2CV4A

Crystal structure of an archaeal peroxiredoxin from the aerobic hyperthermophilic crenarchaeon aeropyrum pernix k1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
241
structure length
240
Chain Sequence
PGSIPLIGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPVTTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHAESATHTVRGVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQARARMESGQYRCLDWWFCWDTPASRDDVEEARRYLRRAAEKPAKLLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords peroxiredoxin
publication title Crystal Structure of an Archaeal Peroxiredoxin from the Aerobic Hyperthermophilic Crenarchaeon Aeropyrum pernix K1
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Oxygen storage/transport
total genus 71
structure length 240
sequence length 241
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1020.20 Alpha Beta 2-Layer Sandwich Antioxidant, Horf6; Chain A, domain 2 Antioxidant, Horf6; Chain A, domain 2 2cv4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2cv4A01
4XS4B 3UMAA 1T3BA 2L59A 4GSSA 4IJ3A 3RDWA 3VFIA 1JFUA 9GSSA 2X8GA 5D8IA 2JU5A 1RK4A 5IMVA 3K8NA 3TJGA 4MF7A 4GQFA 2K9FA 4HOJA 2CA8A 5IOXA 4MP4A 5IPHA 1KNGA 3RAZA 3HA9A 3QPMA 2GZPA 4WETA 4MJBA 5D9VA 4ML6A 2G0FA 6GSTA 3O3TA 4HS1A 1OC9A 2HZEA 1A2LA 2C1YA 2I9HA 2VCVA 2TRCP 2C0FA 1OKTA 4IBPA 3P90A 1S3CA 4DVCA 1XWKA 1A0FA 4TR4A 3GKMA 1NSWA 2FWHA 5KN0A 1X5EA 4POMA 1K0OA 3LEFA 5ECQB 2EIRA 4XS6A 1GUMA 1DE2A 1G6YA 4LMVA 1TRSA 3LJRA 2PN8A 3Q74A 4MZCA 1O8XA 5F0GA 4Q5RA 3CSJA 1IYHA 3L78A 4JR4A 1NHYA 4K7OA 4FIWA 1U3AA 1M2AA 2DJKA 3C8EA 4OO5A 2AAWA 1ABAA 4FYUA 4ZB9A 1V40A 1SJIA 2A2RA 3G9BA 4ULXA 2WRTA 5IO0A 2GTUA 3ME8A 1DE1A 4EDZA 4L8EA 1U3IA 1K0BA 3P2AA 4HEA2 3US3A 3FK8A 3H8QA 1J0FA 1EV9A 4CHSA 1VF2A 4YAPA 5ECOB 2VD1A 4O32A 2H1AA 3EC3A 3ZYWA 4NV5A 4PQ1A 3A2XA 2GS3A 5JCGA 3APSA 2I4AA 5FWGA 3GL5A 2IMFA 2LSTA 5DQSA 2FY6A 5HR1A 3TRXA 2DBCA 1MDKA 3A3TA 3GTUB 4F03A 3CBUA 3NZNA 3QAVA 2B6MA 3GKNA 1SKWB 3M0FA 1GSQA 1PL1A 4EL1A 3VURA 4RI6A 2IMIA 1S3DA 1QXHA 5FHIA 4TVEA 3VI7A 1HNCA 1QUWA 5ECMB 3QCPA 1JLWA 4TW5A 1AIUA 2VD0A 3M9JA 3C71A 4KW6A 2JZTA 3IDVA 4XIHA 16GSA 2WDUA 1TDIA 3HVVA 2FWGA 5DVBA 3GKXA 2M46A 5IMDA 1MDIA 1NHOA 1PKWA 4L5LA 1GUKA 3G7IA 5EY6A 2H71A 2XHFA 4GSNA 4F0CA 4HUAA 4HQZA 2MMNA 4BA7A 3F4SA 4KH7A 2G2QA 1MD3A 2BJXA 3ZIVA 3N5OA 4MZBA 5G31A 1B48A 1ZL9A 4H86A 1G0TA 4IW9A 2L6CA 1B4QA 3F3QA 2LJAA 2CQ9A 3L9SA 3F63A 4MF5A 2LTKA 4MK3A 5CRGA 2H1DA 3ED3A 5GAPD 2I3YA 4XCSA 3ZRDA 5IOWA 5D9WA 1J9BA 4K8MA 2HRFA 1K3YA 2DJJA 1Z6MA 2EIQA 2CX3A 1EOGA 3WGEA 2VOCA 2C0GA 2MMOA 1A0RP 1SK1A 2EC4A 3ISOA 1VGLA 3HYPA 4GF0A 4TOPA 4KCAA 4AJ6A 3QOUA 2PU9C 2L57A 4F9ZA 1GNEA 2DMMA 2PUKC 3S9FA 5COHA 2FCHA 3TCOA 2HT9A 5ABRA 3A2WA 2C0EA 4V2NA 2V41A 4I5QA 1SKRB 3J7Yk 2LKUA 2HE3A 4XS1A 4ISDA 5D9XA 3LXZA 5ENUA 4QL7A 2GQLA 1AQVA 4MZWA 5CRHA 2YWMA 1RW1A 4BVYA 1LU4A 1GSUA 2F3MA 1EGRA 5IIZA 3P8WA 4FH8A 1YQ1A 3HJMA 2DJ1A 3RPPA 1TKDB 1YZXA 3D22A 1RQMA 2MYGA 3EMXA 4NMUA 1K0NA 1OKDA 4IQAA 4TXVA 5CRWA 3RHBA 1F3AA 4LL1B 4V2MA 1TOFA 2LQQA 3MSZA 1AUCA 4EXJA 1EEJA 1LJRA 1WP0A 2VM2A 2IMEA 1R7HA 2K6VA 1FAAA 3TRQA 4ML1A 3PGTA 2V32A 2IFQA 4NXIA 3GYKA 1T4ZA 1WRYA 1R5PA 4IHUA 4NV2A 1M2DA 2PVOC 3H1NA 5DCGA 3IR4A 1HYUA 2FD3A 4PQHA 1V2AA 2LJRA 3CYNA 2FWFA 2VCXA 4MPFA 3KTLA 5H5SA 1GLPA 2JSYA 4DSSB 1U87A 3WT1A 1CQGA 5DQYA 2VCQA 2PGTA 3LQ7A 3WT2A 4D73B 4WKWA 2MBTA 3FRCA 1AAZA 1XPVA 2YV9A 4MMMA 4X43A 1PQNA 1SYXA 2OACA 1SK0A 3DYRA 1A8YA 2IPAA 4K7NA 4Q5NA 3ERFA 2YP6A 4K9ZA 1W4VA 6GSYA 4V1Ap 3E0UA 2V6OA 3WYWA 4KAEA 1F9MA 1Z7RA 3MAKA 3ERWA 2PBJA 3C1RA 4J56E 2KP2A 2OBKA 1Q98A 1WMJA 2K8SA 3HDCA 4IJIA 5DAKB 1XBSA 3GL3A 1XW5A 1MDJA 5IM9A 3KMOA 3J7Yb 3UBLA 2C3TA 1KTEA 1SENA 4XRAA 3FR3A 1WOUA 2P5RA 3DMLA 2AHEA 4MDCA 3FW2A 3UBKA 2GSTA 2TRXA 3KM6A 4TXOA 3FZAA 5GSTA 4OFNA 3HVSA 1I5GA 4I2UA 5A4WA 3MWHA 4YQUA 2LRTA 5DALB 4ZBDA 1MEKA 3GH9A 2FA4A 2WJUA 3FR6A 2GSRA 1EP8A 2V1MA 3LFLA 5HR0A 4CDOA 5B8BA 3TB2A 1PN9A 5ID2A 4OCFA 3BD2A 5F06A 4GQCA 4TRXA 3ZTLA 1EP7A 1FB6A 2WULA 11GSA 2B7KA 2LS5A 2H66A 1XIYA 1DUGA 3TRPA 2XC2A 5AN1A 5LNKe 3F4TA 4JZQA 4WBRD 1I9DA 4AJ7A 2CZ3A 2RM6A 3IE3A 1AC1A 1AXDA 4XS4A 3FYGA 3CMIA 1M7TA 5G2ZA 3IXRA 4RUVA 4HZ2A 5C00A 4TR1B 4IKHA 2IMKA 2PPTA 2X64A 3HKRA 1THXA 2ZCTA 2H76A 5B7CA 1GWCA 3HVXA 1JLVA 4MF6A 4K1FA 3GSSA 3EU4A 3Q6OA 3TKSE 3KJYA 4JR6A 2HZFA 2GQMA 2OJLA 2LNTA 4HZ4A 1V98A 3GSTA 4ECJA 1ZZYA 3BJ5A 4G2EA 2CT6A 5C04A 3APOA 1URMA 3SBCA 2HLSA 4TR0A 2ON7A 2JZRA 1PMTA 4WXTA 2PVQA 3RBTA 1GSSA 4DSQA 4NAXA 2E2MA 5CYYA 1SYRA 5HFIA 1A23A 1XWCA 4PUAA 2NBSA 4YAVA 5L71A 4BVXA 3EE2A 4PNGA 4X1UA 3W8SA 3WGXA 1K0MA 2ES7A 1V58A 1B9XC 3D0ZA 4XHMA 3HY2A 3UOMA 5IO2A 1Z7PA 3IRAA 1SD8A 4QQ7A 1FB0A 4GTUA 2BTOT 1BYEA 1U6TA 3EU3A 1XVWA 2B5XA 5D73A 2ZNMA 1XFLA 2IMDA 2DJ0A 5JWQB 2HSYA 3I43A 3VWXA 3GKKA 3L4NA 4ECBA 1ERUA 5G5EA 2IN3A 4YQMA 4J57E 2H30A 2H01A 2VCZA 3LSZA 4GSTA 3F6DA 3EWLA 3H93A 3MNGA 5H5QA 4N11A 5DJMA 3CSIA 4ZL7A 2VO4A 1EOHA 2O89A 3ZMLA 3ZZXA 3IPZA 1O7UA 1YF0A 1WJKA 4PGTA 12GSA 2R37A 4MPGA 2AJQB 4GRFA 2CVDA 4OCEA 1AQXA 2O87A 3GV1A 5G1LA 3E3EA 3GURA 2XBIA 1ERTA 4PURA 3W8JA 4ZL8A 2F51A 3FKFA 4IQ1A 3C1SA 3NIVA 3JCML 2GGTA 3GTUA 4MA9A 5CRDA 3PR8A 2LQOA 5A5KA 5EVOA 4MH2A 2M80A 4HQSA 2OBIA 2QSIA 2NPBA 3IAM2 2D2ZA 1QMVA 4OD7A 1F3BA 2YWNA 1ZCPA 4O92A 4J2FA 2OKAA 4RI7A 2P31A 5G5FA 2WGRA 3QAWA 3KD0A 4QL9A 3ZITA 1GH2A 2M72A 5KN3A 1MD4A 5HR2A 4NHZA 3H79A 2PMTA 2PERA 3UVHA 3GX8A 3WD6A 4P3YB 5J5NA 1T8EB 1F37A 1BG5A 1VF4A 3C7MA 2HNLA 1T4YA 5E59A 1ZGNA 1GTBA 4I97A 1UA5A 1NM3A 1G6WA 1K0DA 3ZMKA 5ECHB 3D5JA 1ACVA 1M9AA 4OMVA 1TRVA 1R26A 3ZREA 14GSA 3QFBC 5DJLA 3F6FA 3U5RE 1QK8A 2VAFA 1USBA 4EUYA 5IMZA 2C80A 4F2IA 1X9WB 5AIVA 1GSFA 3O6TA 2H70A 4V2LA 2R5GA 2H74A 5J4UA 2FLSA 1A24A 3EURA 4EDYA 1X0RA 3GN3A 3F0IA 1XVQA 4TKYA 1YKAA 3N9JA 1SKSB 2N5AA 3KXOA 2VLUA 2O85A 1FO5A 4KE3A 2TIRA 5LD0A 2B3SA 3PINA 6GSWA 5J9CA 1VF1A 1U88A 3DRNA 2EIOA 4ZL9A 2YJ7A 1UN2A 3I69A 2KLXA 1M9BA 4AGSA 1XW9A 3UAPA 3I6AA 4EC0A 3RPNA 1QGVA 4ZBAA 3ME7A 1IYIA 2I81A 3F8UA 5F07A 4KUNA 1ON4A 4IELA 5GAND 2JSZA 2R4VA 3D6IA 1WWJA 1EGOA 3W6GA 3VWVA 2I1UA 4OO4A 2C8UA 2FHEA 1ZYEA 3CXGA 1LBKA 2MMZA 3LXTA 2HSHA 18GSA 2F8FA 3DEXA 2V2GA 2YJHA 4HU9A 1ILOA 5J3RA 4IP1A 1J08A 5ECNB 3HHVA 1PRXA 2LRCA 5ECPB 1X9MB 4LL4B 1GULA 3QDNA 1FG4A 2FUG2 5F8BA 3KP8A 3VPQA 2R3XA 1CQHA 4RQRA 2K18A 4KCEA 3KP9A 3PH9A 2DIYA 3DVXA 4OFTA 2YZUA 3ZVJD 4JBBA 1XOBA 4ZXGA 2LNSA 4ECIA 2OADA 2VM1A 4XTSA 3VPTA 5AISA 1MTCA 2OE1A 3FZ5A 4AF2A 4GXZA 3HZ4A 1BJXA 2YNXA 1ERVA 4MJAA 6GSXA 4DSSA 4EKZA 1DBYA 5D93A 1GNWA 2PWJA 4BL7A 4D73A 4BWSA 4HJ2A 2OE3A 4HDEA 2CV4A 3UIWA 2C3NA 2JZSA 4MJEA 1Z3EA 2HRNA 3WGDA 2WB9A 3IHQA 1YJ6A 2RLIA 1TK8B 4GWRA 3VWWA 4K2DA 2RM5A 22GSA 1EWXA 3HD5A 4MH3A 4IN0A 2DC5A 2H6YA 1THOA 1TU7A 3DD3A 5KEJA 2CZ2A 4KDYA 3APQA 1W89A 3L0HA 5DAKA 3GHAA 5B8AA 4Q5FA 1AQWA 1JHBA 4TR3A 13GSA 4IS0A 2GLRA 1O6JA 5CAXA 4NHWA 2YWIA 2H73A 1O85A 4HJMA 2VCTA 2XBQA 2FGXA 1QQ2A 5DALA 3KTBA 1HNAA 3P7XA 4KSMA 2FA8A 4EE0A 1XOAA 1TK0B 3DGQA 3QR6A 3LGCA 3A5WA 1JZOA 4CW9A 1M2BA 3SWLA 3CRUA 4ECCA 3I9V2 1E2YA 4KB3A 1BQ7A 3L9UA 2GVPA 4G10A 1FW1A 5EL8A 1OAZA 4ZIJA 4I2TA 2HXKA 5LCZA 4N0VA 2F9SA 3KGKA 3GRXA 2MZCA 2L5LA 1S3AA 1TK5B 1GSDA 2L6DA 3TUEA 3TKPA 1GL8A 3DKSA 5HQPA 3QAGA 3IOSA 3G7JA 3Q19A 1HNBA 1GSEA 3M3MA 3KZQA 5CP1A 2LEGA 3GA4A 1WPIA 3FHKA 3EVIA 2GQKA 4GCIA 2GZZA 3UARA 4KDUA 1HD2A 4TR1A 5B6MA 4E8EA 5KN1A 1WE0A 2L4QA 1OC8A 3Q18A 1T7PB 2BMXA 2YV7A 4ZBBA 4BWQA 5HR3A 2DIZA 2X99A 3F9UA 5ECRB 3IC4A 1PA3A 1GTIA 3KCMA 3M1GA 5A4UA 4PQIA 2XPEA 1OYJA 1C72A 2FWEA 5JCUA 3RHCA 2AV4A 4WBJA 2ON5A 3TJKA 1GUHA 2H6XA 1X5DA 2V6KA 3VK9A 4N30A 1TI1A 2WCIA 3ZL5A 2QC7A 3V1WA 3KEBA 17GSA 2WS2A 2HFDA 2KOKA 4MJCA 3KIJA 2AUVA 1EEMA 3TOUA 2K8VA 1FVJA 1A8LA 3HJPA 8GSSA 1WIKA 1GTUA 2JACA 3HCZA 1OC9B 2HZEB 4FO5A 5JCWA 2NTOA 3UEMA 1VF3A 2QKEA 1K0AA 3DVWA 3DWVA 1PD21 1GP1A 1M0UA 20GSA 2YOIA 4V1Ag 4OWYA 4WF4A 3ZFLA 5IMAA 1SU9A 2ZUPA 4Q5QA 2B7JA 1H75A 3HJOA 4JRRA 1V57A 2VLTA 2QGVA 3DIEA 5FT3A 1BEDA 1M99A 5JWRB 3TGZA 3UVTA 3GX0A 2E0QA 1K0CA 4EVMA 3GMFA 4POBA 3CTFA 3ERGA 1TW9A 4ID0A 3F3RA 3KH9A 1FOVA 2IWTA 1SD9A 2KHPA 4BPYA 5DDLA 4K0GA 2O8VB 2R6KA 4X0XA 4ZB6A 3VWUA 3BOAA 4EF0A 3G7YA 1YDKA 4MABA 5CNWA 2P0GA 3TOTA 3FR9A 2DJ3A 1X9SB 1ZMAA 1PL2A 2J9HA 2R2JA 3TKSA 2J23A 2NDOA 4KGIA 4POLA 5F05A 5ECLB 2YWOA 4L0UA 2NVLA 2YANA 1Z9HA 5ECIB 4YH2A 3IA1A 1SJZA 4IVFA 3BBYA 3EMPA 2C0DA 4MCUA 2LUSA 5ELGA 1ST9A 2XPDA 2H8LA 2A4VA 3R2QA 5HFGA 4N0ZA 4E8HA 4G19A 2N5FA 5CO3A 1JZRA 1NW2A 2B1KA 2H1GA 4O7HA 3ZLPA 2N5BA 1TP9A 2OA7A 2FNOA 1N8JA 3H4KA 2C4JA 3LORA 5ECSA 1A2JA 3CTGA 4OFMA 1R5AA 1GLQA 3FY7A 1E6BA 1GSYA 3D4TA 4TN8A 1ERWA 2OE0A 2X8CA 1XZOA 3ZVJA 6GSUA 1VRSD 4HI7A 1ML6A 2WZ9A 1K3LA 4YQVA 4O5RA 1PKZA 5DCHA 4PX1A 1DSBA 2VIMA 1YF1A 3BCIA 1BAYA 1YY7A 1EZKA 1O81A 4NWYA 4JU5A 4I8BA 2KUCA 3TJJA 2DJ2A 2DLXA 5G30A 1OE8A 4F82A 3VLNA 2E7PA 1ZOFA 4K7IA 3NOFA 4KA0A 4F0BA 2H0IA 1FHEA 2A2SA 5D96A 5D9TA 2YPMA 2GSSA 2H72A 2MMAA 2VL3A 3LWAA 2H6ZA 1XWGA 6GSVA 2YN1A 1O73A 1XWBA 1GRXA 3O76A 3GNJA 7GSSA 5B6NA 3M8NA 2P5QA 2YCDA 1SL2B 5KN2A 2CAIA 4DSRA 1Q4JA 1ZYQB 2B1LA 1XCCA 2Z9SA 3TJBA 2HI7A 1UC7A 4GLTA 3IV4A 4PNFA 2IL3A 2GSQA 4AJ8A 4HU7A 4FYCA 3HZ8A 3CSHA 3MDKA 2RUFA 3TKRA 4JEDA 1R4WA 1FVKA 2E2GA 3TJFA 2VL2C 1KBNA 4MLYA 1B8XA 4KNDA 1A2MA 3LYPA 3IAS2 1BX9A 2WFCA 5GSSA 2F8AA 2JL4A 4WF5A 2H0HA 5GZZB 10GSA 4WR5A 5IPGA 5ELAA 3ZFBA 5CREA 5J9BA 2RUEA 2VLVA 2KP1A 2YZHA 4ILFA 3UL3A 1G7EA 1YEXA 5INYA 1H4OA 1O8WA 5G1KA 2AYTA 3KMNA 2GZYA 3OR5A 1Z6NA 4ZILA 1TRUA 1TJDA 1SK2A 2H1BA 2RIIA 3BCKA 1TI3A 1SL1B 1SL0B 4EO3A 3LG6A 5ECKB 3E9JB 4PUFC 2CX4A 5E4WA 4PXOA 1OE7A 2IIYA 2X8HA 3CRTA 5IMCA 2CVKA 4JE1A 3QFAC 2H0GA 1Y25A 1X5CA 2VL9A 1PX6A 3D21A 1PGTA 3LYKA 1F2EA 5H5RA 5J41A 1TRWA 1T1VA 2HYXA 2H75A 4LMWA 3IK7A 2IFQB 1Y6EA 3HXSA 1TXXA 2JADA 1TU8A 2LRNA 3EYTA 1TTZA 1YKCA 2B5EA 1B9YC 2REMA 4ACSA 5AGYA 4DEJA 5JWOB 19GSA 2AB6A 2GDRA 2IJYA 1OVNA 2ALBA 2CAQA 1T00A 2O7KA 1K3OA 3GFKA 3VI5A 2GT6A 3C73A 2CVBA 3IBHA 2L4CA 4NPBA 1XXUA 1GTAA 2DSAA 4KDXA 4LLRA 4WEYA 5DBQA 3L9VA 1QFNA 3QMXA 3GH6A 1EV4A 2GT5A 4K6XA 2LJKA 3TDGA 4WR4A 3FZ9A 1OC3A 5IQYA 1F6MC 3D4MA 1JZDA 4IP6A 3FZ4A 4KX4A 3GUSA 1N2AA 4ZB8A 1XW6A 4TXOB 3TKSC 1KEBA 4L0WA 4L5OA 4XRDA 1SJ6A 5AIXA 3TKQA 4N10A 1HQOA 3GIXA 3F4RA 2H19A 1AW9A 2C3QA 3QD9A 4LA1A 2VL2A 2VCWA 4Z7XA 3ZIJA 3IK9A 2LV3A 4KSOA 6GSSA 1PSQA 5ID2B 4I6XA 4K0NA 3UJ1A 3U6VA 1JZWA 5A4VA 2VUPA 3M9KA 1PX7A 3AY8A 3FEUA 2MBSA 4RQXA 1G7OA 2B5YA 3KH7A 1B4PA 1XWAA 4G9HA 1V9WA 5IMFA 1UVZA 5EPFA 1Z5YE 5HFKA 4POKA 2L5OA 3A2VA 3EINA 3DXBA 1YEPA 4FYBA 2DMLA 4IGJA
chains in the Genus database with same CATH superfamily
4XS4B 3UMAA 1T3BA 2L59A 4GSSA 4IJ3A 3RDWA 3VFIA 1JFUA 9GSSA 2X8GA 5D8IA 2JU5A 1RK4A 5IMVA 3K8NA 3TJGA 4MF7A 4GQFA 3HVNA 2K9FA 4HOJA 2CA8A 5IOXA 4MP4A 5IPHA 1KNGA 3RAZA 3HA9A 3QPMA 2A4HA 2GZPA 4WETA 4MJBA 5D9VA 4ML6A 2G0FA 6GSTA 3O3TA 4HS1A 1OC9A 2HZEA 1A2LA 2C1YA 2I9HA 2VCVA 2TRCP 2DKIA 2C0FA 1OKTA 4IBPA 3P90A 1S3CA 4DVCA 1XWKA 1A0FA 4TR4A 3GKMA 4BVXB 1NSWA 2FWHA 5KN0A 1X5EA 4USSA 4POMA 1K0OA 3LEFA 5ECQB 2EIRA 4XS6A 1GUMA 1DE2A 1G6YA 4LMVA 1TRSA 3LJRA 2PN8A 3Q74A 4MZCA 1O8XA 5F0GA 4Q5RA 3CSJA 1IYHA 3L78A 4JR4A 1NHYA 4K7OA 4YKFA 4FIWA 1U3AA 1M2AA 2DJKA 3C8EA 4OO5A 2AAWA 1ABAA 4FYUA 4ZB9A 1V40A 1SJIA 2A2RA 3G9BA 4ULXA 2WRTA 5IO0A 2GTUA 4O5UA 3ME8A 1DE1A 4EDZA 4L8EA 1U3IA 1K0BA 3P2AA 4HEA2 3US3A 3FK8A 5BRTA 3H8QA 1J0FA 1EV9A 4CHSA 1VF2A 4YAPA 5ECOB 2VD1A 4O32A 2H1AA 3EC3A 3ZYWA 4NV5A 4PQ1A 3A2XA 2GS3A 5JCGA 3APSA 2I4AA 5FWGA 3GL5A 2IMFA 2LSTA 5DQSA 2FY6A 4K5RA 5HR1A 3TRXA 2DBCA 1MDKA 3A3TA 3GTUB 4F03A 3CBUA 3NZNA 3QAVA 2B6MA 3GKNA 1SKWB 3M0FA 1GSQA 1PL1A 4EL1A 3VURA 4RI6A 2IMIA 1S3DA 1QXHA 5FHIA 4TVEA 3VI7A 1HNCA 1QUWA 5ECMB 3PPUA 3QCPA 1JLWA 4TW5A 1AIUA 2VD0A 3M9JA 3C71A 4KW6A 2JZTA 3IDVA 4XIHA 16GSA 2WDUA 1TDIA 3HVVA 2FWGA 5DVBA 3GKXA 2M46A 5IMDA 1MDIA 1NHOA 1PKWA 4L5LA 1GUKA 3G7IA 5EY6A 2H71A 2XHFA 4GSNA 4F0CA 4HUAA 4HQZA 2MMNA 4BA7A 3F4SA 4KH7A 2G2QA 1MD3A 2BJXA 3ZIVA 3N5OA 4MZBA 5G31A 1B48A 1ZL9A 3IHGA 4H86A 1G0TA 4IW9A 2L6CA 1B4QA 3F3QA 2LJAA 2CQ9A 3L9SA 3F63A 4MF5A 2LTKA 4MK3A 2HRAA 5CRGA 2H1DA 3ED3A 5GAPD 2I3YA 4XCSA 3ZRDA 5IOWA 5D9WA 1J9BA 4K8MA 2HRFA 1K3YA 1PFOA 2DJJA 1Z6MA 2EIQA 2CX3A 1EOGA 3WGEA 2VOCA 2C0GA 2MMOA 1A0RP 1SK1A 2EC4A 3ISOA 1VGLA 3HYPA 2R0PA 4GF0A 4TOPA 4KCAA 4AJ6A 3QOUA 1XG8A 2PU9C 2L57A 4F9ZA 1GNEA 2DMMA 2PUKC 3S9FA 5COHA 2FCHA 3TCOA 2HT9A 5ABRA 3A2WA 2C0EA 4V2NA 2V41A 4I5QA 1SKRB 3J7Yk 2LKUA 2HE3A 4XS1A 4ISDA 5D9XA 3LXZA 5ENUA 4QL7A 2GQLA 1AQVA 4MZWA 5CRHA 2YWMA 1RW1A 4BVYA 1LU4A 1GSUA 2F3MA 1EGRA 5IIZA 3P8WA 4FH8A 1YQ1A 3HJMA 2DJ1A 3RPPA 1TKDB 1YZXA 3D22A 1RQMA 2MYGA 3EMXA 4NMUA 1K0NA 1OKDA 4IQAA 4TXVA 5CRWA 3RHBA 2X49A 1F3AA 4ICYA 4LL1B 4V2MA 1TOFA 2LQQA 3MSZA 1AUCA 4EXJA 1EEJA 3EPTA 1LJRA 1WP0A 2VM2A 2IMEA 1R7HA 2K6VA 4HSCX 1FAAA 3TRQA 4ML1A 3PGTA 2V32A 2IFQA 4NXIA 3GYKA 1T4ZA 1WRYA 1R5PA 4IHUA 4NV2A 1M2DA 2PVOC 3H1NA 5DCGA 3IR4A 1HYUA 2FD3A 4PQHA 1V2AA 2LJRA 3CYNA 2FWFA 2VCXA 4MPFA 3KTLA 5H5SA 1GLPA 2JSYA 4DSSB 1U87A 3WT1A 1CQGA 5DQYA 2VCQA 4BL7B 2PGTA 3LQ7A 3WT2A 4D73B 4WKWA 2MBTA 1AAZA 3FRCA 1XPVA 1ZYNA 2YV9A 4MMMA 4X43A 1PQNA 1SYXA 2OACA 1SK0A 3DYRA 1A8YA 2IPAA 4K7NA 4Q5NA 3ERFA 2YP6A 4K9ZA 1W4VA 6GSYA 4V1Ap 3E0UA 2V6OA 3WYWA 4KAEA 1F9MA 1Z7RA 3MAKA 3ERWA 2PBJA 3C1RA 4J56E 2KP2A 2OBKA 1Q98A 1WMJA 2K8SA 3HDCA 4IJIA 5DAKB 1XBSA 3GL3A 1XW5A 1MDJA 5IM9A 3KMOA 3J7Yb 3UBLA 2C3TA 1KTEA 4G0LA 1SENA 4XRAA 3FR3A 1WOUA 2P5RA 4G0IA 3DMLA 2AHEA 4MDCA 3FW2A 3UBKA 4Z2UA 4K2XA 2GSTA 2TRXA 3KM6A 4TXOA 3FZAA 5GSTA 4OFNA 3HVSA 1I5GA 4I2UA 5A4WA 3MWHA 4YQUA 2LRTA 5DALB 4ZBDA 1MEKA 3GH9A 2FA4A 2WJUA 3FR6A 4K5SA 2GSRA 1EP8A 2V1MA 1S3RA 3LFLA 5HR0A 4CDOA 5B8BA 3TB2A 1PN9A 5ID2A 2DKHA 4OCFA 3BD2A 5F06A 4GQCA 4TRXA 3ZTLA 1EP7A 1FB6A 2WULA 11GSA 2B7KA 2LS5A 2H66A 1XIYA 2UZ8A 1DUGA 3TRPA 2XC2A 5AN1A 5LNKe 3F4TA 4JZQA 4WBRD 1I9DA 4AJ7A 2CZ3A 2RM6A 3IE3A 1AC1A 1AXDA 4XS4A 3FYGA 3CMIA 1M7TA 5G2ZA 3IXRA 4RUVA 4HZ2A 5C00A 4TR1B 4IKHA 2IMKA 2PPTA 2X64A 3HKRA 1THXA 2ZCTA 2H76A 5B7CA 1GWCA 3HVXA 1JLVA 4MF6A 4K1FA 3GSSA 3EU4A 3Q6OA 3TKSE 3KJYA 4JR6A 2HZFA 2GQMA 2OJLA 2LNTA 4HZ4A 1V98A 3GSTA 4ECJA 1ZZYA 3BJ5A 4G2EA 2CT6A 5C04A 3APOA 1URMA 3SBCA 2HLSA 4TR0A 2ON7A 2JZRA 1PMTA 4WXTA 2PVQA 3RBTA 1GSSA 4DSQA 4NAXA 2E2MA 5CYYA 1SYRA 5HFIA 1A23A 1XWCA 4PUAA 2NBSA 4YAVA 5L71A 4FQUA 4BVXA 3EE2A 4PNGA 4X1UA 3W8SA 3WGXA 1K0MA 2ES7A 1V58A 1B9XC 3D0ZA 4XHMA 3HY2A 3UOMA 5IO2A 1Z7PA 3IRAA 1SD8A 4QQ7A 4PTSA 1FB0A 4GTUA 2BTOT 1BYEA 1U6TA 3EU3A 1XVWA 2B5XA 5D73A 2ZNMA 1XFLA 2IMDA 2DJ0A 5JWQB 2HSYA 3I43A 3VWXA 3GKKA 2X4AA 3L4NA 4ECBA 1ERUA 5G5EA 2IN3A 4YQMA 4J57E 3MYDA 2H30A 2H01A 2VCZA 3LSZA 4GSTA 3F6DA 3EWLA 3H93A 3MNGA 5H5QA 4N11A 5DJMA 3CSIA 4ZL7A 2VO4A 1EOHA 2O89A 3ZMLA 3ZZXA 3IPZA 1O7UA 1YF0A 1WJKA 4PGTA 12GSA 2R37A 4MPGA 2AJQB 4GRFA 2CVDA 3IC8A 4OCEA 1AQXA 2O87A 3GV1A 5G1LA 3E3EA 3GURA 2XBIA 1ERTA 4PURA 3W8JA 4ZL8A 2F51A 3FKFA 4IQ1A 3C1SA 3NIVA 3JCML 2GGTA 3GTUA 4MA9A 5CRDA 3PR8A 2LQOA 5A5KA 5EVOA 4MH2A 2M80A 4HQSA 2OBIA 2QSIA 2NPBA 3IAM2 2D2ZA 1QMVA 4OD7A 1F3BA 2YWNA 1ZCPA 4MNNA 4O92A 4J2FA 2OKAA 4RI7A 2P31A 5G5FA 2WGRA 3QAWA 3KD0A 4QL9A 3ZITA 1GH2A 2M72A 5KN3A 1MD4A 5HR2A 4NHZA 3H79A 2PMTA 2PERA 3UVHA 3GX8A 3WD6A 4X4JA 4P3YB 5J5NA 1T8EB 1F37A 1BG5A 1VF4A 3C7MA 2HNLA 1T4YA 5E59A 1ZGNA 1GTBA 4I97A 1UA5A 1NM3A 1G6WA 1K0DA 3ZMKA 5ECHB 3D5JA 1ACVA 1M9AA 4OMVA 1TRVA 1R26A 3ZREA 14GSA 3QFBC 5DJLA 3F6FA 3U5RE 1QK8A 2VAFA 1USBA 4EUYA 5IMZA 2C80A 4F2IA 1X9WB 5AIVA 1GSFA 3O6TA 2H70A 4V2LA 2R5GA 2H74A 5J4UA 2FLSA 1A24A 3EURA 4EDYA 1X0RA 3GN3A 3F0IA 1XVQA 4TKYA 1YKAA 3N9JA 1SKSB 2N5AA 3KXOA 2VLUA 2O85A 1FO5A 4KE3A 2TIRA 5LD0A 2B3SA 3PINA 6GSWA 5J9CA 1VF1A 4G0KA 1U88A 3DRNA 2EIOA 4ZL9A 2YJ7A 1UN2A 3I69A 2KLXA 1M9BA 4AGSA 1XW9A 3UAPA 3I6AA 4EC0A 3RPNA 4O5QA 1QGVA 4ZBAA 3ME7A 1IYIA 2I81A 3F8UA 5F07A 4KUNA 1ON4A 4IELA 5GAND 2JSZA 2R4VA 1M3JA 3D6IA 1WWJA 1EGOA 3W6GA 1M3IA 3VWVA 2I1UA 4OO4A 2C8UA 2FHEA 1ZYEA 3CXGA 1LBKA 2MMZA 3LXTA 2HSHA 18GSA 2F8FA 3DEXA 2V2GA 2YJHA 4HU9A 1ILOA 5J3RA 4IP1A 1J08A 5ECNB 3HHVA 1PRXA 2LRCA 5ECPB 1X9MB 4LL4B 1GULA 3QDNA 1FG4A 2FUG2 5F8BA 3KP8A 3VPQA 2R3XA 1CQHA 4RQRA 2K18A 4KCEA 3KP9A 3PH9A 2DIYA 3DVXA 4OFTA 2YZUA 3ZVJD 4JBBA 1XOBA 4ZXGA 2LNSA 3FMWA 4ECIA 2OADA 2VM1A 4XTSA 3VPTA 5AISA 1MTCA 2OE1A 3FZ5A 4AF2A 4GXZA 3HZ4A 1BJXA 2YNXA 1ERVA 4MJAA 6GSXA 4DSSA 4EKZA 1DBYA 5D93A 1GNWA 2PWJA 4BL7A 4D73A 4BWSA 4HJ2A 2OE3A 4HDEA 2CV4A 3UIWA 2C3NA 2JZSA 4MJEA 1Z3EA 2HRNA 3WGDA 2WB9A 3IHQA 1YJ6A 2RLIA 1TK8B 4GWRA 3VWWA 4K2DA 2RM5A 22GSA 1EWXA 3HD5A 4MH3A 4IN0A 2DC5A 2H6YA 1THOA 1TU7A 3DD3A 5KEJA 2CZ2A 4KDYA 3LW9A 3APQA 1W89A 3L0HA 5DAKA 3GHAA 5B8AA 4Q5FA 1AQWA 1PN0A 1JHBA 4TR3A 13GSA 4IS0A 2GLRA 1O6JA 5CAXA 4NHWA 2YWIA 2H73A 1O85A 4HJMA 2VCTA 2XBQA 2FGXA 1QQ2A 1FOHA 5DALA 3KTBA 1HNAA 3P7XA 4KSMA 2FA8A 4EE0A 1XOAA 1TK0B 3DGQA 3QR6A 3LGCA 3A5WA 1JZOA 4CW9A 1M2BA 3SWLA 3CRUA 4ECCA 3I9V2 1E2YA 4KB3A 1BQ7A 3L9UA 2GVPA 4G10A 1FW1A 5EL8A 1OAZA 4ZIJA 4I2TA 2HXKA 5LCZA 4N0VA 2F9SA 3KGKA 3GRXA 2MZCA 2L5LA 2QA2A 1S3AA 1TK5B 1GSDA 2L6DA 3TUEA 3TKPA 1GL8A 3DKSA 5HQPA 3QAGA 3IOSA 3G7JA 3Q19A 1HNBA 1GSEA 3M3MA 3KZQA 5CP1A 2LEGA 3GA4A 1WPIA 3FHKA 3EVIA 2GQKA 4GCIA 2GZZA 3UARA 4KDUA 1HD2A 4TR1A 5B6MA 4E8EA 5KN1A 1WE0A 2L4QA 1OC8A 3R3EA 3Q18A 1T7PB 2BMXA 2YV7A 4ZBBA 4BWQA 5HR3A 2DIZA 2X99A 3F9UA 5ECRB 3IC4A 1PA3A 1GTIA 3KCMA 3M1GA 5A4UA 4PQIA 2XPEA 1OYJA 1C72A 2FWEA 5JCUA 3RHCA 2AV4A 4WBJA 2ON5A 3TJKA 1GUHA 2H6XA 1X5DA 2V6KA 3VK9A 4N30A 1TI1A 2WCIA 3ZL5A 2QC7A 3V1WA 3KEBA 17GSA 2WS2A 2HFDA 2KOKA 4MJCA 3KIJA 2AUVA 1EEMA 3TOUA 2K8VA 1FVJA 1A8LA 3HJPA 8GSSA 1WIKA 1GTUA 2JACA 3HCZA 1OC9B 2HZEB 4FO5A 5JCWA 2NTOA 3UEMA 1VF3A 2QKEA 1K0AA 3DVWA 3DWVA 1PD21 1GP1A 1M0UA 20GSA 2YOIA 4V1Ag 4OWYA 4WF4A 3ZFLA 5IMAA 1SU9A 2ZUPA 4Q5QA 2B7JA 1H75A 3HJOA 4JRRA 1V57A 2VLTA 2QGVA 3DIEA 5FT3A 1BEDA 1M99A 5JWRB 3TGZA 3UVTA 3GX0A 2E0QA 1K0CA 4EVMA 3GMFA 4POBA 3CTFA 3ERGA 1TW9A 4ID0A 3F3RA 3KH9A 1FOVA 2IWTA 1SD9A 2KHPA 4BPYA 5DDLA 4K0GA 2O8VB 2R6KA 4X0XA 4ZB6A 3VWUA 3BOAA 4EF0A 3G7YA 1YDKA 4MABA 5CNWA 2P0GA 3TOTA 3FR9A 2DJ3A 1X9SB 1ZMAA 1PL2A 2J9HA 2R2JA 3TKSA 2J23A 2NDOA 4KGIA 4POLA 5F05A 5ECLB 2YWOA 4L0UA 2NVLA 2YANA 1Z9HA 5ECIB 4YH2A 3IA1A 1SJZA 4IVFA 3BBYA 3EMPA 2C0DA 4MCUA 2LUSA 5ELGA 1ST9A 2XPDA 2H8LA 2A4VA 3R2QA 5HFGA 4N0ZA 4E8HA 4G19A 2N5FA 5CO3A 1JZRA 1NW2A 2B1KA 2H1GA 4O7HA 3ZLPA 2N5BA 1TP9A 2OA7A 2FNOA 4KF9A 1N8JA 3H4KA 2C4JA 3LORA 1ZYPA 5ECSA 1A2JA 3CTGA 4OFMA 4BIKA 1R5AA 1GLQA 3FY7A 1E6BA 5KOWA 3MIXA 1GSYA 3D4TA 4TN8A 1ERWA 2OE0A 2X8CA 1XZOA 3ZVJA 6GSUA 1VRSD 5BMUA 4HI7A 1ML6A 2WZ9A 1K3LA 4YQVA 4O5RA 1PKZA 5DCHA 4PX1A 1DSBA 2VIMA 1YF1A 3BCIA 1BAYA 1YY7A 1EZKA 1O81A 4NWYA 4JU5A 4I8BA 2KUCA 3TJJA 2DJ2A 2DLXA 5G30A 1OE8A 4F82A 3VLNA 2E7PA 1ZOFA 4K7IA 3NOFA 4KA0A 4F0BA 2R0CA 2H0IA 1FHEA 4Z2TA 2A2SA 5D96A 5D9TA 2YPMA 2GSSA 2H72A 2MMAA 2VL3A 3LWAA 2H6ZA 1XWGA 6GSVA 2YN1A 1O73A 1XWBA 1GRXA 3O76A 3GNJA 7GSSA 5B6NA 3M8NA 2P5QA 2YCDA 1SL2B 5KN2A 2CAIA 4DSRA 1Q4JA 1ZYQB 2B1LA 1XCCA 2Z9SA 3TJBA 2HI7A 1UC7A 4GLTA 3IV4A 4PNFA 2IL3A 2GSQA 4AJ8A 4HU7A 4FYCA 3HZ8A 3CSHA 3MDKA 2RUFA 3TKRA 4JEDA 1R4WA 1FVKA 2HSMA 2E2GA 3TJFA 2VL2C 1KBNA 4MLYA 1B8XA 4KNDA 1A2MA 3LYPA 3IAS2 1BX9A 2WFCA 2R0GA 5GSSA 2F8AA 2JL4A 3CQFA 4WF5A 2H0HA 5GZZB 4EIQA 10GSA 4WR5A 5IPGA 5ELAA 3ZFBA 5CREA 5J9BA 2RUEA 2VLVA 2KP1A 2YZHA 4ILFA 3UL3A 1G7EA 1YEXA 5INYA 1H4OA 1O8WA 5G1KA 2AYTA 3KMNA 2GZYA 3OR5A 1Z6NA 4ZILA 1TRUA 1TJDA 1SK2A 2H1BA 2RIIA 3BCKA 4BVYB 1TI3A 1SL1B 1SL0B 4EO3A 3LG6A 5ECKB 3E9JB 4PUFC 2CX4A 5E4WA 4PXOA 1OE7A 2IIYA 2X8HA 3CRTA 5IMCA 2CVKA 4JE1A 3QFAC 2H0GA 1Y25A 1X5CA 2VL9A 1PX6A 3D21A 1PGTA 3LYKA 1F2EA 5H5RA 5J41A 4A5PA 1TRWA 1T1VA 2HYXA 4Z2RA 2H75A 4LMWA 3IK7A 2IFQB 1Y6EA 3HXSA 1TXXA 2JADA 1TU8A 2LRNA 3EYTA 1TTZA 1YKCA 2B5EA 1B9YC 2REMA 4ACSA 5AGYA 4DEJA 5JWOB 19GSA 2AB6A 2GDRA 2IJYA 1OVNA 2ALBA 2CAQA 2QA1A 1T00A 2O7KA 1K3OA 3GFKA 3VI5A 2A2PA 2GT6A 3C73A 4CY6A 2CVBA 3IBHA 2L4CA 4NPBA 1XXUA 1GTAA 2DSAA 4KDXA 4LLRA 4WEYA 5DBQA 3L9VA 1QFNA 3QMXA 3GH6A 1EV4A 2GT5A 4K6XA 2HRKA 2LJKA 3TDGA 4WR4A 3FZ9A 1OC3A 5IQYA 1F6MC 3D4MA 1JZDA 4IP6A 3FZ4A 4KX4A 3GUSA 1N2AA 4ZB8A 1XW6A 4TXOB 3TKSC 1KEBA 5KOXA 4L0WA 4L5OA 4XRDA 1SJ6A 5AIXA 3TKQA 4N10A 1HQOA 3GIXA 4EIPA 3F4RA 2H19A 1AW9A 2C3QA 3QD9A 4LA1A 2VL2A 2VCWA 4YKGA 4Z7XA 3ZIJA 3IK9A 2LV3A 4KSOA 6GSSA 1PSQA 5ID2B 4I6XA 4K0NA 3UJ1A 3U6VA 1JZWA 5A4VA 2VUPA 3M9KA 1PX7A 3AY8A 3FEUA 2MBSA 4RQXA 1G7OA 2B5YA 3KH7A 1B4PA 1XWAA 4G9HA 1V9WA 5IMFA 1UVZA 5EPFA 1Z5YE 5HFKA 4POKA 2L5OA 3A2VA 3EINA 3DXBA 1YEPA 4FYBA 2DMLA 3A5IA 4CY8A 4IGJA
chains in the Genus database with same CATH topology
4XS4B 3UMAA 1T3BA 2L59A 4GSSA 4IJ3A 3RDWA 3VFIA 1JFUA 9GSSA 2X8GA 5D8IA 2JU5A 1RK4A 5IMVA 3K8NA 3TJGA 4MF7A 4GQFA 2K9FA 4HOJA 2CA8A 5IOXA 4MP4A 5IPHA 1KNGA 3RAZA 3HA9A 3QPMA 2A4HA 2GZPA 4WETA 4MJBA 5D9VA 4ML6A 2G0FA 6GSTA 3O3TA 4HS1A 1OC9A 2HZEA 1A2LA 2C1YA 2I9HA 2VCVA 2TRCP 2DKIA 2C0FA 1OKTA 4IBPA 3P90A 1S3CA 4DVCA 1XWKA 1A0FA 4TR4A 3GKMA 4BVXB 1NSWA 2FWHA 5KN0A 1X5EA 4USSA 4POMA 1K0OA 3LEFA 5ECQB 2EIRA 4XS6A 1GUMA 1DE2A 1G6YA 4LMVA 1TRSA 3LJRA 2PN8A 3Q74A 4MZCA 1O8XA 5F0GA 4Q5RA 3CSJA 1IYHA 3L78A 4JR4A 1NHYA 4K7OA 4YKFA 4FIWA 1U3AA 1M2AA 2DJKA 3C8EA 4OO5A 2AAWA 1ABAA 4FYUA 4ZB9A 1V40A 1SJIA 2A2RA 3G9BA 4ULXA 2WRTA 5IO0A 2GTUA 4O5UA 3ME8A 1DE1A 4EDZA 4L8EA 1U3IA 1K0BA 3P2AA 4HEA2 3US3A 3FK8A 5BRTA 3H8QA 1J0FA 1EV9A 4CHSA 1VF2A 4YAPA 5ECOB 2VD1A 4O32A 2H1AA 3EC3A 3ZYWA 4NV5A 4PQ1A 3A2XA 2GS3A 5JCGA 3APSA 2I4AA 5FWGA 3GL5A 2IMFA 2LSTA 5DQSA 2FY6A 4K5RA 5HR1A 3TRXA 2DBCA 1MDKA 3A3TA 3GTUB 4F03A 3CBUA 3NZNA 3QAVA 2B6MA 3GKNA 1SKWB 3M0FA 1GSQA 1PL1A 4EL1A 3VURA 4RI6A 2IMIA 1S3DA 1QXHA 5FHIA 4TVEA 3VI7A 1HNCA 1QUWA 5ECMB 3PPUA 3QCPA 1JLWA 4TW5A 1AIUA 2VD0A 3M9JA 3C71A 4KW6A 2JZTA 3IDVA 4XIHA 16GSA 2WDUA 1TDIA 3HVVA 2FWGA 5DVBA 3GKXA 2M46A 5IMDA 1MDIA 1NHOA 1PKWA 4L5LA 1GUKA 3G7IA 5EY6A 2H71A 2XHFA 4GSNA 4F0CA 4HUAA 4HQZA 2MMNA 4BA7A 3F4SA 4KH7A 2G2QA 1MD3A 2BJXA 3ZIVA 3N5OA 4MZBA 5G31A 1B48A 1ZL9A 3IHGA 4H86A 1G0TA 4IW9A 2L6CA 1B4QA 3F3QA 2LJAA 2CQ9A 3L9SA 3F63A 4MF5A 2LTKA 4MK3A 2HRAA 5CRGA 2H1DA 3ED3A 5GAPD 2I3YA 4XCSA 3ZRDA 5IOWA 5D9WA 1J9BA 4K8MA 2HRFA 1K3YA 2DJJA 1Z6MA 2EIQA 2CX3A 1EOGA 3WGEA 2VOCA 2C0GA 2MMOA 1A0RP 1SK1A 2EC4A 3ISOA 1VGLA 3HYPA 2R0PA 4GF0A 4TOPA 4KCAA 4AJ6A 3QOUA 2PU9C 2L57A 4F9ZA 1GNEA 2DMMA 2PUKC 3S9FA 5COHA 2FCHA 3TCOA 2HT9A 5ABRA 3A2WA 2C0EA 4V2NA 2V41A 4I5QA 1SKRB 3J7Yk 2LKUA 2HE3A 4XS1A 4ISDA 5D9XA 3LXZA 5ENUA 4QL7A 2GQLA 1AQVA 4MZWA 5CRHA 2YWMA 1RW1A 4BVYA 1LU4A 1GSUA 2F3MA 1EGRA 5IIZA 3P8WA 4FH8A 1YQ1A 3HJMA 2DJ1A 3RPPA 1TKDB 1YZXA 3D22A 1RQMA 2MYGA 3EMXA 4NMUA 1K0NA 1OKDA 4IQAA 4TXVA 5CRWA 3RHBA 2X49A 1F3AA 4ICYA 4LL1B 4V2MA 1TOFA 2LQQA 3MSZA 1AUCA 4EXJA 1EEJA 3EPTA 1LJRA 1WP0A 2VM2A 2IMEA 1R7HA 2K6VA 1FAAA 3TRQA 4ML1A 3PGTA 2V32A 2IFQA 4NXIA 3GYKA 1T4ZA 1WRYA 1R5PA 4IHUA 4NV2A 1M2DA 2PVOC 3H1NA 5DCGA 3IR4A 1HYUA 2FD3A 4PQHA 1V2AA 2LJRA 3CYNA 2FWFA 2VCXA 4MPFA 3KTLA 5H5SA 1GLPA 2JSYA 4DSSB 1U87A 3WT1A 1CQGA 5DQYA 2VCQA 4BL7B 2PGTA 3LQ7A 3WT2A 4D73B 4WKWA 2MBTA 3FRCA 1AAZA 1XPVA 1ZYNA 2YV9A 4MMMA 4X43A 1PQNA 1SYXA 2OACA 1SK0A 3DYRA 1A8YA 2IPAA 4K7NA 4Q5NA 3ERFA 2YP6A 4K9ZA 1W4VA 6GSYA 4V1Ap 3E0UA 2V6OA 3WYWA 4KAEA 1F9MA 1Z7RA 3MAKA 3ERWA 2PBJA 3C1RA 4J56E 2KP2A 2OBKA 1Q98A 1WMJA 2K8SA 3HDCA 4IJIA 5DAKB 1XBSA 3GL3A 1XW5A 1MDJA 5IM9A 3KMOA 3J7Yb 3UBLA 2C3TA 1KTEA 4G0LA 1SENA 4XRAA 3FR3A 1WOUA 2P5RA 4G0IA 3DMLA 2AHEA 4MDCA 3FW2A 3UBKA 4Z2UA 4K2XA 2GSTA 2TRXA 3KM6A 4TXOA 3FZAA 5GSTA 4OFNA 3HVSA 1I5GA 4I2UA 5A4WA 3MWHA 4YQUA 2LRTA 5DALB 4ZBDA 1MEKA 3GH9A 2FA4A 2WJUA 3FR6A 4K5SA 2GSRA 1EP8A 2V1MA 3LFLA 5HR0A 4CDOA 5B8BA 3TB2A 1PN9A 5ID2A 2DKHA 4OCFA 3BD2A 5F06A 4GQCA 4TRXA 3ZTLA 1EP7A 1FB6A 2WULA 11GSA 2B7KA 2LS5A 2H66A 1XIYA 2UZ8A 1DUGA 3TRPA 2XC2A 5AN1A 5LNKe 3F4TA 4JZQA 4WBRD 1I9DA 4AJ7A 2CZ3A 2RM6A 3IE3A 1AC1A 1AXDA 4XS4A 3FYGA 3CMIA 1M7TA 5G2ZA 3IXRA 4RUVA 4HZ2A 5C00A 4TR1B 4IKHA 2IMKA 2PPTA 2X64A 3HKRA 1THXA 2ZCTA 2H76A 5B7CA 1GWCA 3HVXA 1JLVA 4MF6A 4K1FA 3GSSA 3EU4A 3Q6OA 3TKSE 3KJYA 4JR6A 2HZFA 2GQMA 2OJLA 2LNTA 4HZ4A 1V98A 3GSTA 4ECJA 1ZZYA 3BJ5A 4G2EA 2CT6A 5C04A 3APOA 1URMA 3SBCA 2HLSA 4TR0A 2ON7A 2JZRA 1PMTA 4WXTA 2PVQA 3RBTA 1GSSA 4DSQA 4NAXA 2E2MA 5CYYA 1SYRA 5HFIA 1A23A 1XWCA 4PUAA 2NBSA 4YAVA 5L71A 4FQUA 4BVXA 3EE2A 4PNGA 4X1UA 3W8SA 3WGXA 1K0MA 2ES7A 1V58A 1B9XC 3D0ZA 4XHMA 3HY2A 3UOMA 5IO2A 1Z7PA 3IRAA 1SD8A 4QQ7A 4PTSA 1FB0A 4GTUA 2BTOT 1BYEA 1U6TA 3EU3A 1XVWA 2B5XA 5D73A 2ZNMA 1XFLA 2IMDA 2DJ0A 5JWQB 2HSYA 3I43A 3VWXA 3GKKA 2X4AA 3L4NA 4ECBA 1ERUA 5G5EA 2IN3A 4YQMA 4J57E 3MYDA 2H30A 2H01A 2VCZA 3LSZA 4GSTA 3F6DA 3EWLA 3H93A 3MNGA 5H5QA 4N11A 5DJMA 3CSIA 4ZL7A 2VO4A 1EOHA 2O89A 3ZMLA 3ZZXA 3IPZA 1O7UA 1YF0A 1WJKA 4PGTA 12GSA 2R37A 4MPGA 2AJQB 4GRFA 2CVDA 3IC8A 4OCEA 1AQXA 2O87A 3GV1A 5G1LA 3E3EA 3GURA 2XBIA 1ERTA 4PURA 3W8JA 4ZL8A 2F51A 3FKFA 4IQ1A 3C1SA 3NIVA 3JCML 2GGTA 3GTUA 4MA9A 5CRDA 3PR8A 2LQOA 5A5KA 5EVOA 4MH2A 2M80A 4HQSA 2OBIA 2QSIA 2NPBA 3IAM2 2D2ZA 1QMVA 4OD7A 1F3BA 2YWNA 1ZCPA 4MNNA 4O92A 4J2FA 2OKAA 4RI7A 2P31A 5G5FA 2WGRA 3QAWA 3KD0A 4QL9A 3ZITA 1GH2A 2M72A 5KN3A 1MD4A 5HR2A 4NHZA 3H79A 2PMTA 2PERA 3UVHA 3GX8A 3WD6A 4X4JA 4P3YB 5J5NA 1T8EB 1F37A 1BG5A 1VF4A 3C7MA 2HNLA 1T4YA 5E59A 1ZGNA 1GTBA 4I97A 1UA5A 1NM3A 1G6WA 1K0DA 3ZMKA 5ECHB 3D5JA 1ACVA 1M9AA 4OMVA 1TRVA 1R26A 3ZREA 14GSA 3QFBC 5DJLA 3F6FA 3U5RE 1QK8A 2VAFA 1USBA 4EUYA 5IMZA 2C80A 4F2IA 1X9WB 5AIVA 1GSFA 3O6TA 2H70A 4V2LA 2R5GA 2H74A 5J4UA 2FLSA 1A24A 3EURA 4EDYA 1X0RA 3GN3A 3F0IA 1XVQA 4TKYA 1YKAA 3N9JA 1SKSB 2N5AA 3KXOA 2VLUA 2O85A 1FO5A 4KE3A 2TIRA 5LD0A 2B3SA 3PINA 6GSWA 5J9CA 1VF1A 4G0KA 1U88A 3DRNA 2EIOA 4ZL9A 2YJ7A 1UN2A 3I69A 2KLXA 1M9BA 4AGSA 1XW9A 3UAPA 3I6AA 4EC0A 3RPNA 4O5QA 1QGVA 4ZBAA 3ME7A 1IYIA 2I81A 3F8UA 5F07A 4KUNA 1ON4A 4IELA 5GAND 2JSZA 2R4VA 3D6IA 1WWJA 1EGOA 3W6GA 3VWVA 2I1UA 4OO4A 2C8UA 2FHEA 1ZYEA 3CXGA 1LBKA 2MMZA 3LXTA 2HSHA 18GSA 2F8FA 3DEXA 2V2GA 2YJHA 4HU9A 1ILOA 5J3RA 4IP1A 1J08A 5ECNB 3HHVA 1PRXA 2LRCA 5ECPB 1X9MB 4LL4B 1GULA 3QDNA 1FG4A 2FUG2 5F8BA 3KP8A 3VPQA 2R3XA 1CQHA 4RQRA 2K18A 4KCEA 3KP9A 3PH9A 2DIYA 3DVXA 4OFTA 2YZUA 3ZVJD 4JBBA 1XOBA 4ZXGA 2LNSA 3FMWA 4ECIA 2OADA 2VM1A 4XTSA 3VPTA 5AISA 1MTCA 2OE1A 3FZ5A 4AF2A 4GXZA 3HZ4A 1BJXA 2YNXA 1ERVA 4MJAA 6GSXA 4DSSA 4EKZA 1DBYA 5D93A 1GNWA 2PWJA 4BL7A 4D73A 4BWSA 4HJ2A 2OE3A 4HDEA 2CV4A 3UIWA 2C3NA 2JZSA 4MJEA 1Z3EA 2HRNA 3WGDA 2WB9A 3IHQA 1YJ6A 2RLIA 1TK8B 4GWRA 3VWWA 4K2DA 2RM5A 22GSA 1EWXA 3HD5A 4MH3A 4IN0A 2DC5A 2H6YA 1THOA 1TU7A 3DD3A 5KEJA 2CZ2A 4KDYA 3LW9A 3APQA 1W89A 3L0HA 5DAKA 3GHAA 5B8AA 4Q5FA 1AQWA 1PN0A 1JHBA 4TR3A 13GSA 4IS0A 2GLRA 1O6JA 5CAXA 4NHWA 2YWIA 2H73A 1O85A 4HJMA 2VCTA 2XBQA 2FGXA 1QQ2A 1FOHA 5DALA 3KTBA 1HNAA 3P7XA 4KSMA 2FA8A 4EE0A 1XOAA 1TK0B 3DGQA 3QR6A 3LGCA 3A5WA 1JZOA 4CW9A 1M2BA 3SWLA 3CRUA 4ECCA 3I9V2 1E2YA 4KB3A 1BQ7A 3L9UA 2GVPA 4G10A 1FW1A 5EL8A 1OAZA 4ZIJA 4I2TA 2HXKA 5LCZA 4N0VA 2F9SA 3KGKA 3GRXA 2MZCA 2L5LA 2QA2A 1S3AA 1TK5B 1GSDA 2L6DA 3TUEA 3TKPA 1GL8A 3DKSA 5HQPA 3QAGA 3IOSA 3G7JA 3Q19A 1HNBA 1GSEA 3M3MA 3KZQA 5CP1A 2LEGA 3GA4A 1WPIA 3FHKA 3EVIA 2GQKA 4GCIA 2GZZA 3UARA 4KDUA 1HD2A 4TR1A 5B6MA 4E8EA 5KN1A 1WE0A 2L4QA 1OC8A 3R3EA 3Q18A 1T7PB 2BMXA 2YV7A 4ZBBA 4BWQA 5HR3A 2DIZA 2X99A 3F9UA 5ECRB 3IC4A 1PA3A 1GTIA 3KCMA 3M1GA 5A4UA 4PQIA 2XPEA 1OYJA 1C72A 2FWEA 5JCUA 3RHCA 2AV4A 4WBJA 2ON5A 3TJKA 1GUHA 2H6XA 1X5DA 2V6KA 3VK9A 4N30A 1TI1A 2WCIA 3ZL5A 2QC7A 3V1WA 3KEBA 17GSA 2WS2A 2HFDA 2KOKA 4MJCA 3KIJA 2AUVA 1EEMA 3TOUA 2K8VA 1FVJA 1A8LA 3HJPA 8GSSA 1WIKA 1GTUA 2JACA 3HCZA 1OC9B 2HZEB 4FO5A 5JCWA 2NTOA 3UEMA 1VF3A 2QKEA 1K0AA 3DVWA 3DWVA 1PD21 1GP1A 1M0UA 20GSA 2YOIA 4V1Ag 4OWYA 4WF4A 3ZFLA 5IMAA 1SU9A 2ZUPA 4Q5QA 2B7JA 1H75A 3HJOA 4JRRA 1V57A 2VLTA 2QGVA 3DIEA 5FT3A 1BEDA 1M99A 5JWRB 3TGZA 3UVTA 3GX0A 2E0QA 1K0CA 4EVMA 3GMFA 4POBA 3CTFA 3ERGA 1TW9A 4ID0A 3F3RA 3KH9A 1FOVA 2IWTA 1SD9A 2KHPA 4BPYA 5DDLA 4K0GA 2O8VB 2R6KA 4X0XA 4ZB6A 3VWUA 3BOAA 4EF0A 3G7YA 1YDKA 4MABA 5CNWA 2P0GA 3TOTA 3FR9A 2DJ3A 1X9SB 1ZMAA 1PL2A 2J9HA 2R2JA 3TKSA 2J23A 2NDOA 4KGIA 4POLA 5F05A 5ECLB 2YWOA 4L0UA 2NVLA 2YANA 1Z9HA 5ECIB 4YH2A 3IA1A 1SJZA 4IVFA 3BBYA 3EMPA 2C0DA 4MCUA 2LUSA 5ELGA 1ST9A 2XPDA 2H8LA 2A4VA 3R2QA 5HFGA 4N0ZA 4E8HA 4G19A 2N5FA 5CO3A 1JZRA 1NW2A 2B1KA 2H1GA 4O7HA 3ZLPA 2N5BA 1TP9A 2OA7A 2FNOA 4KF9A 1N8JA 3H4KA 2C4JA 3LORA 1ZYPA 5ECSA 1A2JA 3CTGA 4OFMA 1R5AA 1GLQA 3FY7A 1E6BA 5KOWA 3MIXA 1GSYA 3D4TA 4TN8A 1ERWA 2OE0A 2X8CA 1XZOA 3ZVJA 6GSUA 1VRSD 5BMUA 4HI7A 1ML6A 2WZ9A 1K3LA 4YQVA 4O5RA 1PKZA 5DCHA 4PX1A 1DSBA 2VIMA 1YF1A 3BCIA 1BAYA 1YY7A 1EZKA 1O81A 4NWYA 4JU5A 4I8BA 2KUCA 3TJJA 2DJ2A 2DLXA 5G30A 1OE8A 4F82A 3VLNA 2E7PA 1ZOFA 4K7IA 3NOFA 4KA0A 4F0BA 2R0CA 2H0IA 1FHEA 4Z2TA 2A2SA 5D96A 5D9TA 2YPMA 2GSSA 2H72A 2MMAA 2VL3A 3LWAA 2H6ZA 1XWGA 6GSVA 2YN1A 1O73A 1XWBA 1GRXA 3O76A 3GNJA 7GSSA 5B6NA 3M8NA 2P5QA 2YCDA 1SL2B 5KN2A 2CAIA 4DSRA 1Q4JA 1ZYQB 2B1LA 1XCCA 2Z9SA 3TJBA 2HI7A 1UC7A 4GLTA 3IV4A 4PNFA 2IL3A 2GSQA 4AJ8A 4HU7A 4FYCA 3HZ8A 3CSHA 3MDKA 2RUFA 3TKRA 4JEDA 1R4WA 1FVKA 2HSMA 2E2GA 3TJFA 2VL2C 1KBNA 4MLYA 1B8XA 4KNDA 1A2MA 3LYPA 3IAS2 1BX9A 2WFCA 2R0GA 5GSSA 2F8AA 2JL4A 4WF5A 2H0HA 5GZZB 4EIQA 10GSA 4WR5A 5IPGA 5ELAA 3ZFBA 5CREA 5J9BA 2RUEA 2VLVA 2KP1A 2YZHA 4ILFA 3UL3A 1G7EA 1YEXA 5INYA 1H4OA 1O8WA 5G1KA 2AYTA 3KMNA 2GZYA 3OR5A 1Z6NA 4ZILA 1TRUA 1TJDA 1SK2A 2H1BA 2RIIA 3BCKA 4BVYB 1TI3A 1SL1B 1SL0B 4EO3A 3LG6A 5ECKB 3E9JB 4PUFC 2CX4A 5E4WA 4PXOA 1OE7A 2IIYA 2X8HA 3CRTA 5IMCA 2CVKA 4JE1A 3QFAC 2H0GA 1Y25A 1X5CA 2VL9A 1PX6A 3D21A 1PGTA 3LYKA 1F2EA 5H5RA 5J41A 4A5PA 1TRWA 1T1VA 2HYXA 4Z2RA 2H75A 4LMWA 3IK7A 2IFQB 1Y6EA 3HXSA 1TXXA 2JADA 1TU8A 2LRNA 3EYTA 1TTZA 1YKCA 2B5EA 1B9YC 2REMA 4ACSA 5AGYA 4DEJA 5JWOB 19GSA 2AB6A 2GDRA 2IJYA 1OVNA 2ALBA 2CAQA 2QA1A 1T00A 2O7KA 1K3OA 3GFKA 3VI5A 2A2PA 2GT6A 3C73A 4CY6A 2CVBA 3IBHA 2L4CA 4NPBA 1XXUA 1GTAA 2DSAA 4KDXA 4LLRA 4WEYA 5DBQA 3L9VA 1QFNA 3QMXA 3GH6A 1EV4A 2GT5A 4K6XA 2HRKA 2LJKA 3TDGA 4WR4A 3FZ9A 1OC3A 5IQYA 1F6MC 3D4MA 1JZDA 4IP6A 3FZ4A 4KX4A 3GUSA 1N2AA 4ZB8A 1XW6A 4TXOB 3TKSC 1KEBA 5KOXA 4L0WA 4L5OA 4XRDA 1SJ6A 5AIXA 3TKQA 4N10A 1HQOA 3GIXA 4EIPA 3F4RA 2H19A 1AW9A 2C3QA 3QD9A 4LA1A 2VL2A 2VCWA 4YKGA 4Z7XA 3ZIJA 3IK9A 2LV3A 4KSOA 6GSSA 1PSQA 5ID2B 4I6XA 4K0NA 3UJ1A 3U6VA 1JZWA 5A4VA 2VUPA 3M9KA 1PX7A 3AY8A 3FEUA 2MBSA 4RQXA 1G7OA 2B5YA 3KH7A 1B4PA 1XWAA 4G9HA 1V9WA 5IMFA 1UVZA 5EPFA 1Z5YE 5HFKA 4POKA 2L5OA 3A2VA 3EINA 3DXBA 1YEPA 4FYBA 2DMLA 3A5IA 4CY8A 4IGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XS4 B;  3UMA A;  1T3B A;  2L59 A;  4GSS A;  4IJ3 A;  3RDW A;  3VFI A;  1JFU A;  9GSS A;  2X8G A;  5D8I A;  2JU5 A;  1RK4 A;  5IMV A;  3K8N A;  3TJG A;  4MF7 A;  4GQF A;  2K9F A;  4HOJ A;  2CA8 A;  5IOX A;  4MP4 A;  5IPH A;  1KNG A;  3RAZ A;  3HA9 A;  3QPM A;  2GZP A;  4WET A;  4MJB A;  5D9V A;  4ML6 A;  2G0F A;  6GST A;  3O3T A;  4HS1 A;  1OC9 A;  2HZE A;  1A2L A;  2C1Y A;  2I9H A;  2VCV A;  2TRC P;  2C0F A;  1OKT A;  4IBP A;  3P90 A;  1S3C A;  4DVC A;  1XWK A;  1A0F A;  4TR4 A;  3GKM A;  1NSW A;  2FWH A;  5KN0 A;  1X5E A;  4POM A;  1K0O A;  3LEF A;  5ECQ B;  2EIR A;  4XS6 A;  1GUM A;  1DE2 A;  1G6Y A;  4LMV A;  1TRS A;  3LJR A;  2PN8 A;  3Q74 A;  4MZC A;  1O8X A;  5F0G A;  4Q5R A;  3CSJ A;  1IYH A;  3L78 A;  4JR4 A;  1NHY A;  4K7O A;  4FIW A;  1U3A A;  1M2A A;  2DJK A;  3C8E A;  4OO5 A;  2AAW A;  1ABA A;  4FYU A;  4ZB9 A;  1V40 A;  1SJI A;  2A2R A;  3G9B A;  4ULX A;  2WRT A;  5IO0 A;  2GTU A;  3ME8 A;  1DE1 A;  4EDZ A;  4L8E A;  1U3I A;  1K0B A;  3P2A A;  4HEA 2;  3US3 A;  3FK8 A;  3H8Q A;  1J0F A;  1EV9 A;  4CHS A;  1VF2 A;  4YAP A;  5ECO B;  2VD1 A;  4O32 A;  2H1A A;  3EC3 A;  3ZYW A;  4NV5 A;  4PQ1 A;  3A2X A;  2GS3 A;  5JCG A;  3APS A;  2I4A A;  5FWG A;  3GL5 A;  2IMF A;  2LST A;  5DQS A;  2FY6 A;  5HR1 A;  3TRX A;  2DBC A;  1MDK A;  3A3T A;  3GTU B;  4F03 A;  3CBU A;  3NZN A;  3QAV A;  2B6M A;  3GKN A;  1SKW B;  3M0F A;  1GSQ A;  1PL1 A;  4EL1 A;  3VUR A;  4RI6 A;  2IMI A;  1S3D A;  1QXH A;  5FHI A;  4TVE A;  3VI7 A;  1HNC A;  1QUW A;  5ECM B;  3QCP A;  1JLW A;  4TW5 A;  1AIU A;  2VD0 A;  3M9J A;  3C71 A;  4KW6 A;  2JZT A;  3IDV A;  4XIH A;  16GS A;  2WDU A;  1TDI A;  3HVV A;  2FWG A;  5DVB A;  3GKX A;  2M46 A;  5IMD A;  1MDI A;  1NHO A;  1PKW A;  4L5L A;  1GUK A;  3G7I A;  5EY6 A;  2H71 A;  2XHF A;  4GSN A;  4F0C A;  4HUA A;  4HQZ A;  2MMN A;  4BA7 A;  3F4S A;  4KH7 A;  2G2Q A;  1MD3 A;  2BJX A;  3ZIV A;  3N5O A;  4MZB A;  5G31 A;  1B48 A;  1ZL9 A;  4H86 A;  1G0T A;  4IW9 A;  2L6C A;  1B4Q A;  3F3Q A;  2LJA A;  2CQ9 A;  3L9S A;  3F63 A;  4MF5 A;  2LTK A;  4MK3 A;  5CRG A;  2H1D A;  3ED3 A;  5GAP D;  2I3Y A;  4XCS A;  3ZRD A;  5IOW A;  5D9W A;  1J9B A;  4K8M A;  2HRF A;  1K3Y A;  2DJJ A;  1Z6M A;  2EIQ A;  2CX3 A;  1EOG A;  3WGE A;  2VOC A;  2C0G A;  2MMO A;  1A0R P;  1SK1 A;  2EC4 A;  3ISO A;  1VGL A;  3HYP A;  4GF0 A;  4TOP A;  4KCA A;  4AJ6 A;  3QOU A;  2PU9 C;  2L57 A;  4F9Z A;  1GNE A;  2DMM A;  2PUK C;  3S9F A;  5COH A;  2FCH A;  3TCO A;  2HT9 A;  5ABR A;  3A2W A;  2C0E A;  4V2N A;  2V41 A;  4I5Q A;  1SKR B;  3J7Y k;  2LKU A;  2HE3 A;  4XS1 A;  4ISD A;  5D9X A;  3LXZ A;  5ENU A;  4QL7 A;  2GQL A;  1AQV A;  4MZW A;  5CRH A;  2YWM A;  1RW1 A;  4BVY A;  1LU4 A;  1GSU A;  2F3M A;  1EGR A;  5IIZ A;  3P8W A;  4FH8 A;  1YQ1 A;  3HJM A;  2DJ1 A;  3RPP A;  1TKD B;  1YZX A;  3D22 A;  1RQM A;  2MYG A;  3EMX A;  4NMU A;  1K0N A;  1OKD A;  4IQA A;  4TXV A;  5CRW A;  3RHB A;  1F3A A;  4LL1 B;  4V2M A;  1TOF A;  2LQQ A;  3MSZ A;  1AUC A;  4EXJ A;  1EEJ A;  1LJR A;  1WP0 A;  2VM2 A;  2IME A;  1R7H A;  2K6V A;  1FAA A;  3TRQ A;  4ML1 A;  3PGT A;  2V32 A;  2IFQ A;  4NXI A;  3GYK A;  1T4Z A;  1WRY A;  1R5P A;  4IHU A;  4NV2 A;  1M2D A;  2PVO C;  3H1N A;  5DCG A;  3IR4 A;  1HYU A;  2FD3 A;  4PQH A;  1V2A A;  2LJR A;  3CYN A;  2FWF A;  2VCX A;  4MPF A;  3KTL A;  5H5S A;  1GLP A;  2JSY A;  4DSS B;  1U87 A;  3WT1 A;  1CQG A;  5DQY A;  2VCQ A;  2PGT A;  3LQ7 A;  3WT2 A;  4D73 B;  4WKW A;  2MBT A;  3FRC A;  1AAZ A;  1XPV A;  2YV9 A;  4MMM A;  4X43 A;  1PQN A;  1SYX A;  2OAC A;  1SK0 A;  3DYR A;  1A8Y A;  2IPA A;  4K7N A;  4Q5N A;  3ERF A;  2YP6 A;  4K9Z A;  1W4V A;  6GSY A;  4V1A p;  3E0U A;  2V6O A;  3WYW A;  4KAE A;  1F9M A;  1Z7R A;  3MAK A;  3ERW A;  2PBJ A;  3C1R A;  4J56 E;  2KP2 A;  2OBK A;  1Q98 A;  1WMJ A;  2K8S A;  3HDC A;  4IJI A;  5DAK B;  1XBS A;  3GL3 A;  1XW5 A;  1MDJ A;  5IM9 A;  3KMO A;  3J7Y b;  3UBL A;  2C3T A;  1KTE A;  1SEN A;  4XRA A;  3FR3 A;  1WOU A;  2P5R A;  3DML A;  2AHE A;  4MDC A;  3FW2 A;  3UBK A;  2GST A;  2TRX A;  3KM6 A;  4TXO A;  3FZA A;  5GST A;  4OFN A;  3HVS A;  1I5G A;  4I2U A;  5A4W A;  3MWH A;  4YQU A;  2LRT A;  5DAL B;  4ZBD A;  1MEK A;  3GH9 A;  2FA4 A;  2WJU A;  3FR6 A;  2GSR A;  1EP8 A;  2V1M A;  3LFL A;  5HR0 A;  4CDO A;  5B8B A;  3TB2 A;  1PN9 A;  5ID2 A;  4OCF A;  3BD2 A;  5F06 A;  4GQC A;  4TRX A;  3ZTL A;  1EP7 A;  1FB6 A;  2WUL A;  11GS A;  2B7K A;  2LS5 A;  2H66 A;  1XIY A;  1DUG A;  3TRP A;  2XC2 A;  5AN1 A;  5LNK e;  3F4T A;  4JZQ A;  4WBR D;  1I9D A;  4AJ7 A;  2CZ3 A;  2RM6 A;  3IE3 A;  1AC1 A;  1AXD A;  4XS4 A;  3FYG A;  3CMI A;  1M7T A;  5G2Z A;  3IXR A;  4RUV A;  4HZ2 A;  5C00 A;  4TR1 B;  4IKH A;  2IMK A;  2PPT A;  2X64 A;  3HKR A;  1THX A;  2ZCT A;  2H76 A;  5B7C A;  1GWC A;  3HVX A;  1JLV A;  4MF6 A;  4K1F A;  3GSS A;  3EU4 A;  3Q6O A;  3TKS E;  3KJY A;  4JR6 A;  2HZF A;  2GQM A;  2OJL A;  2LNT A;  4HZ4 A;  1V98 A;  3GST A;  4ECJ A;  1ZZY A;  3BJ5 A;  4G2E A;  2CT6 A;  5C04 A;  3APO A;  1URM A;  3SBC A;  2HLS A;  4TR0 A;  2ON7 A;  2JZR A;  1PMT A;  4WXT A;  2PVQ A;  3RBT A;  1GSS A;  4DSQ A;  4NAX A;  2E2M A;  5CYY A;  1SYR A;  5HFI A;  1A23 A;  1XWC A;  4PUA A;  2NBS A;  4YAV A;  5L71 A;  4BVX A;  3EE2 A;  4PNG A;  4X1U A;  3W8S A;  3WGX A;  1K0M A;  2ES7 A;  1V58 A;  1B9X C;  3D0Z A;  4XHM A;  3HY2 A;  3UOM A;  5IO2 A;  1Z7P A;  3IRA A;  1SD8 A;  4QQ7 A;  1FB0 A;  4GTU A;  2BTO T;  1BYE A;  1U6T A;  3EU3 A;  1XVW A;  2B5X A;  5D73 A;  2ZNM A;  1XFL A;  2IMD A;  2DJ0 A;  5JWQ B;  2HSY A;  3I43 A;  3VWX A;  3GKK A;  3L4N A;  4ECB A;  1ERU A;  5G5E A;  2IN3 A;  4YQM A;  4J57 E;  2H30 A;  2H01 A;  2VCZ A;  3LSZ A;  4GST A;  3F6D A;  3EWL A;  3H93 A;  3MNG A;  5H5Q A;  4N11 A;  5DJM A;  3CSI A;  4ZL7 A;  2VO4 A;  1EOH A;  2O89 A;  3ZML A;  3ZZX A;  3IPZ A;  1O7U A;  1YF0 A;  1WJK A;  4PGT A;  12GS A;  2R37 A;  4MPG A;  2AJQ B;  4GRF A;  2CVD A;  4OCE A;  1AQX A;  2O87 A;  3GV1 A;  5G1L A;  3E3E A;  3GUR A;  2XBI A;  1ERT A;  4PUR A;  3W8J A;  4ZL8 A;  2F51 A;  3FKF A;  4IQ1 A;  3C1S A;  3NIV A;  3JCM L;  2GGT A;  3GTU A;  4MA9 A;  5CRD A;  3PR8 A;  2LQO A;  5A5K A;  5EVO A;  4MH2 A;  2M80 A;  4HQS A;  2OBI A;  2QSI A;  2NPB A;  3IAM 2;  2D2Z A;  1QMV A;  4OD7 A;  1F3B A;  2YWN A;  1ZCP A;  4O92 A;  4J2F A;  2OKA A;  4RI7 A;  2P31 A;  5G5F A;  2WGR A;  3QAW A;  3KD0 A;  4QL9 A;  3ZIT A;  1GH2 A;  2M72 A;  5KN3 A;  1MD4 A;  5HR2 A;  4NHZ A;  3H79 A;  2PMT A;  2PER A;  3UVH A;  3GX8 A;  3WD6 A;  4P3Y B;  5J5N A;  1T8E B;  1F37 A;  1BG5 A;  1VF4 A;  3C7M A;  2HNL A;  1T4Y A;  5E59 A;  1ZGN A;  1GTB A;  4I97 A;  1UA5 A;  1NM3 A;  1G6W A;  1K0D A;  3ZMK A;  5ECH B;  3D5J A;  1ACV A;  1M9A A;  4OMV A;  1TRV A;  1R26 A;  3ZRE A;  14GS A;  3QFB C;  5DJL A;  3F6F A;  3U5R E;  1QK8 A;  2VAF A;  1USB A;  4EUY A;  5IMZ A;  2C80 A;  4F2I A;  1X9W B;  5AIV A;  1GSF A;  3O6T A;  2H70 A;  4V2L A;  2R5G A;  2H74 A;  5J4U A;  2FLS A;  1A24 A;  3EUR A;  4EDY A;  1X0R A;  3GN3 A;  3F0I A;  1XVQ A;  4TKY A;  1YKA A;  3N9J A;  1SKS B;  2N5A A;  3KXO A;  2VLU A;  2O85 A;  1FO5 A;  4KE3 A;  2TIR A;  5LD0 A;  2B3S A;  3PIN A;  6GSW A;  5J9C A;  1VF1 A;  1U88 A;  3DRN A;  2EIO A;  4ZL9 A;  2YJ7 A;  1UN2 A;  3I69 A;  2KLX A;  1M9B A;  4AGS A;  1XW9 A;  3UAP A;  3I6A A;  4EC0 A;  3RPN A;  1QGV A;  4ZBA A;  3ME7 A;  1IYI A;  2I81 A;  3F8U A;  5F07 A;  4KUN A;  1ON4 A;  4IEL A;  5GAN D;  2JSZ A;  2R4V A;  3D6I A;  1WWJ A;  1EGO A;  3W6G A;  3VWV A;  2I1U A;  4OO4 A;  2C8U A;  2FHE A;  1ZYE A;  3CXG A;  1LBK A;  2MMZ A;  3LXT A;  2HSH A;  18GS A;  2F8F A;  3DEX A;  2V2G A;  2YJH A;  4HU9 A;  1ILO A;  5J3R A;  4IP1 A;  1J08 A;  5ECN B;  3HHV A;  1PRX A;  2LRC A;  5ECP B;  1X9M B;  4LL4 B;  1GUL A;  3QDN A;  1FG4 A;  2FUG 2;  5F8B A;  3KP8 A;  3VPQ A;  2R3X A;  1CQH A;  4RQR A;  2K18 A;  4KCE A;  3KP9 A;  3PH9 A;  2DIY A;  3DVX A;  4OFT A;  2YZU A;  3ZVJ D;  4JBB A;  1XOB A;  4ZXG A;  2LNS A;  4ECI A;  2OAD A;  2VM1 A;  4XTS A;  3VPT A;  5AIS A;  1MTC A;  2OE1 A;  3FZ5 A;  4AF2 A;  4GXZ A;  3HZ4 A;  1BJX A;  2YNX A;  1ERV A;  4MJA A;  6GSX A;  4DSS A;  4EKZ A;  1DBY A;  5D93 A;  1GNW A;  2PWJ A;  4BL7 A;  4D73 A;  4BWS A;  4HJ2 A;  2OE3 A;  4HDE A;  2CV4 A;  3UIW A;  2C3N A;  2JZS A;  4MJE A;  1Z3E A;  2HRN A;  3WGD A;  2WB9 A;  3IHQ A;  1YJ6 A;  2RLI A;  1TK8 B;  4GWR A;  3VWW A;  4K2D A;  2RM5 A;  22GS A;  1EWX A;  3HD5 A;  4MH3 A;  4IN0 A;  2DC5 A;  2H6Y A;  1THO A;  1TU7 A;  3DD3 A;  5KEJ A;  2CZ2 A;  4KDY A;  3APQ A;  1W89 A;  3L0H A;  5DAK A;  3GHA A;  5B8A A;  4Q5F A;  1AQW A;  1JHB A;  4TR3 A;  13GS A;  4IS0 A;  2GLR A;  1O6J A;  5CAX A;  4NHW A;  2YWI A;  2H73 A;  1O85 A;  4HJM A;  2VCT A;  2XBQ A;  2FGX A;  1QQ2 A;  5DAL A;  3KTB A;  1HNA A;  3P7X A;  4KSM A;  2FA8 A;  4EE0 A;  1XOA A;  1TK0 B;  3DGQ A;  3QR6 A;  3LGC A;  3A5W A;  1JZO A;  4CW9 A;  1M2B A;  3SWL A;  3CRU A;  4ECC A;  3I9V 2;  1E2Y A;  4KB3 A;  1BQ7 A;  3L9U A;  2GVP A;  4G10 A;  1FW1 A;  5EL8 A;  1OAZ A;  4ZIJ A;  4I2T A;  2HXK A;  5LCZ A;  4N0V A;  2F9S A;  3KGK A;  3GRX A;  2MZC A;  2L5L A;  1S3A A;  1TK5 B;  1GSD A;  2L6D A;  3TUE A;  3TKP A;  1GL8 A;  3DKS A;  5HQP A;  3QAG A;  3IOS A;  3G7J A;  3Q19 A;  1HNB A;  1GSE A;  3M3M A;  3KZQ A;  5CP1 A;  2LEG A;  3GA4 A;  1WPI A;  3FHK A;  3EVI A;  2GQK A;  4GCI A;  2GZZ A;  3UAR A;  4KDU A;  1HD2 A;  4TR1 A;  5B6M A;  4E8E A;  5KN1 A;  1WE0 A;  2L4Q A;  1OC8 A;  3Q18 A;  1T7P B;  2BMX A;  2YV7 A;  4ZBB A;  4BWQ A;  5HR3 A;  2DIZ A;  2X99 A;  3F9U A;  5ECR B;  3IC4 A;  1PA3 A;  1GTI A;  3KCM A;  3M1G A;  5A4U A;  4PQI A;  2XPE A;  1OYJ A;  1C72 A;  2FWE A;  5JCU A;  3RHC A;  2AV4 A;  4WBJ A;  2ON5 A;  3TJK A;  1GUH A;  2H6X A;  1X5D A;  2V6K A;  3VK9 A;  4N30 A;  1TI1 A;  2WCI A;  3ZL5 A;  2QC7 A;  3V1W A;  3KEB A;  17GS A;  2WS2 A;  2HFD A;  2KOK A;  4MJC A;  3KIJ A;  2AUV A;  1EEM A;  3TOU A;  2K8V A;  1FVJ A;  1A8L A;  3HJP A;  8GSS A;  1WIK A;  1GTU A;  2JAC A;  3HCZ A;  1OC9 B;  2HZE B;  4FO5 A;  5JCW A;  2NTO A;  3UEM A;  1VF3 A;  2QKE A;  1K0A A;  3DVW A;  3DWV A;  1PD2 1;  1GP1 A;  1M0U A;  20GS A;  2YOI A;  4V1A g;  4OWY A;  4WF4 A;  3ZFL A;  5IMA A;  1SU9 A;  2ZUP A;  4Q5Q A;  2B7J A;  1H75 A;  3HJO A;  4JRR A;  1V57 A;  2VLT A;  2QGV A;  3DIE A;  5FT3 A;  1BED A;  1M99 A;  5JWR B;  3TGZ A;  3UVT A;  3GX0 A;  2E0Q A;  1K0C A;  4EVM A;  3GMF A;  4POB A;  3CTF A;  3ERG A;  1TW9 A;  4ID0 A;  3F3R A;  3KH9 A;  1FOV A;  2IWT A;  1SD9 A;  2KHP A;  4BPY A;  5DDL A;  4K0G A;  2O8V B;  2R6K A;  4X0X A;  4ZB6 A;  3VWU A;  3BOA A;  4EF0 A;  3G7Y A;  1YDK A;  4MAB A;  5CNW A;  2P0G A;  3TOT A;  3FR9 A;  2DJ3 A;  1X9S B;  1ZMA A;  1PL2 A;  2J9H A;  2R2J A;  3TKS A;  2J23 A;  2NDO A;  4KGI A;  4POL A;  5F05 A;  5ECL B;  2YWO A;  4L0U A;  2NVL A;  2YAN A;  1Z9H A;  5ECI B;  4YH2 A;  3IA1 A;  1SJZ A;  4IVF A;  3BBY A;  3EMP A;  2C0D A;  4MCU A;  2LUS A;  5ELG A;  1ST9 A;  2XPD A;  2H8L A;  2A4V A;  3R2Q A;  5HFG A;  4N0Z A;  4E8H A;  4G19 A;  2N5F A;  5CO3 A;  1JZR A;  1NW2 A;  2B1K A;  2H1G A;  4O7H A;  3ZLP A;  2N5B A;  1TP9 A;  2OA7 A;  2FNO A;  1N8J A;  3H4K A;  2C4J A;  3LOR A;  5ECS A;  1A2J A;  3CTG A;  4OFM A;  1R5A A;  1GLQ A;  3FY7 A;  1E6B A;  1GSY A;  3D4T A;  4TN8 A;  1ERW A;  2OE0 A;  2X8C A;  1XZO A;  3ZVJ A;  6GSU A;  1VRS D;  4HI7 A;  1ML6 A;  2WZ9 A;  1K3L A;  4YQV A;  4O5R A;  1PKZ A;  5DCH A;  4PX1 A;  1DSB A;  2VIM A;  1YF1 A;  3BCI A;  1BAY A;  1YY7 A;  1EZK A;  1O81 A;  4NWY A;  4JU5 A;  4I8B A;  2KUC A;  3TJJ A;  2DJ2 A;  2DLX A;  5G30 A;  1OE8 A;  4F82 A;  3VLN A;  2E7P A;  1ZOF A;  4K7I A;  3NOF A;  4KA0 A;  4F0B A;  2H0I A;  1FHE A;  2A2S A;  5D96 A;  5D9T A;  2YPM A;  2GSS A;  2H72 A;  2MMA A;  2VL3 A;  3LWA A;  2H6Z A;  1XWG A;  6GSV A;  2YN1 A;  1O73 A;  1XWB A;  1GRX A;  3O76 A;  3GNJ A;  7GSS A;  5B6N A;  3M8N A;  2P5Q A;  2YCD A;  1SL2 B;  5KN2 A;  2CAI A;  4DSR A;  1Q4J A;  1ZYQ B;  2B1L A;  1XCC A;  2Z9S A;  3TJB A;  2HI7 A;  1UC7 A;  4GLT A;  3IV4 A;  4PNF A;  2IL3 A;  2GSQ A;  4AJ8 A;  4HU7 A;  4FYC A;  3HZ8 A;  3CSH A;  3MDK A;  2RUF A;  3TKR A;  4JED A;  1R4W A;  1FVK A;  2E2G A;  3TJF A;  2VL2 C;  1KBN A;  4MLY A;  1B8X A;  4KND A;  1A2M A;  3LYP A;  3IAS 2;  1BX9 A;  2WFC A;  5GSS A;  2F8A A;  2JL4 A;  4WF5 A;  2H0H A;  5GZZ B;  10GS A;  4WR5 A;  5IPG A;  5ELA A;  3ZFB A;  5CRE A;  5J9B A;  2RUE A;  2VLV A;  2KP1 A;  2YZH A;  4ILF A;  3UL3 A;  1G7E A;  1YEX A;  5INY A;  1H4O A;  1O8W A;  5G1K A;  2AYT A;  3KMN A;  2GZY A;  3OR5 A;  1Z6N A;  4ZIL A;  1TRU A;  1TJD A;  1SK2 A;  2H1B A;  2RII A;  3BCK A;  1TI3 A;  1SL1 B;  1SL0 B;  4EO3 A;  3LG6 A;  5ECK B;  3E9J B;  4PUF C;  2CX4 A;  5E4W A;  4PXO A;  1OE7 A;  2IIY A;  2X8H A;  3CRT A;  5IMC A;  2CVK A;  4JE1 A;  3QFA C;  2H0G A;  1Y25 A;  1X5C A;  2VL9 A;  1PX6 A;  3D21 A;  1PGT A;  3LYK A;  1F2E A;  5H5R A;  5J41 A;  1TRW A;  1T1V A;  2HYX A;  2H75 A;  4LMW A;  3IK7 A;  2IFQ B;  1Y6E A;  3HXS A;  1TXX A;  2JAD A;  1TU8 A;  2LRN A;  3EYT A;  1TTZ A;  1YKC A;  2B5E A;  1B9Y C;  2REM A;  4ACS A;  5AGY A;  4DEJ A;  5JWO B;  19GS A;  2AB6 A;  2GDR A;  2IJY A;  1OVN A;  2ALB A;  2CAQ A;  1T00 A;  2O7K A;  1K3O A;  3GFK A;  3VI5 A;  2GT6 A;  3C73 A;  2CVB A;  3IBH A;  2L4C A;  4NPB A;  1XXU A;  1GTA A;  2DSA A;  4KDX A;  4LLR A;  4WEY A;  5DBQ A;  3L9V A;  1QFN A;  3QMX A;  3GH6 A;  1EV4 A;  2GT5 A;  4K6X A;  2LJK A;  3TDG A;  4WR4 A;  3FZ9 A;  1OC3 A;  5IQY A;  1F6M C;  3D4M A;  1JZD A;  4IP6 A;  3FZ4 A;  4KX4 A;  3GUS A;  1N2A A;  4ZB8 A;  1XW6 A;  4TXO B;  3TKS C;  1KEB A;  4L0W A;  4L5O A;  4XRD A;  1SJ6 A;  5AIX A;  3TKQ A;  4N10 A;  1HQO A;  3GIX A;  3F4R A;  2H19 A;  1AW9 A;  2C3Q A;  3QD9 A;  4LA1 A;  2VL2 A;  2VCW A;  4Z7X A;  3ZIJ A;  3IK9 A;  2LV3 A;  4KSO A;  6GSS A;  1PSQ A;  5ID2 B;  4I6X A;  4K0N A;  3UJ1 A;  3U6V A;  1JZW A;  5A4V A;  2VUP A;  3M9K A;  1PX7 A;  3AY8 A;  3FEU A;  2MBS A;  4RQX A;  1G7O A;  2B5Y A;  3KH7 A;  1B4P A;  1XWA A;  4G9H A;  1V9W A;  5IMF A;  1UVZ A;  5EPF A;  1Z5Y E;  5HFK A;  4POK A;  2L5O A;  3A2V A;  3EIN A;  3DXB A;  1YEP A;  4FYB A;  2DML A;  4IGJ A; 
#chains in the Genus database with same CATH topology
 4XS4 B;  3UMA A;  1T3B A;  2L59 A;  4GSS A;  4IJ3 A;  3RDW A;  3VFI A;  1JFU A;  9GSS A;  2X8G A;  5D8I A;  2JU5 A;  1RK4 A;  5IMV A;  3K8N A;  3TJG A;  4MF7 A;  4GQF A;  3HVN A;  2K9F A;  4HOJ A;  2CA8 A;  5IOX A;  4MP4 A;  5IPH A;  1KNG A;  3RAZ A;  3HA9 A;  3QPM A;  2A4H A;  2GZP A;  4WET A;  4MJB A;  5D9V A;  4ML6 A;  2G0F A;  6GST A;  3O3T A;  4HS1 A;  1OC9 A;  2HZE A;  1A2L A;  2C1Y A;  2I9H A;  2VCV A;  2TRC P;  2DKI A;  2C0F A;  1OKT A;  4IBP A;  3P90 A;  1S3C A;  4DVC A;  1XWK A;  1A0F A;  4TR4 A;  3GKM A;  4BVX B;  1NSW A;  2FWH A;  5KN0 A;  1X5E A;  4USS A;  4POM A;  1K0O A;  3LEF A;  5ECQ B;  2EIR A;  4XS6 A;  1GUM A;  1DE2 A;  1G6Y A;  4LMV A;  1TRS A;  3LJR A;  2PN8 A;  3Q74 A;  4MZC A;  1O8X A;  5F0G A;  4Q5R A;  3CSJ A;  1IYH A;  3L78 A;  4JR4 A;  1NHY A;  4K7O A;  4YKF A;  4FIW A;  1U3A A;  1M2A A;  2DJK A;  3C8E A;  4OO5 A;  2AAW A;  1ABA A;  4FYU A;  4ZB9 A;  1V40 A;  1SJI A;  2A2R A;  3G9B A;  4ULX A;  2WRT A;  5IO0 A;  2GTU A;  4O5U A;  3ME8 A;  1DE1 A;  4EDZ A;  4L8E A;  1U3I A;  1K0B A;  3P2A A;  4HEA 2;  3US3 A;  3FK8 A;  5BRT A;  3H8Q A;  1J0F A;  1EV9 A;  4CHS A;  1VF2 A;  4YAP A;  5ECO B;  2VD1 A;  4O32 A;  2H1A A;  3EC3 A;  3ZYW A;  4NV5 A;  4PQ1 A;  3A2X A;  2GS3 A;  5JCG A;  3APS A;  2I4A A;  5FWG A;  3GL5 A;  2IMF A;  2LST A;  5DQS A;  2FY6 A;  4K5R A;  5HR1 A;  3TRX A;  2DBC A;  1MDK A;  3A3T A;  3GTU B;  4F03 A;  3CBU A;  3NZN A;  3QAV A;  2B6M A;  3GKN A;  1SKW B;  3M0F A;  1GSQ A;  1PL1 A;  4EL1 A;  3VUR A;  4RI6 A;  2IMI A;  1S3D A;  1QXH A;  5FHI A;  4TVE A;  3VI7 A;  1HNC A;  1QUW A;  5ECM B;  3PPU A;  3QCP A;  1JLW A;  4TW5 A;  1AIU A;  2VD0 A;  3M9J A;  3C71 A;  4KW6 A;  2JZT A;  3IDV A;  4XIH A;  16GS A;  2WDU A;  1TDI A;  3HVV A;  2FWG A;  5DVB A;  3GKX A;  2M46 A;  5IMD A;  1MDI A;  1NHO A;  1PKW A;  4L5L A;  1GUK A;  3G7I A;  5EY6 A;  2H71 A;  2XHF A;  4GSN A;  4F0C A;  4HUA A;  4HQZ A;  2MMN A;  4BA7 A;  3F4S A;  4KH7 A;  2G2Q A;  1MD3 A;  2BJX A;  3ZIV A;  3N5O A;  4MZB A;  5G31 A;  1B48 A;  1ZL9 A;  3IHG A;  4H86 A;  1G0T A;  4IW9 A;  2L6C A;  1B4Q A;  3F3Q A;  2LJA A;  2CQ9 A;  3L9S A;  3F63 A;  4MF5 A;  2LTK A;  4MK3 A;  2HRA A;  5CRG A;  2H1D A;  3ED3 A;  5GAP D;  2I3Y A;  4XCS A;  3ZRD A;  5IOW A;  5D9W A;  1J9B A;  4K8M A;  2HRF A;  1K3Y A;  1PFO A;  2DJJ A;  1Z6M A;  2EIQ A;  2CX3 A;  1EOG A;  3WGE A;  2VOC A;  2C0G A;  2MMO A;  1A0R P;  1SK1 A;  2EC4 A;  3ISO A;  1VGL A;  3HYP A;  2R0P A;  4GF0 A;  4TOP A;  4KCA A;  4AJ6 A;  3QOU A;  1XG8 A;  2PU9 C;  2L57 A;  4F9Z A;  1GNE A;  2DMM A;  2PUK C;  3S9F A;  5COH A;  2FCH A;  3TCO A;  2HT9 A;  5ABR A;  3A2W A;  2C0E A;  4V2N A;  2V41 A;  4I5Q A;  1SKR B;  3J7Y k;  2LKU A;  2HE3 A;  4XS1 A;  4ISD A;  5D9X A;  3LXZ A;  5ENU A;  4QL7 A;  2GQL A;  1AQV A;  4MZW A;  5CRH A;  2YWM A;  1RW1 A;  4BVY A;  1LU4 A;  1GSU A;  2F3M A;  1EGR A;  5IIZ A;  3P8W A;  4FH8 A;  1YQ1 A;  3HJM A;  2DJ1 A;  3RPP A;  1TKD B;  1YZX A;  3D22 A;  1RQM A;  2MYG A;  3EMX A;  4NMU A;  1K0N A;  1OKD A;  4IQA A;  4TXV A;  5CRW A;  3RHB A;  2X49 A;  1F3A A;  4ICY A;  4LL1 B;  4V2M A;  1TOF A;  2LQQ A;  3MSZ A;  1AUC A;  4EXJ A;  1EEJ A;  3EPT A;  1LJR A;  1WP0 A;  2VM2 A;  2IME A;  1R7H A;  2K6V A;  4HSC X;  1FAA A;  3TRQ A;  4ML1 A;  3PGT A;  2V32 A;  2IFQ A;  4NXI A;  3GYK A;  1T4Z A;  1WRY A;  1R5P A;  4IHU A;  4NV2 A;  1M2D A;  2PVO C;  3H1N A;  5DCG A;  3IR4 A;  1HYU A;  2FD3 A;  4PQH A;  1V2A A;  2LJR A;  3CYN A;  2FWF A;  2VCX A;  4MPF A;  3KTL A;  5H5S A;  1GLP A;  2JSY A;  4DSS B;  1U87 A;  3WT1 A;  1CQG A;  5DQY A;  2VCQ A;  4BL7 B;  2PGT A;  3LQ7 A;  3WT2 A;  4D73 B;  4WKW A;  2MBT A;  1AAZ A;  3FRC A;  1XPV A;  1ZYN A;  2YV9 A;  4MMM A;  4X43 A;  1PQN A;  1SYX A;  2OAC A;  1SK0 A;  3DYR A;  1A8Y A;  2IPA A;  4K7N A;  4Q5N A;  3ERF A;  2YP6 A;  4K9Z A;  1W4V A;  6GSY A;  4V1A p;  3E0U A;  2V6O A;  3WYW A;  4KAE A;  1F9M A;  1Z7R A;  3MAK A;  3ERW A;  2PBJ A;  3C1R A;  4J56 E;  2KP2 A;  2OBK A;  1Q98 A;  1WMJ A;  2K8S A;  3HDC A;  4IJI A;  5DAK B;  1XBS A;  3GL3 A;  1XW5 A;  1MDJ A;  5IM9 A;  3KMO A;  3J7Y b;  3UBL A;  2C3T A;  1KTE A;  4G0L A;  1SEN A;  4XRA A;  3FR3 A;  1WOU A;  2P5R A;  4G0I A;  3DML A;  2AHE A;  4MDC A;  3FW2 A;  3UBK A;  4Z2U A;  4K2X A;  2GST A;  2TRX A;  3KM6 A;  4TXO A;  3FZA A;  5GST A;  4OFN A;  3HVS A;  1I5G A;  4I2U A;  5A4W A;  3MWH A;  4YQU A;  2LRT A;  5DAL B;  4ZBD A;  1MEK A;  3GH9 A;  2FA4 A;  2WJU A;  3FR6 A;  4K5S A;  2GSR A;  1EP8 A;  2V1M A;  1S3R A;  3LFL A;  5HR0 A;  4CDO A;  5B8B A;  3TB2 A;  1PN9 A;  5ID2 A;  2DKH A;  4OCF A;  3BD2 A;  5F06 A;  4GQC A;  4TRX A;  3ZTL A;  1EP7 A;  1FB6 A;  2WUL A;  11GS A;  2B7K A;  2LS5 A;  2H66 A;  1XIY A;  2UZ8 A;  1DUG A;  3TRP A;  2XC2 A;  5AN1 A;  5LNK e;  3F4T A;  4JZQ A;  4WBR D;  1I9D A;  4AJ7 A;  2CZ3 A;  2RM6 A;  3IE3 A;  1AC1 A;  1AXD A;  4XS4 A;  3FYG A;  3CMI A;  1M7T A;  5G2Z A;  3IXR A;  4RUV A;  4HZ2 A;  5C00 A;  4TR1 B;  4IKH A;  2IMK A;  2PPT A;  2X64 A;  3HKR A;  1THX A;  2ZCT A;  2H76 A;  5B7C A;  1GWC A;  3HVX A;  1JLV A;  4MF6 A;  4K1F A;  3GSS A;  3EU4 A;  3Q6O A;  3TKS E;  3KJY A;  4JR6 A;  2HZF A;  2GQM A;  2OJL A;  2LNT A;  4HZ4 A;  1V98 A;  3GST A;  4ECJ A;  1ZZY A;  3BJ5 A;  4G2E A;  2CT6 A;  5C04 A;  3APO A;  1URM A;  3SBC A;  2HLS A;  4TR0 A;  2ON7 A;  2JZR A;  1PMT A;  4WXT A;  2PVQ A;  3RBT A;  1GSS A;  4DSQ A;  4NAX A;  2E2M A;  5CYY A;  1SYR A;  5HFI A;  1A23 A;  1XWC A;  4PUA A;  2NBS A;  4YAV A;  5L71 A;  4FQU A;  4BVX A;  3EE2 A;  4PNG A;  4X1U A;  3W8S A;  3WGX A;  1K0M A;  2ES7 A;  1V58 A;  1B9X C;  3D0Z A;  4XHM A;  3HY2 A;  3UOM A;  5IO2 A;  1Z7P A;  3IRA A;  1SD8 A;  4QQ7 A;  4PTS A;  1FB0 A;  4GTU A;  2BTO T;  1BYE A;  1U6T A;  3EU3 A;  1XVW A;  2B5X A;  5D73 A;  2ZNM A;  1XFL A;  2IMD A;  2DJ0 A;  5JWQ B;  2HSY A;  3I43 A;  3VWX A;  3GKK A;  2X4A A;  3L4N A;  4ECB A;  1ERU A;  5G5E A;  2IN3 A;  4YQM A;  4J57 E;  3MYD A;  2H30 A;  2H01 A;  2VCZ A;  3LSZ A;  4GST A;  3F6D A;  3EWL A;  3H93 A;  3MNG A;  5H5Q A;  4N11 A;  5DJM A;  3CSI A;  4ZL7 A;  2VO4 A;  1EOH A;  2O89 A;  3ZML A;  3ZZX A;  3IPZ A;  1O7U A;  1YF0 A;  1WJK A;  4PGT A;  12GS A;  2R37 A;  4MPG A;  2AJQ B;  4GRF A;  2CVD A;  3IC8 A;  4OCE A;  1AQX A;  2O87 A;  3GV1 A;  5G1L A;  3E3E A;  3GUR A;  2XBI A;  1ERT A;  4PUR A;  3W8J A;  4ZL8 A;  2F51 A;  3FKF A;  4IQ1 A;  3C1S A;  3NIV A;  3JCM L;  2GGT A;  3GTU A;  4MA9 A;  5CRD A;  3PR8 A;  2LQO A;  5A5K A;  5EVO A;  4MH2 A;  2M80 A;  4HQS A;  2OBI A;  2QSI A;  2NPB A;  3IAM 2;  2D2Z A;  1QMV A;  4OD7 A;  1F3B A;  2YWN A;  1ZCP A;  4MNN A;  4O92 A;  4J2F A;  2OKA A;  4RI7 A;  2P31 A;  5G5F A;  2WGR A;  3QAW A;  3KD0 A;  4QL9 A;  3ZIT A;  1GH2 A;  2M72 A;  5KN3 A;  1MD4 A;  5HR2 A;  4NHZ A;  3H79 A;  2PMT A;  2PER A;  3UVH A;  3GX8 A;  3WD6 A;  4X4J A;  4P3Y B;  5J5N A;  1T8E B;  1F37 A;  1BG5 A;  1VF4 A;  3C7M A;  2HNL A;  1T4Y A;  5E59 A;  1ZGN A;  1GTB A;  4I97 A;  1UA5 A;  1NM3 A;  1G6W A;  1K0D A;  3ZMK A;  5ECH B;  3D5J A;  1ACV A;  1M9A A;  4OMV A;  1TRV A;  1R26 A;  3ZRE A;  14GS A;  3QFB C;  5DJL A;  3F6F A;  3U5R E;  1QK8 A;  2VAF A;  1USB A;  4EUY A;  5IMZ A;  2C80 A;  4F2I A;  1X9W B;  5AIV A;  1GSF A;  3O6T A;  2H70 A;  4V2L A;  2R5G A;  2H74 A;  5J4U A;  2FLS A;  1A24 A;  3EUR A;  4EDY A;  1X0R A;  3GN3 A;  3F0I A;  1XVQ A;  4TKY A;  1YKA A;  3N9J A;  1SKS B;  2N5A A;  3KXO A;  2VLU A;  2O85 A;  1FO5 A;  4KE3 A;  2TIR A;  5LD0 A;  2B3S A;  3PIN A;  6GSW A;  5J9C A;  1VF1 A;  4G0K A;  1U88 A;  3DRN A;  2EIO A;  4ZL9 A;  2YJ7 A;  1UN2 A;  3I69 A;  2KLX A;  1M9B A;  4AGS A;  1XW9 A;  3UAP A;  3I6A A;  4EC0 A;  3RPN A;  4O5Q A;  1QGV A;  4ZBA A;  3ME7 A;  1IYI A;  2I81 A;  3F8U A;  5F07 A;  4KUN A;  1ON4 A;  4IEL A;  5GAN D;  2JSZ A;  2R4V A;  1M3J A;  3D6I A;  1WWJ A;  1EGO A;  3W6G A;  1M3I A;  3VWV A;  2I1U A;  4OO4 A;  2C8U A;  2FHE A;  1ZYE A;  3CXG A;  1LBK A;  2MMZ A;  3LXT A;  2HSH A;  18GS A;  2F8F A;  3DEX A;  2V2G A;  2YJH A;  4HU9 A;  1ILO A;  5J3R A;  4IP1 A;  1J08 A;  5ECN B;  3HHV A;  1PRX A;  2LRC A;  5ECP B;  1X9M B;  4LL4 B;  1GUL A;  3QDN A;  1FG4 A;  2FUG 2;  5F8B A;  3KP8 A;  3VPQ A;  2R3X A;  1CQH A;  4RQR A;  2K18 A;  4KCE A;  3KP9 A;  3PH9 A;  2DIY A;  3DVX A;  4OFT A;  2YZU A;  3ZVJ D;  4JBB A;  1XOB A;  4ZXG A;  2LNS A;  3FMW A;  4ECI A;  2OAD A;  2VM1 A;  4XTS A;  3VPT A;  5AIS A;  1MTC A;  2OE1 A;  3FZ5 A;  4AF2 A;  4GXZ A;  3HZ4 A;  1BJX A;  2YNX A;  1ERV A;  4MJA A;  6GSX A;  4DSS A;  4EKZ A;  1DBY A;  5D93 A;  1GNW A;  2PWJ A;  4BL7 A;  4D73 A;  4BWS A;  4HJ2 A;  2OE3 A;  4HDE A;  2CV4 A;  3UIW A;  2C3N A;  2JZS A;  4MJE A;  1Z3E A;  2HRN A;  3WGD A;  2WB9 A;  3IHQ A;  1YJ6 A;  2RLI A;  1TK8 B;  4GWR A;  3VWW A;  4K2D A;  2RM5 A;  22GS A;  1EWX A;  3HD5 A;  4MH3 A;  4IN0 A;  2DC5 A;  2H6Y A;  1THO A;  1TU7 A;  3DD3 A;  5KEJ A;  2CZ2 A;  4KDY A;  3LW9 A;  3APQ A;  1W89 A;  3L0H A;  5DAK A;  3GHA A;  5B8A A;  4Q5F A;  1AQW A;  1PN0 A;  1JHB A;  4TR3 A;  13GS A;  4IS0 A;  2GLR A;  1O6J A;  5CAX A;  4NHW A;  2YWI A;  2H73 A;  1O85 A;  4HJM A;  2VCT A;  2XBQ A;  2FGX A;  1QQ2 A;  1FOH A;  5DAL A;  3KTB A;  1HNA A;  3P7X A;  4KSM A;  2FA8 A;  4EE0 A;  1XOA A;  1TK0 B;  3DGQ A;  3QR6 A;  3LGC A;  3A5W A;  1JZO A;  4CW9 A;  1M2B A;  3SWL A;  3CRU A;  4ECC A;  3I9V 2;  1E2Y A;  4KB3 A;  1BQ7 A;  3L9U A;  2GVP A;  4G10 A;  1FW1 A;  5EL8 A;  1OAZ A;  4ZIJ A;  4I2T A;  2HXK A;  5LCZ A;  4N0V A;  2F9S A;  3KGK A;  3GRX A;  2MZC A;  2L5L A;  2QA2 A;  1S3A A;  1TK5 B;  1GSD A;  2L6D A;  3TUE A;  3TKP A;  1GL8 A;  3DKS A;  5HQP A;  3QAG A;  3IOS A;  3G7J A;  3Q19 A;  1HNB A;  1GSE A;  3M3M A;  3KZQ A;  5CP1 A;  2LEG A;  3GA4 A;  1WPI A;  3FHK A;  3EVI A;  2GQK A;  4GCI A;  2GZZ A;  3UAR A;  4KDU A;  1HD2 A;  4TR1 A;  5B6M A;  4E8E A;  5KN1 A;  1WE0 A;  2L4Q A;  1OC8 A;  3R3E A;  3Q18 A;  1T7P B;  2BMX A;  2YV7 A;  4ZBB A;  4BWQ A;  5HR3 A;  2DIZ A;  2X99 A;  3F9U A;  5ECR B;  3IC4 A;  1PA3 A;  1GTI A;  3KCM A;  3M1G A;  5A4U A;  4PQI A;  2XPE A;  1OYJ A;  1C72 A;  2FWE A;  5JCU A;  3RHC A;  2AV4 A;  4WBJ A;  2ON5 A;  3TJK A;  1GUH A;  2H6X A;  1X5D A;  2V6K A;  3VK9 A;  4N30 A;  1TI1 A;  2WCI A;  3ZL5 A;  2QC7 A;  3V1W A;  3KEB A;  17GS A;  2WS2 A;  2HFD A;  2KOK A;  4MJC A;  3KIJ A;  2AUV A;  1EEM A;  3TOU A;  2K8V A;  1FVJ A;  1A8L A;  3HJP A;  8GSS A;  1WIK A;  1GTU A;  2JAC A;  3HCZ A;  1OC9 B;  2HZE B;  4FO5 A;  5JCW A;  2NTO A;  3UEM A;  1VF3 A;  2QKE A;  1K0A A;  3DVW A;  3DWV A;  1PD2 1;  1GP1 A;  1M0U A;  20GS A;  2YOI A;  4V1A g;  4OWY A;  4WF4 A;  3ZFL A;  5IMA A;  1SU9 A;  2ZUP A;  4Q5Q A;  2B7J A;  1H75 A;  3HJO A;  4JRR A;  1V57 A;  2VLT A;  2QGV A;  3DIE A;  5FT3 A;  1BED A;  1M99 A;  5JWR B;  3TGZ A;  3UVT A;  3GX0 A;  2E0Q A;  1K0C A;  4EVM A;  3GMF A;  4POB A;  3CTF A;  3ERG A;  1TW9 A;  4ID0 A;  3F3R A;  3KH9 A;  1FOV A;  2IWT A;  1SD9 A;  2KHP A;  4BPY A;  5DDL A;  4K0G A;  2O8V B;  2R6K A;  4X0X A;  4ZB6 A;  3VWU A;  3BOA A;  4EF0 A;  3G7Y A;  1YDK A;  4MAB A;  5CNW A;  2P0G A;  3TOT A;  3FR9 A;  2DJ3 A;  1X9S B;  1ZMA A;  1PL2 A;  2J9H A;  2R2J A;  3TKS A;  2J23 A;  2NDO A;  4KGI A;  4POL A;  5F05 A;  5ECL B;  2YWO A;  4L0U A;  2NVL A;  2YAN A;  1Z9H A;  5ECI B;  4YH2 A;  3IA1 A;  1SJZ A;  4IVF A;  3BBY A;  3EMP A;  2C0D A;  4MCU A;  2LUS A;  5ELG A;  1ST9 A;  2XPD A;  2H8L A;  2A4V A;  3R2Q A;  5HFG A;  4N0Z A;  4E8H A;  4G19 A;  2N5F A;  5CO3 A;  1JZR A;  1NW2 A;  2B1K A;  2H1G A;  4O7H A;  3ZLP A;  2N5B A;  1TP9 A;  2OA7 A;  2FNO A;  4KF9 A;  1N8J A;  3H4K A;  2C4J A;  3LOR A;  1ZYP A;  5ECS A;  1A2J A;  3CTG A;  4OFM A;  4BIK A;  1R5A A;  1GLQ A;  3FY7 A;  1E6B A;  5KOW A;  3MIX A;  1GSY A;  3D4T A;  4TN8 A;  1ERW A;  2OE0 A;  2X8C A;  1XZO A;  3ZVJ A;  6GSU A;  1VRS D;  5BMU A;  4HI7 A;  1ML6 A;  2WZ9 A;  1K3L A;  4YQV A;  4O5R A;  1PKZ A;  5DCH A;  4PX1 A;  1DSB A;  2VIM A;  1YF1 A;  3BCI A;  1BAY A;  1YY7 A;  1EZK A;  1O81 A;  4NWY A;  4JU5 A;  4I8B A;  2KUC A;  3TJJ A;  2DJ2 A;  2DLX A;  5G30 A;  1OE8 A;  4F82 A;  3VLN A;  2E7P A;  1ZOF A;  4K7I A;  3NOF A;  4KA0 A;  4F0B A;  2R0C A;  2H0I A;  1FHE A;  4Z2T A;  2A2S A;  5D96 A;  5D9T A;  2YPM A;  2GSS A;  2H72 A;  2MMA A;  2VL3 A;  3LWA A;  2H6Z A;  1XWG A;  6GSV A;  2YN1 A;  1O73 A;  1XWB A;  1GRX A;  3O76 A;  3GNJ A;  7GSS A;  5B6N A;  3M8N A;  2P5Q A;  2YCD A;  1SL2 B;  5KN2 A;  2CAI A;  4DSR A;  1Q4J A;  1ZYQ B;  2B1L A;  1XCC A;  2Z9S A;  3TJB A;  2HI7 A;  1UC7 A;  4GLT A;  3IV4 A;  4PNF A;  2IL3 A;  2GSQ A;  4AJ8 A;  4HU7 A;  4FYC A;  3HZ8 A;  3CSH A;  3MDK A;  2RUF A;  3TKR A;  4JED A;  1R4W A;  1FVK A;  2HSM A;  2E2G A;  3TJF A;  2VL2 C;  1KBN A;  4MLY A;  1B8X A;  4KND A;  1A2M A;  3LYP A;  3IAS 2;  1BX9 A;  2WFC A;  2R0G A;  5GSS A;  2F8A A;  2JL4 A;  3CQF A;  4WF5 A;  2H0H A;  5GZZ B;  4EIQ A;  10GS A;  4WR5 A;  5IPG A;  5ELA A;  3ZFB A;  5CRE A;  5J9B A;  2RUE A;  2VLV A;  2KP1 A;  2YZH A;  4ILF A;  3UL3 A;  1G7E A;  1YEX A;  5INY A;  1H4O A;  1O8W A;  5G1K A;  2AYT A;  3KMN A;  2GZY A;  3OR5 A;  1Z6N A;  4ZIL A;  1TRU A;  1TJD A;  1SK2 A;  2H1B A;  2RII A;  3BCK A;  4BVY B;  1TI3 A;  1SL1 B;  1SL0 B;  4EO3 A;  3LG6 A;  5ECK B;  3E9J B;  4PUF C;  2CX4 A;  5E4W A;  4PXO A;  1OE7 A;  2IIY A;  2X8H A;  3CRT A;  5IMC A;  2CVK A;  4JE1 A;  3QFA C;  2H0G A;  1Y25 A;  1X5C A;  2VL9 A;  1PX6 A;  3D21 A;  1PGT A;  3LYK A;  1F2E A;  5H5R A;  5J41 A;  4A5P A;  1TRW A;  1T1V A;  2HYX A;  4Z2R A;  2H75 A;  4LMW A;  3IK7 A;  2IFQ B;  1Y6E A;  3HXS A;  1TXX A;  2JAD A;  1TU8 A;  2LRN A;  3EYT A;  1TTZ A;  1YKC A;  2B5E A;  1B9Y C;  2REM A;  4ACS A;  5AGY A;  4DEJ A;  5JWO B;  19GS A;  2AB6 A;  2GDR A;  2IJY A;  1OVN A;  2ALB A;  2CAQ A;  2QA1 A;  1T00 A;  2O7K A;  1K3O A;  3GFK A;  3VI5 A;  2A2P A;  2GT6 A;  3C73 A;  4CY6 A;  2CVB A;  3IBH A;  2L4C A;  4NPB A;  1XXU A;  1GTA A;  2DSA A;  4KDX A;  4LLR A;  4WEY A;  5DBQ A;  3L9V A;  1QFN A;  3QMX A;  3GH6 A;  1EV4 A;  2GT5 A;  4K6X A;  2HRK A;  2LJK A;  3TDG A;  4WR4 A;  3FZ9 A;  1OC3 A;  5IQY A;  1F6M C;  3D4M A;  1JZD A;  4IP6 A;  3FZ4 A;  4KX4 A;  3GUS A;  1N2A A;  4ZB8 A;  1XW6 A;  4TXO B;  3TKS C;  1KEB A;  5KOX A;  4L0W A;  4L5O A;  4XRD A;  1SJ6 A;  5AIX A;  3TKQ A;  4N10 A;  1HQO A;  3GIX A;  4EIP A;  3F4R A;  2H19 A;  1AW9 A;  2C3Q A;  3QD9 A;  4LA1 A;  2VL2 A;  2VCW A;  4YKG A;  4Z7X A;  3ZIJ A;  3IK9 A;  2LV3 A;  4KSO A;  6GSS A;  1PSQ A;  5ID2 B;  4I6X A;  4K0N A;  3UJ1 A;  3U6V A;  1JZW A;  5A4V A;  2VUP A;  3M9K A;  1PX7 A;  3AY8 A;  3FEU A;  2MBS A;  4RQX A;  1G7O A;  2B5Y A;  3KH7 A;  1B4P A;  1XWA A;  4G9H A;  1V9W A;  5IMF A;  1UVZ A;  5EPF A;  1Z5Y E;  5HFK A;  4POK A;  2L5O A;  3A2V A;  3EIN A;  3DXB A;  1YEP A;  4FYB A;  2DML A;  3A5I A;  4CY8 A;  4IGJ A; 
#chains in the Genus database with same CATH homology
 4XS4 B;  3UMA A;  1T3B A;  2L59 A;  4GSS A;  4IJ3 A;  3RDW A;  3VFI A;  1JFU A;  9GSS A;  2X8G A;  5D8I A;  2JU5 A;  1RK4 A;  5IMV A;  3K8N A;  3TJG A;  4MF7 A;  4GQF A;  2K9F A;  4HOJ A;  2CA8 A;  5IOX A;  4MP4 A;  5IPH A;  1KNG A;  3RAZ A;  3HA9 A;  3QPM A;  2A4H A;  2GZP A;  4WET A;  4MJB A;  5D9V A;  4ML6 A;  2G0F A;  6GST A;  3O3T A;  4HS1 A;  1OC9 A;  2HZE A;  1A2L A;  2C1Y A;  2I9H A;  2VCV A;  2TRC P;  2DKI A;  2C0F A;  1OKT A;  4IBP A;  3P90 A;  1S3C A;  4DVC A;  1XWK A;  1A0F A;  4TR4 A;  3GKM A;  4BVX B;  1NSW A;  2FWH A;  5KN0 A;  1X5E A;  4USS A;  4POM A;  1K0O A;  3LEF A;  5ECQ B;  2EIR A;  4XS6 A;  1GUM A;  1DE2 A;  1G6Y A;  4LMV A;  1TRS A;  3LJR A;  2PN8 A;  3Q74 A;  4MZC A;  1O8X A;  5F0G A;  4Q5R A;  3CSJ A;  1IYH A;  3L78 A;  4JR4 A;  1NHY A;  4K7O A;  4YKF A;  4FIW A;  1U3A A;  1M2A A;  2DJK A;  3C8E A;  4OO5 A;  2AAW A;  1ABA A;  4FYU A;  4ZB9 A;  1V40 A;  1SJI A;  2A2R A;  3G9B A;  4ULX A;  2WRT A;  5IO0 A;  2GTU A;  4O5U A;  3ME8 A;  1DE1 A;  4EDZ A;  4L8E A;  1U3I A;  1K0B A;  3P2A A;  4HEA 2;  3US3 A;  3FK8 A;  5BRT A;  3H8Q A;  1J0F A;  1EV9 A;  4CHS A;  1VF2 A;  4YAP A;  5ECO B;  2VD1 A;  4O32 A;  2H1A A;  3EC3 A;  3ZYW A;  4NV5 A;  4PQ1 A;  3A2X A;  2GS3 A;  5JCG A;  3APS A;  2I4A A;  5FWG A;  3GL5 A;  2IMF A;  2LST A;  5DQS A;  2FY6 A;  4K5R A;  5HR1 A;  3TRX A;  2DBC A;  1MDK A;  3A3T A;  3GTU B;  4F03 A;  3CBU A;  3NZN A;  3QAV A;  2B6M A;  3GKN A;  1SKW B;  3M0F A;  1GSQ A;  1PL1 A;  4EL1 A;  3VUR A;  4RI6 A;  2IMI A;  1S3D A;  1QXH A;  5FHI A;  4TVE A;  3VI7 A;  1HNC A;  1QUW A;  5ECM B;  3PPU A;  3QCP A;  1JLW A;  4TW5 A;  1AIU A;  2VD0 A;  3M9J A;  3C71 A;  4KW6 A;  2JZT A;  3IDV A;  4XIH A;  16GS A;  2WDU A;  1TDI A;  3HVV A;  2FWG A;  5DVB A;  3GKX A;  2M46 A;  5IMD A;  1MDI A;  1NHO A;  1PKW A;  4L5L A;  1GUK A;  3G7I A;  5EY6 A;  2H71 A;  2XHF A;  4GSN A;  4F0C A;  4HUA A;  4HQZ A;  2MMN A;  4BA7 A;  3F4S A;  4KH7 A;  2G2Q A;  1MD3 A;  2BJX A;  3ZIV A;  3N5O A;  4MZB A;  5G31 A;  1B48 A;  1ZL9 A;  3IHG A;  4H86 A;  1G0T A;  4IW9 A;  2L6C A;  1B4Q A;  3F3Q A;  2LJA A;  2CQ9 A;  3L9S A;  3F63 A;  4MF5 A;  2LTK A;  4MK3 A;  2HRA A;  5CRG A;  2H1D A;  3ED3 A;  5GAP D;  2I3Y A;  4XCS A;  3ZRD A;  5IOW A;  5D9W A;  1J9B A;  4K8M A;  2HRF A;  1K3Y A;  2DJJ A;  1Z6M A;  2EIQ A;  2CX3 A;  1EOG A;  3WGE A;  2VOC A;  2C0G A;  2MMO A;  1A0R P;  1SK1 A;  2EC4 A;  3ISO A;  1VGL A;  3HYP A;  2R0P A;  4GF0 A;  4TOP A;  4KCA A;  4AJ6 A;  3QOU A;  2PU9 C;  2L57 A;  4F9Z A;  1GNE A;  2DMM A;  2PUK C;  3S9F A;  5COH A;  2FCH A;  3TCO A;  2HT9 A;  5ABR A;  3A2W A;  2C0E A;  4V2N A;  2V41 A;  4I5Q A;  1SKR B;  3J7Y k;  2LKU A;  2HE3 A;  4XS1 A;  4ISD A;  5D9X A;  3LXZ A;  5ENU A;  4QL7 A;  2GQL A;  1AQV A;  4MZW A;  5CRH A;  2YWM A;  1RW1 A;  4BVY A;  1LU4 A;  1GSU A;  2F3M A;  1EGR A;  5IIZ A;  3P8W A;  4FH8 A;  1YQ1 A;  3HJM A;  2DJ1 A;  3RPP A;  1TKD B;  1YZX A;  3D22 A;  1RQM A;  2MYG A;  3EMX A;  4NMU A;  1K0N A;  1OKD A;  4IQA A;  4TXV A;  5CRW A;  3RHB A;  2X49 A;  1F3A A;  4ICY A;  4LL1 B;  4V2M A;  1TOF A;  2LQQ A;  3MSZ A;  1AUC A;  4EXJ A;  1EEJ A;  3EPT A;  1LJR A;  1WP0 A;  2VM2 A;  2IME A;  1R7H A;  2K6V A;  1FAA A;  3TRQ A;  4ML1 A;  3PGT A;  2V32 A;  2IFQ A;  4NXI A;  3GYK A;  1T4Z A;  1WRY A;  1R5P A;  4IHU A;  4NV2 A;  1M2D A;  2PVO C;  3H1N A;  5DCG A;  3IR4 A;  1HYU A;  2FD3 A;  4PQH A;  1V2A A;  2LJR A;  3CYN A;  2FWF A;  2VCX A;  4MPF A;  3KTL A;  5H5S A;  1GLP A;  2JSY A;  4DSS B;  1U87 A;  3WT1 A;  1CQG A;  5DQY A;  2VCQ A;  4BL7 B;  2PGT A;  3LQ7 A;  3WT2 A;  4D73 B;  4WKW A;  2MBT A;  3FRC A;  1AAZ A;  1XPV A;  1ZYN A;  2YV9 A;  4MMM A;  4X43 A;  1PQN A;  1SYX A;  2OAC A;  1SK0 A;  3DYR A;  1A8Y A;  2IPA A;  4K7N A;  4Q5N A;  3ERF A;  2YP6 A;  4K9Z A;  1W4V A;  6GSY A;  4V1A p;  3E0U A;  2V6O A;  3WYW A;  4KAE A;  1F9M A;  1Z7R A;  3MAK A;  3ERW A;  2PBJ A;  3C1R A;  4J56 E;  2KP2 A;  2OBK A;  1Q98 A;  1WMJ A;  2K8S A;  3HDC A;  4IJI A;  5DAK B;  1XBS A;  3GL3 A;  1XW5 A;  1MDJ A;  5IM9 A;  3KMO A;  3J7Y b;  3UBL A;  2C3T A;  1KTE A;  4G0L A;  1SEN A;  4XRA A;  3FR3 A;  1WOU A;  2P5R A;  4G0I A;  3DML A;  2AHE A;  4MDC A;  3FW2 A;  3UBK A;  4Z2U A;  4K2X A;  2GST A;  2TRX A;  3KM6 A;  4TXO A;  3FZA A;  5GST A;  4OFN A;  3HVS A;  1I5G A;  4I2U A;  5A4W A;  3MWH A;  4YQU A;  2LRT A;  5DAL B;  4ZBD A;  1MEK A;  3GH9 A;  2FA4 A;  2WJU A;  3FR6 A;  4K5S A;  2GSR A;  1EP8 A;  2V1M A;  3LFL A;  5HR0 A;  4CDO A;  5B8B A;  3TB2 A;  1PN9 A;  5ID2 A;  2DKH A;  4OCF A;  3BD2 A;  5F06 A;  4GQC A;  4TRX A;  3ZTL A;  1EP7 A;  1FB6 A;  2WUL A;  11GS A;  2B7K A;  2LS5 A;  2H66 A;  1XIY A;  2UZ8 A;  1DUG A;  3TRP A;  2XC2 A;  5AN1 A;  5LNK e;  3F4T A;  4JZQ A;  4WBR D;  1I9D A;  4AJ7 A;  2CZ3 A;  2RM6 A;  3IE3 A;  1AC1 A;  1AXD A;  4XS4 A;  3FYG A;  3CMI A;  1M7T A;  5G2Z A;  3IXR A;  4RUV A;  4HZ2 A;  5C00 A;  4TR1 B;  4IKH A;  2IMK A;  2PPT A;  2X64 A;  3HKR A;  1THX A;  2ZCT A;  2H76 A;  5B7C A;  1GWC A;  3HVX A;  1JLV A;  4MF6 A;  4K1F A;  3GSS A;  3EU4 A;  3Q6O A;  3TKS E;  3KJY A;  4JR6 A;  2HZF A;  2GQM A;  2OJL A;  2LNT A;  4HZ4 A;  1V98 A;  3GST A;  4ECJ A;  1ZZY A;  3BJ5 A;  4G2E A;  2CT6 A;  5C04 A;  3APO A;  1URM A;  3SBC A;  2HLS A;  4TR0 A;  2ON7 A;  2JZR A;  1PMT A;  4WXT A;  2PVQ A;  3RBT A;  1GSS A;  4DSQ A;  4NAX A;  2E2M A;  5CYY A;  1SYR A;  5HFI A;  1A23 A;  1XWC A;  4PUA A;  2NBS A;  4YAV A;  5L71 A;  4FQU A;  4BVX A;  3EE2 A;  4PNG A;  4X1U A;  3W8S A;  3WGX A;  1K0M A;  2ES7 A;  1V58 A;  1B9X C;  3D0Z A;  4XHM A;  3HY2 A;  3UOM A;  5IO2 A;  1Z7P A;  3IRA A;  1SD8 A;  4QQ7 A;  4PTS A;  1FB0 A;  4GTU A;  2BTO T;  1BYE A;  1U6T A;  3EU3 A;  1XVW A;  2B5X A;  5D73 A;  2ZNM A;  1XFL A;  2IMD A;  2DJ0 A;  5JWQ B;  2HSY A;  3I43 A;  3VWX A;  3GKK A;  2X4A A;  3L4N A;  4ECB A;  1ERU A;  5G5E A;  2IN3 A;  4YQM A;  4J57 E;  3MYD A;  2H30 A;  2H01 A;  2VCZ A;  3LSZ A;  4GST A;  3F6D A;  3EWL A;  3H93 A;  3MNG A;  5H5Q A;  4N11 A;  5DJM A;  3CSI A;  4ZL7 A;  2VO4 A;  1EOH A;  2O89 A;  3ZML A;  3ZZX A;  3IPZ A;  1O7U A;  1YF0 A;  1WJK A;  4PGT A;  12GS A;  2R37 A;  4MPG A;  2AJQ B;  4GRF A;  2CVD A;  3IC8 A;  4OCE A;  1AQX A;  2O87 A;  3GV1 A;  5G1L A;  3E3E A;  3GUR A;  2XBI A;  1ERT A;  4PUR A;  3W8J A;  4ZL8 A;  2F51 A;  3FKF A;  4IQ1 A;  3C1S A;  3NIV A;  3JCM L;  2GGT A;  3GTU A;  4MA9 A;  5CRD A;  3PR8 A;  2LQO A;  5A5K A;  5EVO A;  4MH2 A;  2M80 A;  4HQS A;  2OBI A;  2QSI A;  2NPB A;  3IAM 2;  2D2Z A;  1QMV A;  4OD7 A;  1F3B A;  2YWN A;  1ZCP A;  4MNN A;  4O92 A;  4J2F A;  2OKA A;  4RI7 A;  2P31 A;  5G5F A;  2WGR A;  3QAW A;  3KD0 A;  4QL9 A;  3ZIT A;  1GH2 A;  2M72 A;  5KN3 A;  1MD4 A;  5HR2 A;  4NHZ A;  3H79 A;  2PMT A;  2PER A;  3UVH A;  3GX8 A;  3WD6 A;  4X4J A;  4P3Y B;  5J5N A;  1T8E B;  1F37 A;  1BG5 A;  1VF4 A;  3C7M A;  2HNL A;  1T4Y A;  5E59 A;  1ZGN A;  1GTB A;  4I97 A;  1UA5 A;  1NM3 A;  1G6W A;  1K0D A;  3ZMK A;  5ECH B;  3D5J A;  1ACV A;  1M9A A;  4OMV A;  1TRV A;  1R26 A;  3ZRE A;  14GS A;  3QFB C;  5DJL A;  3F6F A;  3U5R E;  1QK8 A;  2VAF A;  1USB A;  4EUY A;  5IMZ A;  2C80 A;  4F2I A;  1X9W B;  5AIV A;  1GSF A;  3O6T A;  2H70 A;  4V2L A;  2R5G A;  2H74 A;  5J4U A;  2FLS A;  1A24 A;  3EUR A;  4EDY A;  1X0R A;  3GN3 A;  3F0I A;  1XVQ A;  4TKY A;  1YKA A;  3N9J A;  1SKS B;  2N5A A;  3KXO A;  2VLU A;  2O85 A;  1FO5 A;  4KE3 A;  2TIR A;  5LD0 A;  2B3S A;  3PIN A;  6GSW A;  5J9C A;  1VF1 A;  4G0K A;  1U88 A;  3DRN A;  2EIO A;  4ZL9 A;  2YJ7 A;  1UN2 A;  3I69 A;  2KLX A;  1M9B A;  4AGS A;  1XW9 A;  3UAP A;  3I6A A;  4EC0 A;  3RPN A;  4O5Q A;  1QGV A;  4ZBA A;  3ME7 A;  1IYI A;  2I81 A;  3F8U A;  5F07 A;  4KUN A;  1ON4 A;  4IEL A;  5GAN D;  2JSZ A;  2R4V A;  3D6I A;  1WWJ A;  1EGO A;  3W6G A;  3VWV A;  2I1U A;  4OO4 A;  2C8U A;  2FHE A;  1ZYE A;  3CXG A;  1LBK A;  2MMZ A;  3LXT A;  2HSH A;  18GS A;  2F8F A;  3DEX A;  2V2G A;  2YJH A;  4HU9 A;  1ILO A;  5J3R A;  4IP1 A;  1J08 A;  5ECN B;  3HHV A;  1PRX A;  2LRC A;  5ECP B;  1X9M B;  4LL4 B;  1GUL A;  3QDN A;  1FG4 A;  2FUG 2;  5F8B A;  3KP8 A;  3VPQ A;  2R3X A;  1CQH A;  4RQR A;  2K18 A;  4KCE A;  3KP9 A;  3PH9 A;  2DIY A;  3DVX A;  4OFT A;  2YZU A;  3ZVJ D;  4JBB A;  1XOB A;  4ZXG A;  2LNS A;  3FMW A;  4ECI A;  2OAD A;  2VM1 A;  4XTS A;  3VPT A;  5AIS A;  1MTC A;  2OE1 A;  3FZ5 A;  4AF2 A;  4GXZ A;  3HZ4 A;  1BJX A;  2YNX A;  1ERV A;  4MJA A;  6GSX A;  4DSS A;  4EKZ A;  1DBY A;  5D93 A;  1GNW A;  2PWJ A;  4BL7 A;  4D73 A;  4BWS A;  4HJ2 A;  2OE3 A;  4HDE A;  2CV4 A;  3UIW A;  2C3N A;  2JZS A;  4MJE A;  1Z3E A;  2HRN A;  3WGD A;  2WB9 A;  3IHQ A;  1YJ6 A;  2RLI A;  1TK8 B;  4GWR A;  3VWW A;  4K2D A;  2RM5 A;  22GS A;  1EWX A;  3HD5 A;  4MH3 A;  4IN0 A;  2DC5 A;  2H6Y A;  1THO A;  1TU7 A;  3DD3 A;  5KEJ A;  2CZ2 A;  4KDY A;  3LW9 A;  3APQ A;  1W89 A;  3L0H A;  5DAK A;  3GHA A;  5B8A A;  4Q5F A;  1AQW A;  1PN0 A;  1JHB A;  4TR3 A;  13GS A;  4IS0 A;  2GLR A;  1O6J A;  5CAX A;  4NHW A;  2YWI A;  2H73 A;  1O85 A;  4HJM A;  2VCT A;  2XBQ A;  2FGX A;  1QQ2 A;  1FOH A;  5DAL A;  3KTB A;  1HNA A;  3P7X A;  4KSM A;  2FA8 A;  4EE0 A;  1XOA A;  1TK0 B;  3DGQ A;  3QR6 A;  3LGC A;  3A5W A;  1JZO A;  4CW9 A;  1M2B A;  3SWL A;  3CRU A;  4ECC A;  3I9V 2;  1E2Y A;  4KB3 A;  1BQ7 A;  3L9U A;  2GVP A;  4G10 A;  1FW1 A;  5EL8 A;  1OAZ A;  4ZIJ A;  4I2T A;  2HXK A;  5LCZ A;  4N0V A;  2F9S A;  3KGK A;  3GRX A;  2MZC A;  2L5L A;  2QA2 A;  1S3A A;  1TK5 B;  1GSD A;  2L6D A;  3TUE A;  3TKP A;  1GL8 A;  3DKS A;  5HQP A;  3QAG A;  3IOS A;  3G7J A;  3Q19 A;  1HNB A;  1GSE A;  3M3M A;  3KZQ A;  5CP1 A;  2LEG A;  3GA4 A;  1WPI A;  3FHK A;  3EVI A;  2GQK A;  4GCI A;  2GZZ A;  3UAR A;  4KDU A;  1HD2 A;  4TR1 A;  5B6M A;  4E8E A;  5KN1 A;  1WE0 A;  2L4Q A;  1OC8 A;  3R3E A;  3Q18 A;  1T7P B;  2BMX A;  2YV7 A;  4ZBB A;  4BWQ A;  5HR3 A;  2DIZ A;  2X99 A;  3F9U A;  5ECR B;  3IC4 A;  1PA3 A;  1GTI A;  3KCM A;  3M1G A;  5A4U A;  4PQI A;  2XPE A;  1OYJ A;  1C72 A;  2FWE A;  5JCU A;  3RHC A;  2AV4 A;  4WBJ A;  2ON5 A;  3TJK A;  1GUH A;  2H6X A;  1X5D A;  2V6K A;  3VK9 A;  4N30 A;  1TI1 A;  2WCI A;  3ZL5 A;  2QC7 A;  3V1W A;  3KEB A;  17GS A;  2WS2 A;  2HFD A;  2KOK A;  4MJC A;  3KIJ A;  2AUV A;  1EEM A;  3TOU A;  2K8V A;  1FVJ A;  1A8L A;  3HJP A;  8GSS A;  1WIK A;  1GTU A;  2JAC A;  3HCZ A;  1OC9 B;  2HZE B;  4FO5 A;  5JCW A;  2NTO A;  3UEM A;  1VF3 A;  2QKE A;  1K0A A;  3DVW A;  3DWV A;  1PD2 1;  1GP1 A;  1M0U A;  20GS A;  2YOI A;  4V1A g;  4OWY A;  4WF4 A;  3ZFL A;  5IMA A;  1SU9 A;  2ZUP A;  4Q5Q A;  2B7J A;  1H75 A;  3HJO A;  4JRR A;  1V57 A;  2VLT A;  2QGV A;  3DIE A;  5FT3 A;  1BED A;  1M99 A;  5JWR B;  3TGZ A;  3UVT A;  3GX0 A;  2E0Q A;  1K0C A;  4EVM A;  3GMF A;  4POB A;  3CTF A;  3ERG A;  1TW9 A;  4ID0 A;  3F3R A;  3KH9 A;  1FOV A;  2IWT A;  1SD9 A;  2KHP A;  4BPY A;  5DDL A;  4K0G A;  2O8V B;  2R6K A;  4X0X A;  4ZB6 A;  3VWU A;  3BOA A;  4EF0 A;  3G7Y A;  1YDK A;  4MAB A;  5CNW A;  2P0G A;  3TOT A;  3FR9 A;  2DJ3 A;  1X9S B;  1ZMA A;  1PL2 A;  2J9H A;  2R2J A;  3TKS A;  2J23 A;  2NDO A;  4KGI A;  4POL A;  5F05 A;  5ECL B;  2YWO A;  4L0U A;  2NVL A;  2YAN A;  1Z9H A;  5ECI B;  4YH2 A;  3IA1 A;  1SJZ A;  4IVF A;  3BBY A;  3EMP A;  2C0D A;  4MCU A;  2LUS A;  5ELG A;  1ST9 A;  2XPD A;  2H8L A;  2A4V A;  3R2Q A;  5HFG A;  4N0Z A;  4E8H A;  4G19 A;  2N5F A;  5CO3 A;  1JZR A;  1NW2 A;  2B1K A;  2H1G A;  4O7H A;  3ZLP A;  2N5B A;  1TP9 A;  2OA7 A;  2FNO A;  4KF9 A;  1N8J A;  3H4K A;  2C4J A;  3LOR A;  1ZYP A;  5ECS A;  1A2J A;  3CTG A;  4OFM A;  1R5A A;  1GLQ A;  3FY7 A;  1E6B A;  5KOW A;  3MIX A;  1GSY A;  3D4T A;  4TN8 A;  1ERW A;  2OE0 A;  2X8C A;  1XZO A;  3ZVJ A;  6GSU A;  1VRS D;  5BMU A;  4HI7 A;  1ML6 A;  2WZ9 A;  1K3L A;  4YQV A;  4O5R A;  1PKZ A;  5DCH A;  4PX1 A;  1DSB A;  2VIM A;  1YF1 A;  3BCI A;  1BAY A;  1YY7 A;  1EZK A;  1O81 A;  4NWY A;  4JU5 A;  4I8B A;  2KUC A;  3TJJ A;  2DJ2 A;  2DLX A;  5G30 A;  1OE8 A;  4F82 A;  3VLN A;  2E7P A;  1ZOF A;  4K7I A;  3NOF A;  4KA0 A;  4F0B A;  2R0C A;  2H0I A;  1FHE A;  4Z2T A;  2A2S A;  5D96 A;  5D9T A;  2YPM A;  2GSS A;  2H72 A;  2MMA A;  2VL3 A;  3LWA A;  2H6Z A;  1XWG A;  6GSV A;  2YN1 A;  1O73 A;  1XWB A;  1GRX A;  3O76 A;  3GNJ A;  7GSS A;  5B6N A;  3M8N A;  2P5Q A;  2YCD A;  1SL2 B;  5KN2 A;  2CAI A;  4DSR A;  1Q4J A;  1ZYQ B;  2B1L A;  1XCC A;  2Z9S A;  3TJB A;  2HI7 A;  1UC7 A;  4GLT A;  3IV4 A;  4PNF A;  2IL3 A;  2GSQ A;  4AJ8 A;  4HU7 A;  4FYC A;  3HZ8 A;  3CSH A;  3MDK A;  2RUF A;  3TKR A;  4JED A;  1R4W A;  1FVK A;  2HSM A;  2E2G A;  3TJF A;  2VL2 C;  1KBN A;  4MLY A;  1B8X A;  4KND A;  1A2M A;  3LYP A;  3IAS 2;  1BX9 A;  2WFC A;  2R0G A;  5GSS A;  2F8A A;  2JL4 A;  4WF5 A;  2H0H A;  5GZZ B;  4EIQ A;  10GS A;  4WR5 A;  5IPG A;  5ELA A;  3ZFB A;  5CRE A;  5J9B A;  2RUE A;  2VLV A;  2KP1 A;  2YZH A;  4ILF A;  3UL3 A;  1G7E A;  1YEX A;  5INY A;  1H4O A;  1O8W A;  5G1K A;  2AYT A;  3KMN A;  2GZY A;  3OR5 A;  1Z6N A;  4ZIL A;  1TRU A;  1TJD A;  1SK2 A;  2H1B A;  2RII A;  3BCK A;  4BVY B;  1TI3 A;  1SL1 B;  1SL0 B;  4EO3 A;  3LG6 A;  5ECK B;  3E9J B;  4PUF C;  2CX4 A;  5E4W A;  4PXO A;  1OE7 A;  2IIY A;  2X8H A;  3CRT A;  5IMC A;  2CVK A;  4JE1 A;  3QFA C;  2H0G A;  1Y25 A;  1X5C A;  2VL9 A;  1PX6 A;  3D21 A;  1PGT A;  3LYK A;  1F2E A;  5H5R A;  5J41 A;  4A5P A;  1TRW A;  1T1V A;  2HYX A;  4Z2R A;  2H75 A;  4LMW A;  3IK7 A;  2IFQ B;  1Y6E A;  3HXS A;  1TXX A;  2JAD A;  1TU8 A;  2LRN A;  3EYT A;  1TTZ A;  1YKC A;  2B5E A;  1B9Y C;  2REM A;  4ACS A;  5AGY A;  4DEJ A;  5JWO B;  19GS A;  2AB6 A;  2GDR A;  2IJY A;  1OVN A;  2ALB A;  2CAQ A;  2QA1 A;  1T00 A;  2O7K A;  1K3O A;  3GFK A;  3VI5 A;  2A2P A;  2GT6 A;  3C73 A;  4CY6 A;  2CVB A;  3IBH A;  2L4C A;  4NPB A;  1XXU A;  1GTA A;  2DSA A;  4KDX A;  4LLR A;  4WEY A;  5DBQ A;  3L9V A;  1QFN A;  3QMX A;  3GH6 A;  1EV4 A;  2GT5 A;  4K6X A;  2HRK A;  2LJK A;  3TDG A;  4WR4 A;  3FZ9 A;  1OC3 A;  5IQY A;  1F6M C;  3D4M A;  1JZD A;  4IP6 A;  3FZ4 A;  4KX4 A;  3GUS A;  1N2A A;  4ZB8 A;  1XW6 A;  4TXO B;  3TKS C;  1KEB A;  5KOX A;  4L0W A;  4L5O A;  4XRD A;  1SJ6 A;  5AIX A;  3TKQ A;  4N10 A;  1HQO A;  3GIX A;  4EIP A;  3F4R A;  2H19 A;  1AW9 A;  2C3Q A;  3QD9 A;  4LA1 A;  2VL2 A;  2VCW A;  4YKG A;  4Z7X A;  3ZIJ A;  3IK9 A;  2LV3 A;  4KSO A;  6GSS A;  1PSQ A;  5ID2 B;  4I6X A;  4K0N A;  3UJ1 A;  3U6V A;  1JZW A;  5A4V A;  2VUP A;  3M9K A;  1PX7 A;  3AY8 A;  3FEU A;  2MBS A;  4RQX A;  1G7O A;  2B5Y A;  3KH7 A;  1B4P A;  1XWA A;  4G9H A;  1V9W A;  5IMF A;  1UVZ A;  5EPF A;  1Z5Y E;  5HFK A;  4POK A;  2L5O A;  3A2V A;  3EIN A;  3DXB A;  1YEP A;  4FYB A;  2DML A;  3A5I A;  4CY8 A;  4IGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...