2OE1A

Crystal structure of mitochondrial thioredoxin 3 from saccharomyces cerevisiae (reduced form)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
106
structure length
106
Chain Sequence
SSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin-3
publication title Structural and mechanistic analyses of yeast mitochondrial thioredoxin Trx3 reveal putative function of its additional cysteine residues
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 36
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2oe1A00
3UAPA 1EGRA 2P5RA 1TK5B 5G1LA 2X64A 2HXKA 2R5GA 2LV3A 1GUMA 1BX9A 4POLA 1SENA 1RQMA 3RHCA 5F05A 1E2YA 2C8UA 4WBJA 5HR1A 3CMIA 1X5EA 3HHVA 2H6YA 4KNDA 2JSZA 2HYXA 3MNGA 4POBA 5DDLA 2GGTA 4N0VA 4WF5A 2IFQA 4H86A 2GSRA 3ME8A 2FWHA 2DC5A 3FYGA 1XPVA 5IMCA 3HKRA 5DJLA 1TRSA 1YKCA 2H1BA 3L9UA 4BPYA 2V32A 2O89A 2CQ9A 3N9JA 3GSSA 3V1WA 2R6KA 3L78A 3QR6A 2VO4A 4IP6A 3QAGA 3GNJA 1ERUA 5AIXA 3M8NA 2IMEA 2H01A 2C1YA 4OFMA 5EL8A 4K9ZA 5GSTA 3BBYA 1XWGA 2VM1A 3QFBC 9GSSA 2TRXA 2EIOA 4HI7A 2AB6A 3P90A 4XHMA 3WGDA 3FRCA 1LJRA 3VLNA 2M72A 2X8CA 2RUEA 2YPMA 4DSSB 4EUYA 3APSA 3CXGA 4MF6A 4GXZA 4LMVA 2MZCA 2DJ1A 3F0IA 5INYA 3ZYWA 1F6MC 4NAXA 3LORA 3J7Yb 5D93A 2O7KA 5B8AA 4WXTA 1XOAA 1B48A 1B9XC 2HT9A 3CSIA 3GSTA 2V41A 3O3TA 3IXRA 3BOAA 3F6DA 4XS4A 1F9MA 2B6MA 3IA1A 4N10A 2YZUA 1LBKA 3UBKA 5ECSA 1U3IA 3MDKA 4XRAA 4FIWA 1XW9A 3LJRA 2Z9SA 1R5AA 3I43A 1W89A 2LTKA 1BQ7A 1GSYA 1NHOA 5F06A 3GA4A 4ECBA 4F82A 1OYJA 5IOWA 3ZRDA 3QFAC 2BTOT 2VLUA 3DEXA 20GSA 3NOFA 3KD0A 2ON5A 2RUFA 2YJ7A 4TW5A 1EZKA 5EY6A 1WPIA 2AV4A 2K9FA 1YJ6A 4TR1A 2E2GA 3QAWA 3EMXA 3CRUA 3GH9A 1X9MB 1FW1A 2HLSA 4MMMA 2C0DA 3ED3A 4TN8A 3GUSA 4HU7A 1OE8A 5ECOB 2BJXA 3AY8A 3TB2A 2H1GA 3WD6A 4HZ2A 1V58A 3EU4A 1Z5YE 2WFCA 2K18A 3IR4A 4I8BA 3IE3A 2DBCA 2KP2A 4MCUA 3UJ1A 4EVMA 4RQXA 4MLYA 5G1KA 3A2WA 4AF2A 2A2SA 2EC4A 2HE3A 3ZFLA 5LNKe 1FB6A 2C0GA 2N5BA 3CSJA 4D73B 2B5XA 2CX3A 4MF7A 1I9DA 4AJ8A 3VPQA 2H8LA 2IMKA 4FYUA 4RQRA 3HVVA 1N2AA 4LA1A 3TKSE 2EIRA 1OC9A 4HUAA 3KGKA 3H4KA 1SK0A 5IM9A 1BEDA 3IRAA 3VWWA 2IMDA 2RIIA 2N5FA 2M46A 2DSAA 1VGLA 4OFNA 1A2MA 1XWKA 5HFIA 3EVIA 5DALA 4NXIA 2I3YA 1GRXA 4NHZA 1G7OA 3TUEA 2KLXA 1KBNA 2RLIA 2QSIA 2DJKA 1FO5A 2VOCA 1SU9A 5JCWA 1NW2A 1FG4A 14GSA 2MBTA 3QPMA 3GURA 1T8EB 1AQXA 1TKDB 2WULA 2AHEA 2GQLA 2L6CA 4OWYA 2EIQA 1EWXA 3GKMA 4ACSA 5ABRA 11GSA 1XZOA 1XFLA 1F37A 4O5RA 2RM5A 3DIEA 2CVBA 4I97A 1Z6NA 1U3AA 3DMLA 2H71A 3ZTLA 3QCPA 1XXUA 4KSMA 3TJGA 1XW6A 1FHEA 5IMFA 4O92A 6GSVA 4HU9A 4JBBA 4KSOA 2H30A 2FUG2 1PL2A 2PWJA 3ERFA 4OCFA 4EE0A 1N8JA 2WCIA 3IK9A 2YJHA 2YOIA 2F3MA 5IMAA 1ZYEA 2PVQA 4ZB6A 3VPTA 5B7CA 3HVSA 4XIHA 5G30A 3IOSA 4MZBA 3DKSA 4DEJA 4RUVA 1TXXA 2C0EA 1JLWA 1QQ2A 3GFKA 1M9BA 2MBSA 2VUPA 2AAWA 3GMFA 3UL3A 3L9SA 2ZNMA 1M7TA 2YV7A 5FWGA 1K0BA 2B1KA 3R2QA 4HJ2A 1MD4A 4KDYA 5HFKA 1JZRA 4FH8A 2MYGA 3MWHA 5J9CA 4V2NA 4N0ZA 1O8WA 3SBCA 1T1VA 3EC3A 4HEA2 1XIYA 1U6TA 2H0IA 5DAKB 5HFGA 4ZB8A 4IQ1A 4ZL8A 3PH9A 1HNCA 4YAPA 1K3YA 4TXOB 1EP8A 1GTAA 4NPBA 3KXOA 3TKSA 4FO5A 3IHQA 5CAXA 2WJUA 5B6NA 2FLSA 1TTZA 2VCWA 6GSYA 3IC4A 4ZIJA 1ERWA 3VI5A 1OKDA 1A8YA 2VM2A 2LQOA 5CNWA 4BL7A 1YY7A 2D2ZA 3ERWA 7GSSA 2PGTA 1JFUA 4G10A 2VD0A 2JL4A 4V2LA 5D8IA 3PR8A 4CDOA 2HZEB 3D21A 3DD3A 2AUVA 1MDKA 1QGVA 5KN1A 3TJFA 5DJMA 1XCCA 3E9JB 4YQVA 1JZOA 1T4YA 3GTUA 1WWJA 3F8UA 3TOUA 2X99A 1ZCPA 1ERVA 1VRSD 2OA7A 3PGTA 2IWTA 2PMTA 5E4WA 4WBRD 4KCAA 4EKZA 5KEJA 3CTFA 22GSA 2VLVA 3DXBA 3Q19A 3BCIA 2VL2C 1ACVA 1HYUA 3ZZXA 5DBQA 1K0MA 3TGZA 3S9FA 3L4NA 2KHPA 4IN0A 1GLQA 2FA8A 1W4VA 4MZCA 4ML1A 1GWCA 4KGIA 3FY7A 3WGXA 2YCDA 1VF2A 2M80A 1TDIA 4I5QA 5ELGA 2PVOC 2NVLA 4YQUA 4PUFC 1WOUA 2DJ2A 4IKHA 4ULXA 5H5RA 4HQZA 3UARA 3JCML 3KTLA 2AYTA 1TRVA 3GYKA 3IAM2 5ECRB 6GSSA 4HQSA 4EDZA 1TP9A 1Q4JA 1ON4A 2VLTA 2F51A 2KP1A 2YANA 1GNEA 2YV9A 3GV1A 4J2FA 3TRPA 2LNSA 1KNGA 4HDEA 2AJQB 1SD9A 2FWGA 1GNWA 1A0FA 4KAEA 4GQCA 3TKRA 3A3TA 1SK1A 2CVKA 2H73A 3HY2A 1OVNA 1O73A 2X8GA 3GX8A 4K7NA 4TOPA 4GF0A 1SD8A 3ZREA 3EU3A 2L4CA 1WIKA 4I6XA 18GSA 4Q5RA 3DWVA 3VWVA 5ECHB 1GUKA 2GSTA 1GSFA 2WZ9A 3KIJA 4WETA 5A4UA 2CVDA 1GH2A 1SL1B 1UC7A 2IPAA 2GZYA 3DVWA 1XWAA 3NIVA 3RPNA 5FHIA 1HNBA 2J9HA 3ZVJD 4EC0A 5A4VA 1FVKA 4PNFA 2C3NA 1VF1A 2L6DA 2B3SA 2MMOA 4YAVA 3IAS2 3BD2A 1B9YC 4MZWA 1UVZA 2PERA 4LL4B 4O7HA 2JSYA 5ELAA 4EXJA 2GT6A 2MMNA 2PUKC 2YN1A 1SK2A 1SKRB 4HZ4A 2LUSA 1GP1A 2WDUA 1G6WA 2H0HA 3KMNA 1YEXA 3ZMLA 2V6KA 2H0GA 3C71A 5IMVA 2R37A 3HZ4A 4OMVA 1XWCA 3F3QA 4GSTA 4KB3A 3CRTA 4ZBDA 1NHYA 5C04A 2NTOA 3I6AA 3QOUA 2VAFA 1H4OA 2FD3A 5ECKB 5D96A 5D9WA 3GX0A 5ECNB 1XBSA 4GTUA 5E59A 19GSA 2YWMA 4DSQA 1J0FA 5D9TA 1K0AA 1JZWA 1K0DA 1EEMA 1Y6EA 4ZBAA 3W6GA 2C3QA 4AJ6A 4TR0A 2LEGA 4IJ3A 3QD9A 4F03A 2ZUPA 1K3OA 3HCZA 1OKTA 3H1NA 1FVJA 2H72A 1G6YA 4NV5A 1OC8A 4FYCA 4DSSA 1YF1A 4MPGA 2HRNA 4EF0A 2B1LA 2OBIA 3TJKA 1TI3A 2JU5A 1MEKA 2F9SA 2LRNA 2YWIA 4YH2A 2ALBA 5B8BA 2O8VB 1M9AA 2DJJA 4QL7A 1HD2A 3EYTA 5J9BA 1ZMAA 4WF4A 2JADA 5COHA 1GSSA 3RAZA 5HR3A 3UEMA 2RM6A 3MAKA 3KJYA 3TDGA 3VURA 1T00A 4K1FA 1DSBA 2CAIA 2B5EA 2LRCA 1EOGA 1ZOFA 2R2JA 2OADA 4K8MA 4O32A 1GSUA 4HOJA 1TRWA 2O87A 5ECIB 2LSTA 4ILFA 5DCHA 1YEPA 4WR5A 4JZQA 3SWLA 1GUHA 13GSA 2H66A 3VI7A 2XPDA 5CYYA 1I5GA 3EE2A 4MP4A 4JE1A 3UMAA 1QMVA 2BMXA 4P3YB 2MMAA 5J5NA 3IPZA 1ZYQB 3LEFA 2DIZA 1M2BA 3VK9A 2KOKA 4ECJA 4K6XA 1R4WA 1KTEA 1BJXA 3FHKA 3G7YA 1THXA 3FR6A 4E8EA 1WE0A 2R4VA 4TR4A 2VCVA 2O85A 1G0TA 1MD3A 2A2RA 2F8FA 3P2AA 4L0WA 2OE3A 5G5EA 2IIYA 5IMZA 1PSQA 2C80A 1O8XA 1WRYA 1Q98A 1V9WA 2GT5A 1CQHA 4TKYA 3Q74A 2J23A 4NWYA 3US3A 3F9UA 4LL1B 4CW9A 3EINA 1TU8A 2CV4A 4IQAA 2GVPA 4JU5A 4JEDA 1T4ZA 1XVWA 2C0FA 3FKFA 3OR5A 5ENUA 1ABAA 5A4WA 4IS0A 4J56E 2FCHA 4D73A 5ECPB 2H1AA 1S3CA 3TOTA 5CRGA 1TRUA 4ZL9A 2VIMA 3APQA 3KH7A 2IN3A 1AW9A 3GIXA 2DJ3A 5A5KA 6GSWA 2DLXA 5IMDA 3C73A 4XS6A 1GTUA 5B6MA 1AQWA 1XW5A 5AISA 2FNOA 1Z7PA 5HR2A 1AUCA 3D0ZA 1PKZA 3TRQA 3FR3A 4HJMA 5AN1A 3C7MA 1XVQA 3LYPA 3U6VA 2HSYA 1MTCA 4MJEA 1E6BA 3FR9A 3F63A 1OE7A 1EGOA 3DVXA 1X9WB 1GSEA 3G9BA 3IDVA 3Q18A 2E0QA 1Z7RA 3H93A 2HZFA 5IPGA 3NZNA 4DSRA 3ZFBA 3HJOA 3ZL5A 1HQOA 3A5WA 4V1Ag 3GKNA 3E0UA 1K0NA 3UOMA 1GTBA 5C00A 2G2QA 3LYKA 1TW9A 5EPFA 3FZAA 2LJAA 4K0GA 3MSZA 4IELA 2YP6A 5KN2A 3TKPA 2P31A 5KN0A 3ZITA 1IYIA 4MH2A 3FW2A 4PNGA 4TXVA 1SYRA 2GQMA 4GRFA 3HA9A 5ECMB 4I2UA 4G9HA 1RK4A 3QAVA 2B7JA 4OFTA 3N5OA 3EWLA 3D5JA 4N30A 5D9VA 1EP7A 4IP1A 4POMA 2OKAA 1M99A 3HJPA 5CRDA 1JHBA 4AJ7A 1PRXA 3U5RE 5KN3A 4F0BA 1QXHA 4G2EA 1F2EA 1A24A 4X1UA 2GSSA 5CRWA 3GH6A 1VF3A 4KX4A 3IBHA 3G7JA 1DBYA 5EVOA 2CX4A 2XBQA 4I2TA 4L0UA 3HVXA 1A2LA 4IW9A 2VCQA 3DGQA 4F9ZA 2VCXA 1Y25A 2IJYA 5DAKA 3FZ5A 5ID2A 3LSZA 6GSTA 4Q5QA 3RPPA 1NSWA 4TXOA 3DRNA 2IFQB 2GZPA 4J57E 1SYXA 5IPHA 3UVHA 1ERTA 1X5CA 3LWAA 4GCIA 1AQVA 4KE3A 16GSA 2VL9A 5F8BA 3KEBA 2FGXA 2C3TA 5GZZB 3D6IA 1MDJA 4PURA 2L4QA 2REMA 2H74A 3H8QA 3KP8A 4JR6A 1GULA 2XPEA 4ECIA 1ILOA 1FAAA 2HZEA 2WGRA 3F4SA 3W8JA 1AAZA 5LCZA 1V40A 1A23A 2GQKA 1TI1A 1ZZYA 3M3MA 2B5YA 3ME7A 2IL3A 3CBUA 4PQHA 2CT6A 3WGEA 2ON7A 5J3RA 5H5SA 2OE0A 1BYEA 1PN9A 1FB0A 1M2AA 4NHWA 3EMPA 4KDUA 4XTSA 4IVFA 3G7IA 2X8HA 5H5QA 3QDNA 1IYHA 2P5QA 3WT1A 1F3AA 2I81A 3CSHA 2JZTA 3LXTA 2H76A 4ID0A 4JRRA 4XS4B 4F0CA 2LJKA 3RHBA 3KTBA 1O85A 3W8SA 5GAND 5J4UA 2L57A 5GSSA 3GL5A 3VWUA 12GSA 4YQMA 2FA4A 4ZL7A 3KCMA 3I69A 5D9XA 3LQ7A 4WKWA 1TK8B 2ES7A 3M9JA 4JR4A 2YNXA 3EURA 3LXZA 1QFNA 5DQSA 3F4TA 4KDXA 1YQ1A 2I1UA 4MJCA 2DMLA 2XBIA 4NV2A 4LLRA 3M0FA 2L5OA 2LQQA 3LFLA 2E2MA 3GKXA 1SKSB 4F2IA 2OACA 1AC1A 4KUNA 1DE2A 4TR1B 5HQPA 4MH3A 5G5FA 3HDCA 2DIYA 1O7UA 3QMXA 4KH7A 4GLTA 5CRHA 1OC3A 1Z6MA 3ZMKA 2H1DA 1SL0B 4TRXA 3ZVJA 3CTGA 3APOA 2YWNA 4OO4A 5FT3A 4GQFA 2VL2A 2H6ZA 2VL3A 2HFDA 5ECQB 2R3XA 4PQIA 1O81A 1X0RA 2H19A 5AGYA 1EEJA 1BAYA 3F3RA 1YDKA 3PINA 2PPTA 2GS3A 4X0XA 5G31A 3BCKA 1J9BA 2H75A 4MF5A 2OE1A 1F3BA 4ZILA 1SJIA 2XC2A 2WB9A 2FY6A 5IIZA 1K3LA 1PX6A 1NM3A 2QGVA 1H75A 2VCZA 4WR4A 1OC9B 5AIVA 4PX1A 1U88A 2JACA 3C1SA 4EDYA 1USBA 1XWBA 2HSHA 5D73A 2FHEA 3VFIA 5DALB 5G2ZA 3K8NA 4OO5A 1YF0A 1K0OA 3VWXA 1SJZA 1EV9A 5GAPD 2I4AA 1PA3A 5F0GA 1YKAA 17GSA 2GLRA 3FZ4A 4IHUA 6GSXA 4X43A 1K0CA 3ZIVA 2WRTA 1UN2A 1URMA 5IQYA 3TJBA 3D4TA 1TJDA 4GSNA 4PQ1A 2NPBA 3HXSA 3UBLA 4AGSA 1EOHA 1S3DA 1Z9HA 2LNTA 3LGCA 1U87A 4Q5NA 5IO0A 1GTIA 3O76A 1R5PA 2K6VA 3ZLPA 4G19A 3ISOA 2A4VA 2F8AA 5JWQB 1AXDA 2MMZA 2TRCP 3M9KA 3HJMA 4BVXA 4BWSA 2CZ2A 1T3BA 2H6XA 1SJ6A 1WP0A 5CREA 1CQGA 3L9VA 3TKSC 4K2DA 2HI7A 1UA5A 2GSQA 3HZ8A 4L5LA 4ECCA 2WS2A 2ZCTA 4ISDA 5JCGA 1A2JA 1GL8A 2LRTA 2PU9C 3IV4A 1ST9A 4RI6A 1B8XA 1C72A 2HRFA 2YWOA 1TK0B 2HNLA 4TVEA 5CP1A 3TJJA 1A0RP 4IBPA 5JWRB 3TRXA 3HD5A 1BG5A 3Q6OA 1V98A 2XHFA 1X9SB 4K7IA 4IJIA 1WMJA 4HS1A 3UVTA 3DYRA 1DE1A 4Z7XA 1B4PA 4E8HA 4XS1A 1Z3EA 3P8WA 3F4RA 2GZZA 4GWRA 2DJ0A 3GKKA 4MABA 4MPFA 2V2GA 4BVYA 1THOA 4CHSA 1ML6A 3H79A 2FWEA 2OBKA 3GL3A 1WJKA 1VF4A 1HNAA 2GTUA 1R7HA 4EO3A 2JZSA 2L59A 3FEUA 5DCGA 4PGTA 1PX7A 1G7EA 3L0HA 1V2AA 4OCEA 5IO2A 2CA8A 4TR3A 1PGTA 1PKWA 2VD1A 4QQ7A 4L8EA 4MDCA 5F07A 1SKWB 3J7Yk 3A2VA 1RW1A 3E3EA 5ECLB 1GSQA 3GHAA 2I9HA 2LKUA 3KMOA 3FZ9A 4GSSA 1PMTA 5IOXA 2E7PA 4QL9A 1QUWA 3WT2A 4BA7A 2V6OA 2K8SA 4MK3A 2JZRA 2OJLA 4OD7A 1GSDA 4IGJA 2IMFA 4ZXGA 2C4JA 3GRXA 1JLVA 2NBSA 3CYNA 3GTUB 1X5DA 1YZXA 1V57A 1ZGNA 1SL2B 1JZDA 2DMMA 5J41A 4MA9A 1AIUA 4L5OA 3I9V2 1PQNA 2PBJA 3TCOA 1B4QA 5JCUA 5ID2B 4KA0A 4POKA 5HR0A 1QK8A 2GDRA 1M0UA 2NDOA 3RBTA 1J08A 2G0FA 4ML6A 1MDIA 1ZL9A 1PL1A 4N11A 4EL1A 2KUCA 1GLPA 4LMWA 2K8VA 2V1MA 3WYWA 4ZB9A 3M1GA 10GSA 3RDWA 3KM6A 4V1Ap 2CZ3A 3D4MA 2VCTA 5CO3A 3TKQA 5L71A 4K0NA 3C8EA 4RI7A 4KW6A 4DVCA 8GSSA 3HYPA 1M2DA 4MJBA 5JWOB 4NMUA 4FYBA 1XOBA 1O6JA 1T7PB 3A2XA 1EV4A 2H70A 2P0GA 4BWQA 2TIRA 4XRDA 1A8LA 3KP9A 2FWFA 2LJRA 3BJ5A 2LS5A 4PUAA 3C1RA 3FK8A 1DUGA 3ZIJA 5DVBA 4MJAA 1R26A 4V2MA 4Q5FA 2YZHA 2IMIA 3GN3A 2N5AA 3UIWA 3KZQA 5DQYA 4PXOA 1FOVA 5LD0A 2QC7A 3ERGA 1OAZA 2CAQA 2B7KA 3IK7A 4WEYA 4XCSA 4K7OA 6GSUA 3LG6A 1PD21 3KH9A 3D22A 2QKEA 2PN8A 3O6TA 1LU4A 4ZBBA 4KCEA 2L5LA 1TOFA 1KEBA 3F6FA 3P7XA 1TU7A 1S3AA
chains in the Genus database with same CATH superfamily
3UAPA 1EGRA 2P5RA 1TK5B 5G1LA 2X64A 2HXKA 2R5GA 2LV3A 1GUMA 1BX9A 1XG8A 4POLA 1SENA 1RQMA 3RHCA 5F05A 1E2YA 2C8UA 4WBJA 5HR1A 3CMIA 1X5EA 3HHVA 2H6YA 4KNDA 2JSZA 2HYXA 3MNGA 4POBA 3IC8A 5DDLA 2GGTA 4N0VA 4WF5A 2IFQA 4H86A 2GSRA 3ME8A 2FWHA 2DC5A 3FYGA 1XPVA 5IMCA 3HKRA 5DJLA 1TRSA 1YKCA 2H1BA 3L9UA 4BPYA 2V32A 2O89A 2CQ9A 3N9JA 2HRKA 3GSSA 3V1WA 2R6KA 3L78A 3QR6A 2VO4A 4IP6A 3QAGA 3GNJA 1ERUA 5AIXA 3M8NA 2IMEA 4G0IA 2QA2A 2H01A 2C1YA 4OFMA 5EL8A 4K9ZA 5GSTA 3BBYA 1XWGA 2VM1A 3QFBC 9GSSA 2QA1A 2TRXA 2EIOA 4HI7A 2AB6A 3P90A 4XHMA 3WGDA 3FRCA 1LJRA 3VLNA 2M72A 2X8CA 2RUEA 2R0GA 2YPMA 4DSSB 4EUYA 3APSA 3CXGA 4MF6A 4GXZA 4LMVA 2MZCA 2DJ1A 3F0IA 5INYA 3ZYWA 1F6MC 4NAXA 3LORA 3J7Yb 5D93A 2O7KA 5B8AA 4WXTA 1XOAA 1B48A 1B9XC 2HT9A 3CSIA 3GSTA 2V41A 3O3TA 3IXRA 3BOAA 3F6DA 4XS4A 1F9MA 2B6MA 3IA1A 4N10A 2YZUA 1LBKA 3UBKA 5ECSA 1U3IA 3MDKA 4XRAA 4FIWA 1XW9A 3LJRA 2Z9SA 1R5AA 3I43A 1W89A 2LTKA 1BQ7A 1GSYA 4K2XA 1NHOA 4PTSA 5F06A 3GA4A 4ECBA 4F82A 1OYJA 5IOWA 3ZRDA 3QFAC 2BTOT 2VLUA 3DEXA 20GSA 3NOFA 3KD0A 2ON5A 2RUFA 2YJ7A 4TW5A 1EZKA 5EY6A 1WPIA 2AV4A 2K9FA 1YJ6A 4TR1A 2E2GA 3QAWA 3EMXA 3CRUA 3GH9A 1X9MB 1FW1A 2HLSA 4MMMA 2C0DA 3ED3A 4TN8A 3GUSA 4HU7A 1OE8A 5ECOB 2BJXA 3AY8A 3TB2A 2H1GA 3WD6A 4HZ2A 1V58A 3EU4A 1Z5YE 2WFCA 2K18A 3IR4A 4I8BA 3IE3A 2DBCA 2KP2A 4MCUA 3UJ1A 4EVMA 4RQXA 4MLYA 5G1KA 3A2WA 4AF2A 2A2SA 2EC4A 2HE3A 3ZFLA 5LNKe 4Z2RA 1FB6A 2C0GA 2N5BA 3CSJA 4D73B 2B5XA 2CX3A 2DKHA 4MF7A 1I9DA 4AJ8A 3VPQA 2H8LA 2IMKA 1S3RA 4FYUA 4RQRA 3HVVA 1N2AA 4LA1A 3TKSE 2EIRA 1OC9A 4HUAA 3KGKA 4CY8A 3H4KA 1SK0A 1ZYNA 5IM9A 1BEDA 3IRAA 3VWWA 2IMDA 2RIIA 2N5FA 2M46A 2DSAA 1VGLA 4OFNA 1A2MA 1XWKA 5HFIA 3EVIA 5DALA 4NXIA 2I3YA 1GRXA 4NHZA 1G7OA 3TUEA 2KLXA 1KBNA 2RLIA 2QSIA 2DJKA 1FO5A 2VOCA 1SU9A 5JCWA 1NW2A 1FG4A 14GSA 2MBTA 3QPMA 3GURA 1T8EB 5BRTA 1AQXA 1TKDB 2WULA 2AHEA 2GQLA 2L6CA 4OWYA 2EIQA 1EWXA 3GKMA 4ACSA 5ABRA 11GSA 1XZOA 1XFLA 1F37A 4O5RA 2RM5A 3DIEA 2CVBA 4I97A 1Z6NA 1U3AA 3DMLA 2H71A 3ZTLA 3QCPA 1XXUA 4KSMA 3TJGA 1XW6A 1FHEA 5IMFA 4O92A 6GSVA 4HU9A 4JBBA 4KSOA 2H30A 4EIQA 4FQUA 2FUG2 4KF9A 1PL2A 2PWJA 3ERFA 4OCFA 4EE0A 1N8JA 2WCIA 3IK9A 2YJHA 2YOIA 2F3MA 5IMAA 1ZYEA 2PVQA 4K5SA 4ZB6A 4O5UA 3VPTA 5B7CA 3HVSA 4XIHA 5G30A 3IOSA 4MZBA 3DKSA 4DEJA 4RUVA 1TXXA 2C0EA 1JLWA 1QQ2A 3IHGA 3GFKA 1M9BA 2MBSA 2VUPA 2AAWA 3GMFA 3UL3A 3L9SA 3EPTA 2ZNMA 1M7TA 2YV7A 5FWGA 1K0BA 2B1KA 3R2QA 4HJ2A 1MD4A 4KDYA 5HFKA 1JZRA 4FH8A 2MYGA 3MWHA 5J9CA 4V2NA 4N0ZA 1O8WA 3SBCA 1T1VA 3EC3A 4HEA2 1XIYA 1U6TA 2H0IA 5DAKB 5HFGA 4ZB8A 4IQ1A 4ZL8A 3PH9A 1HNCA 4YAPA 1K3YA 4TXOB 1EP8A 1GTAA 4NPBA 3KXOA 3TKSA 4FO5A 3IHQA 5CAXA 2WJUA 5B6NA 2FLSA 1TTZA 2VCWA 6GSYA 3IC4A 4ZIJA 1ERWA 3VI5A 1OKDA 1A8YA 2VM2A 2LQOA 5CNWA 4BL7A 1YY7A 2D2ZA 3ERWA 7GSSA 2PGTA 1JFUA 4G10A 2VD0A 2JL4A 4V2LA 5D8IA 3PR8A 4CDOA 2HZEB 3D21A 3DD3A 2AUVA 1MDKA 1QGVA 4USSA 5KN1A 3TJFA 5DJMA 1XCCA 3E9JB 4YQVA 1JZOA 1T4YA 3GTUA 1WWJA 3F8UA 4A5PA 4O5QA 3TOUA 2X99A 1ZCPA 1ERVA 1VRSD 2OA7A 3PGTA 2IWTA 2PMTA 5E4WA 4WBRD 4KCAA 4EKZA 5KEJA 3CTFA 22GSA 2VLVA 3DXBA 3Q19A 3BCIA 2VL2C 1ACVA 1HYUA 3ZZXA 5DBQA 1K0MA 3TGZA 3S9FA 3L4NA 2KHPA 4IN0A 1GLQA 2FA8A 1W4VA 4MZCA 4ML1A 1GWCA 4KGIA 3FY7A 3WGXA 2YCDA 1VF2A 2M80A 1TDIA 4I5QA 5ELGA 2PVOC 2NVLA 4YQUA 4PUFC 1WOUA 2DJ2A 4IKHA 4ULXA 5H5RA 4HQZA 3UARA 3JCML 3KTLA 2AYTA 1TRVA 3GYKA 3IAM2 5ECRB 6GSSA 4HQSA 4EDZA 1TP9A 1Q4JA 1ON4A 2VLTA 2F51A 2KP1A 2YANA 1GNEA 2YV9A 3GV1A 4J2FA 3TRPA 2LNSA 1KNGA 4HDEA 2AJQB 1SD9A 2FWGA 1GNWA 1A0FA 4KAEA 4GQCA 3TKRA 3A3TA 1SK1A 2CVKA 2H73A 3HY2A 1OVNA 1O73A 2X8GA 3GX8A 4K7NA 4TOPA 4ICYA 4GF0A 1SD8A 3ZREA 3EU3A 2L4CA 1WIKA 4I6XA 18GSA 4Q5RA 3DWVA 3VWVA 5ECHB 1GUKA 2GSTA 1GSFA 2WZ9A 3KIJA 4WETA 5A4UA 2CVDA 1GH2A 1SL1B 1UC7A 2IPAA 2GZYA 3DVWA 1XWAA 3NIVA 3RPNA 5FHIA 1HNBA 2J9HA 3ZVJD 4EC0A 5A4VA 1FVKA 4PNFA 2C3NA 1VF1A 3CQFA 3R3EA 2L6DA 2B3SA 2MMOA 4YAVA 3IAS2 3BD2A 1B9YC 4MZWA 1UVZA 2PERA 4LL4B 4O7HA 2JSYA 5ELAA 4EXJA 2GT6A 2MMNA 2PUKC 2YN1A 1SK2A 1SKRB 4HZ4A 2LUSA 1GP1A 2WDUA 1G6WA 2H0HA 3KMNA 1YEXA 3ZMLA 2V6KA 2H0GA 3C71A 5IMVA 2R37A 3HZ4A 4OMVA 1XWCA 3F3QA 4GSTA 4KB3A 3A5IA 3CRTA 4ZBDA 1NHYA 5C04A 2NTOA 3I6AA 3QOUA 2VAFA 1H4OA 2FD3A 5ECKB 5D96A 5D9WA 3GX0A 2R0PA 5ECNB 1XBSA 4GTUA 5E59A 19GSA 2YWMA 4DSQA 1J0FA 5D9TA 1K0AA 1JZWA 1K0DA 1EEMA 1Y6EA 4ZBAA 3W6GA 2C3QA 4AJ6A 4TR0A 2LEGA 4IJ3A 3QD9A 4F03A 2ZUPA 1K3OA 3HCZA 1OKTA 3H1NA 1FVJA 2H72A 1G6YA 2DKIA 4NV5A 1OC8A 4FYCA 4DSSA 1YF1A 4MPGA 2HRNA 4EF0A 2B1LA 2OBIA 3TJKA 4BVXB 1TI3A 2JU5A 1MEKA 2F9SA 2LRNA 2X49A 2YWIA 4YH2A 2ALBA 5B8BA 2O8VB 1M9AA 2DJJA 4QL7A 1HD2A 3EYTA 5J9BA 1ZMAA 4WF4A 2JADA 5COHA 1GSSA 3RAZA 5HR3A 3UEMA 2RM6A 4Z2TA 3MAKA 3KJYA 3TDGA 3VURA 1T00A 4K1FA 1DSBA 2CAIA 2B5EA 2LRCA 1EOGA 1ZOFA 2R2JA 2OADA 4K8MA 4O32A 1GSUA 4HOJA 1TRWA 2O87A 5ECIB 2LSTA 4ILFA 2A2PA 5DCHA 1YEPA 4HSCX 4WR5A 4JZQA 3SWLA 1GUHA 13GSA 2H66A 3VI7A 2XPDA 5CYYA 1I5GA 4JE1A 4MP4A 3EE2A 3UMAA 1QMVA 2BMXA 4P3YB 2MMAA 5J5NA 3IPZA 1ZYQB 4BVYB 3LEFA 2DIZA 1M2BA 3VK9A 2KOKA 4ECJA 4K6XA 1R4WA 1KTEA 1BJXA 3FHKA 3G7YA 1THXA 3FR6A 4E8EA 1WE0A 2R4VA 4TR4A 2VCVA 2O85A 1G0TA 1MD3A 2A2RA 2F8FA 1M3JA 3P2AA 4L0WA 2OE3A 5G5EA 2IIYA 5IMZA 1PSQA 2C80A 1O8XA 2R0CA 1WRYA 1Q98A 1V9WA 2GT5A 1CQHA 4TKYA 3Q74A 2J23A 4NWYA 3US3A 3F9UA 4LL1B 4CW9A 3EINA 1TU8A 2CV4A 4IQAA 2GVPA 4JU5A 4JEDA 1T4ZA 1XVWA 2C0FA 5BMUA 3FKFA 3OR5A 5ENUA 1ABAA 5A4WA 4IS0A 4J56E 2FCHA 4D73A 5ECPB 2H1AA 1S3CA 3TOTA 5CRGA 2HRAA 1TRUA 4ZL9A 2VIMA 3APQA 3KH7A 2IN3A 1AW9A 3GIXA 2DJ3A 5A5KA 6GSWA 2DLXA 5IMDA 3C73A 4XS6A 1GTUA 5B6MA 1AQWA 1XW5A 5AISA 2FNOA 1Z7PA 5HR2A 1AUCA 3D0ZA 1PKZA 3TRQA 3FR3A 4HJMA 5AN1A 3C7MA 1XVQA 3LYPA 3U6VA 2HSYA 1MTCA 4MJEA 1E6BA 3FR9A 3F63A 1OE7A 1EGOA 3DVXA 1X9WB 1GSEA 3G9BA 3IDVA 3Q18A 2E0QA 1Z7RA 3H93A 2HZFA 5IPGA 3NZNA 4DSRA 3ZFBA 3HJOA 3ZL5A 1HQOA 3A5WA 4V1Ag 3GKNA 3E0UA 1K0NA 3UOMA 1GTBA 5C00A 2G2QA 3LYKA 1TW9A 5EPFA 3FZAA 2LJAA 4K0GA 3MSZA 4IELA 2YP6A 5KN2A 3TKPA 2P31A 5KN0A 3ZITA 1IYIA 4MH2A 3FW2A 4PNGA 4TXVA 1SYRA 2GQMA 4GRFA 3HA9A 5ECMB 1PN0A 4I2UA 4G9HA 1RK4A 3QAVA 2B7JA 4OFTA 3N5OA 3EWLA 3D5JA 4N30A 5D9VA 1EP7A 4IP1A 4POMA 2OKAA 1M99A 3HJPA 5CRDA 1JHBA 4AJ7A 1PRXA 3U5RE 5KN3A 4F0BA 1QXHA 4G2EA 1F2EA 1A24A 4X1UA 2GSSA 5CRWA 3GH6A 1VF3A 4KX4A 3IBHA 3G7JA 1DBYA 5EVOA 2CX4A 2XBQA 4I2TA 4L0UA 3HVXA 1A2LA 4IW9A 2VCQA 3DGQA 4BIKA 4F9ZA 2VCXA 1Y25A 2IJYA 5DAKA 3FZ5A 5ID2A 3LSZA 6GSTA 4Q5QA 3RPPA 1NSWA 4TXOA 3DRNA 2IFQB 2GZPA 4J57E 1SYXA 5IPHA 3UVHA 1ERTA 1X5CA 3LWAA 4GCIA 1AQVA 4KE3A 16GSA 2VL9A 5F8BA 3KEBA 2FGXA 2C3TA 5GZZB 3D6IA 1MDJA 4PURA 2L4QA 2REMA 2H74A 3H8QA 3KP8A 4JR6A 1GULA 2XPEA 4ECIA 1ILOA 1FAAA 2HZEA 2WGRA 3F4SA 2A4HA 3W8JA 1AAZA 5LCZA 1V40A 1A23A 2GQKA 1TI1A 1ZZYA 3M3MA 2B5YA 3ME7A 2IL3A 3CBUA 4PQHA 2CT6A 3WGEA 2ON7A 5J3RA 5H5SA 2OE0A 1BYEA 1PN9A 1FB0A 1M2AA 4NHWA 2HSMA 3EMPA 4KDUA 4XTSA 4IVFA 3G7IA 2X8HA 5H5QA 3QDNA 1IYHA 2P5QA 3WT1A 1F3AA 2I81A 3CSHA 2JZTA 3LXTA 2H76A 4ID0A 4JRRA 4XS4B 4F0CA 2LJKA 3RHBA 1PFOA 3KTBA 1FOHA 3PPUA 1O85A 3W8SA 5GAND 5J4UA 2L57A 5GSSA 3GL5A 3VWUA 12GSA 4YQMA 2FA4A 4ZL7A 3KCMA 3I69A 5D9XA 3LQ7A 4WKWA 1TK8B 2ES7A 3M9JA 4JR4A 2YNXA 3EURA 3LXZA 1QFNA 5DQSA 3F4TA 4KDXA 1YQ1A 2I1UA 4MJCA 2DMLA 2XBIA 4NV2A 4LLRA 3M0FA 2L5OA 2LQQA 3LFLA 2E2MA 3GKXA 1SKSB 4YKGA 4F2IA 2OACA 1AC1A 4KUNA 1DE2A 4TR1B 5HQPA 4MH3A 5G5FA 3HDCA 2DIYA 4G0KA 1O7UA 3QMXA 4KH7A 4GLTA 5CRHA 1OC3A 1Z6MA 3ZMKA 2H1DA 1SL0B 4TRXA 3ZVJA 3CTGA 3APOA 2YWNA 4OO4A 5FT3A 4GQFA 2VL2A 2H6ZA 2VL3A 2HFDA 5ECQB 2R3XA 4PQIA 1O81A 1X0RA 2H19A 5AGYA 1EEJA 1BAYA 4CY6A 3F3RA 1YDKA 3PINA 2PPTA 2GS3A 4X0XA 5G31A 3BCKA 1J9BA 2H75A 4G0LA 4MF5A 2OE1A 1F3BA 4ZILA 1SJIA 2XC2A 2WB9A 2FY6A 5IIZA 1K3LA 1PX6A 1NM3A 2QGVA 1H75A 2VCZA 4WR4A 1OC9B 5AIVA 4PX1A 1U88A 2JACA 3C1SA 4EDYA 1USBA 1XWBA 2HSHA 5D73A 2FHEA 3VFIA 5DALB 5G2ZA 3K8NA 4OO5A 1YF0A 1K0OA 3VWXA 1SJZA 1EV9A 5GAPD 2I4AA 1PA3A 5F0GA 1YKAA 17GSA 2GLRA 3FZ4A 4IHUA 6GSXA 4X43A 1K0CA 3ZIVA 2WRTA 1UN2A 1URMA 5IQYA 3TJBA 3D4TA 1TJDA 4GSNA 4PQ1A 2NPBA 1M3IA 3HXSA 3UBLA 4AGSA 1EOHA 1S3DA 1Z9HA 2LNTA 3LGCA 1U87A 4Q5NA 5IO0A 1GTIA 3O76A 2X4AA 1R5PA 2K6VA 4X4JA 3ZLPA 4G19A 3ISOA 2A4VA 2F8AA 5JWQB 1AXDA 2MMZA 2TRCP 3M9KA 3HJMA 4BVXA 4BWSA 2CZ2A 1T3BA 2H6XA 1SJ6A 1WP0A 5CREA 1CQGA 3L9VA 3TKSC 4K2DA 2HI7A 1UA5A 2GSQA 3HZ8A 4L5LA 4ECCA 2WS2A 2ZCTA 4ISDA 5JCGA 1A2JA 1GL8A 2LRTA 2PU9C 3IV4A 1ST9A 4RI6A 1B8XA 1C72A 2HRFA 2YWOA 1TK0B 2HNLA 4TVEA 5CP1A 3TJJA 1A0RP 4IBPA 5JWRB 3TRXA 3HD5A 1BG5A 3Q6OA 1V98A 2XHFA 1X9SB 4K7IA 4IJIA 1ZYPA 1WMJA 4HS1A 3UVTA 3DYRA 1DE1A 4Z7XA 1B4PA 4E8HA 4XS1A 4Z2UA 1Z3EA 3P8WA 3F4RA 2GZZA 4GWRA 2DJ0A 3GKKA 4MABA 4MPFA 2V2GA 4BVYA 1THOA 4CHSA 1ML6A 3H79A 2FWEA 2OBKA 3GL3A 1WJKA 1VF4A 1HNAA 2GTUA 1R7HA 4EO3A 2JZSA 4YKFA 4K5RA 2L59A 3FEUA 5DCGA 4PGTA 1PX7A 1G7EA 3L0HA 1V2AA 4OCEA 5IO2A 2CA8A 4TR3A 1PGTA 1PKWA 3FMWA 2VD1A 4QQ7A 4L8EA 4MDCA 5F07A 1SKWB 3J7Yk 3A2VA 1RW1A 3E3EA 5ECLB 1GSQA 3GHAA 2I9HA 4MNNA 3HVNA 2LKUA 3KMOA 3FZ9A 4GSSA 4BL7B 1PMTA 5IOXA 2E7PA 4QL9A 1QUWA 3WT2A 4BA7A 2V6OA 3MIXA 2K8SA 4MK3A 2JZRA 2OJLA 4OD7A 1GSDA 4IGJA 2IMFA 4ZXGA 2C4JA 3GRXA 1JLVA 2NBSA 3CYNA 3GTUB 1X5DA 1YZXA 1V57A 1ZGNA 1SL2B 1JZDA 2DMMA 5J41A 4MA9A 1AIUA 4L5OA 3I9V2 1PQNA 2PBJA 3TCOA 1B4QA 5JCUA 5ID2B 4KA0A 5KOWA 4POKA 5HR0A 1QK8A 2GDRA 1M0UA 2NDOA 3RBTA 1J08A 2G0FA 4ML6A 1MDIA 1ZL9A 1PL1A 4N11A 4EL1A 2KUCA 1GLPA 4LMWA 2K8VA 2V1MA 3WYWA 4ZB9A 3M1GA 10GSA 3RDWA 3KM6A 4V1Ap 2CZ3A 3D4MA 2VCTA 5CO3A 3TKQA 5L71A 4K0NA 3C8EA 4RI7A 4KW6A 4DVCA 8GSSA 3HYPA 1M2DA 4MJBA 5JWOB 4NMUA 4FYBA 1XOBA 1O6JA 4EIPA 3A2XA 1T7PB 1EV4A 2H70A 2P0GA 4BWQA 2TIRA 4XRDA 1A8LA 3KP9A 3LW9A 2FWFA 2LJRA 3BJ5A 2LS5A 4PUAA 3C1RA 3FK8A 1DUGA 3ZIJA 5DVBA 4MJAA 1R26A 4V2MA 4Q5FA 2YZHA 2IMIA 3GN3A 2N5AA 3UIWA 3KZQA 5DQYA 4PXOA 1FOVA 5LD0A 2QC7A 3ERGA 1OAZA 5KOXA 2CAQA 2B7KA 3IK7A 2UZ8A 4WEYA 4XCSA 4K7OA 6GSUA 3LG6A 1PD21 3KH9A 3D22A 2QKEA 2PN8A 3O6TA 1LU4A 4ZBBA 4KCEA 3MYDA 2L5LA 1TOFA 1KEBA 3F6FA 3P7XA 1TU7A 1S3AA
chains in the Genus database with same CATH topology
3UAPA 1EGRA 2P5RA 1TK5B 5G1LA 2X64A 2HXKA 2R5GA 2LV3A 1GUMA 1BX9A 4POLA 1SENA 1RQMA 3RHCA 5F05A 1E2YA 2C8UA 4WBJA 5HR1A 3CMIA 1X5EA 3HHVA 2H6YA 4KNDA 2JSZA 2HYXA 3MNGA 4POBA 3IC8A 5DDLA 2GGTA 4N0VA 4WF5A 2IFQA 4H86A 2GSRA 3ME8A 2FWHA 2DC5A 3FYGA 1XPVA 5IMCA 3HKRA 5DJLA 1TRSA 1YKCA 2H1BA 3L9UA 4BPYA 2V32A 2O89A 2CQ9A 3N9JA 2HRKA 3GSSA 3V1WA 2R6KA 3L78A 3QR6A 2VO4A 4IP6A 3QAGA 3GNJA 1ERUA 5AIXA 3M8NA 2IMEA 4G0IA 2QA2A 2H01A 2C1YA 4OFMA 5EL8A 4K9ZA 5GSTA 3BBYA 1XWGA 2VM1A 3QFBC 9GSSA 2QA1A 2TRXA 2EIOA 4HI7A 2AB6A 3P90A 4XHMA 3WGDA 3FRCA 1LJRA 3VLNA 2M72A 2X8CA 2RUEA 2R0GA 2YPMA 4DSSB 4EUYA 3APSA 3CXGA 4MF6A 4GXZA 4LMVA 2MZCA 2DJ1A 3F0IA 5INYA 3ZYWA 1F6MC 4NAXA 3LORA 3J7Yb 5D93A 2O7KA 5B8AA 4WXTA 1XOAA 1B48A 1B9XC 2HT9A 3CSIA 3GSTA 2V41A 3O3TA 3IXRA 3BOAA 3F6DA 4XS4A 1F9MA 2B6MA 3IA1A 4N10A 2YZUA 1LBKA 3UBKA 5ECSA 1U3IA 3MDKA 4XRAA 4FIWA 1XW9A 3LJRA 2Z9SA 1R5AA 3I43A 1W89A 2LTKA 1BQ7A 1GSYA 4K2XA 1NHOA 4PTSA 5F06A 3GA4A 4ECBA 4F82A 1OYJA 5IOWA 3ZRDA 3QFAC 2BTOT 2VLUA 3DEXA 20GSA 3NOFA 3KD0A 2ON5A 2RUFA 2YJ7A 4TW5A 1EZKA 5EY6A 1WPIA 2AV4A 2K9FA 1YJ6A 4TR1A 2E2GA 3QAWA 3EMXA 3CRUA 3GH9A 1X9MB 1FW1A 2HLSA 4MMMA 2C0DA 3ED3A 4TN8A 3GUSA 4HU7A 1OE8A 5ECOB 2BJXA 3AY8A 3TB2A 2H1GA 3WD6A 4HZ2A 1V58A 3EU4A 1Z5YE 2WFCA 2K18A 3IR4A 4I8BA 3IE3A 2DBCA 2KP2A 4MCUA 3UJ1A 4EVMA 4RQXA 4MLYA 5G1KA 3A2WA 4AF2A 2A2SA 2EC4A 2HE3A 3ZFLA 5LNKe 4Z2RA 1FB6A 2C0GA 2N5BA 3CSJA 4D73B 2B5XA 2CX3A 2DKHA 4MF7A 1I9DA 4AJ8A 3VPQA 2H8LA 2IMKA 4FYUA 4RQRA 3HVVA 1N2AA 4LA1A 3TKSE 2EIRA 1OC9A 4HUAA 3KGKA 4CY8A 3H4KA 1SK0A 1ZYNA 5IM9A 1BEDA 3IRAA 3VWWA 2IMDA 2RIIA 2N5FA 2M46A 2DSAA 1VGLA 4OFNA 1A2MA 1XWKA 5HFIA 3EVIA 5DALA 4NXIA 2I3YA 1GRXA 4NHZA 1G7OA 3TUEA 2KLXA 1KBNA 2RLIA 2QSIA 2DJKA 1FO5A 2VOCA 1SU9A 5JCWA 1NW2A 1FG4A 14GSA 2MBTA 3QPMA 3GURA 1T8EB 5BRTA 1AQXA 1TKDB 2WULA 2AHEA 2GQLA 2L6CA 4OWYA 2EIQA 1EWXA 3GKMA 4ACSA 5ABRA 11GSA 1XZOA 1XFLA 1F37A 4O5RA 2RM5A 3DIEA 2CVBA 4I97A 1Z6NA 1U3AA 3DMLA 2H71A 3ZTLA 3QCPA 1XXUA 4KSMA 3TJGA 1XW6A 1FHEA 5IMFA 4O92A 6GSVA 4HU9A 4JBBA 4KSOA 2H30A 4EIQA 4FQUA 2FUG2 4KF9A 1PL2A 2PWJA 3ERFA 4OCFA 4EE0A 1N8JA 2WCIA 3IK9A 2YJHA 2YOIA 2F3MA 5IMAA 1ZYEA 2PVQA 4K5SA 4ZB6A 4O5UA 3VPTA 5B7CA 3HVSA 4XIHA 5G30A 3IOSA 4MZBA 3DKSA 4DEJA 4RUVA 1TXXA 2C0EA 1JLWA 1QQ2A 3IHGA 3GFKA 1M9BA 2MBSA 2VUPA 2AAWA 3GMFA 3UL3A 3L9SA 3EPTA 2ZNMA 1M7TA 2YV7A 5FWGA 1K0BA 2B1KA 3R2QA 4HJ2A 1MD4A 4KDYA 5HFKA 1JZRA 4FH8A 2MYGA 3MWHA 5J9CA 4V2NA 4N0ZA 1O8WA 3SBCA 1T1VA 3EC3A 4HEA2 1XIYA 1U6TA 2H0IA 5DAKB 5HFGA 4ZB8A 4IQ1A 4ZL8A 3PH9A 1HNCA 4YAPA 1K3YA 4TXOB 1EP8A 1GTAA 4NPBA 3KXOA 3TKSA 4FO5A 3IHQA 5CAXA 2WJUA 5B6NA 2FLSA 1TTZA 2VCWA 6GSYA 3IC4A 4ZIJA 1ERWA 3VI5A 1OKDA 1A8YA 2VM2A 2LQOA 5CNWA 4BL7A 1YY7A 2D2ZA 3ERWA 7GSSA 2PGTA 1JFUA 4G10A 2VD0A 2JL4A 4V2LA 5D8IA 3PR8A 4CDOA 2HZEB 3D21A 3DD3A 2AUVA 1MDKA 1QGVA 4USSA 5KN1A 3TJFA 5DJMA 1XCCA 3E9JB 4YQVA 1JZOA 1T4YA 3GTUA 1WWJA 3F8UA 4A5PA 4O5QA 3TOUA 2X99A 1ZCPA 1ERVA 1VRSD 2OA7A 3PGTA 2IWTA 2PMTA 5E4WA 4WBRD 4KCAA 4EKZA 5KEJA 3CTFA 22GSA 2VLVA 3DXBA 3Q19A 3BCIA 2VL2C 1ACVA 1HYUA 3ZZXA 5DBQA 1K0MA 3TGZA 3S9FA 3L4NA 2KHPA 4IN0A 1GLQA 2FA8A 1W4VA 4MZCA 4ML1A 1GWCA 4KGIA 3FY7A 3WGXA 2YCDA 1VF2A 2M80A 1TDIA 4I5QA 5ELGA 2PVOC 2NVLA 4YQUA 4PUFC 1WOUA 2DJ2A 4IKHA 4ULXA 5H5RA 4HQZA 3UARA 3JCML 3KTLA 2AYTA 1TRVA 3GYKA 3IAM2 5ECRB 6GSSA 4HQSA 4EDZA 1TP9A 1Q4JA 1ON4A 2VLTA 2F51A 2KP1A 2YANA 1GNEA 2YV9A 3GV1A 4J2FA 3TRPA 2LNSA 1KNGA 4HDEA 2AJQB 1SD9A 2FWGA 1GNWA 1A0FA 4KAEA 4GQCA 3TKRA 3A3TA 1SK1A 2CVKA 2H73A 3HY2A 1OVNA 1O73A 2X8GA 3GX8A 4K7NA 4TOPA 4ICYA 4GF0A 1SD8A 3ZREA 3EU3A 2L4CA 1WIKA 4I6XA 18GSA 4Q5RA 3DWVA 3VWVA 5ECHB 1GUKA 2GSTA 1GSFA 2WZ9A 3KIJA 4WETA 5A4UA 2CVDA 1GH2A 1SL1B 1UC7A 2IPAA 2GZYA 3DVWA 1XWAA 3NIVA 3RPNA 5FHIA 1HNBA 2J9HA 3ZVJD 4EC0A 5A4VA 1FVKA 4PNFA 2C3NA 1VF1A 3R3EA 2L6DA 2B3SA 2MMOA 4YAVA 3IAS2 3BD2A 1B9YC 4MZWA 1UVZA 2PERA 4LL4B 4O7HA 2JSYA 5ELAA 4EXJA 2GT6A 2MMNA 2PUKC 2YN1A 1SK2A 1SKRB 4HZ4A 2LUSA 1GP1A 2WDUA 1G6WA 2H0HA 3KMNA 1YEXA 3ZMLA 2V6KA 2H0GA 3C71A 5IMVA 2R37A 3HZ4A 4OMVA 1XWCA 3F3QA 4GSTA 4KB3A 3A5IA 3CRTA 4ZBDA 1NHYA 5C04A 2NTOA 3I6AA 3QOUA 2VAFA 1H4OA 2FD3A 5ECKB 5D96A 5D9WA 3GX0A 2R0PA 5ECNB 1XBSA 4GTUA 5E59A 19GSA 2YWMA 4DSQA 1J0FA 5D9TA 1K0AA 1JZWA 1K0DA 1EEMA 1Y6EA 4ZBAA 3W6GA 2C3QA 4AJ6A 4TR0A 2LEGA 4IJ3A 3QD9A 4F03A 2ZUPA 1K3OA 3HCZA 1OKTA 3H1NA 1FVJA 2H72A 1G6YA 2DKIA 4NV5A 1OC8A 4FYCA 4DSSA 1YF1A 4MPGA 2HRNA 4EF0A 2B1LA 2OBIA 3TJKA 4BVXB 1TI3A 2JU5A 1MEKA 2F9SA 2LRNA 2X49A 2YWIA 4YH2A 2ALBA 5B8BA 2O8VB 1M9AA 2DJJA 4QL7A 1HD2A 3EYTA 5J9BA 1ZMAA 4WF4A 2JADA 5COHA 1GSSA 3RAZA 5HR3A 3UEMA 2RM6A 4Z2TA 3MAKA 3KJYA 3TDGA 3VURA 1T00A 4K1FA 1DSBA 2CAIA 2B5EA 2LRCA 1EOGA 1ZOFA 2R2JA 2OADA 4K8MA 4O32A 1GSUA 4HOJA 1TRWA 2O87A 5ECIB 2LSTA 4ILFA 2A2PA 5DCHA 1YEPA 4WR5A 4JZQA 3SWLA 1GUHA 13GSA 2H66A 3VI7A 2XPDA 5CYYA 1I5GA 4JE1A 4MP4A 3EE2A 3UMAA 1QMVA 2BMXA 4P3YB 2MMAA 5J5NA 3IPZA 1ZYQB 4BVYB 3LEFA 2DIZA 1M2BA 3VK9A 2KOKA 4ECJA 4K6XA 1R4WA 1KTEA 1BJXA 3FHKA 3G7YA 1THXA 3FR6A 4E8EA 1WE0A 2R4VA 4TR4A 2VCVA 2O85A 1G0TA 1MD3A 2A2RA 2F8FA 3P2AA 4L0WA 2OE3A 5G5EA 2IIYA 5IMZA 1PSQA 2C80A 1O8XA 2R0CA 1WRYA 1Q98A 1V9WA 2GT5A 1CQHA 4TKYA 3Q74A 2J23A 4NWYA 3US3A 3F9UA 4LL1B 4CW9A 3EINA 1TU8A 2CV4A 4IQAA 2GVPA 4JU5A 4JEDA 1T4ZA 1XVWA 2C0FA 5BMUA 3FKFA 3OR5A 5ENUA 1ABAA 5A4WA 4IS0A 4J56E 2FCHA 4D73A 5ECPB 2H1AA 1S3CA 3TOTA 5CRGA 2HRAA 1TRUA 4ZL9A 2VIMA 3APQA 3KH7A 2IN3A 1AW9A 3GIXA 2DJ3A 5A5KA 6GSWA 2DLXA 5IMDA 3C73A 4XS6A 1GTUA 5B6MA 1AQWA 1XW5A 5AISA 2FNOA 1Z7PA 5HR2A 1AUCA 3D0ZA 1PKZA 3TRQA 3FR3A 4HJMA 5AN1A 3C7MA 1XVQA 3LYPA 3U6VA 2HSYA 1MTCA 4MJEA 1E6BA 3FR9A 3F63A 1OE7A 1EGOA 3DVXA 1X9WB 1GSEA 3G9BA 3IDVA 3Q18A 2E0QA 1Z7RA 3H93A 2HZFA 5IPGA 3NZNA 4DSRA 3ZFBA 3HJOA 3ZL5A 1HQOA 3A5WA 4V1Ag 3GKNA 3E0UA 1K0NA 3UOMA 1GTBA 5C00A 2G2QA 3LYKA 1TW9A 5EPFA 3FZAA 2LJAA 4K0GA 3MSZA 4IELA 2YP6A 5KN2A 3TKPA 2P31A 5KN0A 3ZITA 1IYIA 4MH2A 3FW2A 4PNGA 4TXVA 1SYRA 2GQMA 4GRFA 3HA9A 5ECMB 1PN0A 4I2UA 4G9HA 1RK4A 3QAVA 2B7JA 4OFTA 3N5OA 3EWLA 3D5JA 4N30A 5D9VA 1EP7A 4IP1A 4POMA 2OKAA 1M99A 3HJPA 5CRDA 1JHBA 4AJ7A 1PRXA 3U5RE 5KN3A 4F0BA 1QXHA 4G2EA 1F2EA 1A24A 4X1UA 2GSSA 5CRWA 3GH6A 1VF3A 4KX4A 3IBHA 3G7JA 1DBYA 5EVOA 2CX4A 2XBQA 4I2TA 4L0UA 3HVXA 1A2LA 4IW9A 2VCQA 3DGQA 4F9ZA 2VCXA 1Y25A 2IJYA 5DAKA 3FZ5A 5ID2A 3LSZA 6GSTA 4Q5QA 3RPPA 1NSWA 4TXOA 3DRNA 2IFQB 2GZPA 4J57E 1SYXA 5IPHA 3UVHA 1ERTA 1X5CA 3LWAA 4GCIA 1AQVA 4KE3A 16GSA 2VL9A 5F8BA 3KEBA 2FGXA 2C3TA 5GZZB 3D6IA 1MDJA 4PURA 2L4QA 2REMA 2H74A 3H8QA 3KP8A 4JR6A 1GULA 2XPEA 4ECIA 1ILOA 1FAAA 2HZEA 2WGRA 3F4SA 2A4HA 3W8JA 1AAZA 5LCZA 1V40A 1A23A 2GQKA 1TI1A 1ZZYA 3M3MA 2B5YA 3ME7A 2IL3A 3CBUA 4PQHA 2CT6A 3WGEA 2ON7A 5J3RA 5H5SA 2OE0A 1BYEA 1PN9A 1FB0A 1M2AA 4NHWA 2HSMA 3EMPA 4KDUA 4XTSA 4IVFA 3G7IA 2X8HA 5H5QA 3QDNA 1IYHA 2P5QA 3WT1A 1F3AA 2I81A 3CSHA 2JZTA 3LXTA 2H76A 4ID0A 4JRRA 4XS4B 4F0CA 2LJKA 3RHBA 3KTBA 1FOHA 3PPUA 1O85A 3W8SA 5GAND 5J4UA 2L57A 5GSSA 3GL5A 3VWUA 12GSA 4YQMA 2FA4A 4ZL7A 3KCMA 3I69A 5D9XA 3LQ7A 4WKWA 1TK8B 2ES7A 3M9JA 4JR4A 2YNXA 3EURA 3LXZA 1QFNA 5DQSA 3F4TA 4KDXA 1YQ1A 2I1UA 4MJCA 2DMLA 2XBIA 4NV2A 4LLRA 3M0FA 2L5OA 2LQQA 3LFLA 2E2MA 3GKXA 1SKSB 4YKGA 4F2IA 2OACA 1AC1A 4KUNA 1DE2A 4TR1B 5HQPA 4MH3A 5G5FA 3HDCA 2DIYA 4G0KA 1O7UA 3QMXA 4KH7A 4GLTA 5CRHA 1OC3A 1Z6MA 3ZMKA 2H1DA 1SL0B 4TRXA 3ZVJA 3CTGA 3APOA 2YWNA 4OO4A 5FT3A 4GQFA 2VL2A 2H6ZA 2VL3A 2HFDA 5ECQB 2R3XA 4PQIA 1O81A 1X0RA 2H19A 5AGYA 1EEJA 1BAYA 4CY6A 3F3RA 1YDKA 3PINA 2PPTA 2GS3A 4X0XA 5G31A 3BCKA 1J9BA 2H75A 4G0LA 4MF5A 2OE1A 1F3BA 4ZILA 1SJIA 2XC2A 2WB9A 2FY6A 5IIZA 1K3LA 1PX6A 1NM3A 2QGVA 1H75A 2VCZA 4WR4A 1OC9B 5AIVA 4PX1A 1U88A 2JACA 3C1SA 4EDYA 1USBA 1XWBA 2HSHA 5D73A 2FHEA 3VFIA 5DALB 5G2ZA 3K8NA 4OO5A 1YF0A 1K0OA 3VWXA 1SJZA 1EV9A 5GAPD 2I4AA 1PA3A 5F0GA 1YKAA 17GSA 2GLRA 3FZ4A 4IHUA 6GSXA 4X43A 1K0CA 3ZIVA 2WRTA 1UN2A 1URMA 5IQYA 3TJBA 3D4TA 1TJDA 4GSNA 4PQ1A 2NPBA 3HXSA 3UBLA 4AGSA 1EOHA 1S3DA 1Z9HA 2LNTA 3LGCA 1U87A 4Q5NA 5IO0A 1GTIA 3O76A 2X4AA 1R5PA 2K6VA 4X4JA 3ZLPA 4G19A 3ISOA 2A4VA 2F8AA 5JWQB 1AXDA 2MMZA 2TRCP 3M9KA 3HJMA 4BVXA 4BWSA 2CZ2A 1T3BA 2H6XA 1SJ6A 1WP0A 5CREA 1CQGA 3L9VA 3TKSC 4K2DA 2HI7A 1UA5A 2GSQA 3HZ8A 4L5LA 4ECCA 2WS2A 2ZCTA 4ISDA 5JCGA 1A2JA 1GL8A 2LRTA 2PU9C 3IV4A 1ST9A 4RI6A 1B8XA 1C72A 2HRFA 2YWOA 1TK0B 2HNLA 4TVEA 5CP1A 3TJJA 1A0RP 4IBPA 5JWRB 3TRXA 3HD5A 1BG5A 3Q6OA 1V98A 2XHFA 1X9SB 4K7IA 4IJIA 1ZYPA 1WMJA 4HS1A 3UVTA 3DYRA 1DE1A 4Z7XA 1B4PA 4E8HA 4XS1A 4Z2UA 1Z3EA 3P8WA 3F4RA 2GZZA 4GWRA 2DJ0A 3GKKA 4MABA 4MPFA 2V2GA 4BVYA 1THOA 4CHSA 1ML6A 3H79A 2FWEA 2OBKA 3GL3A 1WJKA 1VF4A 1HNAA 2GTUA 1R7HA 4EO3A 2JZSA 4YKFA 4K5RA 2L59A 3FEUA 5DCGA 4PGTA 1PX7A 1G7EA 3L0HA 1V2AA 4OCEA 5IO2A 2CA8A 4TR3A 1PGTA 1PKWA 3FMWA 2VD1A 4QQ7A 4L8EA 4MDCA 5F07A 1SKWB 3J7Yk 3A2VA 1RW1A 3E3EA 5ECLB 1GSQA 3GHAA 2I9HA 4MNNA 2LKUA 3KMOA 3FZ9A 4GSSA 4BL7B 1PMTA 5IOXA 2E7PA 4QL9A 1QUWA 3WT2A 4BA7A 2V6OA 3MIXA 2K8SA 4MK3A 2JZRA 2OJLA 4OD7A 1GSDA 4IGJA 2IMFA 4ZXGA 2C4JA 3GRXA 1JLVA 2NBSA 3CYNA 3GTUB 1X5DA 1YZXA 1V57A 1ZGNA 1SL2B 1JZDA 2DMMA 5J41A 4MA9A 1AIUA 4L5OA 3I9V2 1PQNA 2PBJA 3TCOA 1B4QA 5JCUA 5ID2B 4KA0A 5KOWA 4POKA 5HR0A 1QK8A 2GDRA 1M0UA 2NDOA 3RBTA 1J08A 2G0FA 4ML6A 1MDIA 1ZL9A 1PL1A 4N11A 4EL1A 2KUCA 1GLPA 4LMWA 2K8VA 2V1MA 3WYWA 4ZB9A 3M1GA 10GSA 3RDWA 3KM6A 4V1Ap 2CZ3A 3D4MA 2VCTA 5CO3A 3TKQA 5L71A 4K0NA 3C8EA 4RI7A 4KW6A 4DVCA 8GSSA 3HYPA 1M2DA 4MJBA 5JWOB 4NMUA 4FYBA 1XOBA 1O6JA 4EIPA 3A2XA 1T7PB 1EV4A 2H70A 2P0GA 4BWQA 2TIRA 4XRDA 1A8LA 3KP9A 3LW9A 2FWFA 2LJRA 3BJ5A 2LS5A 4PUAA 3C1RA 3FK8A 1DUGA 3ZIJA 5DVBA 4MJAA 1R26A 4V2MA 4Q5FA 2YZHA 2IMIA 3GN3A 2N5AA 3UIWA 3KZQA 5DQYA 4PXOA 1FOVA 5LD0A 2QC7A 3ERGA 1OAZA 5KOXA 2CAQA 2B7KA 3IK7A 2UZ8A 4WEYA 4XCSA 4K7OA 6GSUA 3LG6A 1PD21 3KH9A 3D22A 2QKEA 2PN8A 3O6TA 1LU4A 4ZBBA 4KCEA 3MYDA 2L5LA 1TOFA 1KEBA 3F6FA 3P7XA 1TU7A 1S3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UAP A;  1EGR A;  2P5R A;  1TK5 B;  5G1L A;  2X64 A;  2HXK A;  2R5G A;  2LV3 A;  1GUM A;  1BX9 A;  4POL A;  1SEN A;  1RQM A;  3RHC A;  5F05 A;  1E2Y A;  2C8U A;  4WBJ A;  5HR1 A;  3CMI A;  1X5E A;  3HHV A;  2H6Y A;  4KND A;  2JSZ A;  2HYX A;  3MNG A;  4POB A;  5DDL A;  2GGT A;  4N0V A;  4WF5 A;  2IFQ A;  4H86 A;  2GSR A;  3ME8 A;  2FWH A;  2DC5 A;  3FYG A;  1XPV A;  5IMC A;  3HKR A;  5DJL A;  1TRS A;  1YKC A;  2H1B A;  3L9U A;  4BPY A;  2V32 A;  2O89 A;  2CQ9 A;  3N9J A;  3GSS A;  3V1W A;  2R6K A;  3L78 A;  3QR6 A;  2VO4 A;  4IP6 A;  3QAG A;  3GNJ A;  1ERU A;  5AIX A;  3M8N A;  2IME A;  2H01 A;  2C1Y A;  4OFM A;  5EL8 A;  4K9Z A;  5GST A;  3BBY A;  1XWG A;  2VM1 A;  3QFB C;  9GSS A;  2TRX A;  2EIO A;  4HI7 A;  2AB6 A;  3P90 A;  4XHM A;  3WGD A;  3FRC A;  1LJR A;  3VLN A;  2M72 A;  2X8C A;  2RUE A;  2YPM A;  4DSS B;  4EUY A;  3APS A;  3CXG A;  4MF6 A;  4GXZ A;  4LMV A;  2MZC A;  2DJ1 A;  3F0I A;  5INY A;  3ZYW A;  1F6M C;  4NAX A;  3LOR A;  3J7Y b;  5D93 A;  2O7K A;  5B8A A;  4WXT A;  1XOA A;  1B48 A;  1B9X C;  2HT9 A;  3CSI A;  3GST A;  2V41 A;  3O3T A;  3IXR A;  3BOA A;  3F6D A;  4XS4 A;  1F9M A;  2B6M A;  3IA1 A;  4N10 A;  2YZU A;  1LBK A;  3UBK A;  5ECS A;  1U3I A;  3MDK A;  4XRA A;  4FIW A;  1XW9 A;  3LJR A;  2Z9S A;  1R5A A;  3I43 A;  1W89 A;  2LTK A;  1BQ7 A;  1GSY A;  1NHO A;  5F06 A;  3GA4 A;  4ECB A;  4F82 A;  1OYJ A;  5IOW A;  3ZRD A;  3QFA C;  2BTO T;  2VLU A;  3DEX A;  20GS A;  3NOF A;  3KD0 A;  2ON5 A;  2RUF A;  2YJ7 A;  4TW5 A;  1EZK A;  5EY6 A;  1WPI A;  2AV4 A;  2K9F A;  1YJ6 A;  4TR1 A;  2E2G A;  3QAW A;  3EMX A;  3CRU A;  3GH9 A;  1X9M B;  1FW1 A;  2HLS A;  4MMM A;  2C0D A;  3ED3 A;  4TN8 A;  3GUS A;  4HU7 A;  1OE8 A;  5ECO B;  2BJX A;  3AY8 A;  3TB2 A;  2H1G A;  3WD6 A;  4HZ2 A;  1V58 A;  3EU4 A;  1Z5Y E;  2WFC A;  2K18 A;  3IR4 A;  4I8B A;  3IE3 A;  2DBC A;  2KP2 A;  4MCU A;  3UJ1 A;  4EVM A;  4RQX A;  4MLY A;  5G1K A;  3A2W A;  4AF2 A;  2A2S A;  2EC4 A;  2HE3 A;  3ZFL A;  5LNK e;  1FB6 A;  2C0G A;  2N5B A;  3CSJ A;  4D73 B;  2B5X A;  2CX3 A;  4MF7 A;  1I9D A;  4AJ8 A;  3VPQ A;  2H8L A;  2IMK A;  4FYU A;  4RQR A;  3HVV A;  1N2A A;  4LA1 A;  3TKS E;  2EIR A;  1OC9 A;  4HUA A;  3KGK A;  3H4K A;  1SK0 A;  5IM9 A;  1BED A;  3IRA A;  3VWW A;  2IMD A;  2RII A;  2N5F A;  2M46 A;  2DSA A;  1VGL A;  4OFN A;  1A2M A;  1XWK A;  5HFI A;  3EVI A;  5DAL A;  4NXI A;  2I3Y A;  1GRX A;  4NHZ A;  1G7O A;  3TUE A;  2KLX A;  1KBN A;  2RLI A;  2QSI A;  2DJK A;  1FO5 A;  2VOC A;  1SU9 A;  5JCW A;  1NW2 A;  1FG4 A;  14GS A;  2MBT A;  3QPM A;  3GUR A;  1T8E B;  1AQX A;  1TKD B;  2WUL A;  2AHE A;  2GQL A;  2L6C A;  4OWY A;  2EIQ A;  1EWX A;  3GKM A;  4ACS A;  5ABR A;  11GS A;  1XZO A;  1XFL A;  1F37 A;  4O5R A;  2RM5 A;  3DIE A;  2CVB A;  4I97 A;  1Z6N A;  1U3A A;  3DML A;  2H71 A;  3ZTL A;  3QCP A;  1XXU A;  4KSM A;  3TJG A;  1XW6 A;  1FHE A;  5IMF A;  4O92 A;  6GSV A;  4HU9 A;  4JBB A;  4KSO A;  2H30 A;  2FUG 2;  1PL2 A;  2PWJ A;  3ERF A;  4OCF A;  4EE0 A;  1N8J A;  2WCI A;  3IK9 A;  2YJH A;  2YOI A;  2F3M A;  5IMA A;  1ZYE A;  2PVQ A;  4ZB6 A;  3VPT A;  5B7C A;  3HVS A;  4XIH A;  5G30 A;  3IOS A;  4MZB A;  3DKS A;  4DEJ A;  4RUV A;  1TXX A;  2C0E A;  1JLW A;  1QQ2 A;  3GFK A;  1M9B A;  2MBS A;  2VUP A;  2AAW A;  3GMF A;  3UL3 A;  3L9S A;  2ZNM A;  1M7T A;  2YV7 A;  5FWG A;  1K0B A;  2B1K A;  3R2Q A;  4HJ2 A;  1MD4 A;  4KDY A;  5HFK A;  1JZR A;  4FH8 A;  2MYG A;  3MWH A;  5J9C A;  4V2N A;  4N0Z A;  1O8W A;  3SBC A;  1T1V A;  3EC3 A;  4HEA 2;  1XIY A;  1U6T A;  2H0I A;  5DAK B;  5HFG A;  4ZB8 A;  4IQ1 A;  4ZL8 A;  3PH9 A;  1HNC A;  4YAP A;  1K3Y A;  4TXO B;  1EP8 A;  1GTA A;  4NPB A;  3KXO A;  3TKS A;  4FO5 A;  3IHQ A;  5CAX A;  2WJU A;  5B6N A;  2FLS A;  1TTZ A;  2VCW A;  6GSY A;  3IC4 A;  4ZIJ A;  1ERW A;  3VI5 A;  1OKD A;  1A8Y A;  2VM2 A;  2LQO A;  5CNW A;  4BL7 A;  1YY7 A;  2D2Z A;  3ERW A;  7GSS A;  2PGT A;  1JFU A;  4G10 A;  2VD0 A;  2JL4 A;  4V2L A;  5D8I A;  3PR8 A;  4CDO A;  2HZE B;  3D21 A;  3DD3 A;  2AUV A;  1MDK A;  1QGV A;  5KN1 A;  3TJF A;  5DJM A;  1XCC A;  3E9J B;  4YQV A;  1JZO A;  1T4Y A;  3GTU A;  1WWJ A;  3F8U A;  3TOU A;  2X99 A;  1ZCP A;  1ERV A;  1VRS D;  2OA7 A;  3PGT A;  2IWT A;  2PMT A;  5E4W A;  4WBR D;  4KCA A;  4EKZ A;  5KEJ A;  3CTF A;  22GS A;  2VLV A;  3DXB A;  3Q19 A;  3BCI A;  2VL2 C;  1ACV A;  1HYU A;  3ZZX A;  5DBQ A;  1K0M A;  3TGZ A;  3S9F A;  3L4N A;  2KHP A;  4IN0 A;  1GLQ A;  2FA8 A;  1W4V A;  4MZC A;  4ML1 A;  1GWC A;  4KGI A;  3FY7 A;  3WGX A;  2YCD A;  1VF2 A;  2M80 A;  1TDI A;  4I5Q A;  5ELG A;  2PVO C;  2NVL A;  4YQU A;  4PUF C;  1WOU A;  2DJ2 A;  4IKH A;  4ULX A;  5H5R A;  4HQZ A;  3UAR A;  3JCM L;  3KTL A;  2AYT A;  1TRV A;  3GYK A;  3IAM 2;  5ECR B;  6GSS A;  4HQS A;  4EDZ A;  1TP9 A;  1Q4J A;  1ON4 A;  2VLT A;  2F51 A;  2KP1 A;  2YAN A;  1GNE A;  2YV9 A;  3GV1 A;  4J2F A;  3TRP A;  2LNS A;  1KNG A;  4HDE A;  2AJQ B;  1SD9 A;  2FWG A;  1GNW A;  1A0F A;  4KAE A;  4GQC A;  3TKR A;  3A3T A;  1SK1 A;  2CVK A;  2H73 A;  3HY2 A;  1OVN A;  1O73 A;  2X8G A;  3GX8 A;  4K7N A;  4TOP A;  4GF0 A;  1SD8 A;  3ZRE A;  3EU3 A;  2L4C A;  1WIK A;  4I6X A;  18GS A;  4Q5R A;  3DWV A;  3VWV A;  5ECH B;  1GUK A;  2GST A;  1GSF A;  2WZ9 A;  3KIJ A;  4WET A;  5A4U A;  2CVD A;  1GH2 A;  1SL1 B;  1UC7 A;  2IPA A;  2GZY A;  3DVW A;  1XWA A;  3NIV A;  3RPN A;  5FHI A;  1HNB A;  2J9H A;  3ZVJ D;  4EC0 A;  5A4V A;  1FVK A;  4PNF A;  2C3N A;  1VF1 A;  2L6D A;  2B3S A;  2MMO A;  4YAV A;  3IAS 2;  3BD2 A;  1B9Y C;  4MZW A;  1UVZ A;  2PER A;  4LL4 B;  4O7H A;  2JSY A;  5ELA A;  4EXJ A;  2GT6 A;  2MMN A;  2PUK C;  2YN1 A;  1SK2 A;  1SKR B;  4HZ4 A;  2LUS A;  1GP1 A;  2WDU A;  1G6W A;  2H0H A;  3KMN A;  1YEX A;  3ZML A;  2V6K A;  2H0G A;  3C71 A;  5IMV A;  2R37 A;  3HZ4 A;  4OMV A;  1XWC A;  3F3Q A;  4GST A;  4KB3 A;  3CRT A;  4ZBD A;  1NHY A;  5C04 A;  2NTO A;  3I6A A;  3QOU A;  2VAF A;  1H4O A;  2FD3 A;  5ECK B;  5D96 A;  5D9W A;  3GX0 A;  5ECN B;  1XBS A;  4GTU A;  5E59 A;  19GS A;  2YWM A;  4DSQ A;  1J0F A;  5D9T A;  1K0A A;  1JZW A;  1K0D A;  1EEM A;  1Y6E A;  4ZBA A;  3W6G A;  2C3Q A;  4AJ6 A;  4TR0 A;  2LEG A;  4IJ3 A;  3QD9 A;  4F03 A;  2ZUP A;  1K3O A;  3HCZ A;  1OKT A;  3H1N A;  1FVJ A;  2H72 A;  1G6Y A;  4NV5 A;  1OC8 A;  4FYC A;  4DSS A;  1YF1 A;  4MPG A;  2HRN A;  4EF0 A;  2B1L A;  2OBI A;  3TJK A;  1TI3 A;  2JU5 A;  1MEK A;  2F9S A;  2LRN A;  2YWI A;  4YH2 A;  2ALB A;  5B8B A;  2O8V B;  1M9A A;  2DJJ A;  4QL7 A;  1HD2 A;  3EYT A;  5J9B A;  1ZMA A;  4WF4 A;  2JAD A;  5COH A;  1GSS A;  3RAZ A;  5HR3 A;  3UEM A;  2RM6 A;  3MAK A;  3KJY A;  3TDG A;  3VUR A;  1T00 A;  4K1F A;  1DSB A;  2CAI A;  2B5E A;  2LRC A;  1EOG A;  1ZOF A;  2R2J A;  2OAD A;  4K8M A;  4O32 A;  1GSU A;  4HOJ A;  1TRW A;  2O87 A;  5ECI B;  2LST A;  4ILF A;  5DCH A;  1YEP A;  4WR5 A;  4JZQ A;  3SWL A;  1GUH A;  13GS A;  2H66 A;  3VI7 A;  2XPD A;  5CYY A;  1I5G A;  3EE2 A;  4MP4 A;  4JE1 A;  3UMA A;  1QMV A;  2BMX A;  4P3Y B;  2MMA A;  5J5N A;  3IPZ A;  1ZYQ B;  3LEF A;  2DIZ A;  1M2B A;  3VK9 A;  2KOK A;  4ECJ A;  4K6X A;  1R4W A;  1KTE A;  1BJX A;  3FHK A;  3G7Y A;  1THX A;  3FR6 A;  4E8E A;  1WE0 A;  2R4V A;  4TR4 A;  2VCV A;  2O85 A;  1G0T A;  1MD3 A;  2A2R A;  2F8F A;  3P2A A;  4L0W A;  2OE3 A;  5G5E A;  2IIY A;  5IMZ A;  1PSQ A;  2C80 A;  1O8X A;  1WRY A;  1Q98 A;  1V9W A;  2GT5 A;  1CQH A;  4TKY A;  3Q74 A;  2J23 A;  4NWY A;  3US3 A;  3F9U A;  4LL1 B;  4CW9 A;  3EIN A;  1TU8 A;  2CV4 A;  4IQA A;  2GVP A;  4JU5 A;  4JED A;  1T4Z A;  1XVW A;  2C0F A;  3FKF A;  3OR5 A;  5ENU A;  1ABA A;  5A4W A;  4IS0 A;  4J56 E;  2FCH A;  4D73 A;  5ECP B;  2H1A A;  1S3C A;  3TOT A;  5CRG A;  1TRU A;  4ZL9 A;  2VIM A;  3APQ A;  3KH7 A;  2IN3 A;  1AW9 A;  3GIX A;  2DJ3 A;  5A5K A;  6GSW A;  2DLX A;  5IMD A;  3C73 A;  4XS6 A;  1GTU A;  5B6M A;  1AQW A;  1XW5 A;  5AIS A;  2FNO A;  1Z7P A;  5HR2 A;  1AUC A;  3D0Z A;  1PKZ A;  3TRQ A;  3FR3 A;  4HJM A;  5AN1 A;  3C7M A;  1XVQ A;  3LYP A;  3U6V A;  2HSY A;  1MTC A;  4MJE A;  1E6B A;  3FR9 A;  3F63 A;  1OE7 A;  1EGO A;  3DVX A;  1X9W B;  1GSE A;  3G9B A;  3IDV A;  3Q18 A;  2E0Q A;  1Z7R A;  3H93 A;  2HZF A;  5IPG A;  3NZN A;  4DSR A;  3ZFB A;  3HJO A;  3ZL5 A;  1HQO A;  3A5W A;  4V1A g;  3GKN A;  3E0U A;  1K0N A;  3UOM A;  1GTB A;  5C00 A;  2G2Q A;  3LYK A;  1TW9 A;  5EPF A;  3FZA A;  2LJA A;  4K0G A;  3MSZ A;  4IEL A;  2YP6 A;  5KN2 A;  3TKP A;  2P31 A;  5KN0 A;  3ZIT A;  1IYI A;  4MH2 A;  3FW2 A;  4PNG A;  4TXV A;  1SYR A;  2GQM A;  4GRF A;  3HA9 A;  5ECM B;  4I2U A;  4G9H A;  1RK4 A;  3QAV A;  2B7J A;  4OFT A;  3N5O A;  3EWL A;  3D5J A;  4N30 A;  5D9V A;  1EP7 A;  4IP1 A;  4POM A;  2OKA A;  1M99 A;  3HJP A;  5CRD A;  1JHB A;  4AJ7 A;  1PRX A;  3U5R E;  5KN3 A;  4F0B A;  1QXH A;  4G2E A;  1F2E A;  1A24 A;  4X1U A;  2GSS A;  5CRW A;  3GH6 A;  1VF3 A;  4KX4 A;  3IBH A;  3G7J A;  1DBY A;  5EVO A;  2CX4 A;  2XBQ A;  4I2T A;  4L0U A;  3HVX A;  1A2L A;  4IW9 A;  2VCQ A;  3DGQ A;  4F9Z A;  2VCX A;  1Y25 A;  2IJY A;  5DAK A;  3FZ5 A;  5ID2 A;  3LSZ A;  6GST A;  4Q5Q A;  3RPP A;  1NSW A;  4TXO A;  3DRN A;  2IFQ B;  2GZP A;  4J57 E;  1SYX A;  5IPH A;  3UVH A;  1ERT A;  1X5C A;  3LWA A;  4GCI A;  1AQV A;  4KE3 A;  16GS A;  2VL9 A;  5F8B A;  3KEB A;  2FGX A;  2C3T A;  5GZZ B;  3D6I A;  1MDJ A;  4PUR A;  2L4Q A;  2REM A;  2H74 A;  3H8Q A;  3KP8 A;  4JR6 A;  1GUL A;  2XPE A;  4ECI A;  1ILO A;  1FAA A;  2HZE A;  2WGR A;  3F4S A;  3W8J A;  1AAZ A;  5LCZ A;  1V40 A;  1A23 A;  2GQK A;  1TI1 A;  1ZZY A;  3M3M A;  2B5Y A;  3ME7 A;  2IL3 A;  3CBU A;  4PQH A;  2CT6 A;  3WGE A;  2ON7 A;  5J3R A;  5H5S A;  2OE0 A;  1BYE A;  1PN9 A;  1FB0 A;  1M2A A;  4NHW A;  3EMP A;  4KDU A;  4XTS A;  4IVF A;  3G7I A;  2X8H A;  5H5Q A;  3QDN A;  1IYH A;  2P5Q A;  3WT1 A;  1F3A A;  2I81 A;  3CSH A;  2JZT A;  3LXT A;  2H76 A;  4ID0 A;  4JRR A;  4XS4 B;  4F0C A;  2LJK A;  3RHB A;  3KTB A;  1O85 A;  3W8S A;  5GAN D;  5J4U A;  2L57 A;  5GSS A;  3GL5 A;  3VWU A;  12GS A;  4YQM A;  2FA4 A;  4ZL7 A;  3KCM A;  3I69 A;  5D9X A;  3LQ7 A;  4WKW A;  1TK8 B;  2ES7 A;  3M9J A;  4JR4 A;  2YNX A;  3EUR A;  3LXZ A;  1QFN A;  5DQS A;  3F4T A;  4KDX A;  1YQ1 A;  2I1U A;  4MJC A;  2DML A;  2XBI A;  4NV2 A;  4LLR A;  3M0F A;  2L5O A;  2LQQ A;  3LFL A;  2E2M A;  3GKX A;  1SKS B;  4F2I A;  2OAC A;  1AC1 A;  4KUN A;  1DE2 A;  4TR1 B;  5HQP A;  4MH3 A;  5G5F A;  3HDC A;  2DIY A;  1O7U A;  3QMX A;  4KH7 A;  4GLT A;  5CRH A;  1OC3 A;  1Z6M A;  3ZMK A;  2H1D A;  1SL0 B;  4TRX A;  3ZVJ A;  3CTG A;  3APO A;  2YWN A;  4OO4 A;  5FT3 A;  4GQF A;  2VL2 A;  2H6Z A;  2VL3 A;  2HFD A;  5ECQ B;  2R3X A;  4PQI A;  1O81 A;  1X0R A;  2H19 A;  5AGY A;  1EEJ A;  1BAY A;  3F3R A;  1YDK A;  3PIN A;  2PPT A;  2GS3 A;  4X0X A;  5G31 A;  3BCK A;  1J9B A;  2H75 A;  4MF5 A;  2OE1 A;  1F3B A;  4ZIL A;  1SJI A;  2XC2 A;  2WB9 A;  2FY6 A;  5IIZ A;  1K3L A;  1PX6 A;  1NM3 A;  2QGV A;  1H75 A;  2VCZ A;  4WR4 A;  1OC9 B;  5AIV A;  4PX1 A;  1U88 A;  2JAC A;  3C1S A;  4EDY A;  1USB A;  1XWB A;  2HSH A;  5D73 A;  2FHE A;  3VFI A;  5DAL B;  5G2Z A;  3K8N A;  4OO5 A;  1YF0 A;  1K0O A;  3VWX A;  1SJZ A;  1EV9 A;  5GAP D;  2I4A A;  1PA3 A;  5F0G A;  1YKA A;  17GS A;  2GLR A;  3FZ4 A;  4IHU A;  6GSX A;  4X43 A;  1K0C A;  3ZIV A;  2WRT A;  1UN2 A;  1URM A;  5IQY A;  3TJB A;  3D4T A;  1TJD A;  4GSN A;  4PQ1 A;  2NPB A;  3HXS A;  3UBL A;  4AGS A;  1EOH A;  1S3D A;  1Z9H A;  2LNT A;  3LGC A;  1U87 A;  4Q5N A;  5IO0 A;  1GTI A;  3O76 A;  1R5P A;  2K6V A;  3ZLP A;  4G19 A;  3ISO A;  2A4V A;  2F8A A;  5JWQ B;  1AXD A;  2MMZ A;  2TRC P;  3M9K A;  3HJM A;  4BVX A;  4BWS A;  2CZ2 A;  1T3B A;  2H6X A;  1SJ6 A;  1WP0 A;  5CRE A;  1CQG A;  3L9V A;  3TKS C;  4K2D A;  2HI7 A;  1UA5 A;  2GSQ A;  3HZ8 A;  4L5L A;  4ECC A;  2WS2 A;  2ZCT A;  4ISD A;  5JCG A;  1A2J A;  1GL8 A;  2LRT A;  2PU9 C;  3IV4 A;  1ST9 A;  4RI6 A;  1B8X A;  1C72 A;  2HRF A;  2YWO A;  1TK0 B;  2HNL A;  4TVE A;  5CP1 A;  3TJJ A;  1A0R P;  4IBP A;  5JWR B;  3TRX A;  3HD5 A;  1BG5 A;  3Q6O A;  1V98 A;  2XHF A;  1X9S B;  4K7I A;  4IJI A;  1WMJ A;  4HS1 A;  3UVT A;  3DYR A;  1DE1 A;  4Z7X A;  1B4P A;  4E8H A;  4XS1 A;  1Z3E A;  3P8W A;  3F4R A;  2GZZ A;  4GWR A;  2DJ0 A;  3GKK A;  4MAB A;  4MPF A;  2V2G A;  4BVY A;  1THO A;  4CHS A;  1ML6 A;  3H79 A;  2FWE A;  2OBK A;  3GL3 A;  1WJK A;  1VF4 A;  1HNA A;  2GTU A;  1R7H A;  4EO3 A;  2JZS A;  2L59 A;  3FEU A;  5DCG A;  4PGT A;  1PX7 A;  1G7E A;  3L0H A;  1V2A A;  4OCE A;  5IO2 A;  2CA8 A;  4TR3 A;  1PGT A;  1PKW A;  2VD1 A;  4QQ7 A;  4L8E A;  4MDC A;  5F07 A;  1SKW B;  3J7Y k;  3A2V A;  1RW1 A;  3E3E A;  5ECL B;  1GSQ A;  3GHA A;  2I9H A;  2LKU A;  3KMO A;  3FZ9 A;  4GSS A;  1PMT A;  5IOX A;  2E7P A;  4QL9 A;  1QUW A;  3WT2 A;  4BA7 A;  2V6O A;  2K8S A;  4MK3 A;  2JZR A;  2OJL A;  4OD7 A;  1GSD A;  4IGJ A;  2IMF A;  4ZXG A;  2C4J A;  3GRX A;  1JLV A;  2NBS A;  3CYN A;  3GTU B;  1X5D A;  1YZX A;  1V57 A;  1ZGN A;  1SL2 B;  1JZD A;  2DMM A;  5J41 A;  4MA9 A;  1AIU A;  4L5O A;  3I9V 2;  1PQN A;  2PBJ A;  3TCO A;  1B4Q A;  5JCU A;  5ID2 B;  4KA0 A;  4POK A;  5HR0 A;  1QK8 A;  2GDR A;  1M0U A;  2NDO A;  3RBT A;  1J08 A;  2G0F A;  4ML6 A;  1MDI A;  1ZL9 A;  1PL1 A;  4N11 A;  4EL1 A;  2KUC A;  1GLP A;  4LMW A;  2K8V A;  2V1M A;  3WYW A;  4ZB9 A;  3M1G A;  10GS A;  3RDW A;  3KM6 A;  4V1A p;  2CZ3 A;  3D4M A;  2VCT A;  5CO3 A;  3TKQ A;  5L71 A;  4K0N A;  3C8E A;  4RI7 A;  4KW6 A;  4DVC A;  8GSS A;  3HYP A;  1M2D A;  4MJB A;  5JWO B;  4NMU A;  4FYB A;  1XOB A;  1O6J A;  1T7P B;  3A2X A;  1EV4 A;  2H70 A;  2P0G A;  4BWQ A;  2TIR A;  4XRD A;  1A8L A;  3KP9 A;  2FWF A;  2LJR A;  3BJ5 A;  2LS5 A;  4PUA A;  3C1R A;  3FK8 A;  1DUG A;  3ZIJ A;  5DVB A;  4MJA A;  1R26 A;  4V2M A;  4Q5F A;  2YZH A;  2IMI A;  3GN3 A;  2N5A A;  3UIW A;  3KZQ A;  5DQY A;  4PXO A;  1FOV A;  5LD0 A;  2QC7 A;  3ERG A;  1OAZ A;  2CAQ A;  2B7K A;  3IK7 A;  4WEY A;  4XCS A;  4K7O A;  6GSU A;  3LG6 A;  1PD2 1;  3KH9 A;  3D22 A;  2QKE A;  2PN8 A;  3O6T A;  1LU4 A;  4ZBB A;  4KCE A;  2L5L A;  1TOF A;  1KEB A;  3F6F A;  3P7X A;  1TU7 A;  1S3A A; 
#chains in the Genus database with same CATH topology
 3UAP A;  1EGR A;  2P5R A;  1TK5 B;  5G1L A;  2X64 A;  2HXK A;  2R5G A;  2LV3 A;  1GUM A;  1BX9 A;  1XG8 A;  4POL A;  1SEN A;  1RQM A;  3RHC A;  5F05 A;  1E2Y A;  2C8U A;  4WBJ A;  5HR1 A;  3CMI A;  1X5E A;  3HHV A;  2H6Y A;  4KND A;  2JSZ A;  2HYX A;  3MNG A;  4POB A;  3IC8 A;  5DDL A;  2GGT A;  4N0V A;  4WF5 A;  2IFQ A;  4H86 A;  2GSR A;  3ME8 A;  2FWH A;  2DC5 A;  3FYG A;  1XPV A;  5IMC A;  3HKR A;  5DJL A;  1TRS A;  1YKC A;  2H1B A;  3L9U A;  4BPY A;  2V32 A;  2O89 A;  2CQ9 A;  3N9J A;  2HRK A;  3GSS A;  3V1W A;  2R6K A;  3L78 A;  3QR6 A;  2VO4 A;  4IP6 A;  3QAG A;  3GNJ A;  1ERU A;  5AIX A;  3M8N A;  2IME A;  4G0I A;  2QA2 A;  2H01 A;  2C1Y A;  4OFM A;  5EL8 A;  4K9Z A;  5GST A;  3BBY A;  1XWG A;  2VM1 A;  3QFB C;  9GSS A;  2QA1 A;  2TRX A;  2EIO A;  4HI7 A;  2AB6 A;  3P90 A;  4XHM A;  3WGD A;  3FRC A;  1LJR A;  3VLN A;  2M72 A;  2X8C A;  2RUE A;  2R0G A;  2YPM A;  4DSS B;  4EUY A;  3APS A;  3CXG A;  4MF6 A;  4GXZ A;  4LMV A;  2MZC A;  2DJ1 A;  3F0I A;  5INY A;  3ZYW A;  1F6M C;  4NAX A;  3LOR A;  3J7Y b;  5D93 A;  2O7K A;  5B8A A;  4WXT A;  1XOA A;  1B48 A;  1B9X C;  2HT9 A;  3CSI A;  3GST A;  2V41 A;  3O3T A;  3IXR A;  3BOA A;  3F6D A;  4XS4 A;  1F9M A;  2B6M A;  3IA1 A;  4N10 A;  2YZU A;  1LBK A;  3UBK A;  5ECS A;  1U3I A;  3MDK A;  4XRA A;  4FIW A;  1XW9 A;  3LJR A;  2Z9S A;  1R5A A;  3I43 A;  1W89 A;  2LTK A;  1BQ7 A;  1GSY A;  4K2X A;  1NHO A;  4PTS A;  5F06 A;  3GA4 A;  4ECB A;  4F82 A;  1OYJ A;  5IOW A;  3ZRD A;  3QFA C;  2BTO T;  2VLU A;  3DEX A;  20GS A;  3NOF A;  3KD0 A;  2ON5 A;  2RUF A;  2YJ7 A;  4TW5 A;  1EZK A;  5EY6 A;  1WPI A;  2AV4 A;  2K9F A;  1YJ6 A;  4TR1 A;  2E2G A;  3QAW A;  3EMX A;  3CRU A;  3GH9 A;  1X9M B;  1FW1 A;  2HLS A;  4MMM A;  2C0D A;  3ED3 A;  4TN8 A;  3GUS A;  4HU7 A;  1OE8 A;  5ECO B;  2BJX A;  3AY8 A;  3TB2 A;  2H1G A;  3WD6 A;  4HZ2 A;  1V58 A;  3EU4 A;  1Z5Y E;  2WFC A;  2K18 A;  3IR4 A;  4I8B A;  3IE3 A;  2DBC A;  2KP2 A;  4MCU A;  3UJ1 A;  4EVM A;  4RQX A;  4MLY A;  5G1K A;  3A2W A;  4AF2 A;  2A2S A;  2EC4 A;  2HE3 A;  3ZFL A;  5LNK e;  4Z2R A;  1FB6 A;  2C0G A;  2N5B A;  3CSJ A;  4D73 B;  2B5X A;  2CX3 A;  2DKH A;  4MF7 A;  1I9D A;  4AJ8 A;  3VPQ A;  2H8L A;  2IMK A;  1S3R A;  4FYU A;  4RQR A;  3HVV A;  1N2A A;  4LA1 A;  3TKS E;  2EIR A;  1OC9 A;  4HUA A;  3KGK A;  4CY8 A;  3H4K A;  1SK0 A;  1ZYN A;  5IM9 A;  1BED A;  3IRA A;  3VWW A;  2IMD A;  2RII A;  2N5F A;  2M46 A;  2DSA A;  1VGL A;  4OFN A;  1A2M A;  1XWK A;  5HFI A;  3EVI A;  5DAL A;  4NXI A;  2I3Y A;  1GRX A;  4NHZ A;  1G7O A;  3TUE A;  2KLX A;  1KBN A;  2RLI A;  2QSI A;  2DJK A;  1FO5 A;  2VOC A;  1SU9 A;  5JCW A;  1NW2 A;  1FG4 A;  14GS A;  2MBT A;  3QPM A;  3GUR A;  1T8E B;  5BRT A;  1AQX A;  1TKD B;  2WUL A;  2AHE A;  2GQL A;  2L6C A;  4OWY A;  2EIQ A;  1EWX A;  3GKM A;  4ACS A;  5ABR A;  11GS A;  1XZO A;  1XFL A;  1F37 A;  4O5R A;  2RM5 A;  3DIE A;  2CVB A;  4I97 A;  1Z6N A;  1U3A A;  3DML A;  2H71 A;  3ZTL A;  3QCP A;  1XXU A;  4KSM A;  3TJG A;  1XW6 A;  1FHE A;  5IMF A;  4O92 A;  6GSV A;  4HU9 A;  4JBB A;  4KSO A;  2H30 A;  4EIQ A;  4FQU A;  2FUG 2;  4KF9 A;  1PL2 A;  2PWJ A;  3ERF A;  4OCF A;  4EE0 A;  1N8J A;  2WCI A;  3IK9 A;  2YJH A;  2YOI A;  2F3M A;  5IMA A;  1ZYE A;  2PVQ A;  4K5S A;  4ZB6 A;  4O5U A;  3VPT A;  5B7C A;  3HVS A;  4XIH A;  5G30 A;  3IOS A;  4MZB A;  3DKS A;  4DEJ A;  4RUV A;  1TXX A;  2C0E A;  1JLW A;  1QQ2 A;  3IHG A;  3GFK A;  1M9B A;  2MBS A;  2VUP A;  2AAW A;  3GMF A;  3UL3 A;  3L9S A;  3EPT A;  2ZNM A;  1M7T A;  2YV7 A;  5FWG A;  1K0B A;  2B1K A;  3R2Q A;  4HJ2 A;  1MD4 A;  4KDY A;  5HFK A;  1JZR A;  4FH8 A;  2MYG A;  3MWH A;  5J9C A;  4V2N A;  4N0Z A;  1O8W A;  3SBC A;  1T1V A;  3EC3 A;  4HEA 2;  1XIY A;  1U6T A;  2H0I A;  5DAK B;  5HFG A;  4ZB8 A;  4IQ1 A;  4ZL8 A;  3PH9 A;  1HNC A;  4YAP A;  1K3Y A;  4TXO B;  1EP8 A;  1GTA A;  4NPB A;  3KXO A;  3TKS A;  4FO5 A;  3IHQ A;  5CAX A;  2WJU A;  5B6N A;  2FLS A;  1TTZ A;  2VCW A;  6GSY A;  3IC4 A;  4ZIJ A;  1ERW A;  3VI5 A;  1OKD A;  1A8Y A;  2VM2 A;  2LQO A;  5CNW A;  4BL7 A;  1YY7 A;  2D2Z A;  3ERW A;  7GSS A;  2PGT A;  1JFU A;  4G10 A;  2VD0 A;  2JL4 A;  4V2L A;  5D8I A;  3PR8 A;  4CDO A;  2HZE B;  3D21 A;  3DD3 A;  2AUV A;  1MDK A;  1QGV A;  4USS A;  5KN1 A;  3TJF A;  5DJM A;  1XCC A;  3E9J B;  4YQV A;  1JZO A;  1T4Y A;  3GTU A;  1WWJ A;  3F8U A;  4A5P A;  4O5Q A;  3TOU A;  2X99 A;  1ZCP A;  1ERV A;  1VRS D;  2OA7 A;  3PGT A;  2IWT A;  2PMT A;  5E4W A;  4WBR D;  4KCA A;  4EKZ A;  5KEJ A;  3CTF A;  22GS A;  2VLV A;  3DXB A;  3Q19 A;  3BCI A;  2VL2 C;  1ACV A;  1HYU A;  3ZZX A;  5DBQ A;  1K0M A;  3TGZ A;  3S9F A;  3L4N A;  2KHP A;  4IN0 A;  1GLQ A;  2FA8 A;  1W4V A;  4MZC A;  4ML1 A;  1GWC A;  4KGI A;  3FY7 A;  3WGX A;  2YCD A;  1VF2 A;  2M80 A;  1TDI A;  4I5Q A;  5ELG A;  2PVO C;  2NVL A;  4YQU A;  4PUF C;  1WOU A;  2DJ2 A;  4IKH A;  4ULX A;  5H5R A;  4HQZ A;  3UAR A;  3JCM L;  3KTL A;  2AYT A;  1TRV A;  3GYK A;  3IAM 2;  5ECR B;  6GSS A;  4HQS A;  4EDZ A;  1TP9 A;  1Q4J A;  1ON4 A;  2VLT A;  2F51 A;  2KP1 A;  2YAN A;  1GNE A;  2YV9 A;  3GV1 A;  4J2F A;  3TRP A;  2LNS A;  1KNG A;  4HDE A;  2AJQ B;  1SD9 A;  2FWG A;  1GNW A;  1A0F A;  4KAE A;  4GQC A;  3TKR A;  3A3T A;  1SK1 A;  2CVK A;  2H73 A;  3HY2 A;  1OVN A;  1O73 A;  2X8G A;  3GX8 A;  4K7N A;  4TOP A;  4ICY A;  4GF0 A;  1SD8 A;  3ZRE A;  3EU3 A;  2L4C A;  1WIK A;  4I6X A;  18GS A;  4Q5R A;  3DWV A;  3VWV A;  5ECH B;  1GUK A;  2GST A;  1GSF A;  2WZ9 A;  3KIJ A;  4WET A;  5A4U A;  2CVD A;  1GH2 A;  1SL1 B;  1UC7 A;  2IPA A;  2GZY A;  3DVW A;  1XWA A;  3NIV A;  3RPN A;  5FHI A;  1HNB A;  2J9H A;  3ZVJ D;  4EC0 A;  5A4V A;  1FVK A;  4PNF A;  2C3N A;  1VF1 A;  3CQF A;  3R3E A;  2L6D A;  2B3S A;  2MMO A;  4YAV A;  3IAS 2;  3BD2 A;  1B9Y C;  4MZW A;  1UVZ A;  2PER A;  4LL4 B;  4O7H A;  2JSY A;  5ELA A;  4EXJ A;  2GT6 A;  2MMN A;  2PUK C;  2YN1 A;  1SK2 A;  1SKR B;  4HZ4 A;  2LUS A;  1GP1 A;  2WDU A;  1G6W A;  2H0H A;  3KMN A;  1YEX A;  3ZML A;  2V6K A;  2H0G A;  3C71 A;  5IMV A;  2R37 A;  3HZ4 A;  4OMV A;  1XWC A;  3F3Q A;  4GST A;  4KB3 A;  3A5I A;  3CRT A;  4ZBD A;  1NHY A;  5C04 A;  2NTO A;  3I6A A;  3QOU A;  2VAF A;  1H4O A;  2FD3 A;  5ECK B;  5D96 A;  5D9W A;  3GX0 A;  2R0P A;  5ECN B;  1XBS A;  4GTU A;  5E59 A;  19GS A;  2YWM A;  4DSQ A;  1J0F A;  5D9T A;  1K0A A;  1JZW A;  1K0D A;  1EEM A;  1Y6E A;  4ZBA A;  3W6G A;  2C3Q A;  4AJ6 A;  4TR0 A;  2LEG A;  4IJ3 A;  3QD9 A;  4F03 A;  2ZUP A;  1K3O A;  3HCZ A;  1OKT A;  3H1N A;  1FVJ A;  2H72 A;  1G6Y A;  2DKI A;  4NV5 A;  1OC8 A;  4FYC A;  4DSS A;  1YF1 A;  4MPG A;  2HRN A;  4EF0 A;  2B1L A;  2OBI A;  3TJK A;  4BVX B;  1TI3 A;  2JU5 A;  1MEK A;  2F9S A;  2LRN A;  2X49 A;  2YWI A;  4YH2 A;  2ALB A;  5B8B A;  2O8V B;  1M9A A;  2DJJ A;  4QL7 A;  1HD2 A;  3EYT A;  5J9B A;  1ZMA A;  4WF4 A;  2JAD A;  5COH A;  1GSS A;  3RAZ A;  5HR3 A;  3UEM A;  2RM6 A;  4Z2T A;  3MAK A;  3KJY A;  3TDG A;  3VUR A;  1T00 A;  4K1F A;  1DSB A;  2CAI A;  2B5E A;  2LRC A;  1EOG A;  1ZOF A;  2R2J A;  2OAD A;  4K8M A;  4O32 A;  1GSU A;  4HOJ A;  1TRW A;  2O87 A;  5ECI B;  2LST A;  4ILF A;  2A2P A;  5DCH A;  1YEP A;  4HSC X;  4WR5 A;  4JZQ A;  3SWL A;  1GUH A;  13GS A;  2H66 A;  3VI7 A;  2XPD A;  5CYY A;  1I5G A;  4JE1 A;  4MP4 A;  3EE2 A;  3UMA A;  1QMV A;  2BMX A;  4P3Y B;  2MMA A;  5J5N A;  3IPZ A;  1ZYQ B;  4BVY B;  3LEF A;  2DIZ A;  1M2B A;  3VK9 A;  2KOK A;  4ECJ A;  4K6X A;  1R4W A;  1KTE A;  1BJX A;  3FHK A;  3G7Y A;  1THX A;  3FR6 A;  4E8E A;  1WE0 A;  2R4V A;  4TR4 A;  2VCV A;  2O85 A;  1G0T A;  1MD3 A;  2A2R A;  2F8F A;  1M3J A;  3P2A A;  4L0W A;  2OE3 A;  5G5E A;  2IIY A;  5IMZ A;  1PSQ A;  2C80 A;  1O8X A;  2R0C A;  1WRY A;  1Q98 A;  1V9W A;  2GT5 A;  1CQH A;  4TKY A;  3Q74 A;  2J23 A;  4NWY A;  3US3 A;  3F9U A;  4LL1 B;  4CW9 A;  3EIN A;  1TU8 A;  2CV4 A;  4IQA A;  2GVP A;  4JU5 A;  4JED A;  1T4Z A;  1XVW A;  2C0F A;  5BMU A;  3FKF A;  3OR5 A;  5ENU A;  1ABA A;  5A4W A;  4IS0 A;  4J56 E;  2FCH A;  4D73 A;  5ECP B;  2H1A A;  1S3C A;  3TOT A;  5CRG A;  2HRA A;  1TRU A;  4ZL9 A;  2VIM A;  3APQ A;  3KH7 A;  2IN3 A;  1AW9 A;  3GIX A;  2DJ3 A;  5A5K A;  6GSW A;  2DLX A;  5IMD A;  3C73 A;  4XS6 A;  1GTU A;  5B6M A;  1AQW A;  1XW5 A;  5AIS A;  2FNO A;  1Z7P A;  5HR2 A;  1AUC A;  3D0Z A;  1PKZ A;  3TRQ A;  3FR3 A;  4HJM A;  5AN1 A;  3C7M A;  1XVQ A;  3LYP A;  3U6V A;  2HSY A;  1MTC A;  4MJE A;  1E6B A;  3FR9 A;  3F63 A;  1OE7 A;  1EGO A;  3DVX A;  1X9W B;  1GSE A;  3G9B A;  3IDV A;  3Q18 A;  2E0Q A;  1Z7R A;  3H93 A;  2HZF A;  5IPG A;  3NZN A;  4DSR A;  3ZFB A;  3HJO A;  3ZL5 A;  1HQO A;  3A5W A;  4V1A g;  3GKN A;  3E0U A;  1K0N A;  3UOM A;  1GTB A;  5C00 A;  2G2Q A;  3LYK A;  1TW9 A;  5EPF A;  3FZA A;  2LJA A;  4K0G A;  3MSZ A;  4IEL A;  2YP6 A;  5KN2 A;  3TKP A;  2P31 A;  5KN0 A;  3ZIT A;  1IYI A;  4MH2 A;  3FW2 A;  4PNG A;  4TXV A;  1SYR A;  2GQM A;  4GRF A;  3HA9 A;  5ECM B;  1PN0 A;  4I2U A;  4G9H A;  1RK4 A;  3QAV A;  2B7J A;  4OFT A;  3N5O A;  3EWL A;  3D5J A;  4N30 A;  5D9V A;  1EP7 A;  4IP1 A;  4POM A;  2OKA A;  1M99 A;  3HJP A;  5CRD A;  1JHB A;  4AJ7 A;  1PRX A;  3U5R E;  5KN3 A;  4F0B A;  1QXH A;  4G2E A;  1F2E A;  1A24 A;  4X1U A;  2GSS A;  5CRW A;  3GH6 A;  1VF3 A;  4KX4 A;  3IBH A;  3G7J A;  1DBY A;  5EVO A;  2CX4 A;  2XBQ A;  4I2T A;  4L0U A;  3HVX A;  1A2L A;  4IW9 A;  2VCQ A;  3DGQ A;  4BIK A;  4F9Z A;  2VCX A;  1Y25 A;  2IJY A;  5DAK A;  3FZ5 A;  5ID2 A;  3LSZ A;  6GST A;  4Q5Q A;  3RPP A;  1NSW A;  4TXO A;  3DRN A;  2IFQ B;  2GZP A;  4J57 E;  1SYX A;  5IPH A;  3UVH A;  1ERT A;  1X5C A;  3LWA A;  4GCI A;  1AQV A;  4KE3 A;  16GS A;  2VL9 A;  5F8B A;  3KEB A;  2FGX A;  2C3T A;  5GZZ B;  3D6I A;  1MDJ A;  4PUR A;  2L4Q A;  2REM A;  2H74 A;  3H8Q A;  3KP8 A;  4JR6 A;  1GUL A;  2XPE A;  4ECI A;  1ILO A;  1FAA A;  2HZE A;  2WGR A;  3F4S A;  2A4H A;  3W8J A;  1AAZ A;  5LCZ A;  1V40 A;  1A23 A;  2GQK A;  1TI1 A;  1ZZY A;  3M3M A;  2B5Y A;  3ME7 A;  2IL3 A;  3CBU A;  4PQH A;  2CT6 A;  3WGE A;  2ON7 A;  5J3R A;  5H5S A;  2OE0 A;  1BYE A;  1PN9 A;  1FB0 A;  1M2A A;  4NHW A;  2HSM A;  3EMP A;  4KDU A;  4XTS A;  4IVF A;  3G7I A;  2X8H A;  5H5Q A;  3QDN A;  1IYH A;  2P5Q A;  3WT1 A;  1F3A A;  2I81 A;  3CSH A;  2JZT A;  3LXT A;  2H76 A;  4ID0 A;  4JRR A;  4XS4 B;  4F0C A;  2LJK A;  3RHB A;  1PFO A;  3KTB A;  1FOH A;  3PPU A;  1O85 A;  3W8S A;  5GAN D;  5J4U A;  2L57 A;  5GSS A;  3GL5 A;  3VWU A;  12GS A;  4YQM A;  2FA4 A;  4ZL7 A;  3KCM A;  3I69 A;  5D9X A;  3LQ7 A;  4WKW A;  1TK8 B;  2ES7 A;  3M9J A;  4JR4 A;  2YNX A;  3EUR A;  3LXZ A;  1QFN A;  5DQS A;  3F4T A;  4KDX A;  1YQ1 A;  2I1U A;  4MJC A;  2DML A;  2XBI A;  4NV2 A;  4LLR A;  3M0F A;  2L5O A;  2LQQ A;  3LFL A;  2E2M A;  3GKX A;  1SKS B;  4YKG A;  4F2I A;  2OAC A;  1AC1 A;  4KUN A;  1DE2 A;  4TR1 B;  5HQP A;  4MH3 A;  5G5F A;  3HDC A;  2DIY A;  4G0K A;  1O7U A;  3QMX A;  4KH7 A;  4GLT A;  5CRH A;  1OC3 A;  1Z6M A;  3ZMK A;  2H1D A;  1SL0 B;  4TRX A;  3ZVJ A;  3CTG A;  3APO A;  2YWN A;  4OO4 A;  5FT3 A;  4GQF A;  2VL2 A;  2H6Z A;  2VL3 A;  2HFD A;  5ECQ B;  2R3X A;  4PQI A;  1O81 A;  1X0R A;  2H19 A;  5AGY A;  1EEJ A;  1BAY A;  4CY6 A;  3F3R A;  1YDK A;  3PIN A;  2PPT A;  2GS3 A;  4X0X A;  5G31 A;  3BCK A;  1J9B A;  2H75 A;  4G0L A;  4MF5 A;  2OE1 A;  1F3B A;  4ZIL A;  1SJI A;  2XC2 A;  2WB9 A;  2FY6 A;  5IIZ A;  1K3L A;  1PX6 A;  1NM3 A;  2QGV A;  1H75 A;  2VCZ A;  4WR4 A;  1OC9 B;  5AIV A;  4PX1 A;  1U88 A;  2JAC A;  3C1S A;  4EDY A;  1USB A;  1XWB A;  2HSH A;  5D73 A;  2FHE A;  3VFI A;  5DAL B;  5G2Z A;  3K8N A;  4OO5 A;  1YF0 A;  1K0O A;  3VWX A;  1SJZ A;  1EV9 A;  5GAP D;  2I4A A;  1PA3 A;  5F0G A;  1YKA A;  17GS A;  2GLR A;  3FZ4 A;  4IHU A;  6GSX A;  4X43 A;  1K0C A;  3ZIV A;  2WRT A;  1UN2 A;  1URM A;  5IQY A;  3TJB A;  3D4T A;  1TJD A;  4GSN A;  4PQ1 A;  2NPB A;  1M3I A;  3HXS A;  3UBL A;  4AGS A;  1EOH A;  1S3D A;  1Z9H A;  2LNT A;  3LGC A;  1U87 A;  4Q5N A;  5IO0 A;  1GTI A;  3O76 A;  2X4A A;  1R5P A;  2K6V A;  4X4J A;  3ZLP A;  4G19 A;  3ISO A;  2A4V A;  2F8A A;  5JWQ B;  1AXD A;  2MMZ A;  2TRC P;  3M9K A;  3HJM A;  4BVX A;  4BWS A;  2CZ2 A;  1T3B A;  2H6X A;  1SJ6 A;  1WP0 A;  5CRE A;  1CQG A;  3L9V A;  3TKS C;  4K2D A;  2HI7 A;  1UA5 A;  2GSQ A;  3HZ8 A;  4L5L A;  4ECC A;  2WS2 A;  2ZCT A;  4ISD A;  5JCG A;  1A2J A;  1GL8 A;  2LRT A;  2PU9 C;  3IV4 A;  1ST9 A;  4RI6 A;  1B8X A;  1C72 A;  2HRF A;  2YWO A;  1TK0 B;  2HNL A;  4TVE A;  5CP1 A;  3TJJ A;  1A0R P;  4IBP A;  5JWR B;  3TRX A;  3HD5 A;  1BG5 A;  3Q6O A;  1V98 A;  2XHF A;  1X9S B;  4K7I A;  4IJI A;  1ZYP A;  1WMJ A;  4HS1 A;  3UVT A;  3DYR A;  1DE1 A;  4Z7X A;  1B4P A;  4E8H A;  4XS1 A;  4Z2U A;  1Z3E A;  3P8W A;  3F4R A;  2GZZ A;  4GWR A;  2DJ0 A;  3GKK A;  4MAB A;  4MPF A;  2V2G A;  4BVY A;  1THO A;  4CHS A;  1ML6 A;  3H79 A;  2FWE A;  2OBK A;  3GL3 A;  1WJK A;  1VF4 A;  1HNA A;  2GTU A;  1R7H A;  4EO3 A;  2JZS A;  4YKF A;  4K5R A;  2L59 A;  3FEU A;  5DCG A;  4PGT A;  1PX7 A;  1G7E A;  3L0H A;  1V2A A;  4OCE A;  5IO2 A;  2CA8 A;  4TR3 A;  1PGT A;  1PKW A;  3FMW A;  2VD1 A;  4QQ7 A;  4L8E A;  4MDC A;  5F07 A;  1SKW B;  3J7Y k;  3A2V A;  1RW1 A;  3E3E A;  5ECL B;  1GSQ A;  3GHA A;  2I9H A;  4MNN A;  3HVN A;  2LKU A;  3KMO A;  3FZ9 A;  4GSS A;  4BL7 B;  1PMT A;  5IOX A;  2E7P A;  4QL9 A;  1QUW A;  3WT2 A;  4BA7 A;  2V6O A;  3MIX A;  2K8S A;  4MK3 A;  2JZR A;  2OJL A;  4OD7 A;  1GSD A;  4IGJ A;  2IMF A;  4ZXG A;  2C4J A;  3GRX A;  1JLV A;  2NBS A;  3CYN A;  3GTU B;  1X5D A;  1YZX A;  1V57 A;  1ZGN A;  1SL2 B;  1JZD A;  2DMM A;  5J41 A;  4MA9 A;  1AIU A;  4L5O A;  3I9V 2;  1PQN A;  2PBJ A;  3TCO A;  1B4Q A;  5JCU A;  5ID2 B;  4KA0 A;  5KOW A;  4POK A;  5HR0 A;  1QK8 A;  2GDR A;  1M0U A;  2NDO A;  3RBT A;  1J08 A;  2G0F A;  4ML6 A;  1MDI A;  1ZL9 A;  1PL1 A;  4N11 A;  4EL1 A;  2KUC A;  1GLP A;  4LMW A;  2K8V A;  2V1M A;  3WYW A;  4ZB9 A;  3M1G A;  10GS A;  3RDW A;  3KM6 A;  4V1A p;  2CZ3 A;  3D4M A;  2VCT A;  5CO3 A;  3TKQ A;  5L71 A;  4K0N A;  3C8E A;  4RI7 A;  4KW6 A;  4DVC A;  8GSS A;  3HYP A;  1M2D A;  4MJB A;  5JWO B;  4NMU A;  4FYB A;  1XOB A;  1O6J A;  4EIP A;  3A2X A;  1T7P B;  1EV4 A;  2H70 A;  2P0G A;  4BWQ A;  2TIR A;  4XRD A;  1A8L A;  3KP9 A;  3LW9 A;  2FWF A;  2LJR A;  3BJ5 A;  2LS5 A;  4PUA A;  3C1R A;  3FK8 A;  1DUG A;  3ZIJ A;  5DVB A;  4MJA A;  1R26 A;  4V2M A;  4Q5F A;  2YZH A;  2IMI A;  3GN3 A;  2N5A A;  3UIW A;  3KZQ A;  5DQY A;  4PXO A;  1FOV A;  5LD0 A;  2QC7 A;  3ERG A;  1OAZ A;  5KOX A;  2CAQ A;  2B7K A;  3IK7 A;  2UZ8 A;  4WEY A;  4XCS A;  4K7O A;  6GSU A;  3LG6 A;  1PD2 1;  3KH9 A;  3D22 A;  2QKE A;  2PN8 A;  3O6T A;  1LU4 A;  4ZBB A;  4KCE A;  3MYD A;  2L5L A;  1TOF A;  1KEB A;  3F6F A;  3P7X A;  1TU7 A;  1S3A A; 
#chains in the Genus database with same CATH homology
 3UAP A;  1EGR A;  2P5R A;  1TK5 B;  5G1L A;  2X64 A;  2HXK A;  2R5G A;  2LV3 A;  1GUM A;  1BX9 A;  4POL A;  1SEN A;  1RQM A;  3RHC A;  5F05 A;  1E2Y A;  2C8U A;  4WBJ A;  5HR1 A;  3CMI A;  1X5E A;  3HHV A;  2H6Y A;  4KND A;  2JSZ A;  2HYX A;  3MNG A;  4POB A;  3IC8 A;  5DDL A;  2GGT A;  4N0V A;  4WF5 A;  2IFQ A;  4H86 A;  2GSR A;  3ME8 A;  2FWH A;  2DC5 A;  3FYG A;  1XPV A;  5IMC A;  3HKR A;  5DJL A;  1TRS A;  1YKC A;  2H1B A;  3L9U A;  4BPY A;  2V32 A;  2O89 A;  2CQ9 A;  3N9J A;  2HRK A;  3GSS A;  3V1W A;  2R6K A;  3L78 A;  3QR6 A;  2VO4 A;  4IP6 A;  3QAG A;  3GNJ A;  1ERU A;  5AIX A;  3M8N A;  2IME A;  4G0I A;  2QA2 A;  2H01 A;  2C1Y A;  4OFM A;  5EL8 A;  4K9Z A;  5GST A;  3BBY A;  1XWG A;  2VM1 A;  3QFB C;  9GSS A;  2QA1 A;  2TRX A;  2EIO A;  4HI7 A;  2AB6 A;  3P90 A;  4XHM A;  3WGD A;  3FRC A;  1LJR A;  3VLN A;  2M72 A;  2X8C A;  2RUE A;  2R0G A;  2YPM A;  4DSS B;  4EUY A;  3APS A;  3CXG A;  4MF6 A;  4GXZ A;  4LMV A;  2MZC A;  2DJ1 A;  3F0I A;  5INY A;  3ZYW A;  1F6M C;  4NAX A;  3LOR A;  3J7Y b;  5D93 A;  2O7K A;  5B8A A;  4WXT A;  1XOA A;  1B48 A;  1B9X C;  2HT9 A;  3CSI A;  3GST A;  2V41 A;  3O3T A;  3IXR A;  3BOA A;  3F6D A;  4XS4 A;  1F9M A;  2B6M A;  3IA1 A;  4N10 A;  2YZU A;  1LBK A;  3UBK A;  5ECS A;  1U3I A;  3MDK A;  4XRA A;  4FIW A;  1XW9 A;  3LJR A;  2Z9S A;  1R5A A;  3I43 A;  1W89 A;  2LTK A;  1BQ7 A;  1GSY A;  4K2X A;  1NHO A;  4PTS A;  5F06 A;  3GA4 A;  4ECB A;  4F82 A;  1OYJ A;  5IOW A;  3ZRD A;  3QFA C;  2BTO T;  2VLU A;  3DEX A;  20GS A;  3NOF A;  3KD0 A;  2ON5 A;  2RUF A;  2YJ7 A;  4TW5 A;  1EZK A;  5EY6 A;  1WPI A;  2AV4 A;  2K9F A;  1YJ6 A;  4TR1 A;  2E2G A;  3QAW A;  3EMX A;  3CRU A;  3GH9 A;  1X9M B;  1FW1 A;  2HLS A;  4MMM A;  2C0D A;  3ED3 A;  4TN8 A;  3GUS A;  4HU7 A;  1OE8 A;  5ECO B;  2BJX A;  3AY8 A;  3TB2 A;  2H1G A;  3WD6 A;  4HZ2 A;  1V58 A;  3EU4 A;  1Z5Y E;  2WFC A;  2K18 A;  3IR4 A;  4I8B A;  3IE3 A;  2DBC A;  2KP2 A;  4MCU A;  3UJ1 A;  4EVM A;  4RQX A;  4MLY A;  5G1K A;  3A2W A;  4AF2 A;  2A2S A;  2EC4 A;  2HE3 A;  3ZFL A;  5LNK e;  4Z2R A;  1FB6 A;  2C0G A;  2N5B A;  3CSJ A;  4D73 B;  2B5X A;  2CX3 A;  2DKH A;  4MF7 A;  1I9D A;  4AJ8 A;  3VPQ A;  2H8L A;  2IMK A;  4FYU A;  4RQR A;  3HVV A;  1N2A A;  4LA1 A;  3TKS E;  2EIR A;  1OC9 A;  4HUA A;  3KGK A;  4CY8 A;  3H4K A;  1SK0 A;  1ZYN A;  5IM9 A;  1BED A;  3IRA A;  3VWW A;  2IMD A;  2RII A;  2N5F A;  2M46 A;  2DSA A;  1VGL A;  4OFN A;  1A2M A;  1XWK A;  5HFI A;  3EVI A;  5DAL A;  4NXI A;  2I3Y A;  1GRX A;  4NHZ A;  1G7O A;  3TUE A;  2KLX A;  1KBN A;  2RLI A;  2QSI A;  2DJK A;  1FO5 A;  2VOC A;  1SU9 A;  5JCW A;  1NW2 A;  1FG4 A;  14GS A;  2MBT A;  3QPM A;  3GUR A;  1T8E B;  5BRT A;  1AQX A;  1TKD B;  2WUL A;  2AHE A;  2GQL A;  2L6C A;  4OWY A;  2EIQ A;  1EWX A;  3GKM A;  4ACS A;  5ABR A;  11GS A;  1XZO A;  1XFL A;  1F37 A;  4O5R A;  2RM5 A;  3DIE A;  2CVB A;  4I97 A;  1Z6N A;  1U3A A;  3DML A;  2H71 A;  3ZTL A;  3QCP A;  1XXU A;  4KSM A;  3TJG A;  1XW6 A;  1FHE A;  5IMF A;  4O92 A;  6GSV A;  4HU9 A;  4JBB A;  4KSO A;  2H30 A;  4EIQ A;  4FQU A;  2FUG 2;  4KF9 A;  1PL2 A;  2PWJ A;  3ERF A;  4OCF A;  4EE0 A;  1N8J A;  2WCI A;  3IK9 A;  2YJH A;  2YOI A;  2F3M A;  5IMA A;  1ZYE A;  2PVQ A;  4K5S A;  4ZB6 A;  4O5U A;  3VPT A;  5B7C A;  3HVS A;  4XIH A;  5G30 A;  3IOS A;  4MZB A;  3DKS A;  4DEJ A;  4RUV A;  1TXX A;  2C0E A;  1JLW A;  1QQ2 A;  3IHG A;  3GFK A;  1M9B A;  2MBS A;  2VUP A;  2AAW A;  3GMF A;  3UL3 A;  3L9S A;  3EPT A;  2ZNM A;  1M7T A;  2YV7 A;  5FWG A;  1K0B A;  2B1K A;  3R2Q A;  4HJ2 A;  1MD4 A;  4KDY A;  5HFK A;  1JZR A;  4FH8 A;  2MYG A;  3MWH A;  5J9C A;  4V2N A;  4N0Z A;  1O8W A;  3SBC A;  1T1V A;  3EC3 A;  4HEA 2;  1XIY A;  1U6T A;  2H0I A;  5DAK B;  5HFG A;  4ZB8 A;  4IQ1 A;  4ZL8 A;  3PH9 A;  1HNC A;  4YAP A;  1K3Y A;  4TXO B;  1EP8 A;  1GTA A;  4NPB A;  3KXO A;  3TKS A;  4FO5 A;  3IHQ A;  5CAX A;  2WJU A;  5B6N A;  2FLS A;  1TTZ A;  2VCW A;  6GSY A;  3IC4 A;  4ZIJ A;  1ERW A;  3VI5 A;  1OKD A;  1A8Y A;  2VM2 A;  2LQO A;  5CNW A;  4BL7 A;  1YY7 A;  2D2Z A;  3ERW A;  7GSS A;  2PGT A;  1JFU A;  4G10 A;  2VD0 A;  2JL4 A;  4V2L A;  5D8I A;  3PR8 A;  4CDO A;  2HZE B;  3D21 A;  3DD3 A;  2AUV A;  1MDK A;  1QGV A;  4USS A;  5KN1 A;  3TJF A;  5DJM A;  1XCC A;  3E9J B;  4YQV A;  1JZO A;  1T4Y A;  3GTU A;  1WWJ A;  3F8U A;  4A5P A;  4O5Q A;  3TOU A;  2X99 A;  1ZCP A;  1ERV A;  1VRS D;  2OA7 A;  3PGT A;  2IWT A;  2PMT A;  5E4W A;  4WBR D;  4KCA A;  4EKZ A;  5KEJ A;  3CTF A;  22GS A;  2VLV A;  3DXB A;  3Q19 A;  3BCI A;  2VL2 C;  1ACV A;  1HYU A;  3ZZX A;  5DBQ A;  1K0M A;  3TGZ A;  3S9F A;  3L4N A;  2KHP A;  4IN0 A;  1GLQ A;  2FA8 A;  1W4V A;  4MZC A;  4ML1 A;  1GWC A;  4KGI A;  3FY7 A;  3WGX A;  2YCD A;  1VF2 A;  2M80 A;  1TDI A;  4I5Q A;  5ELG A;  2PVO C;  2NVL A;  4YQU A;  4PUF C;  1WOU A;  2DJ2 A;  4IKH A;  4ULX A;  5H5R A;  4HQZ A;  3UAR A;  3JCM L;  3KTL A;  2AYT A;  1TRV A;  3GYK A;  3IAM 2;  5ECR B;  6GSS A;  4HQS A;  4EDZ A;  1TP9 A;  1Q4J A;  1ON4 A;  2VLT A;  2F51 A;  2KP1 A;  2YAN A;  1GNE A;  2YV9 A;  3GV1 A;  4J2F A;  3TRP A;  2LNS A;  1KNG A;  4HDE A;  2AJQ B;  1SD9 A;  2FWG A;  1GNW A;  1A0F A;  4KAE A;  4GQC A;  3TKR A;  3A3T A;  1SK1 A;  2CVK A;  2H73 A;  3HY2 A;  1OVN A;  1O73 A;  2X8G A;  3GX8 A;  4K7N A;  4TOP A;  4ICY A;  4GF0 A;  1SD8 A;  3ZRE A;  3EU3 A;  2L4C A;  1WIK A;  4I6X A;  18GS A;  4Q5R A;  3DWV A;  3VWV A;  5ECH B;  1GUK A;  2GST A;  1GSF A;  2WZ9 A;  3KIJ A;  4WET A;  5A4U A;  2CVD A;  1GH2 A;  1SL1 B;  1UC7 A;  2IPA A;  2GZY A;  3DVW A;  1XWA A;  3NIV A;  3RPN A;  5FHI A;  1HNB A;  2J9H A;  3ZVJ D;  4EC0 A;  5A4V A;  1FVK A;  4PNF A;  2C3N A;  1VF1 A;  3R3E A;  2L6D A;  2B3S A;  2MMO A;  4YAV A;  3IAS 2;  3BD2 A;  1B9Y C;  4MZW A;  1UVZ A;  2PER A;  4LL4 B;  4O7H A;  2JSY A;  5ELA A;  4EXJ A;  2GT6 A;  2MMN A;  2PUK C;  2YN1 A;  1SK2 A;  1SKR B;  4HZ4 A;  2LUS A;  1GP1 A;  2WDU A;  1G6W A;  2H0H A;  3KMN A;  1YEX A;  3ZML A;  2V6K A;  2H0G A;  3C71 A;  5IMV A;  2R37 A;  3HZ4 A;  4OMV A;  1XWC A;  3F3Q A;  4GST A;  4KB3 A;  3A5I A;  3CRT A;  4ZBD A;  1NHY A;  5C04 A;  2NTO A;  3I6A A;  3QOU A;  2VAF A;  1H4O A;  2FD3 A;  5ECK B;  5D96 A;  5D9W A;  3GX0 A;  2R0P A;  5ECN B;  1XBS A;  4GTU A;  5E59 A;  19GS A;  2YWM A;  4DSQ A;  1J0F A;  5D9T A;  1K0A A;  1JZW A;  1K0D A;  1EEM A;  1Y6E A;  4ZBA A;  3W6G A;  2C3Q A;  4AJ6 A;  4TR0 A;  2LEG A;  4IJ3 A;  3QD9 A;  4F03 A;  2ZUP A;  1K3O A;  3HCZ A;  1OKT A;  3H1N A;  1FVJ A;  2H72 A;  1G6Y A;  2DKI A;  4NV5 A;  1OC8 A;  4FYC A;  4DSS A;  1YF1 A;  4MPG A;  2HRN A;  4EF0 A;  2B1L A;  2OBI A;  3TJK A;  4BVX B;  1TI3 A;  2JU5 A;  1MEK A;  2F9S A;  2LRN A;  2X49 A;  2YWI A;  4YH2 A;  2ALB A;  5B8B A;  2O8V B;  1M9A A;  2DJJ A;  4QL7 A;  1HD2 A;  3EYT A;  5J9B A;  1ZMA A;  4WF4 A;  2JAD A;  5COH A;  1GSS A;  3RAZ A;  5HR3 A;  3UEM A;  2RM6 A;  4Z2T A;  3MAK A;  3KJY A;  3TDG A;  3VUR A;  1T00 A;  4K1F A;  1DSB A;  2CAI A;  2B5E A;  2LRC A;  1EOG A;  1ZOF A;  2R2J A;  2OAD A;  4K8M A;  4O32 A;  1GSU A;  4HOJ A;  1TRW A;  2O87 A;  5ECI B;  2LST A;  4ILF A;  2A2P A;  5DCH A;  1YEP A;  4WR5 A;  4JZQ A;  3SWL A;  1GUH A;  13GS A;  2H66 A;  3VI7 A;  2XPD A;  5CYY A;  1I5G A;  4JE1 A;  4MP4 A;  3EE2 A;  3UMA A;  1QMV A;  2BMX A;  4P3Y B;  2MMA A;  5J5N A;  3IPZ A;  1ZYQ B;  4BVY B;  3LEF A;  2DIZ A;  1M2B A;  3VK9 A;  2KOK A;  4ECJ A;  4K6X A;  1R4W A;  1KTE A;  1BJX A;  3FHK A;  3G7Y A;  1THX A;  3FR6 A;  4E8E A;  1WE0 A;  2R4V A;  4TR4 A;  2VCV A;  2O85 A;  1G0T A;  1MD3 A;  2A2R A;  2F8F A;  3P2A A;  4L0W A;  2OE3 A;  5G5E A;  2IIY A;  5IMZ A;  1PSQ A;  2C80 A;  1O8X A;  2R0C A;  1WRY A;  1Q98 A;  1V9W A;  2GT5 A;  1CQH A;  4TKY A;  3Q74 A;  2J23 A;  4NWY A;  3US3 A;  3F9U A;  4LL1 B;  4CW9 A;  3EIN A;  1TU8 A;  2CV4 A;  4IQA A;  2GVP A;  4JU5 A;  4JED A;  1T4Z A;  1XVW A;  2C0F A;  5BMU A;  3FKF A;  3OR5 A;  5ENU A;  1ABA A;  5A4W A;  4IS0 A;  4J56 E;  2FCH A;  4D73 A;  5ECP B;  2H1A A;  1S3C A;  3TOT A;  5CRG A;  2HRA A;  1TRU A;  4ZL9 A;  2VIM A;  3APQ A;  3KH7 A;  2IN3 A;  1AW9 A;  3GIX A;  2DJ3 A;  5A5K A;  6GSW A;  2DLX A;  5IMD A;  3C73 A;  4XS6 A;  1GTU A;  5B6M A;  1AQW A;  1XW5 A;  5AIS A;  2FNO A;  1Z7P A;  5HR2 A;  1AUC A;  3D0Z A;  1PKZ A;  3TRQ A;  3FR3 A;  4HJM A;  5AN1 A;  3C7M A;  1XVQ A;  3LYP A;  3U6V A;  2HSY A;  1MTC A;  4MJE A;  1E6B A;  3FR9 A;  3F63 A;  1OE7 A;  1EGO A;  3DVX A;  1X9W B;  1GSE A;  3G9B A;  3IDV A;  3Q18 A;  2E0Q A;  1Z7R A;  3H93 A;  2HZF A;  5IPG A;  3NZN A;  4DSR A;  3ZFB A;  3HJO A;  3ZL5 A;  1HQO A;  3A5W A;  4V1A g;  3GKN A;  3E0U A;  1K0N A;  3UOM A;  1GTB A;  5C00 A;  2G2Q A;  3LYK A;  1TW9 A;  5EPF A;  3FZA A;  2LJA A;  4K0G A;  3MSZ A;  4IEL A;  2YP6 A;  5KN2 A;  3TKP A;  2P31 A;  5KN0 A;  3ZIT A;  1IYI A;  4MH2 A;  3FW2 A;  4PNG A;  4TXV A;  1SYR A;  2GQM A;  4GRF A;  3HA9 A;  5ECM B;  1PN0 A;  4I2U A;  4G9H A;  1RK4 A;  3QAV A;  2B7J A;  4OFT A;  3N5O A;  3EWL A;  3D5J A;  4N30 A;  5D9V A;  1EP7 A;  4IP1 A;  4POM A;  2OKA A;  1M99 A;  3HJP A;  5CRD A;  1JHB A;  4AJ7 A;  1PRX A;  3U5R E;  5KN3 A;  4F0B A;  1QXH A;  4G2E A;  1F2E A;  1A24 A;  4X1U A;  2GSS A;  5CRW A;  3GH6 A;  1VF3 A;  4KX4 A;  3IBH A;  3G7J A;  1DBY A;  5EVO A;  2CX4 A;  2XBQ A;  4I2T A;  4L0U A;  3HVX A;  1A2L A;  4IW9 A;  2VCQ A;  3DGQ A;  4F9Z A;  2VCX A;  1Y25 A;  2IJY A;  5DAK A;  3FZ5 A;  5ID2 A;  3LSZ A;  6GST A;  4Q5Q A;  3RPP A;  1NSW A;  4TXO A;  3DRN A;  2IFQ B;  2GZP A;  4J57 E;  1SYX A;  5IPH A;  3UVH A;  1ERT A;  1X5C A;  3LWA A;  4GCI A;  1AQV A;  4KE3 A;  16GS A;  2VL9 A;  5F8B A;  3KEB A;  2FGX A;  2C3T A;  5GZZ B;  3D6I A;  1MDJ A;  4PUR A;  2L4Q A;  2REM A;  2H74 A;  3H8Q A;  3KP8 A;  4JR6 A;  1GUL A;  2XPE A;  4ECI A;  1ILO A;  1FAA A;  2HZE A;  2WGR A;  3F4S A;  2A4H A;  3W8J A;  1AAZ A;  5LCZ A;  1V40 A;  1A23 A;  2GQK A;  1TI1 A;  1ZZY A;  3M3M A;  2B5Y A;  3ME7 A;  2IL3 A;  3CBU A;  4PQH A;  2CT6 A;  3WGE A;  2ON7 A;  5J3R A;  5H5S A;  2OE0 A;  1BYE A;  1PN9 A;  1FB0 A;  1M2A A;  4NHW A;  2HSM A;  3EMP A;  4KDU A;  4XTS A;  4IVF A;  3G7I A;  2X8H A;  5H5Q A;  3QDN A;  1IYH A;  2P5Q A;  3WT1 A;  1F3A A;  2I81 A;  3CSH A;  2JZT A;  3LXT A;  2H76 A;  4ID0 A;  4JRR A;  4XS4 B;  4F0C A;  2LJK A;  3RHB A;  3KTB A;  1FOH A;  3PPU A;  1O85 A;  3W8S A;  5GAN D;  5J4U A;  2L57 A;  5GSS A;  3GL5 A;  3VWU A;  12GS A;  4YQM A;  2FA4 A;  4ZL7 A;  3KCM A;  3I69 A;  5D9X A;  3LQ7 A;  4WKW A;  1TK8 B;  2ES7 A;  3M9J A;  4JR4 A;  2YNX A;  3EUR A;  3LXZ A;  1QFN A;  5DQS A;  3F4T A;  4KDX A;  1YQ1 A;  2I1U A;  4MJC A;  2DML A;  2XBI A;  4NV2 A;  4LLR A;  3M0F A;  2L5O A;  2LQQ A;  3LFL A;  2E2M A;  3GKX A;  1SKS B;  4YKG A;  4F2I A;  2OAC A;  1AC1 A;  4KUN A;  1DE2 A;  4TR1 B;  5HQP A;  4MH3 A;  5G5F A;  3HDC A;  2DIY A;  4G0K A;  1O7U A;  3QMX A;  4KH7 A;  4GLT A;  5CRH A;  1OC3 A;  1Z6M A;  3ZMK A;  2H1D A;  1SL0 B;  4TRX A;  3ZVJ A;  3CTG A;  3APO A;  2YWN A;  4OO4 A;  5FT3 A;  4GQF A;  2VL2 A;  2H6Z A;  2VL3 A;  2HFD A;  5ECQ B;  2R3X A;  4PQI A;  1O81 A;  1X0R A;  2H19 A;  5AGY A;  1EEJ A;  1BAY A;  4CY6 A;  3F3R A;  1YDK A;  3PIN A;  2PPT A;  2GS3 A;  4X0X A;  5G31 A;  3BCK A;  1J9B A;  2H75 A;  4G0L A;  4MF5 A;  2OE1 A;  1F3B A;  4ZIL A;  1SJI A;  2XC2 A;  2WB9 A;  2FY6 A;  5IIZ A;  1K3L A;  1PX6 A;  1NM3 A;  2QGV A;  1H75 A;  2VCZ A;  4WR4 A;  1OC9 B;  5AIV A;  4PX1 A;  1U88 A;  2JAC A;  3C1S A;  4EDY A;  1USB A;  1XWB A;  2HSH A;  5D73 A;  2FHE A;  3VFI A;  5DAL B;  5G2Z A;  3K8N A;  4OO5 A;  1YF0 A;  1K0O A;  3VWX A;  1SJZ A;  1EV9 A;  5GAP D;  2I4A A;  1PA3 A;  5F0G A;  1YKA A;  17GS A;  2GLR A;  3FZ4 A;  4IHU A;  6GSX A;  4X43 A;  1K0C A;  3ZIV A;  2WRT A;  1UN2 A;  1URM A;  5IQY A;  3TJB A;  3D4T A;  1TJD A;  4GSN A;  4PQ1 A;  2NPB A;  3HXS A;  3UBL A;  4AGS A;  1EOH A;  1S3D A;  1Z9H A;  2LNT A;  3LGC A;  1U87 A;  4Q5N A;  5IO0 A;  1GTI A;  3O76 A;  2X4A A;  1R5P A;  2K6V A;  4X4J A;  3ZLP A;  4G19 A;  3ISO A;  2A4V A;  2F8A A;  5JWQ B;  1AXD A;  2MMZ A;  2TRC P;  3M9K A;  3HJM A;  4BVX A;  4BWS A;  2CZ2 A;  1T3B A;  2H6X A;  1SJ6 A;  1WP0 A;  5CRE A;  1CQG A;  3L9V A;  3TKS C;  4K2D A;  2HI7 A;  1UA5 A;  2GSQ A;  3HZ8 A;  4L5L A;  4ECC A;  2WS2 A;  2ZCT A;  4ISD A;  5JCG A;  1A2J A;  1GL8 A;  2LRT A;  2PU9 C;  3IV4 A;  1ST9 A;  4RI6 A;  1B8X A;  1C72 A;  2HRF A;  2YWO A;  1TK0 B;  2HNL A;  4TVE A;  5CP1 A;  3TJJ A;  1A0R P;  4IBP A;  5JWR B;  3TRX A;  3HD5 A;  1BG5 A;  3Q6O A;  1V98 A;  2XHF A;  1X9S B;  4K7I A;  4IJI A;  1ZYP A;  1WMJ A;  4HS1 A;  3UVT A;  3DYR A;  1DE1 A;  4Z7X A;  1B4P A;  4E8H A;  4XS1 A;  4Z2U A;  1Z3E A;  3P8W A;  3F4R A;  2GZZ A;  4GWR A;  2DJ0 A;  3GKK A;  4MAB A;  4MPF A;  2V2G A;  4BVY A;  1THO A;  4CHS A;  1ML6 A;  3H79 A;  2FWE A;  2OBK A;  3GL3 A;  1WJK A;  1VF4 A;  1HNA A;  2GTU A;  1R7H A;  4EO3 A;  2JZS A;  4YKF A;  4K5R A;  2L59 A;  3FEU A;  5DCG A;  4PGT A;  1PX7 A;  1G7E A;  3L0H A;  1V2A A;  4OCE A;  5IO2 A;  2CA8 A;  4TR3 A;  1PGT A;  1PKW A;  3FMW A;  2VD1 A;  4QQ7 A;  4L8E A;  4MDC A;  5F07 A;  1SKW B;  3J7Y k;  3A2V A;  1RW1 A;  3E3E A;  5ECL B;  1GSQ A;  3GHA A;  2I9H A;  4MNN A;  2LKU A;  3KMO A;  3FZ9 A;  4GSS A;  4BL7 B;  1PMT A;  5IOX A;  2E7P A;  4QL9 A;  1QUW A;  3WT2 A;  4BA7 A;  2V6O A;  3MIX A;  2K8S A;  4MK3 A;  2JZR A;  2OJL A;  4OD7 A;  1GSD A;  4IGJ A;  2IMF A;  4ZXG A;  2C4J A;  3GRX A;  1JLV A;  2NBS A;  3CYN A;  3GTU B;  1X5D A;  1YZX A;  1V57 A;  1ZGN A;  1SL2 B;  1JZD A;  2DMM A;  5J41 A;  4MA9 A;  1AIU A;  4L5O A;  3I9V 2;  1PQN A;  2PBJ A;  3TCO A;  1B4Q A;  5JCU A;  5ID2 B;  4KA0 A;  5KOW A;  4POK A;  5HR0 A;  1QK8 A;  2GDR A;  1M0U A;  2NDO A;  3RBT A;  1J08 A;  2G0F A;  4ML6 A;  1MDI A;  1ZL9 A;  1PL1 A;  4N11 A;  4EL1 A;  2KUC A;  1GLP A;  4LMW A;  2K8V A;  2V1M A;  3WYW A;  4ZB9 A;  3M1G A;  10GS A;  3RDW A;  3KM6 A;  4V1A p;  2CZ3 A;  3D4M A;  2VCT A;  5CO3 A;  3TKQ A;  5L71 A;  4K0N A;  3C8E A;  4RI7 A;  4KW6 A;  4DVC A;  8GSS A;  3HYP A;  1M2D A;  4MJB A;  5JWO B;  4NMU A;  4FYB A;  1XOB A;  1O6J A;  4EIP A;  3A2X A;  1T7P B;  1EV4 A;  2H70 A;  2P0G A;  4BWQ A;  2TIR A;  4XRD A;  1A8L A;  3KP9 A;  3LW9 A;  2FWF A;  2LJR A;  3BJ5 A;  2LS5 A;  4PUA A;  3C1R A;  3FK8 A;  1DUG A;  3ZIJ A;  5DVB A;  4MJA A;  1R26 A;  4V2M A;  4Q5F A;  2YZH A;  2IMI A;  3GN3 A;  2N5A A;  3UIW A;  3KZQ A;  5DQY A;  4PXO A;  1FOV A;  5LD0 A;  2QC7 A;  3ERG A;  1OAZ A;  5KOX A;  2CAQ A;  2B7K A;  3IK7 A;  2UZ8 A;  4WEY A;  4XCS A;  4K7O A;  6GSU A;  3LG6 A;  1PD2 1;  3KH9 A;  3D22 A;  2QKE A;  2PN8 A;  3O6T A;  1LU4 A;  4ZBB A;  4KCE A;  3MYD A;  2L5L A;  1TOF A;  1KEB A;  3F6F A;  3P7X A;  1TU7 A;  1S3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...