4NWYA 3TKPA 2GSSA 2TRCP 1QXHA 1GSQA 5A4UA 4GCIA 1M0UA 4K2DA 3GV1A 3F9UA 1TK0B 4K5SA 4YQUA 3CRTA 3FR3A 1ERTA 2X8CA 1AIUA 1S3AA 1SK0A 1PD21 3A2WA 2IJYA 2MMZA 3GIXA 5IOXA 5ECQB 1JZRA 2NPBA 1HNCA 2X99A 2OE3A 2B1KA 1O7UA 2B1LA 4D73B 1SK2A 3LQ7A 2RIIA 5B8AA 1SKSB 2BJXA 1YDKA 1ZCPA 3L9UA 4PNFA 5L71A 3ZMLA 3GL3A 1YJ6A 2X64A 4IW9A 1QUWA 5AIXA 5IMVA 4KSMA 2CQ9A 1XW6A 1FW1A 2LNSA 5LNKe 1RW1A 5ELAA 1WP0A 3E9JB 4CW9A 3LYKA 4BVYA 3IE3A 2OACA 3ISOA 4TR3A 3HYPA 1E6BA 4DSSB 2P31A 2YZHA 1N2AA 1HNAA 1M2DA 1YF0A 4BPYA 4FH8A 5FWGA 1A2MA 2FGXA 5ECLB 4OFTA 5G5EA 1SKRB 4CDOA 3EMXA 4RI7A 2P5RA 4N11A 2B6MA 2O85A 1ABAA 5ELGA 2AV4A 4ULXA 3N9JA 3KTBA 1Z6NA 3F4RA 4X4JA 3FZ5A 2YNXA 2VCZA 1SKWB 1NHOA 1YKAA 4IQAA 4AJ7A 3CRUA 3HHVA 3KCMA 2VD1A 5KN1A 1SL2B 1U3AA 1PMTA 4YAVA 5E4WA 4GQFA 2GS3A 13GSA 2F51A 5AGYA 3ZL5A 3IPZA 4EDYA 2H1BA 2RM6A 1JZWA 2HI7A 2LRTA 3EC3A 4G9HA 1TTZA 3Q74A 4TR1B 2PN8A 7GSSA 1K3LA 1UC7A 5ECKB 3TB2A 1I5GA 4N0ZA 2R0PA 1MEKA 1TKDB 1T00A 4ZL9A 2YANA 3EE2A 4ECCA 2IMFA 1TW9A 4HZ2A 6GSUA 1A0FA 3H93A 5G2ZA 5DDLA 1T4YA 1EOHA 3ZFLA 4ZXGA 3F63A 4Z2RA 5DAKA 1SYRA 1V2AA 3TKRA 2ES7A 1GSUA 1WWJA 3GNJA 5HR1A 1SJIA 1GP1A 3DD3A 4NV2A 4AJ6A 3GSSA 1YZXA 3ERGA 2F9SA 1OC9B 3R3EA 4GLTA 3IAS2 3GKNA 3EVIA 2HRKA 1DE1A 1ZL9A 3LFLA 4I2TA 3FZ9A 5D9VA 2B5EA 4XS1A 3MYDA 1A2LA 4OMVA 1LJRA 3FR6A 1EV4A 3KMOA 3GKXA 5ENUA 4MF7A 2P0GA 3GTUA 2KLXA 2LQQA 1WMJA 4V2LA 3IV4A 3GA4A 3KTLA 4WKWA 3J7Yk 5J9BA 4ZIJA 1TRVA 4BA7A 2CAIA 2RUFA 3VK9A 3HXSA 1OE8A 4DSQA 2C80A 2HRFA 5KOWA 4OO4A 3QPMA 2AAWA 1XFLA 1V9WA 1X5CA 4HJMA 4JR4A 3S9FA 2H1AA 2REMA 3U5RE 5JWQB 5ECSA 2TRXA 2CAQA 5JCGA 2RM5A 3GYKA 4MNNA 2IMEA 2KOKA 1BYEA 3QAWA 1M2AA 2CA8A 4ZB6A 3CTFA 1FB0A 1KNGA 4KDYA 2HFDA 3OR5A 4MJBA 5BRTA 2MMOA 3TKQA 2AUVA 4YKFA 2FNOA 2HZEA 3UARA 4G0LA 4PUAA 1KBNA 5IO0A 2V6OA 14GSA 3A3TA 4ZL8A 3TJGA 4IQ1A 4A5PA 5GZZB 1GSSA 2DC5A 5HR3A 5J3RA 3TCOA 1GLQA 5HR2A 2V41A 2MMNA 1H4OA 5DALB 2JU5A 1SD8A 2C0FA 5D73A 1ZOFA 2L57A 3M9JA 1ML6A 3GKMA 5ECPB 4N30A 1ZMAA 2H1GA 3ZMKA 1X9SB 4KGIA 3KMNA 4YH2A 2YV7A 3KP9A 1AAZA 1F37A 2E2GA 3IBHA 3LSZA 4Z2TA 5HQPA 5GSSA 1K0BA 2B7KA 3BCKA 2EIQA 4EVMA 2GT5A 4MP4A 3UL3A 4JU5A 1XPVA 4BL7B 3WT1A 1WPIA 3UIWA 2X8GA 1XCCA 2DIZA 2H30A 3LYPA 1IYHA 3HVXA 2OADA 1FHEA 5G1LA 5J5NA 4O5QA 4I6XA 3EWLA 3EU3A 3NOFA 1Z7PA 3VFIA 1K0MA 1J08A 2WFCA 2GSQA 1X9WB 1OYJA 2VCQA 4CY8A 4KCAA 4HZ4A 4ZB9A 3LXTA 2YWNA 2FY6A 8GSSA 3GX8A 2AB6A 3HCZA 2R37A 1G6WA 3HZ4A 3TJFA 4MF5A 4J56E 3L9SA 4CHSA 3DKSA 5DQSA 6GSWA 5HFGA 1TJDA 1W4VA 2ZUPA 4K7NA 5D9TA 2CX3A 2FWHA 2H66A 3PGTA 5KN2A 4YQVA 4TKYA 4K0GA 3G7YA 5ECMB 1QK8A 1VGLA 5B6NA 2ON5A 4EL1A 1EOGA 3VLNA 1CQHA 4TR0A 2GTUA 2G2QA 2YJ7A 3RDWA 4K7IA 1BG5A 2I81A 2YN1A 1PL1A 1Q98A 4OCEA 2IIYA 2B3SA 1X5DA 1M9BA 2H0IA 1ON4A 2IN3A 4NHZA 5ID2A 4CY6A 5H5RA 4NAXA 1IYIA 2H1DA 1T8EB 2GQMA 5ECRB 5JCWA 5C04A 3C7MA 1TP9A 4MJEA 1WJKA 3C1RA 3CSJA 5EPFA 1GUMA 4JE1A 3I9V2 2H76A 3GKKA 2VLUA 3U6VA 1V98A 2VLTA 2NDOA 4K0NA 4GXZA 2K8VA 4OWYA 2LRCA 3WGDA 5A4VA 4I2UA 2EC4A 5HFIA 2M46A 2OJLA 1FOVA 1I9DA 3DVWA 3LJRA 4IGJA 4HOJA 1MD3A 5JCUA 3LGCA 5F07A 4PUFC 3KD0A 5AIVA 3DEXA 4PGTA 2DJ0A 3ZYWA 4BVXA 4YAPA 2O89A 4IHUA 3A5WA 4OO5A 5C00A 3KH7A 1Z7RA 5DJLA 3DXBA 2AJQB 1JZOA 2DLXA 1QMVA 2DSAA 1PKWA 2L6CA 1DE2A 3EPTA 2X49A 1M9AA 3EMPA 3FEUA 1HQOA 3D5JA 4KUNA 2DJKA 2J23A 2HT9A 1B9YC 2VL3A 3TOUA 4ECIA 2VCWA 3M9KA 1ERVA 4HI7A 10GSA 5CRDA 2AHEA 2GZZA 2NBSA 1VF1A 4HDEA 4EKZA 2YP6A 1MDIA 1EEMA 3ZTLA 3HJOA 1R4WA 1MDJA 2LJAA 5GAND 1V58A 3WT2A 5LD0A 2P5QA 1QGVA 2PGTA 1BEDA 3CSHA 3PINA 3GSTA 2GSTA 1ZYEA 5JWRB 4KH7A 1PN9A 2FWEA 4KNDA 2IL3A 3ZREA 1XBSA 3JCML 2HZFA 1WIKA 3TKSA 3LXZA 2F3MA 3IA1A 2VCTA 3TRQA 4POKA 1FG4A 3G9BA 4FIWA 4WR4A 2H74A 2JSZA 5H5QA 2IMKA 3TKSE 4EIQA 5J9CA 4YQMA 3VWXA 3DMLA 4L8EA 3GL5A 1U6TA 4LMWA 3L4NA 3W6GA 1JZDA 4XCSA 4X1UA 3CXGA 2C0DA 1T1VA 5IO2A 3QAGA 3VWUA 3F4TA 4MMMA 3BBYA 2R5GA 3K8NA 3H79A 2MMAA 4WBJA 2VOCA 4G19A 4MK3A 1EGRA 3QMXA 3TJBA 4ECBA 1MTCA 1EWXA 3KGKA 3F6DA 3Q19A 1XOAA 3LW9A 4V1Ap 4DSSA 1ZGNA 2H8LA 4MJCA 1Z9HA 1YEPA 4PQ1A 3HZ8A 2O8VB 3PPUA 1OAZA 4LLRA 1BJXA 3BD2A 2QC7A 5ABRA 1NSWA 1EP7A 4TVEA 2PVQA 4WF4A 4KCEA 5DAKB 3ZFBA 1GRXA 4MJAA 3J7Yb 2WJUA 1GTBA 3ED3A 4TXOA 4GSNA 3HD5A 1GL8A 3IC8A 2H0HA 2YWIA 1TRSA 3CYNA 4L5OA 2EIRA 1X5EA 2HXKA 1JFUA 22GSA 2X4AA 5A5KA 2I4AA 4WEYA 1FAAA 3W8JA 3ZVJA 5D8IA 3HA9A 2XPEA 19GSA 1HD2A 4GWRA 2DBCA 2VD0A 2XPDA 9GSSA 3GTUB 3FZ4A 4X43A 3RAZA 16GSA 1SU9A 1ST9A 4BWQA 2UZ8A 1WOUA 1ACVA 3MAKA 4QL9A 2WRTA 3PH9A 5EY6A 4KDUA 1NW2A 4JEDA 2V6KA 4ID0A 1AQWA 3FHKA 1GWCA 5HFKA 2YCDA 5G30A 5CNWA 2L6DA 3WYWA 5IQYA 2VM2A 4F03A 1PRXA 2LJRA 5DCGA 2H6YA 4IJ3A 4KW6A 1TU7A 4NMUA 2VL9A 4K7OA 3GFKA 3WD6A 4RUVA 1LU4A 2DJJA 4EIPA 2H6ZA 1PN0A 1A24A 2KP1A 1GNEA 1VRSD 2VCVA 4KAEA 1GH2A 2I3YA 3VI5A 1K0DA 5CO3A 2LS5A 4H86A 5G31A 1YF1A 4FYUA 4WETA 2OBIA 1K3YA 4GF0A 5DQYA 1TU8A 1XWKA 4RQRA 3CMIA 5CREA 1X0RA 3BCIA 4EE0A 3A2VA 2ALBA 2FUG2 1EP8A 4NXIA 5IM9A 2PU9C 2FCHA 2IFQB 2A2SA 1EV9A 1SL0B 2DJ1A 4NPBA 1O73A 6GSTA 2CZ3A 3WGXA 3QD9A 5AN1A 2VL2C 4RQXA 2LTKA 1GSEA 2MYGA 5CAXA 1J0FA 3PR8A 3M0FA 1XOBA 3O6TA 5DBQA 3CBUA 1QQ2A 2N5FA 4G0IA 3F6FA 4DSRA 5D93A 1E2YA 3ME8A 4E8HA 1PX7A 2JZSA 5ECIB 1M99A 3IK9A 2DMLA 4AF2A 5B6MA 3F3QA 2BMXA 3FMWA 5DVBA 5E59A 2M80A 5GAPD 3KP8A 2GQKA 18GSA 1Z3EA 2GGTA 1S3CA 2AYTA 5EL8A 3RHBA 1Q4JA 2VO4A 5IMZA 2H72A 5COHA 4KE3A 4HQZA 2H70A 1XVWA 3ZIVA 3DRNA 5CRHA 2LSTA 3F0IA 5CRWA 3FY7A 1WRYA 1K0CA 2CV4A 3V1WA 1SYXA 1GULA 5ECHB 1GUHA 1A23A 4P3YB 5IMCA 1SK1A 2LRNA 5JWOB 1Z6MA 4O32A 4MDCA 5F0GA 4KA0A 5DALA 2CVKA 4WBRD 1GNWA 3D4TA 3VWVA 2K9FA 4I8BA 5G5FA 2CZ2A 4GSTA 5ECNB 5H5SA 3F3RA 4LL4B 4XS4A 4HU7A 2R3XA 2VAFA 1EGOA 2DJ3A 4ZILA 4K8MA 2F8FA 2HLSA 3CSIA 3ERWA 4ILFA 3C8EA 2GDRA 2C3NA 1PSQA 3HJPA 3M8NA 2PVOC 2OE1A 1FB6A 2VUPA 3HJMA 1PGTA 1OKDA 1O85A 1B8XA 3VPQA 4IVFA 4ZBBA 2FWFA 4POBA 2CVDA 2R4VA 17GSA 3D0ZA 2IWTA 1EZKA 3TUEA 5ID2B 3HDCA 3E0UA 2L5OA 1G7EA 3ERFA 5IOWA 1GSFA 1J9BA 2YPMA 3GUSA 4NV5A 4EXJA 4MZBA 2L4QA 4K1FA 3EYTA 4GTUA 4XIHA 4HJ2A 4Q5RA 1RQMA 1C72A 4HEA2 1B4QA 1B9XC 1THOA 2V2GA 5IPHA 1PQNA 1ZZYA 4ML1A 4Q5NA 1G7OA 2MBTA 3DWVA 3P90A 6GSXA 2YWOA 2HSYA 5CRGA 4X0XA 1B48A 1TK8B 2XBIA 4MABA 4LA1A 1OE7A 4IP6A 3GHAA 12GSA 2HRAA 2B5YA 2FD3A 1UA5A 3M3MA 3D21A 1DBYA 2C0EA 2K8SA 4BVXB 2N5BA 2CVBA 2GZPA 1B4PA 3H8QA 2XBQA 4IELA 4ICYA 2KHPA 2H6XA 2C8UA 2PBJA 1A8YA 2H01A 1URMA 1K0AA 1KTEA 1GTUA 4N10A 3O76A 4XRDA 3TRPA 2WDUA 1M7TA 1N8JA 2LEGA 3FR9A 1YKCA 4TW5A 2YOIA 3QFAC 1SENA 2DKHA 3RPPA 4N0VA 2LKUA 1FOHA 3GN3A 3VURA 4Q5QA 2RUEA 1O8WA 4MPGA 3I69A 1NHYA 3KZQA 5J4UA 1GTAA 4V2MA 4QL7A 3HY2A 2HYXA 2PWJA 4ACSA 2BTOT 1HNBA 1OC3A 4BVYB 3Q18A 3LG6A 1V40A 3I6AA 5IPGA 3MDKA 1GSDA 1UVZA 1TRWA 3IOSA 3TKSC 5D9XA 5F06A 1BAYA 3FZAA 4AJ8A 2TIRA 4O5RA 2H19A 4F2IA 4PQHA 2VLVA 1XW9A 2FWGA 1S3DA 1Y25A 3O3TA 4XS6A 3E3EA 1U87A 4K2XA 1EEJA 4D73A 3UVHA 1NM3A 4OFMA 2NVLA 3UBKA 3CTGA 4EC0A 5FT3A 5DCHA 2LV3A 1XVQA 2I9HA 2GVPA 3RPNA 2X8HA 4L5LA 2ON7A 2JL4A 4JR6A 3KJYA 4AGSA 4O5UA 2RLIA 4F0CA 2GT6A 4MF6A 2CX4A 4IBPA 4IN0A 3GX0A 1T3BA 1M2BA 2ZCTA 2IMIA 3UBLA 4G2EA 2E7PA 4F82A 4MCUA 2JADA 3WGEA 1G0TA 1JLVA 2A4VA 4KSOA 5A4WA 2C1YA 4IS0A 1W89A 4XRAA 3KIJA 2J9HA 5CYYA 2QGVA 1XWCA 4TXOB 4I97A 3MSZA 4KF9A 2FHEA 2XC2A 3N5OA 2H71A 2YJHA 3I43A 2JACA 1K0NA 3KXOA 5IMAA 1XWBA 2OBKA 4J57E 3C71A 2XHFA 3KH9A 1SL1B 4KX4A 3QR6A 3FW2A 1GSYA 5LCZA 1AQXA 4I5QA 2H75A 1TDIA 1GUKA 4ZB8A 4JRRA 3EURA 5B8BA 3QCPA 3FKFA 3IC4A 1XW5A 3IDVA 4XHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IP1 A;  3G7J A;  2WGR A;  2KP2 A;  4HQS A;  4G10 A;  4EUY A;  5J41 A;  1TI1 A;  2WZ9 A;  4LL1 B;  2PPT A;  3FRC A;  5KEJ A;  2DIY A;  2PMT A;  2F8A A;  2L4C A;  1Y6E A;  4TR1 A;  4PNG A;  6GSV A;  1AUC A;  2JZT A;  1GLP A;  1LBK A;  1TXX A;  2C3T A;  2FA4 A;  1USB A;  2OE0 A;  3QDN A;  2B5X A;  1FO5 A;  1PKZ A;  5G1K A;  4EO3 A;  4IKH A;  5IMD A;  4POM A;  1TOF A;  2PER A;  1AXD A;  2OA7 A;  5IMF A;  5AIS A;  4EDZ A;  5HR0 A;  3APO A;  3UVT A;  4PX1 A;  4MA9 A;  4NHW A;  2CT6 A;  3AY8 A;  3DYR A;  2C0G A;  4F0B A;  2YV9 A;  2LUS A;  3M1G A;  3L9V A;  3W8S A;  1OVN A;  1VF4 A;  2E0Q A;  3NZN A;  4EF0 A;  3IHQ A;  3DIE A;  3LWA A;  1OC9 A;  1OKT A;  2DMM A;  2MBS A;  2L5L A;  2G0F A;  5FHI A;  3GRX A;  3KM6 A;  1O8X A;  4PXO A;  11GS A;  1O81 A;  2V32 A;  4GSS A;  2N5A A;  3EU4 A;  3P2A A;  1YQ1 A;  1OC8 A;  2HNL A;  3R2Q A;  2FLS A;  3ZLP A;  1QFN A;  1WE0 A;  5KN3 A;  2PUK C;  1DSB A;  4KB3 A;  2HRN A;  4ECJ A;  2M72 A;  3DVX A;  3TJJ A;  5INY A;  5GST A;  3DGQ A;  2HZE B;  1YY7 A;  2VM1 A;  3IRA A;  4L0W A;  3GMF A;  1SJ6 A;  6GSY A;  3TOT A;  1XWA A;  4RI6 A;  2YZU A;  3APQ A;  3P8W A;  5D9W A;  1A8L A;  3D4M A;  3A2X A;  3ZZX A;  4FO5 A;  1U88 A;  2IPA A;  2H0G A;  4K6X A;  4HU9 A;  3HKR A;  3VI7 A;  2MZC A;  2FA8 A;  3LOR A;  2GLR A;  1XWG A;  4QQ7 A;  1AC1 A;  2C3Q A;  1O6J A;  2O7K A;  1CQG A;  1RK4 A;  4BWS A;  1PL2 A;  1XIY A;  1BX9 A;  3HVS A;  1T7P B;  6GSS A;  3ZIT A;  2HSH A;  4TR4 A;  4OFN A;  2JSY A;  1PX6 A;  4FYB A;  2K18 A;  2IFQ A;  4PUR A;  3QFB C;  5KN0 A;  2VL2 A;  1SD9 A;  4ISD A;  3Q6O A;  2OKA A;  4F9Z A;  5CP1 A;  2K6V A;  4GRF A;  2ZNM A;  3US3 A;  2VIM A;  1PA3 A;  3ME7 A;  2HE3 A;  2WS2 A;  3KEB A;  1XXU A;  4ZBA A;  3TDG A;  1ERU A;  4MZC A;  4PQI A;  1K0O A;  4MH3 A;  1F2E A;  3F8U A;  1F3B A;  1HYU A;  1K3O A;  1ERW A;  2WB9 A;  3IR4 A;  2LJK A;  4XS4 B;  3EIN A;  4WR5 A;  1XZO A;  3TGZ A;  1R5P A;  3P7X A;  4ZL7 A;  3ZRD A;  4XTS A;  1GTI A;  5ECO B;  1YEX A;  2QKE A;  4E8E A;  4Q5F A;  1G6Y A;  2JZR A;  4ZBD A;  1R5A A;  4TXV A;  3SBC A;  4MH2 A;  5F8B A;  1X9M B;  2A2R A;  1U3I A;  1JLW A;  3NIV A;  1KEB A;  1VF3 A;  1MD4 A;  4TRX A;  1THX A;  3HVV A;  1FVJ A;  1TK5 B;  1MDK A;  3QAV A;  4ML6 A;  4DVC A;  4O92 A;  3G7I A;  3BJ5 A;  1ZYQ B;  1AW9 A;  2QSI A;  3UMA A;  4K9Z A;  3D22 A;  4BL7 A;  1VF2 A;  3LEF A;  3GUR A;  2H73 A;  3RBT A;  3VPT A;  2D2Z A;  3IAM 2;  3F4S A;  5D96 A;  3UJ1 A;  3RHC A;  2L59 A;  3GH9 A;  1V57 A;  3C1S A;  3C73 A;  4O7H A;  1BQ7 A;  20GS A;  2R6K A;  2I1U A;  3ZVJ D;  4MZW A;  2WCI A;  4OCF A;  4WF5 A;  3ZIJ A;  1F6M C;  2KUC A;  2V1M A;  2R2J A;  1FVK A;  4HS1 A;  4DEJ A;  4J2F A;  1TI3 A;  1F9M A;  3UEM A;  4V2N A;  3FK8 A;  4POL A;  1T4Z A;  3D6I A;  3SWL A;  2E2M A;  4IJI A;  5EVO A;  5F05 A;  2C4J A;  4TOP A;  1R26 A;  3BOA A;  2LNT A;  3UOM A;  4FYC A;  2IMD A;  3QOU A;  1ILO A;  3MWH A;  1R7H A;  2YWM A;  4GQC A;  4JZQ A;  1H75 A;  1AQV A;  2O87 A;  4LMV A;  1Z5Y E;  3FYG A;  3APS A;  4JBB A;  2GQL A;  3VWW A;  2NTO A;  4MPF A;  4KDX A;  2DJ2 A;  1A2J A;  4TN8 A;  3H4K A;  3IK7 A;  3L0H A;  2VCX A;  5B7C A;  1SJZ A;  2GZY A;  1A0R P;  4HUA A;  3MNG A;  5IIZ A;  1UN2 A;  3UAP A;  3TRX A;  5DJM A;  3L78 A;  4OD7 A;  4L0U A;  1F3A A;  2Z9S A;  2EIO A;  3IXR A;  1TRU A;  3TJK A;  1JHB A;  4WXT A;  4V1A g;  4Z7X A;  2B7J A;  3GH6 A;  1DUG A;  2LQO A;  2GSR A;  2WUL A;  3H1N A;  4MLY A;  4NWY A;  3TKP A;  2GSS A;  2TRC P;  1QXH A;  1GSQ A;  5A4U A;  4GCI A;  1M0U A;  4K2D A;  3GV1 A;  3F9U A;  1TK0 B;  4YQU A;  3CRT A;  3FR3 A;  1ERT A;  2X8C A;  1AIU A;  1S3A A;  1SK0 A;  1PD2 1;  3A2W A;  2IJY A;  2MMZ A;  3GIX A;  5IOX A;  5ECQ B;  1JZR A;  2NPB A;  1HNC A;  2X99 A;  2OE3 A;  2B1K A;  1O7U A;  2B1L A;  4D73 B;  1SK2 A;  3LQ7 A;  2RII A;  5B8A A;  1SKS B;  2BJX A;  1YDK A;  1ZCP A;  3L9U A;  4PNF A;  5L71 A;  3ZML A;  3GL3 A;  1YJ6 A;  2X64 A;  4IW9 A;  1QUW A;  5AIX A;  5IMV A;  4KSM A;  2CQ9 A;  1XW6 A;  1FW1 A;  2LNS A;  5LNK e;  1RW1 A;  5ELA A;  1WP0 A;  3E9J B;  4CW9 A;  3LYK A;  4BVY A;  3IE3 A;  2OAC A;  3ISO A;  4TR3 A;  3HYP A;  1E6B A;  4DSS B;  2P31 A;  2YZH A;  1N2A A;  1HNA A;  1M2D A;  1YF0 A;  4BPY A;  4FH8 A;  5FWG A;  1A2M A;  2FGX A;  5ECL B;  4OFT A;  5G5E A;  1SKR B;  4CDO A;  3EMX A;  4RI7 A;  2P5R A;  4N11 A;  2B6M A;  2O85 A;  1ABA A;  5ELG A;  2AV4 A;  4ULX A;  3N9J A;  3KTB A;  1Z6N A;  3F4R A;  3FZ5 A;  2YNX A;  2VCZ A;  1SKW B;  1NHO A;  1YKA A;  4IQA A;  4AJ7 A;  3CRU A;  3HHV A;  3KCM A;  2VD1 A;  5KN1 A;  1SL2 B;  1U3A A;  1PMT A;  4YAV A;  5E4W A;  4GQF A;  2GS3 A;  13GS A;  2F51 A;  5AGY A;  3ZL5 A;  3IPZ A;  4EDY A;  2H1B A;  2RM6 A;  1JZW A;  2HI7 A;  2LRT A;  3EC3 A;  4G9H A;  1TTZ A;  3Q74 A;  4TR1 B;  2PN8 A;  7GSS A;  1K3L A;  1UC7 A;  5ECK B;  3TB2 A;  1I5G A;  4N0Z A;  1MEK A;  1TKD B;  1T00 A;  4ZL9 A;  2YAN A;  3EE2 A;  4ECC A;  2IMF A;  1TW9 A;  4HZ2 A;  6GSU A;  1A0F A;  3H93 A;  5G2Z A;  5DDL A;  1T4Y A;  1EOH A;  3ZFL A;  4ZXG A;  3F63 A;  5DAK A;  1SYR A;  1V2A A;  3TKR A;  2ES7 A;  1GSU A;  1WWJ A;  3GNJ A;  5HR1 A;  1SJI A;  1GP1 A;  3DD3 A;  4NV2 A;  4AJ6 A;  3GSS A;  1YZX A;  3ERG A;  2F9S A;  1OC9 B;  4GLT A;  3IAS 2;  3GKN A;  3EVI A;  1DE1 A;  1ZL9 A;  3LFL A;  4I2T A;  3FZ9 A;  5D9V A;  2B5E A;  4XS1 A;  1A2L A;  4OMV A;  1LJR A;  3FR6 A;  1EV4 A;  3KMO A;  3GKX A;  5ENU A;  4MF7 A;  2P0G A;  3GTU A;  2KLX A;  2LQQ A;  1WMJ A;  4V2L A;  3IV4 A;  3GA4 A;  3KTL A;  4WKW A;  3J7Y k;  5J9B A;  4ZIJ A;  1TRV A;  4BA7 A;  2CAI A;  2RUF A;  3VK9 A;  3HXS A;  1OE8 A;  4DSQ A;  2C80 A;  2HRF A;  4OO4 A;  3QPM A;  2AAW A;  1XFL A;  1V9W A;  1X5C A;  4HJM A;  4JR4 A;  3S9F A;  2H1A A;  2REM A;  3U5R E;  5JWQ B;  5ECS A;  2TRX A;  2CAQ A;  5JCG A;  2RM5 A;  3GYK A;  2IME A;  2KOK A;  1BYE A;  3QAW A;  1M2A A;  2CA8 A;  4ZB6 A;  3CTF A;  1FB0 A;  1KNG A;  4KDY A;  2HFD A;  3OR5 A;  4MJB A;  2MMO A;  3TKQ A;  2AUV A;  2FNO A;  2HZE A;  3UAR A;  4PUA A;  1KBN A;  5IO0 A;  2V6O A;  14GS A;  3A3T A;  4ZL8 A;  3TJG A;  4IQ1 A;  5GZZ B;  1GSS A;  2DC5 A;  5HR3 A;  5J3R A;  3TCO A;  1GLQ A;  5HR2 A;  2V41 A;  2MMN A;  1H4O A;  5DAL B;  2JU5 A;  1SD8 A;  2C0F A;  5D73 A;  1ZOF A;  2L57 A;  3M9J A;  1ML6 A;  3GKM A;  5ECP B;  4N30 A;  1ZMA A;  2H1G A;  3ZMK A;  1X9S B;  4KGI A;  3KMN A;  4YH2 A;  2YV7 A;  3KP9 A;  1AAZ A;  1F37 A;  2E2G A;  3IBH A;  3LSZ A;  5HQP A;  5GSS A;  1K0B A;  2B7K A;  3BCK A;  2EIQ A;  4EVM A;  2GT5 A;  4MP4 A;  3UL3 A;  4JU5 A;  1XPV A;  3WT1 A;  1WPI A;  3UIW A;  2X8G A;  1XCC A;  2DIZ A;  2H30 A;  3LYP A;  1IYH A;  3HVX A;  2OAD A;  1FHE A;  5G1L A;  5J5N A;  4I6X A;  3EWL A;  3EU3 A;  3NOF A;  1Z7P A;  3VFI A;  1K0M A;  1J08 A;  2WFC A;  2GSQ A;  1X9W B;  1OYJ A;  2VCQ A;  4KCA A;  4HZ4 A;  4ZB9 A;  3LXT A;  2YWN A;  2FY6 A;  8GSS A;  3GX8 A;  2AB6 A;  3HCZ A;  2R37 A;  1G6W A;  3HZ4 A;  3TJF A;  4MF5 A;  4J56 E;  3L9S A;  4CHS A;  3DKS A;  5DQS A;  6GSW A;  5HFG A;  1TJD A;  1W4V A;  2ZUP A;  4K7N A;  5D9T A;  2CX3 A;  2FWH A;  2H66 A;  3PGT A;  5KN2 A;  4YQV A;  4TKY A;  4K0G A;  3G7Y A;  5ECM B;  1QK8 A;  1VGL A;  5B6N A;  2ON5 A;  4EL1 A;  1EOG A;  3VLN A;  1CQH A;  4TR0 A;  2GTU A;  2G2Q A;  2YJ7 A;  3RDW A;  4K7I A;  1BG5 A;  2I81 A;  2YN1 A;  1PL1 A;  1Q98 A;  4OCE A;  2IIY A;  2B3S A;  1X5D A;  1M9B A;  2H0I A;  1ON4 A;  2IN3 A;  4NHZ A;  5ID2 A;  5H5R A;  4NAX A;  1IYI A;  2H1D A;  1T8E B;  2GQM A;  5ECR B;  5JCW A;  5C04 A;  3C7M A;  1TP9 A;  4MJE A;  1WJK A;  3C1R A;  3CSJ A;  5EPF A;  1GUM A;  4JE1 A;  3I9V 2;  2H76 A;  3GKK A;  2VLU A;  3U6V A;  1V98 A;  2VLT A;  2NDO A;  4K0N A;  4GXZ A;  2K8V A;  4OWY A;  2LRC A;  3WGD A;  5A4V A;  4I2U A;  2EC4 A;  5HFI A;  2M46 A;  2OJL A;  1FOV A;  1I9D A;  3DVW A;  3LJR A;  4IGJ A;  4HOJ A;  1MD3 A;  5JCU A;  3LGC A;  5F07 A;  4PUF C;  3KD0 A;  5AIV A;  3DEX A;  4PGT A;  2DJ0 A;  3ZYW A;  4BVX A;  4YAP A;  2O89 A;  4IHU A;  3A5W A;  4OO5 A;  5C00 A;  3KH7 A;  1Z7R A;  5DJL A;  3DXB A;  2AJQ B;  1JZO A;  2DLX A;  1QMV A;  2DSA A;  1PKW A;  2L6C A;  1DE2 A;  1M9A A;  3EMP A;  3FEU A;  1HQO A;  3D5J A;  4KUN A;  2DJK A;  2J23 A;  2HT9 A;  1B9Y C;  2VL3 A;  3TOU A;  4ECI A;  2VCW A;  3M9K A;  1ERV A;  4HI7 A;  10GS A;  5CRD A;  2AHE A;  2GZZ A;  2NBS A;  1VF1 A;  4HDE A;  4EKZ A;  2YP6 A;  1MDI A;  1EEM A;  3ZTL A;  3HJO A;  1R4W A;  1MDJ A;  2LJA A;  5GAN D;  1V58 A;  3WT2 A;  5LD0 A;  2P5Q A;  1QGV A;  2PGT A;  1BED A;  3CSH A;  3PIN A;  3GST A;  2GST A;  1ZYE A;  5JWR B;  4KH7 A;  1PN9 A;  2FWE A;  4KND A;  2IL3 A;  3ZRE A;  1XBS A;  3JCM L;  2HZF A;  1WIK A;  3TKS A;  3LXZ A;  2F3M A;  3IA1 A;  2VCT A;  3TRQ A;  4POK A;  1FG4 A;  3G9B A;  4FIW A;  4WR4 A;  2H74 A;  2JSZ A;  5H5Q A;  2IMK A;  3TKS E;  5J9C A;  4YQM A;  3VWX A;  3DML A;  4L8E A;  3GL5 A;  1U6T A;  4LMW A;  3L4N A;  3W6G A;  1JZD A;  4XCS A;  4X1U A;  3CXG A;  2C0D A;  1T1V A;  5IO2 A;  3QAG A;  3VWU A;  3F4T A;  4MMM A;  3BBY A;  2R5G A;  3K8N A;  3H79 A;  2MMA A;  4WBJ A;  2VOC A;  4G19 A;  4MK3 A;  1EGR A;  3QMX A;  3TJB A;  4ECB A;  1MTC A;  1EWX A;  3KGK A;  3F6D A;  3Q19 A;  1XOA A;  4V1A p;  4DSS A;  1ZGN A;  2H8L A;  4MJC A;  1Z9H A;  1YEP A;  4PQ1 A;  3HZ8 A;  2O8V B;  1OAZ A;  4LLR A;  1BJX A;  3BD2 A;  2QC7 A;  5ABR A;  1NSW A;  1EP7 A;  4TVE A;  2PVQ A;  4WF4 A;  4KCE A;  5DAK B;  3ZFB A;  1GRX A;  4MJA A;  3J7Y b;  2WJU A;  1GTB A;  3ED3 A;  4TXO A;  4GSN A;  3HD5 A;  1GL8 A;  2H0H A;  2YWI A;  1TRS A;  3CYN A;  4L5O A;  2EIR A;  1X5E A;  2HXK A;  1JFU A;  22GS A;  5A5K A;  2I4A A;  4WEY A;  1FAA A;  3W8J A;  3ZVJ A;  5D8I A;  3HA9 A;  2XPE A;  19GS A;  1HD2 A;  4GWR A;  2DBC A;  2VD0 A;  2XPD A;  9GSS A;  3GTU B;  3FZ4 A;  4X43 A;  3RAZ A;  16GS A;  1SU9 A;  1ST9 A;  4BWQ A;  1WOU A;  1ACV A;  3MAK A;  4QL9 A;  2WRT A;  3PH9 A;  5EY6 A;  4KDU A;  1NW2 A;  4JED A;  2V6K A;  4ID0 A;  1AQW A;  3FHK A;  1GWC A;  5HFK A;  2YCD A;  5G30 A;  5CNW A;  2L6D A;  3WYW A;  5IQY A;  2VM2 A;  4F03 A;  1PRX A;  2LJR A;  5DCG A;  2H6Y A;  4IJ3 A;  4KW6 A;  1TU7 A;  4NMU A;  2VL9 A;  4K7O A;  3GFK A;  3WD6 A;  4RUV A;  1LU4 A;  2DJJ A;  2H6Z A;  1A24 A;  2KP1 A;  1GNE A;  1VRS D;  2VCV A;  4KAE A;  1GH2 A;  2I3Y A;  3VI5 A;  1K0D A;  5CO3 A;  2LS5 A;  4H86 A;  5G31 A;  1YF1 A;  4FYU A;  4WET A;  2OBI A;  1K3Y A;  4GF0 A;  5DQY A;  1TU8 A;  1XWK A;  4RQR A;  3CMI A;  5CRE A;  1X0R A;  3BCI A;  4EE0 A;  3A2V A;  2ALB A;  2FUG 2;  1EP8 A;  4NXI A;  5IM9 A;  2PU9 C;  2FCH A;  2IFQ B;  2A2S A;  1EV9 A;  1SL0 B;  2DJ1 A;  4NPB A;  1O73 A;  6GST A;  2CZ3 A;  3WGX A;  3QD9 A;  5AN1 A;  2VL2 C;  4RQX A;  2LTK A;  1GSE A;  2MYG A;  5CAX A;  1J0F A;  3PR8 A;  3M0F A;  1XOB A;  3O6T A;  5DBQ A;  3CBU A;  1QQ2 A;  2N5F A;  3F6F A;  4DSR A;  5D93 A;  1E2Y A;  3ME8 A;  4E8H A;  1PX7 A;  2JZS A;  5ECI B;  1M99 A;  3IK9 A;  2DML A;  4AF2 A;  5B6M A;  3F3Q A;  2BMX A;  5DVB A;  5E59 A;  2M80 A;  5GAP D;  3KP8 A;  2GQK A;  18GS A;  1Z3E A;  2GGT A;  1S3C A;  2AYT A;  5EL8 A;  3RHB A;  1Q4J A;  2VO4 A;  5IMZ A;  2H72 A;  5COH A;  4KE3 A;  4HQZ A;  2H70 A;  1XVW A;  3ZIV A;  3DRN A;  5CRH A;  2LST A;  3F0I A;  5CRW A;  3FY7 A;  1WRY A;  1K0C A;  2CV4 A;  3V1W A;  1SYX A;  1GUL A;  5ECH B;  1GUH A;  1A23 A;  4P3Y B;  5IMC A;  1SK1 A;  2LRN A;  5JWO B;  1Z6M A;  4O32 A;  4MDC A;  5F0G A;  4KA0 A;  5DAL A;  2CVK A;  4WBR D;  1GNW A;  3D4T A;  3VWV A;  2K9F A;  4I8B A;  5G5F A;  2CZ2 A;  4GST A;  5ECN B;  5H5S A;  3F3R A;  4LL4 B;  4XS4 A;  4HU7 A;  2R3X A;  2VAF A;  1EGO A;  2DJ3 A;  4ZIL A;  4K8M A;  2F8F A;  2HLS A;  3CSI A;  3ERW A;  4ILF A;  3C8E A;  2GDR A;  2C3N A;  1PSQ A;  3HJP A;  3M8N A;  2PVO C;  2OE1 A;  1FB6 A;  2VUP A;  3HJM A;  1PGT A;  1OKD A;  1O85 A;  1B8X A;  3VPQ A;  4IVF A;  4ZBB A;  2FWF A;  4POB A;  2CVD A;  2R4V A;  17GS A;  3D0Z A;  2IWT A;  1EZK A;  3TUE A;  5ID2 B;  3HDC A;  3E0U A;  2L5O A;  1G7E A;  3ERF A;  5IOW A;  1GSF A;  1J9B A;  2YPM A;  3GUS A;  4NV5 A;  4EXJ A;  4MZB A;  2L4Q A;  4K1F A;  3EYT A;  4GTU A;  4XIH A;  4HJ2 A;  4Q5R A;  1RQM A;  1C72 A;  4HEA 2;  1B4Q A;  1B9X C;  1THO A;  2V2G A;  5IPH A;  1PQN A;  1ZZY A;  4ML1 A;  4Q5N A;  1G7O A;  2MBT A;  3DWV A;  3P90 A;  6GSX A;  2YWO A;  2HSY A;  5CRG A;  4X0X A;  1B48 A;  1TK8 B;  2XBI A;  4MAB A;  4LA1 A;  1OE7 A;  4IP6 A;  3GHA A;  12GS A;  2B5Y A;  2FD3 A;  1UA5 A;  3M3M A;  3D21 A;  1DBY A;  2C0E A;  2K8S A;  2N5B A;  2CVB A;  2GZP A;  1B4P A;  3H8Q A;  2XBQ A;  4IEL A;  2KHP A;  2H6X A;  2C8U A;  2PBJ A;  1A8Y A;  2H01 A;  1URM A;  1K0A A;  1KTE A;  1GTU A;  4N10 A;  3O76 A;  4XRD A;  3TRP A;  2WDU A;  1M7T A;  1N8J A;  2LEG A;  3FR9 A;  1YKC A;  4TW5 A;  2YOI A;  3QFA C;  1SEN A;  3RPP A;  4N0V A;  2LKU A;  3GN3 A;  3VUR A;  4Q5Q A;  2RUE A;  1O8W A;  4MPG A;  3I69 A;  1NHY A;  3KZQ A;  5J4U A;  1GTA A;  4V2M A;  4QL7 A;  3HY2 A;  2HYX A;  2PWJ A;  4ACS A;  2BTO T;  1HNB A;  1OC3 A;  3Q18 A;  3LG6 A;  1V40 A;  3I6A A;  5IPG A;  3MDK A;  1GSD A;  1UVZ A;  1TRW A;  3IOS A;  3TKS C;  5D9X A;  5F06 A;  1BAY A;  3FZA A;  4AJ8 A;  2TIR A;  4O5R A;  2H19 A;  4F2I A;  4PQH A;  2VLV A;  1XW9 A;  2FWG A;  1S3D A;  1Y25 A;  3O3T A;  4XS6 A;  3E3E A;  1U87 A;  1EEJ A;  4D73 A;  3UVH A;  1NM3 A;  4OFM A;  2NVL A;  3UBK A;  3CTG A;  4EC0 A;  5FT3 A;  5DCH A;  2LV3 A;  1XVQ A;  2I9H A;  2GVP A;  3RPN A;  2X8H A;  4L5L A;  2ON7 A;  2JL4 A;  4JR6 A;  3KJY A;  4AGS A;  4F0C A;  2RLI A;  2GT6 A;  4MF6 A;  2CX4 A;  4IBP A;  4IN0 A;  3GX0 A;  1T3B A;  1M2B A;  2ZCT A;  2IMI A;  3UBL A;  4G2E A;  2E7P A;  4F82 A;  4MCU A;  2JAD A;  3WGE A;  1G0T A;  1JLV A;  2A4V A;  4KSO A;  5A4W A;  2C1Y A;  4IS0 A;  1W89 A;  4XRA A;  3KIJ A;  2J9H A;  5CYY A;  2QGV A;  1XWC A;  4TXO B;  4I97 A;  3MSZ A;  2FHE A;  2XC2 A;  3N5O A;  2H71 A;  2YJH A;  3I43 A;  2JAC A;  1K0N A;  3KXO A;  5IMA A;  1XWB A;  2OBK A;  4J57 E;  3C71 A;  2XHF A;  3KH9 A;  1SL1 B;  4KX4 A;  3QR6 A;  3FW2 A;  1GSY A;  5LCZ A;  1AQX A;  4I5Q A;  2H75 A;  1TDI A;  1GUK A;  4ZB8 A;  4JRR A;  3EUR A;  5B8B A;  3QCP A;  3FKF A;  3IC4 A;  1XW5 A;  3IDV A;  4XHM A; 
#chains in the Genus database with same CATH topology
 1PFO A;  4IP1 A;  3G7J A;  2WGR A;  2KP2 A;  4HQS A;  4G10 A;  4EUY A;  5J41 A;  1TI1 A;  2WZ9 A;  4LL1 B;  2PPT A;  3FRC A;  5KEJ A;  2DIY A;  2PMT A;  2F8A A;  2L4C A;  1Y6E A;  4TR1 A;  4PNG A;  6GSV A;  2A2P A;  1AUC A;  2JZT A;  1GLP A;  1LBK A;  2HSM A;  1TXX A;  2C3T A;  2FA4 A;  1USB A;  2OE0 A;  3QDN A;  2B5X A;  1FO5 A;  1PKZ A;  5G1K A;  4EO3 A;  3CQF A;  4IKH A;  5IMD A;  4POM A;  4Z2U A;  1TOF A;  2PER A;  1AXD A;  3HVN A;  2OA7 A;  5IMF A;  5AIS A;  4EDZ A;  5HR0 A;  3APO A;  3UVT A;  4PX1 A;  4MA9 A;  4NHW A;  2CT6 A;  3AY8 A;  3DYR A;  2C0G A;  4F0B A;  2YV9 A;  2LUS A;  3M1G A;  3L9V A;  3W8S A;  1OVN A;  1VF4 A;  2E0Q A;  3NZN A;  4EF0 A;  3IHQ A;  3DIE A;  3LWA A;  1OC9 A;  1OKT A;  2DMM A;  2MBS A;  2L5L A;  2A4H A;  2G0F A;  5FHI A;  3GRX A;  3KM6 A;  1O8X A;  4PXO A;  11GS A;  1O81 A;  2V32 A;  4GSS A;  2N5A A;  3EU4 A;  3P2A A;  1YQ1 A;  1OC8 A;  2HNL A;  3R2Q A;  2FLS A;  3ZLP A;  1QFN A;  1WE0 A;  5KN3 A;  2PUK C;  1DSB A;  4KB3 A;  2HRN A;  4ECJ A;  2M72 A;  3DVX A;  3TJJ A;  5INY A;  5GST A;  3DGQ A;  2HZE B;  4PTS A;  1YY7 A;  2VM1 A;  3IRA A;  4L0W A;  3GMF A;  1SJ6 A;  6GSY A;  3TOT A;  4USS A;  1XWA A;  4RI6 A;  2YZU A;  3APQ A;  3P8W A;  5D9W A;  1A8L A;  3D4M A;  3A2X A;  3ZZX A;  4FO5 A;  1U88 A;  2IPA A;  2H0G A;  4K6X A;  4HU9 A;  3HKR A;  3VI7 A;  2MZC A;  2FA8 A;  3LOR A;  2GLR A;  1XWG A;  4QQ7 A;  1AC1 A;  2C3Q A;  1O6J A;  2O7K A;  1CQG A;  1RK4 A;  2QA1 A;  4BWS A;  1PL2 A;  1XIY A;  1BX9 A;  3HVS A;  1T7P B;  6GSS A;  3ZIT A;  2HSH A;  4TR4 A;  4OFN A;  2JSY A;  1PX6 A;  4FYB A;  2K18 A;  2IFQ A;  4PUR A;  3QFB C;  5KN0 A;  2VL2 A;  1SD9 A;  4ISD A;  4K5R A;  3Q6O A;  2OKA A;  4F9Z A;  5CP1 A;  2K6V A;  4GRF A;  2ZNM A;  4FQU A;  3A5I A;  3US3 A;  2VIM A;  1PA3 A;  3ME7 A;  2HE3 A;  2WS2 A;  3KEB A;  1XXU A;  4ZBA A;  3TDG A;  1ERU A;  4MZC A;  4PQI A;  1ZYP A;  1K0O A;  4MH3 A;  1F2E A;  3F8U A;  1F3B A;  1HYU A;  1K3O A;  1ERW A;  2WB9 A;  3IR4 A;  2LJK A;  4XS4 B;  4WR5 A;  3EIN A;  2R0C A;  1XZO A;  3TGZ A;  1R5P A;  3P7X A;  4ZL7 A;  3ZRD A;  4XTS A;  1GTI A;  5ECO B;  1YEX A;  2QKE A;  4E8E A;  4Q5F A;  1G6Y A;  2JZR A;  4ZBD A;  1R5A A;  4TXV A;  3SBC A;  4MH2 A;  5F8B A;  1X9M B;  2A2R A;  1U3I A;  1JLW A;  3NIV A;  1KEB A;  1VF3 A;  1MD4 A;  4TRX A;  1THX A;  3HVV A;  1FVJ A;  1TK5 B;  1MDK A;  3QAV A;  4ML6 A;  4DVC A;  4O92 A;  3G7I A;  3BJ5 A;  1ZYQ B;  1AW9 A;  2QSI A;  3UMA A;  4K9Z A;  3D22 A;  4BL7 A;  1VF2 A;  2DKI A;  3LEF A;  3GUR A;  2H73 A;  3RBT A;  3VPT A;  2D2Z A;  3IAM 2;  3F4S A;  5D96 A;  3UJ1 A;  3RHC A;  2L59 A;  3GH9 A;  1V57 A;  3C1S A;  3C73 A;  4O7H A;  1BQ7 A;  20GS A;  2R6K A;  2I1U A;  3ZVJ D;  4MZW A;  2WCI A;  4OCF A;  4WF5 A;  3ZIJ A;  4G0K A;  1F6M C;  2KUC A;  2V1M A;  2R2J A;  1FVK A;  4HS1 A;  4DEJ A;  4J2F A;  1TI3 A;  1F9M A;  3UEM A;  4V2N A;  3FK8 A;  4POL A;  4YKG A;  1T4Z A;  3D6I A;  3SWL A;  2E2M A;  4IJI A;  4BIK A;  5EVO A;  2R0G A;  5F05 A;  2C4J A;  4TOP A;  1R26 A;  3BOA A;  2LNT A;  3UOM A;  4FYC A;  2IMD A;  3QOU A;  1ILO A;  3MWH A;  1R7H A;  2YWM A;  4GQC A;  4JZQ A;  1H75 A;  1AQV A;  2O87 A;  4LMV A;  1Z5Y E;  3FYG A;  3MIX A;  3APS A;  4JBB A;  2GQL A;  3VWW A;  2NTO A;  4MPF A;  4KDX A;  2DJ2 A;  1A2J A;  4TN8 A;  3H4K A;  3IK7 A;  3L0H A;  2VCX A;  5B7C A;  1SJZ A;  5KOX A;  2GZY A;  1A0R P;  4HUA A;  3MNG A;  5IIZ A;  1UN2 A;  1ZYN A;  3UAP A;  3TRX A;  3IHG A;  5DJM A;  3L78 A;  2QA2 A;  4OD7 A;  4L0U A;  1F3A A;  2Z9S A;  2EIO A;  3IXR A;  1TRU A;  3TJK A;  1JHB A;  4WXT A;  4V1A g;  4Z7X A;  2B7J A;  3GH6 A;  1DUG A;  2LQO A;  2GSR A;  2WUL A;  5BMU A;  3H1N A;  4MLY A;  4NWY A;  3TKP A;  2GSS A;  2TRC P;  1QXH A;  1GSQ A;  5A4U A;  4GCI A;  1M0U A;  4K2D A;  3GV1 A;  3F9U A;  1TK0 B;  4K5S A;  4YQU A;  3CRT A;  3FR3 A;  1ERT A;  2X8C A;  1AIU A;  1S3A A;  1SK0 A;  1PD2 1;  3A2W A;  2IJY A;  2MMZ A;  3GIX A;  5IOX A;  5ECQ B;  1JZR A;  2NPB A;  1HNC A;  2X99 A;  2OE3 A;  2B1K A;  1O7U A;  2B1L A;  4D73 B;  1SK2 A;  3LQ7 A;  2RII A;  5B8A A;  1SKS B;  2BJX A;  1YDK A;  1ZCP A;  3L9U A;  4PNF A;  5L71 A;  3ZML A;  3GL3 A;  1YJ6 A;  2X64 A;  4IW9 A;  1QUW A;  5AIX A;  5IMV A;  4KSM A;  2CQ9 A;  1XW6 A;  1FW1 A;  2LNS A;  5LNK e;  1RW1 A;  5ELA A;  1WP0 A;  3E9J B;  4CW9 A;  3LYK A;  4BVY A;  3IE3 A;  2OAC A;  3ISO A;  4TR3 A;  3HYP A;  1E6B A;  4DSS B;  2P31 A;  2YZH A;  1N2A A;  1HNA A;  1M2D A;  1YF0 A;  4BPY A;  4FH8 A;  5FWG A;  1A2M A;  2FGX A;  5ECL B;  4OFT A;  5G5E A;  1SKR B;  4CDO A;  3EMX A;  4RI7 A;  2P5R A;  4N11 A;  2B6M A;  2O85 A;  1ABA A;  5ELG A;  2AV4 A;  4ULX A;  3N9J A;  3KTB A;  1Z6N A;  3F4R A;  4X4J A;  3FZ5 A;  2YNX A;  2VCZ A;  1SKW B;  1NHO A;  1YKA A;  4IQA A;  4AJ7 A;  3CRU A;  3HHV A;  3KCM A;  2VD1 A;  5KN1 A;  1SL2 B;  1U3A A;  1PMT A;  4YAV A;  5E4W A;  4GQF A;  2GS3 A;  13GS A;  2F51 A;  5AGY A;  3ZL5 A;  3IPZ A;  4EDY A;  2H1B A;  2RM6 A;  1JZW A;  2HI7 A;  2LRT A;  4HSC X;  3EC3 A;  4G9H A;  1TTZ A;  3Q74 A;  4TR1 B;  2PN8 A;  7GSS A;  1K3L A;  1UC7 A;  5ECK B;  3TB2 A;  1I5G A;  4N0Z A;  2R0P A;  1MEK A;  1TKD B;  1T00 A;  4ZL9 A;  2YAN A;  3EE2 A;  4ECC A;  2IMF A;  1TW9 A;  4HZ2 A;  6GSU A;  1A0F A;  3H93 A;  5G2Z A;  5DDL A;  1T4Y A;  1EOH A;  3ZFL A;  4ZXG A;  3F63 A;  4Z2R A;  5DAK A;  1SYR A;  1V2A A;  3TKR A;  2ES7 A;  1GSU A;  1WWJ A;  3GNJ A;  5HR1 A;  1SJI A;  1GP1 A;  3DD3 A;  4NV2 A;  4AJ6 A;  3GSS A;  1YZX A;  3ERG A;  2F9S A;  1OC9 B;  3R3E A;  4GLT A;  3IAS 2;  3GKN A;  3EVI A;  2HRK A;  1DE1 A;  1ZL9 A;  3LFL A;  4I2T A;  3FZ9 A;  5D9V A;  2B5E A;  4XS1 A;  3MYD A;  1A2L A;  4OMV A;  1LJR A;  3FR6 A;  1EV4 A;  3KMO A;  3GKX A;  5ENU A;  4MF7 A;  2P0G A;  3GTU A;  2KLX A;  2LQQ A;  1WMJ A;  4V2L A;  3IV4 A;  3GA4 A;  3KTL A;  4WKW A;  3J7Y k;  5J9B A;  4ZIJ A;  1TRV A;  4BA7 A;  2CAI A;  2RUF A;  3VK9 A;  3HXS A;  1OE8 A;  4DSQ A;  2C80 A;  2HRF A;  5KOW A;  4OO4 A;  3QPM A;  2AAW A;  1XFL A;  1V9W A;  1X5C A;  4HJM A;  4JR4 A;  3S9F A;  2H1A A;  2REM A;  3U5R E;  5JWQ B;  5ECS A;  2TRX A;  2CAQ A;  5JCG A;  2RM5 A;  3GYK A;  4MNN A;  2IME A;  2KOK A;  1BYE A;  3QAW A;  1M2A A;  2CA8 A;  4ZB6 A;  3CTF A;  1FB0 A;  1KNG A;  4KDY A;  2HFD A;  3OR5 A;  4MJB A;  5BRT A;  2MMO A;  3TKQ A;  2AUV A;  4YKF A;  2FNO A;  2HZE A;  3UAR A;  4G0L A;  4PUA A;  1KBN A;  5IO0 A;  2V6O A;  14GS A;  3A3T A;  4ZL8 A;  3TJG A;  4IQ1 A;  4A5P A;  5GZZ B;  1GSS A;  2DC5 A;  5HR3 A;  5J3R A;  3TCO A;  1GLQ A;  5HR2 A;  2V41 A;  2MMN A;  1H4O A;  5DAL B;  2JU5 A;  1SD8 A;  2C0F A;  5D73 A;  1ZOF A;  2L57 A;  3M9J A;  1ML6 A;  3GKM A;  5ECP B;  4N30 A;  1ZMA A;  2H1G A;  3ZMK A;  1X9S B;  4KGI A;  3KMN A;  4YH2 A;  2YV7 A;  3KP9 A;  1AAZ A;  1F37 A;  2E2G A;  3IBH A;  3LSZ A;  4Z2T A;  5HQP A;  5GSS A;  1K0B A;  2B7K A;  3BCK A;  2EIQ A;  4EVM A;  2GT5 A;  4MP4 A;  3UL3 A;  4JU5 A;  1XPV A;  4BL7 B;  3WT1 A;  1WPI A;  3UIW A;  2X8G A;  1XCC A;  2DIZ A;  2H30 A;  3LYP A;  1IYH A;  3HVX A;  2OAD A;  1FHE A;  5G1L A;  5J5N A;  4O5Q A;  4I6X A;  3EWL A;  3EU3 A;  3NOF A;  1Z7P A;  3VFI A;  1K0M A;  1J08 A;  2WFC A;  2GSQ A;  1X9W B;  1OYJ A;  2VCQ A;  4CY8 A;  4KCA A;  4HZ4 A;  4ZB9 A;  3LXT A;  2YWN A;  2FY6 A;  8GSS A;  3GX8 A;  2AB6 A;  3HCZ A;  2R37 A;  1G6W A;  3HZ4 A;  3TJF A;  4MF5 A;  4J56 E;  3L9S A;  4CHS A;  3DKS A;  5DQS A;  6GSW A;  5HFG A;  1TJD A;  1W4V A;  2ZUP A;  4K7N A;  5D9T A;  2CX3 A;  2FWH A;  2H66 A;  3PGT A;  5KN2 A;  4YQV A;  1M3J A;  4TKY A;  4K0G A;  3G7Y A;  5ECM B;  1QK8 A;  1VGL A;  5B6N A;  2ON5 A;  4EL1 A;  1EOG A;  3VLN A;  1CQH A;  4TR0 A;  2GTU A;  2G2Q A;  2YJ7 A;  3RDW A;  4K7I A;  1BG5 A;  2I81 A;  2YN1 A;  1PL1 A;  1Q98 A;  4OCE A;  2IIY A;  2B3S A;  1X5D A;  1M9B A;  2H0I A;  1ON4 A;  2IN3 A;  4NHZ A;  5ID2 A;  4CY6 A;  5H5R A;  4NAX A;  1IYI A;  2H1D A;  1T8E B;  2GQM A;  5ECR B;  5JCW A;  5C04 A;  3C7M A;  1TP9 A;  4MJE A;  1WJK A;  3C1R A;  3CSJ A;  5EPF A;  1GUM A;  4JE1 A;  3I9V 2;  2H76 A;  3GKK A;  2VLU A;  3U6V A;  1V98 A;  2VLT A;  2NDO A;  4K0N A;  4GXZ A;  2K8V A;  4OWY A;  2LRC A;  3WGD A;  5A4V A;  4I2U A;  2EC4 A;  5HFI A;  2M46 A;  2OJL A;  1FOV A;  1I9D A;  3DVW A;  3LJR A;  4IGJ A;  4HOJ A;  1MD3 A;  5JCU A;  3LGC A;  5F07 A;  4PUF C;  3KD0 A;  5AIV A;  3DEX A;  4PGT A;  2DJ0 A;  3ZYW A;  4BVX A;  4YAP A;  2O89 A;  4IHU A;  3A5W A;  4OO5 A;  5C00 A;  3KH7 A;  1Z7R A;  5DJL A;  3DXB A;  2AJQ B;  1JZO A;  2DLX A;  1QMV A;  2DSA A;  1PKW A;  2L6C A;  1DE2 A;  3EPT A;  2X49 A;  1M9A A;  3EMP A;  3FEU A;  1HQO A;  3D5J A;  4KUN A;  2DJK A;  2J23 A;  2HT9 A;  1B9Y C;  2VL3 A;  3TOU A;  4ECI A;  2VCW A;  3M9K A;  1ERV A;  4HI7 A;  10GS A;  5CRD A;  2AHE A;  2GZZ A;  2NBS A;  1VF1 A;  4HDE A;  4EKZ A;  2YP6 A;  1MDI A;  1EEM A;  3ZTL A;  3HJO A;  1R4W A;  1MDJ A;  2LJA A;  5GAN D;  1V58 A;  3WT2 A;  5LD0 A;  2P5Q A;  1QGV A;  2PGT A;  1BED A;  3CSH A;  3PIN A;  3GST A;  2GST A;  1ZYE A;  5JWR B;  4KH7 A;  1PN9 A;  2FWE A;  4KND A;  2IL3 A;  3ZRE A;  1XBS A;  3JCM L;  2HZF A;  1WIK A;  3TKS A;  3LXZ A;  2F3M A;  3IA1 A;  2VCT A;  3TRQ A;  4POK A;  1FG4 A;  3G9B A;  4FIW A;  4WR4 A;  2H74 A;  2JSZ A;  5H5Q A;  2IMK A;  3TKS E;  4EIQ A;  5J9C A;  4YQM A;  3VWX A;  3DML A;  4L8E A;  3GL5 A;  1U6T A;  4LMW A;  3L4N A;  3W6G A;  1JZD A;  4XCS A;  4X1U A;  3CXG A;  2C0D A;  1T1V A;  5IO2 A;  3QAG A;  3VWU A;  3F4T A;  4MMM A;  3BBY A;  2R5G A;  3K8N A;  3H79 A;  2MMA A;  4WBJ A;  2VOC A;  4G19 A;  4MK3 A;  1EGR A;  3QMX A;  3TJB A;  4ECB A;  1MTC A;  1EWX A;  3KGK A;  3F6D A;  3Q19 A;  1XOA A;  3LW9 A;  4V1A p;  4DSS A;  1S3R A;  1ZGN A;  2H8L A;  4MJC A;  1Z9H A;  1YEP A;  4PQ1 A;  3HZ8 A;  2O8V B;  3PPU A;  1OAZ A;  4LLR A;  1BJX A;  3BD2 A;  2QC7 A;  5ABR A;  1NSW A;  1EP7 A;  4TVE A;  2PVQ A;  4WF4 A;  4KCE A;  5DAK B;  3ZFB A;  1XG8 A;  1GRX A;  4MJA A;  3J7Y b;  2WJU A;  1GTB A;  3ED3 A;  4TXO A;  4GSN A;  3HD5 A;  1GL8 A;  3IC8 A;  2H0H A;  2YWI A;  1TRS A;  3CYN A;  4L5O A;  2EIR A;  1X5E A;  2HXK A;  1JFU A;  22GS A;  2X4A A;  5A5K A;  2I4A A;  4WEY A;  1FAA A;  3W8J A;  3ZVJ A;  5D8I A;  3HA9 A;  2XPE A;  19GS A;  1HD2 A;  4GWR A;  2DBC A;  2VD0 A;  2XPD A;  9GSS A;  3GTU B;  3FZ4 A;  4X43 A;  3RAZ A;  16GS A;  1SU9 A;  1ST9 A;  4BWQ A;  2UZ8 A;  1WOU A;  1ACV A;  3MAK A;  4QL9 A;  2WRT A;  3PH9 A;  5EY6 A;  4KDU A;  1NW2 A;  4JED A;  2V6K A;  4ID0 A;  1AQW A;  3FHK A;  1GWC A;  5HFK A;  2YCD A;  5G30 A;  5CNW A;  2L6D A;  3WYW A;  5IQY A;  2VM2 A;  4F03 A;  1PRX A;  2LJR A;  5DCG A;  2H6Y A;  4IJ3 A;  4KW6 A;  1TU7 A;  4NMU A;  2VL9 A;  4K7O A;  3GFK A;  3WD6 A;  4RUV A;  1LU4 A;  2DJJ A;  4EIP A;  2H6Z A;  1PN0 A;  1A24 A;  2KP1 A;  1GNE A;  1VRS D;  2VCV A;  4KAE A;  1GH2 A;  2I3Y A;  3VI5 A;  1K0D A;  5CO3 A;  2LS5 A;  4H86 A;  5G31 A;  1YF1 A;  4FYU A;  4WET A;  2OBI A;  1K3Y A;  4GF0 A;  5DQY A;  1TU8 A;  1XWK A;  4RQR A;  3CMI A;  5CRE A;  1X0R A;  3BCI A;  4EE0 A;  3A2V A;  2ALB A;  2FUG 2;  1EP8 A;  4NXI A;  5IM9 A;  2PU9 C;  2FCH A;  2IFQ B;  2A2S A;  1EV9 A;  1SL0 B;  2DJ1 A;  4NPB A;  1O73 A;  6GST A;  2CZ3 A;  3WGX A;  3QD9 A;  5AN1 A;  2VL2 C;  4RQX A;  2LTK A;  1GSE A;  2MYG A;  5CAX A;  1J0F A;  3PR8 A;  3M0F A;  1XOB A;  3O6T A;  5DBQ A;  3CBU A;  1QQ2 A;  2N5F A;  4G0I A;  3F6F A;  4DSR A;  5D93 A;  1E2Y A;  3ME8 A;  4E8H A;  1PX7 A;  2JZS A;  5ECI B;  1M99 A;  3IK9 A;  2DML A;  4AF2 A;  5B6M A;  3F3Q A;  2BMX A;  3FMW A;  5DVB A;  5E59 A;  2M80 A;  5GAP D;  3KP8 A;  2GQK A;  18GS A;  1Z3E A;  2GGT A;  1S3C A;  2AYT A;  5EL8 A;  3RHB A;  1Q4J A;  2VO4 A;  5IMZ A;  2H72 A;  5COH A;  4KE3 A;  4HQZ A;  2H70 A;  1XVW A;  3ZIV A;  3DRN A;  5CRH A;  2LST A;  3F0I A;  5CRW A;  3FY7 A;  1WRY A;  1K0C A;  2CV4 A;  3V1W A;  1SYX A;  1GUL A;  5ECH B;  1GUH A;  1A23 A;  4P3Y B;  5IMC A;  1SK1 A;  2LRN A;  5JWO B;  1Z6M A;  4O32 A;  4MDC A;  5F0G A;  4KA0 A;  5DAL A;  2CVK A;  4WBR D;  1GNW A;  3D4T A;  3VWV A;  2K9F A;  4I8B A;  5G5F A;  2CZ2 A;  4GST A;  5ECN B;  5H5S A;  3F3R A;  4LL4 B;  4XS4 A;  4HU7 A;  2R3X A;  2VAF A;  1EGO A;  2DJ3 A;  4ZIL A;  4K8M A;  2F8F A;  2HLS A;  3CSI A;  3ERW A;  4ILF A;  3C8E A;  2GDR A;  2C3N A;  1PSQ A;  3HJP A;  3M8N A;  2PVO C;  2OE1 A;  1FB6 A;  2VUP A;  3HJM A;  1PGT A;  1OKD A;  1O85 A;  1B8X A;  3VPQ A;  4IVF A;  4ZBB A;  2FWF A;  4POB A;  2CVD A;  2R4V A;  17GS A;  3D0Z A;  2IWT A;  1EZK A;  3TUE A;  5ID2 B;  3HDC A;  3E0U A;  2L5O A;  1G7E A;  3ERF A;  5IOW A;  1GSF A;  1J9B A;  2YPM A;  3GUS A;  4NV5 A;  4EXJ A;  4MZB A;  2L4Q A;  4K1F A;  3EYT A;  4GTU A;  4XIH A;  4HJ2 A;  4Q5R A;  1RQM A;  1C72 A;  4HEA 2;  1B4Q A;  1B9X C;  1THO A;  2V2G A;  5IPH A;  1PQN A;  1ZZY A;  4ML1 A;  4Q5N A;  1G7O A;  2MBT A;  3DWV A;  3P90 A;  6GSX A;  2YWO A;  2HSY A;  5CRG A;  4X0X A;  1B48 A;  1TK8 B;  2XBI A;  4MAB A;  4LA1 A;  1OE7 A;  4IP6 A;  3GHA A;  12GS A;  2HRA A;  2B5Y A;  2FD3 A;  1UA5 A;  3M3M A;  3D21 A;  1DBY A;  2C0E A;  2K8S A;  4BVX B;  2N5B A;  2CVB A;  2GZP A;  1B4P A;  3H8Q A;  2XBQ A;  4IEL A;  4ICY A;  2KHP A;  2H6X A;  2C8U A;  2PBJ A;  1A8Y A;  2H01 A;  1URM A;  1K0A A;  1KTE A;  1GTU A;  4N10 A;  3O76 A;  4XRD A;  3TRP A;  2WDU A;  1M7T A;  1N8J A;  2LEG A;  3FR9 A;  1YKC A;  4TW5 A;  2YOI A;  3QFA C;  1SEN A;  2DKH A;  3RPP A;  4N0V A;  2LKU A;  1FOH A;  3GN3 A;  3VUR A;  4Q5Q A;  2RUE A;  1O8W A;  4MPG A;  3I69 A;  1NHY A;  3KZQ A;  5J4U A;  1GTA A;  4V2M A;  4QL7 A;  3HY2 A;  2HYX A;  2PWJ A;  4ACS A;  2BTO T;  1HNB A;  1OC3 A;  4BVY B;  3Q18 A;  3LG6 A;  1V40 A;  3I6A A;  5IPG A;  3MDK A;  1GSD A;  1UVZ A;  1TRW A;  3IOS A;  3TKS C;  5D9X A;  5F06 A;  1BAY A;  3FZA A;  4AJ8 A;  2TIR A;  4O5R A;  2H19 A;  4F2I A;  4PQH A;  2VLV A;  1XW9 A;  2FWG A;  1S3D A;  1Y25 A;  3O3T A;  4XS6 A;  3E3E A;  1U87 A;  4K2X A;  1EEJ A;  4D73 A;  3UVH A;  1NM3 A;  4OFM A;  2NVL A;  3UBK A;  3CTG A;  4EC0 A;  5FT3 A;  5DCH A;  2LV3 A;  1XVQ A;  2I9H A;  2GVP A;  3RPN A;  2X8H A;  4L5L A;  2ON7 A;  1M3I A;  2JL4 A;  4JR6 A;  3KJY A;  4AGS A;  4O5U A;  2RLI A;  4F0C A;  2GT6 A;  4MF6 A;  2CX4 A;  4IBP A;  4IN0 A;  3GX0 A;  1T3B A;  1M2B A;  2ZCT A;  2IMI A;  3UBL A;  4G2E A;  2E7P A;  4F82 A;  4MCU A;  2JAD A;  3WGE A;  1G0T A;  1JLV A;  2A4V A;  4KSO A;  5A4W A;  2C1Y A;  4IS0 A;  1W89 A;  4XRA A;  3KIJ A;  2J9H A;  5CYY A;  2QGV A;  1XWC A;  4TXO B;  4I97 A;  3MSZ A;  4KF9 A;  2FHE A;  2XC2 A;  3N5O A;  2H71 A;  2YJH A;  3I43 A;  2JAC A;  1K0N A;  3KXO A;  5IMA A;  1XWB A;  2OBK A;  4J57 E;  3C71 A;  2XHF A;  3KH9 A;  1SL1 B;  4KX4 A;  3QR6 A;  3FW2 A;  1GSY A;  5LCZ A;  1AQX A;  4I5Q A;  2H75 A;  1TDI A;  1GUK A;  4ZB8 A;  4JRR A;  3EUR A;  5B8B A;  3QCP A;  3FKF A;  3IC4 A;  1XW5 A;  3IDV A;  4XHM A; 
#chains in the Genus database with same CATH homology
 4IP1 A;  3G7J A;  2WGR A;  2KP2 A;  4HQS A;  4G10 A;  4EUY A;  5J41 A;  1TI1 A;  2WZ9 A;  4LL1 B;  2PPT A;  3FRC A;  5KEJ A;  2DIY A;  2PMT A;  2F8A A;  2L4C A;  1Y6E A;  4TR1 A;  4PNG A;  6GSV A;  2A2P A;  1AUC A;  2JZT A;  1GLP A;  1LBK A;  2HSM A;  1TXX A;  2C3T A;  2FA4 A;  1USB A;  2OE0 A;  3QDN A;  2B5X A;  1FO5 A;  1PKZ A;  5G1K A;  4EO3 A;  4IKH A;  5IMD A;  4POM A;  4Z2U A;  1TOF A;  2PER A;  1AXD A;  2OA7 A;  5IMF A;  5AIS A;  4EDZ A;  5HR0 A;  3APO A;  3UVT A;  4PX1 A;  4MA9 A;  4NHW A;  2CT6 A;  3AY8 A;  3DYR A;  2C0G A;  4F0B A;  2YV9 A;  2LUS A;  3M1G A;  3L9V A;  3W8S A;  1OVN A;  1VF4 A;  2E0Q A;  3NZN A;  4EF0 A;  3IHQ A;  3DIE A;  3LWA A;  1OC9 A;  1OKT A;  2DMM A;  2MBS A;  2L5L A;  2A4H A;  2G0F A;  5FHI A;  3GRX A;  3KM6 A;  1O8X A;  4PXO A;  11GS A;  1O81 A;  2V32 A;  4GSS A;  2N5A A;  3EU4 A;  3P2A A;  1YQ1 A;  1OC8 A;  2HNL A;  3R2Q A;  2FLS A;  3ZLP A;  1QFN A;  1WE0 A;  5KN3 A;  2PUK C;  1DSB A;  4KB3 A;  2HRN A;  4ECJ A;  2M72 A;  3DVX A;  3TJJ A;  5INY A;  5GST A;  3DGQ A;  2HZE B;  4PTS A;  1YY7 A;  2VM1 A;  3IRA A;  4L0W A;  3GMF A;  1SJ6 A;  6GSY A;  3TOT A;  4USS A;  1XWA A;  4RI6 A;  2YZU A;  3APQ A;  3P8W A;  5D9W A;  1A8L A;  3D4M A;  3A2X A;  3ZZX A;  4FO5 A;  1U88 A;  2IPA A;  2H0G A;  4K6X A;  4HU9 A;  3HKR A;  3VI7 A;  2MZC A;  2FA8 A;  3LOR A;  2GLR A;  1XWG A;  4QQ7 A;  1AC1 A;  2C3Q A;  1O6J A;  2O7K A;  1CQG A;  1RK4 A;  2QA1 A;  4BWS A;  1PL2 A;  1XIY A;  1BX9 A;  3HVS A;  1T7P B;  6GSS A;  3ZIT A;  2HSH A;  4TR4 A;  4OFN A;  2JSY A;  1PX6 A;  4FYB A;  2K18 A;  2IFQ A;  4PUR A;  3QFB C;  5KN0 A;  2VL2 A;  1SD9 A;  4ISD A;  4K5R A;  3Q6O A;  2OKA A;  4F9Z A;  5CP1 A;  2K6V A;  4GRF A;  2ZNM A;  4FQU A;  3A5I A;  3US3 A;  2VIM A;  1PA3 A;  3ME7 A;  2HE3 A;  2WS2 A;  3KEB A;  1XXU A;  4ZBA A;  3TDG A;  1ERU A;  4MZC A;  4PQI A;  1ZYP A;  1K0O A;  4MH3 A;  1F2E A;  3F8U A;  1F3B A;  1HYU A;  1K3O A;  1ERW A;  2WB9 A;  3IR4 A;  2LJK A;  4XS4 B;  4WR5 A;  3EIN A;  2R0C A;  1XZO A;  3TGZ A;  1R5P A;  3P7X A;  4ZL7 A;  3ZRD A;  4XTS A;  1GTI A;  5ECO B;  1YEX A;  2QKE A;  4E8E A;  4Q5F A;  1G6Y A;  2JZR A;  4ZBD A;  1R5A A;  4TXV A;  3SBC A;  4MH2 A;  5F8B A;  1X9M B;  2A2R A;  1U3I A;  1JLW A;  3NIV A;  1KEB A;  1VF3 A;  1MD4 A;  4TRX A;  1THX A;  3HVV A;  1FVJ A;  1TK5 B;  1MDK A;  3QAV A;  4ML6 A;  4DVC A;  4O92 A;  3G7I A;  3BJ5 A;  1ZYQ B;  1AW9 A;  2QSI A;  3UMA A;  4K9Z A;  3D22 A;  4BL7 A;  1VF2 A;  2DKI A;  3LEF A;  3GUR A;  2H73 A;  3RBT A;  3VPT A;  2D2Z A;  3IAM 2;  3F4S A;  5D96 A;  3UJ1 A;  3RHC A;  2L59 A;  3GH9 A;  1V57 A;  3C1S A;  3C73 A;  4O7H A;  1BQ7 A;  20GS A;  2R6K A;  2I1U A;  3ZVJ D;  4MZW A;  2WCI A;  4OCF A;  4WF5 A;  3ZIJ A;  4G0K A;  1F6M C;  2KUC A;  2V1M A;  2R2J A;  1FVK A;  4HS1 A;  4DEJ A;  4J2F A;  1TI3 A;  1F9M A;  3UEM A;  4V2N A;  3FK8 A;  4POL A;  4YKG A;  1T4Z A;  3D6I A;  3SWL A;  2E2M A;  4IJI A;  5EVO A;  2R0G A;  5F05 A;  2C4J A;  4TOP A;  1R26 A;  3BOA A;  2LNT A;  3UOM A;  4FYC A;  2IMD A;  3QOU A;  1ILO A;  3MWH A;  1R7H A;  2YWM A;  4GQC A;  4JZQ A;  1H75 A;  1AQV A;  2O87 A;  4LMV A;  1Z5Y E;  3FYG A;  3MIX A;  3APS A;  4JBB A;  2GQL A;  3VWW A;  2NTO A;  4MPF A;  4KDX A;  2DJ2 A;  1A2J A;  4TN8 A;  3H4K A;  3IK7 A;  3L0H A;  2VCX A;  5B7C A;  1SJZ A;  5KOX A;  2GZY A;  1A0R P;  4HUA A;  3MNG A;  5IIZ A;  1UN2 A;  1ZYN A;  3UAP A;  3TRX A;  3IHG A;  5DJM A;  3L78 A;  2QA2 A;  4OD7 A;  4L0U A;  1F3A A;  2Z9S A;  2EIO A;  3IXR A;  1TRU A;  3TJK A;  1JHB A;  4WXT A;  4V1A g;  4Z7X A;  2B7J A;  3GH6 A;  1DUG A;  2LQO A;  2GSR A;  2WUL A;  5BMU A;  3H1N A;  4MLY A;  4NWY A;  3TKP A;  2GSS A;  2TRC P;  1QXH A;  1GSQ A;  5A4U A;  4GCI A;  1M0U A;  4K2D A;  3GV1 A;  3F9U A;  1TK0 B;  4K5S A;  4YQU A;  3CRT A;  3FR3 A;  1ERT A;  2X8C A;  1AIU A;  1S3A A;  1SK0 A;  1PD2 1;  3A2W A;  2IJY A;  2MMZ A;  3GIX A;  5IOX A;  5ECQ B;  1JZR A;  2NPB A;  1HNC A;  2X99 A;  2OE3 A;  2B1K A;  1O7U A;  2B1L A;  4D73 B;  1SK2 A;  3LQ7 A;  2RII A;  5B8A A;  1SKS B;  2BJX A;  1YDK A;  1ZCP A;  3L9U A;  4PNF A;  5L71 A;  3ZML A;  3GL3 A;  1YJ6 A;  2X64 A;  4IW9 A;  1QUW A;  5AIX A;  5IMV A;  4KSM A;  2CQ9 A;  1XW6 A;  1FW1 A;  2LNS A;  5LNK e;  1RW1 A;  5ELA A;  1WP0 A;  3E9J B;  4CW9 A;  3LYK A;  4BVY A;  3IE3 A;  2OAC A;  3ISO A;  4TR3 A;  3HYP A;  1E6B A;  4DSS B;  2P31 A;  2YZH A;  1N2A A;  1HNA A;  1M2D A;  1YF0 A;  4BPY A;  4FH8 A;  5FWG A;  1A2M A;  2FGX A;  5ECL B;  4OFT A;  5G5E A;  1SKR B;  4CDO A;  3EMX A;  4RI7 A;  2P5R A;  4N11 A;  2B6M A;  2O85 A;  1ABA A;  5ELG A;  2AV4 A;  4ULX A;  3N9J A;  3KTB A;  1Z6N A;  3F4R A;  4X4J A;  3FZ5 A;  2YNX A;  2VCZ A;  1SKW B;  1NHO A;  1YKA A;  4IQA A;  4AJ7 A;  3CRU A;  3HHV A;  3KCM A;  2VD1 A;  5KN1 A;  1SL2 B;  1U3A A;  1PMT A;  4YAV A;  5E4W A;  4GQF A;  2GS3 A;  13GS A;  2F51 A;  5AGY A;  3ZL5 A;  3IPZ A;  4EDY A;  2H1B A;  2RM6 A;  1JZW A;  2HI7 A;  2LRT A;  3EC3 A;  4G9H A;  1TTZ A;  3Q74 A;  4TR1 B;  2PN8 A;  7GSS A;  1K3L A;  1UC7 A;  5ECK B;  3TB2 A;  1I5G A;  4N0Z A;  2R0P A;  1MEK A;  1TKD B;  1T00 A;  4ZL9 A;  2YAN A;  3EE2 A;  4ECC A;  2IMF A;  1TW9 A;  4HZ2 A;  6GSU A;  1A0F A;  3H93 A;  5G2Z A;  5DDL A;  1T4Y A;  1EOH A;  3ZFL A;  4ZXG A;  3F63 A;  4Z2R A;  5DAK A;  1SYR A;  1V2A A;  3TKR A;  2ES7 A;  1GSU A;  1WWJ A;  3GNJ A;  5HR1 A;  1SJI A;  1GP1 A;  3DD3 A;  4NV2 A;  4AJ6 A;  3GSS A;  1YZX A;  3ERG A;  2F9S A;  1OC9 B;  3R3E A;  4GLT A;  3IAS 2;  3GKN A;  3EVI A;  2HRK A;  1DE1 A;  1ZL9 A;  3LFL A;  4I2T A;  3FZ9 A;  5D9V A;  2B5E A;  4XS1 A;  3MYD A;  1A2L A;  4OMV A;  1LJR A;  3FR6 A;  1EV4 A;  3KMO A;  3GKX A;  5ENU A;  4MF7 A;  2P0G A;  3GTU A;  2KLX A;  2LQQ A;  1WMJ A;  4V2L A;  3IV4 A;  3GA4 A;  3KTL A;  4WKW A;  3J7Y k;  5J9B A;  4ZIJ A;  1TRV A;  4BA7 A;  2CAI A;  2RUF A;  3VK9 A;  3HXS A;  1OE8 A;  4DSQ A;  2C80 A;  2HRF A;  5KOW A;  4OO4 A;  3QPM A;  2AAW A;  1XFL A;  1V9W A;  1X5C A;  4HJM A;  4JR4 A;  3S9F A;  2H1A A;  2REM A;  3U5R E;  5JWQ B;  5ECS A;  2TRX A;  2CAQ A;  5JCG A;  2RM5 A;  3GYK A;  4MNN A;  2IME A;  2KOK A;  1BYE A;  3QAW A;  1M2A A;  2CA8 A;  4ZB6 A;  3CTF A;  1FB0 A;  1KNG A;  4KDY A;  2HFD A;  3OR5 A;  4MJB A;  5BRT A;  2MMO A;  3TKQ A;  2AUV A;  4YKF A;  2FNO A;  2HZE A;  3UAR A;  4G0L A;  4PUA A;  1KBN A;  5IO0 A;  2V6O A;  14GS A;  3A3T A;  4ZL8 A;  3TJG A;  4IQ1 A;  4A5P A;  5GZZ B;  1GSS A;  2DC5 A;  5HR3 A;  5J3R A;  3TCO A;  1GLQ A;  5HR2 A;  2V41 A;  2MMN A;  1H4O A;  5DAL B;  2JU5 A;  1SD8 A;  2C0F A;  5D73 A;  1ZOF A;  2L57 A;  3M9J A;  1ML6 A;  3GKM A;  5ECP B;  4N30 A;  1ZMA A;  2H1G A;  3ZMK A;  1X9S B;  4KGI A;  3KMN A;  4YH2 A;  2YV7 A;  3KP9 A;  1AAZ A;  1F37 A;  2E2G A;  3IBH A;  3LSZ A;  4Z2T A;  5HQP A;  5GSS A;  1K0B A;  2B7K A;  3BCK A;  2EIQ A;  4EVM A;  2GT5 A;  4MP4 A;  3UL3 A;  4JU5 A;  1XPV A;  4BL7 B;  3WT1 A;  1WPI A;  3UIW A;  2X8G A;  1XCC A;  2DIZ A;  2H30 A;  3LYP A;  1IYH A;  3HVX A;  2OAD A;  1FHE A;  5G1L A;  5J5N A;  4O5Q A;  4I6X A;  3EWL A;  3EU3 A;  3NOF A;  1Z7P A;  3VFI A;  1K0M A;  1J08 A;  2WFC A;  2GSQ A;  1X9W B;  1OYJ A;  2VCQ A;  4CY8 A;  4KCA A;  4HZ4 A;  4ZB9 A;  3LXT A;  2YWN A;  2FY6 A;  8GSS A;  3GX8 A;  2AB6 A;  3HCZ A;  2R37 A;  1G6W A;  3HZ4 A;  3TJF A;  4MF5 A;  4J56 E;  3L9S A;  4CHS A;  3DKS A;  5DQS A;  6GSW A;  5HFG A;  1TJD A;  1W4V A;  2ZUP A;  4K7N A;  5D9T A;  2CX3 A;  2FWH A;  2H66 A;  3PGT A;  5KN2 A;  4YQV A;  4TKY A;  4K0G A;  3G7Y A;  5ECM B;  1QK8 A;  1VGL A;  5B6N A;  2ON5 A;  4EL1 A;  1EOG A;  3VLN A;  1CQH A;  4TR0 A;  2GTU A;  2G2Q A;  2YJ7 A;  3RDW A;  4K7I A;  1BG5 A;  2I81 A;  2YN1 A;  1PL1 A;  1Q98 A;  4OCE A;  2IIY A;  2B3S A;  1X5D A;  1M9B A;  2H0I A;  1ON4 A;  2IN3 A;  4NHZ A;  5ID2 A;  4CY6 A;  5H5R A;  4NAX A;  1IYI A;  2H1D A;  1T8E B;  2GQM A;  5ECR B;  5JCW A;  5C04 A;  3C7M A;  1TP9 A;  4MJE A;  1WJK A;  3C1R A;  3CSJ A;  5EPF A;  1GUM A;  4JE1 A;  3I9V 2;  2H76 A;  3GKK A;  2VLU A;  3U6V A;  1V98 A;  2VLT A;  2NDO A;  4K0N A;  4GXZ A;  2K8V A;  4OWY A;  2LRC A;  3WGD A;  5A4V A;  4I2U A;  2EC4 A;  5HFI A;  2M46 A;  2OJL A;  1FOV A;  1I9D A;  3DVW A;  3LJR A;  4IGJ A;  4HOJ A;  1MD3 A;  5JCU A;  3LGC A;  5F07 A;  4PUF C;  3KD0 A;  5AIV A;  3DEX A;  4PGT A;  2DJ0 A;  3ZYW A;  4BVX A;  4YAP A;  2O89 A;  4IHU A;  3A5W A;  4OO5 A;  5C00 A;  3KH7 A;  1Z7R A;  5DJL A;  3DXB A;  2AJQ B;  1JZO A;  2DLX A;  1QMV A;  2DSA A;  1PKW A;  2L6C A;  1DE2 A;  3EPT A;  2X49 A;  1M9A A;  3EMP A;  3FEU A;  1HQO A;  3D5J A;  4KUN A;  2DJK A;  2J23 A;  2HT9 A;  1B9Y C;  2VL3 A;  3TOU A;  4ECI A;  2VCW A;  3M9K A;  1ERV A;  4HI7 A;  10GS A;  5CRD A;  2AHE A;  2GZZ A;  2NBS A;  1VF1 A;  4HDE A;  4EKZ A;  2YP6 A;  1MDI A;  1EEM A;  3ZTL A;  3HJO A;  1R4W A;  1MDJ A;  2LJA A;  5GAN D;  1V58 A;  3WT2 A;  5LD0 A;  2P5Q A;  1QGV A;  2PGT A;  1BED A;  3CSH A;  3PIN A;  3GST A;  2GST A;  1ZYE A;  5JWR B;  4KH7 A;  1PN9 A;  2FWE A;  4KND A;  2IL3 A;  3ZRE A;  1XBS A;  3JCM L;  2HZF A;  1WIK A;  3TKS A;  3LXZ A;  2F3M A;  3IA1 A;  2VCT A;  3TRQ A;  4POK A;  1FG4 A;  3G9B A;  4FIW A;  4WR4 A;  2H74 A;  2JSZ A;  5H5Q A;  2IMK A;  3TKS E;  4EIQ A;  5J9C A;  4YQM A;  3VWX A;  3DML A;  4L8E A;  3GL5 A;  1U6T A;  4LMW A;  3L4N A;  3W6G A;  1JZD A;  4XCS A;  4X1U A;  3CXG A;  2C0D A;  1T1V A;  5IO2 A;  3QAG A;  3VWU A;  3F4T A;  4MMM A;  3BBY A;  2R5G A;  3K8N A;  3H79 A;  2MMA A;  4WBJ A;  2VOC A;  4G19 A;  4MK3 A;  1EGR A;  3QMX A;  3TJB A;  4ECB A;  1MTC A;  1EWX A;  3KGK A;  3F6D A;  3Q19 A;  1XOA A;  3LW9 A;  4V1A p;  4DSS A;  1ZGN A;  2H8L A;  4MJC A;  1Z9H A;  1YEP A;  4PQ1 A;  3HZ8 A;  2O8V B;  3PPU A;  1OAZ A;  4LLR A;  1BJX A;  3BD2 A;  2QC7 A;  5ABR A;  1NSW A;  1EP7 A;  4TVE A;  2PVQ A;  4WF4 A;  4KCE A;  5DAK B;  3ZFB A;  1GRX A;  4MJA A;  3J7Y b;  2WJU A;  1GTB A;  3ED3 A;  4TXO A;  4GSN A;  3HD5 A;  1GL8 A;  3IC8 A;  2H0H A;  2YWI A;  1TRS A;  3CYN A;  4L5O A;  2EIR A;  1X5E A;  2HXK A;  1JFU A;  22GS A;  2X4A A;  5A5K A;  2I4A A;  4WEY A;  1FAA A;  3W8J A;  3ZVJ A;  5D8I A;  3HA9 A;  2XPE A;  19GS A;  1HD2 A;  4GWR A;  2DBC A;  2VD0 A;  2XPD A;  9GSS A;  3GTU B;  3FZ4 A;  4X43 A;  3RAZ A;  16GS A;  1SU9 A;  1ST9 A;  4BWQ A;  2UZ8 A;  1WOU A;  1ACV A;  3MAK A;  4QL9 A;  2WRT A;  3PH9 A;  5EY6 A;  4KDU A;  1NW2 A;  4JED A;  2V6K A;  4ID0 A;  1AQW A;  3FHK A;  1GWC A;  5HFK A;  2YCD A;  5G30 A;  5CNW A;  2L6D A;  3WYW A;  5IQY A;  2VM2 A;  4F03 A;  1PRX A;  2LJR A;  5DCG A;  2H6Y A;  4IJ3 A;  4KW6 A;  1TU7 A;  4NMU A;  2VL9 A;  4K7O A;  3GFK A;  3WD6 A;  4RUV A;  1LU4 A;  2DJJ A;  4EIP A;  2H6Z A;  1PN0 A;  1A24 A;  2KP1 A;  1GNE A;  1VRS D;  2VCV A;  4KAE A;  1GH2 A;  2I3Y A;  3VI5 A;  1K0D A;  5CO3 A;  2LS5 A;  4H86 A;  5G31 A;  1YF1 A;  4FYU A;  4WET A;  2OBI A;  1K3Y A;  4GF0 A;  5DQY A;  1TU8 A;  1XWK A;  4RQR A;  3CMI A;  5CRE A;  1X0R A;  3BCI A;  4EE0 A;  3A2V A;  2ALB A;  2FUG 2;  1EP8 A;  4NXI A;  5IM9 A;  2PU9 C;  2FCH A;  2IFQ B;  2A2S A;  1EV9 A;  1SL0 B;  2DJ1 A;  4NPB A;  1O73 A;  6GST A;  2CZ3 A;  3WGX A;  3QD9 A;  5AN1 A;  2VL2 C;  4RQX A;  2LTK A;  1GSE A;  2MYG A;  5CAX A;  1J0F A;  3PR8 A;  3M0F A;  1XOB A;  3O6T A;  5DBQ A;  3CBU A;  1QQ2 A;  2N5F A;  4G0I A;  3F6F A;  4DSR A;  5D93 A;  1E2Y A;  3ME8 A;  4E8H A;  1PX7 A;  2JZS A;  5ECI B;  1M99 A;  3IK9 A;  2DML A;  4AF2 A;  5B6M A;  3F3Q A;  2BMX A;  3FMW A;  5DVB A;  5E59 A;  2M80 A;  5GAP D;  3KP8 A;  2GQK A;  18GS A;  1Z3E A;  2GGT A;  1S3C A;  2AYT A;  5EL8 A;  3RHB A;  1Q4J A;  2VO4 A;  5IMZ A;  2H72 A;  5COH A;  4KE3 A;  4HQZ A;  2H70 A;  1XVW A;  3ZIV A;  3DRN A;  5CRH A;  2LST A;  3F0I A;  5CRW A;  3FY7 A;  1WRY A;  1K0C A;  2CV4 A;  3V1W A;  1SYX A;  1GUL A;  5ECH B;  1GUH A;  1A23 A;  4P3Y B;  5IMC A;  1SK1 A;  2LRN A;  5JWO B;  1Z6M A;  4O32 A;  4MDC A;  5F0G A;  4KA0 A;  5DAL A;  2CVK A;  4WBR D;  1GNW A;  3D4T A;  3VWV A;  2K9F A;  4I8B A;  5G5F A;  2CZ2 A;  4GST A;  5ECN B;  5H5S A;  3F3R A;  4LL4 B;  4XS4 A;  4HU7 A;  2R3X A;  2VAF A;  1EGO A;  2DJ3 A;  4ZIL A;  4K8M A;  2F8F A;  2HLS A;  3CSI A;  3ERW A;  4ILF A;  3C8E A;  2GDR A;  2C3N A;  1PSQ A;  3HJP A;  3M8N A;  2PVO C;  2OE1 A;  1FB6 A;  2VUP A;  3HJM A;  1PGT A;  1OKD A;  1O85 A;  1B8X A;  3VPQ A;  4IVF A;  4ZBB A;  2FWF A;  4POB A;  2CVD A;  2R4V A;  17GS A;  3D0Z A;  2IWT A;  1EZK A;  3TUE A;  5ID2 B;  3HDC A;  3E0U A;  2L5O A;  1G7E A;  3ERF A;  5IOW A;  1GSF A;  1J9B A;  2YPM A;  3GUS A;  4NV5 A;  4EXJ A;  4MZB A;  2L4Q A;  4K1F A;  3EYT A;  4GTU A;  4XIH A;  4HJ2 A;  4Q5R A;  1RQM A;  1C72 A;  4HEA 2;  1B4Q A;  1B9X C;  1THO A;  2V2G A;  5IPH A;  1PQN A;  1ZZY A;  4ML1 A;  4Q5N A;  1G7O A;  2MBT A;  3DWV A;  3P90 A;  6GSX A;  2YWO A;  2HSY A;  5CRG A;  4X0X A;  1B48 A;  1TK8 B;  2XBI A;  4MAB A;  4LA1 A;  1OE7 A;  4IP6 A;  3GHA A;  12GS A;  2HRA A;  2B5Y A;  2FD3 A;  1UA5 A;  3M3M A;  3D21 A;  1DBY A;  2C0E A;  2K8S A;  4BVX B;  2N5B A;  2CVB A;  2GZP A;  1B4P A;  3H8Q A;  2XBQ A;  4IEL A;  4ICY A;  2KHP A;  2H6X A;  2C8U A;  2PBJ A;  1A8Y A;  2H01 A;  1URM A;  1K0A A;  1KTE A;  1GTU A;  4N10 A;  3O76 A;  4XRD A;  3TRP A;  2WDU A;  1M7T A;  1N8J A;  2LEG A;  3FR9 A;  1YKC A;  4TW5 A;  2YOI A;  3QFA C;  1SEN A;  2DKH A;  3RPP A;  4N0V A;  2LKU A;  1FOH A;  3GN3 A;  3VUR A;  4Q5Q A;  2RUE A;  1O8W A;  4MPG A;  3I69 A;  1NHY A;  3KZQ A;  5J4U A;  1GTA A;  4V2M A;  4QL7 A;  3HY2 A;  2HYX A;  2PWJ A;  4ACS A;  2BTO T;  1HNB A;  1OC3 A;  4BVY B;  3Q18 A;  3LG6 A;  1V40 A;  3I6A A;  5IPG A;  3MDK A;  1GSD A;  1UVZ A;  1TRW A;  3IOS A;  3TKS C;  5D9X A;  5F06 A;  1BAY A;  3FZA A;  4AJ8 A;  2TIR A;  4O5R A;  2H19 A;  4F2I A;  4PQH A;  2VLV A;  1XW9 A;  2FWG A;  1S3D A;  1Y25 A;  3O3T A;  4XS6 A;  3E3E A;  1U87 A;  4K2X A;  1EEJ A;  4D73 A;  3UVH A;  1NM3 A;  4OFM A;  2NVL A;  3UBK A;  3CTG A;  4EC0 A;  5FT3 A;  5DCH A;  2LV3 A;  1XVQ A;  2I9H A;  2GVP A;  3RPN A;  2X8H A;  4L5L A;  2ON7 A;  2JL4 A;  4JR6 A;  3KJY A;  4AGS A;  4O5U A;  2RLI A;  4F0C A;  2GT6 A;  4MF6 A;  2CX4 A;  4IBP A;  4IN0 A;  3GX0 A;  1T3B A;  1M2B A;  2ZCT A;  2IMI A;  3UBL A;  4G2E A;  2E7P A;  4F82 A;  4MCU A;  2JAD A;  3WGE A;  1G0T A;  1JLV A;  2A4V A;  4KSO A;  5A4W A;  2C1Y A;  4IS0 A;  1W89 A;  4XRA A;  3KIJ A;  2J9H A;  5CYY A;  2QGV A;  1XWC A;  4TXO B;  4I97 A;  3MSZ A;  4KF9 A;  2FHE A;  2XC2 A;  3N5O A;  2H71 A;  2YJH A;  3I43 A;  2JAC A;  1K0N A;  3KXO A;  5IMA A;  1XWB A;  2OBK A;  4J57 E;  3C71 A;  2XHF A;  3KH9 A;  1SL1 B;  4KX4 A;  3QR6 A;  3FW2 A;  1GSY A;  5LCZ A;  1AQX A;  4I5Q A;  2H75 A;  1TDI A;  1GUK A;  4ZB8 A;  4JRR A;  3EUR A;  5B8B A;  3QCP A;  3FKF A;  3IC4 A;  1XW5 A;  3IDV A;  4XHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...