2CV4A

Crystal structure of an archaeal peroxiredoxin from the aerobic hyperthermophilic crenarchaeon aeropyrum pernix k1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
241
structure length
240
Chain Sequence
PGSIPLIGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPVTTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHAESATHTVRGVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQARARMESGQYRCLDWWFCWDTPASRDDVEEARRYLRRAAEKPAKLLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxygen storage/transport
molecule keywords peroxiredoxin
publication title Crystal Structure of an Archaeal Peroxiredoxin from the Aerobic Hyperthermophilic Crenarchaeon Aeropyrum pernix K1
pubmed doi rcsb
source organism Aeropyrum pernix
total genus 71
structure length 240
sequence length 241
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1020.20 Alpha Beta 2-Layer Sandwich Antioxidant, Horf6; Chain A, domain 2 Antioxidant, Horf6; Chain A, domain 2 2cv4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2cv4A01
4JRRA 1JZDA 2DC5A 2R37A 5D96A 1GH2A 2VLTA 3ZMLA 1QXHA 1XWKA 2VL2C 4IW9A 1M2BA 2GZZA 2H74A 1MD3A 1ZOFA 3FZAA 3CSIA 4MLYA 1JLWA 1K0OA 3MWHA 3KJYA 1O8WA 1OE8A 2HI7A 3TCOA 4K8MA 5JCWA 2HFDA 5G30A 1GUKA 14GSA 2R2JA 4IVFA 2GVPA 2V32A 3H4KA 2LQOA 1RK4A 4V1Ap 2JZSA 2H6XA 4WF5A 3IE3A 2OA7A 1TU7A 4GSSA 3P7XA 3ZTLA 4OD7A 1X5CA 1GTIA 3D5JA 1TK8B 2OE3A 3F4SA 4J56E 1BAYA 3IBHA 5EL8A 3ZIJA 2VM2A 4IELA 1Z7RA 2H66A 1THOA 3DMLA 3E9JB 4E8HA 2FCHA 1EP7A 5DVBA 2GSQA 3UVHA 5ECSA 2DJ0A 1Z7PA 2I4AA 2X8GA 1AQVA 5HFGA 2AUVA 2O7KA 5CRHA 5J9CA 2YANA 4OWYA 5A4VA 1B9YC 2B6MA 3FR3A 3PINA 2KHPA 1PL2A 4ZL9A 1B4PA 3GKMA 2I81A 4WBRD 5F07A 4D73B 3GL3A 3DIEA 1EWXA 5IO2A 2NDOA 5IMAA 1T4YA 4OFMA 2IMEA 4WXTA 3RPPA 3F9UA 4F9ZA 3TDGA 4X0XA 1YQ1A 1O8XA 1XOAA 3ERGA 1AQWA 3HCZA 4HQZA 2NTOA 5ECPB 1U6TA 2VL3A 3LXZA 4IS0A 4TXOA 2BJXA 4GTUA 3UOMA 2QGVA 1FHEA 3ZMKA 1FVKA 3H93A 4ZIJA 2PBJA 3BCIA 4K7IA 2VM1A 2LJKA 5FWGA 1B48A 1XFLA 1SJIA 3FR9A 4MZWA 4MZBA 5F0GA 1SL2B 1JLVA 5CP1A 2CT6A 1PMTA 1GNWA 1GTUA 1WOUA 3D0ZA 4HJ2A 2YZUA 3IDVA 4HZ2A 4BWQA 1IYHA 3D21A 2ALBA 3PR8A 1JZRA 1K0CA 3OR5A 3GTUA 3O6TA 3IR4A 2B1KA 2VL9A 4DSSB 4KX4A 2H71A 2V41A 3LEFA 2NBSA 3VWUA 1BEDA 1N8JA 1U87A 4WKWA 4JE1A 2H0HA 1MDKA 1QK8A 2KP1A 2FA4A 4AJ7A 5EY6A 2MBTA 4TR1A 3UL3A 4DVCA 3KTLA 2IN3A 1W89A 1M0UA 2L5OA 13GSA 2LUSA 1EV9A 1SK0A 4KA0A 2OKAA 5A5KA 4NXIA 4YAVA 2JSYA 3GX8A 3WGEA 4F2IA 3GN3A 3ERWA 5GSTA 1C72A 3IC4A 1VF3A 3KM6A 1UVZA 1TKDB 3IOSA 3TKPA 4V2LA 4CW9A 3L78A 4FH8A 4OCEA 4BWSA 3C73A 1XWGA 3HVXA 1SKWB 1O81A 3E0UA 1Y25A 2OBKA 3KGKA 4EVMA 4FO5A 1F3AA 3F6DA 3TJGA 1UC7A 2IMIA 1ZCPA 1T3BA 1HNBA 4NPBA 3SWLA 3UBLA 2I1UA 1PKWA 3IV4A 3UEMA 4IP1A 1OC8A 1G6YA 5CAXA 1XZOA 1XVQA 1USBA 2X8HA 4NV5A 3S9FA 1TI1A 2CVBA 1WPIA 4MA9A 6GSVA 3FYGA 2L4CA 2L59A 2TRCP 2ZNMA 4IQ1A 2V6OA 2H30A 3QFAC 2AJQB 4N11A 1SU9A 1EZKA 2YNXA 5DCHA 1I5GA 3Q18A 4KSOA 3EC3A 2LRCA 3GTUB 2F51A 2YPMA 1A0FA 1MDIA 2PWJA 2HSYA 4I8BA 5B8AA 2H72A 3ZVJA 4ZILA 2PPTA 4MPFA 4ULXA 4IJ3A 3EWLA 4XRAA 3M9JA 2O89A 4TR1B 1X5EA 2TIRA 4ML1A 3GNJA 3C8EA 2JADA 2IIYA 2M46A 5F06A 5ECHB 4PUAA 3BD2A 1FO5A 2LRNA 5HFIA 5DAKA 2VIMA 2CZ3A 2AAWA 1YKAA 1XBSA 2CAQA 1A23A 5ID2B 2WZ9A 3ZFBA 4XCSA 4MF5A 4K7OA 3GL5A 2VCXA 2HLSA 4OO5A 1A2LA 2JSZA 1N2AA 1A24A 1TI3A 1TTZA 4K7NA 4ILFA 6GSSA 5GAND 3O76A 4O92A 3M3MA 2FLSA 2IWTA 3KMNA 2H0IA 3GH6A 4PNGA 1PX6A 1X9WB 3VPTA 2H73A 2VD0A 3HHVA 3K8NA 20GSA 4BVYA 4DSRA 3Q19A 2M80A 3GH9A 2FWEA 4L0UA 2L6DA 3QAGA 1M7TA 4PX1A 4MF7A 1THXA 3TGZA 3HXSA 4HU9A 3HJPA 2H1BA 1M2AA 3DVXA 3GSTA 1VF4A 4PURA 5CRGA 5EVOA 3M8NA 3NOFA 4GSNA 2H6ZA 1PL1A 3KTBA 4JBBA 2C8UA 3LYPA 4AJ6A 5ECMB 4AJ8A 4IBPA 1TP9A 4AF2A 4I6XA 4KH7A 1FB6A 1SK2A 3BJ5A 4ECCA 5IIZA 3VWVA 1V9WA 3LJRA 4ECJA 1M99A 3HD5A 1R5AA 2D2ZA 1X0RA 4KW6A 1R5PA 3LFLA 4X43A 5KN2A 4TN8A 2LEGA 4IJIA 1GSEA 4I2TA 5D9WA 2MMOA 1U3AA 5ECOB 6GSTA 3UMAA 2GQMA 2CQ9A 3A5WA 2Z9SA 4BA7A 1Y6EA 4IKHA 2KP2A 2GQLA 1DBYA 2C0GA 2H1DA 2O85A 5LD0A 5DAKB 5KN0A 1KTEA 3MDKA 2X99A 3FRCA 2V2GA 3ZVJD 4BL7A 2HYXA 2IMKA 5G31A 5CYYA 1GSDA 4EC0A 2A2SA 2ZUPA 5AGYA 2PVQA 3VPQA 1H4OA 2LS5A 4N10A 1GLQA 1I9DA 2GDRA 4LMWA 2KUCA 5DALB 4TR4A 5J3RA 1O6JA 3TOTA 3P8WA 2RLIA 4XRDA 2E0QA 3A3TA 1HYUA 2ES7A 2FA8A 1ZL9A 5AISA 1DUGA 3RHBA 5CRWA 1S3DA 4OCFA 1SL1B 1XPVA 2DSAA 5C04A 3CMIA 3TJJA 5FT3A 2B3SA 3CSHA 2YCDA 1G6WA 2VCVA 3TJFA 4CDOA 2HNLA 4IHUA 3D22A 2VCTA 4XIHA 2LNSA 16GSA 2H0GA 2YWIA 4CHSA 4HUAA 2IFQB 1FG4A 1AUCA 4LLRA 3L0HA 4P3YB 3I9V2 1TDIA 1F9MA 2C3NA 3TKQA 1XCCA 3EE2A 3M1GA 2J9HA 2LQQA 3C7MA 4POKA 1YZXA 1B9XC 3VI7A 2C80A 2YJ7A 3TRPA 3GURA 3RAZA 1T8EB 1SKSB 2H70A 2P0GA 2XBIA 1M9AA 3F8UA 2PVOC 4OFNA 1ERTA 2PGTA 3ZL5A 3FR6A 2N5AA 2H76A 2RUEA 2PN8A 3IHQA 2CVDA 1TXXA 1GUMA 1QGVA 3DGQA 3H8QA 2R4VA 4G19A 2A4VA 4QL7A 1GSSA 2K6VA 5F05A 4GQFA 4MPGA 3JCML 4IGJA 4MH3A 2L57A 4KDXA 5KN3A 1TJDA 4NHZA 5CREA 2FD3A 1F2EA 2YN1A 1KBNA 2GSRA 19GSA 4LL4B 3CXGA 4LMVA 1ILOA 1V58A 1T4ZA 5ELGA 3TKRA 4KDYA 5HFKA 1XW9A 1HD2A 2G0FA 3BOAA 10GSA 4BVXA 1BYEA 1BX9A 2K8VA 1K0BA 1GSFA 3F4RA 3GA4A 1QQ2A 2RM5A 2F3MA 3FK8A 5G5FA 3VWWA 3WD6A 1TRVA 2DJ2A 1A8YA 4KGIA 3A2XA 4V2MA 2FNOA 1O7UA 2F9SA 3FW2A 5GZZB 4JR6A 5IQYA 1GUHA 2GLRA 3EU4A 3DXBA 4KCAA 1ERUA 1BG5A 2E2GA 2HXKA 1U3IA 2IL3A 1IYIA 2YWNA 1OKTA 1A2MA 1FW1A 1O73A 1M2DA 3G7YA 3M0FA 1X5DA 4MDCA 4TRXA 4MH2A 1OYJA 5ELAA 3C1SA 1WMJA 3FY7A 4GF0A 1EEMA 4GRFA 1GSYA 4L5OA 1PN9A 2QKEA 4F0BA 2DLXA 2R6KA 1HNAA 2VLUA 3L9VA 3C71A 3R2QA 3MAKA 3QD9A 3GKKA 17GSA 5D73A 1V40A 3D6IA 4FIWA 2O87A 3UVTA 1YEPA 1SD9A 4ID0A 1SYXA 1PD21 4WF4A 4EKZA 4QL9A 1V57A 3KMOA 3ZFLA 3IPZA 5J5NA 2C4JA 4HI7A 3GUSA 2MMAA 3CRTA 1LBKA 3IK9A 2MMNA 4ISDA 2CZ2A 6GSYA 1GSQA 3FZ9A 5IMFA 2AB6A 4WBJA 5HR3A 2KLXA 1ON4A 2WULA 4MJCA 2TRXA 5ECKB 2ZCTA 2R5GA 2JL4A 4ZL8A 3V1WA 1CQHA 1ZZYA 3UJ1A 1AAZA 1KNGA 2C0FA 4HJMA 2R3XA 2ON7A 4DEJA 4HU7A 4PGTA 2YP6A 2PUKC 2ON5A 3HJMA 3N9JA 1YF1A 4TXOB 2E2MA 3G7IA 4POBA 1RQMA 1JFUA 4XS1A 1QFNA 1F3BA 3J7Yb 1XXUA 4N30A 2WGRA 5DBQA 3P90A 1FOVA 5IMZA 3EMXA 2GQKA 4Q5QA 1UN2A 5IM9A 1OVNA 4KNDA 1ABAA 2JZTA 2V6KA 2FWHA 1ERVA 1URMA 4GWRA 3KZQA 5E59A 1EOHA 3QPMA 4I5QA 1LJRA 2B7KA 4NHWA 2HT9A 3QAWA 1OC9A 3QR6A 4K9ZA 5DCGA 3WGXA 1FAAA 1TU8A 2PERA 4ZL7A 1F37A 2I3YA 3ZREA 4ACSA 4JEDA 5ECQB 1XWAA 1J9BA 2HZFA 2K18A 5ECIB 2YWMA 2LRTA 3DRNA 1K0MA 4F82A 2WS2A 4KSMA 2HE3A 1YY7A 2H1AA 4LA1A 3DKSA 4EL1A 4I97A 3UBKA 4TR3A 3H1NA 4MZCA 3L9SA 1Q98A 3CYNA 3TKSA 3GMFA 2YOIA 3I69A 2NPBA 1G7EA 4EUYA 3IXRA 1WWJA 2GT6A 2J23A 3QMXA 4ECBA 4MJBA 2REMA 5ECRB 2EC4A 2P5RA 3TJBA 1G0TA 2G2QA 2JACA 3HDCA 2VL2A 3HJOA 1PRXA 3QDNA 3BBYA 1BQ7A 1XW6A 2CAIA 5A4UA 4K6XA 4POMA 4HDEA 1R26A 1GRXA 1ZGNA 1S3AA 4PUFC 1MTCA 2OE0A 3H79A 1YKCA 2EIQA 3A2VA 5H5QA 1QMVA 2I9HA 2DJKA 4XHMA 4L0WA 2F8AA 4KAEA 5B7CA 5ENUA 5GAPD 3QCPA 4HEA2 3HKRA 5DQSA 1Z3EA 4XTSA 1NW2A 5LCZA 1XOBA 4MJAA 4ZBAA 2N5FA 1WRYA 3HA9A 5IOWA 5INYA 5CRDA 2OE1A 4RI6A 1TW9A 3TKSE 3ZLPA 1S3CA 4MABA 1TK0B 4YQUA 3GSSA 1OE7A 1AW9A 1DE1A 3RDWA 3ZYWA 1PX7A 1EP8A 5IMCA 2RIIA 2FWFA 4OFTA 1OC9B 1GNEA 1EV4A 3MNGA 3U5RE 2OBIA 2WDUA 11GSA 3GHAA 2DJ1A 3KH7A 5J4UA 4JU5A 5D93A 3IRAA 4KB3A 3GRXA 2H19A 5AIVA 3J7Yk 1JZWA 4AGSA 2L6CA 3WT1A 2DJ3A 2IPAA 2CX4A 5COHA 4MK3A 5G2ZA 4K1FA 2VD1A 1KEBA 3VWXA 1EOGA 3CTGA 1XW5A 1K3LA 2WB9A 4H86A 4O5RA 1MDJA 2LKUA 3W6GA 4GXZA 4ML6A 3KEBA 5CO3A 2O8VB 3D4TA 3NZNA 2P5QA 1HQOA 1OAZA 4TXVA 4YH2A 22GSA 2RM6A 1AIUA 3KCMA 4GSTA 2WFCA 3GKNA 4FYCA 2FGXA 4PQIA 2B7JA 2IMDA 2BMXA 1XVWA 3FEUA 4EXJA 4FYBA 1GTAA 5G1LA 1XIYA 3F3RA 3KP9A 4YAPA 4ZB9A 1PQNA 4HS1A 1ML6A 4KE3A 5B6NA 2X8CA 1PSQA 4MF6A 2VAFA 3EURA 1BJXA 1XWBA 2P31A 1SD8A 4G2EA 4G10A 1K0NA 5D8IA 2GT5A 3L4NA 1FVJA 4L8EA 1DSBA 2B5XA 1GLPA 4DSSA 2GZPA 2YZHA 1LU4A 2FUG2 3P2AA 2B5YA 4TOPA 1EGOA 4RI7A 3EYTA 2DJJA 3M9KA 3D4MA 2DBCA 1Z5YE 1E2YA 3PH9A 2C0DA 2B1LA 2MYGA 1Z6NA 2WCIA 4ZXGA 1PGTA 3ZIVA 1VRSD 3TOUA 1K3YA 2FWGA 3BCKA 5C00A 1TOFA 2HSHA 3DYRA 3HZ4A 4TKYA 4V2NA 3VFIA 5JWQB 1V98A 1TRUA 4EDYA 5HQPA 3MSZA 2JZRA 1JHBA 2VLVA 2K9FA 1SYRA 2CX3A 5HR1A 2HZEA 1SJ6A 2HRNA 1SKRB 5JWRB 1GSUA 4YQMA 5DJLA 3RPNA 3RHCA 1R7HA 1EEJA 1YDKA 4NMUA 4L5LA 2H8LA 5J41A 1K3OA 5IPGA 3GX0A 4N0VA 4F0CA 2H1GA 3NIVA 2YWOA 5J9BA 3VLNA 3ZRDA 5E4WA 6GSWA 3KXOA 3F0IA 1ZMAA 4MP4A 1AXDA 1QUWA 5JCGA 2FHEA 1O85A 2AV4A 3ME7A 1SENA 3ISOA 2XBQA 3VURA 4LL1B 1PKZA 1ZYEA 3KH9A 2HRFA 1T00A 4EO3A 4JR4A 4EE0A 3N5OA 3GYKA 3WYWA 1J0FA 5GSSA 3E3EA 3A2WA 3EMPA 4PQHA 1A0RP 5DDLA 4DSQA 5DJMA 5ECNB 4ECIA 5IOXA 5H5SA 2F8FA 3LQ7A 2AYTA 3FHKA 2QC7A 3TB2A 5A4WA 5ABRA 3ERFA 2E7PA 4G9HA 3UIWA 3KIJA 3CSJA 1ST9A 1WE0A 2DIZA 5D9XA 5LNKe 1G7OA 4XS4A 3HZ8A 3Q74A 4OO4A 2GZYA 2VO4A 2XC2A 5B6MA 5JWOB 3I6AA 1VGLA 4TR0A 5IMDA 3EVIA 5KEJA 1WP0A 3HY2A 4PXOA 2DMMA 2LNTA 1YEXA 1M9BA 5D9VA 1PA3A 4Q5RA 4E8EA 3EU3A 2OACA 4I2UA 4V1Ag 2V1MA 1AC1A 3SBCA 1JZOA 5HR2A 2LSTA 5L71A 2VUPA 5HR0A 1DE2A 1GULA 2IJYA 3LSZA 5IO0A 5ID2A 3APQA 3IAM2 2HZEB 3UAPA 3CBUA 2CA8A 1NHYA 1SL0B 1A2JA 2MBSA 3C1RA 2YJHA 2WJUA 2H01A 4BPYA 4HZ4A 2M72A 4PNFA 2GGTA 2RUFA 3LWAA 5IMVA 2C1YA 4PQ1A 3RBTA 1WJKA 3FZ5A 2IMFA 3WT2A 3IK7A 2MZCA 5FHIA 1MEKA 2VCZA 1EGRA 3TRXA 3IA1A 3EINA 2L4QA 3TUEA 4FYUA 4F03A 3LXTA 1GP1A 4Q5FA 4ZBDA 2C3TA 2FY6A 3ED3A 1GWCA 3FZ4A 4O32A 4ZBBA 3O3TA 1Z6MA 4EDZA 3CTFA 4MJEA 1TRSA 2GSSA 2OJLA 4MMMA 4O7HA 1XWCA 1MD4A 1H75A 2WRTA 2QSIA 4IQAA 2B5EA 3QAVA 3F63A 3F3QA 4GLTA 4WR5A 2EIRA 3DD3A 4GQCA 4WEYA 1ERWA 3W8SA 5G1KA 3I43A 3TRQA 3LGCA 3APSA 2CVKA 2YV9A 1W4VA 2AHEA 4XS4B 3U6VA 1WIKA 2X64A 2A2RA 2GS3A 3IAS2 2DIYA 3Q6OA 4K0NA 2LV3A 4Q5NA 5B8BA 3L9UA 1U88A 2VCQA 5JCUA 3DEXA 4WR4A 3LYKA 1CQGA 1YF0A 4RUVA 2PMTA 2C3QA 6GSXA 4YQVA 1VF1A 3ME8A 1J08A 1SK1A 3APOA 4POLA 1GTBA 1K0DA 1ZYQB 1V2AA 4ZB6A 2LTKA 3HYPA 5KN1A 3G7JA 1Z9HA 3F6FA 2H75A 5DQYA 3G9BA 4KCEA 2XHFA 3HVSA 1B8XA 3CRUA 3PGTA 1AQXA 2PU9C 4Z7XA 1Q4JA 1HNCA 2LJRA 2YV7A 1X9SB 1RW1A 5G5EA 3KD0A 4HOJA 3GFKA 4QQ7A 1TRWA 3GKXA 5F8BA 2JU5A 1B4QA 3LORA 2GSTA 1VF2A 5DALA 3KP8A 3ZITA 4J57E 2VOCA 1ACVA 1YJ6A 12GSA 4K2DA 2GTUA 4ZB8A 3AY8A 3VK9A 3DWVA 1F6MC 2C0EA 3WGDA 3QFBC 4KUNA 3GV1A 3UARA 2IFQA 1FB0A 1R4WA 4HQSA 1SJZA 8GSSA 5CNWA 5H5RA 4TW5A 4RQXA 2OADA 1OKDA 2K8SA 2CV4A 4NWYA 4GCIA 2N5BA 2NVLA 4EF0A 7GSSA 1K0AA 6GSUA 4X1UA 2KOKA 3F4TA 9GSSA 4IN0A 1X9MB 3HVVA 2XPEA 1NHOA 3W8JA 3QOUA 1NM3A 4XS6A 1TK5B 3GIXA 4JZQA 2MMZA 3US3A 1T1VA 3LG6A 18GSA 1UA5A 4KDUA 4N0ZA 4NAXA 1A8LA 2H6YA 4OMVA 1E6BA 5EPFA 5AN1A 4D73A 4WETA 3ZZXA 4MCUA 4J2FA 4NV2A 1T7PB 3VI5A 1NSWA 1OC3A 4K0GA 1GL8A 5ECLB 5IPHA 4RQRA 5AIXA 2DMLA 3TKSC 3DVWA 3FKFA 2VCWA 4TVEA 3TJKA 2XPDA 4IP6A 2LJAA 5D9TA 2BTOT 2EIOA 2L5LA
chains in the Genus database with same CATH superfamily
4JRRA 1JZDA 2DC5A 2R37A 5D96A 1GH2A 2VLTA 3ZMLA 1QXHA 1XWKA 2VL2C 4IW9A 1M2BA 2GZZA 2H74A 1MD3A 1ZOFA 3FZAA 3CSIA 4MLYA 2UZ8A 1JLWA 1K0OA 3MWHA 3KJYA 1O8WA 1OE8A 2HI7A 3TCOA 4K8MA 5JCWA 2HFDA 5G30A 1GUKA 14GSA 1M3IA 2R2JA 4IVFA 2GVPA 2V32A 3H4KA 2LQOA 1RK4A 4V1Ap 2JZSA 2H6XA 4WF5A 3IE3A 2OA7A 1TU7A 4GSSA 3P7XA 3ZTLA 4OD7A 1X5CA 1GTIA 3D5JA 1TK8B 4MNNA 2OE3A 3F4SA 4J56E 1BAYA 3IBHA 5EL8A 3ZIJA 2VM2A 4IELA 1Z7RA 2H66A 1THOA 3DMLA 3E9JB 4E8HA 2FCHA 1EP7A 5DVBA 2GSQA 3UVHA 5ECSA 2DJ0A 1Z7PA 2I4AA 2X8GA 1AQVA 5HFGA 2AUVA 2O7KA 5CRHA 5J9CA 2YANA 5BRTA 4OWYA 5A4VA 1B9YC 2B6MA 3FR3A 3PINA 2KHPA 1PL2A 4ZL9A 1B4PA 3GKMA 2I81A 4WBRD 5F07A 4D73B 3GL3A 3DIEA 1EWXA 5IO2A 2NDOA 5IMAA 1T4YA 4OFMA 2IMEA 4WXTA 3RPPA 3F9UA 4F9ZA 3TDGA 4X0XA 1YQ1A 1O8XA 1XOAA 3ERGA 1AQWA 3HCZA 4HQZA 2NTOA 5ECPB 1U6TA 2VL3A 3LXZA 3EPTA 4IS0A 4TXOA 2BJXA 4GTUA 3UOMA 2QGVA 1FHEA 3ZMKA 1FVKA 3H93A 4ZIJA 2PBJA 3BCIA 4K7IA 2VM1A 2LJKA 5FWGA 1B48A 1XFLA 1SJIA 3FR9A 4MZWA 4MZBA 5F0GA 1SL2B 1JLVA 5CP1A 2CT6A 1PMTA 1GNWA 1GTUA 1WOUA 3D0ZA 4HJ2A 2YZUA 3IDVA 4HZ2A 4BWQA 1IYHA 3D21A 2ALBA 3PR8A 1JZRA 1K0CA 3OR5A 3GTUA 3O6TA 4O5UA 3IR4A 2B1KA 2VL9A 4DSSB 4KX4A 2H71A 2V41A 3LEFA 2NBSA 3VWUA 1BEDA 1N8JA 1U87A 4WKWA 4JE1A 2H0HA 1MDKA 1QK8A 2KP1A 2FA4A 4AJ7A 5EY6A 2MBTA 4TR1A 3UL3A 4DVCA 3KTLA 2IN3A 1W89A 1M0UA 2L5OA 13GSA 2LUSA 1EV9A 1SK0A 4KA0A 2OKAA 5A5KA 4NXIA 4YAVA 2HRAA 2JSYA 3GX8A 3WGEA 4F2IA 3GN3A 3ERWA 5GSTA 1C72A 3IC4A 1VF3A 3KM6A 1UVZA 1TKDB 3IOSA 3TKPA 3FMWA 4V2LA 4CW9A 3L78A 4FH8A 4OCEA 4BWSA 3C73A 1XWGA 3A5IA 3HVXA 1SKWB 1O81A 3E0UA 1Y25A 2OBKA 3KGKA 4EVMA 4FO5A 1F3AA 3F6DA 3TJGA 1UC7A 2IMIA 1ZCPA 1T3BA 1HNBA 4NPBA 3SWLA 3UBLA 2I1UA 1PKWA 3IV4A 3UEMA 4IP1A 1OC8A 1G6YA 5CAXA 1XZOA 1XVQA 1USBA 2X8HA 4NV5A 3S9FA 1TI1A 2CVBA 1WPIA 4MA9A 6GSVA 3FYGA 2L4CA 2L59A 2TRCP 2ZNMA 4IQ1A 2V6OA 2H30A 3QFAC 2AJQB 4N11A 1SU9A 1EZKA 2YNXA 2A2PA 5DCHA 1I5GA 3Q18A 4KSOA 3EC3A 2LRCA 3GTUB 2F51A 2YPMA 1A0FA 1MDIA 2PWJA 2HSYA 4I8BA 2R0PA 5B8AA 2H72A 3ZVJA 4ZILA 4K5SA 2PPTA 4MPFA 4ULXA 4O5QA 4IJ3A 3EWLA 4XRAA 3M9JA 2O89A 4TR1B 1X5EA 2TIRA 4ML1A 3GNJA 3C8EA 2JADA 2IIYA 2M46A 2X49A 5F06A 5ECHB 4PUAA 3BD2A 1FO5A 2LRNA 5HFIA 5DAKA 2VIMA 2CZ3A 2AAWA 1YKAA 1XBSA 2CAQA 1A23A 5ID2B 2WZ9A 3ZFBA 4XCSA 4MF5A 3PPUA 4K7OA 3GL5A 2R0CA 2VCXA 2HLSA 4OO5A 1A2LA 2JSZA 1N2AA 1A24A 1TI3A 1TTZA 4K7NA 4ILFA 6GSSA 2HRKA 5GAND 3O76A 4O92A 2QA2A 3M3MA 2FLSA 2IWTA 3KMNA 2H0IA 3GH6A 3LW9A 4PNGA 1PX6A 1X9WB 3VPTA 2H73A 2VD0A 3HHVA 3K8NA 20GSA 4BVYA 4DSRA 3Q19A 2M80A 3GH9A 2FWEA 4L0UA 2L6DA 3QAGA 1M7TA 4PX1A 4MF7A 1THXA 3TGZA 3HXSA 4HU9A 3HJPA 2H1BA 1M2AA 3DVXA 3GSTA 1VF4A 4PURA 5CRGA 5EVOA 3M8NA 3NOFA 4GSNA 2H6ZA 1PL1A 3KTBA 4JBBA 2C8UA 3LYPA 4AJ6A 5ECMB 4AJ8A 4IBPA 1TP9A 4AF2A 4I6XA 4KH7A 1FB6A 1SK2A 4G0KA 3BJ5A 4ECCA 5IIZA 3VWVA 1V9WA 3LJRA 4ECJA 1M99A 3HD5A 1R5AA 2D2ZA 1X0RA 4KW6A 1R5PA 3LFLA 4X43A 5KN2A 4TN8A 2LEGA 4IJIA 1GSEA 4I2TA 5D9WA 2MMOA 1U3AA 5ECOB 6GSTA 3UMAA 2GQMA 2CQ9A 3A5WA 2Z9SA 4BA7A 1Y6EA 4IKHA 2KP2A 2QA1A 2GQLA 1DBYA 2C0GA 2H1DA 2O85A 5LD0A 5DAKB 5KN0A 1KTEA 3MDKA 2X99A 2HSMA 3FRCA 2V2GA 3ZVJD 4BL7A 2HYXA 2IMKA 5G31A 5CYYA 1GSDA 4EC0A 2A2SA 2ZUPA 5AGYA 2PVQA 3VPQA 1H4OA 2LS5A 4N10A 1GLQA 1I9DA 2GDRA 4LMWA 2KUCA 5DALB 4TR4A 5J3RA 1O6JA 3TOTA 3P8WA 2RLIA 4XRDA 2E0QA 3A3TA 1HYUA 2R0GA 2ES7A 2FA8A 1ZL9A 5AISA 1DUGA 3RHBA 5CRWA 1S3DA 4OCFA 1SL1B 1XPVA 2DSAA 5C04A 1M3JA 3CMIA 3TJJA 5FT3A 2B3SA 3CSHA 2YCDA 1G6WA 2VCVA 3TJFA 4CDOA 2HNLA 4IHUA 3D22A 2VCTA 4XIHA 2LNSA 16GSA 2H0GA 2YWIA 4CHSA 4HUAA 2IFQB 1FG4A 1AUCA 4LLRA 3L0HA 4P3YB 3I9V2 4PTSA 1TDIA 1F9MA 2C3NA 3TKQA 1XCCA 3EE2A 3M1GA 2J9HA 2LQQA 3C7MA 4POKA 1YZXA 1B9XC 3VI7A 2C80A 2YJ7A 3TRPA 3GURA 3RAZA 1T8EB 1SKSB 2H70A 2P0GA 2XBIA 1M9AA 3F8UA 2PVOC 4OFNA 1ERTA 2PGTA 3ZL5A 3FR6A 2N5AA 2H76A 2RUEA 2PN8A 3IHQA 2CVDA 1TXXA 1GUMA 1QGVA 3DGQA 3H8QA 2R4VA 4G19A 2A4VA 4QL7A 1GSSA 2K6VA 5F05A 4GQFA 4MPGA 3JCML 4IGJA 4MH3A 2L57A 4KDXA 5KN3A 1TJDA 4NHZA 5CREA 2FD3A 1F2EA 2YN1A 1KBNA 2GSRA 19GSA 4LL4B 3CXGA 4LMVA 1ILOA 1V58A 1T4ZA 5ELGA 3TKRA 4KDYA 5HFKA 1XW9A 5BMUA 1HD2A 2G0FA 3BOAA 10GSA 4BVXA 1BYEA 1BX9A 2K8VA 1K0BA 1GSFA 3F4RA 3GA4A 1QQ2A 2RM5A 2F3MA 3FK8A 5G5FA 3VWWA 3WD6A 3IC8A 1TRVA 2DJ2A 1A8YA 4KGIA 3A2XA 4V2MA 2FNOA 1O7UA 4G0IA 2F9SA 3FW2A 5GZZB 4JR6A 5IQYA 1GUHA 1ZYNA 2GLRA 3EU4A 3DXBA 4KCAA 1ERUA 1BG5A 3MYDA 2E2GA 2HXKA 1U3IA 2IL3A 1IYIA 2YWNA 3MIXA 1OKTA 1A2MA 1FW1A 1O73A 1M2DA 3G7YA 3M0FA 1X5DA 4MDCA 4TRXA 4MH2A 1OYJA 5ELAA 3C1SA 1WMJA 3FY7A 4GF0A 1EEMA 4GRFA 1GSYA 4L5OA 1PN9A 2QKEA 4F0BA 2DLXA 2R6KA 1HNAA 2VLUA 3L9VA 3C71A 3R2QA 3MAKA 3QD9A 3GKKA 17GSA 5D73A 1V40A 3D6IA 4FIWA 2O87A 3UVTA 1YEPA 1SD9A 4ID0A 1SYXA 1PD21 4Z2UA 4WF4A 4EKZA 4QL9A 1V57A 3KMOA 3ZFLA 3IPZA 5J5NA 2C4JA 4HI7A 3GUSA 2MMAA 3CRTA 4HSCX 1LBKA 3IK9A 2MMNA 4ISDA 2CZ2A 6GSYA 1GSQA 3FZ9A 5IMFA 2AB6A 4WBJA 5HR3A 2KLXA 4X4JA 1ON4A 2WULA 4MJCA 2TRXA 5ECKB 2ZCTA 2R5GA 2JL4A 4ZL8A 3V1WA 1CQHA 1ZZYA 3UJ1A 1AAZA 1KNGA 2C0FA 4HJMA 2R3XA 2ON7A 4DEJA 4HU7A 4PGTA 2YP6A 2PUKC 2ON5A 3HJMA 3N9JA 1YF1A 4TXOB 2E2MA 3G7IA 4POBA 1RQMA 1JFUA 4XS1A 1QFNA 1F3BA 3J7Yb 1XXUA 4N30A 2WGRA 5DBQA 4BVXB 3P90A 1FOVA 5IMZA 3EMXA 2GQKA 4Q5QA 1UN2A 5IM9A 1OVNA 4KNDA 1ABAA 2JZTA 2V6KA 2FWHA 1ERVA 1URMA 4GWRA 3KZQA 5E59A 1EOHA 3QPMA 4I5QA 1LJRA 2B7KA 4NHWA 2HT9A 3QAWA 1OC9A 3QR6A 4K9ZA 5DCGA 3WGXA 1FAAA 1TU8A 2PERA 4ZL7A 1F37A 2I3YA 3ZREA 4ACSA 4JEDA 5ECQB 1XWAA 1J9BA 2HZFA 2K18A 5ECIB 2YWMA 2LRTA 3DRNA 1K0MA 4F82A 2WS2A 4KSMA 2HE3A 1YY7A 2H1AA 4LA1A 3DKSA 4EL1A 4I97A 3UBKA 4TR3A 3H1NA 4MZCA 3L9SA 1Q98A 3CYNA 3TKSA 3GMFA 2YOIA 3I69A 2NPBA 1G7EA 4EUYA 3IXRA 1WWJA 2GT6A 2J23A 3QMXA 4ECBA 4MJBA 2REMA 2A4HA 5ECRB 2EC4A 2P5RA 3TJBA 1G0TA 4YKFA 2G2QA 2JACA 3HDCA 2VL2A 3HJOA 1PRXA 3QDNA 4KF9A 3BBYA 1BQ7A 1XW6A 2CAIA 5A4UA 4K6XA 4POMA 4HDEA 1R26A 1GRXA 1ZGNA 1S3AA 4PUFC 1MTCA 2OE0A 3H79A 1YKCA 2EIQA 3A2VA 5H5QA 1QMVA 2I9HA 2DJKA 4XHMA 4L0WA 2F8AA 4KAEA 5B7CA 5ENUA 5GAPD 3QCPA 4HEA2 3HKRA 5DQSA 1Z3EA 4XTSA 1NW2A 4YKGA 5LCZA 1XOBA 4MJAA 4ZBAA 2N5FA 1WRYA 3HA9A 5IOWA 5INYA 5CRDA 2OE1A 4K5RA 4RI6A 1TW9A 3TKSE 3ZLPA 1S3CA 4MABA 1TK0B 4YQUA 3GSSA 1OE7A 1AW9A 4G0LA 1DE1A 3RDWA 3ZYWA 1PX7A 1EP8A 5IMCA 2RIIA 2FWFA 4OFTA 1OC9B 1GNEA 1EV4A 3MNGA 3U5RE 2OBIA 2WDUA 11GSA 3GHAA 2DJ1A 3KH7A 5J4UA 4JU5A 5D93A 3IRAA 4KB3A 3GRXA 2H19A 5AIVA 3J7Yk 1JZWA 4AGSA 2L6CA 3WT1A 2DJ3A 2IPAA 2CX4A 5COHA 4MK3A 5G2ZA 4K1FA 2VD1A 1KEBA 3VWXA 1PFOA 1EOGA 3CTGA 1XW5A 1K3LA 2WB9A 4H86A 4O5RA 1MDJA 2LKUA 3W6GA 4GXZA 4ML6A 3KEBA 5CO3A 2O8VB 3D4TA 3NZNA 5KOXA 2P5QA 1HQOA 1OAZA 4TXVA 4YH2A 1S3RA 22GSA 2RM6A 1AIUA 3KCMA 4GSTA 2WFCA 3GKNA 4FYCA 2FGXA 4PQIA 2B7JA 2IMDA 2BMXA 1XVWA 3FEUA 4EXJA 4FYBA 1GTAA 5G1LA 1XIYA 3F3RA 3KP9A 4YAPA 4ZB9A 1PQNA 4HS1A 1ML6A 5B6NA 4KE3A 2X8CA 1PSQA 4MF6A 2VAFA 3EURA 1BJXA 4A5PA 1XWBA 2P31A 1SD8A 4G2EA 5KOWA 4G10A 1K0NA 2GT5A 5D8IA 3L4NA 1FVJA 4BVYB 4L8EA 1DSBA 2B5XA 1GLPA 4DSSA 2GZPA 2YZHA 1LU4A 2FUG2 3P2AA 2B5YA 4TOPA 1EGOA 4RI7A 3R3EA 3EYTA 2DJJA 3M9KA 3D4MA 2DBCA 1Z5YE 1E2YA 3PH9A 2C0DA 2B1LA 2MYGA 1Z6NA 2WCIA 4ZXGA 1PGTA 3ZIVA 1VRSD 3TOUA 1K3YA 2FWGA 3BCKA 5C00A 1TOFA 2HSHA 3DYRA 3HZ4A 4TKYA 4V2NA 3VFIA 5JWQB 1V98A 1TRUA 4EDYA 4BIKA 5HQPA 3MSZA 2JZRA 1JHBA 2VLVA 2K9FA 1SYRA 2CX3A 2X4AA 5HR1A 2HZEA 1SJ6A 2HRNA 1SKRB 5JWRB 1GSUA 4YQMA 5DJLA 3RPNA 3RHCA 1R7HA 1EEJA 1YDKA 4NMUA 4L5LA 2H8LA 5J41A 1K3OA 5IPGA 3GX0A 4N0VA 4F0CA 2H1GA 3NIVA 2YWOA 5J9BA 3VLNA 3ZRDA 5E4WA 6GSWA 3KXOA 3F0IA 1ZMAA 4MP4A 1AXDA 1QUWA 5JCGA 2FHEA 1O85A 2AV4A 3ME7A 1SENA 3ISOA 4BL7B 2XBQA 3VURA 4LL1B 1PKZA 1ZYEA 3KH9A 2HRFA 1T00A 4EO3A 4JR4A 4EE0A 3N5OA 4CY6A 3GYKA 3WYWA 1J0FA 5GSSA 3E3EA 3A2WA 3EMPA 4PQHA 1A0RP 5DDLA 4DSQA 5DJMA 5ECNB 4ECIA 5IOXA 5H5SA 2F8FA 3LQ7A 2AYTA 2DKIA 1ZYPA 3FHKA 1XG8A 2QC7A 3TB2A 5A4WA 5ABRA 3ERFA 2E7PA 4Z2RA 4G9HA 3UIWA 3KIJA 3CSJA 1ST9A 3IHGA 1WE0A 2DIZA 5D9XA 5LNKe 1G7OA 4XS4A 3HZ8A 3Q74A 3HVNA 4OO4A 2GZYA 2VO4A 2XC2A 5B6MA 5JWOB 3I6AA 1VGLA 4TR0A 5IMDA 3EVIA 1FOHA 5KEJA 1WP0A 3HY2A 4PXOA 2DMMA 2LNTA 1YEXA 1M9BA 5D9VA 1PA3A 4Q5RA 4E8EA 3EU3A 2OACA 4I2UA 4V1Ag 2V1MA 1AC1A 3SBCA 1JZOA 5HR2A 2LSTA 5L71A 2VUPA 5HR0A 1DE2A 4ICYA 1GULA 2IJYA 3LSZA 5IO0A 5ID2A 3APQA 3IAM2 2HZEB 3UAPA 3CBUA 2CA8A 1NHYA 1SL0B 4Z2TA 1A2JA 2MBSA 3C1RA 2YJHA 2WJUA 2H01A 4BPYA 4HZ4A 2M72A 4PNFA 2GGTA 2RUFA 3LWAA 5IMVA 2C1YA 4PQ1A 3RBTA 1WJKA 3FZ5A 2IMFA 4EIPA 3WT2A 3IK7A 2MZCA 5FHIA 1MEKA 2VCZA 1EGRA 3TRXA 3IA1A 3EINA 2L4QA 3TUEA 4FYUA 4F03A 3LXTA 1GP1A 4Q5FA 4ZBDA 2C3TA 2FY6A 3ED3A 1GWCA 3FZ4A 4O32A 4ZBBA 3O3TA 1Z6MA 4EDZA 3CTFA 4MJEA 1TRSA 2GSSA 2OJLA 4MMMA 4O7HA 1XWCA 1MD4A 1H75A 2WRTA 2QSIA 4IQAA 2B5EA 3QAVA 3F63A 3F3QA 4GLTA 4WR5A 2EIRA 3DD3A 4GQCA 4WEYA 1ERWA 4K2XA 3W8SA 5G1KA 3I43A 3TRQA 3LGCA 3APSA 2CVKA 2YV9A 1W4VA 2AHEA 4XS4B 3U6VA 1WIKA 2X64A 2A2RA 2GS3A 3IAS2 2DIYA 3Q6OA 4K0NA 2LV3A 4Q5NA 5B8BA 3L9UA 1U88A 2VCQA 5JCUA 3DEXA 4WR4A 3LYKA 1CQGA 4CY8A 1YF0A 4RUVA 3CQFA 2PMTA 2C3QA 6GSXA 4YQVA 1VF1A 3ME8A 1J08A 1SK1A 3APOA 4POLA 1GTBA 1K0DA 1ZYQB 1V2AA 4ZB6A 2LTKA 3HYPA 1PN0A 5KN1A 3G7JA 1Z9HA 3F6FA 2H75A 5DQYA 3G9BA 4KCEA 2XHFA 3HVSA 1B8XA 3CRUA 3PGTA 1AQXA 2PU9C 4Z7XA 1Q4JA 1HNCA 2LJRA 2YV7A 1X9SB 1RW1A 5G5EA 3KD0A 4HOJA 3GFKA 4QQ7A 1TRWA 3GKXA 5F8BA 2JU5A 1B4QA 3LORA 2GSTA 1VF2A 2DKHA 5DALA 3KP8A 3ZITA 4J57E 2VOCA 1ACVA 1YJ6A 4FQUA 12GSA 4K2DA 2GTUA 4ZB8A 3AY8A 3VK9A 3DWVA 1F6MC 2C0EA 3WGDA 3QFBC 4KUNA 3GV1A 3UARA 2IFQA 1FB0A 1R4WA 4HQSA 1SJZA 8GSSA 5CNWA 5H5RA 4TW5A 4RQXA 2OADA 1OKDA 2K8SA 2CV4A 4NWYA 4GCIA 2N5BA 4EIQA 2NVLA 4EF0A 7GSSA 1K0AA 6GSUA 4X1UA 2KOKA 3F4TA 9GSSA 4IN0A 1X9MB 3HVVA 2XPEA 1NHOA 3W8JA 3QOUA 1NM3A 4XS6A 1TK5B 3GIXA 4JZQA 2MMZA 3US3A 1T1VA 3LG6A 18GSA 1UA5A 4KDUA 4N0ZA 4NAXA 1A8LA 2H6YA 4OMVA 1E6BA 5EPFA 5AN1A 4D73A 4WETA 4USSA 3ZZXA 4MCUA 4J2FA 4NV2A 1T7PB 3VI5A 1NSWA 1OC3A 4K0GA 1GL8A 5ECLB 5IPHA 4RQRA 5AIXA 2DMLA 3TKSC 3DVWA 3FKFA 2VCWA 4TVEA 3TJKA 2XPDA 4IP6A 2LJAA 5D9TA 2BTOT 2EIOA 2L5LA
chains in the Genus database with same CATH topology
4JRRA 1JZDA 2DC5A 2R37A 5D96A 1GH2A 2VLTA 3ZMLA 1QXHA 1XWKA 2VL2C 4IW9A 1M2BA 2GZZA 2H74A 1MD3A 1ZOFA 3FZAA 3CSIA 4MLYA 2UZ8A 1JLWA 1K0OA 3MWHA 3KJYA 1O8WA 1OE8A 2HI7A 3TCOA 4K8MA 5JCWA 2HFDA 5G30A 1GUKA 14GSA 2R2JA 4IVFA 2GVPA 2V32A 3H4KA 2LQOA 1RK4A 4V1Ap 2JZSA 2H6XA 4WF5A 3IE3A 2OA7A 1TU7A 4GSSA 3P7XA 3ZTLA 4OD7A 1X5CA 1GTIA 3D5JA 1TK8B 4MNNA 2OE3A 3F4SA 4J56E 1BAYA 3IBHA 5EL8A 3ZIJA 2VM2A 4IELA 1Z7RA 2H66A 1THOA 3DMLA 3E9JB 4E8HA 2FCHA 1EP7A 5DVBA 2GSQA 3UVHA 5ECSA 2DJ0A 1Z7PA 2I4AA 2X8GA 1AQVA 5HFGA 2AUVA 2O7KA 5CRHA 5J9CA 2YANA 5BRTA 4OWYA 5A4VA 1B9YC 2B6MA 3FR3A 3PINA 2KHPA 1PL2A 4ZL9A 1B4PA 3GKMA 2I81A 4WBRD 5F07A 4D73B 3GL3A 3DIEA 1EWXA 5IO2A 2NDOA 5IMAA 1T4YA 4OFMA 2IMEA 4WXTA 3RPPA 3F9UA 4F9ZA 3TDGA 4X0XA 1YQ1A 1O8XA 1XOAA 3ERGA 1AQWA 3HCZA 4HQZA 2NTOA 5ECPB 1U6TA 2VL3A 3LXZA 3EPTA 4IS0A 4TXOA 2BJXA 4GTUA 3UOMA 2QGVA 1FHEA 3ZMKA 1FVKA 3H93A 4ZIJA 2PBJA 3BCIA 4K7IA 2VM1A 2LJKA 5FWGA 1B48A 1XFLA 1SJIA 3FR9A 4MZWA 4MZBA 5F0GA 1SL2B 1JLVA 5CP1A 2CT6A 1PMTA 1GNWA 1GTUA 1WOUA 3D0ZA 4HJ2A 2YZUA 3IDVA 4HZ2A 4BWQA 1IYHA 3D21A 2ALBA 3PR8A 1JZRA 1K0CA 3OR5A 3GTUA 3O6TA 4O5UA 3IR4A 2B1KA 2VL9A 4DSSB 4KX4A 2H71A 2V41A 3LEFA 2NBSA 3VWUA 1BEDA 1N8JA 1U87A 4WKWA 4JE1A 2H0HA 1MDKA 1QK8A 2KP1A 2FA4A 4AJ7A 5EY6A 2MBTA 4TR1A 3UL3A 4DVCA 3KTLA 2IN3A 1W89A 1M0UA 2L5OA 13GSA 2LUSA 1EV9A 1SK0A 4KA0A 2OKAA 5A5KA 4NXIA 4YAVA 2HRAA 2JSYA 3GX8A 3WGEA 4F2IA 3GN3A 3ERWA 5GSTA 1C72A 3IC4A 1VF3A 3KM6A 1UVZA 1TKDB 3IOSA 3TKPA 3FMWA 4V2LA 4CW9A 3L78A 4FH8A 4OCEA 4BWSA 3C73A 1XWGA 3A5IA 3HVXA 1SKWB 1O81A 3E0UA 1Y25A 2OBKA 3KGKA 4EVMA 4FO5A 1F3AA 3F6DA 3TJGA 1UC7A 2IMIA 1ZCPA 1T3BA 1HNBA 4NPBA 3SWLA 3UBLA 2I1UA 1PKWA 3IV4A 3UEMA 4IP1A 1OC8A 1G6YA 5CAXA 1XZOA 1XVQA 1USBA 2X8HA 4NV5A 3S9FA 1TI1A 2CVBA 1WPIA 4MA9A 6GSVA 3FYGA 2L4CA 2L59A 2TRCP 2ZNMA 4IQ1A 2V6OA 2H30A 3QFAC 2AJQB 4N11A 1SU9A 1EZKA 2YNXA 2A2PA 5DCHA 1I5GA 3Q18A 4KSOA 3EC3A 2LRCA 3GTUB 2F51A 2YPMA 1A0FA 1MDIA 2PWJA 2HSYA 4I8BA 2R0PA 5B8AA 2H72A 3ZVJA 4ZILA 4K5SA 2PPTA 4MPFA 4ULXA 4O5QA 4IJ3A 3EWLA 4XRAA 3M9JA 2O89A 4TR1B 1X5EA 2TIRA 4ML1A 3GNJA 3C8EA 2JADA 2IIYA 2M46A 2X49A 5F06A 5ECHB 4PUAA 3BD2A 1FO5A 2LRNA 5HFIA 5DAKA 2VIMA 2CZ3A 2AAWA 1YKAA 1XBSA 2CAQA 1A23A 5ID2B 2WZ9A 3ZFBA 4XCSA 4MF5A 3PPUA 4K7OA 3GL5A 2R0CA 2VCXA 2HLSA 4OO5A 1A2LA 2JSZA 1N2AA 1A24A 1TI3A 1TTZA 4K7NA 4ILFA 6GSSA 2HRKA 5GAND 3O76A 4O92A 2QA2A 3M3MA 2FLSA 2IWTA 3KMNA 2H0IA 3GH6A 3LW9A 4PNGA 1PX6A 1X9WB 3VPTA 2H73A 2VD0A 3HHVA 3K8NA 20GSA 4BVYA 4DSRA 3Q19A 2M80A 3GH9A 2FWEA 4L0UA 2L6DA 3QAGA 1M7TA 4PX1A 4MF7A 1THXA 3TGZA 3HXSA 4HU9A 3HJPA 2H1BA 1M2AA 3DVXA 3GSTA 1VF4A 4PURA 5CRGA 5EVOA 3M8NA 3NOFA 4GSNA 2H6ZA 1PL1A 3KTBA 4JBBA 2C8UA 3LYPA 4AJ6A 5ECMB 4AJ8A 4IBPA 1TP9A 4AF2A 4I6XA 4KH7A 1FB6A 1SK2A 4G0KA 3BJ5A 4ECCA 5IIZA 3VWVA 1V9WA 3LJRA 4ECJA 1M99A 3HD5A 1R5AA 2D2ZA 1X0RA 4KW6A 1R5PA 3LFLA 4X43A 5KN2A 4TN8A 2LEGA 4IJIA 1GSEA 4I2TA 5D9WA 2MMOA 1U3AA 5ECOB 6GSTA 3UMAA 2GQMA 2CQ9A 3A5WA 2Z9SA 4BA7A 1Y6EA 4IKHA 2KP2A 2QA1A 2GQLA 1DBYA 2C0GA 2H1DA 2O85A 5LD0A 5DAKB 5KN0A 1KTEA 3MDKA 2X99A 2HSMA 3FRCA 2V2GA 3ZVJD 4BL7A 2HYXA 2IMKA 5G31A 5CYYA 1GSDA 4EC0A 2A2SA 2ZUPA 5AGYA 2PVQA 3VPQA 1H4OA 2LS5A 4N10A 1GLQA 1I9DA 2GDRA 4LMWA 2KUCA 5DALB 4TR4A 5J3RA 1O6JA 3TOTA 3P8WA 2RLIA 4XRDA 2E0QA 3A3TA 1HYUA 2R0GA 2ES7A 2FA8A 1ZL9A 5AISA 1DUGA 3RHBA 5CRWA 1S3DA 4OCFA 1SL1B 1XPVA 2DSAA 5C04A 3CMIA 3TJJA 5FT3A 2B3SA 3CSHA 2YCDA 1G6WA 2VCVA 3TJFA 4CDOA 2HNLA 4IHUA 3D22A 2VCTA 4XIHA 2LNSA 16GSA 2H0GA 2YWIA 4CHSA 4HUAA 2IFQB 1FG4A 1AUCA 4LLRA 3L0HA 4P3YB 3I9V2 4PTSA 1TDIA 1F9MA 2C3NA 3TKQA 1XCCA 3EE2A 3M1GA 2J9HA 2LQQA 3C7MA 4POKA 1YZXA 1B9XC 3VI7A 2C80A 2YJ7A 3TRPA 3GURA 3RAZA 1T8EB 1SKSB 2H70A 2P0GA 2XBIA 1M9AA 3F8UA 2PVOC 4OFNA 1ERTA 2PGTA 3ZL5A 3FR6A 2N5AA 2H76A 2RUEA 2PN8A 3IHQA 2CVDA 1TXXA 1GUMA 1QGVA 3DGQA 3H8QA 2R4VA 4G19A 2A4VA 4QL7A 1GSSA 2K6VA 5F05A 4GQFA 4MPGA 3JCML 4IGJA 4MH3A 2L57A 4KDXA 5KN3A 1TJDA 4NHZA 5CREA 2FD3A 1F2EA 2YN1A 1KBNA 2GSRA 19GSA 4LL4B 3CXGA 4LMVA 1ILOA 1V58A 1T4ZA 5ELGA 3TKRA 4KDYA 5HFKA 1XW9A 5BMUA 1HD2A 2G0FA 3BOAA 10GSA 4BVXA 1BYEA 1BX9A 2K8VA 1K0BA 1GSFA 3F4RA 3GA4A 1QQ2A 2RM5A 2F3MA 3FK8A 5G5FA 3VWWA 3WD6A 3IC8A 1TRVA 2DJ2A 1A8YA 4KGIA 3A2XA 4V2MA 2FNOA 1O7UA 4G0IA 2F9SA 3FW2A 5GZZB 4JR6A 5IQYA 1GUHA 1ZYNA 2GLRA 3EU4A 3DXBA 4KCAA 1ERUA 1BG5A 3MYDA 2E2GA 2HXKA 1U3IA 2IL3A 1IYIA 2YWNA 3MIXA 1OKTA 1A2MA 1FW1A 1O73A 1M2DA 3G7YA 3M0FA 1X5DA 4MDCA 4TRXA 4MH2A 1OYJA 5ELAA 3C1SA 1WMJA 3FY7A 4GF0A 1EEMA 4GRFA 1GSYA 4L5OA 1PN9A 2QKEA 4F0BA 2DLXA 2R6KA 1HNAA 2VLUA 3L9VA 3C71A 3R2QA 3MAKA 3QD9A 3GKKA 17GSA 5D73A 1V40A 3D6IA 4FIWA 2O87A 3UVTA 1YEPA 1SD9A 4ID0A 1SYXA 1PD21 4Z2UA 4WF4A 4EKZA 4QL9A 1V57A 3KMOA 3ZFLA 3IPZA 5J5NA 2C4JA 4HI7A 3GUSA 2MMAA 3CRTA 1LBKA 3IK9A 2MMNA 4ISDA 2CZ2A 6GSYA 1GSQA 3FZ9A 5IMFA 2AB6A 4WBJA 5HR3A 2KLXA 4X4JA 1ON4A 2WULA 4MJCA 2TRXA 5ECKB 2ZCTA 2R5GA 2JL4A 4ZL8A 3V1WA 1CQHA 1ZZYA 3UJ1A 1AAZA 1KNGA 2C0FA 4HJMA 2R3XA 2ON7A 4DEJA 4HU7A 4PGTA 2YP6A 2PUKC 2ON5A 3HJMA 3N9JA 1YF1A 4TXOB 2E2MA 3G7IA 4POBA 1RQMA 1JFUA 4XS1A 1QFNA 1F3BA 3J7Yb 1XXUA 4N30A 2WGRA 5DBQA 4BVXB 3P90A 1FOVA 5IMZA 3EMXA 2GQKA 4Q5QA 1UN2A 5IM9A 1OVNA 4KNDA 1ABAA 2JZTA 2V6KA 2FWHA 1ERVA 1URMA 4GWRA 3KZQA 5E59A 1EOHA 3QPMA 4I5QA 1LJRA 2B7KA 4NHWA 2HT9A 3QAWA 1OC9A 3QR6A 4K9ZA 5DCGA 3WGXA 1FAAA 1TU8A 2PERA 4ZL7A 1F37A 2I3YA 3ZREA 4ACSA 4JEDA 5ECQB 1XWAA 1J9BA 2HZFA 2K18A 5ECIB 2YWMA 2LRTA 3DRNA 1K0MA 4F82A 2WS2A 4KSMA 2HE3A 1YY7A 2H1AA 4LA1A 3DKSA 4EL1A 4I97A 3UBKA 4TR3A 3H1NA 4MZCA 3L9SA 1Q98A 3CYNA 3TKSA 3GMFA 2YOIA 3I69A 2NPBA 1G7EA 4EUYA 3IXRA 1WWJA 2GT6A 2J23A 3QMXA 4ECBA 4MJBA 2REMA 2A4HA 5ECRB 2EC4A 2P5RA 3TJBA 1G0TA 4YKFA 2G2QA 2JACA 3HDCA 2VL2A 3HJOA 1PRXA 3QDNA 4KF9A 3BBYA 1BQ7A 1XW6A 2CAIA 5A4UA 4K6XA 4POMA 4HDEA 1R26A 1GRXA 1ZGNA 1S3AA 4PUFC 1MTCA 2OE0A 3H79A 1YKCA 2EIQA 3A2VA 5H5QA 1QMVA 2I9HA 2DJKA 4XHMA 4L0WA 2F8AA 4KAEA 5B7CA 5ENUA 5GAPD 3QCPA 4HEA2 3HKRA 5DQSA 1Z3EA 4XTSA 1NW2A 4YKGA 5LCZA 1XOBA 4MJAA 4ZBAA 2N5FA 1WRYA 3HA9A 5IOWA 5INYA 5CRDA 2OE1A 4K5RA 4RI6A 1TW9A 3TKSE 3ZLPA 1S3CA 4MABA 1TK0B 4YQUA 3GSSA 1OE7A 1AW9A 4G0LA 1DE1A 3RDWA 3ZYWA 1PX7A 1EP8A 5IMCA 2RIIA 2FWFA 4OFTA 1OC9B 1GNEA 1EV4A 3MNGA 3U5RE 2OBIA 2WDUA 11GSA 3GHAA 2DJ1A 3KH7A 5J4UA 4JU5A 5D93A 3IRAA 4KB3A 3GRXA 2H19A 5AIVA 3J7Yk 1JZWA 4AGSA 2L6CA 3WT1A 2DJ3A 2IPAA 2CX4A 5COHA 4MK3A 5G2ZA 4K1FA 2VD1A 1KEBA 3VWXA 1EOGA 3CTGA 1XW5A 1K3LA 2WB9A 4H86A 4O5RA 1MDJA 2LKUA 3W6GA 4GXZA 4ML6A 3KEBA 5CO3A 2O8VB 3D4TA 3NZNA 5KOXA 2P5QA 1HQOA 1OAZA 4TXVA 4YH2A 22GSA 2RM6A 1AIUA 3KCMA 4GSTA 2WFCA 3GKNA 4FYCA 2FGXA 4PQIA 2B7JA 2IMDA 2BMXA 1XVWA 3FEUA 4EXJA 4FYBA 1GTAA 5G1LA 1XIYA 3F3RA 3KP9A 4YAPA 4ZB9A 1PQNA 4HS1A 1ML6A 4KE3A 5B6NA 2X8CA 1PSQA 4MF6A 2VAFA 3EURA 1BJXA 4A5PA 1XWBA 2P31A 1SD8A 4G2EA 5KOWA 4G10A 1K0NA 2GT5A 5D8IA 3L4NA 1FVJA 4BVYB 4L8EA 1DSBA 2B5XA 1GLPA 4DSSA 2GZPA 2YZHA 1LU4A 2FUG2 3P2AA 2B5YA 4TOPA 1EGOA 4RI7A 3R3EA 3EYTA 2DJJA 3M9KA 3D4MA 2DBCA 1Z5YE 1E2YA 3PH9A 2C0DA 2B1LA 2MYGA 1Z6NA 2WCIA 4ZXGA 1PGTA 3ZIVA 1VRSD 3TOUA 1K3YA 2FWGA 3BCKA 5C00A 1TOFA 2HSHA 3DYRA 3HZ4A 4TKYA 4V2NA 3VFIA 5JWQB 1V98A 1TRUA 4EDYA 5HQPA 3MSZA 2JZRA 1JHBA 2VLVA 2K9FA 1SYRA 2CX3A 2X4AA 5HR1A 2HZEA 1SJ6A 2HRNA 1SKRB 5JWRB 1GSUA 4YQMA 5DJLA 3RPNA 3RHCA 1R7HA 1EEJA 1YDKA 4NMUA 4L5LA 2H8LA 5J41A 1K3OA 5IPGA 3GX0A 4N0VA 4F0CA 2H1GA 3NIVA 2YWOA 5J9BA 3VLNA 3ZRDA 5E4WA 6GSWA 3KXOA 3F0IA 1ZMAA 4MP4A 1AXDA 1QUWA 5JCGA 2FHEA 1O85A 2AV4A 3ME7A 1SENA 3ISOA 4BL7B 2XBQA 3VURA 4LL1B 1PKZA 1ZYEA 3KH9A 2HRFA 1T00A 4EO3A 4JR4A 4EE0A 3N5OA 4CY6A 3GYKA 3WYWA 1J0FA 5GSSA 3E3EA 3A2WA 3EMPA 4PQHA 1A0RP 5DDLA 4DSQA 5DJMA 5ECNB 4ECIA 5IOXA 5H5SA 2F8FA 3LQ7A 2AYTA 2DKIA 1ZYPA 3FHKA 2QC7A 3TB2A 5A4WA 5ABRA 3ERFA 2E7PA 4Z2RA 4G9HA 3UIWA 3KIJA 3CSJA 1ST9A 3IHGA 1WE0A 2DIZA 5D9XA 5LNKe 1G7OA 4XS4A 3HZ8A 3Q74A 4OO4A 2GZYA 2VO4A 2XC2A 5B6MA 5JWOB 3I6AA 1VGLA 4TR0A 5IMDA 3EVIA 1FOHA 5KEJA 1WP0A 3HY2A 4PXOA 2DMMA 2LNTA 1YEXA 1M9BA 5D9VA 1PA3A 4Q5RA 4E8EA 3EU3A 2OACA 4I2UA 4V1Ag 2V1MA 1AC1A 3SBCA 1JZOA 5HR2A 2LSTA 5L71A 2VUPA 5HR0A 1DE2A 4ICYA 1GULA 2IJYA 3LSZA 5IO0A 5ID2A 3APQA 3IAM2 2HZEB 3UAPA 3CBUA 2CA8A 1NHYA 1SL0B 4Z2TA 1A2JA 2MBSA 3C1RA 2YJHA 2WJUA 2H01A 4BPYA 4HZ4A 2M72A 4PNFA 2GGTA 2RUFA 3LWAA 5IMVA 2C1YA 4PQ1A 3RBTA 1WJKA 3FZ5A 2IMFA 4EIPA 3WT2A 3IK7A 2MZCA 5FHIA 1MEKA 2VCZA 1EGRA 3TRXA 3IA1A 3EINA 2L4QA 3TUEA 4FYUA 4F03A 3LXTA 1GP1A 4Q5FA 4ZBDA 2C3TA 2FY6A 3ED3A 1GWCA 3FZ4A 4O32A 4ZBBA 3O3TA 1Z6MA 4EDZA 3CTFA 4MJEA 1TRSA 2GSSA 2OJLA 4MMMA 4O7HA 1XWCA 1MD4A 1H75A 2WRTA 2QSIA 4IQAA 2B5EA 3QAVA 3F63A 3F3QA 4GLTA 4WR5A 2EIRA 3DD3A 4GQCA 4WEYA 1ERWA 4K2XA 3W8SA 5G1KA 3I43A 3TRQA 3LGCA 3APSA 2CVKA 2YV9A 1W4VA 2AHEA 4XS4B 3U6VA 1WIKA 2X64A 2A2RA 2GS3A 3IAS2 2DIYA 3Q6OA 4K0NA 2LV3A 4Q5NA 5B8BA 3L9UA 1U88A 2VCQA 5JCUA 3DEXA 4WR4A 3LYKA 1CQGA 4CY8A 1YF0A 4RUVA 2PMTA 2C3QA 6GSXA 4YQVA 1VF1A 3ME8A 1J08A 1SK1A 3APOA 4POLA 1GTBA 1K0DA 1ZYQB 1V2AA 4ZB6A 2LTKA 3HYPA 1PN0A 5KN1A 3G7JA 1Z9HA 3F6FA 2H75A 5DQYA 3G9BA 4KCEA 2XHFA 3HVSA 1B8XA 3CRUA 3PGTA 1AQXA 2PU9C 4Z7XA 1Q4JA 1HNCA 2LJRA 2YV7A 1X9SB 1RW1A 5G5EA 3KD0A 4HOJA 3GFKA 4QQ7A 1TRWA 3GKXA 5F8BA 2JU5A 1B4QA 3LORA 2GSTA 1VF2A 2DKHA 5DALA 3KP8A 3ZITA 4J57E 2VOCA 1ACVA 1YJ6A 4FQUA 12GSA 4K2DA 2GTUA 4ZB8A 3AY8A 3VK9A 3DWVA 1F6MC 2C0EA 3WGDA 3QFBC 4KUNA 3GV1A 3UARA 2IFQA 1FB0A 1R4WA 4HQSA 1SJZA 8GSSA 5CNWA 5H5RA 4TW5A 4RQXA 2OADA 1OKDA 2K8SA 2CV4A 4NWYA 4GCIA 2N5BA 4EIQA 2NVLA 4EF0A 7GSSA 1K0AA 6GSUA 4X1UA 2KOKA 3F4TA 9GSSA 4IN0A 1X9MB 3HVVA 2XPEA 1NHOA 3W8JA 3QOUA 1NM3A 4XS6A 1TK5B 3GIXA 4JZQA 2MMZA 3US3A 1T1VA 3LG6A 18GSA 1UA5A 4KDUA 4N0ZA 4NAXA 1A8LA 2H6YA 4OMVA 1E6BA 5EPFA 5AN1A 4D73A 4WETA 4USSA 3ZZXA 4MCUA 4J2FA 4NV2A 1T7PB 3VI5A 1NSWA 1OC3A 4K0GA 1GL8A 5ECLB 5IPHA 4RQRA 5AIXA 2DMLA 3TKSC 3DVWA 3FKFA 2VCWA 4TVEA 3TJKA 2XPDA 4IP6A 2LJAA 5D9TA 2BTOT 2EIOA 2L5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRR A;  1JZD A;  2DC5 A;  2R37 A;  5D96 A;  1GH2 A;  2VLT A;  3ZML A;  1QXH A;  1XWK A;  2VL2 C;  4IW9 A;  1M2B A;  2GZZ A;  2H74 A;  1MD3 A;  1ZOF A;  3FZA A;  3CSI A;  4MLY A;  1JLW A;  1K0O A;  3MWH A;  3KJY A;  1O8W A;  1OE8 A;  2HI7 A;  3TCO A;  4K8M A;  5JCW A;  2HFD A;  5G30 A;  1GUK A;  14GS A;  2R2J A;  4IVF A;  2GVP A;  2V32 A;  3H4K A;  2LQO A;  1RK4 A;  4V1A p;  2JZS A;  2H6X A;  4WF5 A;  3IE3 A;  2OA7 A;  1TU7 A;  4GSS A;  3P7X A;  3ZTL A;  4OD7 A;  1X5C A;  1GTI A;  3D5J A;  1TK8 B;  2OE3 A;  3F4S A;  4J56 E;  1BAY A;  3IBH A;  5EL8 A;  3ZIJ A;  2VM2 A;  4IEL A;  1Z7R A;  2H66 A;  1THO A;  3DML A;  3E9J B;  4E8H A;  2FCH A;  1EP7 A;  5DVB A;  2GSQ A;  3UVH A;  5ECS A;  2DJ0 A;  1Z7P A;  2I4A A;  2X8G A;  1AQV A;  5HFG A;  2AUV A;  2O7K A;  5CRH A;  5J9C A;  2YAN A;  4OWY A;  5A4V A;  1B9Y C;  2B6M A;  3FR3 A;  3PIN A;  2KHP A;  1PL2 A;  4ZL9 A;  1B4P A;  3GKM A;  2I81 A;  4WBR D;  5F07 A;  4D73 B;  3GL3 A;  3DIE A;  1EWX A;  5IO2 A;  2NDO A;  5IMA A;  1T4Y A;  4OFM A;  2IME A;  4WXT A;  3RPP A;  3F9U A;  4F9Z A;  3TDG A;  4X0X A;  1YQ1 A;  1O8X A;  1XOA A;  3ERG A;  1AQW A;  3HCZ A;  4HQZ A;  2NTO A;  5ECP B;  1U6T A;  2VL3 A;  3LXZ A;  4IS0 A;  4TXO A;  2BJX A;  4GTU A;  3UOM A;  2QGV A;  1FHE A;  3ZMK A;  1FVK A;  3H93 A;  4ZIJ A;  2PBJ A;  3BCI A;  4K7I A;  2VM1 A;  2LJK A;  5FWG A;  1B48 A;  1XFL A;  1SJI A;  3FR9 A;  4MZW A;  4MZB A;  5F0G A;  1SL2 B;  1JLV A;  5CP1 A;  2CT6 A;  1PMT A;  1GNW A;  1GTU A;  1WOU A;  3D0Z A;  4HJ2 A;  2YZU A;  3IDV A;  4HZ2 A;  4BWQ A;  1IYH A;  3D21 A;  2ALB A;  3PR8 A;  1JZR A;  1K0C A;  3OR5 A;  3GTU A;  3O6T A;  3IR4 A;  2B1K A;  2VL9 A;  4DSS B;  4KX4 A;  2H71 A;  2V41 A;  3LEF A;  2NBS A;  3VWU A;  1BED A;  1N8J A;  1U87 A;  4WKW A;  4JE1 A;  2H0H A;  1MDK A;  1QK8 A;  2KP1 A;  2FA4 A;  4AJ7 A;  5EY6 A;  2MBT A;  4TR1 A;  3UL3 A;  4DVC A;  3KTL A;  2IN3 A;  1W89 A;  1M0U A;  2L5O A;  13GS A;  2LUS A;  1EV9 A;  1SK0 A;  4KA0 A;  2OKA A;  5A5K A;  4NXI A;  4YAV A;  2JSY A;  3GX8 A;  3WGE A;  4F2I A;  3GN3 A;  3ERW A;  5GST A;  1C72 A;  3IC4 A;  1VF3 A;  3KM6 A;  1UVZ A;  1TKD B;  3IOS A;  3TKP A;  4V2L A;  4CW9 A;  3L78 A;  4FH8 A;  4OCE A;  4BWS A;  3C73 A;  1XWG A;  3HVX A;  1SKW B;  1O81 A;  3E0U A;  1Y25 A;  2OBK A;  3KGK A;  4EVM A;  4FO5 A;  1F3A A;  3F6D A;  3TJG A;  1UC7 A;  2IMI A;  1ZCP A;  1T3B A;  1HNB A;  4NPB A;  3SWL A;  3UBL A;  2I1U A;  1PKW A;  3IV4 A;  3UEM A;  4IP1 A;  1OC8 A;  1G6Y A;  5CAX A;  1XZO A;  1XVQ A;  1USB A;  2X8H A;  4NV5 A;  3S9F A;  1TI1 A;  2CVB A;  1WPI A;  4MA9 A;  6GSV A;  3FYG A;  2L4C A;  2L59 A;  2TRC P;  2ZNM A;  4IQ1 A;  2V6O A;  2H30 A;  3QFA C;  2AJQ B;  4N11 A;  1SU9 A;  1EZK A;  2YNX A;  5DCH A;  1I5G A;  3Q18 A;  4KSO A;  3EC3 A;  2LRC A;  3GTU B;  2F51 A;  2YPM A;  1A0F A;  1MDI A;  2PWJ A;  2HSY A;  4I8B A;  5B8A A;  2H72 A;  3ZVJ A;  4ZIL A;  2PPT A;  4MPF A;  4ULX A;  4IJ3 A;  3EWL A;  4XRA A;  3M9J A;  2O89 A;  4TR1 B;  1X5E A;  2TIR A;  4ML1 A;  3GNJ A;  3C8E A;  2JAD A;  2IIY A;  2M46 A;  5F06 A;  5ECH B;  4PUA A;  3BD2 A;  1FO5 A;  2LRN A;  5HFI A;  5DAK A;  2VIM A;  2CZ3 A;  2AAW A;  1YKA A;  1XBS A;  2CAQ A;  1A23 A;  5ID2 B;  2WZ9 A;  3ZFB A;  4XCS A;  4MF5 A;  4K7O A;  3GL5 A;  2VCX A;  2HLS A;  4OO5 A;  1A2L A;  2JSZ A;  1N2A A;  1A24 A;  1TI3 A;  1TTZ A;  4K7N A;  4ILF A;  6GSS A;  5GAN D;  3O76 A;  4O92 A;  3M3M A;  2FLS A;  2IWT A;  3KMN A;  2H0I A;  3GH6 A;  4PNG A;  1PX6 A;  1X9W B;  3VPT A;  2H73 A;  2VD0 A;  3HHV A;  3K8N A;  20GS A;  4BVY A;  4DSR A;  3Q19 A;  2M80 A;  3GH9 A;  2FWE A;  4L0U A;  2L6D A;  3QAG A;  1M7T A;  4PX1 A;  4MF7 A;  1THX A;  3TGZ A;  3HXS A;  4HU9 A;  3HJP A;  2H1B A;  1M2A A;  3DVX A;  3GST A;  1VF4 A;  4PUR A;  5CRG A;  5EVO A;  3M8N A;  3NOF A;  4GSN A;  2H6Z A;  1PL1 A;  3KTB A;  4JBB A;  2C8U A;  3LYP A;  4AJ6 A;  5ECM B;  4AJ8 A;  4IBP A;  1TP9 A;  4AF2 A;  4I6X A;  4KH7 A;  1FB6 A;  1SK2 A;  3BJ5 A;  4ECC A;  5IIZ A;  3VWV A;  1V9W A;  3LJR A;  4ECJ A;  1M99 A;  3HD5 A;  1R5A A;  2D2Z A;  1X0R A;  4KW6 A;  1R5P A;  3LFL A;  4X43 A;  5KN2 A;  4TN8 A;  2LEG A;  4IJI A;  1GSE A;  4I2T A;  5D9W A;  2MMO A;  1U3A A;  5ECO B;  6GST A;  3UMA A;  2GQM A;  2CQ9 A;  3A5W A;  2Z9S A;  4BA7 A;  1Y6E A;  4IKH A;  2KP2 A;  2GQL A;  1DBY A;  2C0G A;  2H1D A;  2O85 A;  5LD0 A;  5DAK B;  5KN0 A;  1KTE A;  3MDK A;  2X99 A;  3FRC A;  2V2G A;  3ZVJ D;  4BL7 A;  2HYX A;  2IMK A;  5G31 A;  5CYY A;  1GSD A;  4EC0 A;  2A2S A;  2ZUP A;  5AGY A;  2PVQ A;  3VPQ A;  1H4O A;  2LS5 A;  4N10 A;  1GLQ A;  1I9D A;  2GDR A;  4LMW A;  2KUC A;  5DAL B;  4TR4 A;  5J3R A;  1O6J A;  3TOT A;  3P8W A;  2RLI A;  4XRD A;  2E0Q A;  3A3T A;  1HYU A;  2ES7 A;  2FA8 A;  1ZL9 A;  5AIS A;  1DUG A;  3RHB A;  5CRW A;  1S3D A;  4OCF A;  1SL1 B;  1XPV A;  2DSA A;  5C04 A;  3CMI A;  3TJJ A;  5FT3 A;  2B3S A;  3CSH A;  2YCD A;  1G6W A;  2VCV A;  3TJF A;  4CDO A;  2HNL A;  4IHU A;  3D22 A;  2VCT A;  4XIH A;  2LNS A;  16GS A;  2H0G A;  2YWI A;  4CHS A;  4HUA A;  2IFQ B;  1FG4 A;  1AUC A;  4LLR A;  3L0H A;  4P3Y B;  3I9V 2;  1TDI A;  1F9M A;  2C3N A;  3TKQ A;  1XCC A;  3EE2 A;  3M1G A;  2J9H A;  2LQQ A;  3C7M A;  4POK A;  1YZX A;  1B9X C;  3VI7 A;  2C80 A;  2YJ7 A;  3TRP A;  3GUR A;  3RAZ A;  1T8E B;  1SKS B;  2H70 A;  2P0G A;  2XBI A;  1M9A A;  3F8U A;  2PVO C;  4OFN A;  1ERT A;  2PGT A;  3ZL5 A;  3FR6 A;  2N5A A;  2H76 A;  2RUE A;  2PN8 A;  3IHQ A;  2CVD A;  1TXX A;  1GUM A;  1QGV A;  3DGQ A;  3H8Q A;  2R4V A;  4G19 A;  2A4V A;  4QL7 A;  1GSS A;  2K6V A;  5F05 A;  4GQF A;  4MPG A;  3JCM L;  4IGJ A;  4MH3 A;  2L57 A;  4KDX A;  5KN3 A;  1TJD A;  4NHZ A;  5CRE A;  2FD3 A;  1F2E A;  2YN1 A;  1KBN A;  2GSR A;  19GS A;  4LL4 B;  3CXG A;  4LMV A;  1ILO A;  1V58 A;  1T4Z A;  5ELG A;  3TKR A;  4KDY A;  5HFK A;  1XW9 A;  1HD2 A;  2G0F A;  3BOA A;  10GS A;  4BVX A;  1BYE A;  1BX9 A;  2K8V A;  1K0B A;  1GSF A;  3F4R A;  3GA4 A;  1QQ2 A;  2RM5 A;  2F3M A;  3FK8 A;  5G5F A;  3VWW A;  3WD6 A;  1TRV A;  2DJ2 A;  1A8Y A;  4KGI A;  3A2X A;  4V2M A;  2FNO A;  1O7U A;  2F9S A;  3FW2 A;  5GZZ B;  4JR6 A;  5IQY A;  1GUH A;  2GLR A;  3EU4 A;  3DXB A;  4KCA A;  1ERU A;  1BG5 A;  2E2G A;  2HXK A;  1U3I A;  2IL3 A;  1IYI A;  2YWN A;  1OKT A;  1A2M A;  1FW1 A;  1O73 A;  1M2D A;  3G7Y A;  3M0F A;  1X5D A;  4MDC A;  4TRX A;  4MH2 A;  1OYJ A;  5ELA A;  3C1S A;  1WMJ A;  3FY7 A;  4GF0 A;  1EEM A;  4GRF A;  1GSY A;  4L5O A;  1PN9 A;  2QKE A;  4F0B A;  2DLX A;  2R6K A;  1HNA A;  2VLU A;  3L9V A;  3C71 A;  3R2Q A;  3MAK A;  3QD9 A;  3GKK A;  17GS A;  5D73 A;  1V40 A;  3D6I A;  4FIW A;  2O87 A;  3UVT A;  1YEP A;  1SD9 A;  4ID0 A;  1SYX A;  1PD2 1;  4WF4 A;  4EKZ A;  4QL9 A;  1V57 A;  3KMO A;  3ZFL A;  3IPZ A;  5J5N A;  2C4J A;  4HI7 A;  3GUS A;  2MMA A;  3CRT A;  1LBK A;  3IK9 A;  2MMN A;  4ISD A;  2CZ2 A;  6GSY A;  1GSQ A;  3FZ9 A;  5IMF A;  2AB6 A;  4WBJ A;  5HR3 A;  2KLX A;  1ON4 A;  2WUL A;  4MJC A;  2TRX A;  5ECK B;  2ZCT A;  2R5G A;  2JL4 A;  4ZL8 A;  3V1W A;  1CQH A;  1ZZY A;  3UJ1 A;  1AAZ A;  1KNG A;  2C0F A;  4HJM A;  2R3X A;  2ON7 A;  4DEJ A;  4HU7 A;  4PGT A;  2YP6 A;  2PUK C;  2ON5 A;  3HJM A;  3N9J A;  1YF1 A;  4TXO B;  2E2M A;  3G7I A;  4POB A;  1RQM A;  1JFU A;  4XS1 A;  1QFN A;  1F3B A;  3J7Y b;  1XXU A;  4N30 A;  2WGR A;  5DBQ A;  3P90 A;  1FOV A;  5IMZ A;  3EMX A;  2GQK A;  4Q5Q A;  1UN2 A;  5IM9 A;  1OVN A;  4KND A;  1ABA A;  2JZT A;  2V6K A;  2FWH A;  1ERV A;  1URM A;  4GWR A;  3KZQ A;  5E59 A;  1EOH A;  3QPM A;  4I5Q A;  1LJR A;  2B7K A;  4NHW A;  2HT9 A;  3QAW A;  1OC9 A;  3QR6 A;  4K9Z A;  5DCG A;  3WGX A;  1FAA A;  1TU8 A;  2PER A;  4ZL7 A;  1F37 A;  2I3Y A;  3ZRE A;  4ACS A;  4JED A;  5ECQ B;  1XWA A;  1J9B A;  2HZF A;  2K18 A;  5ECI B;  2YWM A;  2LRT A;  3DRN A;  1K0M A;  4F82 A;  2WS2 A;  4KSM A;  2HE3 A;  1YY7 A;  2H1A A;  4LA1 A;  3DKS A;  4EL1 A;  4I97 A;  3UBK A;  4TR3 A;  3H1N A;  4MZC A;  3L9S A;  1Q98 A;  3CYN A;  3TKS A;  3GMF A;  2YOI A;  3I69 A;  2NPB A;  1G7E A;  4EUY A;  3IXR A;  1WWJ A;  2GT6 A;  2J23 A;  3QMX A;  4ECB A;  4MJB A;  2REM A;  5ECR B;  2EC4 A;  2P5R A;  3TJB A;  1G0T A;  2G2Q A;  2JAC A;  3HDC A;  2VL2 A;  3HJO A;  1PRX A;  3QDN A;  3BBY A;  1BQ7 A;  1XW6 A;  2CAI A;  5A4U A;  4K6X A;  4POM A;  4HDE A;  1R26 A;  1GRX A;  1ZGN A;  1S3A A;  4PUF C;  1MTC A;  2OE0 A;  3H79 A;  1YKC A;  2EIQ A;  3A2V A;  5H5Q A;  1QMV A;  2I9H A;  2DJK A;  4XHM A;  4L0W A;  2F8A A;  4KAE A;  5B7C A;  5ENU A;  5GAP D;  3QCP A;  4HEA 2;  3HKR A;  5DQS A;  1Z3E A;  4XTS A;  1NW2 A;  5LCZ A;  1XOB A;  4MJA A;  4ZBA A;  2N5F A;  1WRY A;  3HA9 A;  5IOW A;  5INY A;  5CRD A;  2OE1 A;  4RI6 A;  1TW9 A;  3TKS E;  3ZLP A;  1S3C A;  4MAB A;  1TK0 B;  4YQU A;  3GSS A;  1OE7 A;  1AW9 A;  1DE1 A;  3RDW A;  3ZYW A;  1PX7 A;  1EP8 A;  5IMC A;  2RII A;  2FWF A;  4OFT A;  1OC9 B;  1GNE A;  1EV4 A;  3MNG A;  3U5R E;  2OBI A;  2WDU A;  11GS A;  3GHA A;  2DJ1 A;  3KH7 A;  5J4U A;  4JU5 A;  5D93 A;  3IRA A;  4KB3 A;  3GRX A;  2H19 A;  5AIV A;  3J7Y k;  1JZW A;  4AGS A;  2L6C A;  3WT1 A;  2DJ3 A;  2IPA A;  2CX4 A;  5COH A;  4MK3 A;  5G2Z A;  4K1F A;  2VD1 A;  1KEB A;  3VWX A;  1EOG A;  3CTG A;  1XW5 A;  1K3L A;  2WB9 A;  4H86 A;  4O5R A;  1MDJ A;  2LKU A;  3W6G A;  4GXZ A;  4ML6 A;  3KEB A;  5CO3 A;  2O8V B;  3D4T A;  3NZN A;  2P5Q A;  1HQO A;  1OAZ A;  4TXV A;  4YH2 A;  22GS A;  2RM6 A;  1AIU A;  3KCM A;  4GST A;  2WFC A;  3GKN A;  4FYC A;  2FGX A;  4PQI A;  2B7J A;  2IMD A;  2BMX A;  1XVW A;  3FEU A;  4EXJ A;  4FYB A;  1GTA A;  5G1L A;  1XIY A;  3F3R A;  3KP9 A;  4YAP A;  4ZB9 A;  1PQN A;  4HS1 A;  1ML6 A;  4KE3 A;  5B6N A;  2X8C A;  1PSQ A;  4MF6 A;  2VAF A;  3EUR A;  1BJX A;  1XWB A;  2P31 A;  1SD8 A;  4G2E A;  4G10 A;  1K0N A;  5D8I A;  2GT5 A;  3L4N A;  1FVJ A;  4L8E A;  1DSB A;  2B5X A;  1GLP A;  4DSS A;  2GZP A;  2YZH A;  1LU4 A;  2FUG 2;  3P2A A;  2B5Y A;  4TOP A;  1EGO A;  4RI7 A;  3EYT A;  2DJJ A;  3M9K A;  3D4M A;  2DBC A;  1Z5Y E;  1E2Y A;  3PH9 A;  2C0D A;  2B1L A;  2MYG A;  1Z6N A;  2WCI A;  4ZXG A;  1PGT A;  3ZIV A;  1VRS D;  3TOU A;  1K3Y A;  2FWG A;  3BCK A;  5C00 A;  1TOF A;  2HSH A;  3DYR A;  3HZ4 A;  4TKY A;  4V2N A;  3VFI A;  5JWQ B;  1V98 A;  1TRU A;  4EDY A;  5HQP A;  3MSZ A;  2JZR A;  1JHB A;  2VLV A;  2K9F A;  1SYR A;  2CX3 A;  5HR1 A;  2HZE A;  1SJ6 A;  2HRN A;  1SKR B;  5JWR B;  1GSU A;  4YQM A;  5DJL A;  3RPN A;  3RHC A;  1R7H A;  1EEJ A;  1YDK A;  4NMU A;  4L5L A;  2H8L A;  5J41 A;  1K3O A;  5IPG A;  3GX0 A;  4N0V A;  4F0C A;  2H1G A;  3NIV A;  2YWO A;  5J9B A;  3VLN A;  3ZRD A;  5E4W A;  6GSW A;  3KXO A;  3F0I A;  1ZMA A;  4MP4 A;  1AXD A;  1QUW A;  5JCG A;  2FHE A;  1O85 A;  2AV4 A;  3ME7 A;  1SEN A;  3ISO A;  2XBQ A;  3VUR A;  4LL1 B;  1PKZ A;  1ZYE A;  3KH9 A;  2HRF A;  1T00 A;  4EO3 A;  4JR4 A;  4EE0 A;  3N5O A;  3GYK A;  3WYW A;  1J0F A;  5GSS A;  3E3E A;  3A2W A;  3EMP A;  4PQH A;  1A0R P;  5DDL A;  4DSQ A;  5DJM A;  5ECN B;  4ECI A;  5IOX A;  5H5S A;  2F8F A;  3LQ7 A;  2AYT A;  3FHK A;  2QC7 A;  3TB2 A;  5A4W A;  5ABR A;  3ERF A;  2E7P A;  4G9H A;  3UIW A;  3KIJ A;  3CSJ A;  1ST9 A;  1WE0 A;  2DIZ A;  5D9X A;  5LNK e;  1G7O A;  4XS4 A;  3HZ8 A;  3Q74 A;  4OO4 A;  2GZY A;  2VO4 A;  2XC2 A;  5B6M A;  5JWO B;  3I6A A;  1VGL A;  4TR0 A;  5IMD A;  3EVI A;  5KEJ A;  1WP0 A;  3HY2 A;  4PXO A;  2DMM A;  2LNT A;  1YEX A;  1M9B A;  5D9V A;  1PA3 A;  4Q5R A;  4E8E A;  3EU3 A;  2OAC A;  4I2U A;  4V1A g;  2V1M A;  1AC1 A;  3SBC A;  1JZO A;  5HR2 A;  2LST A;  5L71 A;  2VUP A;  5HR0 A;  1DE2 A;  1GUL A;  2IJY A;  3LSZ A;  5IO0 A;  5ID2 A;  3APQ A;  3IAM 2;  2HZE B;  3UAP A;  3CBU A;  2CA8 A;  1NHY A;  1SL0 B;  1A2J A;  2MBS A;  3C1R A;  2YJH A;  2WJU A;  2H01 A;  4BPY A;  4HZ4 A;  2M72 A;  4PNF A;  2GGT A;  2RUF A;  3LWA A;  5IMV A;  2C1Y A;  4PQ1 A;  3RBT A;  1WJK A;  3FZ5 A;  2IMF A;  3WT2 A;  3IK7 A;  2MZC A;  5FHI A;  1MEK A;  2VCZ A;  1EGR A;  3TRX A;  3IA1 A;  3EIN A;  2L4Q A;  3TUE A;  4FYU A;  4F03 A;  3LXT A;  1GP1 A;  4Q5F A;  4ZBD A;  2C3T A;  2FY6 A;  3ED3 A;  1GWC A;  3FZ4 A;  4O32 A;  4ZBB A;  3O3T A;  1Z6M A;  4EDZ A;  3CTF A;  4MJE A;  1TRS A;  2GSS A;  2OJL A;  4MMM A;  4O7H A;  1XWC A;  1MD4 A;  1H75 A;  2WRT A;  2QSI A;  4IQA A;  2B5E A;  3QAV A;  3F63 A;  3F3Q A;  4GLT A;  4WR5 A;  2EIR A;  3DD3 A;  4GQC A;  4WEY A;  1ERW A;  3W8S A;  5G1K A;  3I43 A;  3TRQ A;  3LGC A;  3APS A;  2CVK A;  2YV9 A;  1W4V A;  2AHE A;  4XS4 B;  3U6V A;  1WIK A;  2X64 A;  2A2R A;  2GS3 A;  3IAS 2;  2DIY A;  3Q6O A;  4K0N A;  2LV3 A;  4Q5N A;  5B8B A;  3L9U A;  1U88 A;  2VCQ A;  5JCU A;  3DEX A;  4WR4 A;  3LYK A;  1CQG A;  1YF0 A;  4RUV A;  2PMT A;  2C3Q A;  6GSX A;  4YQV A;  1VF1 A;  3ME8 A;  1J08 A;  1SK1 A;  3APO A;  4POL A;  1GTB A;  1K0D A;  1ZYQ B;  1V2A A;  4ZB6 A;  2LTK A;  3HYP A;  5KN1 A;  3G7J A;  1Z9H A;  3F6F A;  2H75 A;  5DQY A;  3G9B A;  4KCE A;  2XHF A;  3HVS A;  1B8X A;  3CRU A;  3PGT A;  1AQX A;  2PU9 C;  4Z7X A;  1Q4J A;  1HNC A;  2LJR A;  2YV7 A;  1X9S B;  1RW1 A;  5G5E A;  3KD0 A;  4HOJ A;  3GFK A;  4QQ7 A;  1TRW A;  3GKX A;  5F8B A;  2JU5 A;  1B4Q A;  3LOR A;  2GST A;  1VF2 A;  5DAL A;  3KP8 A;  3ZIT A;  4J57 E;  2VOC A;  1ACV A;  1YJ6 A;  12GS A;  4K2D A;  2GTU A;  4ZB8 A;  3AY8 A;  3VK9 A;  3DWV A;  1F6M C;  2C0E A;  3WGD A;  3QFB C;  4KUN A;  3GV1 A;  3UAR A;  2IFQ A;  1FB0 A;  1R4W A;  4HQS A;  1SJZ A;  8GSS A;  5CNW A;  5H5R A;  4TW5 A;  4RQX A;  2OAD A;  1OKD A;  2K8S A;  2CV4 A;  4NWY A;  4GCI A;  2N5B A;  2NVL A;  4EF0 A;  7GSS A;  1K0A A;  6GSU A;  4X1U A;  2KOK A;  3F4T A;  9GSS A;  4IN0 A;  1X9M B;  3HVV A;  2XPE A;  1NHO A;  3W8J A;  3QOU A;  1NM3 A;  4XS6 A;  1TK5 B;  3GIX A;  4JZQ A;  2MMZ A;  3US3 A;  1T1V A;  3LG6 A;  18GS A;  1UA5 A;  4KDU A;  4N0Z A;  4NAX A;  1A8L A;  2H6Y A;  4OMV A;  1E6B A;  5EPF A;  5AN1 A;  4D73 A;  4WET A;  3ZZX A;  4MCU A;  4J2F A;  4NV2 A;  1T7P B;  3VI5 A;  1NSW A;  1OC3 A;  4K0G A;  1GL8 A;  5ECL B;  5IPH A;  4RQR A;  5AIX A;  2DML A;  3TKS C;  3DVW A;  3FKF A;  2VCW A;  4TVE A;  3TJK A;  2XPD A;  4IP6 A;  2LJA A;  5D9T A;  2BTO T;  2EIO A;  2L5L A; 
#chains in the Genus database with same CATH topology
 4JRR A;  1JZD A;  2DC5 A;  2R37 A;  5D96 A;  1GH2 A;  2VLT A;  3ZML A;  1QXH A;  1XWK A;  2VL2 C;  4IW9 A;  1M2B A;  2GZZ A;  2H74 A;  1MD3 A;  1ZOF A;  3FZA A;  3CSI A;  4MLY A;  2UZ8 A;  1JLW A;  1K0O A;  3MWH A;  3KJY A;  1O8W A;  1OE8 A;  2HI7 A;  3TCO A;  4K8M A;  5JCW A;  2HFD A;  5G30 A;  1GUK A;  14GS A;  1M3I A;  2R2J A;  4IVF A;  2GVP A;  2V32 A;  3H4K A;  2LQO A;  1RK4 A;  4V1A p;  2JZS A;  2H6X A;  4WF5 A;  3IE3 A;  2OA7 A;  1TU7 A;  4GSS A;  3P7X A;  3ZTL A;  4OD7 A;  1X5C A;  1GTI A;  3D5J A;  1TK8 B;  4MNN A;  2OE3 A;  3F4S A;  4J56 E;  1BAY A;  3IBH A;  5EL8 A;  3ZIJ A;  2VM2 A;  4IEL A;  1Z7R A;  2H66 A;  1THO A;  3DML A;  3E9J B;  4E8H A;  2FCH A;  1EP7 A;  5DVB A;  2GSQ A;  3UVH A;  5ECS A;  2DJ0 A;  1Z7P A;  2I4A A;  2X8G A;  1AQV A;  5HFG A;  2AUV A;  2O7K A;  5CRH A;  5J9C A;  2YAN A;  5BRT A;  4OWY A;  5A4V A;  1B9Y C;  2B6M A;  3FR3 A;  3PIN A;  2KHP A;  1PL2 A;  4ZL9 A;  1B4P A;  3GKM A;  2I81 A;  4WBR D;  5F07 A;  4D73 B;  3GL3 A;  3DIE A;  1EWX A;  5IO2 A;  2NDO A;  5IMA A;  1T4Y A;  4OFM A;  2IME A;  4WXT A;  3RPP A;  3F9U A;  4F9Z A;  3TDG A;  4X0X A;  1YQ1 A;  1O8X A;  1XOA A;  3ERG A;  1AQW A;  3HCZ A;  4HQZ A;  2NTO A;  5ECP B;  1U6T A;  2VL3 A;  3LXZ A;  3EPT A;  4IS0 A;  4TXO A;  2BJX A;  4GTU A;  3UOM A;  2QGV A;  1FHE A;  3ZMK A;  1FVK A;  3H93 A;  4ZIJ A;  2PBJ A;  3BCI A;  4K7I A;  2VM1 A;  2LJK A;  5FWG A;  1B48 A;  1XFL A;  1SJI A;  3FR9 A;  4MZW A;  4MZB A;  5F0G A;  1SL2 B;  1JLV A;  5CP1 A;  2CT6 A;  1PMT A;  1GNW A;  1GTU A;  1WOU A;  3D0Z A;  4HJ2 A;  2YZU A;  3IDV A;  4HZ2 A;  4BWQ A;  1IYH A;  3D21 A;  2ALB A;  3PR8 A;  1JZR A;  1K0C A;  3OR5 A;  3GTU A;  3O6T A;  4O5U A;  3IR4 A;  2B1K A;  2VL9 A;  4DSS B;  4KX4 A;  2H71 A;  2V41 A;  3LEF A;  2NBS A;  3VWU A;  1BED A;  1N8J A;  1U87 A;  4WKW A;  4JE1 A;  2H0H A;  1MDK A;  1QK8 A;  2KP1 A;  2FA4 A;  4AJ7 A;  5EY6 A;  2MBT A;  4TR1 A;  3UL3 A;  4DVC A;  3KTL A;  2IN3 A;  1W89 A;  1M0U A;  2L5O A;  13GS A;  2LUS A;  1EV9 A;  1SK0 A;  4KA0 A;  2OKA A;  5A5K A;  4NXI A;  4YAV A;  2HRA A;  2JSY A;  3GX8 A;  3WGE A;  4F2I A;  3GN3 A;  3ERW A;  5GST A;  1C72 A;  3IC4 A;  1VF3 A;  3KM6 A;  1UVZ A;  1TKD B;  3IOS A;  3TKP A;  3FMW A;  4V2L A;  4CW9 A;  3L78 A;  4FH8 A;  4OCE A;  4BWS A;  3C73 A;  1XWG A;  3A5I A;  3HVX A;  1SKW B;  1O81 A;  3E0U A;  1Y25 A;  2OBK A;  3KGK A;  4EVM A;  4FO5 A;  1F3A A;  3F6D A;  3TJG A;  1UC7 A;  2IMI A;  1ZCP A;  1T3B A;  1HNB A;  4NPB A;  3SWL A;  3UBL A;  2I1U A;  1PKW A;  3IV4 A;  3UEM A;  4IP1 A;  1OC8 A;  1G6Y A;  5CAX A;  1XZO A;  1XVQ A;  1USB A;  2X8H A;  4NV5 A;  3S9F A;  1TI1 A;  2CVB A;  1WPI A;  4MA9 A;  6GSV A;  3FYG A;  2L4C A;  2L59 A;  2TRC P;  2ZNM A;  4IQ1 A;  2V6O A;  2H30 A;  3QFA C;  2AJQ B;  4N11 A;  1SU9 A;  1EZK A;  2YNX A;  2A2P A;  5DCH A;  1I5G A;  3Q18 A;  4KSO A;  3EC3 A;  2LRC A;  3GTU B;  2F51 A;  2YPM A;  1A0F A;  1MDI A;  2PWJ A;  2HSY A;  4I8B A;  2R0P A;  5B8A A;  2H72 A;  3ZVJ A;  4ZIL A;  4K5S A;  2PPT A;  4MPF A;  4ULX A;  4O5Q A;  4IJ3 A;  3EWL A;  4XRA A;  3M9J A;  2O89 A;  4TR1 B;  1X5E A;  2TIR A;  4ML1 A;  3GNJ A;  3C8E A;  2JAD A;  2IIY A;  2M46 A;  2X49 A;  5F06 A;  5ECH B;  4PUA A;  3BD2 A;  1FO5 A;  2LRN A;  5HFI A;  5DAK A;  2VIM A;  2CZ3 A;  2AAW A;  1YKA A;  1XBS A;  2CAQ A;  1A23 A;  5ID2 B;  2WZ9 A;  3ZFB A;  4XCS A;  4MF5 A;  3PPU A;  4K7O A;  3GL5 A;  2R0C A;  2VCX A;  2HLS A;  4OO5 A;  1A2L A;  2JSZ A;  1N2A A;  1A24 A;  1TI3 A;  1TTZ A;  4K7N A;  4ILF A;  6GSS A;  2HRK A;  5GAN D;  3O76 A;  4O92 A;  2QA2 A;  3M3M A;  2FLS A;  2IWT A;  3KMN A;  2H0I A;  3GH6 A;  3LW9 A;  4PNG A;  1PX6 A;  1X9W B;  3VPT A;  2H73 A;  2VD0 A;  3HHV A;  3K8N A;  20GS A;  4BVY A;  4DSR A;  3Q19 A;  2M80 A;  3GH9 A;  2FWE A;  4L0U A;  2L6D A;  3QAG A;  1M7T A;  4PX1 A;  4MF7 A;  1THX A;  3TGZ A;  3HXS A;  4HU9 A;  3HJP A;  2H1B A;  1M2A A;  3DVX A;  3GST A;  1VF4 A;  4PUR A;  5CRG A;  5EVO A;  3M8N A;  3NOF A;  4GSN A;  2H6Z A;  1PL1 A;  3KTB A;  4JBB A;  2C8U A;  3LYP A;  4AJ6 A;  5ECM B;  4AJ8 A;  4IBP A;  1TP9 A;  4AF2 A;  4I6X A;  4KH7 A;  1FB6 A;  1SK2 A;  4G0K A;  3BJ5 A;  4ECC A;  5IIZ A;  3VWV A;  1V9W A;  3LJR A;  4ECJ A;  1M99 A;  3HD5 A;  1R5A A;  2D2Z A;  1X0R A;  4KW6 A;  1R5P A;  3LFL A;  4X43 A;  5KN2 A;  4TN8 A;  2LEG A;  4IJI A;  1GSE A;  4I2T A;  5D9W A;  2MMO A;  1U3A A;  5ECO B;  6GST A;  3UMA A;  2GQM A;  2CQ9 A;  3A5W A;  2Z9S A;  4BA7 A;  1Y6E A;  4IKH A;  2KP2 A;  2QA1 A;  2GQL A;  1DBY A;  2C0G A;  2H1D A;  2O85 A;  5LD0 A;  5DAK B;  5KN0 A;  1KTE A;  3MDK A;  2X99 A;  2HSM A;  3FRC A;  2V2G A;  3ZVJ D;  4BL7 A;  2HYX A;  2IMK A;  5G31 A;  5CYY A;  1GSD A;  4EC0 A;  2A2S A;  2ZUP A;  5AGY A;  2PVQ A;  3VPQ A;  1H4O A;  2LS5 A;  4N10 A;  1GLQ A;  1I9D A;  2GDR A;  4LMW A;  2KUC A;  5DAL B;  4TR4 A;  5J3R A;  1O6J A;  3TOT A;  3P8W A;  2RLI A;  4XRD A;  2E0Q A;  3A3T A;  1HYU A;  2R0G A;  2ES7 A;  2FA8 A;  1ZL9 A;  5AIS A;  1DUG A;  3RHB A;  5CRW A;  1S3D A;  4OCF A;  1SL1 B;  1XPV A;  2DSA A;  5C04 A;  1M3J A;  3CMI A;  3TJJ A;  5FT3 A;  2B3S A;  3CSH A;  2YCD A;  1G6W A;  2VCV A;  3TJF A;  4CDO A;  2HNL A;  4IHU A;  3D22 A;  2VCT A;  4XIH A;  2LNS A;  16GS A;  2H0G A;  2YWI A;  4CHS A;  4HUA A;  2IFQ B;  1FG4 A;  1AUC A;  4LLR A;  3L0H A;  4P3Y B;  3I9V 2;  4PTS A;  1TDI A;  1F9M A;  2C3N A;  3TKQ A;  1XCC A;  3EE2 A;  3M1G A;  2J9H A;  2LQQ A;  3C7M A;  4POK A;  1YZX A;  1B9X C;  3VI7 A;  2C80 A;  2YJ7 A;  3TRP A;  3GUR A;  3RAZ A;  1T8E B;  1SKS B;  2H70 A;  2P0G A;  2XBI A;  1M9A A;  3F8U A;  2PVO C;  4OFN A;  1ERT A;  2PGT A;  3ZL5 A;  3FR6 A;  2N5A A;  2H76 A;  2RUE A;  2PN8 A;  3IHQ A;  2CVD A;  1TXX A;  1GUM A;  1QGV A;  3DGQ A;  3H8Q A;  2R4V A;  4G19 A;  2A4V A;  4QL7 A;  1GSS A;  2K6V A;  5F05 A;  4GQF A;  4MPG A;  3JCM L;  4IGJ A;  4MH3 A;  2L57 A;  4KDX A;  5KN3 A;  1TJD A;  4NHZ A;  5CRE A;  2FD3 A;  1F2E A;  2YN1 A;  1KBN A;  2GSR A;  19GS A;  4LL4 B;  3CXG A;  4LMV A;  1ILO A;  1V58 A;  1T4Z A;  5ELG A;  3TKR A;  4KDY A;  5HFK A;  1XW9 A;  5BMU A;  1HD2 A;  2G0F A;  3BOA A;  10GS A;  4BVX A;  1BYE A;  1BX9 A;  2K8V A;  1K0B A;  1GSF A;  3F4R A;  3GA4 A;  1QQ2 A;  2RM5 A;  2F3M A;  3FK8 A;  5G5F A;  3VWW A;  3WD6 A;  3IC8 A;  1TRV A;  2DJ2 A;  1A8Y A;  4KGI A;  3A2X A;  4V2M A;  2FNO A;  1O7U A;  4G0I A;  2F9S A;  3FW2 A;  5GZZ B;  4JR6 A;  5IQY A;  1GUH A;  1ZYN A;  2GLR A;  3EU4 A;  3DXB A;  4KCA A;  1ERU A;  1BG5 A;  3MYD A;  2E2G A;  2HXK A;  1U3I A;  2IL3 A;  1IYI A;  2YWN A;  3MIX A;  1OKT A;  1A2M A;  1FW1 A;  1O73 A;  1M2D A;  3G7Y A;  3M0F A;  1X5D A;  4MDC A;  4TRX A;  4MH2 A;  1OYJ A;  5ELA A;  3C1S A;  1WMJ A;  3FY7 A;  4GF0 A;  1EEM A;  4GRF A;  1GSY A;  4L5O A;  1PN9 A;  2QKE A;  4F0B A;  2DLX A;  2R6K A;  1HNA A;  2VLU A;  3L9V A;  3C71 A;  3R2Q A;  3MAK A;  3QD9 A;  3GKK A;  17GS A;  5D73 A;  1V40 A;  3D6I A;  4FIW A;  2O87 A;  3UVT A;  1YEP A;  1SD9 A;  4ID0 A;  1SYX A;  1PD2 1;  4Z2U A;  4WF4 A;  4EKZ A;  4QL9 A;  1V57 A;  3KMO A;  3ZFL A;  3IPZ A;  5J5N A;  2C4J A;  4HI7 A;  3GUS A;  2MMA A;  3CRT A;  4HSC X;  1LBK A;  3IK9 A;  2MMN A;  4ISD A;  2CZ2 A;  6GSY A;  1GSQ A;  3FZ9 A;  5IMF A;  2AB6 A;  4WBJ A;  5HR3 A;  2KLX A;  4X4J A;  1ON4 A;  2WUL A;  4MJC A;  2TRX A;  5ECK B;  2ZCT A;  2R5G A;  2JL4 A;  4ZL8 A;  3V1W A;  1CQH A;  1ZZY A;  3UJ1 A;  1AAZ A;  1KNG A;  2C0F A;  4HJM A;  2R3X A;  2ON7 A;  4DEJ A;  4HU7 A;  4PGT A;  2YP6 A;  2PUK C;  2ON5 A;  3HJM A;  3N9J A;  1YF1 A;  4TXO B;  2E2M A;  3G7I A;  4POB A;  1RQM A;  1JFU A;  4XS1 A;  1QFN A;  1F3B A;  3J7Y b;  1XXU A;  4N30 A;  2WGR A;  5DBQ A;  4BVX B;  3P90 A;  1FOV A;  5IMZ A;  3EMX A;  2GQK A;  4Q5Q A;  1UN2 A;  5IM9 A;  1OVN A;  4KND A;  1ABA A;  2JZT A;  2V6K A;  2FWH A;  1ERV A;  1URM A;  4GWR A;  3KZQ A;  5E59 A;  1EOH A;  3QPM A;  4I5Q A;  1LJR A;  2B7K A;  4NHW A;  2HT9 A;  3QAW A;  1OC9 A;  3QR6 A;  4K9Z A;  5DCG A;  3WGX A;  1FAA A;  1TU8 A;  2PER A;  4ZL7 A;  1F37 A;  2I3Y A;  3ZRE A;  4ACS A;  4JED A;  5ECQ B;  1XWA A;  1J9B A;  2HZF A;  2K18 A;  5ECI B;  2YWM A;  2LRT A;  3DRN A;  1K0M A;  4F82 A;  2WS2 A;  4KSM A;  2HE3 A;  1YY7 A;  2H1A A;  4LA1 A;  3DKS A;  4EL1 A;  4I97 A;  3UBK A;  4TR3 A;  3H1N A;  4MZC A;  3L9S A;  1Q98 A;  3CYN A;  3TKS A;  3GMF A;  2YOI A;  3I69 A;  2NPB A;  1G7E A;  4EUY A;  3IXR A;  1WWJ A;  2GT6 A;  2J23 A;  3QMX A;  4ECB A;  4MJB A;  2REM A;  2A4H A;  5ECR B;  2EC4 A;  2P5R A;  3TJB A;  1G0T A;  4YKF A;  2G2Q A;  2JAC A;  3HDC A;  2VL2 A;  3HJO A;  1PRX A;  3QDN A;  4KF9 A;  3BBY A;  1BQ7 A;  1XW6 A;  2CAI A;  5A4U A;  4K6X A;  4POM A;  4HDE A;  1R26 A;  1GRX A;  1ZGN A;  1S3A A;  4PUF C;  1MTC A;  2OE0 A;  3H79 A;  1YKC A;  2EIQ A;  3A2V A;  5H5Q A;  1QMV A;  2I9H A;  2DJK A;  4XHM A;  4L0W A;  2F8A A;  4KAE A;  5B7C A;  5ENU A;  5GAP D;  3QCP A;  4HEA 2;  3HKR A;  5DQS A;  1Z3E A;  4XTS A;  1NW2 A;  4YKG A;  5LCZ A;  1XOB A;  4MJA A;  4ZBA A;  2N5F A;  1WRY A;  3HA9 A;  5IOW A;  5INY A;  5CRD A;  2OE1 A;  4K5R A;  4RI6 A;  1TW9 A;  3TKS E;  3ZLP A;  1S3C A;  4MAB A;  1TK0 B;  4YQU A;  3GSS A;  1OE7 A;  1AW9 A;  4G0L A;  1DE1 A;  3RDW A;  3ZYW A;  1PX7 A;  1EP8 A;  5IMC A;  2RII A;  2FWF A;  4OFT A;  1OC9 B;  1GNE A;  1EV4 A;  3MNG A;  3U5R E;  2OBI A;  2WDU A;  11GS A;  3GHA A;  2DJ1 A;  3KH7 A;  5J4U A;  4JU5 A;  5D93 A;  3IRA A;  4KB3 A;  3GRX A;  2H19 A;  5AIV A;  3J7Y k;  1JZW A;  4AGS A;  2L6C A;  3WT1 A;  2DJ3 A;  2IPA A;  2CX4 A;  5COH A;  4MK3 A;  5G2Z A;  4K1F A;  2VD1 A;  1KEB A;  3VWX A;  1PFO A;  1EOG A;  3CTG A;  1XW5 A;  1K3L A;  2WB9 A;  4H86 A;  4O5R A;  1MDJ A;  2LKU A;  3W6G A;  4GXZ A;  4ML6 A;  3KEB A;  5CO3 A;  2O8V B;  3D4T A;  3NZN A;  5KOX A;  2P5Q A;  1HQO A;  1OAZ A;  4TXV A;  4YH2 A;  1S3R A;  22GS A;  2RM6 A;  1AIU A;  3KCM A;  4GST A;  2WFC A;  3GKN A;  4FYC A;  2FGX A;  4PQI A;  2B7J A;  2IMD A;  2BMX A;  1XVW A;  3FEU A;  4EXJ A;  4FYB A;  1GTA A;  5G1L A;  1XIY A;  3F3R A;  3KP9 A;  4YAP A;  4ZB9 A;  1PQN A;  4HS1 A;  1ML6 A;  5B6N A;  4KE3 A;  2X8C A;  1PSQ A;  4MF6 A;  2VAF A;  3EUR A;  1BJX A;  4A5P A;  1XWB A;  2P31 A;  1SD8 A;  4G2E A;  5KOW A;  4G10 A;  1K0N A;  2GT5 A;  5D8I A;  3L4N A;  1FVJ A;  4BVY B;  4L8E A;  1DSB A;  2B5X A;  1GLP A;  4DSS A;  2GZP A;  2YZH A;  1LU4 A;  2FUG 2;  3P2A A;  2B5Y A;  4TOP A;  1EGO A;  4RI7 A;  3R3E A;  3EYT A;  2DJJ A;  3M9K A;  3D4M A;  2DBC A;  1Z5Y E;  1E2Y A;  3PH9 A;  2C0D A;  2B1L A;  2MYG A;  1Z6N A;  2WCI A;  4ZXG A;  1PGT A;  3ZIV A;  1VRS D;  3TOU A;  1K3Y A;  2FWG A;  3BCK A;  5C00 A;  1TOF A;  2HSH A;  3DYR A;  3HZ4 A;  4TKY A;  4V2N A;  3VFI A;  5JWQ B;  1V98 A;  1TRU A;  4EDY A;  4BIK A;  5HQP A;  3MSZ A;  2JZR A;  1JHB A;  2VLV A;  2K9F A;  1SYR A;  2CX3 A;  2X4A A;  5HR1 A;  2HZE A;  1SJ6 A;  2HRN A;  1SKR B;  5JWR B;  1GSU A;  4YQM A;  5DJL A;  3RPN A;  3RHC A;  1R7H A;  1EEJ A;  1YDK A;  4NMU A;  4L5L A;  2H8L A;  5J41 A;  1K3O A;  5IPG A;  3GX0 A;  4N0V A;  4F0C A;  2H1G A;  3NIV A;  2YWO A;  5J9B A;  3VLN A;  3ZRD A;  5E4W A;  6GSW A;  3KXO A;  3F0I A;  1ZMA A;  4MP4 A;  1AXD A;  1QUW A;  5JCG A;  2FHE A;  1O85 A;  2AV4 A;  3ME7 A;  1SEN A;  3ISO A;  4BL7 B;  2XBQ A;  3VUR A;  4LL1 B;  1PKZ A;  1ZYE A;  3KH9 A;  2HRF A;  1T00 A;  4EO3 A;  4JR4 A;  4EE0 A;  3N5O A;  4CY6 A;  3GYK A;  3WYW A;  1J0F A;  5GSS A;  3E3E A;  3A2W A;  3EMP A;  4PQH A;  1A0R P;  5DDL A;  4DSQ A;  5DJM A;  5ECN B;  4ECI A;  5IOX A;  5H5S A;  2F8F A;  3LQ7 A;  2AYT A;  2DKI A;  1ZYP A;  3FHK A;  1XG8 A;  2QC7 A;  3TB2 A;  5A4W A;  5ABR A;  3ERF A;  2E7P A;  4Z2R A;  4G9H A;  3UIW A;  3KIJ A;  3CSJ A;  1ST9 A;  3IHG A;  1WE0 A;  2DIZ A;  5D9X A;  5LNK e;  1G7O A;  4XS4 A;  3HZ8 A;  3Q74 A;  3HVN A;  4OO4 A;  2GZY A;  2VO4 A;  2XC2 A;  5B6M A;  5JWO B;  3I6A A;  1VGL A;  4TR0 A;  5IMD A;  3EVI A;  1FOH A;  5KEJ A;  1WP0 A;  3HY2 A;  4PXO A;  2DMM A;  2LNT A;  1YEX A;  1M9B A;  5D9V A;  1PA3 A;  4Q5R A;  4E8E A;  3EU3 A;  2OAC A;  4I2U A;  4V1A g;  2V1M A;  1AC1 A;  3SBC A;  1JZO A;  5HR2 A;  2LST A;  5L71 A;  2VUP A;  5HR0 A;  1DE2 A;  4ICY A;  1GUL A;  2IJY A;  3LSZ A;  5IO0 A;  5ID2 A;  3APQ A;  3IAM 2;  2HZE B;  3UAP A;  3CBU A;  2CA8 A;  1NHY A;  1SL0 B;  4Z2T A;  1A2J A;  2MBS A;  3C1R A;  2YJH A;  2WJU A;  2H01 A;  4BPY A;  4HZ4 A;  2M72 A;  4PNF A;  2GGT A;  2RUF A;  3LWA A;  5IMV A;  2C1Y A;  4PQ1 A;  3RBT A;  1WJK A;  3FZ5 A;  2IMF A;  4EIP A;  3WT2 A;  3IK7 A;  2MZC A;  5FHI A;  1MEK A;  2VCZ A;  1EGR A;  3TRX A;  3IA1 A;  3EIN A;  2L4Q A;  3TUE A;  4FYU A;  4F03 A;  3LXT A;  1GP1 A;  4Q5F A;  4ZBD A;  2C3T A;  2FY6 A;  3ED3 A;  1GWC A;  3FZ4 A;  4O32 A;  4ZBB A;  3O3T A;  1Z6M A;  4EDZ A;  3CTF A;  4MJE A;  1TRS A;  2GSS A;  2OJL A;  4MMM A;  4O7H A;  1XWC A;  1MD4 A;  1H75 A;  2WRT A;  2QSI A;  4IQA A;  2B5E A;  3QAV A;  3F63 A;  3F3Q A;  4GLT A;  4WR5 A;  2EIR A;  3DD3 A;  4GQC A;  4WEY A;  1ERW A;  4K2X A;  3W8S A;  5G1K A;  3I43 A;  3TRQ A;  3LGC A;  3APS A;  2CVK A;  2YV9 A;  1W4V A;  2AHE A;  4XS4 B;  3U6V A;  1WIK A;  2X64 A;  2A2R A;  2GS3 A;  3IAS 2;  2DIY A;  3Q6O A;  4K0N A;  2LV3 A;  4Q5N A;  5B8B A;  3L9U A;  1U88 A;  2VCQ A;  5JCU A;  3DEX A;  4WR4 A;  3LYK A;  1CQG A;  4CY8 A;  1YF0 A;  4RUV A;  3CQF A;  2PMT A;  2C3Q A;  6GSX A;  4YQV A;  1VF1 A;  3ME8 A;  1J08 A;  1SK1 A;  3APO A;  4POL A;  1GTB A;  1K0D A;  1ZYQ B;  1V2A A;  4ZB6 A;  2LTK A;  3HYP A;  1PN0 A;  5KN1 A;  3G7J A;  1Z9H A;  3F6F A;  2H75 A;  5DQY A;  3G9B A;  4KCE A;  2XHF A;  3HVS A;  1B8X A;  3CRU A;  3PGT A;  1AQX A;  2PU9 C;  4Z7X A;  1Q4J A;  1HNC A;  2LJR A;  2YV7 A;  1X9S B;  1RW1 A;  5G5E A;  3KD0 A;  4HOJ A;  3GFK A;  4QQ7 A;  1TRW A;  3GKX A;  5F8B A;  2JU5 A;  1B4Q A;  3LOR A;  2GST A;  1VF2 A;  2DKH A;  5DAL A;  3KP8 A;  3ZIT A;  4J57 E;  2VOC A;  1ACV A;  1YJ6 A;  4FQU A;  12GS A;  4K2D A;  2GTU A;  4ZB8 A;  3AY8 A;  3VK9 A;  3DWV A;  1F6M C;  2C0E A;  3WGD A;  3QFB C;  4KUN A;  3GV1 A;  3UAR A;  2IFQ A;  1FB0 A;  1R4W A;  4HQS A;  1SJZ A;  8GSS A;  5CNW A;  5H5R A;  4TW5 A;  4RQX A;  2OAD A;  1OKD A;  2K8S A;  2CV4 A;  4NWY A;  4GCI A;  2N5B A;  4EIQ A;  2NVL A;  4EF0 A;  7GSS A;  1K0A A;  6GSU A;  4X1U A;  2KOK A;  3F4T A;  9GSS A;  4IN0 A;  1X9M B;  3HVV A;  2XPE A;  1NHO A;  3W8J A;  3QOU A;  1NM3 A;  4XS6 A;  1TK5 B;  3GIX A;  4JZQ A;  2MMZ A;  3US3 A;  1T1V A;  3LG6 A;  18GS A;  1UA5 A;  4KDU A;  4N0Z A;  4NAX A;  1A8L A;  2H6Y A;  4OMV A;  1E6B A;  5EPF A;  5AN1 A;  4D73 A;  4WET A;  4USS A;  3ZZX A;  4MCU A;  4J2F A;  4NV2 A;  1T7P B;  3VI5 A;  1NSW A;  1OC3 A;  4K0G A;  1GL8 A;  5ECL B;  5IPH A;  4RQR A;  5AIX A;  2DML A;  3TKS C;  3DVW A;  3FKF A;  2VCW A;  4TVE A;  3TJK A;  2XPD A;  4IP6 A;  2LJA A;  5D9T A;  2BTO T;  2EIO A;  2L5L A; 
#chains in the Genus database with same CATH homology
 4JRR A;  1JZD A;  2DC5 A;  2R37 A;  5D96 A;  1GH2 A;  2VLT A;  3ZML A;  1QXH A;  1XWK A;  2VL2 C;  4IW9 A;  1M2B A;  2GZZ A;  2H74 A;  1MD3 A;  1ZOF A;  3FZA A;  3CSI A;  4MLY A;  2UZ8 A;  1JLW A;  1K0O A;  3MWH A;  3KJY A;  1O8W A;  1OE8 A;  2HI7 A;  3TCO A;  4K8M A;  5JCW A;  2HFD A;  5G30 A;  1GUK A;  14GS A;  2R2J A;  4IVF A;  2GVP A;  2V32 A;  3H4K A;  2LQO A;  1RK4 A;  4V1A p;  2JZS A;  2H6X A;  4WF5 A;  3IE3 A;  2OA7 A;  1TU7 A;  4GSS A;  3P7X A;  3ZTL A;  4OD7 A;  1X5C A;  1GTI A;  3D5J A;  1TK8 B;  4MNN A;  2OE3 A;  3F4S A;  4J56 E;  1BAY A;  3IBH A;  5EL8 A;  3ZIJ A;  2VM2 A;  4IEL A;  1Z7R A;  2H66 A;  1THO A;  3DML A;  3E9J B;  4E8H A;  2FCH A;  1EP7 A;  5DVB A;  2GSQ A;  3UVH A;  5ECS A;  2DJ0 A;  1Z7P A;  2I4A A;  2X8G A;  1AQV A;  5HFG A;  2AUV A;  2O7K A;  5CRH A;  5J9C A;  2YAN A;  5BRT A;  4OWY A;  5A4V A;  1B9Y C;  2B6M A;  3FR3 A;  3PIN A;  2KHP A;  1PL2 A;  4ZL9 A;  1B4P A;  3GKM A;  2I81 A;  4WBR D;  5F07 A;  4D73 B;  3GL3 A;  3DIE A;  1EWX A;  5IO2 A;  2NDO A;  5IMA A;  1T4Y A;  4OFM A;  2IME A;  4WXT A;  3RPP A;  3F9U A;  4F9Z A;  3TDG A;  4X0X A;  1YQ1 A;  1O8X A;  1XOA A;  3ERG A;  1AQW A;  3HCZ A;  4HQZ A;  2NTO A;  5ECP B;  1U6T A;  2VL3 A;  3LXZ A;  3EPT A;  4IS0 A;  4TXO A;  2BJX A;  4GTU A;  3UOM A;  2QGV A;  1FHE A;  3ZMK A;  1FVK A;  3H93 A;  4ZIJ A;  2PBJ A;  3BCI A;  4K7I A;  2VM1 A;  2LJK A;  5FWG A;  1B48 A;  1XFL A;  1SJI A;  3FR9 A;  4MZW A;  4MZB A;  5F0G A;  1SL2 B;  1JLV A;  5CP1 A;  2CT6 A;  1PMT A;  1GNW A;  1GTU A;  1WOU A;  3D0Z A;  4HJ2 A;  2YZU A;  3IDV A;  4HZ2 A;  4BWQ A;  1IYH A;  3D21 A;  2ALB A;  3PR8 A;  1JZR A;  1K0C A;  3OR5 A;  3GTU A;  3O6T A;  4O5U A;  3IR4 A;  2B1K A;  2VL9 A;  4DSS B;  4KX4 A;  2H71 A;  2V41 A;  3LEF A;  2NBS A;  3VWU A;  1BED A;  1N8J A;  1U87 A;  4WKW A;  4JE1 A;  2H0H A;  1MDK A;  1QK8 A;  2KP1 A;  2FA4 A;  4AJ7 A;  5EY6 A;  2MBT A;  4TR1 A;  3UL3 A;  4DVC A;  3KTL A;  2IN3 A;  1W89 A;  1M0U A;  2L5O A;  13GS A;  2LUS A;  1EV9 A;  1SK0 A;  4KA0 A;  2OKA A;  5A5K A;  4NXI A;  4YAV A;  2HRA A;  2JSY A;  3GX8 A;  3WGE A;  4F2I A;  3GN3 A;  3ERW A;  5GST A;  1C72 A;  3IC4 A;  1VF3 A;  3KM6 A;  1UVZ A;  1TKD B;  3IOS A;  3TKP A;  3FMW A;  4V2L A;  4CW9 A;  3L78 A;  4FH8 A;  4OCE A;  4BWS A;  3C73 A;  1XWG A;  3A5I A;  3HVX A;  1SKW B;  1O81 A;  3E0U A;  1Y25 A;  2OBK A;  3KGK A;  4EVM A;  4FO5 A;  1F3A A;  3F6D A;  3TJG A;  1UC7 A;  2IMI A;  1ZCP A;  1T3B A;  1HNB A;  4NPB A;  3SWL A;  3UBL A;  2I1U A;  1PKW A;  3IV4 A;  3UEM A;  4IP1 A;  1OC8 A;  1G6Y A;  5CAX A;  1XZO A;  1XVQ A;  1USB A;  2X8H A;  4NV5 A;  3S9F A;  1TI1 A;  2CVB A;  1WPI A;  4MA9 A;  6GSV A;  3FYG A;  2L4C A;  2L59 A;  2TRC P;  2ZNM A;  4IQ1 A;  2V6O A;  2H30 A;  3QFA C;  2AJQ B;  4N11 A;  1SU9 A;  1EZK A;  2YNX A;  2A2P A;  5DCH A;  1I5G A;  3Q18 A;  4KSO A;  3EC3 A;  2LRC A;  3GTU B;  2F51 A;  2YPM A;  1A0F A;  1MDI A;  2PWJ A;  2HSY A;  4I8B A;  2R0P A;  5B8A A;  2H72 A;  3ZVJ A;  4ZIL A;  4K5S A;  2PPT A;  4MPF A;  4ULX A;  4O5Q A;  4IJ3 A;  3EWL A;  4XRA A;  3M9J A;  2O89 A;  4TR1 B;  1X5E A;  2TIR A;  4ML1 A;  3GNJ A;  3C8E A;  2JAD A;  2IIY A;  2M46 A;  2X49 A;  5F06 A;  5ECH B;  4PUA A;  3BD2 A;  1FO5 A;  2LRN A;  5HFI A;  5DAK A;  2VIM A;  2CZ3 A;  2AAW A;  1YKA A;  1XBS A;  2CAQ A;  1A23 A;  5ID2 B;  2WZ9 A;  3ZFB A;  4XCS A;  4MF5 A;  3PPU A;  4K7O A;  3GL5 A;  2R0C A;  2VCX A;  2HLS A;  4OO5 A;  1A2L A;  2JSZ A;  1N2A A;  1A24 A;  1TI3 A;  1TTZ A;  4K7N A;  4ILF A;  6GSS A;  2HRK A;  5GAN D;  3O76 A;  4O92 A;  2QA2 A;  3M3M A;  2FLS A;  2IWT A;  3KMN A;  2H0I A;  3GH6 A;  3LW9 A;  4PNG A;  1PX6 A;  1X9W B;  3VPT A;  2H73 A;  2VD0 A;  3HHV A;  3K8N A;  20GS A;  4BVY A;  4DSR A;  3Q19 A;  2M80 A;  3GH9 A;  2FWE A;  4L0U A;  2L6D A;  3QAG A;  1M7T A;  4PX1 A;  4MF7 A;  1THX A;  3TGZ A;  3HXS A;  4HU9 A;  3HJP A;  2H1B A;  1M2A A;  3DVX A;  3GST A;  1VF4 A;  4PUR A;  5CRG A;  5EVO A;  3M8N A;  3NOF A;  4GSN A;  2H6Z A;  1PL1 A;  3KTB A;  4JBB A;  2C8U A;  3LYP A;  4AJ6 A;  5ECM B;  4AJ8 A;  4IBP A;  1TP9 A;  4AF2 A;  4I6X A;  4KH7 A;  1FB6 A;  1SK2 A;  4G0K A;  3BJ5 A;  4ECC A;  5IIZ A;  3VWV A;  1V9W A;  3LJR A;  4ECJ A;  1M99 A;  3HD5 A;  1R5A A;  2D2Z A;  1X0R A;  4KW6 A;  1R5P A;  3LFL A;  4X43 A;  5KN2 A;  4TN8 A;  2LEG A;  4IJI A;  1GSE A;  4I2T A;  5D9W A;  2MMO A;  1U3A A;  5ECO B;  6GST A;  3UMA A;  2GQM A;  2CQ9 A;  3A5W A;  2Z9S A;  4BA7 A;  1Y6E A;  4IKH A;  2KP2 A;  2QA1 A;  2GQL A;  1DBY A;  2C0G A;  2H1D A;  2O85 A;  5LD0 A;  5DAK B;  5KN0 A;  1KTE A;  3MDK A;  2X99 A;  2HSM A;  3FRC A;  2V2G A;  3ZVJ D;  4BL7 A;  2HYX A;  2IMK A;  5G31 A;  5CYY A;  1GSD A;  4EC0 A;  2A2S A;  2ZUP A;  5AGY A;  2PVQ A;  3VPQ A;  1H4O A;  2LS5 A;  4N10 A;  1GLQ A;  1I9D A;  2GDR A;  4LMW A;  2KUC A;  5DAL B;  4TR4 A;  5J3R A;  1O6J A;  3TOT A;  3P8W A;  2RLI A;  4XRD A;  2E0Q A;  3A3T A;  1HYU A;  2R0G A;  2ES7 A;  2FA8 A;  1ZL9 A;  5AIS A;  1DUG A;  3RHB A;  5CRW A;  1S3D A;  4OCF A;  1SL1 B;  1XPV A;  2DSA A;  5C04 A;  3CMI A;  3TJJ A;  5FT3 A;  2B3S A;  3CSH A;  2YCD A;  1G6W A;  2VCV A;  3TJF A;  4CDO A;  2HNL A;  4IHU A;  3D22 A;  2VCT A;  4XIH A;  2LNS A;  16GS A;  2H0G A;  2YWI A;  4CHS A;  4HUA A;  2IFQ B;  1FG4 A;  1AUC A;  4LLR A;  3L0H A;  4P3Y B;  3I9V 2;  4PTS A;  1TDI A;  1F9M A;  2C3N A;  3TKQ A;  1XCC A;  3EE2 A;  3M1G A;  2J9H A;  2LQQ A;  3C7M A;  4POK A;  1YZX A;  1B9X C;  3VI7 A;  2C80 A;  2YJ7 A;  3TRP A;  3GUR A;  3RAZ A;  1T8E B;  1SKS B;  2H70 A;  2P0G A;  2XBI A;  1M9A A;  3F8U A;  2PVO C;  4OFN A;  1ERT A;  2PGT A;  3ZL5 A;  3FR6 A;  2N5A A;  2H76 A;  2RUE A;  2PN8 A;  3IHQ A;  2CVD A;  1TXX A;  1GUM A;  1QGV A;  3DGQ A;  3H8Q A;  2R4V A;  4G19 A;  2A4V A;  4QL7 A;  1GSS A;  2K6V A;  5F05 A;  4GQF A;  4MPG A;  3JCM L;  4IGJ A;  4MH3 A;  2L57 A;  4KDX A;  5KN3 A;  1TJD A;  4NHZ A;  5CRE A;  2FD3 A;  1F2E A;  2YN1 A;  1KBN A;  2GSR A;  19GS A;  4LL4 B;  3CXG A;  4LMV A;  1ILO A;  1V58 A;  1T4Z A;  5ELG A;  3TKR A;  4KDY A;  5HFK A;  1XW9 A;  5BMU A;  1HD2 A;  2G0F A;  3BOA A;  10GS A;  4BVX A;  1BYE A;  1BX9 A;  2K8V A;  1K0B A;  1GSF A;  3F4R A;  3GA4 A;  1QQ2 A;  2RM5 A;  2F3M A;  3FK8 A;  5G5F A;  3VWW A;  3WD6 A;  3IC8 A;  1TRV A;  2DJ2 A;  1A8Y A;  4KGI A;  3A2X A;  4V2M A;  2FNO A;  1O7U A;  4G0I A;  2F9S A;  3FW2 A;  5GZZ B;  4JR6 A;  5IQY A;  1GUH A;  1ZYN A;  2GLR A;  3EU4 A;  3DXB A;  4KCA A;  1ERU A;  1BG5 A;  3MYD A;  2E2G A;  2HXK A;  1U3I A;  2IL3 A;  1IYI A;  2YWN A;  3MIX A;  1OKT A;  1A2M A;  1FW1 A;  1O73 A;  1M2D A;  3G7Y A;  3M0F A;  1X5D A;  4MDC A;  4TRX A;  4MH2 A;  1OYJ A;  5ELA A;  3C1S A;  1WMJ A;  3FY7 A;  4GF0 A;  1EEM A;  4GRF A;  1GSY A;  4L5O A;  1PN9 A;  2QKE A;  4F0B A;  2DLX A;  2R6K A;  1HNA A;  2VLU A;  3L9V A;  3C71 A;  3R2Q A;  3MAK A;  3QD9 A;  3GKK A;  17GS A;  5D73 A;  1V40 A;  3D6I A;  4FIW A;  2O87 A;  3UVT A;  1YEP A;  1SD9 A;  4ID0 A;  1SYX A;  1PD2 1;  4Z2U A;  4WF4 A;  4EKZ A;  4QL9 A;  1V57 A;  3KMO A;  3ZFL A;  3IPZ A;  5J5N A;  2C4J A;  4HI7 A;  3GUS A;  2MMA A;  3CRT A;  1LBK A;  3IK9 A;  2MMN A;  4ISD A;  2CZ2 A;  6GSY A;  1GSQ A;  3FZ9 A;  5IMF A;  2AB6 A;  4WBJ A;  5HR3 A;  2KLX A;  4X4J A;  1ON4 A;  2WUL A;  4MJC A;  2TRX A;  5ECK B;  2ZCT A;  2R5G A;  2JL4 A;  4ZL8 A;  3V1W A;  1CQH A;  1ZZY A;  3UJ1 A;  1AAZ A;  1KNG A;  2C0F A;  4HJM A;  2R3X A;  2ON7 A;  4DEJ A;  4HU7 A;  4PGT A;  2YP6 A;  2PUK C;  2ON5 A;  3HJM A;  3N9J A;  1YF1 A;  4TXO B;  2E2M A;  3G7I A;  4POB A;  1RQM A;  1JFU A;  4XS1 A;  1QFN A;  1F3B A;  3J7Y b;  1XXU A;  4N30 A;  2WGR A;  5DBQ A;  4BVX B;  3P90 A;  1FOV A;  5IMZ A;  3EMX A;  2GQK A;  4Q5Q A;  1UN2 A;  5IM9 A;  1OVN A;  4KND A;  1ABA A;  2JZT A;  2V6K A;  2FWH A;  1ERV A;  1URM A;  4GWR A;  3KZQ A;  5E59 A;  1EOH A;  3QPM A;  4I5Q A;  1LJR A;  2B7K A;  4NHW A;  2HT9 A;  3QAW A;  1OC9 A;  3QR6 A;  4K9Z A;  5DCG A;  3WGX A;  1FAA A;  1TU8 A;  2PER A;  4ZL7 A;  1F37 A;  2I3Y A;  3ZRE A;  4ACS A;  4JED A;  5ECQ B;  1XWA A;  1J9B A;  2HZF A;  2K18 A;  5ECI B;  2YWM A;  2LRT A;  3DRN A;  1K0M A;  4F82 A;  2WS2 A;  4KSM A;  2HE3 A;  1YY7 A;  2H1A A;  4LA1 A;  3DKS A;  4EL1 A;  4I97 A;  3UBK A;  4TR3 A;  3H1N A;  4MZC A;  3L9S A;  1Q98 A;  3CYN A;  3TKS A;  3GMF A;  2YOI A;  3I69 A;  2NPB A;  1G7E A;  4EUY A;  3IXR A;  1WWJ A;  2GT6 A;  2J23 A;  3QMX A;  4ECB A;  4MJB A;  2REM A;  2A4H A;  5ECR B;  2EC4 A;  2P5R A;  3TJB A;  1G0T A;  4YKF A;  2G2Q A;  2JAC A;  3HDC A;  2VL2 A;  3HJO A;  1PRX A;  3QDN A;  4KF9 A;  3BBY A;  1BQ7 A;  1XW6 A;  2CAI A;  5A4U A;  4K6X A;  4POM A;  4HDE A;  1R26 A;  1GRX A;  1ZGN A;  1S3A A;  4PUF C;  1MTC A;  2OE0 A;  3H79 A;  1YKC A;  2EIQ A;  3A2V A;  5H5Q A;  1QMV A;  2I9H A;  2DJK A;  4XHM A;  4L0W A;  2F8A A;  4KAE A;  5B7C A;  5ENU A;  5GAP D;  3QCP A;  4HEA 2;  3HKR A;  5DQS A;  1Z3E A;  4XTS A;  1NW2 A;  4YKG A;  5LCZ A;  1XOB A;  4MJA A;  4ZBA A;  2N5F A;  1WRY A;  3HA9 A;  5IOW A;  5INY A;  5CRD A;  2OE1 A;  4K5R A;  4RI6 A;  1TW9 A;  3TKS E;  3ZLP A;  1S3C A;  4MAB A;  1TK0 B;  4YQU A;  3GSS A;  1OE7 A;  1AW9 A;  4G0L A;  1DE1 A;  3RDW A;  3ZYW A;  1PX7 A;  1EP8 A;  5IMC A;  2RII A;  2FWF A;  4OFT A;  1OC9 B;  1GNE A;  1EV4 A;  3MNG A;  3U5R E;  2OBI A;  2WDU A;  11GS A;  3GHA A;  2DJ1 A;  3KH7 A;  5J4U A;  4JU5 A;  5D93 A;  3IRA A;  4KB3 A;  3GRX A;  2H19 A;  5AIV A;  3J7Y k;  1JZW A;  4AGS A;  2L6C A;  3WT1 A;  2DJ3 A;  2IPA A;  2CX4 A;  5COH A;  4MK3 A;  5G2Z A;  4K1F A;  2VD1 A;  1KEB A;  3VWX A;  1EOG A;  3CTG A;  1XW5 A;  1K3L A;  2WB9 A;  4H86 A;  4O5R A;  1MDJ A;  2LKU A;  3W6G A;  4GXZ A;  4ML6 A;  3KEB A;  5CO3 A;  2O8V B;  3D4T A;  3NZN A;  5KOX A;  2P5Q A;  1HQO A;  1OAZ A;  4TXV A;  4YH2 A;  22GS A;  2RM6 A;  1AIU A;  3KCM A;  4GST A;  2WFC A;  3GKN A;  4FYC A;  2FGX A;  4PQI A;  2B7J A;  2IMD A;  2BMX A;  1XVW A;  3FEU A;  4EXJ A;  4FYB A;  1GTA A;  5G1L A;  1XIY A;  3F3R A;  3KP9 A;  4YAP A;  4ZB9 A;  1PQN A;  4HS1 A;  1ML6 A;  4KE3 A;  5B6N A;  2X8C A;  1PSQ A;  4MF6 A;  2VAF A;  3EUR A;  1BJX A;  4A5P A;  1XWB A;  2P31 A;  1SD8 A;  4G2E A;  5KOW A;  4G10 A;  1K0N A;  2GT5 A;  5D8I A;  3L4N A;  1FVJ A;  4BVY B;  4L8E A;  1DSB A;  2B5X A;  1GLP A;  4DSS A;  2GZP A;  2YZH A;  1LU4 A;  2FUG 2;  3P2A A;  2B5Y A;  4TOP A;  1EGO A;  4RI7 A;  3R3E A;  3EYT A;  2DJJ A;  3M9K A;  3D4M A;  2DBC A;  1Z5Y E;  1E2Y A;  3PH9 A;  2C0D A;  2B1L A;  2MYG A;  1Z6N A;  2WCI A;  4ZXG A;  1PGT A;  3ZIV A;  1VRS D;  3TOU A;  1K3Y A;  2FWG A;  3BCK A;  5C00 A;  1TOF A;  2HSH A;  3DYR A;  3HZ4 A;  4TKY A;  4V2N A;  3VFI A;  5JWQ B;  1V98 A;  1TRU A;  4EDY A;  5HQP A;  3MSZ A;  2JZR A;  1JHB A;  2VLV A;  2K9F A;  1SYR A;  2CX3 A;  2X4A A;  5HR1 A;  2HZE A;  1SJ6 A;  2HRN A;  1SKR B;  5JWR B;  1GSU A;  4YQM A;  5DJL A;  3RPN A;  3RHC A;  1R7H A;  1EEJ A;  1YDK A;  4NMU A;  4L5L A;  2H8L A;  5J41 A;  1K3O A;  5IPG A;  3GX0 A;  4N0V A;  4F0C A;  2H1G A;  3NIV A;  2YWO A;  5J9B A;  3VLN A;  3ZRD A;  5E4W A;  6GSW A;  3KXO A;  3F0I A;  1ZMA A;  4MP4 A;  1AXD A;  1QUW A;  5JCG A;  2FHE A;  1O85 A;  2AV4 A;  3ME7 A;  1SEN A;  3ISO A;  4BL7 B;  2XBQ A;  3VUR A;  4LL1 B;  1PKZ A;  1ZYE A;  3KH9 A;  2HRF A;  1T00 A;  4EO3 A;  4JR4 A;  4EE0 A;  3N5O A;  4CY6 A;  3GYK A;  3WYW A;  1J0F A;  5GSS A;  3E3E A;  3A2W A;  3EMP A;  4PQH A;  1A0R P;  5DDL A;  4DSQ A;  5DJM A;  5ECN B;  4ECI A;  5IOX A;  5H5S A;  2F8F A;  3LQ7 A;  2AYT A;  2DKI A;  1ZYP A;  3FHK A;  2QC7 A;  3TB2 A;  5A4W A;  5ABR A;  3ERF A;  2E7P A;  4Z2R A;  4G9H A;  3UIW A;  3KIJ A;  3CSJ A;  1ST9 A;  3IHG A;  1WE0 A;  2DIZ A;  5D9X A;  5LNK e;  1G7O A;  4XS4 A;  3HZ8 A;  3Q74 A;  4OO4 A;  2GZY A;  2VO4 A;  2XC2 A;  5B6M A;  5JWO B;  3I6A A;  1VGL A;  4TR0 A;  5IMD A;  3EVI A;  1FOH A;  5KEJ A;  1WP0 A;  3HY2 A;  4PXO A;  2DMM A;  2LNT A;  1YEX A;  1M9B A;  5D9V A;  1PA3 A;  4Q5R A;  4E8E A;  3EU3 A;  2OAC A;  4I2U A;  4V1A g;  2V1M A;  1AC1 A;  3SBC A;  1JZO A;  5HR2 A;  2LST A;  5L71 A;  2VUP A;  5HR0 A;  1DE2 A;  4ICY A;  1GUL A;  2IJY A;  3LSZ A;  5IO0 A;  5ID2 A;  3APQ A;  3IAM 2;  2HZE B;  3UAP A;  3CBU A;  2CA8 A;  1NHY A;  1SL0 B;  4Z2T A;  1A2J A;  2MBS A;  3C1R A;  2YJH A;  2WJU A;  2H01 A;  4BPY A;  4HZ4 A;  2M72 A;  4PNF A;  2GGT A;  2RUF A;  3LWA A;  5IMV A;  2C1Y A;  4PQ1 A;  3RBT A;  1WJK A;  3FZ5 A;  2IMF A;  4EIP A;  3WT2 A;  3IK7 A;  2MZC A;  5FHI A;  1MEK A;  2VCZ A;  1EGR A;  3TRX A;  3IA1 A;  3EIN A;  2L4Q A;  3TUE A;  4FYU A;  4F03 A;  3LXT A;  1GP1 A;  4Q5F A;  4ZBD A;  2C3T A;  2FY6 A;  3ED3 A;  1GWC A;  3FZ4 A;  4O32 A;  4ZBB A;  3O3T A;  1Z6M A;  4EDZ A;  3CTF A;  4MJE A;  1TRS A;  2GSS A;  2OJL A;  4MMM A;  4O7H A;  1XWC A;  1MD4 A;  1H75 A;  2WRT A;  2QSI A;  4IQA A;  2B5E A;  3QAV A;  3F63 A;  3F3Q A;  4GLT A;  4WR5 A;  2EIR A;  3DD3 A;  4GQC A;  4WEY A;  1ERW A;  4K2X A;  3W8S A;  5G1K A;  3I43 A;  3TRQ A;  3LGC A;  3APS A;  2CVK A;  2YV9 A;  1W4V A;  2AHE A;  4XS4 B;  3U6V A;  1WIK A;  2X64 A;  2A2R A;  2GS3 A;  3IAS 2;  2DIY A;  3Q6O A;  4K0N A;  2LV3 A;  4Q5N A;  5B8B A;  3L9U A;  1U88 A;  2VCQ A;  5JCU A;  3DEX A;  4WR4 A;  3LYK A;  1CQG A;  4CY8 A;  1YF0 A;  4RUV A;  2PMT A;  2C3Q A;  6GSX A;  4YQV A;  1VF1 A;  3ME8 A;  1J08 A;  1SK1 A;  3APO A;  4POL A;  1GTB A;  1K0D A;  1ZYQ B;  1V2A A;  4ZB6 A;  2LTK A;  3HYP A;  1PN0 A;  5KN1 A;  3G7J A;  1Z9H A;  3F6F A;  2H75 A;  5DQY A;  3G9B A;  4KCE A;  2XHF A;  3HVS A;  1B8X A;  3CRU A;  3PGT A;  1AQX A;  2PU9 C;  4Z7X A;  1Q4J A;  1HNC A;  2LJR A;  2YV7 A;  1X9S B;  1RW1 A;  5G5E A;  3KD0 A;  4HOJ A;  3GFK A;  4QQ7 A;  1TRW A;  3GKX A;  5F8B A;  2JU5 A;  1B4Q A;  3LOR A;  2GST A;  1VF2 A;  2DKH A;  5DAL A;  3KP8 A;  3ZIT A;  4J57 E;  2VOC A;  1ACV A;  1YJ6 A;  4FQU A;  12GS A;  4K2D A;  2GTU A;  4ZB8 A;  3AY8 A;  3VK9 A;  3DWV A;  1F6M C;  2C0E A;  3WGD A;  3QFB C;  4KUN A;  3GV1 A;  3UAR A;  2IFQ A;  1FB0 A;  1R4W A;  4HQS A;  1SJZ A;  8GSS A;  5CNW A;  5H5R A;  4TW5 A;  4RQX A;  2OAD A;  1OKD A;  2K8S A;  2CV4 A;  4NWY A;  4GCI A;  2N5B A;  4EIQ A;  2NVL A;  4EF0 A;  7GSS A;  1K0A A;  6GSU A;  4X1U A;  2KOK A;  3F4T A;  9GSS A;  4IN0 A;  1X9M B;  3HVV A;  2XPE A;  1NHO A;  3W8J A;  3QOU A;  1NM3 A;  4XS6 A;  1TK5 B;  3GIX A;  4JZQ A;  2MMZ A;  3US3 A;  1T1V A;  3LG6 A;  18GS A;  1UA5 A;  4KDU A;  4N0Z A;  4NAX A;  1A8L A;  2H6Y A;  4OMV A;  1E6B A;  5EPF A;  5AN1 A;  4D73 A;  4WET A;  4USS A;  3ZZX A;  4MCU A;  4J2F A;  4NV2 A;  1T7P B;  3VI5 A;  1NSW A;  1OC3 A;  4K0G A;  1GL8 A;  5ECL B;  5IPH A;  4RQR A;  5AIX A;  2DML A;  3TKS C;  3DVW A;  3FKF A;  2VCW A;  4TVE A;  3TJK A;  2XPD A;  4IP6 A;  2LJA A;  5D9T A;  2BTO T;  2EIO A;  2L5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...