2OE1A

Crystal structure of mitochondrial thioredoxin 3 from saccharomyces cerevisiae (reduced form)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
106
structure length
106
Chain Sequence
SSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin-3
publication title Structural and mechanistic analyses of yeast mitochondrial thioredoxin Trx3 reveal putative function of its additional cysteine residues
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Electron transport
total genus 36
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2oe1A00
1J9BA 2PMTA 3ZMKA 4O32A 4WF5A 4MH2A 1ZL9A 5DQSA 5HFGA 4LMVA 4LL1B 1R7HA 3DWVA 3HJPA 1GL8A 3GL5A 2CAIA 1TRVA 2YV9A 1TDIA 2PGTA 2YWMA 2TRXA 2CA8A 3VPTA 3UJ1A 1RK4A 2LJAA 1O7UA 1GSSA 5E59A 1M2AA 2KP2A 4OO5A 3LWAA 1OKTA 4TRXA 4WKWA 2ON5A 1FG4A 2P5QA 3UMAA 1GH2A 2N5FA 1VF3A 3H4KA 1XVQA 2C0FA 1JFUA 5IMCA 2B1LA 3HJOA 1BYEA 1YJ6A 2EIQA 5B6MA 2GGTA 2GVPA 5FHIA 2I3YA 3F8UA 4N0ZA 4PQ1A 2F51A 1RW1A 1KEBA 1JLVA 1O85A 1SK2A 2VCZA 1UA5A 3TJKA 3QAGA 4ZBBA 2I1UA 5JWQB 2QGVA 3M0FA 4G9HA 4QL9A 1SENA 3DD3A 5CO3A 1M9AA 4IJ3A 2VLUA 4WF4A 4PQIA 2ES7A 1I9DA 4TOPA 4N0VA 2HZEA 1XWKA 3FW2A 5DALB 1ZGNA 4EO3A 2LJRA 3EURA 2FY6A 3IA1A 2P5RA 5IMDA 2L4CA 2E2MA 3P8WA 3M1GA 4KDYA 3IPZA 5ECPB 5HR0A 4LL4B 1LJRA 1AW9A 5IPGA 1U87A 5HR2A 5J41A 4POBA 3I43A 2H0GA 3UL3A 4OCEA 3ZTLA 5ECLB 4KX4A 1PL1A 9GSSA 2AB6A 1A2MA 3ZZXA 4TR3A 2HE3A 3TGZA 3WGXA 5E4WA 2IPAA 1AAZA 5DDLA 1YQ1A 2H75A 3LSZA 3ME7A 4BWQA 4MJCA 3DVWA 2HZFA 4PNFA 4YAPA 3TJFA 2FGXA 5CNWA 3NOFA 2IMIA 2CVDA 4X1UA 4K8MA 7GSSA 2H6YA 4AJ8A 2CX3A 1SU9A 4XS6A 4CW9A 2DMLA 2K8SA 4ILFA 2YJ7A 2OA7A 2DIZA 1N2AA 3D5JA 4RQXA 20GSA 1X9SB 4PGTA 3QAVA 1MDIA 1UVZA 4MLYA 5ECSA 2FA8A 3P2AA 1PQNA 4KW6A 2C4JA 4MF7A 2M46A 4EKZA 2QKEA 1R5PA 2JZTA 3UBKA 4GLTA 5DQYA 1PD21 2EIOA 1M9BA 4TXOA 1AQVA 3KMNA 5DVBA 1DE1A 17GSA 1EV4A 5IMZA 3DIEA 1OAZA 4D73A 2LJKA 4GF0A 3WGEA 3GH9A 3IAS2 1NM3A 3GV1A 4ZBDA 5CYYA 4QQ7A 3E3EA 1QFNA 5INYA 4IBPA 2H0IA 5IOXA 3TKSA 5FWGA 2CV4A 1T7PB 2X8GA 3CSHA 4WR5A 2PVOC 2WRTA 4K0GA 2KP1A 3TRPA 3IXRA 18GSA 1H75A 3TKQA 4G19A 2JU5A 1X5EA 5AN1A 3J7Yb 2YCDA 2C3NA 2PPTA 2R37A 1THOA 3GHAA 1Z3EA 3QPMA 4HI7A 4NAXA 1IYIA 3EMXA 2H1GA 1R5AA 1ZOFA 4Q5RA 1A24A 3HZ8A 4ZIJA 1AC1A 3PGTA 3W8JA 2J9HA 2IL3A 4KDXA 1E6BA 1TRSA 4EF0A 2IFQA 1VF1A 3FY7A 2GZYA 2B7KA 1EP8A 1OC9B 2I9HA 3KGKA 1YDKA 4HU9A 2HSYA 1TW9A 2OBIA 1XW6A 5GAPD 4GWRA 2LQOA 4K7IA 12GSA 1BG5A 2NVLA 2H6XA 2O89A 6GSSA 2N5AA 1SKSB 1MEKA 2DJ1A 1KNGA 1VF4A 4MMMA 2VL2A 2X64A 4TKYA 2DIYA 2XC2A 2L5OA 3IR4A 3M3MA 4HJMA 1YEPA 3KXOA 5G31A 6GSWA 2R6KA 2IMKA 1V2AA 4MZBA 2WGRA 1ERTA 1XZOA 1XWCA 3Q19A 4IW9A 5IQYA 3TB2A 4ISDA 3P7XA 4ZILA 4AGSA 1WE0A 4FO5A 1PL2A 3F4SA 2HXKA 5IMFA 1I5GA 4WEYA 3ZFBA 2AJQB 4RI6A 3C71A 3H1NA 4DSRA 2FWFA 2YWIA 5J9BA 5F07A 5JWRB 3KH7A 4HQZA 2GQLA 5GAND 4FIWA 3R2QA 5C00A 1HQOA 5ECKB 3G7JA 3F4TA 1O6JA 2GZZA 4GRFA 4NV5A 1YY7A 2H30A 1WMJA 1PRXA 6GSVA 2X8CA 3A3TA 2E2GA 4IP6A 2K8VA 1J0FA 2AV4A 1SKRB 1A2LA 4FYCA 3VWXA 3TUEA 2KHPA 4I8BA 5D9XA 3QR6A 2JADA 1WIKA 4V1Ap 2OBKA 1R26A 5CRGA 1NHYA 2XPEA 4I2UA 1SL2B 2HI7A 3GFKA 1A2JA 3LFLA 2FNOA 4NHWA 3L9VA 4TXVA 2DJJA 1XWBA 5CRDA 1TKDB 4E8HA 1QK8A 3TJGA 4MDCA 1T1VA 1EGRA 2C3QA 5DCHA 4IP1A 2YWNA 1W4VA 3KP9A 5J3RA 3HY2A 2LRCA 5JCWA 2FD3A 3D6IA 3D0ZA 2KOKA 3GSTA 3LG6A 4OWYA 3QAWA 4YQVA 3EVIA 4XS4B 2R5GA 4EDYA 2YV7A 2P31A 1PKWA 3IV4A 3WGDA 4BA7A 5AISA 1TRWA 4NHZA 2KLXA 3ERGA 1PMTA 1OYJA 1SK1A 2YOIA 2HYXA 2V41A 4NMUA 2M80A 2LKUA 2QSIA 5DCGA 2HRFA 1BEDA 2IN3A 2WB9A 1XWGA 4IELA 1SJZA 3H8QA 2MBSA 3ISOA 4G2EA 4MCUA 5D9TA 3EWLA 1SJIA 3KTLA 3EE2A 1AQXA 4KA0A 5A4WA 3CYNA 3WT2A 4XIHA 3GUSA 4K0NA 2BMXA 2HNLA 1TK5B 5DJLA 4POLA 16GSA 2WS2A 5D96A 4TR0A 1DSBA 3ZRDA 3H93A 2REMA 3VFIA 4IVFA 5ECNB 4YQMA 2YANA 4POMA 4BWSA 2XHFA 3C7MA 2PERA 1F3AA 2R2JA 5DBQA 3V1WA 3SBCA 4KSOA 2VCXA 1OKDA 1A0RP 3CRTA 4BVXA 2O8VB 1FVJA 4Z7XA 1K0CA 3QD9A 3IOSA 1JZDA 4TR4A 4WR4A 3FR3A 3FR9A 4HZ4A 1S3AA 1XBSA 4J57E 2VM2A 3ME8A 5HQPA 2H66A 2WJUA 2H74A 2WULA 3ZLPA 3IC4A 1EEJA 2C0GA 3IK9A 4O7HA 1GWCA 3APOA 2L6CA 4JE1A 3Q74A 3I9V2 1GRXA 4F0BA 2NDOA 1TTZA 4J56E 3MSZA 3HDCA 3L0HA 4DSSA 4F0CA 5HFIA 1JZOA 1PA3A 5IOWA 4Q5QA 1FAAA 2C0EA 3E9JB 4ECIA 1B8XA 4YAVA 3BBYA 3N9JA 1WJKA 5A5KA 2HRNA 2H1DA 2YWOA 2B6MA 1ABAA 4L0UA 1PX7A 3D22A 2K6VA 4ACSA 3HVSA 3LEFA 2C0DA 4TXOB 3ZIVA 5JCGA 5D8IA 4P3YB 2L5LA 2C80A 5F0GA 4D73B 5A4UA 1T8EB 4RQRA 5ECQB 3F3RA 4GQCA 2DSAA 8GSSA 4OFTA 1V98A 1HNCA 3GYKA 1EOHA 4ECJA 2OE3A 3F9UA 4LMWA 1KBNA 3ZFLA 2Z9SA 3DRNA 1S3DA 2O87A 2DJ0A 2GTUA 2R3XA 1E2YA 1XWAA 4KH7A 3FZAA 3GTUB 5D9WA 4EDZA 2VM1A 2MMNA 3HA9A 5L71A 2LRTA 2FWHA 5EPFA 2I4AA 4ZB9A 4GSSA 2WCIA 3BD2A 5GZZB 3CBUA 5F8BA 4OO4A 4PX1A 4IS0A 2CVBA 1QXHA 2WFCA 2FUG2 4ZB8A 3TRXA 2ZUPA 1T00A 3BCKA 1Q98A 2MYGA 2C3TA 3O6TA 2JSYA 3QCPA 3HZ4A 3F3QA 4HQSA 1Z9HA 1FW1A 3EU4A 1GLPA 5DALA 1A8YA 1VF2A 4LLRA 3FRCA 1GTIA 1JZRA 1B48A 3KEBA 1C72A 1WWJA 4POKA 4ZL7A 3NZNA 2WDUA 5ECRB 5ELGA 2IWTA 3VURA 1GSFA 4TR1B 3VWVA 3VWWA 3K8NA 3APSA 2LS5A 1F3BA 2F8AA 2OE1A 4KDUA 3N5OA 4QL7A 4MPFA 1M2DA 4FH8A 3GN3A 4KAEA 1R4WA 2H70A 1GTUA 2YJHA 2OKAA 5ECIB 6GSTA 1QQ2A 1GSUA 3EINA 2GT6A 1OE7A 5GSTA 4KE3A 1GLQA 3G9BA 3HHVA 4AJ6A 1B9YC 1XCCA 5G1KA 5J4UA 4K9ZA 4RUVA 1EGOA 4KUNA 3GKMA 1BAYA 3EYTA 2DC5A 1B4PA 5EY6A 1TK8B 1GSEA 3A2WA 4I6XA 3BOAA 5IM9A 4NXIA 2LEGA 2H1AA 5D9VA 1GNWA 2O7KA 1TU7A 4TN8A 4H86A 6GSUA 4BVYA 3E0UA 4F82A 3SWLA 1GUHA 5COHA 4AJ7A 5ECOB 1XIYA 1N8JA 2GLRA 3FZ4A 1USBA 1MDJA 4ML6A 2C1YA 4MF5A 3DVXA 1EEMA 3KP8A 2H73A 3RBTA 3HD5A 1V40A 1FO5A 5IMAA 4ECBA 2VUPA 3TOUA 1K3OA 2B5YA 2B5EA 2CX4A 4OD7A 2DMMA 2WZ9A 2A4VA 2H01A 3J7Yk 5B8AA 3KM6A 2RM6A 2RM5A 1DE2A 3KH9A 2H6ZA 3APQA 4WETA 3DXBA 3F6DA 3TJBA 4PQHA 2AUVA 4EL1A 2MBTA 3CTFA 4G10A 5ID2B 19GSA 1GSQA 4XRDA 3GKKA 3LXZA 1XVWA 1ILOA 2L57A 3W6GA 1ZMAA 2VOCA 3UARA 4OMVA 5LCZA 4O5RA 1U88A 4X43A 2VL9A 5AIXA 1MD3A 1O73A 1Y6EA 4OFNA 2OACA 3P90A 3DEXA 2IMDA 3ERWA 2JL4A 1ML6A 4I97A 5AIVA 3RAZA 1H4OA 2ZNMA 2LRNA 1JLWA 2L6DA 5A4VA 5G5FA 5DAKB 2YP6A 1EP7A 4Q5FA 1TOFA 4GQFA 3C1SA 5ENUA 2K18A 1OC9A 2PUKC 3WT1A 1W89A 4HJ2A 5GSSA 4GXZA 3C73A 2JZRA 1GUMA 4EE0A 3GSSA 3HVVA 3TKRA 2FCHA 4WBJA 4XS1A 3A2VA 3Q18A 2KUCA 1X9WB 2I81A 1GNEA 2JSZA 2IMFA 3JCML 3LXTA 1B9XC 1TXXA 4N30A 10GSA 2HFDA 4NV2A 11GSA 2L59A 4NPBA 1S3CA 4HDEA 5H5RA 3BJ5A 1SKWB 5AGYA 1Z6NA 1XW9A 2ALBA 1TI1A 2L4QA 2NPBA 3UVTA 4GSTA 1EV9A 5IO0A 1X0RA 3KMOA 4ZL8A 2HT9A 1FOVA 2XPDA 3GA4A 3GKXA 1SL1B 1G7EA 1SL0B 5JCUA 4IGJA 5IIZA 1Z5YE 2JACA 4V1Ag 1GUKA 1IYHA 4LA1A 2NTOA 2VCVA 3GL3A 1ERVA 3VWUA 1GULA 1OC8A 2F9SA 2GDRA 4MJAA 4MF6A 1SD9A 2CZ3A 4MP4A 1JZWA 2DJKA 4JRRA 4GSNA 1Y25A 4MPGA 1UN2A 5IMVA 1K3YA 3C1RA 3DMLA 2YPMA 2LQQA 4NWYA 4E8EA 3W8SA 2V32A 1A0FA 2LNTA 1ZCPA 4ZBAA 3FEUA 3U5RE 2B1KA 3QFAC 1LU4A 1XXUA 1PN9A 4PURA 1XW5A 3FK8A 5ABRA 3RHCA 3S9FA 2B5XA 4ZL9A 1PGTA 4IHUA 1OC3A 4WXTA 4Q5NA 3HJMA 1SK0A 4DSSB 2GT5A 3VPQA 2HSHA 1OE8A 5DJMA 1WRYA 3IE3A 2CQ9A 4L8EA 3UIWA 2HZEB 3IBHA 2A2SA 2E7PA 4JBBA 5KN3A 5H5QA 3PINA 5HR1A 2YN1A 22GSA 3O76A 5F06A 3UOMA 2XBQA 3CXGA 3NIVA 1T4YA 3L78A 3QDNA 2VCWA 3KD0A 1WP0A 3M8NA 2VD1A 2VCTA 4X0XA 2GSQA 1CQHA 2BJXA 4PXOA 4DVCA 1VRSD 4L0WA 4HOJA 1ERUA 2LUSA 4EUYA 2AAWA 1K0BA 2VL3A 1Z7PA 1GSYA 4I2TA 1K0NA 2CVKA 4HEA2 1RQMA 3U6VA 1SJ6A 2GSSA 5LNKe 2AHEA 2FWEA 4BPYA 3RPNA 1THXA 4XS4A 4F03A 1MTCA 1O8XA 1ON4A 1FB0A 1URMA 3ZYWA 1GTAA 1U3AA 4KGIA 3QMXA 1V57A 3HYPA 3HXSA 4ID0A 2J23A 1X5DA 1AQWA 1G0TA 3FHKA 1FHEA 3FZ5A 1GTBA 1F2EA 3GURA 1WOUA 3F6FA 1SD8A 2RUFA 3KIJA 1MDKA 3L9SA 5F05A 2YNXA 4PNGA 3GNJA 2IIYA 2X8HA 2LV3A 5H5SA 4J2FA 3UEMA 1U3IA 3TKSE 2XBIA 1ACVA 2DBCA 2B7JA 3CSJA 3D4TA 1SYRA 1TP9A 4IQ1A 1CQGA 3G7YA 4CDOA 3TKSC 1GSDA 1HNBA 3PH9A 1T4ZA 2LTKA 1EOGA 3DKSA 4N11A 3GIXA 3OR5A 1F6MC 2H76A 3FR6A 2C8UA 2V1MA 2VLVA 4WBRD 2QC7A 3QFBC 2PVQA 5HFKA 3UVHA 1TI3A 4PUAA 1F9MA 3LQ7A 3KCMA 1XPVA 5JWOB 3BCIA 3F0IA 1TJDA 3KZQA 4MABA 3L9UA 3D21A 1A23A 4V2MA 2B3SA 1BJXA 3AY8A 1LBKA 2YZHA 3MAKA 2ZCTA 3TOTA 2FWGA 1YF1A 2MZCA 4BL7A 1NSWA 5B8BA 2V2GA 2N5BA 2O85A 5J9CA 2H72A 1O8WA 3ZVJD 2VLTA 3L4NA 4K7OA 2DLXA 1OVNA 4JZQA 4MK3A 1PX6A 3IAM2 2IFQB 3HVXA 1ZZYA 2LNSA 3LJRA 4MA9A 4K2DA 4MJBA 4AF2A 3CSIA 5B6NA 2FA4A 1V58A 4JR4A 1XFLA 1XOBA 3EC3A 5IO2A 1AIUA 3LYKA 1K3LA 2TRCP 2VL2C 2P0GA 2PN8A 2GSTA 3TKPA 4KSMA 1BX9A 1K0MA 3IDVA 2H1BA 3VK9A 5D93A 1K0DA 1TU8A 1HD2A 2EIRA 3UBLA 2EC4A 5CP1A 1JHBA 3WD6A 5HR3A 5ECMB 4ZXGA 2RIIA 2DJ2A 3ZMLA 2HLSA 3ED3A 4OFMA 1J08A 1X5CA 4K6XA 3EU3A 1V9WA 1YKCA 3LGCA 14GSA 1YEXA 3FYGA 4JU5A 4MZCA 3GKNA 1B4QA 3VI7A 2NBSA 2G0FA 4ML1A 2GZPA 2H71A 4XRAA 3GTUA 4TW5A 3VLNA 3VI5A 4DEJA 4XCSA 5EL8A 1T3BA 2YZUA 2VCQA 3MNGA 4V2LA 5C04A 2GQKA 3IK7A 1QMVA 4FYBA 1AUCA 1M99A 4I5QA 4N10A 3GX0A 3RPPA 1FVKA 1HNAA 3ZIJA 1K0OA 3D4MA 4IN0A 1KTEA 2MMOA 3ZVJA 4V2NA 2FHEA 4L5LA 1QGVA 1M0UA 1A8LA 3TJJA 1FB6A 3I69A 3MWHA 3O3TA 5EVOA 1PSQA 5ECHB 3I6AA 5KEJA 1NW2A 3C8EA 1Z6MA 1AXDA 3F4RA 6GSXA 3IHQA 4KCEA 3WYWA 3TRQA 5FT3A 2MMZA 3FZ9A 1QUWA 2VIMA 4F9ZA 1YKAA 3QOUA 4TR1A 2OADA 3M9JA 2E0QA 1HYUA 4KB3A 2JZSA 2GS3A 2OJLA 3US3A 2GQMA 3LYPA 1M7TA 3ZITA 4YH2A 4F2IA 2RLIA 13GSA 1EWXA 1GP1A 5ELAA 1MD4A 1UC7A 2VAFA 2VD0A 4KNDA 3UAPA 5D73A 2CAQA 4IJIA 2V6KA 2CZ2A 1VGLA 5G5EA 3FKFA 5CRHA 4ECCA 4JR6A 5CREA 5CRWA 3GRXA 4ZB6A 3IRAA 2PU9C 2V6OA 2BTOT 4O92A 3ZREA 3ZL5A 4MH3A 3MDKA 2M72A 1O81A 4KCAA 5G2ZA 5KN1A 2OE0A 4YQUA 4DSQA 4EXJA 3TCOA 3F63A 1X9MB 1M2BA 2MMAA 2F8FA 2IJYA 2PWJA 4RI7A 1XOAA 3KTBA 3HKRA 1G6YA 5CAXA 4IQAA 2R4VA 3A2XA 5KN0A 3HCZA 4CHSA 5IPHA 2H0HA 3EMPA 1F37A 4GTUA 2FLSA 4OCFA 4XHMA 1PKZA 2X99A 4IKHA 1ST9A 4L5OA 2G2QA 1YF0A 2D2ZA 1ZYEA 1TK0B 1EZKA 3PR8A 2GSRA 5ID2A 1U6TA 2ON7A 3CMIA 4TVEA 4EC0A 2CT6A 2DJ3A 4K7NA 3A5WA 2A2RA 5G30A 1G7OA 4XTSA 1YZXA 2F3MA 3M9KA 2PBJA 3CRUA 5LD0A 1DUGA 1TRUA 4K1FA 5G1LA 1SYXA 1Q4JA 4HU7A 3DGQA 5B7CA 2LSTA 5DAKA 1ZYQB 1G6WA 1Z7RA 3Q6OA 4PUFC 4HUAA 2VO4A 5KN2A 2TIRA 3KJYA 4MZWA 2RUEA 1BQ7A 3ERFA 4GCIA 4FYUA 1WPIA 3H79A 2H19A 1K0AA 4MJEA 3G7IA 4ULXA 3TDGA 4HZ2A 4HS1A 3LORA 3RDWA 1NHOA 3CTGA 3GMFA 4EVMA 3GH6A 2AYTA 4JEDA 2H8LA 1DBYA 1ERWA 5J5NA 2K9FA 6GSYA 3RHBA 3DYRA 2IMEA 3GX8A
chains in the Genus database with same CATH superfamily
1J9BA 2PMTA 3ZMKA 4O32A 4WF5A 4MH2A 1ZL9A 5DQSA 5HFGA 4LMVA 4LL1B 1R7HA 3DWVA 3HJPA 1GL8A 3GL5A 2CAIA 1TRVA 4G0IA 2YV9A 1TDIA 2PGTA 2YWMA 2TRXA 2CA8A 3VPTA 3UJ1A 1RK4A 2LJAA 1O7UA 1GSSA 5E59A 1M2AA 2KP2A 4OO5A 3LWAA 1OKTA 4TRXA 4WKWA 2ON5A 1FG4A 2P5QA 3UMAA 1GH2A 2N5FA 1VF3A 3H4KA 1XVQA 2C0FA 1JFUA 5IMCA 2B1LA 3HJOA 1BYEA 1YJ6A 2EIQA 5B6MA 2GGTA 2GVPA 5FHIA 2I3YA 3F8UA 4N0ZA 4PQ1A 2F51A 1RW1A 1KEBA 1JLVA 1O85A 1SK2A 2VCZA 4K5SA 1UA5A 3TJKA 3QAGA 4ZBBA 2I1UA 5JWQB 2QGVA 3M0FA 4G9HA 4QL9A 1SENA 3DD3A 5CO3A 1M9AA 4IJ3A 2VLUA 4WF4A 4PQIA 2ES7A 1I9DA 4TOPA 4N0VA 2HZEA 1XWKA 3FW2A 5DALB 1ZGNA 4EO3A 2LJRA 3EURA 2FY6A 3IA1A 2P5RA 5IMDA 2L4CA 2E2MA 3P8WA 3M1GA 4KDYA 3IPZA 5ECPB 5HR0A 4LL4B 1LJRA 1AW9A 5IPGA 1U87A 5HR2A 5J41A 4POBA 3I43A 2H0GA 3UL3A 4OCEA 3ZTLA 5ECLB 4KX4A 1PL1A 9GSSA 2AB6A 1A2MA 3ZZXA 4TR3A 2HE3A 3TGZA 3WGXA 5E4WA 2IPAA 1AAZA 5DDLA 1YQ1A 3CQFA 2H75A 3LSZA 3ME7A 4BWQA 4MJCA 3DVWA 2HZFA 4PNFA 4YAPA 3TJFA 2FGXA 5CNWA 3NOFA 2IMIA 2CVDA 4X1UA 4K8MA 7GSSA 2H6YA 4AJ8A 2CX3A 1SU9A 3PPUA 4XS6A 4CW9A 2DMLA 2K8SA 4ILFA 2YJ7A 2OA7A 2DIZA 1N2AA 3D5JA 4RQXA 20GSA 1X9SB 4PGTA 3QAVA 1MDIA 1UVZA 4MLYA 5ECSA 2FA8A 3P2AA 1PQNA 4KW6A 2C4JA 4MF7A 2M46A 4EKZA 2QKEA 1R5PA 2JZTA 3UBKA 4GLTA 5DQYA 1PD21 2EIOA 1M9BA 4TXOA 1AQVA 3KMNA 5DVBA 1DE1A 17GSA 1EV4A 5IMZA 3DIEA 1OAZA 4D73A 2LJKA 4GF0A 3WGEA 3GH9A 3IAS2 1NM3A 4A5PA 3GV1A 4ZBDA 5CYYA 4QQ7A 3E3EA 1QFNA 5INYA 4IBPA 2H0IA 5IOXA 3TKSA 5FWGA 2CV4A 1T7PB 2X8GA 3CSHA 4WR5A 2PVOC 2WRTA 4K0GA 2KP1A 3TRPA 3IXRA 18GSA 1H75A 3TKQA 4G19A 2JU5A 1X5EA 5AN1A 3J7Yb 2YCDA 2C3NA 2PPTA 2R37A 1THOA 3GHAA 1Z3EA 3QPMA 4HI7A 4NAXA 1IYIA 3EMXA 2H1GA 1R5AA 1ZOFA 4Q5RA 1A24A 3HZ8A 4ZIJA 1AC1A 3PGTA 3W8JA 2J9HA 2IL3A 4KDXA 4EIQA 1E6BA 1TRSA 4EF0A 2IFQA 1VF1A 3FY7A 2GZYA 2B7KA 1EP8A 1OC9B 2I9HA 3KGKA 1YDKA 4HU9A 2HSYA 1TW9A 2OBIA 1XW6A 2HSMA 4Z2RA 5GAPD 4GWRA 2LQOA 4K7IA 12GSA 1BG5A 2NVLA 2H6XA 2O89A 6GSSA 2N5AA 1SKSB 1MEKA 2DJ1A 1KNGA 1VF4A 4MMMA 2VL2A 2X64A 4TKYA 2DIYA 2XC2A 2L5OA 3IR4A 3M3MA 4HJMA 1YEPA 3KXOA 5G31A 6GSWA 2R6KA 2IMKA 1V2AA 4MZBA 2WGRA 1ERTA 1XZOA 1XWCA 3Q19A 4IW9A 4EIPA 5IQYA 3TB2A 4ISDA 3LW9A 3P7XA 4ZILA 4AGSA 1WE0A 4FO5A 1PL2A 3F4SA 2HXKA 5IMFA 1I5GA 4WEYA 3ZFBA 2AJQB 4RI6A 3C71A 3H1NA 4DSRA 2FWFA 2YWIA 5J9BA 5F07A 5JWRB 3KH7A 3IC8A 4G0KA 4HQZA 2GQLA 5GAND 4FIWA 3R2QA 5C00A 1HQOA 5ECKB 3G7JA 3F4TA 1O6JA 2GZZA 4GRFA 4NV5A 1YY7A 2H30A 1WMJA 1PRXA 6GSVA 2X8CA 3A3TA 2E2GA 4IP6A 2K8VA 1J0FA 2AV4A 1SKRB 1A2LA 4FYCA 3VWXA 3TUEA 2KHPA 4I8BA 5D9XA 3QR6A 2JADA 1WIKA 4V1Ap 2OBKA 1R26A 5KOWA 5CRGA 1NHYA 2XPEA 4I2UA 1SL2B 2HI7A 3GFKA 1A2JA 3LFLA 2FNOA 4NHWA 3L9VA 4TXVA 2DJJA 1XWBA 5CRDA 1TKDB 4E8HA 1QK8A 3TJGA 4MDCA 1T1VA 1EGRA 2C3QA 5DCHA 4IP1A 2YWNA 1W4VA 3KP9A 5J3RA 3HY2A 2LRCA 5JCWA 2FD3A 3D6IA 3D0ZA 2KOKA 3GSTA 3LG6A 4OWYA 3QAWA 4YQVA 3EVIA 4XS4B 2R5GA 4EDYA 3IHGA 2YV7A 2P31A 1PKWA 3IV4A 3WGDA 4BA7A 5AISA 1TRWA 4NHZA 2KLXA 3ERGA 1PMTA 1OYJA 1SK1A 2YOIA 2HYXA 2V41A 4NMUA 2M80A 2LKUA 2QSIA 1ZYPA 5DCGA 2HRFA 1BEDA 2IN3A 2WB9A 1XWGA 4IELA 1SJZA 3H8QA 2MBSA 3ISOA 4G2EA 4MCUA 5D9TA 3EWLA 1SJIA 3KTLA 3EE2A 1AQXA 4KA0A 5A4WA 3CYNA 3WT2A 4XIHA 3GUSA 4K0NA 2BMXA 2HNLA 1TK5B 5DJLA 4POLA 16GSA 2HRAA 2WS2A 5D96A 4TR0A 1DSBA 3ZRDA 3H93A 1S3RA 2REMA 3VFIA 1M3JA 4IVFA 5ECNB 4YQMA 2YANA 4POMA 4BWSA 2XHFA 3C7MA 2PERA 4FQUA 1F3AA 2R2JA 5DBQA 3V1WA 3SBCA 4KSOA 2VCXA 1OKDA 1A0RP 3CRTA 4BVXA 2O8VB 1FVJA 4Z7XA 1K0CA 3QD9A 3IOSA 1JZDA 4TR4A 4WR4A 3FR3A 3FR9A 4HZ4A 1S3AA 1XBSA 4J57E 2VM2A 3ME8A 5HQPA 2H66A 2WJUA 4PTSA 2H74A 2WULA 3ZLPA 4BL7B 3IC4A 1EEJA 2C0GA 3IK9A 4O7HA 1GWCA 3APOA 2L6CA 4JE1A 3Q74A 3I9V2 1GRXA 4F0BA 2NDOA 1TTZA 4J56E 3MSZA 3HDCA 4G0LA 3L0HA 4DSSA 4F0CA 5HFIA 1JZOA 1PA3A 4X4JA 5IOWA 5KOXA 4Q5QA 1FAAA 2C0EA 3E9JB 4ECIA 1B8XA 4YAVA 3BBYA 3N9JA 1WJKA 5A5KA 2HRNA 2H1DA 2YWOA 2B6MA 1ABAA 4L0UA 1PX7A 3D22A 2K6VA 4O5UA 4ACSA 3HVSA 3LEFA 2C0DA 4TXOB 3ZIVA 5JCGA 5D8IA 4P3YB 2L5LA 2C80A 5F0GA 4D73B 5A4UA 1T8EB 4RQRA 5ECQB 3F3RA 4GQCA 2DSAA 8GSSA 4OFTA 1V98A 1HNCA 3GYKA 1EOHA 4ECJA 2OE3A 3F9UA 4LMWA 1KBNA 3ZFLA 2Z9SA 3DRNA 2R0GA 1S3DA 2O87A 2DJ0A 2GTUA 2R3XA 1E2YA 1XWAA 4KH7A 3FZAA 3GTUB 5D9WA 4EDZA 2VM1A 2MMNA 3HA9A 5L71A 2LRTA 2FWHA 5EPFA 2I4AA 4ZB9A 4GSSA 2WCIA 3BD2A 4MNNA 5GZZB 3CBUA 5F8BA 4OO4A 4PX1A 4IS0A 2CVBA 1QXHA 2WFCA 2FUG2 4ZB8A 3TRXA 2ZUPA 1T00A 3BCKA 1Q98A 2MYGA 2C3TA 3O6TA 2JSYA 3QCPA 3HZ4A 3F3QA 4HQSA 1Z9HA 1FW1A 3EU4A 1GLPA 5DALA 1A8YA 1VF2A 4LLRA 3FRCA 1GTIA 1JZRA 1B48A 3KEBA 1C72A 1WWJA 1PFOA 4POKA 4ZL7A 3NZNA 2WDUA 5ECRB 5ELGA 2IWTA 3VURA 1GSFA 4TR1B 3VWVA 3VWWA 3K8NA 3APSA 2LS5A 1F3BA 2F8AA 2OE1A 4KDUA 3N5OA 4QL7A 4MPFA 1M2DA 4FH8A 3GN3A 4KAEA 1R4WA 2H70A 1GTUA 2YJHA 2OKAA 5ECIB 6GSTA 1PN0A 2QA2A 1QQ2A 1GSUA 3EINA 2GT6A 1OE7A 5GSTA 4KE3A 1GLQA 3G9BA 3HHVA 4AJ6A 1B9YC 1XCCA 5G1KA 5J4UA 4K9ZA 4RUVA 1EGOA 4KUNA 3GKMA 1BAYA 3EYTA 2DC5A 1B4PA 5EY6A 1TK8B 1GSEA 3A2WA 4I6XA 3BOAA 5IM9A 4K5RA 4NXIA 2LEGA 2H1AA 5D9VA 1GNWA 2O7KA 1TU7A 4TN8A 4H86A 6GSUA 4BVYA 3E0UA 4F82A 3SWLA 1GUHA 5COHA 4AJ7A 5ECOB 1XIYA 1N8JA 2GLRA 3FZ4A 1USBA 1MDJA 4ML6A 2C1YA 4MF5A 3DVXA 1EEMA 3KP8A 2H73A 3RBTA 3HD5A 1V40A 1FO5A 5IMAA 4ECBA 2VUPA 3TOUA 1K3OA 2B5YA 2B5EA 2CX4A 4OD7A 2DMMA 2WZ9A 2A4VA 2H01A 3J7Yk 5B8AA 3KM6A 2RM6A 2RM5A 1DE2A 3KH9A 2H6ZA 3APQA 4WETA 3DXBA 3F6DA 3TJBA 4PQHA 2AUVA 4EL1A 2MBTA 3CTFA 4G10A 5ID2B 19GSA 1GSQA 4XRDA 3GKKA 3LXZA 1XVWA 1ILOA 2L57A 3W6GA 1ZMAA 2VOCA 3UARA 4OMVA 5LCZA 4O5RA 1U88A 4X43A 2VL9A 5AIXA 1MD3A 1O73A 1Y6EA 4OFNA 2OACA 3P90A 3DEXA 2IMDA 3ERWA 2JL4A 1ML6A 4I97A 5AIVA 3RAZA 1H4OA 2ZNMA 2LRNA 1JLWA 2L6DA 5A4VA 5G5FA 5DAKB 2YP6A 1EP7A 4Q5FA 1TOFA 4GQFA 3C1SA 5ENUA 2K18A 1OC9A 2PUKC 3WT1A 1W89A 4HJ2A 5GSSA 4GXZA 3C73A 2JZRA 1GUMA 4EE0A 3GSSA 3HVVA 3TKRA 2FCHA 4WBJA 4XS1A 3A2VA 3Q18A 2KUCA 1X9WB 2I81A 1GNEA 2JSZA 2IMFA 3JCML 3LXTA 1B9XC 1TXXA 4N30A 10GSA 2HFDA 4NV2A 2X49A 11GSA 2L59A 4NPBA 1S3CA 4HDEA 5H5RA 3BJ5A 1SKWB 5AGYA 1Z6NA 1XW9A 2ALBA 1TI1A 2L4QA 2NPBA 3UVTA 4GSTA 1EV9A 5IO0A 1X0RA 3KMOA 4ZL8A 2HT9A 1FOVA 2XPDA 3GA4A 3GKXA 1SL1B 1G7EA 1SL0B 5JCUA 4IGJA 5IIZA 1Z5YE 2JACA 4V1Ag 1GUKA 1IYHA 4LA1A 4K2XA 2NTOA 2VCVA 3GL3A 1ERVA 2R0PA 3VWUA 1GULA 1OC8A 2F9SA 2GDRA 4MJAA 4MF6A 1SD9A 2CZ3A 4MP4A 1JZWA 2DJKA 4JRRA 4GSNA 1Y25A 4MPGA 1UN2A 5IMVA 1K3YA 3C1RA 3DMLA 2YPMA 2LQQA 4NWYA 4E8EA 3W8SA 2V32A 1A0FA 2LNTA 1ZCPA 4ZBAA 3FEUA 3U5RE 2B1KA 4CY8A 3QFAC 1LU4A 1XXUA 1PN9A 4PURA 1XW5A 3FK8A 5ABRA 3RHCA 2DKIA 3S9FA 2B5XA 4ZL9A 1PGTA 4IHUA 1OC3A 4WXTA 4Q5NA 3HJMA 1SK0A 1XG8A 4DSSB 2GT5A 3VPQA 2HSHA 1OE8A 5DJMA 1WRYA 3IE3A 2CQ9A 4L8EA 3UIWA 2HZEB 3IBHA 2A2SA 2E7PA 2HRKA 4JBBA 5KN3A 5H5QA 3PINA 5HR1A 2YN1A 22GSA 3O76A 5F06A 3UOMA 2XBQA 3CXGA 3NIVA 1T4YA 3L78A 3QDNA 2VCWA 3KD0A 1WP0A 4Z2UA 3M8NA 5BMUA 2VD1A 2VCTA 4X0XA 2GSQA 1CQHA 3EPTA 2BJXA 4PXOA 4BIKA 4DVCA 1VRSD 4L0WA 4HOJA 1ERUA 2LUSA 4EUYA 2AAWA 1K0BA 2VL3A 1Z7PA 1GSYA 4I2TA 1K0NA 2CVKA 4HEA2 1RQMA 3U6VA 1SJ6A 2GSSA 5LNKe 2AHEA 2FWEA 4BPYA 4ICYA 3RPNA 1THXA 4XS4A 4F03A 1MTCA 1FOHA 1O8XA 1ON4A 1FB0A 1URMA 3ZYWA 1GTAA 1U3AA 4KGIA 3QMXA 1V57A 3HYPA 3HXSA 4ID0A 2J23A 1X5DA 1AQWA 1G0TA 3FHKA 1FHEA 3FZ5A 1GTBA 1F2EA 3GURA 1WOUA 3F6FA 1SD8A 2RUFA 3KIJA 1MDKA 3L9SA 5F05A 2YNXA 4PNGA 3GNJA 2IIYA 2X8HA 2LV3A 5H5SA 4J2FA 3UEMA 1U3IA 4Z2TA 3TKSE 2XBIA 4KF9A 1ACVA 2DBCA 2B7JA 3CSJA 3D4TA 1SYRA 3MYDA 1TP9A 4IQ1A 1CQGA 3G7YA 4CDOA 3TKSC 1GSDA 1HNBA 3PH9A 1T4ZA 2LTKA 1EOGA 3DKSA 4N11A 3GIXA 3OR5A 1F6MC 2H76A 3FR6A 2C8UA 2V1MA 2VLVA 4WBRD 2QC7A 3QFBC 2PVQA 5HFKA 4YKGA 3UVHA 1TI3A 4PUAA 1F9MA 3LQ7A 3KCMA 5BRTA 2DKHA 1XPVA 5JWOB 3BCIA 3F0IA 1TJDA 3KZQA 4MABA 3L9UA 3D21A 1A23A 4V2MA 2B3SA 1BJXA 3AY8A 1LBKA 2YZHA 3MAKA 2ZCTA 3TOTA 2FWGA 1YF1A 2MZCA 4BL7A 1NSWA 5B8BA 2V2GA 2N5BA 2O85A 5J9CA 2H72A 4CY6A 1O8WA 3ZVJD 2VLTA 3L4NA 4K7OA 2DLXA 1OVNA 4JZQA 4MK3A 1PX6A 3IAM2 2IFQB 3HVXA 1ZZYA 2LNSA 1M3IA 3LJRA 4MA9A 4K2DA 4MJBA 4AF2A 3CSIA 5B6NA 2FA4A 1V58A 4JR4A 4BVYB 1XFLA 1XOBA 3EC3A 5IO2A 1AIUA 3LYKA 1K3LA 2TRCP 2VL2C 2P0GA 2PN8A 2GSTA 3TKPA 4KSMA 1BX9A 1K0MA 3IDVA 2H1BA 3VK9A 5D93A 1K0DA 1TU8A 1HD2A 2EIRA 3UBLA 2EC4A 5CP1A 1JHBA 3WD6A 5HR3A 5ECMB 4ZXGA 2RIIA 2DJ2A 3ZMLA 2HLSA 3ED3A 4OFMA 1J08A 1X5CA 4K6XA 3EU3A 2A4HA 1V9WA 1YKCA 3LGCA 14GSA 1YEXA 3FYGA 4JU5A 4MZCA 3GKNA 1B4QA 3VI7A 2NBSA 2G0FA 4ML1A 2GZPA 2H71A 4XRAA 3GTUA 4TW5A 3VLNA 3VI5A 4DEJA 4XCSA 5EL8A 1T3BA 2YZUA 2VCQA 3MNGA 4V2LA 5C04A 2GQKA 3HVNA 3IK7A 1QMVA 4FYBA 1AUCA 4USSA 1M99A 4I5QA 3R3EA 3GX0A 4N10A 3RPPA 1FVKA 1HNAA 3ZIJA 1K0OA 3D4MA 4IN0A 1KTEA 2MMOA 3ZVJA 4V2NA 2FHEA 4L5LA 1QGVA 1M0UA 1A8LA 3TJJA 1FB6A 3I69A 3MWHA 3O3TA 5EVOA 1PSQA 5ECHB 4O5QA 3I6AA 5KEJA 1NW2A 3C8EA 1Z6MA 1AXDA 3F4RA 6GSXA 3IHQA 4KCEA 3WYWA 3TRQA 5FT3A 2MMZA 3FZ9A 1QUWA 2VIMA 4F9ZA 1YKAA 3QOUA 4TR1A 2OADA 3M9JA 2E0QA 1HYUA 4KB3A 2JZSA 2GS3A 2OJLA 4HSCX 3US3A 2GQMA 3LYPA 4YKFA 1M7TA 3ZITA 4YH2A 4F2IA 2RLIA 13GSA 1EWXA 1GP1A 5ELAA 1MD4A 1UC7A 2VAFA 2VD0A 4KNDA 3UAPA 5D73A 2CAQA 4IJIA 2V6KA 2CZ2A 1VGLA 5G5EA 2X4AA 3FKFA 5CRHA 4ECCA 4JR6A 5CREA 5CRWA 3GRXA 4ZB6A 3IRAA 2PU9C 2V6OA 2BTOT 4O92A 3ZREA 3ZL5A 4MH3A 3MDKA 2M72A 1O81A 4KCAA 5G2ZA 5KN1A 2OE0A 4YQUA 4DSQA 4EXJA 3TCOA 3F63A 3A5IA 1X9MB 1M2BA 2MMAA 2F8FA 2IJYA 2PWJA 2QA1A 4RI7A 1XOAA 3MIXA 3KTBA 3HKRA 1G6YA 5CAXA 4IQAA 2R4VA 3A2XA 5KN0A 3HCZA 4CHSA 5IPHA 2H0HA 3EMPA 1F37A 4GTUA 2FLSA 4OCFA 4XHMA 1PKZA 2X99A 4IKHA 1ST9A 3FMWA 4L5OA 2G2QA 1YF0A 2D2ZA 1ZYEA 1TK0B 1EZKA 3PR8A 2GSRA 5ID2A 1U6TA 2ON7A 3CMIA 4TVEA 4EC0A 2CT6A 2DJ3A 4K7NA 3A5WA 2A2RA 5G30A 1G7OA 4XTSA 1YZXA 2F3MA 3M9KA 2PBJA 3CRUA 5LD0A 4BVXB 1DUGA 1TRUA 4K1FA 5G1LA 1SYXA 1Q4JA 4HU7A 3DGQA 5B7CA 2LSTA 5DAKA 1ZYQB 1G6WA 1Z7RA 3Q6OA 4PUFC 4HUAA 2VO4A 5KN2A 2TIRA 3KJYA 4MZWA 2RUEA 1ZYNA 1BQ7A 3ERFA 4GCIA 4FYUA 1WPIA 3H79A 2H19A 2UZ8A 1K0AA 4MJEA 3G7IA 4ULXA 3TDGA 4HZ2A 4HS1A 3LORA 2A2PA 3RDWA 1NHOA 3CTGA 3GMFA 4EVMA 2R0CA 3GH6A 2AYTA 4JEDA 2H8LA 1DBYA 1ERWA 5J5NA 2K9FA 6GSYA 3RHBA 3DYRA 2IMEA 3GX8A
chains in the Genus database with same CATH topology
1J9BA 2PMTA 3ZMKA 4O32A 4WF5A 4MH2A 1ZL9A 5DQSA 5HFGA 4LMVA 4LL1B 1R7HA 3DWVA 3HJPA 1GL8A 3GL5A 2CAIA 1TRVA 4G0IA 2YV9A 1TDIA 2PGTA 2YWMA 2TRXA 2CA8A 3VPTA 3UJ1A 1RK4A 2LJAA 1O7UA 1GSSA 5E59A 1M2AA 2KP2A 4OO5A 3LWAA 1OKTA 4TRXA 4WKWA 2ON5A 1FG4A 2P5QA 3UMAA 1GH2A 2N5FA 1VF3A 3H4KA 1XVQA 2C0FA 1JFUA 5IMCA 2B1LA 3HJOA 1BYEA 1YJ6A 2EIQA 5B6MA 2GGTA 2GVPA 5FHIA 2I3YA 3F8UA 4N0ZA 4PQ1A 2F51A 1RW1A 1KEBA 1JLVA 1O85A 1SK2A 2VCZA 4K5SA 1UA5A 3TJKA 3QAGA 4ZBBA 2I1UA 5JWQB 2QGVA 3M0FA 4G9HA 4QL9A 1SENA 3DD3A 5CO3A 1M9AA 4IJ3A 2VLUA 4WF4A 4PQIA 2ES7A 1I9DA 4TOPA 4N0VA 2HZEA 1XWKA 3FW2A 5DALB 1ZGNA 4EO3A 2LJRA 3EURA 2FY6A 3IA1A 2P5RA 5IMDA 2L4CA 2E2MA 3P8WA 3M1GA 4KDYA 3IPZA 5ECPB 5HR0A 4LL4B 1LJRA 1AW9A 5IPGA 1U87A 5HR2A 5J41A 4POBA 3I43A 2H0GA 3UL3A 4OCEA 3ZTLA 5ECLB 4KX4A 1PL1A 9GSSA 2AB6A 1A2MA 3ZZXA 4TR3A 2HE3A 3TGZA 3WGXA 5E4WA 2IPAA 1AAZA 5DDLA 1YQ1A 2H75A 3LSZA 3ME7A 4BWQA 4MJCA 3DVWA 2HZFA 4PNFA 4YAPA 3TJFA 2FGXA 5CNWA 3NOFA 2IMIA 2CVDA 4X1UA 4K8MA 7GSSA 2H6YA 4AJ8A 2CX3A 1SU9A 3PPUA 4XS6A 4CW9A 2DMLA 2K8SA 4ILFA 2YJ7A 2OA7A 2DIZA 1N2AA 3D5JA 4RQXA 20GSA 1X9SB 4PGTA 3QAVA 1MDIA 1UVZA 4MLYA 5ECSA 2FA8A 3P2AA 1PQNA 4KW6A 2C4JA 4MF7A 2M46A 4EKZA 2QKEA 1R5PA 2JZTA 3UBKA 4GLTA 5DQYA 1PD21 2EIOA 1M9BA 4TXOA 1AQVA 3KMNA 5DVBA 1DE1A 17GSA 1EV4A 5IMZA 3DIEA 1OAZA 4D73A 2LJKA 4GF0A 3WGEA 3GH9A 3IAS2 1NM3A 4A5PA 3GV1A 4ZBDA 5CYYA 4QQ7A 3E3EA 1QFNA 5INYA 4IBPA 2H0IA 5IOXA 3TKSA 5FWGA 2CV4A 1T7PB 2X8GA 3CSHA 4WR5A 2PVOC 2WRTA 4K0GA 2KP1A 3TRPA 3IXRA 18GSA 1H75A 3TKQA 4G19A 2JU5A 1X5EA 5AN1A 3J7Yb 2YCDA 2C3NA 2PPTA 2R37A 1THOA 3GHAA 1Z3EA 3QPMA 4HI7A 4NAXA 1IYIA 3EMXA 2H1GA 1R5AA 1ZOFA 4Q5RA 1A24A 3HZ8A 4ZIJA 1AC1A 3PGTA 3W8JA 2J9HA 2IL3A 4KDXA 4EIQA 1E6BA 1TRSA 4EF0A 2IFQA 1VF1A 3FY7A 2GZYA 2B7KA 1EP8A 1OC9B 2I9HA 3KGKA 1YDKA 4HU9A 2HSYA 1TW9A 2OBIA 1XW6A 2HSMA 4Z2RA 5GAPD 4GWRA 2LQOA 4K7IA 12GSA 1BG5A 2NVLA 2H6XA 2O89A 6GSSA 2N5AA 1SKSB 1MEKA 2DJ1A 1KNGA 1VF4A 4MMMA 2VL2A 2X64A 4TKYA 2DIYA 2XC2A 2L5OA 3IR4A 3M3MA 4HJMA 1YEPA 3KXOA 5G31A 6GSWA 2R6KA 2IMKA 1V2AA 4MZBA 2WGRA 1ERTA 1XZOA 1XWCA 3Q19A 4IW9A 4EIPA 5IQYA 3TB2A 4ISDA 3LW9A 3P7XA 4ZILA 4AGSA 1WE0A 4FO5A 1PL2A 3F4SA 2HXKA 5IMFA 1I5GA 4WEYA 3ZFBA 2AJQB 4RI6A 3C71A 3H1NA 4DSRA 2FWFA 2YWIA 5J9BA 5F07A 5JWRB 3KH7A 3IC8A 4G0KA 4HQZA 2GQLA 5GAND 4FIWA 3R2QA 5C00A 1HQOA 5ECKB 3G7JA 3F4TA 1O6JA 2GZZA 4GRFA 4NV5A 1YY7A 2H30A 1WMJA 1PRXA 6GSVA 2X8CA 3A3TA 2E2GA 4IP6A 2K8VA 1J0FA 2AV4A 1SKRB 1A2LA 4FYCA 3VWXA 3TUEA 2KHPA 4I8BA 5D9XA 3QR6A 2JADA 1WIKA 4V1Ap 2OBKA 1R26A 5KOWA 5CRGA 1NHYA 2XPEA 4I2UA 1SL2B 2HI7A 3GFKA 1A2JA 3LFLA 2FNOA 4NHWA 3L9VA 4TXVA 2DJJA 1XWBA 5CRDA 1TKDB 4E8HA 1QK8A 3TJGA 4MDCA 1T1VA 1EGRA 2C3QA 5DCHA 4IP1A 2YWNA 1W4VA 3KP9A 5J3RA 3HY2A 2LRCA 5JCWA 2FD3A 3D6IA 3D0ZA 2KOKA 3GSTA 3LG6A 4OWYA 3QAWA 4YQVA 3EVIA 4XS4B 2R5GA 4EDYA 3IHGA 2YV7A 2P31A 1PKWA 3IV4A 3WGDA 4BA7A 5AISA 1TRWA 4NHZA 2KLXA 3ERGA 1PMTA 1OYJA 1SK1A 2YOIA 2HYXA 2V41A 4NMUA 2M80A 2LKUA 2QSIA 1ZYPA 5DCGA 2HRFA 1BEDA 2IN3A 2WB9A 1XWGA 4IELA 1SJZA 3H8QA 2MBSA 3ISOA 4G2EA 4MCUA 5D9TA 3EWLA 1SJIA 3KTLA 3EE2A 1AQXA 4KA0A 5A4WA 3CYNA 3WT2A 4XIHA 3GUSA 4K0NA 2BMXA 2HNLA 1TK5B 5DJLA 4POLA 16GSA 2HRAA 2WS2A 5D96A 4TR0A 1DSBA 3ZRDA 3H93A 2REMA 3VFIA 4IVFA 5ECNB 4YQMA 2YANA 4POMA 4BWSA 2XHFA 3C7MA 2PERA 4FQUA 1F3AA 2R2JA 5DBQA 3V1WA 3SBCA 4KSOA 2VCXA 1OKDA 1A0RP 3CRTA 4BVXA 2O8VB 1FVJA 4Z7XA 1K0CA 3QD9A 3IOSA 1JZDA 4TR4A 4WR4A 3FR3A 3FR9A 4HZ4A 1S3AA 1XBSA 4J57E 2VM2A 3ME8A 5HQPA 2H66A 2WJUA 4PTSA 2H74A 2WULA 3ZLPA 4BL7B 3IC4A 1EEJA 2C0GA 3IK9A 4O7HA 1GWCA 3APOA 2L6CA 4JE1A 3Q74A 3I9V2 1GRXA 4F0BA 2NDOA 1TTZA 4J56E 3MSZA 3HDCA 4G0LA 3L0HA 4DSSA 4F0CA 5HFIA 1JZOA 1PA3A 4X4JA 5IOWA 5KOXA 4Q5QA 1FAAA 2C0EA 3E9JB 4ECIA 1B8XA 4YAVA 3BBYA 3N9JA 1WJKA 5A5KA 2HRNA 2H1DA 2YWOA 2B6MA 1ABAA 4L0UA 1PX7A 3D22A 2K6VA 4O5UA 4ACSA 3HVSA 3LEFA 2C0DA 4TXOB 3ZIVA 5JCGA 5D8IA 4P3YB 2L5LA 2C80A 5F0GA 4D73B 5A4UA 1T8EB 4RQRA 5ECQB 3F3RA 4GQCA 2DSAA 8GSSA 4OFTA 1V98A 1HNCA 3GYKA 1EOHA 4ECJA 2OE3A 3F9UA 4LMWA 1KBNA 3ZFLA 2Z9SA 3DRNA 2R0GA 1S3DA 2O87A 2DJ0A 2GTUA 2R3XA 1E2YA 1XWAA 4KH7A 3FZAA 3GTUB 5D9WA 4EDZA 2VM1A 2MMNA 3HA9A 5L71A 2LRTA 2FWHA 5EPFA 2I4AA 4ZB9A 4GSSA 2WCIA 3BD2A 4MNNA 5GZZB 3CBUA 5F8BA 4OO4A 4PX1A 4IS0A 2CVBA 1QXHA 2WFCA 2FUG2 4ZB8A 3TRXA 2ZUPA 1T00A 3BCKA 1Q98A 2MYGA 2C3TA 3O6TA 2JSYA 3QCPA 3HZ4A 3F3QA 4HQSA 1Z9HA 1FW1A 3EU4A 1GLPA 5DALA 1A8YA 1VF2A 4LLRA 3FRCA 1GTIA 1JZRA 1B48A 3KEBA 1C72A 1WWJA 4POKA 4ZL7A 3NZNA 2WDUA 5ECRB 5ELGA 2IWTA 3VURA 1GSFA 4TR1B 3VWVA 3VWWA 3K8NA 3APSA 2LS5A 1F3BA 2F8AA 2OE1A 4KDUA 3N5OA 4QL7A 4MPFA 1M2DA 4FH8A 3GN3A 4KAEA 1R4WA 2H70A 1GTUA 2YJHA 2OKAA 5ECIB 6GSTA 1PN0A 2QA2A 1QQ2A 1GSUA 3EINA 2GT6A 1OE7A 5GSTA 4KE3A 1GLQA 3G9BA 3HHVA 4AJ6A 1B9YC 1XCCA 5G1KA 5J4UA 4K9ZA 4RUVA 1EGOA 4KUNA 3GKMA 1BAYA 3EYTA 2DC5A 1B4PA 5EY6A 1TK8B 1GSEA 3A2WA 4I6XA 3BOAA 5IM9A 4K5RA 4NXIA 2LEGA 2H1AA 5D9VA 1GNWA 2O7KA 1TU7A 4TN8A 4H86A 6GSUA 4BVYA 3E0UA 4F82A 3SWLA 1GUHA 5COHA 4AJ7A 5ECOB 1XIYA 1N8JA 2GLRA 3FZ4A 1USBA 1MDJA 4ML6A 2C1YA 4MF5A 3DVXA 1EEMA 3KP8A 2H73A 3RBTA 3HD5A 1V40A 1FO5A 5IMAA 4ECBA 2VUPA 3TOUA 1K3OA 2B5YA 2B5EA 2CX4A 4OD7A 2DMMA 2WZ9A 2A4VA 2H01A 3J7Yk 5B8AA 3KM6A 2RM6A 2RM5A 1DE2A 3KH9A 2H6ZA 3APQA 4WETA 3DXBA 3F6DA 3TJBA 4PQHA 2AUVA 4EL1A 2MBTA 3CTFA 4G10A 5ID2B 19GSA 1GSQA 4XRDA 3GKKA 3LXZA 1XVWA 1ILOA 2L57A 3W6GA 1ZMAA 2VOCA 3UARA 4OMVA 5LCZA 4O5RA 1U88A 4X43A 2VL9A 5AIXA 1MD3A 1O73A 1Y6EA 4OFNA 2OACA 3P90A 3DEXA 2IMDA 3ERWA 2JL4A 1ML6A 4I97A 5AIVA 3RAZA 1H4OA 2ZNMA 2LRNA 1JLWA 2L6DA 5A4VA 5G5FA 5DAKB 2YP6A 1EP7A 4Q5FA 1TOFA 4GQFA 3C1SA 5ENUA 2K18A 1OC9A 2PUKC 3WT1A 1W89A 4HJ2A 5GSSA 4GXZA 3C73A 2JZRA 1GUMA 4EE0A 3GSSA 3HVVA 3TKRA 2FCHA 4WBJA 4XS1A 3A2VA 3Q18A 2KUCA 1X9WB 2I81A 1GNEA 2JSZA 2IMFA 3JCML 3LXTA 1B9XC 1TXXA 4N30A 10GSA 2HFDA 4NV2A 2X49A 11GSA 2L59A 4NPBA 1S3CA 4HDEA 5H5RA 3BJ5A 1SKWB 5AGYA 1Z6NA 1XW9A 2ALBA 1TI1A 2L4QA 2NPBA 3UVTA 4GSTA 1EV9A 5IO0A 1X0RA 3KMOA 4ZL8A 2HT9A 1FOVA 2XPDA 3GA4A 3GKXA 1SL1B 1G7EA 1SL0B 5JCUA 4IGJA 5IIZA 1Z5YE 2JACA 4V1Ag 1GUKA 1IYHA 4LA1A 4K2XA 2NTOA 2VCVA 3GL3A 1ERVA 2R0PA 3VWUA 1GULA 1OC8A 2F9SA 2GDRA 4MJAA 4MF6A 1SD9A 2CZ3A 4MP4A 1JZWA 2DJKA 4JRRA 4GSNA 1Y25A 4MPGA 1UN2A 5IMVA 1K3YA 3C1RA 3DMLA 2YPMA 2LQQA 4NWYA 4E8EA 3W8SA 2V32A 1A0FA 2LNTA 1ZCPA 4ZBAA 3FEUA 3U5RE 2B1KA 4CY8A 3QFAC 1LU4A 1XXUA 1PN9A 4PURA 1XW5A 3FK8A 5ABRA 3RHCA 2DKIA 3S9FA 2B5XA 4ZL9A 1PGTA 4IHUA 1OC3A 4WXTA 4Q5NA 3HJMA 1SK0A 4DSSB 2GT5A 3VPQA 2HSHA 1OE8A 5DJMA 1WRYA 3IE3A 2CQ9A 4L8EA 3UIWA 2HZEB 3IBHA 2A2SA 2E7PA 2HRKA 4JBBA 5KN3A 5H5QA 3PINA 5HR1A 2YN1A 22GSA 3O76A 5F06A 3UOMA 2XBQA 3CXGA 3NIVA 1T4YA 3L78A 3QDNA 2VCWA 3KD0A 1WP0A 4Z2UA 3M8NA 5BMUA 2VD1A 2VCTA 4X0XA 2GSQA 1CQHA 3EPTA 2BJXA 4PXOA 4DVCA 1VRSD 4L0WA 4HOJA 1ERUA 2LUSA 4EUYA 2AAWA 1K0BA 2VL3A 1Z7PA 1GSYA 4I2TA 1K0NA 2CVKA 4HEA2 1RQMA 3U6VA 1SJ6A 2GSSA 5LNKe 2AHEA 2FWEA 4BPYA 4ICYA 3RPNA 1THXA 4XS4A 4F03A 1MTCA 1FOHA 1O8XA 1ON4A 1FB0A 1URMA 3ZYWA 1GTAA 1U3AA 4KGIA 3QMXA 1V57A 3HYPA 3HXSA 4ID0A 2J23A 1X5DA 1AQWA 1G0TA 3FHKA 1FHEA 3FZ5A 1GTBA 1F2EA 3GURA 1WOUA 3F6FA 1SD8A 2RUFA 3KIJA 1MDKA 3L9SA 5F05A 2YNXA 4PNGA 3GNJA 2IIYA 2X8HA 2LV3A 5H5SA 4J2FA 3UEMA 1U3IA 4Z2TA 3TKSE 2XBIA 4KF9A 1ACVA 2DBCA 2B7JA 3CSJA 3D4TA 1SYRA 3MYDA 1TP9A 4IQ1A 1CQGA 3G7YA 4CDOA 3TKSC 1GSDA 1HNBA 3PH9A 1T4ZA 2LTKA 1EOGA 3DKSA 4N11A 3GIXA 3OR5A 1F6MC 2H76A 3FR6A 2C8UA 2V1MA 2VLVA 4WBRD 2QC7A 3QFBC 2PVQA 5HFKA 4YKGA 3UVHA 1TI3A 4PUAA 1F9MA 3LQ7A 3KCMA 5BRTA 2DKHA 1XPVA 5JWOB 3BCIA 3F0IA 1TJDA 3KZQA 4MABA 3L9UA 3D21A 1A23A 4V2MA 2B3SA 1BJXA 3AY8A 1LBKA 2YZHA 3MAKA 2ZCTA 3TOTA 2FWGA 1YF1A 2MZCA 4BL7A 1NSWA 5B8BA 2V2GA 2N5BA 2O85A 5J9CA 2H72A 4CY6A 1O8WA 3ZVJD 2VLTA 3L4NA 4K7OA 2DLXA 1OVNA 4JZQA 4MK3A 1PX6A 3IAM2 2IFQB 3HVXA 1ZZYA 2LNSA 3LJRA 4MA9A 4K2DA 4MJBA 4AF2A 3CSIA 5B6NA 2FA4A 1V58A 4JR4A 4BVYB 1XFLA 1XOBA 3EC3A 5IO2A 1AIUA 3LYKA 1K3LA 2TRCP 2VL2C 2P0GA 2PN8A 2GSTA 3TKPA 4KSMA 1BX9A 1K0MA 3IDVA 2H1BA 3VK9A 5D93A 1K0DA 1TU8A 1HD2A 2EIRA 3UBLA 2EC4A 5CP1A 1JHBA 3WD6A 5HR3A 5ECMB 4ZXGA 2RIIA 2DJ2A 3ZMLA 2HLSA 3ED3A 4OFMA 1J08A 1X5CA 4K6XA 3EU3A 2A4HA 1V9WA 1YKCA 3LGCA 14GSA 1YEXA 3FYGA 4JU5A 4MZCA 3GKNA 1B4QA 3VI7A 2NBSA 2G0FA 4ML1A 2GZPA 2H71A 4XRAA 3GTUA 4TW5A 3VLNA 3VI5A 4DEJA 4XCSA 5EL8A 1T3BA 2YZUA 2VCQA 3MNGA 4V2LA 5C04A 2GQKA 3IK7A 1QMVA 4FYBA 1AUCA 4USSA 1M99A 4I5QA 3R3EA 3GX0A 4N10A 3RPPA 1FVKA 1HNAA 3ZIJA 1K0OA 3D4MA 4IN0A 1KTEA 2MMOA 3ZVJA 4V2NA 2FHEA 4L5LA 1QGVA 1M0UA 1A8LA 3TJJA 1FB6A 3I69A 3MWHA 3O3TA 5EVOA 1PSQA 5ECHB 4O5QA 3I6AA 5KEJA 1NW2A 3C8EA 1Z6MA 1AXDA 3F4RA 6GSXA 3IHQA 4KCEA 3WYWA 3TRQA 5FT3A 2MMZA 3FZ9A 1QUWA 2VIMA 4F9ZA 1YKAA 3QOUA 4TR1A 2OADA 3M9JA 2E0QA 1HYUA 4KB3A 2JZSA 2GS3A 2OJLA 3US3A 2GQMA 3LYPA 4YKFA 1M7TA 3ZITA 4YH2A 4F2IA 2RLIA 13GSA 1EWXA 1GP1A 5ELAA 1MD4A 1UC7A 2VAFA 2VD0A 4KNDA 3UAPA 5D73A 2CAQA 4IJIA 2V6KA 2CZ2A 1VGLA 5G5EA 2X4AA 3FKFA 5CRHA 4ECCA 4JR6A 5CREA 5CRWA 3GRXA 4ZB6A 3IRAA 2PU9C 2V6OA 2BTOT 4O92A 3ZREA 3ZL5A 4MH3A 3MDKA 2M72A 1O81A 4KCAA 5G2ZA 5KN1A 2OE0A 4YQUA 4DSQA 4EXJA 3TCOA 3F63A 3A5IA 1X9MB 1M2BA 2MMAA 2F8FA 2IJYA 2PWJA 2QA1A 4RI7A 1XOAA 3MIXA 3KTBA 3HKRA 1G6YA 5CAXA 4IQAA 2R4VA 3A2XA 5KN0A 3HCZA 4CHSA 5IPHA 2H0HA 3EMPA 1F37A 4GTUA 2FLSA 4OCFA 4XHMA 1PKZA 2X99A 4IKHA 1ST9A 3FMWA 4L5OA 2G2QA 1YF0A 2D2ZA 1ZYEA 1TK0B 1EZKA 3PR8A 2GSRA 5ID2A 1U6TA 2ON7A 3CMIA 4TVEA 4EC0A 2CT6A 2DJ3A 4K7NA 3A5WA 2A2RA 5G30A 1G7OA 4XTSA 1YZXA 2F3MA 3M9KA 2PBJA 3CRUA 5LD0A 4BVXB 1DUGA 1TRUA 4K1FA 5G1LA 1SYXA 1Q4JA 4HU7A 3DGQA 5B7CA 2LSTA 5DAKA 1ZYQB 1G6WA 1Z7RA 3Q6OA 4PUFC 4HUAA 2VO4A 5KN2A 2TIRA 3KJYA 4MZWA 2RUEA 1ZYNA 1BQ7A 3ERFA 4GCIA 4FYUA 1WPIA 3H79A 2H19A 2UZ8A 1K0AA 4MJEA 3G7IA 4ULXA 3TDGA 4HZ2A 4HS1A 3LORA 2A2PA 3RDWA 1NHOA 3CTGA 3GMFA 4EVMA 2R0CA 3GH6A 2AYTA 4JEDA 2H8LA 1DBYA 1ERWA 5J5NA 2K9FA 6GSYA 3RHBA 3DYRA 2IMEA 3GX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J9B A;  2PMT A;  3ZMK A;  4O32 A;  4WF5 A;  4MH2 A;  1ZL9 A;  5DQS A;  5HFG A;  4LMV A;  4LL1 B;  1R7H A;  3DWV A;  3HJP A;  1GL8 A;  3GL5 A;  2CAI A;  1TRV A;  2YV9 A;  1TDI A;  2PGT A;  2YWM A;  2TRX A;  2CA8 A;  3VPT A;  3UJ1 A;  1RK4 A;  2LJA A;  1O7U A;  1GSS A;  5E59 A;  1M2A A;  2KP2 A;  4OO5 A;  3LWA A;  1OKT A;  4TRX A;  4WKW A;  2ON5 A;  1FG4 A;  2P5Q A;  3UMA A;  1GH2 A;  2N5F A;  1VF3 A;  3H4K A;  1XVQ A;  2C0F A;  1JFU A;  5IMC A;  2B1L A;  3HJO A;  1BYE A;  1YJ6 A;  2EIQ A;  5B6M A;  2GGT A;  2GVP A;  5FHI A;  2I3Y A;  3F8U A;  4N0Z A;  4PQ1 A;  2F51 A;  1RW1 A;  1KEB A;  1JLV A;  1O85 A;  1SK2 A;  2VCZ A;  1UA5 A;  3TJK A;  3QAG A;  4ZBB A;  2I1U A;  5JWQ B;  2QGV A;  3M0F A;  4G9H A;  4QL9 A;  1SEN A;  3DD3 A;  5CO3 A;  1M9A A;  4IJ3 A;  2VLU A;  4WF4 A;  4PQI A;  2ES7 A;  1I9D A;  4TOP A;  4N0V A;  2HZE A;  1XWK A;  3FW2 A;  5DAL B;  1ZGN A;  4EO3 A;  2LJR A;  3EUR A;  2FY6 A;  3IA1 A;  2P5R A;  5IMD A;  2L4C A;  2E2M A;  3P8W A;  3M1G A;  4KDY A;  3IPZ A;  5ECP B;  5HR0 A;  4LL4 B;  1LJR A;  1AW9 A;  5IPG A;  1U87 A;  5HR2 A;  5J41 A;  4POB A;  3I43 A;  2H0G A;  3UL3 A;  4OCE A;  3ZTL A;  5ECL B;  4KX4 A;  1PL1 A;  9GSS A;  2AB6 A;  1A2M A;  3ZZX A;  4TR3 A;  2HE3 A;  3TGZ A;  3WGX A;  5E4W A;  2IPA A;  1AAZ A;  5DDL A;  1YQ1 A;  2H75 A;  3LSZ A;  3ME7 A;  4BWQ A;  4MJC A;  3DVW A;  2HZF A;  4PNF A;  4YAP A;  3TJF A;  2FGX A;  5CNW A;  3NOF A;  2IMI A;  2CVD A;  4X1U A;  4K8M A;  7GSS A;  2H6Y A;  4AJ8 A;  2CX3 A;  1SU9 A;  4XS6 A;  4CW9 A;  2DML A;  2K8S A;  4ILF A;  2YJ7 A;  2OA7 A;  2DIZ A;  1N2A A;  3D5J A;  4RQX A;  20GS A;  1X9S B;  4PGT A;  3QAV A;  1MDI A;  1UVZ A;  4MLY A;  5ECS A;  2FA8 A;  3P2A A;  1PQN A;  4KW6 A;  2C4J A;  4MF7 A;  2M46 A;  4EKZ A;  2QKE A;  1R5P A;  2JZT A;  3UBK A;  4GLT A;  5DQY A;  1PD2 1;  2EIO A;  1M9B A;  4TXO A;  1AQV A;  3KMN A;  5DVB A;  1DE1 A;  17GS A;  1EV4 A;  5IMZ A;  3DIE A;  1OAZ A;  4D73 A;  2LJK A;  4GF0 A;  3WGE A;  3GH9 A;  3IAS 2;  1NM3 A;  3GV1 A;  4ZBD A;  5CYY A;  4QQ7 A;  3E3E A;  1QFN A;  5INY A;  4IBP A;  2H0I A;  5IOX A;  3TKS A;  5FWG A;  2CV4 A;  1T7P B;  2X8G A;  3CSH A;  4WR5 A;  2PVO C;  2WRT A;  4K0G A;  2KP1 A;  3TRP A;  3IXR A;  18GS A;  1H75 A;  3TKQ A;  4G19 A;  2JU5 A;  1X5E A;  5AN1 A;  3J7Y b;  2YCD A;  2C3N A;  2PPT A;  2R37 A;  1THO A;  3GHA A;  1Z3E A;  3QPM A;  4HI7 A;  4NAX A;  1IYI A;  3EMX A;  2H1G A;  1R5A A;  1ZOF A;  4Q5R A;  1A24 A;  3HZ8 A;  4ZIJ A;  1AC1 A;  3PGT A;  3W8J A;  2J9H A;  2IL3 A;  4KDX A;  1E6B A;  1TRS A;  4EF0 A;  2IFQ A;  1VF1 A;  3FY7 A;  2GZY A;  2B7K A;  1EP8 A;  1OC9 B;  2I9H A;  3KGK A;  1YDK A;  4HU9 A;  2HSY A;  1TW9 A;  2OBI A;  1XW6 A;  5GAP D;  4GWR A;  2LQO A;  4K7I A;  12GS A;  1BG5 A;  2NVL A;  2H6X A;  2O89 A;  6GSS A;  2N5A A;  1SKS B;  1MEK A;  2DJ1 A;  1KNG A;  1VF4 A;  4MMM A;  2VL2 A;  2X64 A;  4TKY A;  2DIY A;  2XC2 A;  2L5O A;  3IR4 A;  3M3M A;  4HJM A;  1YEP A;  3KXO A;  5G31 A;  6GSW A;  2R6K A;  2IMK A;  1V2A A;  4MZB A;  2WGR A;  1ERT A;  1XZO A;  1XWC A;  3Q19 A;  4IW9 A;  5IQY A;  3TB2 A;  4ISD A;  3P7X A;  4ZIL A;  4AGS A;  1WE0 A;  4FO5 A;  1PL2 A;  3F4S A;  2HXK A;  5IMF A;  1I5G A;  4WEY A;  3ZFB A;  2AJQ B;  4RI6 A;  3C71 A;  3H1N A;  4DSR A;  2FWF A;  2YWI A;  5J9B A;  5F07 A;  5JWR B;  3KH7 A;  4HQZ A;  2GQL A;  5GAN D;  4FIW A;  3R2Q A;  5C00 A;  1HQO A;  5ECK B;  3G7J A;  3F4T A;  1O6J A;  2GZZ A;  4GRF A;  4NV5 A;  1YY7 A;  2H30 A;  1WMJ A;  1PRX A;  6GSV A;  2X8C A;  3A3T A;  2E2G A;  4IP6 A;  2K8V A;  1J0F A;  2AV4 A;  1SKR B;  1A2L A;  4FYC A;  3VWX A;  3TUE A;  2KHP A;  4I8B A;  5D9X A;  3QR6 A;  2JAD A;  1WIK A;  4V1A p;  2OBK A;  1R26 A;  5CRG A;  1NHY A;  2XPE A;  4I2U A;  1SL2 B;  2HI7 A;  3GFK A;  1A2J A;  3LFL A;  2FNO A;  4NHW A;  3L9V A;  4TXV A;  2DJJ A;  1XWB A;  5CRD A;  1TKD B;  4E8H A;  1QK8 A;  3TJG A;  4MDC A;  1T1V A;  1EGR A;  2C3Q A;  5DCH A;  4IP1 A;  2YWN A;  1W4V A;  3KP9 A;  5J3R A;  3HY2 A;  2LRC A;  5JCW A;  2FD3 A;  3D6I A;  3D0Z A;  2KOK A;  3GST A;  3LG6 A;  4OWY A;  3QAW A;  4YQV A;  3EVI A;  4XS4 B;  2R5G A;  4EDY A;  2YV7 A;  2P31 A;  1PKW A;  3IV4 A;  3WGD A;  4BA7 A;  5AIS A;  1TRW A;  4NHZ A;  2KLX A;  3ERG A;  1PMT A;  1OYJ A;  1SK1 A;  2YOI A;  2HYX A;  2V41 A;  4NMU A;  2M80 A;  2LKU A;  2QSI A;  5DCG A;  2HRF A;  1BED A;  2IN3 A;  2WB9 A;  1XWG A;  4IEL A;  1SJZ A;  3H8Q A;  2MBS A;  3ISO A;  4G2E A;  4MCU A;  5D9T A;  3EWL A;  1SJI A;  3KTL A;  3EE2 A;  1AQX A;  4KA0 A;  5A4W A;  3CYN A;  3WT2 A;  4XIH A;  3GUS A;  4K0N A;  2BMX A;  2HNL A;  1TK5 B;  5DJL A;  4POL A;  16GS A;  2WS2 A;  5D96 A;  4TR0 A;  1DSB A;  3ZRD A;  3H93 A;  2REM A;  3VFI A;  4IVF A;  5ECN B;  4YQM A;  2YAN A;  4POM A;  4BWS A;  2XHF A;  3C7M A;  2PER A;  1F3A A;  2R2J A;  5DBQ A;  3V1W A;  3SBC A;  4KSO A;  2VCX A;  1OKD A;  1A0R P;  3CRT A;  4BVX A;  2O8V B;  1FVJ A;  4Z7X A;  1K0C A;  3QD9 A;  3IOS A;  1JZD A;  4TR4 A;  4WR4 A;  3FR3 A;  3FR9 A;  4HZ4 A;  1S3A A;  1XBS A;  4J57 E;  2VM2 A;  3ME8 A;  5HQP A;  2H66 A;  2WJU A;  2H74 A;  2WUL A;  3ZLP A;  3IC4 A;  1EEJ A;  2C0G A;  3IK9 A;  4O7H A;  1GWC A;  3APO A;  2L6C A;  4JE1 A;  3Q74 A;  3I9V 2;  1GRX A;  4F0B A;  2NDO A;  1TTZ A;  4J56 E;  3MSZ A;  3HDC A;  3L0H A;  4DSS A;  4F0C A;  5HFI A;  1JZO A;  1PA3 A;  5IOW A;  4Q5Q A;  1FAA A;  2C0E A;  3E9J B;  4ECI A;  1B8X A;  4YAV A;  3BBY A;  3N9J A;  1WJK A;  5A5K A;  2HRN A;  2H1D A;  2YWO A;  2B6M A;  1ABA A;  4L0U A;  1PX7 A;  3D22 A;  2K6V A;  4ACS A;  3HVS A;  3LEF A;  2C0D A;  4TXO B;  3ZIV A;  5JCG A;  5D8I A;  4P3Y B;  2L5L A;  2C80 A;  5F0G A;  4D73 B;  5A4U A;  1T8E B;  4RQR A;  5ECQ B;  3F3R A;  4GQC A;  2DSA A;  8GSS A;  4OFT A;  1V98 A;  1HNC A;  3GYK A;  1EOH A;  4ECJ A;  2OE3 A;  3F9U A;  4LMW A;  1KBN A;  3ZFL A;  2Z9S A;  3DRN A;  1S3D A;  2O87 A;  2DJ0 A;  2GTU A;  2R3X A;  1E2Y A;  1XWA A;  4KH7 A;  3FZA A;  3GTU B;  5D9W A;  4EDZ A;  2VM1 A;  2MMN A;  3HA9 A;  5L71 A;  2LRT A;  2FWH A;  5EPF A;  2I4A A;  4ZB9 A;  4GSS A;  2WCI A;  3BD2 A;  5GZZ B;  3CBU A;  5F8B A;  4OO4 A;  4PX1 A;  4IS0 A;  2CVB A;  1QXH A;  2WFC A;  2FUG 2;  4ZB8 A;  3TRX A;  2ZUP A;  1T00 A;  3BCK A;  1Q98 A;  2MYG A;  2C3T A;  3O6T A;  2JSY A;  3QCP A;  3HZ4 A;  3F3Q A;  4HQS A;  1Z9H A;  1FW1 A;  3EU4 A;  1GLP A;  5DAL A;  1A8Y A;  1VF2 A;  4LLR A;  3FRC A;  1GTI A;  1JZR A;  1B48 A;  3KEB A;  1C72 A;  1WWJ A;  4POK A;  4ZL7 A;  3NZN A;  2WDU A;  5ECR B;  5ELG A;  2IWT A;  3VUR A;  1GSF A;  4TR1 B;  3VWV A;  3VWW A;  3K8N A;  3APS A;  2LS5 A;  1F3B A;  2F8A A;  2OE1 A;  4KDU A;  3N5O A;  4QL7 A;  4MPF A;  1M2D A;  4FH8 A;  3GN3 A;  4KAE A;  1R4W A;  2H70 A;  1GTU A;  2YJH A;  2OKA A;  5ECI B;  6GST A;  1QQ2 A;  1GSU A;  3EIN A;  2GT6 A;  1OE7 A;  5GST A;  4KE3 A;  1GLQ A;  3G9B A;  3HHV A;  4AJ6 A;  1B9Y C;  1XCC A;  5G1K A;  5J4U A;  4K9Z A;  4RUV A;  1EGO A;  4KUN A;  3GKM A;  1BAY A;  3EYT A;  2DC5 A;  1B4P A;  5EY6 A;  1TK8 B;  1GSE A;  3A2W A;  4I6X A;  3BOA A;  5IM9 A;  4NXI A;  2LEG A;  2H1A A;  5D9V A;  1GNW A;  2O7K A;  1TU7 A;  4TN8 A;  4H86 A;  6GSU A;  4BVY A;  3E0U A;  4F82 A;  3SWL A;  1GUH A;  5COH A;  4AJ7 A;  5ECO B;  1XIY A;  1N8J A;  2GLR A;  3FZ4 A;  1USB A;  1MDJ A;  4ML6 A;  2C1Y A;  4MF5 A;  3DVX A;  1EEM A;  3KP8 A;  2H73 A;  3RBT A;  3HD5 A;  1V40 A;  1FO5 A;  5IMA A;  4ECB A;  2VUP A;  3TOU A;  1K3O A;  2B5Y A;  2B5E A;  2CX4 A;  4OD7 A;  2DMM A;  2WZ9 A;  2A4V A;  2H01 A;  3J7Y k;  5B8A A;  3KM6 A;  2RM6 A;  2RM5 A;  1DE2 A;  3KH9 A;  2H6Z A;  3APQ A;  4WET A;  3DXB A;  3F6D A;  3TJB A;  4PQH A;  2AUV A;  4EL1 A;  2MBT A;  3CTF A;  4G10 A;  5ID2 B;  19GS A;  1GSQ A;  4XRD A;  3GKK A;  3LXZ A;  1XVW A;  1ILO A;  2L57 A;  3W6G A;  1ZMA A;  2VOC A;  3UAR A;  4OMV A;  5LCZ A;  4O5R A;  1U88 A;  4X43 A;  2VL9 A;  5AIX A;  1MD3 A;  1O73 A;  1Y6E A;  4OFN A;  2OAC A;  3P90 A;  3DEX A;  2IMD A;  3ERW A;  2JL4 A;  1ML6 A;  4I97 A;  5AIV A;  3RAZ A;  1H4O A;  2ZNM A;  2LRN A;  1JLW A;  2L6D A;  5A4V A;  5G5F A;  5DAK B;  2YP6 A;  1EP7 A;  4Q5F A;  1TOF A;  4GQF A;  3C1S A;  5ENU A;  2K18 A;  1OC9 A;  2PUK C;  3WT1 A;  1W89 A;  4HJ2 A;  5GSS A;  4GXZ A;  3C73 A;  2JZR A;  1GUM A;  4EE0 A;  3GSS A;  3HVV A;  3TKR A;  2FCH A;  4WBJ A;  4XS1 A;  3A2V A;  3Q18 A;  2KUC A;  1X9W B;  2I81 A;  1GNE A;  2JSZ A;  2IMF A;  3JCM L;  3LXT A;  1B9X C;  1TXX A;  4N30 A;  10GS A;  2HFD A;  4NV2 A;  11GS A;  2L59 A;  4NPB A;  1S3C A;  4HDE A;  5H5R A;  3BJ5 A;  1SKW B;  5AGY A;  1Z6N A;  1XW9 A;  2ALB A;  1TI1 A;  2L4Q A;  2NPB A;  3UVT A;  4GST A;  1EV9 A;  5IO0 A;  1X0R A;  3KMO A;  4ZL8 A;  2HT9 A;  1FOV A;  2XPD A;  3GA4 A;  3GKX A;  1SL1 B;  1G7E A;  1SL0 B;  5JCU A;  4IGJ A;  5IIZ A;  1Z5Y E;  2JAC A;  4V1A g;  1GUK A;  1IYH A;  4LA1 A;  2NTO A;  2VCV A;  3GL3 A;  1ERV A;  3VWU A;  1GUL A;  1OC8 A;  2F9S A;  2GDR A;  4MJA A;  4MF6 A;  1SD9 A;  2CZ3 A;  4MP4 A;  1JZW A;  2DJK A;  4JRR A;  4GSN A;  1Y25 A;  4MPG A;  1UN2 A;  5IMV A;  1K3Y A;  3C1R A;  3DML A;  2YPM A;  2LQQ A;  4NWY A;  4E8E A;  3W8S A;  2V32 A;  1A0F A;  2LNT A;  1ZCP A;  4ZBA A;  3FEU A;  3U5R E;  2B1K A;  3QFA C;  1LU4 A;  1XXU A;  1PN9 A;  4PUR A;  1XW5 A;  3FK8 A;  5ABR A;  3RHC A;  3S9F A;  2B5X A;  4ZL9 A;  1PGT A;  4IHU A;  1OC3 A;  4WXT A;  4Q5N A;  3HJM A;  1SK0 A;  4DSS B;  2GT5 A;  3VPQ A;  2HSH A;  1OE8 A;  5DJM A;  1WRY A;  3IE3 A;  2CQ9 A;  4L8E A;  3UIW A;  2HZE B;  3IBH A;  2A2S A;  2E7P A;  4JBB A;  5KN3 A;  5H5Q A;  3PIN A;  5HR1 A;  2YN1 A;  22GS A;  3O76 A;  5F06 A;  3UOM A;  2XBQ A;  3CXG A;  3NIV A;  1T4Y A;  3L78 A;  3QDN A;  2VCW A;  3KD0 A;  1WP0 A;  3M8N A;  2VD1 A;  2VCT A;  4X0X A;  2GSQ A;  1CQH A;  2BJX A;  4PXO A;  4DVC A;  1VRS D;  4L0W A;  4HOJ A;  1ERU A;  2LUS A;  4EUY A;  2AAW A;  1K0B A;  2VL3 A;  1Z7P A;  1GSY A;  4I2T A;  1K0N A;  2CVK A;  4HEA 2;  1RQM A;  3U6V A;  1SJ6 A;  2GSS A;  5LNK e;  2AHE A;  2FWE A;  4BPY A;  3RPN A;  1THX A;  4XS4 A;  4F03 A;  1MTC A;  1O8X A;  1ON4 A;  1FB0 A;  1URM A;  3ZYW A;  1GTA A;  1U3A A;  4KGI A;  3QMX A;  1V57 A;  3HYP A;  3HXS A;  4ID0 A;  2J23 A;  1X5D A;  1AQW A;  1G0T A;  3FHK A;  1FHE A;  3FZ5 A;  1GTB A;  1F2E A;  3GUR A;  1WOU A;  3F6F A;  1SD8 A;  2RUF A;  3KIJ A;  1MDK A;  3L9S A;  5F05 A;  2YNX A;  4PNG A;  3GNJ A;  2IIY A;  2X8H A;  2LV3 A;  5H5S A;  4J2F A;  3UEM A;  1U3I A;  3TKS E;  2XBI A;  1ACV A;  2DBC A;  2B7J A;  3CSJ A;  3D4T A;  1SYR A;  1TP9 A;  4IQ1 A;  1CQG A;  3G7Y A;  4CDO A;  3TKS C;  1GSD A;  1HNB A;  3PH9 A;  1T4Z A;  2LTK A;  1EOG A;  3DKS A;  4N11 A;  3GIX A;  3OR5 A;  1F6M C;  2H76 A;  3FR6 A;  2C8U A;  2V1M A;  2VLV A;  4WBR D;  2QC7 A;  3QFB C;  2PVQ A;  5HFK A;  3UVH A;  1TI3 A;  4PUA A;  1F9M A;  3LQ7 A;  3KCM A;  1XPV A;  5JWO B;  3BCI A;  3F0I A;  1TJD A;  3KZQ A;  4MAB A;  3L9U A;  3D21 A;  1A23 A;  4V2M A;  2B3S A;  1BJX A;  3AY8 A;  1LBK A;  2YZH A;  3MAK A;  2ZCT A;  3TOT A;  2FWG A;  1YF1 A;  2MZC A;  4BL7 A;  1NSW A;  5B8B A;  2V2G A;  2N5B A;  2O85 A;  5J9C A;  2H72 A;  1O8W A;  3ZVJ D;  2VLT A;  3L4N A;  4K7O A;  2DLX A;  1OVN A;  4JZQ A;  4MK3 A;  1PX6 A;  3IAM 2;  2IFQ B;  3HVX A;  1ZZY A;  2LNS A;  3LJR A;  4MA9 A;  4K2D A;  4MJB A;  4AF2 A;  3CSI A;  5B6N A;  2FA4 A;  1V58 A;  4JR4 A;  1XFL A;  1XOB A;  3EC3 A;  5IO2 A;  1AIU A;  3LYK A;  1K3L A;  2TRC P;  2VL2 C;  2P0G A;  2PN8 A;  2GST A;  3TKP A;  4KSM A;  1BX9 A;  1K0M A;  3IDV A;  2H1B A;  3VK9 A;  5D93 A;  1K0D A;  1TU8 A;  1HD2 A;  2EIR A;  3UBL A;  2EC4 A;  5CP1 A;  1JHB A;  3WD6 A;  5HR3 A;  5ECM B;  4ZXG A;  2RII A;  2DJ2 A;  3ZML A;  2HLS A;  3ED3 A;  4OFM A;  1J08 A;  1X5C A;  4K6X A;  3EU3 A;  1V9W A;  1YKC A;  3LGC A;  14GS A;  1YEX A;  3FYG A;  4JU5 A;  4MZC A;  3GKN A;  1B4Q A;  3VI7 A;  2NBS A;  2G0F A;  4ML1 A;  2GZP A;  2H71 A;  4XRA A;  3GTU A;  4TW5 A;  3VLN A;  3VI5 A;  4DEJ A;  4XCS A;  5EL8 A;  1T3B A;  2YZU A;  2VCQ A;  3MNG A;  4V2L A;  5C04 A;  2GQK A;  3IK7 A;  1QMV A;  4FYB A;  1AUC A;  1M99 A;  4I5Q A;  4N10 A;  3GX0 A;  3RPP A;  1FVK A;  1HNA A;  3ZIJ A;  1K0O A;  3D4M A;  4IN0 A;  1KTE A;  2MMO A;  3ZVJ A;  4V2N A;  2FHE A;  4L5L A;  1QGV A;  1M0U A;  1A8L A;  3TJJ A;  1FB6 A;  3I69 A;  3MWH A;  3O3T A;  5EVO A;  1PSQ A;  5ECH B;  3I6A A;  5KEJ A;  1NW2 A;  3C8E A;  1Z6M A;  1AXD A;  3F4R A;  6GSX A;  3IHQ A;  4KCE A;  3WYW A;  3TRQ A;  5FT3 A;  2MMZ A;  3FZ9 A;  1QUW A;  2VIM A;  4F9Z A;  1YKA A;  3QOU A;  4TR1 A;  2OAD A;  3M9J A;  2E0Q A;  1HYU A;  4KB3 A;  2JZS A;  2GS3 A;  2OJL A;  3US3 A;  2GQM A;  3LYP A;  1M7T A;  3ZIT A;  4YH2 A;  4F2I A;  2RLI A;  13GS A;  1EWX A;  1GP1 A;  5ELA A;  1MD4 A;  1UC7 A;  2VAF A;  2VD0 A;  4KND A;  3UAP A;  5D73 A;  2CAQ A;  4IJI A;  2V6K A;  2CZ2 A;  1VGL A;  5G5E A;  3FKF A;  5CRH A;  4ECC A;  4JR6 A;  5CRE A;  5CRW A;  3GRX A;  4ZB6 A;  3IRA A;  2PU9 C;  2V6O A;  2BTO T;  4O92 A;  3ZRE A;  3ZL5 A;  4MH3 A;  3MDK A;  2M72 A;  1O81 A;  4KCA A;  5G2Z A;  5KN1 A;  2OE0 A;  4YQU A;  4DSQ A;  4EXJ A;  3TCO A;  3F63 A;  1X9M B;  1M2B A;  2MMA A;  2F8F A;  2IJY A;  2PWJ A;  4RI7 A;  1XOA A;  3KTB A;  3HKR A;  1G6Y A;  5CAX A;  4IQA A;  2R4V A;  3A2X A;  5KN0 A;  3HCZ A;  4CHS A;  5IPH A;  2H0H A;  3EMP A;  1F37 A;  4GTU A;  2FLS A;  4OCF A;  4XHM A;  1PKZ A;  2X99 A;  4IKH A;  1ST9 A;  4L5O A;  2G2Q A;  1YF0 A;  2D2Z A;  1ZYE A;  1TK0 B;  1EZK A;  3PR8 A;  2GSR A;  5ID2 A;  1U6T A;  2ON7 A;  3CMI A;  4TVE A;  4EC0 A;  2CT6 A;  2DJ3 A;  4K7N A;  3A5W A;  2A2R A;  5G30 A;  1G7O A;  4XTS A;  1YZX A;  2F3M A;  3M9K A;  2PBJ A;  3CRU A;  5LD0 A;  1DUG A;  1TRU A;  4K1F A;  5G1L A;  1SYX A;  1Q4J A;  4HU7 A;  3DGQ A;  5B7C A;  2LST A;  5DAK A;  1ZYQ B;  1G6W A;  1Z7R A;  3Q6O A;  4PUF C;  4HUA A;  2VO4 A;  5KN2 A;  2TIR A;  3KJY A;  4MZW A;  2RUE A;  1BQ7 A;  3ERF A;  4GCI A;  4FYU A;  1WPI A;  3H79 A;  2H19 A;  1K0A A;  4MJE A;  3G7I A;  4ULX A;  3TDG A;  4HZ2 A;  4HS1 A;  3LOR A;  3RDW A;  1NHO A;  3CTG A;  3GMF A;  4EVM A;  3GH6 A;  2AYT A;  4JED A;  2H8L A;  1DBY A;  1ERW A;  5J5N A;  2K9F A;  6GSY A;  3RHB A;  3DYR A;  2IME A;  3GX8 A; 
#chains in the Genus database with same CATH topology
 1J9B A;  2PMT A;  3ZMK A;  4O32 A;  4WF5 A;  4MH2 A;  1ZL9 A;  5DQS A;  5HFG A;  4LMV A;  4LL1 B;  1R7H A;  3DWV A;  3HJP A;  1GL8 A;  3GL5 A;  2CAI A;  1TRV A;  4G0I A;  2YV9 A;  1TDI A;  2PGT A;  2YWM A;  2TRX A;  2CA8 A;  3VPT A;  3UJ1 A;  1RK4 A;  2LJA A;  1O7U A;  1GSS A;  5E59 A;  1M2A A;  2KP2 A;  4OO5 A;  3LWA A;  1OKT A;  4TRX A;  4WKW A;  2ON5 A;  1FG4 A;  2P5Q A;  3UMA A;  1GH2 A;  2N5F A;  1VF3 A;  3H4K A;  1XVQ A;  2C0F A;  1JFU A;  5IMC A;  2B1L A;  3HJO A;  1BYE A;  1YJ6 A;  2EIQ A;  5B6M A;  2GGT A;  2GVP A;  5FHI A;  2I3Y A;  3F8U A;  4N0Z A;  4PQ1 A;  2F51 A;  1RW1 A;  1KEB A;  1JLV A;  1O85 A;  1SK2 A;  2VCZ A;  4K5S A;  1UA5 A;  3TJK A;  3QAG A;  4ZBB A;  2I1U A;  5JWQ B;  2QGV A;  3M0F A;  4G9H A;  4QL9 A;  1SEN A;  3DD3 A;  5CO3 A;  1M9A A;  4IJ3 A;  2VLU A;  4WF4 A;  4PQI A;  2ES7 A;  1I9D A;  4TOP A;  4N0V A;  2HZE A;  1XWK A;  3FW2 A;  5DAL B;  1ZGN A;  4EO3 A;  2LJR A;  3EUR A;  2FY6 A;  3IA1 A;  2P5R A;  5IMD A;  2L4C A;  2E2M A;  3P8W A;  3M1G A;  4KDY A;  3IPZ A;  5ECP B;  5HR0 A;  4LL4 B;  1LJR A;  1AW9 A;  5IPG A;  1U87 A;  5HR2 A;  5J41 A;  4POB A;  3I43 A;  2H0G A;  3UL3 A;  4OCE A;  3ZTL A;  5ECL B;  4KX4 A;  1PL1 A;  9GSS A;  2AB6 A;  1A2M A;  3ZZX A;  4TR3 A;  2HE3 A;  3TGZ A;  3WGX A;  5E4W A;  2IPA A;  1AAZ A;  5DDL A;  1YQ1 A;  3CQF A;  2H75 A;  3LSZ A;  3ME7 A;  4BWQ A;  4MJC A;  3DVW A;  2HZF A;  4PNF A;  4YAP A;  3TJF A;  2FGX A;  5CNW A;  3NOF A;  2IMI A;  2CVD A;  4X1U A;  4K8M A;  7GSS A;  2H6Y A;  4AJ8 A;  2CX3 A;  1SU9 A;  3PPU A;  4XS6 A;  4CW9 A;  2DML A;  2K8S A;  4ILF A;  2YJ7 A;  2OA7 A;  2DIZ A;  1N2A A;  3D5J A;  4RQX A;  20GS A;  1X9S B;  4PGT A;  3QAV A;  1MDI A;  1UVZ A;  4MLY A;  5ECS A;  2FA8 A;  3P2A A;  1PQN A;  4KW6 A;  2C4J A;  4MF7 A;  2M46 A;  4EKZ A;  2QKE A;  1R5P A;  2JZT A;  3UBK A;  4GLT A;  5DQY A;  1PD2 1;  2EIO A;  1M9B A;  4TXO A;  1AQV A;  3KMN A;  5DVB A;  1DE1 A;  17GS A;  1EV4 A;  5IMZ A;  3DIE A;  1OAZ A;  4D73 A;  2LJK A;  4GF0 A;  3WGE A;  3GH9 A;  3IAS 2;  1NM3 A;  4A5P A;  3GV1 A;  4ZBD A;  5CYY A;  4QQ7 A;  3E3E A;  1QFN A;  5INY A;  4IBP A;  2H0I A;  5IOX A;  3TKS A;  5FWG A;  2CV4 A;  1T7P B;  2X8G A;  3CSH A;  4WR5 A;  2PVO C;  2WRT A;  4K0G A;  2KP1 A;  3TRP A;  3IXR A;  18GS A;  1H75 A;  3TKQ A;  4G19 A;  2JU5 A;  1X5E A;  5AN1 A;  3J7Y b;  2YCD A;  2C3N A;  2PPT A;  2R37 A;  1THO A;  3GHA A;  1Z3E A;  3QPM A;  4HI7 A;  4NAX A;  1IYI A;  3EMX A;  2H1G A;  1R5A A;  1ZOF A;  4Q5R A;  1A24 A;  3HZ8 A;  4ZIJ A;  1AC1 A;  3PGT A;  3W8J A;  2J9H A;  2IL3 A;  4KDX A;  4EIQ A;  1E6B A;  1TRS A;  4EF0 A;  2IFQ A;  1VF1 A;  3FY7 A;  2GZY A;  2B7K A;  1EP8 A;  1OC9 B;  2I9H A;  3KGK A;  1YDK A;  4HU9 A;  2HSY A;  1TW9 A;  2OBI A;  1XW6 A;  2HSM A;  4Z2R A;  5GAP D;  4GWR A;  2LQO A;  4K7I A;  12GS A;  1BG5 A;  2NVL A;  2H6X A;  2O89 A;  6GSS A;  2N5A A;  1SKS B;  1MEK A;  2DJ1 A;  1KNG A;  1VF4 A;  4MMM A;  2VL2 A;  2X64 A;  4TKY A;  2DIY A;  2XC2 A;  2L5O A;  3IR4 A;  3M3M A;  4HJM A;  1YEP A;  3KXO A;  5G31 A;  6GSW A;  2R6K A;  2IMK A;  1V2A A;  4MZB A;  2WGR A;  1ERT A;  1XZO A;  1XWC A;  3Q19 A;  4IW9 A;  4EIP A;  5IQY A;  3TB2 A;  4ISD A;  3LW9 A;  3P7X A;  4ZIL A;  4AGS A;  1WE0 A;  4FO5 A;  1PL2 A;  3F4S A;  2HXK A;  5IMF A;  1I5G A;  4WEY A;  3ZFB A;  2AJQ B;  4RI6 A;  3C71 A;  3H1N A;  4DSR A;  2FWF A;  2YWI A;  5J9B A;  5F07 A;  5JWR B;  3KH7 A;  3IC8 A;  4G0K A;  4HQZ A;  2GQL A;  5GAN D;  4FIW A;  3R2Q A;  5C00 A;  1HQO A;  5ECK B;  3G7J A;  3F4T A;  1O6J A;  2GZZ A;  4GRF A;  4NV5 A;  1YY7 A;  2H30 A;  1WMJ A;  1PRX A;  6GSV A;  2X8C A;  3A3T A;  2E2G A;  4IP6 A;  2K8V A;  1J0F A;  2AV4 A;  1SKR B;  1A2L A;  4FYC A;  3VWX A;  3TUE A;  2KHP A;  4I8B A;  5D9X A;  3QR6 A;  2JAD A;  1WIK A;  4V1A p;  2OBK A;  1R26 A;  5KOW A;  5CRG A;  1NHY A;  2XPE A;  4I2U A;  1SL2 B;  2HI7 A;  3GFK A;  1A2J A;  3LFL A;  2FNO A;  4NHW A;  3L9V A;  4TXV A;  2DJJ A;  1XWB A;  5CRD A;  1TKD B;  4E8H A;  1QK8 A;  3TJG A;  4MDC A;  1T1V A;  1EGR A;  2C3Q A;  5DCH A;  4IP1 A;  2YWN A;  1W4V A;  3KP9 A;  5J3R A;  3HY2 A;  2LRC A;  5JCW A;  2FD3 A;  3D6I A;  3D0Z A;  2KOK A;  3GST A;  3LG6 A;  4OWY A;  3QAW A;  4YQV A;  3EVI A;  4XS4 B;  2R5G A;  4EDY A;  3IHG A;  2YV7 A;  2P31 A;  1PKW A;  3IV4 A;  3WGD A;  4BA7 A;  5AIS A;  1TRW A;  4NHZ A;  2KLX A;  3ERG A;  1PMT A;  1OYJ A;  1SK1 A;  2YOI A;  2HYX A;  2V41 A;  4NMU A;  2M80 A;  2LKU A;  2QSI A;  1ZYP A;  5DCG A;  2HRF A;  1BED A;  2IN3 A;  2WB9 A;  1XWG A;  4IEL A;  1SJZ A;  3H8Q A;  2MBS A;  3ISO A;  4G2E A;  4MCU A;  5D9T A;  3EWL A;  1SJI A;  3KTL A;  3EE2 A;  1AQX A;  4KA0 A;  5A4W A;  3CYN A;  3WT2 A;  4XIH A;  3GUS A;  4K0N A;  2BMX A;  2HNL A;  1TK5 B;  5DJL A;  4POL A;  16GS A;  2HRA A;  2WS2 A;  5D96 A;  4TR0 A;  1DSB A;  3ZRD A;  3H93 A;  1S3R A;  2REM A;  3VFI A;  1M3J A;  4IVF A;  5ECN B;  4YQM A;  2YAN A;  4POM A;  4BWS A;  2XHF A;  3C7M A;  2PER A;  4FQU A;  1F3A A;  2R2J A;  5DBQ A;  3V1W A;  3SBC A;  4KSO A;  2VCX A;  1OKD A;  1A0R P;  3CRT A;  4BVX A;  2O8V B;  1FVJ A;  4Z7X A;  1K0C A;  3QD9 A;  3IOS A;  1JZD A;  4TR4 A;  4WR4 A;  3FR3 A;  3FR9 A;  4HZ4 A;  1S3A A;  1XBS A;  4J57 E;  2VM2 A;  3ME8 A;  5HQP A;  2H66 A;  2WJU A;  4PTS A;  2H74 A;  2WUL A;  3ZLP A;  4BL7 B;  3IC4 A;  1EEJ A;  2C0G A;  3IK9 A;  4O7H A;  1GWC A;  3APO A;  2L6C A;  4JE1 A;  3Q74 A;  3I9V 2;  1GRX A;  4F0B A;  2NDO A;  1TTZ A;  4J56 E;  3MSZ A;  3HDC A;  4G0L A;  3L0H A;  4DSS A;  4F0C A;  5HFI A;  1JZO A;  1PA3 A;  4X4J A;  5IOW A;  5KOX A;  4Q5Q A;  1FAA A;  2C0E A;  3E9J B;  4ECI A;  1B8X A;  4YAV A;  3BBY A;  3N9J A;  1WJK A;  5A5K A;  2HRN A;  2H1D A;  2YWO A;  2B6M A;  1ABA A;  4L0U A;  1PX7 A;  3D22 A;  2K6V A;  4O5U A;  4ACS A;  3HVS A;  3LEF A;  2C0D A;  4TXO B;  3ZIV A;  5JCG A;  5D8I A;  4P3Y B;  2L5L A;  2C80 A;  5F0G A;  4D73 B;  5A4U A;  1T8E B;  4RQR A;  5ECQ B;  3F3R A;  4GQC A;  2DSA A;  8GSS A;  4OFT A;  1V98 A;  1HNC A;  3GYK A;  1EOH A;  4ECJ A;  2OE3 A;  3F9U A;  4LMW A;  1KBN A;  3ZFL A;  2Z9S A;  3DRN A;  2R0G A;  1S3D A;  2O87 A;  2DJ0 A;  2GTU A;  2R3X A;  1E2Y A;  1XWA A;  4KH7 A;  3FZA A;  3GTU B;  5D9W A;  4EDZ A;  2VM1 A;  2MMN A;  3HA9 A;  5L71 A;  2LRT A;  2FWH A;  5EPF A;  2I4A A;  4ZB9 A;  4GSS A;  2WCI A;  3BD2 A;  4MNN A;  5GZZ B;  3CBU A;  5F8B A;  4OO4 A;  4PX1 A;  4IS0 A;  2CVB A;  1QXH A;  2WFC A;  2FUG 2;  4ZB8 A;  3TRX A;  2ZUP A;  1T00 A;  3BCK A;  1Q98 A;  2MYG A;  2C3T A;  3O6T A;  2JSY A;  3QCP A;  3HZ4 A;  3F3Q A;  4HQS A;  1Z9H A;  1FW1 A;  3EU4 A;  1GLP A;  5DAL A;  1A8Y A;  1VF2 A;  4LLR A;  3FRC A;  1GTI A;  1JZR A;  1B48 A;  3KEB A;  1C72 A;  1WWJ A;  1PFO A;  4POK A;  4ZL7 A;  3NZN A;  2WDU A;  5ECR B;  5ELG A;  2IWT A;  3VUR A;  1GSF A;  4TR1 B;  3VWV A;  3VWW A;  3K8N A;  3APS A;  2LS5 A;  1F3B A;  2F8A A;  2OE1 A;  4KDU A;  3N5O A;  4QL7 A;  4MPF A;  1M2D A;  4FH8 A;  3GN3 A;  4KAE A;  1R4W A;  2H70 A;  1GTU A;  2YJH A;  2OKA A;  5ECI B;  6GST A;  1PN0 A;  2QA2 A;  1QQ2 A;  1GSU A;  3EIN A;  2GT6 A;  1OE7 A;  5GST A;  4KE3 A;  1GLQ A;  3G9B A;  3HHV A;  4AJ6 A;  1B9Y C;  1XCC A;  5G1K A;  5J4U A;  4K9Z A;  4RUV A;  1EGO A;  4KUN A;  3GKM A;  1BAY A;  3EYT A;  2DC5 A;  1B4P A;  5EY6 A;  1TK8 B;  1GSE A;  3A2W A;  4I6X A;  3BOA A;  5IM9 A;  4K5R A;  4NXI A;  2LEG A;  2H1A A;  5D9V A;  1GNW A;  2O7K A;  1TU7 A;  4TN8 A;  4H86 A;  6GSU A;  4BVY A;  3E0U A;  4F82 A;  3SWL A;  1GUH A;  5COH A;  4AJ7 A;  5ECO B;  1XIY A;  1N8J A;  2GLR A;  3FZ4 A;  1USB A;  1MDJ A;  4ML6 A;  2C1Y A;  4MF5 A;  3DVX A;  1EEM A;  3KP8 A;  2H73 A;  3RBT A;  3HD5 A;  1V40 A;  1FO5 A;  5IMA A;  4ECB A;  2VUP A;  3TOU A;  1K3O A;  2B5Y A;  2B5E A;  2CX4 A;  4OD7 A;  2DMM A;  2WZ9 A;  2A4V A;  2H01 A;  3J7Y k;  5B8A A;  3KM6 A;  2RM6 A;  2RM5 A;  1DE2 A;  3KH9 A;  2H6Z A;  3APQ A;  4WET A;  3DXB A;  3F6D A;  3TJB A;  4PQH A;  2AUV A;  4EL1 A;  2MBT A;  3CTF A;  4G10 A;  5ID2 B;  19GS A;  1GSQ A;  4XRD A;  3GKK A;  3LXZ A;  1XVW A;  1ILO A;  2L57 A;  3W6G A;  1ZMA A;  2VOC A;  3UAR A;  4OMV A;  5LCZ A;  4O5R A;  1U88 A;  4X43 A;  2VL9 A;  5AIX A;  1MD3 A;  1O73 A;  1Y6E A;  4OFN A;  2OAC A;  3P90 A;  3DEX A;  2IMD A;  3ERW A;  2JL4 A;  1ML6 A;  4I97 A;  5AIV A;  3RAZ A;  1H4O A;  2ZNM A;  2LRN A;  1JLW A;  2L6D A;  5A4V A;  5G5F A;  5DAK B;  2YP6 A;  1EP7 A;  4Q5F A;  1TOF A;  4GQF A;  3C1S A;  5ENU A;  2K18 A;  1OC9 A;  2PUK C;  3WT1 A;  1W89 A;  4HJ2 A;  5GSS A;  4GXZ A;  3C73 A;  2JZR A;  1GUM A;  4EE0 A;  3GSS A;  3HVV A;  3TKR A;  2FCH A;  4WBJ A;  4XS1 A;  3A2V A;  3Q18 A;  2KUC A;  1X9W B;  2I81 A;  1GNE A;  2JSZ A;  2IMF A;  3JCM L;  3LXT A;  1B9X C;  1TXX A;  4N30 A;  10GS A;  2HFD A;  4NV2 A;  2X49 A;  11GS A;  2L59 A;  4NPB A;  1S3C A;  4HDE A;  5H5R A;  3BJ5 A;  1SKW B;  5AGY A;  1Z6N A;  1XW9 A;  2ALB A;  1TI1 A;  2L4Q A;  2NPB A;  3UVT A;  4GST A;  1EV9 A;  5IO0 A;  1X0R A;  3KMO A;  4ZL8 A;  2HT9 A;  1FOV A;  2XPD A;  3GA4 A;  3GKX A;  1SL1 B;  1G7E A;  1SL0 B;  5JCU A;  4IGJ A;  5IIZ A;  1Z5Y E;  2JAC A;  4V1A g;  1GUK A;  1IYH A;  4LA1 A;  4K2X A;  2NTO A;  2VCV A;  3GL3 A;  1ERV A;  2R0P A;  3VWU A;  1GUL A;  1OC8 A;  2F9S A;  2GDR A;  4MJA A;  4MF6 A;  1SD9 A;  2CZ3 A;  4MP4 A;  1JZW A;  2DJK A;  4JRR A;  4GSN A;  1Y25 A;  4MPG A;  1UN2 A;  5IMV A;  1K3Y A;  3C1R A;  3DML A;  2YPM A;  2LQQ A;  4NWY A;  4E8E A;  3W8S A;  2V32 A;  1A0F A;  2LNT A;  1ZCP A;  4ZBA A;  3FEU A;  3U5R E;  2B1K A;  4CY8 A;  3QFA C;  1LU4 A;  1XXU A;  1PN9 A;  4PUR A;  1XW5 A;  3FK8 A;  5ABR A;  3RHC A;  2DKI A;  3S9F A;  2B5X A;  4ZL9 A;  1PGT A;  4IHU A;  1OC3 A;  4WXT A;  4Q5N A;  3HJM A;  1SK0 A;  1XG8 A;  4DSS B;  2GT5 A;  3VPQ A;  2HSH A;  1OE8 A;  5DJM A;  1WRY A;  3IE3 A;  2CQ9 A;  4L8E A;  3UIW A;  2HZE B;  3IBH A;  2A2S A;  2E7P A;  2HRK A;  4JBB A;  5KN3 A;  5H5Q A;  3PIN A;  5HR1 A;  2YN1 A;  22GS A;  3O76 A;  5F06 A;  3UOM A;  2XBQ A;  3CXG A;  3NIV A;  1T4Y A;  3L78 A;  3QDN A;  2VCW A;  3KD0 A;  1WP0 A;  4Z2U A;  3M8N A;  5BMU A;  2VD1 A;  2VCT A;  4X0X A;  2GSQ A;  1CQH A;  3EPT A;  2BJX A;  4PXO A;  4BIK A;  4DVC A;  1VRS D;  4L0W A;  4HOJ A;  1ERU A;  2LUS A;  4EUY A;  2AAW A;  1K0B A;  2VL3 A;  1Z7P A;  1GSY A;  4I2T A;  1K0N A;  2CVK A;  4HEA 2;  1RQM A;  3U6V A;  1SJ6 A;  2GSS A;  5LNK e;  2AHE A;  2FWE A;  4BPY A;  4ICY A;  3RPN A;  1THX A;  4XS4 A;  4F03 A;  1MTC A;  1FOH A;  1O8X A;  1ON4 A;  1FB0 A;  1URM A;  3ZYW A;  1GTA A;  1U3A A;  4KGI A;  3QMX A;  1V57 A;  3HYP A;  3HXS A;  4ID0 A;  2J23 A;  1X5D A;  1AQW A;  1G0T A;  3FHK A;  1FHE A;  3FZ5 A;  1GTB A;  1F2E A;  3GUR A;  1WOU A;  3F6F A;  1SD8 A;  2RUF A;  3KIJ A;  1MDK A;  3L9S A;  5F05 A;  2YNX A;  4PNG A;  3GNJ A;  2IIY A;  2X8H A;  2LV3 A;  5H5S A;  4J2F A;  3UEM A;  1U3I A;  4Z2T A;  3TKS E;  2XBI A;  4KF9 A;  1ACV A;  2DBC A;  2B7J A;  3CSJ A;  3D4T A;  1SYR A;  3MYD A;  1TP9 A;  4IQ1 A;  1CQG A;  3G7Y A;  4CDO A;  3TKS C;  1GSD A;  1HNB A;  3PH9 A;  1T4Z A;  2LTK A;  1EOG A;  3DKS A;  4N11 A;  3GIX A;  3OR5 A;  1F6M C;  2H76 A;  3FR6 A;  2C8U A;  2V1M A;  2VLV A;  4WBR D;  2QC7 A;  3QFB C;  2PVQ A;  5HFK A;  4YKG A;  3UVH A;  1TI3 A;  4PUA A;  1F9M A;  3LQ7 A;  3KCM A;  5BRT A;  2DKH A;  1XPV A;  5JWO B;  3BCI A;  3F0I A;  1TJD A;  3KZQ A;  4MAB A;  3L9U A;  3D21 A;  1A23 A;  4V2M A;  2B3S A;  1BJX A;  3AY8 A;  1LBK A;  2YZH A;  3MAK A;  2ZCT A;  3TOT A;  2FWG A;  1YF1 A;  2MZC A;  4BL7 A;  1NSW A;  5B8B A;  2V2G A;  2N5B A;  2O85 A;  5J9C A;  2H72 A;  4CY6 A;  1O8W A;  3ZVJ D;  2VLT A;  3L4N A;  4K7O A;  2DLX A;  1OVN A;  4JZQ A;  4MK3 A;  1PX6 A;  3IAM 2;  2IFQ B;  3HVX A;  1ZZY A;  2LNS A;  1M3I A;  3LJR A;  4MA9 A;  4K2D A;  4MJB A;  4AF2 A;  3CSI A;  5B6N A;  2FA4 A;  1V58 A;  4JR4 A;  4BVY B;  1XFL A;  1XOB A;  3EC3 A;  5IO2 A;  1AIU A;  3LYK A;  1K3L A;  2TRC P;  2VL2 C;  2P0G A;  2PN8 A;  2GST A;  3TKP A;  4KSM A;  1BX9 A;  1K0M A;  3IDV A;  2H1B A;  3VK9 A;  5D93 A;  1K0D A;  1TU8 A;  1HD2 A;  2EIR A;  3UBL A;  2EC4 A;  5CP1 A;  1JHB A;  3WD6 A;  5HR3 A;  5ECM B;  4ZXG A;  2RII A;  2DJ2 A;  3ZML A;  2HLS A;  3ED3 A;  4OFM A;  1J08 A;  1X5C A;  4K6X A;  3EU3 A;  2A4H A;  1V9W A;  1YKC A;  3LGC A;  14GS A;  1YEX A;  3FYG A;  4JU5 A;  4MZC A;  3GKN A;  1B4Q A;  3VI7 A;  2NBS A;  2G0F A;  4ML1 A;  2GZP A;  2H71 A;  4XRA A;  3GTU A;  4TW5 A;  3VLN A;  3VI5 A;  4DEJ A;  4XCS A;  5EL8 A;  1T3B A;  2YZU A;  2VCQ A;  3MNG A;  4V2L A;  5C04 A;  2GQK A;  3HVN A;  3IK7 A;  1QMV A;  4FYB A;  1AUC A;  4USS A;  1M99 A;  4I5Q A;  3R3E A;  3GX0 A;  4N10 A;  3RPP A;  1FVK A;  1HNA A;  3ZIJ A;  1K0O A;  3D4M A;  4IN0 A;  1KTE A;  2MMO A;  3ZVJ A;  4V2N A;  2FHE A;  4L5L A;  1QGV A;  1M0U A;  1A8L A;  3TJJ A;  1FB6 A;  3I69 A;  3MWH A;  3O3T A;  5EVO A;  1PSQ A;  5ECH B;  4O5Q A;  3I6A A;  5KEJ A;  1NW2 A;  3C8E A;  1Z6M A;  1AXD A;  3F4R A;  6GSX A;  3IHQ A;  4KCE A;  3WYW A;  3TRQ A;  5FT3 A;  2MMZ A;  3FZ9 A;  1QUW A;  2VIM A;  4F9Z A;  1YKA A;  3QOU A;  4TR1 A;  2OAD A;  3M9J A;  2E0Q A;  1HYU A;  4KB3 A;  2JZS A;  2GS3 A;  2OJL A;  4HSC X;  3US3 A;  2GQM A;  3LYP A;  4YKF A;  1M7T A;  3ZIT A;  4YH2 A;  4F2I A;  2RLI A;  13GS A;  1EWX A;  1GP1 A;  5ELA A;  1MD4 A;  1UC7 A;  2VAF A;  2VD0 A;  4KND A;  3UAP A;  5D73 A;  2CAQ A;  4IJI A;  2V6K A;  2CZ2 A;  1VGL A;  5G5E A;  2X4A A;  3FKF A;  5CRH A;  4ECC A;  4JR6 A;  5CRE A;  5CRW A;  3GRX A;  4ZB6 A;  3IRA A;  2PU9 C;  2V6O A;  2BTO T;  4O92 A;  3ZRE A;  3ZL5 A;  4MH3 A;  3MDK A;  2M72 A;  1O81 A;  4KCA A;  5G2Z A;  5KN1 A;  2OE0 A;  4YQU A;  4DSQ A;  4EXJ A;  3TCO A;  3F63 A;  3A5I A;  1X9M B;  1M2B A;  2MMA A;  2F8F A;  2IJY A;  2PWJ A;  2QA1 A;  4RI7 A;  1XOA A;  3MIX A;  3KTB A;  3HKR A;  1G6Y A;  5CAX A;  4IQA A;  2R4V A;  3A2X A;  5KN0 A;  3HCZ A;  4CHS A;  5IPH A;  2H0H A;  3EMP A;  1F37 A;  4GTU A;  2FLS A;  4OCF A;  4XHM A;  1PKZ A;  2X99 A;  4IKH A;  1ST9 A;  3FMW A;  4L5O A;  2G2Q A;  1YF0 A;  2D2Z A;  1ZYE A;  1TK0 B;  1EZK A;  3PR8 A;  2GSR A;  5ID2 A;  1U6T A;  2ON7 A;  3CMI A;  4TVE A;  4EC0 A;  2CT6 A;  2DJ3 A;  4K7N A;  3A5W A;  2A2R A;  5G30 A;  1G7O A;  4XTS A;  1YZX A;  2F3M A;  3M9K A;  2PBJ A;  3CRU A;  5LD0 A;  4BVX B;  1DUG A;  1TRU A;  4K1F A;  5G1L A;  1SYX A;  1Q4J A;  4HU7 A;  3DGQ A;  5B7C A;  2LST A;  5DAK A;  1ZYQ B;  1G6W A;  1Z7R A;  3Q6O A;  4PUF C;  4HUA A;  2VO4 A;  5KN2 A;  2TIR A;  3KJY A;  4MZW A;  2RUE A;  1ZYN A;  1BQ7 A;  3ERF A;  4GCI A;  4FYU A;  1WPI A;  3H79 A;  2H19 A;  2UZ8 A;  1K0A A;  4MJE A;  3G7I A;  4ULX A;  3TDG A;  4HZ2 A;  4HS1 A;  3LOR A;  2A2P A;  3RDW A;  1NHO A;  3CTG A;  3GMF A;  4EVM A;  2R0C A;  3GH6 A;  2AYT A;  4JED A;  2H8L A;  1DBY A;  1ERW A;  5J5N A;  2K9F A;  6GSY A;  3RHB A;  3DYR A;  2IME A;  3GX8 A; 
#chains in the Genus database with same CATH homology
 1J9B A;  2PMT A;  3ZMK A;  4O32 A;  4WF5 A;  4MH2 A;  1ZL9 A;  5DQS A;  5HFG A;  4LMV A;  4LL1 B;  1R7H A;  3DWV A;  3HJP A;  1GL8 A;  3GL5 A;  2CAI A;  1TRV A;  4G0I A;  2YV9 A;  1TDI A;  2PGT A;  2YWM A;  2TRX A;  2CA8 A;  3VPT A;  3UJ1 A;  1RK4 A;  2LJA A;  1O7U A;  1GSS A;  5E59 A;  1M2A A;  2KP2 A;  4OO5 A;  3LWA A;  1OKT A;  4TRX A;  4WKW A;  2ON5 A;  1FG4 A;  2P5Q A;  3UMA A;  1GH2 A;  2N5F A;  1VF3 A;  3H4K A;  1XVQ A;  2C0F A;  1JFU A;  5IMC A;  2B1L A;  3HJO A;  1BYE A;  1YJ6 A;  2EIQ A;  5B6M A;  2GGT A;  2GVP A;  5FHI A;  2I3Y A;  3F8U A;  4N0Z A;  4PQ1 A;  2F51 A;  1RW1 A;  1KEB A;  1JLV A;  1O85 A;  1SK2 A;  2VCZ A;  4K5S A;  1UA5 A;  3TJK A;  3QAG A;  4ZBB A;  2I1U A;  5JWQ B;  2QGV A;  3M0F A;  4G9H A;  4QL9 A;  1SEN A;  3DD3 A;  5CO3 A;  1M9A A;  4IJ3 A;  2VLU A;  4WF4 A;  4PQI A;  2ES7 A;  1I9D A;  4TOP A;  4N0V A;  2HZE A;  1XWK A;  3FW2 A;  5DAL B;  1ZGN A;  4EO3 A;  2LJR A;  3EUR A;  2FY6 A;  3IA1 A;  2P5R A;  5IMD A;  2L4C A;  2E2M A;  3P8W A;  3M1G A;  4KDY A;  3IPZ A;  5ECP B;  5HR0 A;  4LL4 B;  1LJR A;  1AW9 A;  5IPG A;  1U87 A;  5HR2 A;  5J41 A;  4POB A;  3I43 A;  2H0G A;  3UL3 A;  4OCE A;  3ZTL A;  5ECL B;  4KX4 A;  1PL1 A;  9GSS A;  2AB6 A;  1A2M A;  3ZZX A;  4TR3 A;  2HE3 A;  3TGZ A;  3WGX A;  5E4W A;  2IPA A;  1AAZ A;  5DDL A;  1YQ1 A;  2H75 A;  3LSZ A;  3ME7 A;  4BWQ A;  4MJC A;  3DVW A;  2HZF A;  4PNF A;  4YAP A;  3TJF A;  2FGX A;  5CNW A;  3NOF A;  2IMI A;  2CVD A;  4X1U A;  4K8M A;  7GSS A;  2H6Y A;  4AJ8 A;  2CX3 A;  1SU9 A;  3PPU A;  4XS6 A;  4CW9 A;  2DML A;  2K8S A;  4ILF A;  2YJ7 A;  2OA7 A;  2DIZ A;  1N2A A;  3D5J A;  4RQX A;  20GS A;  1X9S B;  4PGT A;  3QAV A;  1MDI A;  1UVZ A;  4MLY A;  5ECS A;  2FA8 A;  3P2A A;  1PQN A;  4KW6 A;  2C4J A;  4MF7 A;  2M46 A;  4EKZ A;  2QKE A;  1R5P A;  2JZT A;  3UBK A;  4GLT A;  5DQY A;  1PD2 1;  2EIO A;  1M9B A;  4TXO A;  1AQV A;  3KMN A;  5DVB A;  1DE1 A;  17GS A;  1EV4 A;  5IMZ A;  3DIE A;  1OAZ A;  4D73 A;  2LJK A;  4GF0 A;  3WGE A;  3GH9 A;  3IAS 2;  1NM3 A;  4A5P A;  3GV1 A;  4ZBD A;  5CYY A;  4QQ7 A;  3E3E A;  1QFN A;  5INY A;  4IBP A;  2H0I A;  5IOX A;  3TKS A;  5FWG A;  2CV4 A;  1T7P B;  2X8G A;  3CSH A;  4WR5 A;  2PVO C;  2WRT A;  4K0G A;  2KP1 A;  3TRP A;  3IXR A;  18GS A;  1H75 A;  3TKQ A;  4G19 A;  2JU5 A;  1X5E A;  5AN1 A;  3J7Y b;  2YCD A;  2C3N A;  2PPT A;  2R37 A;  1THO A;  3GHA A;  1Z3E A;  3QPM A;  4HI7 A;  4NAX A;  1IYI A;  3EMX A;  2H1G A;  1R5A A;  1ZOF A;  4Q5R A;  1A24 A;  3HZ8 A;  4ZIJ A;  1AC1 A;  3PGT A;  3W8J A;  2J9H A;  2IL3 A;  4KDX A;  4EIQ A;  1E6B A;  1TRS A;  4EF0 A;  2IFQ A;  1VF1 A;  3FY7 A;  2GZY A;  2B7K A;  1EP8 A;  1OC9 B;  2I9H A;  3KGK A;  1YDK A;  4HU9 A;  2HSY A;  1TW9 A;  2OBI A;  1XW6 A;  2HSM A;  4Z2R A;  5GAP D;  4GWR A;  2LQO A;  4K7I A;  12GS A;  1BG5 A;  2NVL A;  2H6X A;  2O89 A;  6GSS A;  2N5A A;  1SKS B;  1MEK A;  2DJ1 A;  1KNG A;  1VF4 A;  4MMM A;  2VL2 A;  2X64 A;  4TKY A;  2DIY A;  2XC2 A;  2L5O A;  3IR4 A;  3M3M A;  4HJM A;  1YEP A;  3KXO A;  5G31 A;  6GSW A;  2R6K A;  2IMK A;  1V2A A;  4MZB A;  2WGR A;  1ERT A;  1XZO A;  1XWC A;  3Q19 A;  4IW9 A;  4EIP A;  5IQY A;  3TB2 A;  4ISD A;  3LW9 A;  3P7X A;  4ZIL A;  4AGS A;  1WE0 A;  4FO5 A;  1PL2 A;  3F4S A;  2HXK A;  5IMF A;  1I5G A;  4WEY A;  3ZFB A;  2AJQ B;  4RI6 A;  3C71 A;  3H1N A;  4DSR A;  2FWF A;  2YWI A;  5J9B A;  5F07 A;  5JWR B;  3KH7 A;  3IC8 A;  4G0K A;  4HQZ A;  2GQL A;  5GAN D;  4FIW A;  3R2Q A;  5C00 A;  1HQO A;  5ECK B;  3G7J A;  3F4T A;  1O6J A;  2GZZ A;  4GRF A;  4NV5 A;  1YY7 A;  2H30 A;  1WMJ A;  1PRX A;  6GSV A;  2X8C A;  3A3T A;  2E2G A;  4IP6 A;  2K8V A;  1J0F A;  2AV4 A;  1SKR B;  1A2L A;  4FYC A;  3VWX A;  3TUE A;  2KHP A;  4I8B A;  5D9X A;  3QR6 A;  2JAD A;  1WIK A;  4V1A p;  2OBK A;  1R26 A;  5KOW A;  5CRG A;  1NHY A;  2XPE A;  4I2U A;  1SL2 B;  2HI7 A;  3GFK A;  1A2J A;  3LFL A;  2FNO A;  4NHW A;  3L9V A;  4TXV A;  2DJJ A;  1XWB A;  5CRD A;  1TKD B;  4E8H A;  1QK8 A;  3TJG A;  4MDC A;  1T1V A;  1EGR A;  2C3Q A;  5DCH A;  4IP1 A;  2YWN A;  1W4V A;  3KP9 A;  5J3R A;  3HY2 A;  2LRC A;  5JCW A;  2FD3 A;  3D6I A;  3D0Z A;  2KOK A;  3GST A;  3LG6 A;  4OWY A;  3QAW A;  4YQV A;  3EVI A;  4XS4 B;  2R5G A;  4EDY A;  3IHG A;  2YV7 A;  2P31 A;  1PKW A;  3IV4 A;  3WGD A;  4BA7 A;  5AIS A;  1TRW A;  4NHZ A;  2KLX A;  3ERG A;  1PMT A;  1OYJ A;  1SK1 A;  2YOI A;  2HYX A;  2V41 A;  4NMU A;  2M80 A;  2LKU A;  2QSI A;  1ZYP A;  5DCG A;  2HRF A;  1BED A;  2IN3 A;  2WB9 A;  1XWG A;  4IEL A;  1SJZ A;  3H8Q A;  2MBS A;  3ISO A;  4G2E A;  4MCU A;  5D9T A;  3EWL A;  1SJI A;  3KTL A;  3EE2 A;  1AQX A;  4KA0 A;  5A4W A;  3CYN A;  3WT2 A;  4XIH A;  3GUS A;  4K0N A;  2BMX A;  2HNL A;  1TK5 B;  5DJL A;  4POL A;  16GS A;  2HRA A;  2WS2 A;  5D96 A;  4TR0 A;  1DSB A;  3ZRD A;  3H93 A;  2REM A;  3VFI A;  4IVF A;  5ECN B;  4YQM A;  2YAN A;  4POM A;  4BWS A;  2XHF A;  3C7M A;  2PER A;  4FQU A;  1F3A A;  2R2J A;  5DBQ A;  3V1W A;  3SBC A;  4KSO A;  2VCX A;  1OKD A;  1A0R P;  3CRT A;  4BVX A;  2O8V B;  1FVJ A;  4Z7X A;  1K0C A;  3QD9 A;  3IOS A;  1JZD A;  4TR4 A;  4WR4 A;  3FR3 A;  3FR9 A;  4HZ4 A;  1S3A A;  1XBS A;  4J57 E;  2VM2 A;  3ME8 A;  5HQP A;  2H66 A;  2WJU A;  4PTS A;  2H74 A;  2WUL A;  3ZLP A;  4BL7 B;  3IC4 A;  1EEJ A;  2C0G A;  3IK9 A;  4O7H A;  1GWC A;  3APO A;  2L6C A;  4JE1 A;  3Q74 A;  3I9V 2;  1GRX A;  4F0B A;  2NDO A;  1TTZ A;  4J56 E;  3MSZ A;  3HDC A;  4G0L A;  3L0H A;  4DSS A;  4F0C A;  5HFI A;  1JZO A;  1PA3 A;  4X4J A;  5IOW A;  5KOX A;  4Q5Q A;  1FAA A;  2C0E A;  3E9J B;  4ECI A;  1B8X A;  4YAV A;  3BBY A;  3N9J A;  1WJK A;  5A5K A;  2HRN A;  2H1D A;  2YWO A;  2B6M A;  1ABA A;  4L0U A;  1PX7 A;  3D22 A;  2K6V A;  4O5U A;  4ACS A;  3HVS A;  3LEF A;  2C0D A;  4TXO B;  3ZIV A;  5JCG A;  5D8I A;  4P3Y B;  2L5L A;  2C80 A;  5F0G A;  4D73 B;  5A4U A;  1T8E B;  4RQR A;  5ECQ B;  3F3R A;  4GQC A;  2DSA A;  8GSS A;  4OFT A;  1V98 A;  1HNC A;  3GYK A;  1EOH A;  4ECJ A;  2OE3 A;  3F9U A;  4LMW A;  1KBN A;  3ZFL A;  2Z9S A;  3DRN A;  2R0G A;  1S3D A;  2O87 A;  2DJ0 A;  2GTU A;  2R3X A;  1E2Y A;  1XWA A;  4KH7 A;  3FZA A;  3GTU B;  5D9W A;  4EDZ A;  2VM1 A;  2MMN A;  3HA9 A;  5L71 A;  2LRT A;  2FWH A;  5EPF A;  2I4A A;  4ZB9 A;  4GSS A;  2WCI A;  3BD2 A;  4MNN A;  5GZZ B;  3CBU A;  5F8B A;  4OO4 A;  4PX1 A;  4IS0 A;  2CVB A;  1QXH A;  2WFC A;  2FUG 2;  4ZB8 A;  3TRX A;  2ZUP A;  1T00 A;  3BCK A;  1Q98 A;  2MYG A;  2C3T A;  3O6T A;  2JSY A;  3QCP A;  3HZ4 A;  3F3Q A;  4HQS A;  1Z9H A;  1FW1 A;  3EU4 A;  1GLP A;  5DAL A;  1A8Y A;  1VF2 A;  4LLR A;  3FRC A;  1GTI A;  1JZR A;  1B48 A;  3KEB A;  1C72 A;  1WWJ A;  4POK A;  4ZL7 A;  3NZN A;  2WDU A;  5ECR B;  5ELG A;  2IWT A;  3VUR A;  1GSF A;  4TR1 B;  3VWV A;  3VWW A;  3K8N A;  3APS A;  2LS5 A;  1F3B A;  2F8A A;  2OE1 A;  4KDU A;  3N5O A;  4QL7 A;  4MPF A;  1M2D A;  4FH8 A;  3GN3 A;  4KAE A;  1R4W A;  2H70 A;  1GTU A;  2YJH A;  2OKA A;  5ECI B;  6GST A;  1PN0 A;  2QA2 A;  1QQ2 A;  1GSU A;  3EIN A;  2GT6 A;  1OE7 A;  5GST A;  4KE3 A;  1GLQ A;  3G9B A;  3HHV A;  4AJ6 A;  1B9Y C;  1XCC A;  5G1K A;  5J4U A;  4K9Z A;  4RUV A;  1EGO A;  4KUN A;  3GKM A;  1BAY A;  3EYT A;  2DC5 A;  1B4P A;  5EY6 A;  1TK8 B;  1GSE A;  3A2W A;  4I6X A;  3BOA A;  5IM9 A;  4K5R A;  4NXI A;  2LEG A;  2H1A A;  5D9V A;  1GNW A;  2O7K A;  1TU7 A;  4TN8 A;  4H86 A;  6GSU A;  4BVY A;  3E0U A;  4F82 A;  3SWL A;  1GUH A;  5COH A;  4AJ7 A;  5ECO B;  1XIY A;  1N8J A;  2GLR A;  3FZ4 A;  1USB A;  1MDJ A;  4ML6 A;  2C1Y A;  4MF5 A;  3DVX A;  1EEM A;  3KP8 A;  2H73 A;  3RBT A;  3HD5 A;  1V40 A;  1FO5 A;  5IMA A;  4ECB A;  2VUP A;  3TOU A;  1K3O A;  2B5Y A;  2B5E A;  2CX4 A;  4OD7 A;  2DMM A;  2WZ9 A;  2A4V A;  2H01 A;  3J7Y k;  5B8A A;  3KM6 A;  2RM6 A;  2RM5 A;  1DE2 A;  3KH9 A;  2H6Z A;  3APQ A;  4WET A;  3DXB A;  3F6D A;  3TJB A;  4PQH A;  2AUV A;  4EL1 A;  2MBT A;  3CTF A;  4G10 A;  5ID2 B;  19GS A;  1GSQ A;  4XRD A;  3GKK A;  3LXZ A;  1XVW A;  1ILO A;  2L57 A;  3W6G A;  1ZMA A;  2VOC A;  3UAR A;  4OMV A;  5LCZ A;  4O5R A;  1U88 A;  4X43 A;  2VL9 A;  5AIX A;  1MD3 A;  1O73 A;  1Y6E A;  4OFN A;  2OAC A;  3P90 A;  3DEX A;  2IMD A;  3ERW A;  2JL4 A;  1ML6 A;  4I97 A;  5AIV A;  3RAZ A;  1H4O A;  2ZNM A;  2LRN A;  1JLW A;  2L6D A;  5A4V A;  5G5F A;  5DAK B;  2YP6 A;  1EP7 A;  4Q5F A;  1TOF A;  4GQF A;  3C1S A;  5ENU A;  2K18 A;  1OC9 A;  2PUK C;  3WT1 A;  1W89 A;  4HJ2 A;  5GSS A;  4GXZ A;  3C73 A;  2JZR A;  1GUM A;  4EE0 A;  3GSS A;  3HVV A;  3TKR A;  2FCH A;  4WBJ A;  4XS1 A;  3A2V A;  3Q18 A;  2KUC A;  1X9W B;  2I81 A;  1GNE A;  2JSZ A;  2IMF A;  3JCM L;  3LXT A;  1B9X C;  1TXX A;  4N30 A;  10GS A;  2HFD A;  4NV2 A;  2X49 A;  11GS A;  2L59 A;  4NPB A;  1S3C A;  4HDE A;  5H5R A;  3BJ5 A;  1SKW B;  5AGY A;  1Z6N A;  1XW9 A;  2ALB A;  1TI1 A;  2L4Q A;  2NPB A;  3UVT A;  4GST A;  1EV9 A;  5IO0 A;  1X0R A;  3KMO A;  4ZL8 A;  2HT9 A;  1FOV A;  2XPD A;  3GA4 A;  3GKX A;  1SL1 B;  1G7E A;  1SL0 B;  5JCU A;  4IGJ A;  5IIZ A;  1Z5Y E;  2JAC A;  4V1A g;  1GUK A;  1IYH A;  4LA1 A;  4K2X A;  2NTO A;  2VCV A;  3GL3 A;  1ERV A;  2R0P A;  3VWU A;  1GUL A;  1OC8 A;  2F9S A;  2GDR A;  4MJA A;  4MF6 A;  1SD9 A;  2CZ3 A;  4MP4 A;  1JZW A;  2DJK A;  4JRR A;  4GSN A;  1Y25 A;  4MPG A;  1UN2 A;  5IMV A;  1K3Y A;  3C1R A;  3DML A;  2YPM A;  2LQQ A;  4NWY A;  4E8E A;  3W8S A;  2V32 A;  1A0F A;  2LNT A;  1ZCP A;  4ZBA A;  3FEU A;  3U5R E;  2B1K A;  4CY8 A;  3QFA C;  1LU4 A;  1XXU A;  1PN9 A;  4PUR A;  1XW5 A;  3FK8 A;  5ABR A;  3RHC A;  2DKI A;  3S9F A;  2B5X A;  4ZL9 A;  1PGT A;  4IHU A;  1OC3 A;  4WXT A;  4Q5N A;  3HJM A;  1SK0 A;  4DSS B;  2GT5 A;  3VPQ A;  2HSH A;  1OE8 A;  5DJM A;  1WRY A;  3IE3 A;  2CQ9 A;  4L8E A;  3UIW A;  2HZE B;  3IBH A;  2A2S A;  2E7P A;  2HRK A;  4JBB A;  5KN3 A;  5H5Q A;  3PIN A;  5HR1 A;  2YN1 A;  22GS A;  3O76 A;  5F06 A;  3UOM A;  2XBQ A;  3CXG A;  3NIV A;  1T4Y A;  3L78 A;  3QDN A;  2VCW A;  3KD0 A;  1WP0 A;  4Z2U A;  3M8N A;  5BMU A;  2VD1 A;  2VCT A;  4X0X A;  2GSQ A;  1CQH A;  3EPT A;  2BJX A;  4PXO A;  4DVC A;  1VRS D;  4L0W A;  4HOJ A;  1ERU A;  2LUS A;  4EUY A;  2AAW A;  1K0B A;  2VL3 A;  1Z7P A;  1GSY A;  4I2T A;  1K0N A;  2CVK A;  4HEA 2;  1RQM A;  3U6V A;  1SJ6 A;  2GSS A;  5LNK e;  2AHE A;  2FWE A;  4BPY A;  4ICY A;  3RPN A;  1THX A;  4XS4 A;  4F03 A;  1MTC A;  1FOH A;  1O8X A;  1ON4 A;  1FB0 A;  1URM A;  3ZYW A;  1GTA A;  1U3A A;  4KGI A;  3QMX A;  1V57 A;  3HYP A;  3HXS A;  4ID0 A;  2J23 A;  1X5D A;  1AQW A;  1G0T A;  3FHK A;  1FHE A;  3FZ5 A;  1GTB A;  1F2E A;  3GUR A;  1WOU A;  3F6F A;  1SD8 A;  2RUF A;  3KIJ A;  1MDK A;  3L9S A;  5F05 A;  2YNX A;  4PNG A;  3GNJ A;  2IIY A;  2X8H A;  2LV3 A;  5H5S A;  4J2F A;  3UEM A;  1U3I A;  4Z2T A;  3TKS E;  2XBI A;  4KF9 A;  1ACV A;  2DBC A;  2B7J A;  3CSJ A;  3D4T A;  1SYR A;  3MYD A;  1TP9 A;  4IQ1 A;  1CQG A;  3G7Y A;  4CDO A;  3TKS C;  1GSD A;  1HNB A;  3PH9 A;  1T4Z A;  2LTK A;  1EOG A;  3DKS A;  4N11 A;  3GIX A;  3OR5 A;  1F6M C;  2H76 A;  3FR6 A;  2C8U A;  2V1M A;  2VLV A;  4WBR D;  2QC7 A;  3QFB C;  2PVQ A;  5HFK A;  4YKG A;  3UVH A;  1TI3 A;  4PUA A;  1F9M A;  3LQ7 A;  3KCM A;  5BRT A;  2DKH A;  1XPV A;  5JWO B;  3BCI A;  3F0I A;  1TJD A;  3KZQ A;  4MAB A;  3L9U A;  3D21 A;  1A23 A;  4V2M A;  2B3S A;  1BJX A;  3AY8 A;  1LBK A;  2YZH A;  3MAK A;  2ZCT A;  3TOT A;  2FWG A;  1YF1 A;  2MZC A;  4BL7 A;  1NSW A;  5B8B A;  2V2G A;  2N5B A;  2O85 A;  5J9C A;  2H72 A;  4CY6 A;  1O8W A;  3ZVJ D;  2VLT A;  3L4N A;  4K7O A;  2DLX A;  1OVN A;  4JZQ A;  4MK3 A;  1PX6 A;  3IAM 2;  2IFQ B;  3HVX A;  1ZZY A;  2LNS A;  3LJR A;  4MA9 A;  4K2D A;  4MJB A;  4AF2 A;  3CSI A;  5B6N A;  2FA4 A;  1V58 A;  4JR4 A;  4BVY B;  1XFL A;  1XOB A;  3EC3 A;  5IO2 A;  1AIU A;  3LYK A;  1K3L A;  2TRC P;  2VL2 C;  2P0G A;  2PN8 A;  2GST A;  3TKP A;  4KSM A;  1BX9 A;  1K0M A;  3IDV A;  2H1B A;  3VK9 A;  5D93 A;  1K0D A;  1TU8 A;  1HD2 A;  2EIR A;  3UBL A;  2EC4 A;  5CP1 A;  1JHB A;  3WD6 A;  5HR3 A;  5ECM B;  4ZXG A;  2RII A;  2DJ2 A;  3ZML A;  2HLS A;  3ED3 A;  4OFM A;  1J08 A;  1X5C A;  4K6X A;  3EU3 A;  2A4H A;  1V9W A;  1YKC A;  3LGC A;  14GS A;  1YEX A;  3FYG A;  4JU5 A;  4MZC A;  3GKN A;  1B4Q A;  3VI7 A;  2NBS A;  2G0F A;  4ML1 A;  2GZP A;  2H71 A;  4XRA A;  3GTU A;  4TW5 A;  3VLN A;  3VI5 A;  4DEJ A;  4XCS A;  5EL8 A;  1T3B A;  2YZU A;  2VCQ A;  3MNG A;  4V2L A;  5C04 A;  2GQK A;  3IK7 A;  1QMV A;  4FYB A;  1AUC A;  4USS A;  1M99 A;  4I5Q A;  3R3E A;  3GX0 A;  4N10 A;  3RPP A;  1FVK A;  1HNA A;  3ZIJ A;  1K0O A;  3D4M A;  4IN0 A;  1KTE A;  2MMO A;  3ZVJ A;  4V2N A;  2FHE A;  4L5L A;  1QGV A;  1M0U A;  1A8L A;  3TJJ A;  1FB6 A;  3I69 A;  3MWH A;  3O3T A;  5EVO A;  1PSQ A;  5ECH B;  4O5Q A;  3I6A A;  5KEJ A;  1NW2 A;  3C8E A;  1Z6M A;  1AXD A;  3F4R A;  6GSX A;  3IHQ A;  4KCE A;  3WYW A;  3TRQ A;  5FT3 A;  2MMZ A;  3FZ9 A;  1QUW A;  2VIM A;  4F9Z A;  1YKA A;  3QOU A;  4TR1 A;  2OAD A;  3M9J A;  2E0Q A;  1HYU A;  4KB3 A;  2JZS A;  2GS3 A;  2OJL A;  3US3 A;  2GQM A;  3LYP A;  4YKF A;  1M7T A;  3ZIT A;  4YH2 A;  4F2I A;  2RLI A;  13GS A;  1EWX A;  1GP1 A;  5ELA A;  1MD4 A;  1UC7 A;  2VAF A;  2VD0 A;  4KND A;  3UAP A;  5D73 A;  2CAQ A;  4IJI A;  2V6K A;  2CZ2 A;  1VGL A;  5G5E A;  2X4A A;  3FKF A;  5CRH A;  4ECC A;  4JR6 A;  5CRE A;  5CRW A;  3GRX A;  4ZB6 A;  3IRA A;  2PU9 C;  2V6O A;  2BTO T;  4O92 A;  3ZRE A;  3ZL5 A;  4MH3 A;  3MDK A;  2M72 A;  1O81 A;  4KCA A;  5G2Z A;  5KN1 A;  2OE0 A;  4YQU A;  4DSQ A;  4EXJ A;  3TCO A;  3F63 A;  3A5I A;  1X9M B;  1M2B A;  2MMA A;  2F8F A;  2IJY A;  2PWJ A;  2QA1 A;  4RI7 A;  1XOA A;  3MIX A;  3KTB A;  3HKR A;  1G6Y A;  5CAX A;  4IQA A;  2R4V A;  3A2X A;  5KN0 A;  3HCZ A;  4CHS A;  5IPH A;  2H0H A;  3EMP A;  1F37 A;  4GTU A;  2FLS A;  4OCF A;  4XHM A;  1PKZ A;  2X99 A;  4IKH A;  1ST9 A;  3FMW A;  4L5O A;  2G2Q A;  1YF0 A;  2D2Z A;  1ZYE A;  1TK0 B;  1EZK A;  3PR8 A;  2GSR A;  5ID2 A;  1U6T A;  2ON7 A;  3CMI A;  4TVE A;  4EC0 A;  2CT6 A;  2DJ3 A;  4K7N A;  3A5W A;  2A2R A;  5G30 A;  1G7O A;  4XTS A;  1YZX A;  2F3M A;  3M9K A;  2PBJ A;  3CRU A;  5LD0 A;  4BVX B;  1DUG A;  1TRU A;  4K1F A;  5G1L A;  1SYX A;  1Q4J A;  4HU7 A;  3DGQ A;  5B7C A;  2LST A;  5DAK A;  1ZYQ B;  1G6W A;  1Z7R A;  3Q6O A;  4PUF C;  4HUA A;  2VO4 A;  5KN2 A;  2TIR A;  3KJY A;  4MZW A;  2RUE A;  1ZYN A;  1BQ7 A;  3ERF A;  4GCI A;  4FYU A;  1WPI A;  3H79 A;  2H19 A;  2UZ8 A;  1K0A A;  4MJE A;  3G7I A;  4ULX A;  3TDG A;  4HZ2 A;  4HS1 A;  3LOR A;  2A2P A;  3RDW A;  1NHO A;  3CTG A;  3GMF A;  4EVM A;  2R0C A;  3GH6 A;  2AYT A;  4JED A;  2H8L A;  1DBY A;  1ERW A;  5J5N A;  2K9F A;  6GSY A;  3RHB A;  3DYR A;  2IME A;  3GX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...