1X9MB

T7 dna polymerase in complex with an n-2-acetylaminofluorene-adducted dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/electron transport/dna
molecule keywords 5'-D(*GP*GP*AP*GP*AP*GP*TP*GP*AP*TP*TP*GP*GP*TP*AP*GP*TP*GP*
publication title Crystal structures of 2-acetylaminofluorene and 2-aminofluorene in complex with T7 DNA polymerase reveal mechanisms of mutagenesis.
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 29
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1x9mB00
1RK4A 5F05A 2GVPA 2YPMA 5EY6A 3SWLA 1M99A 3CMIA 1TXXA 1EOHA 4HZ2A 4LMVA 3BOAA 3PH9A 3ZL5A 5CRGA 1M2DA 18GSA 3GKMA 4K6XA 2FY6A 3LFLA 4L5LA 4KH7A 1EGOA 2VAFA 1ZZYA 3L9SA 1GUMA 5GZZB 4POKA 4JRRA 5KN3A 5B6MA 1LBKA 2JU5A 2OE1A 5HR0A 4AF2A 2L5OA 2R4VA 5ECQB 1JFUA 16GSA 2WRTA 4MMMA 4JE1A 2V32A 4MPFA 1PKZA 3IK7A 5CNWA 2VCQA 1WMJA 1XW5A 3PGTA 2N5FA 4OMVA 3ME7A 3F3RA 4ULXA 1R7HA 3GNJA 1VF4A 1V9WA 4JEDA 5CRWA 3H4KA 3FYGA 1AUCA 1JLWA 1BJXA 1SD8A 3KH7A 2B5YA 4LL1B 2OBIA 5DBQA 1EOGA 3TKSE 2LNSA 4D73A 3LQ7A 3UMAA 3L4NA 2CAIA 3ERGA 1YEXA 4I6XA 1F3BA 2PVQA 4E8EA 4V2NA 4DSSB 17GSA 4LA1A 5ECMB 2KUCA 3I9V2 1XPVA 5GSTA 5ELGA 3QPMA 2C3TA 1BQ7A 1FB6A 4EO3A 3QFAC 4PUFC 3F8UA 4Q5RA 2A2RA 4K2DA 1G6WA 2PUKC 1X9MB 1HD2A 2HSYA 5D9XA 2L4QA 4YH2A 4EL1A 3PINA 1O8WA 1GNWA 3VK9A 1ERVA 1EWXA 4L5OA 3W8SA 2CZ3A 1A0FA 4ECJA 2K8SA 3KEBA 1SK0A 1ZGNA 3SBCA 3WGXA 1C72A 1A0RP 3GMFA 3IBHA 1V40A 2IMIA 1ZOFA 2B5XA 4ECBA 4LLRA 2H76A 3TGZA 2HI7A 5GSSA 4K1FA 1I5GA 3E9JB 2MZCA 4EDYA 5DCGA 2MMOA 5B8BA 5JWRB 2R5GA 1H4OA 2FWEA 3HDCA 3QR6A 4N10A 1SK1A 2FGXA 4KGIA 1PGTA 1B9XC 3W6GA 2VUPA 4ZBAA 4ZB8A 3TKSA 2YV7A 2GZPA 4ID0A 4J57E 1GNEA 5JWOB 4QL9A 4NWYA 1DE1A 4PX1A 4EDZA 2I3YA 2Z9SA 5IQYA 2K9FA 1GWCA 2N5AA 1MDKA 3ZTLA 3APOA 1GULA 3N5OA 3APQA 5HFKA 5H5QA 3NZNA 1M9AA 3VPTA 2CV4A 2H30A 3F63A 2LJRA 5ID2A 1K0BA 2JZRA 1ERTA 1GTIA 2YWIA 1WP0A 2H19A 3AY8A 5AN1A 3ISOA 1F2EA 4KAEA 2LJKA 1B4QA 5F07A 1GSFA 1GSDA 3M9KA 5EVOA 3TRQA 1A8LA 4KCAA 2FUG2 2JSYA 3D22A 4BWSA 2QSIA 2ZNMA 1AIUA 2FD3A 1ZYEA 2VL9A 2F8AA 1PKWA 1XWAA 1GTAA 4TXOB 6GSXA 5DDLA 5KN2A 5IMDA 2I1UA 1R26A 1YDKA 5JCWA 3FRCA 2MBSA 2IN3A 4O92A 1VF2A 2ON5A 1AC1A 5KEJA 2TRCP 6GSYA 5DALB 4F2IA 4WR5A 2GZYA 2FNOA 3KZQA 2TRXA 2JL4A 4XRDA 1THOA 2XBQA 2KHPA 1TW9A 2AB6A 2NTOA 2VD0A 2JZSA 4K7OA 3TRXA 4XS1A 5DVBA 3TOTA 3J7Yb 1KTEA 2O87A 2I9HA 1RW1A 1YY7A 3H8QA 4FO5A 4XIHA 3IAM2 1AQXA 2EIOA 1GUHA 3DEXA 4AGSA 3ZFBA 3D4TA 1UA5A 3QFBC 2P5QA 4FIWA 4OFNA 2LV3A 2H1DA 4RQRA 2PVOC 2J9HA 3BBYA 4HQSA 1O7UA 3GX0A 2NPBA 3C7MA 1AQVA 3TUEA 3OR5A 3VWXA 5DJLA 3U5RE 4V1Ap 2PERA 1SK2A 3DRNA 4L8EA 3KTLA 2IFQA 1XW6A 4YAPA 3HJPA 5H5RA 2LSTA 2NVLA 2M80A 3DVWA 3US3A 3QOUA 2XPDA 4I8BA 3RHBA 5DQYA 2OACA 3CXGA 4K8MA 3N9JA 1O85A 2KP2A 3EMPA 4MLYA 3UBLA 1BEDA 3CSIA 3TJFA 1Z6NA 3HZ4A 3EMXA 3QAVA 4POBA 2F3MA 3TOUA 4ZBDA 1TP9A 2YWMA 5E4WA 3A2WA 3L9VA 5COHA 2H73A 2B5EA 1N2AA 1J9BA 4DSQA 4CHSA 1TI1A 3BCIA 4LMWA 3A5WA 3RHCA 3GL5A 1S3DA 5G30A 3P2AA 4IP6A 4BA7A 2TIRA 4BVXA 4MZBA 1T4YA 3QAWA 1K0AA 4IQ1A 1Z9HA 3U6VA 1J08A 4NMUA 3ZMLA 1MDIA 3VPQA 1HNCA 2HZEA 5ECHB 5A4VA 2V1MA 3VFIA 3FY7A 8GSSA 4MABA 1T00A 1K0NA 1MTCA 1DUGA 2GSQA 2N5BA 1J0FA 1URMA 1TI3A 1GRXA 4ZIJA 2HRNA 1HNBA 5DCHA 4IW9A 2VIMA 2DLXA 5C04A 2C0GA 3IE3A 4YQUA 3TKSC 5FWGA 2VD1A 1XVWA 3O6TA 1UVZA 4OWYA 3H1NA 5J5NA 2OBKA 2HYXA 2LKUA 4JU5A 2MMZA 2HT9A 3FKFA 1GLQA 4RUVA 1X9WB 3I69A 4GRFA 1DE2A 1X9SB 4WBRD 4WEYA 3ERFA 4POLA 4JBBA 1OC9A 1F9MA 2LTKA 1JHBA 4N30A 4PQHA 3EINA 1OVNA 2RUEA 3ZYWA 3QAGA 2J23A 5D9TA 2V6OA 2B1LA 5GAND 1I9DA 2C3NA 4EUYA 2DSAA 5IPHA 4NXIA 5D73A 3UIWA 4QQ7A 2R6KA 5AGYA 2LS5A 2B1KA 2K8VA 3EC3A 3LXZA 5IMFA 4JR6A 5DAKB 3IA1A 2WFCA 2FWGA 4WETA 1QGVA 3RDWA 3G9BA 3GURA 3F0IA 3WGEA 2DIZA 1EGRA 4OFTA 2XPEA 1V2AA 3ZREA 3GTUB 4XCSA 1S3AA 3IC4A 6GSWA 1LJRA 4KDYA 3JCML 3EU4A 1GH2A 1DBYA 1EEJA 5JWQB 3PR8A 4TN8A 2C3QA 3VURA 2YANA 1JZWA 3IXRA 1USBA 2CX4A 2EC4A 2AAWA 2HNLA 2B7JA 2ES7A 2GDRA 2X64A 1FVJA 4KW6A 1GSYA 1SYRA 1K3OA 1PRXA 1A23A 1VF1A 3M8NA 1QUWA 4HU9A 3UOMA 2VL3A 1ZCPA 3LYKA 1XZOA 3TJGA 5A4UA 4DSSA 1SJ6A 5J3RA 2O85A 2H75A 2FWFA 4EC0A 4BWQA 4TW5A 5JCUA 1GUKA 5L71A 5LCZA 1Z5YE 4ISDA 3GUSA 4MJEA 3TRPA 4K7NA 3VLNA 4TR3A 5HFIA 3F9UA 3MWHA 4HEA2 2H0IA 4MZCA 5LD0A 1F6MC 3A2VA 1PN9A 1QMVA 2FA4A 3CBUA 1R4WA 5EPFA 1FO5A 1FVKA 3TJJA 3ZITA 1S3CA 1VF3A 20GSA 1WOUA 4EKZA 2L59A 3TJKA 3LJRA 3GSSA 1YF1A 4IP1A 3KP8A 2P31A 2R3XA 14GSA 2CVBA 2GGTA 1QXHA 1BX9A 2R37A 1WIKA 1TRVA 3WT2A 2RM5A 1XWKA 2WJUA 1GLPA 2JADA 2YV9A 2O89A 1ABAA 3IOSA 4OFMA 3ZLPA 4MCUA 3F4RA 1SL1B 2VCTA 4GSTA 1YQ1A 4XHMA 3H79A 3LWAA 5IOXA 1XWCA 4FYCA 4BPYA 1OKDA 4K9ZA 2H6YA 3KGKA 3UL3A 1ILOA 3IR4A 4KA0A 1MD3A 1YKCA 1A2LA 5G2ZA 4TR1B 4MK3A 2GQLA 1UC7A 4GSNA 5D8IA 1TKDB 4IBPA 1ERWA 4KSMA 3D4MA 1M2BA 3ZVJD 4IQAA 3M1GA 4WKWA 4L0WA 1B48A 2IWTA 1F3AA 3CYNA 2KLXA 1T3BA 3DWVA 4LL4B 1GTBA 1TK8B 4IHUA 4DSRA 3C8EA 5IMAA 1NSWA 1TU8A 1G6YA 1NM3A 2IMKA 3D21A 4TR0A 1WPIA 4HS1A 3FR6A 2MYGA 3KD0A 1WRYA 4TXOA 2OA7A 4HI7A 2B3SA 2C0FA 2B6MA 2YN1A 4HDEA 2VM2A 2B7KA 4XS4B 2PWJA 1A8YA 3P90A 4IELA 1XBSA 1Z3EA 2PPTA 4OCEA 1OC8A 5DALA 4ZL9A 5AIXA 2AHEA 5ECNB 1O6JA 3C71A 4YAVA 3VWVA 4EXJA 3GN3A 5IMZA 3FR9A 3Q19A 5A5KA 2YNXA 4KDXA 1E6BA 1PD21 3F6DA 1JLVA 4ACSA 2H1BA 1O73A 1GSQA 1TK5B 1A2MA 2IPAA 1SKWB 3HJOA 4I2TA 2QKEA 6GSUA 2HXKA 4X43A 3P7XA 2C8UA 2M46A 1FHEA 3RPPA 1OE8A 1XCCA 1OKTA 2ALBA 1GSEA 2QC7A 3C73A 3TKPA 4F03A 3GX8A 3RAZA 1WE0A 4GQFA 2ZCTA 3WT1A 1SJIA 2EIRA 2PU9C 1AAZA 4GXZA 4WBJA 1K3LA 4F0BA 1V58A 4YQMA 5CYYA 1ZYQB 2HZFA 3WYWA 2K18A 1EV4A 2LEGA 2IMEA 4PNFA 2DMMA 4ZB9A 3VWUA 4YQVA 3IRAA 2RLIA 4AJ8A 3E0UA 3WD6A 4H86A 2FLSA 4G10A 2ON7A 3I43A 4MH2A 5HR2A 2H74A 3P8WA 4TKYA 5HR3A 3QDNA 4Q5NA 1GTUA 2H72A 2C0DA 1K0MA 5FHIA 3NOFA 3GH6A 2X8GA 1X0RA 2LQOA 4X0XA 5F0GA 4PQIA 2YOIA 4XTSA 1O8XA 2VCWA 4QL7A 2OADA 1JZRA 3G7IA 1PSQA 4BVYA 3UVHA 2FCHA 4ZXGA 2RUFA 3GSTA 2H6XA 1HQOA 2LQQA 4OCFA 3RPNA 1U6TA 5CRHA 2GSRA 1A24A 3FZ4A 3E3EA 4V2MA 3UARA 3VI5A 1SJZA 4F9ZA 2AYTA 4I2UA 22GSA 4IN0A 2GT6A 3FEUA 3KP9A 1T7PB 3TJBA 1TOFA 2GQMA 2KOKA 3O76A 5G1KA 1GSUA 5B6NA 2LJAA 4N0ZA 2GLRA 3FR3A 1B9YC 4MPGA 1XIYA 3ERWA 5G5FA 1Q4JA 1Z7PA 2H70A 1JZDA 2EIQA 2H1GA 1QK8A 4G19A 3LYPA 2DJ3A 2XBIA 5G31A 4ECIA 2PGTA 1QFNA 3QMXA 2CVDA 5CREA 2F8FA 4RI6A 4MJCA 4IS0A 1W4VA 4IKHA 1G0TA 1TRUA 1EP8A 3MNGA 1NW2A 5D93A 2VCXA 2ZUPA 1B4PA 1YZXA 1Y6EA 1CQGA 3L9UA 2HE3A 3R2QA 1IYHA 1ST9A 1K0DA 2X8CA 3ZMKA 1EP7A 4WXTA 1K3YA 2FHEA 2GSTA 2JZTA 4PURA 3EVIA 2HLSA 5ECOB 4N11A 4WF5A 5G1LA 2V6KA 1M0UA 3VI7A 4O5RA 1Y25A 1U3IA 2VCZA 4ECCA 5D9VA 3FZ5A 2GS3A 1PX6A 3GL3A 2H71A 4HU7A 1SU9A 3Q18A 3MDKA 2VLVA 3GRXA 3HD5A 2H1AA 2MMAA 3EE2A 2C4JA 4HQZA 5F8BA 4POMA 3IDVA 1U88A 2YZHA 1QQ2A 2NDOA 3CSJA 3ZFLA 5CAXA 1XW9A 2F9SA 2CZ2A 4XRAA 1PMTA 5D9WA 1ML6A 5DAKA 4MF7A 1MEKA 3HY2A 3HJMA 2V41A 2VL2A 2PMTA 4KDUA 4NV5A 4BL7A 5KN0A 3UVTA 3HVXA 3HYPA 5IO0A 4CW9A 4KSOA 4MP4A 1VRSD 4MF6A 2FA8A 5EL8A 3DVXA 3GTUA 5JCGA 2BTOT 5A4WA 5FT3A 2P5RA 3M9JA 5HQPA 2C80A 2WZ9A 6GSVA 13GSA 3LGCA 5KN1A 1XVQA 3FHKA 4K0NA 4P3YB 4MJBA 2XC2A 1R5AA 4GWRA 1TU7A 4EE0A 3KXOA 1GL8A 2V2GA 5AIVA 1YF0A 2D2ZA 1XFLA 1XWGA 3ZVJA 2R2JA 4HZ4A 5IIZA 2I81A 4TOPA 3QCPA 1WJKA 5AISA 5CRDA 1WWJA 3HXSA 2WGRA 2WDUA 1MD4A 1EEMA 4ZB6A 1TDIA 2LNTA 1FW1A 2PBJA 2X8HA 3J7Yk 5ECKB 1N8JA 2F51A 2P0GA 1PL1A 2H8LA 2IMDA 2AUVA 4KE3A 1X5EA 2RIIA 4KNDA 4ML1A 1MDJA 2YCDA 1AW9A 2MBTA 1DSBA 5ECLB 2O8VB 3F6FA 5ELAA 3H93A 2VCVA 3EYTA 3S9FA 4ILFA 4D73B 5F06A 3FZ9A 2IJYA 4KB3A 1JZOA 4XS6A 4MH3A 6GSTA 1G7EA 3HZ8A 1GP1A 3RBTA 1NHYA 4IJIA 1V98A 5DQSA 3FZAA 5D96A 5IMVA 3MSZA 3ZRDA 4TR4A 3DXBA 2WCIA 3GHAA 4HOJA 3TCOA 3LEFA 2CT6A 5J9BA 3GFKA 2AV4A 2GZZA 3TB2A 2DIYA 4WF4A 1FOVA 4G2EA 2CVKA 4CDOA 1TRSA 4MZWA 2LRNA 4WR4A 1BAYA 3ZIJA 2LUSA 2YZUA 1B8XA 4NAXA 1M9BA 4ZILA 3L78A 4PGTA 2CQ9A 1K0OA 3C1SA 3KH9A 3HA9A 3V1WA 3LXTA 1EV9A 4J56E 1ERUA 2E0QA 1Z6MA 5CP1A 4TR1A 2IIYA 4OD7A 4I5QA 3UBKA 6GSSA 10GSA 4IGJA 1F37A 5HR1A 4O32A 1A2JA 3TKRA 4V1Ag 1SL2B 19GSA 2VM1A 3CSHA 3HCZA 3IPZA 1HNAA 1BYEA 4GQCA 2GQKA 3DMLA 3BD2A 2H0GA 4F82A 3IK9A 3KMOA 1IYIA 1V57A 4NHZA 3DIEA 1T8EB 4FYBA 4GF0A 4Z7XA 1XOBA 1XOAA 2YP6A 4GSSA 5IM9A 3KIJA 5IPGA 2H66A 1EZKA 2OE3A 3TKQA 5DJMA 1FB0A 4XS4A 2WS2A 5ECRB 2YJ7A 1YKAA 1SD9A 5IOWA 4NHWA 2XHFA 1G7OA 2IL3A 4K7IA 5HFGA 3ZIVA 3GKKA 2HFDA 5ID2B 2LRTA 4MA9A 3HKRA 3CTGA 2IMFA 5H5SA 3LG6A 1O81A 4ZBBA 3K8NA 5G5EA 1OAZA 2H01A 3LSZA 4L0UA 1CQHA 3NIVA 3F3QA 5IMCA 4NPBA 2BJXA 2VLUA 3CTFA 2VL2C 5LNKe 2M72A 3DD3A 4HJ2A 1SKSB 1KNGA 1OC3A 2FWHA 12GSA 3WGDA 9GSSA 4GCIA 2E7PA 5ECIB 1GSSA 2OJLA 4KX4A 5E59A 4PXOA 1PQNA 5B8AA 5J41A 2WULA 4FYUA 3FK8A 4RI7A 2I4AA 1U3AA 1RQMA 4IVFA 4EVMA 4PNGA 4V2LA 3KCMA 4Q5QA 2HRFA 2MMNA 1NHOA 4FH8A 4O7HA 4MF5A 2A2SA 4KUNA 4N0VA 1OYJA 4ZL8A 1UN2A 3HVVA 2O7KA 4JR4A 4ML6A 4PQ1A 3DYRA 5CO3A 3FW2A 3G7YA 3IAS2 3EWLA 5ABRA 2C1YA 4I97A 1FAAA 2DJ2A 3KMNA 3F4TA 2G0FA 2YWOA 3BJ5A 1FG4A 3A2XA 1SL0B 3TDGA 3UJ1A 5J4UA 4J2FA 1KEBA 2C0EA 1TK0B 4KCEA 2OKAA 2DJJA 1SYXA 2L57A 2DC5A 2DJKA 3MAKA 4DEJA 3ED3A 1M2AA 4E8HA 2IFQB 1E2YA 2NBSA 1LU4A 3IHQA 7GSSA 3GA4A 2DJ1A 5J9CA 1XWBA 2HSHA 3HHVA 2QGVA 3VWWA 4K0GA 1SKRB 3C1RA 4MDCA 3ME8A 2GT5A 3GH9A 5INYA 1X5CA 1ZL9A 2A4VA 2JACA 2YJHA 4DVCA 1U87A 2E2GA 2K6VA 5IO2A 3M0FA 2VOCA 4GLTA 4AJ6A 2VO4A 3A3TA 1XXUA 3DKSA 1ZMAA 5ECPB 2PN8A 1TJDA 1Q98A 3ZZXA 2DJ0A 1K0CA 1ACVA 3KJYA 2CAQA 4X1UA 4TRXA 2L6CA 4HUAA 4NV2A 1BG5A 4EF0A 1VGLA 3GV1A 3GIXA 4G9HA 1M7TA 1Z7RA 3D5JA 3UAPA 4OO5A 11GSA 3UEMA 2GTUA 4OO4A 2L4CA 1T1VA 3CRUA 2CX3A 3O3TA 1YEPA 5ENUA 2L6DA 2DBCA 3GKXA 2JSZA 2HZEB 3W8JA 1YJ6A 2E2MA 3KTBA 3GYKA 1SENA 1H75A 2G2QA 3GKNA 3D6IA 3DGQA 4IJ3A 3IV4A 2L5LA 3G7JA 1TRWA 5GAPD 2VLTA 3QD9A 1TTZA 3Q6OA 2LRCA 2AJQB 1PX7A 1THXA 3HVSA 2REMA 5B7CA 1HYUA 4AJ7A 1ON4A 3L0HA 1OE7A 1PA3A 2OE0A 3I6AA 2DMLA 1PL2A 1R5PA 2CA8A 3CRTA 1KBNA 3EURA 1AXDA 2GSSA 3M3MA 4RQXA 5ECSA 4ZL7A 2YWNA 2KP1A 2H6ZA 5C00A 1X5DA 4F0CA 1AQWA 4HJMA 3BCKA 4GTUA 2X99A 4TVEA 3KM6A 4Q5FA 1OC9B 2WB9A 4PUAA 2H0HA 3F4SA 2BMXA 3D0ZA 4MJAA 2RM6A 3Q74A 4JZQA 3APSA 3EU3A 4TXVA 3LORA 1W89A 1T4ZA
chains in the Genus database with same CATH superfamily
1RK4A 5F05A 2GVPA 2YPMA 5EY6A 3SWLA 1M99A 3CMIA 1TXXA 1EOHA 4HZ2A 4LMVA 3BOAA 3PH9A 3ZL5A 5CRGA 1M2DA 18GSA 3GKMA 4K6XA 2FY6A 3LFLA 4L5LA 4KH7A 1EGOA 2VAFA 1ZZYA 3L9SA 1GUMA 5GZZB 4POKA 4JRRA 5KN3A 5B6MA 1LBKA 2JU5A 2OE1A 5HR0A 4AF2A 2L5OA 2R4VA 5ECQB 1JFUA 16GSA 2WRTA 4MMMA 4JE1A 2V32A 4CY6A 4MPFA 1PKZA 3IK7A 5CNWA 2VCQA 1WMJA 1XW5A 3PGTA 2N5FA 4OMVA 3ME7A 3F3RA 4ULXA 1R7HA 2X49A 3GNJA 4X4JA 1VF4A 1V9WA 4JEDA 5CRWA 3H4KA 3FYGA 1AUCA 1JLWA 1BJXA 1SD8A 3KH7A 2B5YA 4LL1B 2OBIA 5DBQA 1EOGA 3TKSE 2LNSA 4D73A 3LQ7A 3UMAA 3L4NA 2CAIA 3ERGA 1YEXA 4I6XA 1F3BA 2PVQA 4E8EA 4V2NA 4DSSB 17GSA 4LA1A 5ECMB 2KUCA 5KOXA 3I9V2 4EIQA 1XPVA 5GSTA 5ELGA 3QPMA 2C3TA 1BQ7A 1FB6A 4EO3A 3QFAC 4PUFC 3F8UA 4Q5RA 2A2RA 4K2DA 5BRTA 1G6WA 2PUKC 1X9MB 1HD2A 2HSYA 5D9XA 2L4QA 4YH2A 4EL1A 3PINA 1O8WA 1GNWA 3VK9A 1ERVA 1EWXA 4L5OA 2DKHA 2CZ3A 1A0FA 3W8SA 4ECJA 2K8SA 3KEBA 1SK0A 1PFOA 1ZGNA 3SBCA 3WGXA 1C72A 1A0RP 2QA2A 3GMFA 3IBHA 1V40A 2IMIA 1ZOFA 2B5XA 4ECBA 4LLRA 2H76A 3TGZA 2HI7A 5GSSA 4K1FA 1I5GA 3E9JB 2MZCA 4EDYA 5DCGA 2MMOA 5B8BA 5JWRB 2R5GA 1H4OA 2FWEA 4G0LA 3HDCA 3QR6A 4N10A 1SK1A 2FGXA 4KGIA 1PGTA 1B9XC 3W6GA 2VUPA 4ZBAA 4ZB8A 3TKSA 2YV7A 2GZPA 4ID0A 4J57E 1GNEA 5JWOB 4QL9A 4NWYA 1DE1A 4PX1A 4EDZA 2I3YA 2Z9SA 5IQYA 2K9FA 1GWCA 2N5AA 1MDKA 3ZTLA 3APOA 1GULA 3N5OA 3APQA 5HFKA 5H5QA 3NZNA 1M9AA 3VPTA 2CV4A 2H30A 3F63A 2LJRA 5ID2A 1K0BA 2JZRA 1ERTA 1GTIA 2YWIA 1WP0A 2H19A 3AY8A 5AN1A 3ISOA 1F2EA 4KAEA 2LJKA 1B4QA 5F07A 1GSFA 1GSDA 3M9KA 5EVOA 3TRQA 1A8LA 4KCAA 4O5QA 2FUG2 2JSYA 3D22A 4BWSA 2QSIA 2ZNMA 1AIUA 2FD3A 1ZYEA 2VL9A 2F8AA 2QA1A 1PKWA 1XWAA 1GTAA 4TXOB 6GSXA 5DDLA 5KN2A 5IMDA 2I1UA 1R26A 1YDKA 5JCWA 3FRCA 2MBSA 2IN3A 4O92A 1VF2A 2ON5A 1AC1A 5KEJA 2TRCP 6GSYA 5DALB 4F2IA 4WR5A 2GZYA 2FNOA 3KZQA 2TRXA 2JL4A 4XRDA 1THOA 2XBQA 2KHPA 3CQFA 1TW9A 2AB6A 2NTOA 2VD0A 2JZSA 4K7OA 3TRXA 4XS1A 5DVBA 3TOTA 3J7Yb 1KTEA 2O87A 2I9HA 1RW1A 1YY7A 3H8QA 4FO5A 4XIHA 3IAM2 1AQXA 2EIOA 1GUHA 3DEXA 4AGSA 3ZFBA 3D4TA 1UA5A 3QFBC 2P5QA 4FIWA 4OFNA 2LV3A 2H1DA 4RQRA 2PVOC 2J9HA 3BBYA 4HQSA 1O7UA 3GX0A 2NPBA 3C7MA 1AQVA 3TUEA 3OR5A 3VWXA 5DJLA 3U5RE 4V1Ap 2PERA 1SK2A 3DRNA 4L8EA 3KTLA 2IFQA 1XW6A 4YAPA 3HJPA 5H5RA 2LSTA 2NVLA 2M80A 3DVWA 3US3A 3QOUA 2XPDA 4I8BA 3RHBA 5DQYA 2OACA 3CXGA 4K8MA 3N9JA 1O85A 2KP2A 3EMPA 4MLYA 3UBLA 1BEDA 3CSIA 3TJFA 1Z6NA 3HZ4A 3EMXA 3QAVA 4POBA 2F3MA 3TOUA 4ZBDA 1TP9A 1XG8A 2YWMA 5E4WA 3A2WA 3L9VA 5COHA 2H73A 2B5EA 1N2AA 1J9BA 4BVYB 4DSQA 4CHSA 1TI1A 3BCIA 4LMWA 3A5WA 3RHCA 3GL5A 1S3DA 5G30A 3P2AA 4IP6A 4BA7A 2TIRA 4BVXA 4MZBA 1T4YA 3QAWA 1K0AA 4IQ1A 1Z9HA 3U6VA 1J08A 3LW9A 4NMUA 3ZMLA 1MDIA 3VPQA 1HNCA 2HZEA 5ECHB 5A4VA 2V1MA 3VFIA 3FY7A 8GSSA 4MABA 1T00A 1K0NA 1MTCA 1DUGA 2GSQA 2N5BA 1J0FA 1URMA 1TI3A 1GRXA 4ZIJA 2HRNA 1HNBA 5DCHA 4IW9A 2VIMA 2DLXA 5C04A 2C0GA 3IE3A 4YQUA 3TKSC 5FWGA 2VD1A 3FMWA 1XVWA 3O6TA 1UVZA 4OWYA 3H1NA 5J5NA 2OBKA 2HYXA 2LKUA 4JU5A 2MMZA 2HT9A 3FKFA 1GLQA 4RUVA 1X9WB 3I69A 4GRFA 1DE2A 1X9SB 4WBRD 4WEYA 3ERFA 4POLA 4JBBA 3A5IA 1OC9A 1F9MA 2LTKA 1JHBA 4N30A 4PQHA 3EINA 1OVNA 2RUEA 3ZYWA 3QAGA 2J23A 5D9TA 4K5SA 2V6OA 2B1LA 5GAND 1I9DA 2C3NA 4EUYA 2DSAA 5IPHA 4NXIA 5D73A 3UIWA 4QQ7A 2R6KA 5AGYA 2LS5A 2B1KA 2K8VA 3EC3A 3LXZA 5IMFA 4JR6A 5DAKB 3IA1A 2WFCA 2FWGA 4WETA 1QGVA 3RDWA 3G9BA 3GURA 4BL7B 3F0IA 3WGEA 2DIZA 1EGRA 4OFTA 2XPEA 1V2AA 3ZREA 3GTUB 4XCSA 1S3AA 3IC4A 6GSWA 1LJRA 2A4HA 4KDYA 3JCML 3EU4A 1GH2A 1DBYA 1EEJA 5JWQB 3PR8A 4TN8A 2C3QA 3VURA 2YANA 1JZWA 3IXRA 1USBA 2CX4A 2EC4A 5BMUA 2AAWA 2HNLA 2B7JA 2ES7A 2GDRA 2X64A 1FVJA 4KW6A 1GSYA 1SYRA 1K3OA 1PRXA 1A23A 1VF1A 3M8NA 1QUWA 4HU9A 3UOMA 2VL3A 2R0CA 1ZCPA 3LYKA 1XZOA 3TJGA 5KOWA 5A4UA 4DSSA 1SJ6A 5J3RA 2O85A 2H75A 2FWFA 4EC0A 4BWQA 4TW5A 5JCUA 1GUKA 5L71A 5LCZA 1Z5YE 4ISDA 3GUSA 4MJEA 3TRPA 4K7NA 3VLNA 4TR3A 5HFIA 3F9UA 3MWHA 4HEA2 2H0IA 4MZCA 5LD0A 4Z2RA 1F6MC 3A2VA 1PN9A 1QMVA 2FA4A 3CBUA 1R4WA 5EPFA 1FO5A 1FVKA 3TJJA 3ZITA 1S3CA 1VF3A 20GSA 1WOUA 4EKZA 2L59A 3TJKA 3LJRA 3GSSA 1YF1A 2X4AA 4IP1A 3KP8A 2P31A 2R3XA 14GSA 2CVBA 2GGTA 1QXHA 1BX9A 2R37A 1WIKA 1TRVA 3WT2A 2RM5A 1XWKA 2WJUA 1GLPA 2R0GA 2JADA 2YV9A 2O89A 1ABAA 3IOSA 4OFMA 3ZLPA 4MCUA 3F4RA 1SL1B 2VCTA 4GSTA 1YQ1A 4XHMA 3H79A 3LWAA 5IOXA 1XWCA 4FYCA 4BPYA 1OKDA 4K9ZA 1M3IA 2H6YA 3KGKA 3UL3A 1ILOA 3IR4A 4KA0A 1MD3A 1YKCA 1A2LA 5G2ZA 4TR1B 4MK3A 2GQLA 1UC7A 4GSNA 5D8IA 1TKDB 4IBPA 1ERWA 4KSMA 3D4MA 1M2BA 2HSMA 3ZVJD 4IQAA 3M1GA 4WKWA 4L0WA 1B48A 2IWTA 1F3AA 3CYNA 2KLXA 1T3BA 3DWVA 4LL4B 1GTBA 1TK8B 4IHUA 4DSRA 3C8EA 5IMAA 1NSWA 1TU8A 1G6YA 1NM3A 2IMKA 3D21A 4TR0A 1WPIA 4HS1A 3FR6A 2MYGA 3KD0A 1WRYA 4TXOA 2OA7A 4HI7A 2B3SA 2C0FA 2B6MA 2YN1A 4HDEA 2VM2A 2B7KA 4XS4B 2PWJA 1A8YA 3P90A 4IELA 1XBSA 1Z3EA 2PPTA 4OCEA 1OC8A 5DALA 4ZL9A 5AIXA 2AHEA 5ECNB 1O6JA 3C71A 4YAVA 3VWVA 3HVNA 4EXJA 3GN3A 5IMZA 3FR9A 3Q19A 5A5KA 2YNXA 4KDXA 1E6BA 1PD21 4FQUA 3F6DA 1JLVA 2UZ8A 4ACSA 2H1BA 1O73A 1GSQA 1TK5B 1A2MA 2IPAA 1SKWB 3HJOA 4I2TA 2QKEA 6GSUA 2HXKA 4X43A 3P7XA 2C8UA 2M46A 1FHEA 3RPPA 1OE8A 1XCCA 1OKTA 2ALBA 1GSEA 2QC7A 3C73A 3TKPA 4F03A 3GX8A 3RAZA 1WE0A 4GQFA 2ZCTA 3WT1A 1SJIA 2EIRA 2PU9C 1AAZA 4USSA 4GXZA 4WBJA 1K3LA 4F0BA 1V58A 4YQMA 5CYYA 1ZYQB 2HZFA 3WYWA 2K18A 1EV4A 2LEGA 2IMEA 4PNFA 2DMMA 4ZB9A 3VWUA 4YQVA 3IRAA 2RLIA 4AJ8A 3E0UA 3WD6A 1PN0A 4H86A 2FLSA 4G10A 2ON7A 3I43A 4MH2A 5HR2A 2H74A 3P8WA 4TKYA 5HR3A 3QDNA 4Q5NA 1GTUA 2H72A 2C0DA 1K0MA 5FHIA 3MYDA 3NOFA 4G0KA 3GH6A 2X8GA 1X0RA 2LQOA 4X0XA 5F0GA 4PQIA 2YOIA 4XTSA 1O8XA 2VCWA 4QL7A 2OADA 1JZRA 3G7IA 1PSQA 4BVYA 3UVHA 2FCHA 4ZXGA 2RUFA 2DKIA 3GSTA 2H6XA 4HSCX 1HQOA 2LQQA 4OCFA 3RPNA 1U6TA 3R3EA 5CRHA 2GSRA 1A24A 3FZ4A 3E3EA 4V2MA 3UARA 3VI5A 1SJZA 4F9ZA 2AYTA 4I2UA 22GSA 4IN0A 2GT6A 3FEUA 3KP9A 1T7PB 3TJBA 1TOFA 2GQMA 2KOKA 3O76A 5G1KA 1GSUA 5B6NA 2LJAA 4N0ZA 2GLRA 3FR3A 1B9YC 4MPGA 1XIYA 3ERWA 5G5FA 1Q4JA 1Z7PA 2H70A 1JZDA 2EIQA 2H1GA 1QK8A 4G19A 3LYPA 2DJ3A 2XBIA 5G31A 4ECIA 2PGTA 1QFNA 3QMXA 2CVDA 5CREA 2F8FA 4RI6A 4MJCA 4IS0A 1W4VA 4IKHA 1G0TA 1TRUA 1EP8A 3MNGA 1NW2A 5D93A 4A5PA 2VCXA 2ZUPA 1B4PA 1YZXA 1Y6EA 1CQGA 3L9UA 2HE3A 3R2QA 1IYHA 1ST9A 1K0DA 2X8CA 3EPTA 3ZMKA 1EP7A 4WXTA 1K3YA 2FHEA 2GSTA 2JZTA 4PURA 3EVIA 2HLSA 5ECOB 4N11A 4WF5A 5G1LA 2V6KA 1M0UA 3VI7A 4O5RA 1Y25A 1U3IA 4MNNA 2VCZA 4ECCA 5D9VA 3FZ5A 2GS3A 1PX6A 3GL3A 2H71A 4HU7A 1SU9A 3Q18A 3MDKA 2VLVA 3GRXA 3HD5A 2H1AA 2MMAA 4K5RA 3EE2A 2C4JA 4HQZA 5F8BA 4POMA 3IDVA 1U88A 2YZHA 1QQ2A 2NDOA 3CSJA 4KF9A 3ZFLA 1XW9A 5CAXA 2F9SA 2CZ2A 2R0PA 4XRAA 3PPUA 1PMTA 5D9WA 1ML6A 5DAKA 4MF7A 1MEKA 3HY2A 3HJMA 2V41A 2VL2A 2PMTA 4KDUA 4NV5A 4BL7A 5KN0A 1ZYPA 3UVTA 3HVXA 3HYPA 5IO0A 4CW9A 4KSOA 4MP4A 1VRSD 4MF6A 2FA8A 5EL8A 3DVXA 3GTUA 5JCGA 2BTOT 5A4WA 5FT3A 2P5RA 3M9JA 4YKFA 5HQPA 2C80A 2WZ9A 6GSVA 13GSA 3LGCA 4G0IA 5KN1A 1XVQA 3FHKA 4K0NA 4P3YB 2A2PA 4MJBA 2XC2A 1R5AA 4GWRA 1TU7A 4EE0A 3KXOA 1GL8A 2V2GA 5AIVA 1YF0A 2D2ZA 4BIKA 1XFLA 1XWGA 3ZVJA 2R2JA 4HZ4A 5IIZA 2I81A 4TOPA 3QCPA 1WJKA 5AISA 5CRDA 1WWJA 4K2XA 3HXSA 2WGRA 2WDUA 1MD4A 1EEMA 4ICYA 1FOHA 4ZB6A 1TDIA 2LNTA 1FW1A 2PBJA 2X8HA 3J7Yk 5ECKB 1N8JA 2F51A 2P0GA 1PL1A 2H8LA 2IMDA 2AUVA 4KE3A 1X5EA 2RIIA 4KNDA 4ML1A 1MDJA 2YCDA 1AW9A 2MBTA 1DSBA 5ECLB 2O8VB 3F6FA 5ELAA 3H93A 2VCVA 3EYTA 3S9FA 4ILFA 4D73B 5F06A 3FZ9A 2IJYA 4KB3A 1JZOA 4XS6A 4MH3A 6GSTA 1G7EA 3HZ8A 1GP1A 3RBTA 1NHYA 4IJIA 1V98A 5DQSA 3FZAA 5D96A 5IMVA 3MSZA 3ZRDA 4TR4A 3DXBA 2WCIA 3GHAA 4HOJA 3TCOA 3LEFA 2CT6A 5J9BA 3GFKA 2AV4A 2GZZA 3TB2A 2DIYA 4WF4A 1FOVA 4G2EA 2CVKA 4CDOA 1TRSA 4MZWA 2LRNA 3MIXA 4WR4A 1BAYA 3ZIJA 2LUSA 2YZUA 1B8XA 3IHGA 4NAXA 1M9BA 4ZILA 3L78A 4PGTA 2CQ9A 3IC8A 1K0OA 3C1SA 3KH9A 3HA9A 3V1WA 3LXTA 4Z2UA 1EV9A 4J56E 1ERUA 2E0QA 1Z6MA 5CP1A 4TR1A 2IIYA 4OD7A 4I5QA 3UBKA 6GSSA 10GSA 4IGJA 1F37A 5HR1A 4O32A 1A2JA 3TKRA 4V1Ag 1SL2B 19GSA 2VM1A 3CSHA 3HCZA 3IPZA 1HNAA 1BYEA 4GQCA 2GQKA 3DMLA 3BD2A 2H0GA 4F82A 4PTSA 4YKGA 3IK9A 3KMOA 1IYIA 1V57A 4NHZA 3DIEA 1T8EB 4FYBA 4GF0A 4Z7XA 1XOBA 1XOAA 2YP6A 4GSSA 5IM9A 3KIJA 5IPGA 2H66A 1EZKA 2OE3A 3TKQA 5DJMA 1FB0A 4CY8A 4XS4A 2WS2A 4O5UA 5ECRB 2YJ7A 1YKAA 1SD9A 5IOWA 4NHWA 2XHFA 1G7OA 2IL3A 4K7IA 5HFGA 3ZIVA 3GKKA 2HFDA 5ID2B 2LRTA 4MA9A 3HKRA 3CTGA 2IMFA 5H5SA 3LG6A 1O81A 4ZBBA 3K8NA 5G5EA 1OAZA 2H01A 3LSZA 4L0UA 1CQHA 3NIVA 3F3QA 5IMCA 4NPBA 2BJXA 2VLUA 3CTFA 2VL2C 5LNKe 2M72A 3DD3A 4HJ2A 1SKSB 1S3RA 1KNGA 1OC3A 2FWHA 12GSA 3WGDA 4Z2TA 9GSSA 4GCIA 2E7PA 5ECIB 1GSSA 2OJLA 4KX4A 5E59A 4PXOA 1PQNA 5B8AA 5J41A 2WULA 4FYUA 3FK8A 4RI7A 2I4AA 1U3AA 1RQMA 4IVFA 4EVMA 4PNGA 4V2LA 3KCMA 4Q5QA 2HRFA 2MMNA 1NHOA 4FH8A 4O7HA 4MF5A 2A2SA 4KUNA 4N0VA 1OYJA 4ZL8A 1UN2A 3HVVA 2O7KA 4JR4A 4ML6A 4PQ1A 3DYRA 5CO3A 3FW2A 3G7YA 3IAS2 3EWLA 5ABRA 2C1YA 4I97A 1FAAA 2DJ2A 3KMNA 3F4TA 2G0FA 2YWOA 3BJ5A 1FG4A 3A2XA 2HRAA 1SL0B 3TDGA 3UJ1A 5J4UA 4J2FA 1KEBA 2C0EA 1TK0B 4KCEA 2OKAA 2DJJA 1SYXA 2L57A 2DC5A 2DJKA 3MAKA 4DEJA 3ED3A 1M2AA 4E8HA 2IFQB 1E2YA 2NBSA 1LU4A 3IHQA 7GSSA 3GA4A 2DJ1A 5J9CA 1XWBA 2HSHA 3HHVA 2QGVA 3VWWA 4K0GA 1SKRB 3C1RA 4MDCA 3ME8A 2GT5A 3GH9A 5INYA 1X5CA 1ZL9A 2A4VA 2JACA 2YJHA 4DVCA 1U87A 2E2GA 2K6VA 5IO2A 3M0FA 2VOCA 4GLTA 4AJ6A 2VO4A 3A3TA 1XXUA 3DKSA 1ZMAA 5ECPB 2PN8A 1TJDA 1Q98A 3ZZXA 2DJ0A 1K0CA 1ACVA 3KJYA 2CAQA 4X1UA 4TRXA 2L6CA 4HUAA 4NV2A 1BG5A 4EF0A 1VGLA 3GV1A 3GIXA 4G9HA 1M7TA 1Z7RA 3D5JA 3UAPA 4OO5A 11GSA 3UEMA 2GTUA 4OO4A 4BVXB 2L4CA 1T1VA 3CRUA 2CX3A 3O3TA 1ZYNA 1YEPA 5ENUA 2L6DA 2DBCA 3GKXA 2JSZA 2HZEB 3W8JA 1YJ6A 2E2MA 3KTBA 3GYKA 1SENA 1H75A 2G2QA 3GKNA 3D6IA 3DGQA 4IJ3A 3IV4A 2L5LA 3G7JA 1TRWA 5GAPD 2VLTA 3QD9A 1TTZA 3Q6OA 2LRCA 2AJQB 1PX7A 1THXA 3HVSA 2REMA 5B7CA 1M3JA 1HYUA 4AJ7A 1ON4A 3L0HA 1OE7A 1PA3A 2OE0A 3I6AA 2DMLA 1PL2A 1R5PA 2CA8A 3CRTA 1KBNA 3EURA 1AXDA 2GSSA 3M3MA 4RQXA 5ECSA 4ZL7A 2YWNA 2KP1A 2H6ZA 5C00A 1X5DA 4F0CA 1AQWA 4HJMA 3BCKA 4GTUA 2X99A 4TVEA 3KM6A 4Q5FA 1OC9B 2WB9A 4PUAA 2H0HA 3F4SA 2HRKA 2BMXA 3D0ZA 4MJAA 2RM6A 3Q74A 4JZQA 3APSA 4EIPA 3EU3A 4TXVA 3LORA 1W89A 1T4ZA
chains in the Genus database with same CATH topology
1RK4A 5F05A 2GVPA 2YPMA 5EY6A 3SWLA 1M99A 3CMIA 1TXXA 1EOHA 4HZ2A 4LMVA 3BOAA 3PH9A 3ZL5A 5CRGA 1M2DA 18GSA 3GKMA 4K6XA 2FY6A 3LFLA 4L5LA 4KH7A 1EGOA 2VAFA 1ZZYA 3L9SA 1GUMA 5GZZB 4POKA 4JRRA 5KN3A 5B6MA 1LBKA 2JU5A 2OE1A 5HR0A 4AF2A 2L5OA 2R4VA 5ECQB 1JFUA 16GSA 2WRTA 4MMMA 4JE1A 2V32A 4CY6A 4MPFA 1PKZA 3IK7A 5CNWA 2VCQA 1WMJA 1XW5A 3PGTA 2N5FA 4OMVA 3ME7A 3F3RA 4ULXA 1R7HA 2X49A 3GNJA 4X4JA 1VF4A 1V9WA 4JEDA 5CRWA 3H4KA 3FYGA 1AUCA 1JLWA 1BJXA 1SD8A 3KH7A 2B5YA 4LL1B 2OBIA 5DBQA 1EOGA 3TKSE 2LNSA 4D73A 3LQ7A 3UMAA 3L4NA 2CAIA 3ERGA 1YEXA 4I6XA 1F3BA 2PVQA 4E8EA 4V2NA 4DSSB 17GSA 4LA1A 5ECMB 2KUCA 5KOXA 3I9V2 4EIQA 1XPVA 5GSTA 5ELGA 3QPMA 2C3TA 1BQ7A 1FB6A 4EO3A 3QFAC 4PUFC 3F8UA 4Q5RA 2A2RA 4K2DA 5BRTA 1G6WA 2PUKC 1X9MB 1HD2A 2HSYA 5D9XA 2L4QA 4YH2A 4EL1A 3PINA 1O8WA 1GNWA 3VK9A 1ERVA 1EWXA 4L5OA 2DKHA 2CZ3A 1A0FA 3W8SA 4ECJA 2K8SA 3KEBA 1SK0A 1ZGNA 3SBCA 3WGXA 1C72A 1A0RP 2QA2A 3GMFA 3IBHA 1V40A 2IMIA 1ZOFA 2B5XA 4ECBA 4LLRA 2H76A 3TGZA 2HI7A 5GSSA 4K1FA 1I5GA 3E9JB 2MZCA 4EDYA 5DCGA 2MMOA 5B8BA 5JWRB 2R5GA 1H4OA 2FWEA 4G0LA 3HDCA 3QR6A 4N10A 1SK1A 2FGXA 4KGIA 1PGTA 1B9XC 3W6GA 2VUPA 4ZBAA 4ZB8A 3TKSA 2YV7A 2GZPA 4ID0A 4J57E 1GNEA 5JWOB 4QL9A 4NWYA 1DE1A 4PX1A 4EDZA 2I3YA 2Z9SA 5IQYA 2K9FA 1GWCA 2N5AA 1MDKA 3ZTLA 3APOA 1GULA 3N5OA 3APQA 5HFKA 5H5QA 3NZNA 1M9AA 3VPTA 2CV4A 2H30A 3F63A 2LJRA 5ID2A 1K0BA 2JZRA 1ERTA 1GTIA 2YWIA 1WP0A 2H19A 3AY8A 5AN1A 3ISOA 1F2EA 4KAEA 2LJKA 1B4QA 5F07A 1GSFA 1GSDA 3M9KA 5EVOA 3TRQA 1A8LA 4KCAA 4O5QA 2FUG2 2JSYA 3D22A 4BWSA 2QSIA 2ZNMA 1AIUA 2FD3A 1ZYEA 2VL9A 2F8AA 2QA1A 1PKWA 1XWAA 1GTAA 4TXOB 6GSXA 5DDLA 5KN2A 5IMDA 2I1UA 1R26A 1YDKA 5JCWA 3FRCA 2MBSA 2IN3A 4O92A 1VF2A 2ON5A 1AC1A 5KEJA 2TRCP 6GSYA 5DALB 4F2IA 4WR5A 2GZYA 2FNOA 3KZQA 2TRXA 2JL4A 4XRDA 1THOA 2XBQA 2KHPA 1TW9A 2AB6A 2NTOA 2VD0A 2JZSA 4K7OA 3TRXA 4XS1A 5DVBA 3TOTA 3J7Yb 1KTEA 2O87A 2I9HA 1RW1A 1YY7A 3H8QA 4FO5A 4XIHA 3IAM2 1AQXA 2EIOA 1GUHA 3DEXA 4AGSA 3ZFBA 3D4TA 1UA5A 3QFBC 2P5QA 4FIWA 4OFNA 2LV3A 2H1DA 4RQRA 2PVOC 2J9HA 3BBYA 4HQSA 1O7UA 3GX0A 2NPBA 3C7MA 1AQVA 3TUEA 3OR5A 3VWXA 5DJLA 3U5RE 4V1Ap 2PERA 1SK2A 3DRNA 4L8EA 3KTLA 2IFQA 1XW6A 4YAPA 3HJPA 5H5RA 2LSTA 2NVLA 2M80A 3DVWA 3US3A 3QOUA 2XPDA 4I8BA 3RHBA 5DQYA 2OACA 3CXGA 4K8MA 3N9JA 1O85A 2KP2A 3EMPA 4MLYA 3UBLA 1BEDA 3CSIA 3TJFA 1Z6NA 3HZ4A 3EMXA 3QAVA 4POBA 2F3MA 3TOUA 4ZBDA 1TP9A 2YWMA 5E4WA 3A2WA 3L9VA 5COHA 2H73A 2B5EA 1N2AA 1J9BA 4BVYB 4DSQA 4CHSA 1TI1A 3BCIA 4LMWA 3A5WA 3RHCA 3GL5A 1S3DA 5G30A 3P2AA 4IP6A 4BA7A 2TIRA 4BVXA 4MZBA 1T4YA 3QAWA 1K0AA 4IQ1A 1Z9HA 3U6VA 1J08A 3LW9A 4NMUA 3ZMLA 1MDIA 3VPQA 1HNCA 2HZEA 5ECHB 5A4VA 2V1MA 3VFIA 3FY7A 8GSSA 4MABA 1T00A 1K0NA 1MTCA 1DUGA 2GSQA 2N5BA 1J0FA 1URMA 1TI3A 1GRXA 4ZIJA 2HRNA 1HNBA 5DCHA 4IW9A 2VIMA 2DLXA 5C04A 2C0GA 3IE3A 4YQUA 3TKSC 5FWGA 2VD1A 3FMWA 1XVWA 3O6TA 1UVZA 4OWYA 3H1NA 5J5NA 2OBKA 2HYXA 2LKUA 4JU5A 2MMZA 2HT9A 3FKFA 1GLQA 4RUVA 1X9WB 3I69A 4GRFA 1DE2A 1X9SB 4WBRD 4WEYA 3ERFA 4POLA 4JBBA 3A5IA 1OC9A 1F9MA 2LTKA 1JHBA 4N30A 4PQHA 3EINA 1OVNA 2RUEA 3ZYWA 3QAGA 2J23A 5D9TA 4K5SA 2V6OA 2B1LA 5GAND 1I9DA 2C3NA 4EUYA 2DSAA 5IPHA 4NXIA 5D73A 3UIWA 4QQ7A 2R6KA 5AGYA 2LS5A 2B1KA 2K8VA 3EC3A 3LXZA 5IMFA 4JR6A 5DAKB 3IA1A 2WFCA 2FWGA 4WETA 1QGVA 3RDWA 3G9BA 3GURA 4BL7B 3F0IA 3WGEA 2DIZA 1EGRA 4OFTA 2XPEA 1V2AA 3ZREA 3GTUB 4XCSA 1S3AA 3IC4A 6GSWA 1LJRA 2A4HA 4KDYA 3JCML 3EU4A 1GH2A 1DBYA 1EEJA 5JWQB 3PR8A 4TN8A 2C3QA 3VURA 2YANA 1JZWA 3IXRA 1USBA 2CX4A 2EC4A 5BMUA 2AAWA 2HNLA 2B7JA 2ES7A 2GDRA 2X64A 1FVJA 4KW6A 1GSYA 1SYRA 1K3OA 1PRXA 1A23A 1VF1A 3M8NA 1QUWA 4HU9A 3UOMA 2VL3A 2R0CA 1ZCPA 3LYKA 1XZOA 3TJGA 5KOWA 5A4UA 4DSSA 1SJ6A 5J3RA 2O85A 2H75A 2FWFA 4EC0A 4BWQA 4TW5A 5JCUA 1GUKA 5L71A 5LCZA 1Z5YE 4ISDA 3GUSA 4MJEA 3TRPA 4K7NA 3VLNA 4TR3A 5HFIA 3F9UA 3MWHA 4HEA2 2H0IA 4MZCA 5LD0A 4Z2RA 1F6MC 3A2VA 1PN9A 1QMVA 2FA4A 3CBUA 1R4WA 5EPFA 1FO5A 1FVKA 3TJJA 3ZITA 1S3CA 1VF3A 20GSA 1WOUA 4EKZA 2L59A 3TJKA 3LJRA 3GSSA 1YF1A 2X4AA 4IP1A 3KP8A 2P31A 2R3XA 14GSA 2CVBA 2GGTA 1QXHA 1BX9A 2R37A 1WIKA 1TRVA 3WT2A 2RM5A 1XWKA 2WJUA 1GLPA 2R0GA 2JADA 2YV9A 2O89A 1ABAA 3IOSA 4OFMA 3ZLPA 4MCUA 3F4RA 1SL1B 2VCTA 4GSTA 1YQ1A 4XHMA 3H79A 3LWAA 5IOXA 1XWCA 4FYCA 4BPYA 1OKDA 4K9ZA 2H6YA 3KGKA 3UL3A 1ILOA 3IR4A 4KA0A 1MD3A 1YKCA 1A2LA 5G2ZA 4TR1B 4MK3A 2GQLA 1UC7A 4GSNA 5D8IA 1TKDB 4IBPA 1ERWA 4KSMA 3D4MA 1M2BA 2HSMA 3ZVJD 4IQAA 3M1GA 4WKWA 4L0WA 1B48A 2IWTA 1F3AA 3CYNA 2KLXA 1T3BA 3DWVA 4LL4B 1GTBA 1TK8B 4IHUA 4DSRA 3C8EA 5IMAA 1NSWA 1TU8A 1G6YA 1NM3A 2IMKA 3D21A 4TR0A 1WPIA 4HS1A 3FR6A 2MYGA 3KD0A 1WRYA 4TXOA 2OA7A 4HI7A 2B3SA 2C0FA 2B6MA 2YN1A 4HDEA 2VM2A 2B7KA 4XS4B 2PWJA 1A8YA 3P90A 4IELA 1XBSA 1Z3EA 2PPTA 4OCEA 1OC8A 5DALA 4ZL9A 5AIXA 2AHEA 5ECNB 1O6JA 3C71A 4YAVA 3VWVA 4EXJA 3GN3A 5IMZA 3FR9A 3Q19A 5A5KA 2YNXA 4KDXA 1E6BA 1PD21 4FQUA 3F6DA 1JLVA 2UZ8A 4ACSA 2H1BA 1O73A 1GSQA 1TK5B 1A2MA 2IPAA 1SKWB 3HJOA 4I2TA 2QKEA 6GSUA 2HXKA 4X43A 3P7XA 2C8UA 2M46A 1FHEA 3RPPA 1OE8A 1XCCA 1OKTA 2ALBA 1GSEA 2QC7A 3C73A 3TKPA 4F03A 3GX8A 3RAZA 1WE0A 4GQFA 2ZCTA 3WT1A 1SJIA 2EIRA 2PU9C 1AAZA 4USSA 4GXZA 4WBJA 1K3LA 4F0BA 1V58A 4YQMA 5CYYA 1ZYQB 2HZFA 3WYWA 2K18A 1EV4A 2LEGA 2IMEA 4PNFA 2DMMA 4ZB9A 3VWUA 4YQVA 3IRAA 2RLIA 4AJ8A 3E0UA 3WD6A 1PN0A 4H86A 2FLSA 4G10A 2ON7A 3I43A 4MH2A 5HR2A 2H74A 3P8WA 4TKYA 5HR3A 3QDNA 4Q5NA 1GTUA 2H72A 2C0DA 1K0MA 5FHIA 3MYDA 3NOFA 4G0KA 3GH6A 2X8GA 1X0RA 2LQOA 4X0XA 5F0GA 4PQIA 2YOIA 4XTSA 1O8XA 2VCWA 4QL7A 2OADA 1JZRA 3G7IA 1PSQA 4BVYA 3UVHA 2FCHA 4ZXGA 2RUFA 2DKIA 3GSTA 2H6XA 1HQOA 2LQQA 4OCFA 3RPNA 1U6TA 3R3EA 5CRHA 2GSRA 1A24A 3FZ4A 3E3EA 4V2MA 3UARA 3VI5A 1SJZA 4F9ZA 2AYTA 4I2UA 22GSA 4IN0A 2GT6A 3FEUA 3KP9A 1T7PB 3TJBA 1TOFA 2GQMA 2KOKA 3O76A 5G1KA 1GSUA 5B6NA 2LJAA 4N0ZA 2GLRA 3FR3A 1B9YC 4MPGA 1XIYA 3ERWA 5G5FA 1Q4JA 1Z7PA 2H70A 1JZDA 2EIQA 2H1GA 1QK8A 4G19A 3LYPA 2DJ3A 2XBIA 5G31A 4ECIA 2PGTA 1QFNA 3QMXA 2CVDA 5CREA 2F8FA 4RI6A 4MJCA 4IS0A 1W4VA 4IKHA 1G0TA 1TRUA 1EP8A 3MNGA 1NW2A 5D93A 4A5PA 2VCXA 2ZUPA 1B4PA 1YZXA 1Y6EA 1CQGA 3L9UA 2HE3A 3R2QA 1IYHA 1ST9A 1K0DA 2X8CA 3EPTA 3ZMKA 1EP7A 4WXTA 1K3YA 2FHEA 2GSTA 2JZTA 4PURA 3EVIA 2HLSA 5ECOB 4N11A 4WF5A 5G1LA 2V6KA 1M0UA 3VI7A 4O5RA 1Y25A 1U3IA 4MNNA 2VCZA 4ECCA 5D9VA 3FZ5A 2GS3A 1PX6A 3GL3A 2H71A 4HU7A 1SU9A 3Q18A 3MDKA 2VLVA 3GRXA 3HD5A 2H1AA 2MMAA 4K5RA 3EE2A 2C4JA 4HQZA 5F8BA 4POMA 3IDVA 1U88A 2YZHA 1QQ2A 2NDOA 3CSJA 4KF9A 3ZFLA 1XW9A 5CAXA 2F9SA 2CZ2A 2R0PA 4XRAA 3PPUA 1PMTA 5D9WA 1ML6A 5DAKA 4MF7A 1MEKA 3HY2A 3HJMA 2V41A 2VL2A 2PMTA 4KDUA 4NV5A 4BL7A 5KN0A 1ZYPA 3UVTA 3HVXA 3HYPA 5IO0A 4CW9A 4KSOA 4MP4A 1VRSD 4MF6A 2FA8A 5EL8A 3DVXA 3GTUA 5JCGA 2BTOT 5A4WA 5FT3A 2P5RA 3M9JA 4YKFA 5HQPA 2C80A 2WZ9A 6GSVA 13GSA 3LGCA 4G0IA 5KN1A 1XVQA 3FHKA 4K0NA 4P3YB 2A2PA 4MJBA 2XC2A 1R5AA 4GWRA 1TU7A 4EE0A 3KXOA 1GL8A 2V2GA 5AIVA 1YF0A 2D2ZA 1XFLA 1XWGA 3ZVJA 2R2JA 4HZ4A 5IIZA 2I81A 4TOPA 3QCPA 1WJKA 5AISA 5CRDA 1WWJA 4K2XA 3HXSA 2WGRA 2WDUA 1MD4A 1EEMA 4ICYA 1FOHA 4ZB6A 1TDIA 2LNTA 1FW1A 2PBJA 2X8HA 3J7Yk 5ECKB 1N8JA 2F51A 2P0GA 1PL1A 2H8LA 2IMDA 2AUVA 4KE3A 1X5EA 2RIIA 4KNDA 4ML1A 1MDJA 2YCDA 1AW9A 2MBTA 1DSBA 5ECLB 2O8VB 3F6FA 5ELAA 3H93A 2VCVA 3EYTA 3S9FA 4ILFA 4D73B 5F06A 3FZ9A 2IJYA 4KB3A 1JZOA 4XS6A 4MH3A 6GSTA 1G7EA 3HZ8A 1GP1A 3RBTA 1NHYA 4IJIA 1V98A 5DQSA 3FZAA 5D96A 5IMVA 3MSZA 3ZRDA 4TR4A 3DXBA 2WCIA 3GHAA 4HOJA 3TCOA 3LEFA 2CT6A 5J9BA 3GFKA 2AV4A 2GZZA 3TB2A 2DIYA 4WF4A 1FOVA 4G2EA 2CVKA 4CDOA 1TRSA 4MZWA 2LRNA 3MIXA 4WR4A 1BAYA 3ZIJA 2LUSA 2YZUA 1B8XA 3IHGA 4NAXA 1M9BA 4ZILA 3L78A 4PGTA 2CQ9A 3IC8A 1K0OA 3C1SA 3KH9A 3HA9A 3V1WA 3LXTA 4Z2UA 1EV9A 4J56E 1ERUA 2E0QA 1Z6MA 5CP1A 4TR1A 2IIYA 4OD7A 4I5QA 3UBKA 6GSSA 10GSA 4IGJA 1F37A 5HR1A 4O32A 1A2JA 3TKRA 4V1Ag 1SL2B 19GSA 2VM1A 3CSHA 3HCZA 3IPZA 1HNAA 1BYEA 4GQCA 2GQKA 3DMLA 3BD2A 2H0GA 4F82A 4PTSA 4YKGA 3IK9A 3KMOA 1IYIA 1V57A 4NHZA 3DIEA 1T8EB 4FYBA 4GF0A 4Z7XA 1XOBA 1XOAA 2YP6A 4GSSA 5IM9A 3KIJA 5IPGA 2H66A 1EZKA 2OE3A 3TKQA 5DJMA 1FB0A 4CY8A 4XS4A 2WS2A 4O5UA 5ECRB 2YJ7A 1YKAA 1SD9A 5IOWA 4NHWA 2XHFA 1G7OA 2IL3A 4K7IA 5HFGA 3ZIVA 3GKKA 2HFDA 5ID2B 2LRTA 4MA9A 3HKRA 3CTGA 2IMFA 5H5SA 3LG6A 1O81A 4ZBBA 3K8NA 5G5EA 1OAZA 2H01A 3LSZA 4L0UA 1CQHA 3NIVA 3F3QA 5IMCA 4NPBA 2BJXA 2VLUA 3CTFA 2VL2C 5LNKe 2M72A 3DD3A 4HJ2A 1SKSB 1KNGA 1OC3A 2FWHA 12GSA 3WGDA 4Z2TA 9GSSA 4GCIA 2E7PA 5ECIB 1GSSA 2OJLA 4KX4A 5E59A 4PXOA 1PQNA 5B8AA 5J41A 2WULA 4FYUA 3FK8A 4RI7A 2I4AA 1U3AA 1RQMA 4IVFA 4EVMA 4PNGA 4V2LA 3KCMA 4Q5QA 2HRFA 2MMNA 1NHOA 4FH8A 4O7HA 4MF5A 2A2SA 4KUNA 4N0VA 1OYJA 4ZL8A 1UN2A 3HVVA 2O7KA 4JR4A 4ML6A 4PQ1A 3DYRA 5CO3A 3FW2A 3G7YA 3IAS2 3EWLA 5ABRA 2C1YA 4I97A 1FAAA 2DJ2A 3KMNA 3F4TA 2G0FA 2YWOA 3BJ5A 1FG4A 3A2XA 2HRAA 1SL0B 3TDGA 3UJ1A 5J4UA 4J2FA 1KEBA 2C0EA 1TK0B 4KCEA 2OKAA 2DJJA 1SYXA 2L57A 2DC5A 2DJKA 3MAKA 4DEJA 3ED3A 1M2AA 4E8HA 2IFQB 1E2YA 2NBSA 1LU4A 3IHQA 7GSSA 3GA4A 2DJ1A 5J9CA 1XWBA 2HSHA 3HHVA 2QGVA 3VWWA 4K0GA 1SKRB 3C1RA 4MDCA 3ME8A 2GT5A 3GH9A 5INYA 1X5CA 1ZL9A 2A4VA 2JACA 2YJHA 4DVCA 1U87A 2E2GA 2K6VA 5IO2A 3M0FA 2VOCA 4GLTA 4AJ6A 2VO4A 3A3TA 1XXUA 3DKSA 1ZMAA 5ECPB 2PN8A 1TJDA 1Q98A 3ZZXA 2DJ0A 1K0CA 1ACVA 3KJYA 2CAQA 4X1UA 4TRXA 2L6CA 4HUAA 4NV2A 1BG5A 4EF0A 1VGLA 3GV1A 3GIXA 4G9HA 1M7TA 1Z7RA 3D5JA 3UAPA 4OO5A 11GSA 3UEMA 2GTUA 4OO4A 4BVXB 2L4CA 1T1VA 3CRUA 2CX3A 3O3TA 1ZYNA 1YEPA 5ENUA 2L6DA 2DBCA 3GKXA 2JSZA 2HZEB 3W8JA 1YJ6A 2E2MA 3KTBA 3GYKA 1SENA 1H75A 2G2QA 3GKNA 3D6IA 3DGQA 4IJ3A 3IV4A 2L5LA 3G7JA 1TRWA 5GAPD 2VLTA 3QD9A 1TTZA 3Q6OA 2LRCA 2AJQB 1PX7A 1THXA 3HVSA 2REMA 5B7CA 1HYUA 4AJ7A 1ON4A 3L0HA 1OE7A 1PA3A 2OE0A 3I6AA 2DMLA 1PL2A 1R5PA 2CA8A 3CRTA 1KBNA 3EURA 1AXDA 2GSSA 3M3MA 4RQXA 5ECSA 4ZL7A 2YWNA 2KP1A 2H6ZA 5C00A 1X5DA 4F0CA 1AQWA 4HJMA 3BCKA 4GTUA 2X99A 4TVEA 3KM6A 4Q5FA 1OC9B 2WB9A 4PUAA 2H0HA 3F4SA 2HRKA 2BMXA 3D0ZA 4MJAA 2RM6A 3Q74A 4JZQA 3APSA 4EIPA 3EU3A 4TXVA 3LORA 1W89A 1T4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RK4 A;  5F05 A;  2GVP A;  2YPM A;  5EY6 A;  3SWL A;  1M99 A;  3CMI A;  1TXX A;  1EOH A;  4HZ2 A;  4LMV A;  3BOA A;  3PH9 A;  3ZL5 A;  5CRG A;  1M2D A;  18GS A;  3GKM A;  4K6X A;  2FY6 A;  3LFL A;  4L5L A;  4KH7 A;  1EGO A;  2VAF A;  1ZZY A;  3L9S A;  1GUM A;  5GZZ B;  4POK A;  4JRR A;  5KN3 A;  5B6M A;  1LBK A;  2JU5 A;  2OE1 A;  5HR0 A;  4AF2 A;  2L5O A;  2R4V A;  5ECQ B;  1JFU A;  16GS A;  2WRT A;  4MMM A;  4JE1 A;  2V32 A;  4MPF A;  1PKZ A;  3IK7 A;  5CNW A;  2VCQ A;  1WMJ A;  1XW5 A;  3PGT A;  2N5F A;  4OMV A;  3ME7 A;  3F3R A;  4ULX A;  1R7H A;  3GNJ A;  1VF4 A;  1V9W A;  4JED A;  5CRW A;  3H4K A;  3FYG A;  1AUC A;  1JLW A;  1BJX A;  1SD8 A;  3KH7 A;  2B5Y A;  4LL1 B;  2OBI A;  5DBQ A;  1EOG A;  3TKS E;  2LNS A;  4D73 A;  3LQ7 A;  3UMA A;  3L4N A;  2CAI A;  3ERG A;  1YEX A;  4I6X A;  1F3B A;  2PVQ A;  4E8E A;  4V2N A;  4DSS B;  17GS A;  4LA1 A;  5ECM B;  2KUC A;  3I9V 2;  1XPV A;  5GST A;  5ELG A;  3QPM A;  2C3T A;  1BQ7 A;  1FB6 A;  4EO3 A;  3QFA C;  4PUF C;  3F8U A;  4Q5R A;  2A2R A;  4K2D A;  1G6W A;  2PUK C;  1X9M B;  1HD2 A;  2HSY A;  5D9X A;  2L4Q A;  4YH2 A;  4EL1 A;  3PIN A;  1O8W A;  1GNW A;  3VK9 A;  1ERV A;  1EWX A;  4L5O A;  3W8S A;  2CZ3 A;  1A0F A;  4ECJ A;  2K8S A;  3KEB A;  1SK0 A;  1ZGN A;  3SBC A;  3WGX A;  1C72 A;  1A0R P;  3GMF A;  3IBH A;  1V40 A;  2IMI A;  1ZOF A;  2B5X A;  4ECB A;  4LLR A;  2H76 A;  3TGZ A;  2HI7 A;  5GSS A;  4K1F A;  1I5G A;  3E9J B;  2MZC A;  4EDY A;  5DCG A;  2MMO A;  5B8B A;  5JWR B;  2R5G A;  1H4O A;  2FWE A;  3HDC A;  3QR6 A;  4N10 A;  1SK1 A;  2FGX A;  4KGI A;  1PGT A;  1B9X C;  3W6G A;  2VUP A;  4ZBA A;  4ZB8 A;  3TKS A;  2YV7 A;  2GZP A;  4ID0 A;  4J57 E;  1GNE A;  5JWO B;  4QL9 A;  4NWY A;  1DE1 A;  4PX1 A;  4EDZ A;  2I3Y A;  2Z9S A;  5IQY A;  2K9F A;  1GWC A;  2N5A A;  1MDK A;  3ZTL A;  3APO A;  1GUL A;  3N5O A;  3APQ A;  5HFK A;  5H5Q A;  3NZN A;  1M9A A;  3VPT A;  2CV4 A;  2H30 A;  3F63 A;  2LJR A;  5ID2 A;  1K0B A;  2JZR A;  1ERT A;  1GTI A;  2YWI A;  1WP0 A;  2H19 A;  3AY8 A;  5AN1 A;  3ISO A;  1F2E A;  4KAE A;  2LJK A;  1B4Q A;  5F07 A;  1GSF A;  1GSD A;  3M9K A;  5EVO A;  3TRQ A;  1A8L A;  4KCA A;  2FUG 2;  2JSY A;  3D22 A;  4BWS A;  2QSI A;  2ZNM A;  1AIU A;  2FD3 A;  1ZYE A;  2VL9 A;  2F8A A;  1PKW A;  1XWA A;  1GTA A;  4TXO B;  6GSX A;  5DDL A;  5KN2 A;  5IMD A;  2I1U A;  1R26 A;  1YDK A;  5JCW A;  3FRC A;  2MBS A;  2IN3 A;  4O92 A;  1VF2 A;  2ON5 A;  1AC1 A;  5KEJ A;  2TRC P;  6GSY A;  5DAL B;  4F2I A;  4WR5 A;  2GZY A;  2FNO A;  3KZQ A;  2TRX A;  2JL4 A;  4XRD A;  1THO A;  2XBQ A;  2KHP A;  1TW9 A;  2AB6 A;  2NTO A;  2VD0 A;  2JZS A;  4K7O A;  3TRX A;  4XS1 A;  5DVB A;  3TOT A;  3J7Y b;  1KTE A;  2O87 A;  2I9H A;  1RW1 A;  1YY7 A;  3H8Q A;  4FO5 A;  4XIH A;  3IAM 2;  1AQX A;  2EIO A;  1GUH A;  3DEX A;  4AGS A;  3ZFB A;  3D4T A;  1UA5 A;  3QFB C;  2P5Q A;  4FIW A;  4OFN A;  2LV3 A;  2H1D A;  4RQR A;  2PVO C;  2J9H A;  3BBY A;  4HQS A;  1O7U A;  3GX0 A;  2NPB A;  3C7M A;  1AQV A;  3TUE A;  3OR5 A;  3VWX A;  5DJL A;  3U5R E;  4V1A p;  2PER A;  1SK2 A;  3DRN A;  4L8E A;  3KTL A;  2IFQ A;  1XW6 A;  4YAP A;  3HJP A;  5H5R A;  2LST A;  2NVL A;  2M80 A;  3DVW A;  3US3 A;  3QOU A;  2XPD A;  4I8B A;  3RHB A;  5DQY A;  2OAC A;  3CXG A;  4K8M A;  3N9J A;  1O85 A;  2KP2 A;  3EMP A;  4MLY A;  3UBL A;  1BED A;  3CSI A;  3TJF A;  1Z6N A;  3HZ4 A;  3EMX A;  3QAV A;  4POB A;  2F3M A;  3TOU A;  4ZBD A;  1TP9 A;  2YWM A;  5E4W A;  3A2W A;  3L9V A;  5COH A;  2H73 A;  2B5E A;  1N2A A;  1J9B A;  4DSQ A;  4CHS A;  1TI1 A;  3BCI A;  4LMW A;  3A5W A;  3RHC A;  3GL5 A;  1S3D A;  5G30 A;  3P2A A;  4IP6 A;  4BA7 A;  2TIR A;  4BVX A;  4MZB A;  1T4Y A;  3QAW A;  1K0A A;  4IQ1 A;  1Z9H A;  3U6V A;  1J08 A;  4NMU A;  3ZML A;  1MDI A;  3VPQ A;  1HNC A;  2HZE A;  5ECH B;  5A4V A;  2V1M A;  3VFI A;  3FY7 A;  8GSS A;  4MAB A;  1T00 A;  1K0N A;  1MTC A;  1DUG A;  2GSQ A;  2N5B A;  1J0F A;  1URM A;  1TI3 A;  1GRX A;  4ZIJ A;  2HRN A;  1HNB A;  5DCH A;  4IW9 A;  2VIM A;  2DLX A;  5C04 A;  2C0G A;  3IE3 A;  4YQU A;  3TKS C;  5FWG A;  2VD1 A;  1XVW A;  3O6T A;  1UVZ A;  4OWY A;  3H1N A;  5J5N A;  2OBK A;  2HYX A;  2LKU A;  4JU5 A;  2MMZ A;  2HT9 A;  3FKF A;  1GLQ A;  4RUV A;  1X9W B;  3I69 A;  4GRF A;  1DE2 A;  1X9S B;  4WBR D;  4WEY A;  3ERF A;  4POL A;  4JBB A;  1OC9 A;  1F9M A;  2LTK A;  1JHB A;  4N30 A;  4PQH A;  3EIN A;  1OVN A;  2RUE A;  3ZYW A;  3QAG A;  2J23 A;  5D9T A;  2V6O A;  2B1L A;  5GAN D;  1I9D A;  2C3N A;  4EUY A;  2DSA A;  5IPH A;  4NXI A;  5D73 A;  3UIW A;  4QQ7 A;  2R6K A;  5AGY A;  2LS5 A;  2B1K A;  2K8V A;  3EC3 A;  3LXZ A;  5IMF A;  4JR6 A;  5DAK B;  3IA1 A;  2WFC A;  2FWG A;  4WET A;  1QGV A;  3RDW A;  3G9B A;  3GUR A;  3F0I A;  3WGE A;  2DIZ A;  1EGR A;  4OFT A;  2XPE A;  1V2A A;  3ZRE A;  3GTU B;  4XCS A;  1S3A A;  3IC4 A;  6GSW A;  1LJR A;  4KDY A;  3JCM L;  3EU4 A;  1GH2 A;  1DBY A;  1EEJ A;  5JWQ B;  3PR8 A;  4TN8 A;  2C3Q A;  3VUR A;  2YAN A;  1JZW A;  3IXR A;  1USB A;  2CX4 A;  2EC4 A;  2AAW A;  2HNL A;  2B7J A;  2ES7 A;  2GDR A;  2X64 A;  1FVJ A;  4KW6 A;  1GSY A;  1SYR A;  1K3O A;  1PRX A;  1A23 A;  1VF1 A;  3M8N A;  1QUW A;  4HU9 A;  3UOM A;  2VL3 A;  1ZCP A;  3LYK A;  1XZO A;  3TJG A;  5A4U A;  4DSS A;  1SJ6 A;  5J3R A;  2O85 A;  2H75 A;  2FWF A;  4EC0 A;  4BWQ A;  4TW5 A;  5JCU A;  1GUK A;  5L71 A;  5LCZ A;  1Z5Y E;  4ISD A;  3GUS A;  4MJE A;  3TRP A;  4K7N A;  3VLN A;  4TR3 A;  5HFI A;  3F9U A;  3MWH A;  4HEA 2;  2H0I A;  4MZC A;  5LD0 A;  1F6M C;  3A2V A;  1PN9 A;  1QMV A;  2FA4 A;  3CBU A;  1R4W A;  5EPF A;  1FO5 A;  1FVK A;  3TJJ A;  3ZIT A;  1S3C A;  1VF3 A;  20GS A;  1WOU A;  4EKZ A;  2L59 A;  3TJK A;  3LJR A;  3GSS A;  1YF1 A;  4IP1 A;  3KP8 A;  2P31 A;  2R3X A;  14GS A;  2CVB A;  2GGT A;  1QXH A;  1BX9 A;  2R37 A;  1WIK A;  1TRV A;  3WT2 A;  2RM5 A;  1XWK A;  2WJU A;  1GLP A;  2JAD A;  2YV9 A;  2O89 A;  1ABA A;  3IOS A;  4OFM A;  3ZLP A;  4MCU A;  3F4R A;  1SL1 B;  2VCT A;  4GST A;  1YQ1 A;  4XHM A;  3H79 A;  3LWA A;  5IOX A;  1XWC A;  4FYC A;  4BPY A;  1OKD A;  4K9Z A;  2H6Y A;  3KGK A;  3UL3 A;  1ILO A;  3IR4 A;  4KA0 A;  1MD3 A;  1YKC A;  1A2L A;  5G2Z A;  4TR1 B;  4MK3 A;  2GQL A;  1UC7 A;  4GSN A;  5D8I A;  1TKD B;  4IBP A;  1ERW A;  4KSM A;  3D4M A;  1M2B A;  3ZVJ D;  4IQA A;  3M1G A;  4WKW A;  4L0W A;  1B48 A;  2IWT A;  1F3A A;  3CYN A;  2KLX A;  1T3B A;  3DWV A;  4LL4 B;  1GTB A;  1TK8 B;  4IHU A;  4DSR A;  3C8E A;  5IMA A;  1NSW A;  1TU8 A;  1G6Y A;  1NM3 A;  2IMK A;  3D21 A;  4TR0 A;  1WPI A;  4HS1 A;  3FR6 A;  2MYG A;  3KD0 A;  1WRY A;  4TXO A;  2OA7 A;  4HI7 A;  2B3S A;  2C0F A;  2B6M A;  2YN1 A;  4HDE A;  2VM2 A;  2B7K A;  4XS4 B;  2PWJ A;  1A8Y A;  3P90 A;  4IEL A;  1XBS A;  1Z3E A;  2PPT A;  4OCE A;  1OC8 A;  5DAL A;  4ZL9 A;  5AIX A;  2AHE A;  5ECN B;  1O6J A;  3C71 A;  4YAV A;  3VWV A;  4EXJ A;  3GN3 A;  5IMZ A;  3FR9 A;  3Q19 A;  5A5K A;  2YNX A;  4KDX A;  1E6B A;  1PD2 1;  3F6D A;  1JLV A;  4ACS A;  2H1B A;  1O73 A;  1GSQ A;  1TK5 B;  1A2M A;  2IPA A;  1SKW B;  3HJO A;  4I2T A;  2QKE A;  6GSU A;  2HXK A;  4X43 A;  3P7X A;  2C8U A;  2M46 A;  1FHE A;  3RPP A;  1OE8 A;  1XCC A;  1OKT A;  2ALB A;  1GSE A;  2QC7 A;  3C73 A;  3TKP A;  4F03 A;  3GX8 A;  3RAZ A;  1WE0 A;  4GQF A;  2ZCT A;  3WT1 A;  1SJI A;  2EIR A;  2PU9 C;  1AAZ A;  4GXZ A;  4WBJ A;  1K3L A;  4F0B A;  1V58 A;  4YQM A;  5CYY A;  1ZYQ B;  2HZF A;  3WYW A;  2K18 A;  1EV4 A;  2LEG A;  2IME A;  4PNF A;  2DMM A;  4ZB9 A;  3VWU A;  4YQV A;  3IRA A;  2RLI A;  4AJ8 A;  3E0U A;  3WD6 A;  4H86 A;  2FLS A;  4G10 A;  2ON7 A;  3I43 A;  4MH2 A;  5HR2 A;  2H74 A;  3P8W A;  4TKY A;  5HR3 A;  3QDN A;  4Q5N A;  1GTU A;  2H72 A;  2C0D A;  1K0M A;  5FHI A;  3NOF A;  3GH6 A;  2X8G A;  1X0R A;  2LQO A;  4X0X A;  5F0G A;  4PQI A;  2YOI A;  4XTS A;  1O8X A;  2VCW A;  4QL7 A;  2OAD A;  1JZR A;  3G7I A;  1PSQ A;  4BVY A;  3UVH A;  2FCH A;  4ZXG A;  2RUF A;  3GST A;  2H6X A;  1HQO A;  2LQQ A;  4OCF A;  3RPN A;  1U6T A;  5CRH A;  2GSR A;  1A24 A;  3FZ4 A;  3E3E A;  4V2M A;  3UAR A;  3VI5 A;  1SJZ A;  4F9Z A;  2AYT A;  4I2U A;  22GS A;  4IN0 A;  2GT6 A;  3FEU A;  3KP9 A;  1T7P B;  3TJB A;  1TOF A;  2GQM A;  2KOK A;  3O76 A;  5G1K A;  1GSU A;  5B6N A;  2LJA A;  4N0Z A;  2GLR A;  3FR3 A;  1B9Y C;  4MPG A;  1XIY A;  3ERW A;  5G5F A;  1Q4J A;  1Z7P A;  2H70 A;  1JZD A;  2EIQ A;  2H1G A;  1QK8 A;  4G19 A;  3LYP A;  2DJ3 A;  2XBI A;  5G31 A;  4ECI A;  2PGT A;  1QFN A;  3QMX A;  2CVD A;  5CRE A;  2F8F A;  4RI6 A;  4MJC A;  4IS0 A;  1W4V A;  4IKH A;  1G0T A;  1TRU A;  1EP8 A;  3MNG A;  1NW2 A;  5D93 A;  2VCX A;  2ZUP A;  1B4P A;  1YZX A;  1Y6E A;  1CQG A;  3L9U A;  2HE3 A;  3R2Q A;  1IYH A;  1ST9 A;  1K0D A;  2X8C A;  3ZMK A;  1EP7 A;  4WXT A;  1K3Y A;  2FHE A;  2GST A;  2JZT A;  4PUR A;  3EVI A;  2HLS A;  5ECO B;  4N11 A;  4WF5 A;  5G1L A;  2V6K A;  1M0U A;  3VI7 A;  4O5R A;  1Y25 A;  1U3I A;  2VCZ A;  4ECC A;  5D9V A;  3FZ5 A;  2GS3 A;  1PX6 A;  3GL3 A;  2H71 A;  4HU7 A;  1SU9 A;  3Q18 A;  3MDK A;  2VLV A;  3GRX A;  3HD5 A;  2H1A A;  2MMA A;  3EE2 A;  2C4J A;  4HQZ A;  5F8B A;  4POM A;  3IDV A;  1U88 A;  2YZH A;  1QQ2 A;  2NDO A;  3CSJ A;  3ZFL A;  5CAX A;  1XW9 A;  2F9S A;  2CZ2 A;  4XRA A;  1PMT A;  5D9W A;  1ML6 A;  5DAK A;  4MF7 A;  1MEK A;  3HY2 A;  3HJM A;  2V41 A;  2VL2 A;  2PMT A;  4KDU A;  4NV5 A;  4BL7 A;  5KN0 A;  3UVT A;  3HVX A;  3HYP A;  5IO0 A;  4CW9 A;  4KSO A;  4MP4 A;  1VRS D;  4MF6 A;  2FA8 A;  5EL8 A;  3DVX A;  3GTU A;  5JCG A;  2BTO T;  5A4W A;  5FT3 A;  2P5R A;  3M9J A;  5HQP A;  2C80 A;  2WZ9 A;  6GSV A;  13GS A;  3LGC A;  5KN1 A;  1XVQ A;  3FHK A;  4K0N A;  4P3Y B;  4MJB A;  2XC2 A;  1R5A A;  4GWR A;  1TU7 A;  4EE0 A;  3KXO A;  1GL8 A;  2V2G A;  5AIV A;  1YF0 A;  2D2Z A;  1XFL A;  1XWG A;  3ZVJ A;  2R2J A;  4HZ4 A;  5IIZ A;  2I81 A;  4TOP A;  3QCP A;  1WJK A;  5AIS A;  5CRD A;  1WWJ A;  3HXS A;  2WGR A;  2WDU A;  1MD4 A;  1EEM A;  4ZB6 A;  1TDI A;  2LNT A;  1FW1 A;  2PBJ A;  2X8H A;  3J7Y k;  5ECK B;  1N8J A;  2F51 A;  2P0G A;  1PL1 A;  2H8L A;  2IMD A;  2AUV A;  4KE3 A;  1X5E A;  2RII A;  4KND A;  4ML1 A;  1MDJ A;  2YCD A;  1AW9 A;  2MBT A;  1DSB A;  5ECL B;  2O8V B;  3F6F A;  5ELA A;  3H93 A;  2VCV A;  3EYT A;  3S9F A;  4ILF A;  4D73 B;  5F06 A;  3FZ9 A;  2IJY A;  4KB3 A;  1JZO A;  4XS6 A;  4MH3 A;  6GST A;  1G7E A;  3HZ8 A;  1GP1 A;  3RBT A;  1NHY A;  4IJI A;  1V98 A;  5DQS A;  3FZA A;  5D96 A;  5IMV A;  3MSZ A;  3ZRD A;  4TR4 A;  3DXB A;  2WCI A;  3GHA A;  4HOJ A;  3TCO A;  3LEF A;  2CT6 A;  5J9B A;  3GFK A;  2AV4 A;  2GZZ A;  3TB2 A;  2DIY A;  4WF4 A;  1FOV A;  4G2E A;  2CVK A;  4CDO A;  1TRS A;  4MZW A;  2LRN A;  4WR4 A;  1BAY A;  3ZIJ A;  2LUS A;  2YZU A;  1B8X A;  4NAX A;  1M9B A;  4ZIL A;  3L78 A;  4PGT A;  2CQ9 A;  1K0O A;  3C1S A;  3KH9 A;  3HA9 A;  3V1W A;  3LXT A;  1EV9 A;  4J56 E;  1ERU A;  2E0Q A;  1Z6M A;  5CP1 A;  4TR1 A;  2IIY A;  4OD7 A;  4I5Q A;  3UBK A;  6GSS A;  10GS A;  4IGJ A;  1F37 A;  5HR1 A;  4O32 A;  1A2J A;  3TKR A;  4V1A g;  1SL2 B;  19GS A;  2VM1 A;  3CSH A;  3HCZ A;  3IPZ A;  1HNA A;  1BYE A;  4GQC A;  2GQK A;  3DML A;  3BD2 A;  2H0G A;  4F82 A;  3IK9 A;  3KMO A;  1IYI A;  1V57 A;  4NHZ A;  3DIE A;  1T8E B;  4FYB A;  4GF0 A;  4Z7X A;  1XOB A;  1XOA A;  2YP6 A;  4GSS A;  5IM9 A;  3KIJ A;  5IPG A;  2H66 A;  1EZK A;  2OE3 A;  3TKQ A;  5DJM A;  1FB0 A;  4XS4 A;  2WS2 A;  5ECR B;  2YJ7 A;  1YKA A;  1SD9 A;  5IOW A;  4NHW A;  2XHF A;  1G7O A;  2IL3 A;  4K7I A;  5HFG A;  3ZIV A;  3GKK A;  2HFD A;  5ID2 B;  2LRT A;  4MA9 A;  3HKR A;  3CTG A;  2IMF A;  5H5S A;  3LG6 A;  1O81 A;  4ZBB A;  3K8N A;  5G5E A;  1OAZ A;  2H01 A;  3LSZ A;  4L0U A;  1CQH A;  3NIV A;  3F3Q A;  5IMC A;  4NPB A;  2BJX A;  2VLU A;  3CTF A;  2VL2 C;  5LNK e;  2M72 A;  3DD3 A;  4HJ2 A;  1SKS B;  1KNG A;  1OC3 A;  2FWH A;  12GS A;  3WGD A;  9GSS A;  4GCI A;  2E7P A;  5ECI B;  1GSS A;  2OJL A;  4KX4 A;  5E59 A;  4PXO A;  1PQN A;  5B8A A;  5J41 A;  2WUL A;  4FYU A;  3FK8 A;  4RI7 A;  2I4A A;  1U3A A;  1RQM A;  4IVF A;  4EVM A;  4PNG A;  4V2L A;  3KCM A;  4Q5Q A;  2HRF A;  2MMN A;  1NHO A;  4FH8 A;  4O7H A;  4MF5 A;  2A2S A;  4KUN A;  4N0V A;  1OYJ A;  4ZL8 A;  1UN2 A;  3HVV A;  2O7K A;  4JR4 A;  4ML6 A;  4PQ1 A;  3DYR A;  5CO3 A;  3FW2 A;  3G7Y A;  3IAS 2;  3EWL A;  5ABR A;  2C1Y A;  4I97 A;  1FAA A;  2DJ2 A;  3KMN A;  3F4T A;  2G0F A;  2YWO A;  3BJ5 A;  1FG4 A;  3A2X A;  1SL0 B;  3TDG A;  3UJ1 A;  5J4U A;  4J2F A;  1KEB A;  2C0E A;  1TK0 B;  4KCE A;  2OKA A;  2DJJ A;  1SYX A;  2L57 A;  2DC5 A;  2DJK A;  3MAK A;  4DEJ A;  3ED3 A;  1M2A A;  4E8H A;  2IFQ B;  1E2Y A;  2NBS A;  1LU4 A;  3IHQ A;  7GSS A;  3GA4 A;  2DJ1 A;  5J9C A;  1XWB A;  2HSH A;  3HHV A;  2QGV A;  3VWW A;  4K0G A;  1SKR B;  3C1R A;  4MDC A;  3ME8 A;  2GT5 A;  3GH9 A;  5INY A;  1X5C A;  1ZL9 A;  2A4V A;  2JAC A;  2YJH A;  4DVC A;  1U87 A;  2E2G A;  2K6V A;  5IO2 A;  3M0F A;  2VOC A;  4GLT A;  4AJ6 A;  2VO4 A;  3A3T A;  1XXU A;  3DKS A;  1ZMA A;  5ECP B;  2PN8 A;  1TJD A;  1Q98 A;  3ZZX A;  2DJ0 A;  1K0C A;  1ACV A;  3KJY A;  2CAQ A;  4X1U A;  4TRX A;  2L6C A;  4HUA A;  4NV2 A;  1BG5 A;  4EF0 A;  1VGL A;  3GV1 A;  3GIX A;  4G9H A;  1M7T A;  1Z7R A;  3D5J A;  3UAP A;  4OO5 A;  11GS A;  3UEM A;  2GTU A;  4OO4 A;  2L4C A;  1T1V A;  3CRU A;  2CX3 A;  3O3T A;  1YEP A;  5ENU A;  2L6D A;  2DBC A;  3GKX A;  2JSZ A;  2HZE B;  3W8J A;  1YJ6 A;  2E2M A;  3KTB A;  3GYK A;  1SEN A;  1H75 A;  2G2Q A;  3GKN A;  3D6I A;  3DGQ A;  4IJ3 A;  3IV4 A;  2L5L A;  3G7J A;  1TRW A;  5GAP D;  2VLT A;  3QD9 A;  1TTZ A;  3Q6O A;  2LRC A;  2AJQ B;  1PX7 A;  1THX A;  3HVS A;  2REM A;  5B7C A;  1HYU A;  4AJ7 A;  1ON4 A;  3L0H A;  1OE7 A;  1PA3 A;  2OE0 A;  3I6A A;  2DML A;  1PL2 A;  1R5P A;  2CA8 A;  3CRT A;  1KBN A;  3EUR A;  1AXD A;  2GSS A;  3M3M A;  4RQX A;  5ECS A;  4ZL7 A;  2YWN A;  2KP1 A;  2H6Z A;  5C00 A;  1X5D A;  4F0C A;  1AQW A;  4HJM A;  3BCK A;  4GTU A;  2X99 A;  4TVE A;  3KM6 A;  4Q5F A;  1OC9 B;  2WB9 A;  4PUA A;  2H0H A;  3F4S A;  2BMX A;  3D0Z A;  4MJA A;  2RM6 A;  3Q74 A;  4JZQ A;  3APS A;  3EU3 A;  4TXV A;  3LOR A;  1W89 A;  1T4Z A; 
#chains in the Genus database with same CATH topology
 1RK4 A;  5F05 A;  2GVP A;  2YPM A;  5EY6 A;  3SWL A;  1M99 A;  3CMI A;  1TXX A;  1EOH A;  4HZ2 A;  4LMV A;  3BOA A;  3PH9 A;  3ZL5 A;  5CRG A;  1M2D A;  18GS A;  3GKM A;  4K6X A;  2FY6 A;  3LFL A;  4L5L A;  4KH7 A;  1EGO A;  2VAF A;  1ZZY A;  3L9S A;  1GUM A;  5GZZ B;  4POK A;  4JRR A;  5KN3 A;  5B6M A;  1LBK A;  2JU5 A;  2OE1 A;  5HR0 A;  4AF2 A;  2L5O A;  2R4V A;  5ECQ B;  1JFU A;  16GS A;  2WRT A;  4MMM A;  4JE1 A;  2V32 A;  4CY6 A;  4MPF A;  1PKZ A;  3IK7 A;  5CNW A;  2VCQ A;  1WMJ A;  1XW5 A;  3PGT A;  2N5F A;  4OMV A;  3ME7 A;  3F3R A;  4ULX A;  1R7H A;  2X49 A;  3GNJ A;  4X4J A;  1VF4 A;  1V9W A;  4JED A;  5CRW A;  3H4K A;  3FYG A;  1AUC A;  1JLW A;  1BJX A;  1SD8 A;  3KH7 A;  2B5Y A;  4LL1 B;  2OBI A;  5DBQ A;  1EOG A;  3TKS E;  2LNS A;  4D73 A;  3LQ7 A;  3UMA A;  3L4N A;  2CAI A;  3ERG A;  1YEX A;  4I6X A;  1F3B A;  2PVQ A;  4E8E A;  4V2N A;  4DSS B;  17GS A;  4LA1 A;  5ECM B;  2KUC A;  5KOX A;  3I9V 2;  4EIQ A;  1XPV A;  5GST A;  5ELG A;  3QPM A;  2C3T A;  1BQ7 A;  1FB6 A;  4EO3 A;  3QFA C;  4PUF C;  3F8U A;  4Q5R A;  2A2R A;  4K2D A;  5BRT A;  1G6W A;  2PUK C;  1X9M B;  1HD2 A;  2HSY A;  5D9X A;  2L4Q A;  4YH2 A;  4EL1 A;  3PIN A;  1O8W A;  1GNW A;  3VK9 A;  1ERV A;  1EWX A;  4L5O A;  2DKH A;  2CZ3 A;  1A0F A;  3W8S A;  4ECJ A;  2K8S A;  3KEB A;  1SK0 A;  1PFO A;  1ZGN A;  3SBC A;  3WGX A;  1C72 A;  1A0R P;  2QA2 A;  3GMF A;  3IBH A;  1V40 A;  2IMI A;  1ZOF A;  2B5X A;  4ECB A;  4LLR A;  2H76 A;  3TGZ A;  2HI7 A;  5GSS A;  4K1F A;  1I5G A;  3E9J B;  2MZC A;  4EDY A;  5DCG A;  2MMO A;  5B8B A;  5JWR B;  2R5G A;  1H4O A;  2FWE A;  4G0L A;  3HDC A;  3QR6 A;  4N10 A;  1SK1 A;  2FGX A;  4KGI A;  1PGT A;  1B9X C;  3W6G A;  2VUP A;  4ZBA A;  4ZB8 A;  3TKS A;  2YV7 A;  2GZP A;  4ID0 A;  4J57 E;  1GNE A;  5JWO B;  4QL9 A;  4NWY A;  1DE1 A;  4PX1 A;  4EDZ A;  2I3Y A;  2Z9S A;  5IQY A;  2K9F A;  1GWC A;  2N5A A;  1MDK A;  3ZTL A;  3APO A;  1GUL A;  3N5O A;  3APQ A;  5HFK A;  5H5Q A;  3NZN A;  1M9A A;  3VPT A;  2CV4 A;  2H30 A;  3F63 A;  2LJR A;  5ID2 A;  1K0B A;  2JZR A;  1ERT A;  1GTI A;  2YWI A;  1WP0 A;  2H19 A;  3AY8 A;  5AN1 A;  3ISO A;  1F2E A;  4KAE A;  2LJK A;  1B4Q A;  5F07 A;  1GSF A;  1GSD A;  3M9K A;  5EVO A;  3TRQ A;  1A8L A;  4KCA A;  4O5Q A;  2FUG 2;  2JSY A;  3D22 A;  4BWS A;  2QSI A;  2ZNM A;  1AIU A;  2FD3 A;  1ZYE A;  2VL9 A;  2F8A A;  2QA1 A;  1PKW A;  1XWA A;  1GTA A;  4TXO B;  6GSX A;  5DDL A;  5KN2 A;  5IMD A;  2I1U A;  1R26 A;  1YDK A;  5JCW A;  3FRC A;  2MBS A;  2IN3 A;  4O92 A;  1VF2 A;  2ON5 A;  1AC1 A;  5KEJ A;  2TRC P;  6GSY A;  5DAL B;  4F2I A;  4WR5 A;  2GZY A;  2FNO A;  3KZQ A;  2TRX A;  2JL4 A;  4XRD A;  1THO A;  2XBQ A;  2KHP A;  3CQF A;  1TW9 A;  2AB6 A;  2NTO A;  2VD0 A;  2JZS A;  4K7O A;  3TRX A;  4XS1 A;  5DVB A;  3TOT A;  3J7Y b;  1KTE A;  2O87 A;  2I9H A;  1RW1 A;  1YY7 A;  3H8Q A;  4FO5 A;  4XIH A;  3IAM 2;  1AQX A;  2EIO A;  1GUH A;  3DEX A;  4AGS A;  3ZFB A;  3D4T A;  1UA5 A;  3QFB C;  2P5Q A;  4FIW A;  4OFN A;  2LV3 A;  2H1D A;  4RQR A;  2PVO C;  2J9H A;  3BBY A;  4HQS A;  1O7U A;  3GX0 A;  2NPB A;  3C7M A;  1AQV A;  3TUE A;  3OR5 A;  3VWX A;  5DJL A;  3U5R E;  4V1A p;  2PER A;  1SK2 A;  3DRN A;  4L8E A;  3KTL A;  2IFQ A;  1XW6 A;  4YAP A;  3HJP A;  5H5R A;  2LST A;  2NVL A;  2M80 A;  3DVW A;  3US3 A;  3QOU A;  2XPD A;  4I8B A;  3RHB A;  5DQY A;  2OAC A;  3CXG A;  4K8M A;  3N9J A;  1O85 A;  2KP2 A;  3EMP A;  4MLY A;  3UBL A;  1BED A;  3CSI A;  3TJF A;  1Z6N A;  3HZ4 A;  3EMX A;  3QAV A;  4POB A;  2F3M A;  3TOU A;  4ZBD A;  1TP9 A;  1XG8 A;  2YWM A;  5E4W A;  3A2W A;  3L9V A;  5COH A;  2H73 A;  2B5E A;  1N2A A;  1J9B A;  4BVY B;  4DSQ A;  4CHS A;  1TI1 A;  3BCI A;  4LMW A;  3A5W A;  3RHC A;  3GL5 A;  1S3D A;  5G30 A;  3P2A A;  4IP6 A;  4BA7 A;  2TIR A;  4BVX A;  4MZB A;  1T4Y A;  3QAW A;  1K0A A;  4IQ1 A;  1Z9H A;  3U6V A;  1J08 A;  3LW9 A;  4NMU A;  3ZML A;  1MDI A;  3VPQ A;  1HNC A;  2HZE A;  5ECH B;  5A4V A;  2V1M A;  3VFI A;  3FY7 A;  8GSS A;  4MAB A;  1T00 A;  1K0N A;  1MTC A;  1DUG A;  2GSQ A;  2N5B A;  1J0F A;  1URM A;  1TI3 A;  1GRX A;  4ZIJ A;  2HRN A;  1HNB A;  5DCH A;  4IW9 A;  2VIM A;  2DLX A;  5C04 A;  2C0G A;  3IE3 A;  4YQU A;  3TKS C;  5FWG A;  2VD1 A;  3FMW A;  1XVW A;  3O6T A;  1UVZ A;  4OWY A;  3H1N A;  5J5N A;  2OBK A;  2HYX A;  2LKU A;  4JU5 A;  2MMZ A;  2HT9 A;  3FKF A;  1GLQ A;  4RUV A;  1X9W B;  3I69 A;  4GRF A;  1DE2 A;  1X9S B;  4WBR D;  4WEY A;  3ERF A;  4POL A;  4JBB A;  3A5I A;  1OC9 A;  1F9M A;  2LTK A;  1JHB A;  4N30 A;  4PQH A;  3EIN A;  1OVN A;  2RUE A;  3ZYW A;  3QAG A;  2J23 A;  5D9T A;  4K5S A;  2V6O A;  2B1L A;  5GAN D;  1I9D A;  2C3N A;  4EUY A;  2DSA A;  5IPH A;  4NXI A;  5D73 A;  3UIW A;  4QQ7 A;  2R6K A;  5AGY A;  2LS5 A;  2B1K A;  2K8V A;  3EC3 A;  3LXZ A;  5IMF A;  4JR6 A;  5DAK B;  3IA1 A;  2WFC A;  2FWG A;  4WET A;  1QGV A;  3RDW A;  3G9B A;  3GUR A;  4BL7 B;  3F0I A;  3WGE A;  2DIZ A;  1EGR A;  4OFT A;  2XPE A;  1V2A A;  3ZRE A;  3GTU B;  4XCS A;  1S3A A;  3IC4 A;  6GSW A;  1LJR A;  2A4H A;  4KDY A;  3JCM L;  3EU4 A;  1GH2 A;  1DBY A;  1EEJ A;  5JWQ B;  3PR8 A;  4TN8 A;  2C3Q A;  3VUR A;  2YAN A;  1JZW A;  3IXR A;  1USB A;  2CX4 A;  2EC4 A;  5BMU A;  2AAW A;  2HNL A;  2B7J A;  2ES7 A;  2GDR A;  2X64 A;  1FVJ A;  4KW6 A;  1GSY A;  1SYR A;  1K3O A;  1PRX A;  1A23 A;  1VF1 A;  3M8N A;  1QUW A;  4HU9 A;  3UOM A;  2VL3 A;  2R0C A;  1ZCP A;  3LYK A;  1XZO A;  3TJG A;  5KOW A;  5A4U A;  4DSS A;  1SJ6 A;  5J3R A;  2O85 A;  2H75 A;  2FWF A;  4EC0 A;  4BWQ A;  4TW5 A;  5JCU A;  1GUK A;  5L71 A;  5LCZ A;  1Z5Y E;  4ISD A;  3GUS A;  4MJE A;  3TRP A;  4K7N A;  3VLN A;  4TR3 A;  5HFI A;  3F9U A;  3MWH A;  4HEA 2;  2H0I A;  4MZC A;  5LD0 A;  4Z2R A;  1F6M C;  3A2V A;  1PN9 A;  1QMV A;  2FA4 A;  3CBU A;  1R4W A;  5EPF A;  1FO5 A;  1FVK A;  3TJJ A;  3ZIT A;  1S3C A;  1VF3 A;  20GS A;  1WOU A;  4EKZ A;  2L59 A;  3TJK A;  3LJR A;  3GSS A;  1YF1 A;  2X4A A;  4IP1 A;  3KP8 A;  2P31 A;  2R3X A;  14GS A;  2CVB A;  2GGT A;  1QXH A;  1BX9 A;  2R37 A;  1WIK A;  1TRV A;  3WT2 A;  2RM5 A;  1XWK A;  2WJU A;  1GLP A;  2R0G A;  2JAD A;  2YV9 A;  2O89 A;  1ABA A;  3IOS A;  4OFM A;  3ZLP A;  4MCU A;  3F4R A;  1SL1 B;  2VCT A;  4GST A;  1YQ1 A;  4XHM A;  3H79 A;  3LWA A;  5IOX A;  1XWC A;  4FYC A;  4BPY A;  1OKD A;  4K9Z A;  1M3I A;  2H6Y A;  3KGK A;  3UL3 A;  1ILO A;  3IR4 A;  4KA0 A;  1MD3 A;  1YKC A;  1A2L A;  5G2Z A;  4TR1 B;  4MK3 A;  2GQL A;  1UC7 A;  4GSN A;  5D8I A;  1TKD B;  4IBP A;  1ERW A;  4KSM A;  3D4M A;  1M2B A;  2HSM A;  3ZVJ D;  4IQA A;  3M1G A;  4WKW A;  4L0W A;  1B48 A;  2IWT A;  1F3A A;  3CYN A;  2KLX A;  1T3B A;  3DWV A;  4LL4 B;  1GTB A;  1TK8 B;  4IHU A;  4DSR A;  3C8E A;  5IMA A;  1NSW A;  1TU8 A;  1G6Y A;  1NM3 A;  2IMK A;  3D21 A;  4TR0 A;  1WPI A;  4HS1 A;  3FR6 A;  2MYG A;  3KD0 A;  1WRY A;  4TXO A;  2OA7 A;  4HI7 A;  2B3S A;  2C0F A;  2B6M A;  2YN1 A;  4HDE A;  2VM2 A;  2B7K A;  4XS4 B;  2PWJ A;  1A8Y A;  3P90 A;  4IEL A;  1XBS A;  1Z3E A;  2PPT A;  4OCE A;  1OC8 A;  5DAL A;  4ZL9 A;  5AIX A;  2AHE A;  5ECN B;  1O6J A;  3C71 A;  4YAV A;  3VWV A;  3HVN A;  4EXJ A;  3GN3 A;  5IMZ A;  3FR9 A;  3Q19 A;  5A5K A;  2YNX A;  4KDX A;  1E6B A;  1PD2 1;  4FQU A;  3F6D A;  1JLV A;  2UZ8 A;  4ACS A;  2H1B A;  1O73 A;  1GSQ A;  1TK5 B;  1A2M A;  2IPA A;  1SKW B;  3HJO A;  4I2T A;  2QKE A;  6GSU A;  2HXK A;  4X43 A;  3P7X A;  2C8U A;  2M46 A;  1FHE A;  3RPP A;  1OE8 A;  1XCC A;  1OKT A;  2ALB A;  1GSE A;  2QC7 A;  3C73 A;  3TKP A;  4F03 A;  3GX8 A;  3RAZ A;  1WE0 A;  4GQF A;  2ZCT A;  3WT1 A;  1SJI A;  2EIR A;  2PU9 C;  1AAZ A;  4USS A;  4GXZ A;  4WBJ A;  1K3L A;  4F0B A;  1V58 A;  4YQM A;  5CYY A;  1ZYQ B;  2HZF A;  3WYW A;  2K18 A;  1EV4 A;  2LEG A;  2IME A;  4PNF A;  2DMM A;  4ZB9 A;  3VWU A;  4YQV A;  3IRA A;  2RLI A;  4AJ8 A;  3E0U A;  3WD6 A;  1PN0 A;  4H86 A;  2FLS A;  4G10 A;  2ON7 A;  3I43 A;  4MH2 A;  5HR2 A;  2H74 A;  3P8W A;  4TKY A;  5HR3 A;  3QDN A;  4Q5N A;  1GTU A;  2H72 A;  2C0D A;  1K0M A;  5FHI A;  3MYD A;  3NOF A;  4G0K A;  3GH6 A;  2X8G A;  1X0R A;  2LQO A;  4X0X A;  5F0G A;  4PQI A;  2YOI A;  4XTS A;  1O8X A;  2VCW A;  4QL7 A;  2OAD A;  1JZR A;  3G7I A;  1PSQ A;  4BVY A;  3UVH A;  2FCH A;  4ZXG A;  2RUF A;  2DKI A;  3GST A;  2H6X A;  4HSC X;  1HQO A;  2LQQ A;  4OCF A;  3RPN A;  1U6T A;  3R3E A;  5CRH A;  2GSR A;  1A24 A;  3FZ4 A;  3E3E A;  4V2M A;  3UAR A;  3VI5 A;  1SJZ A;  4F9Z A;  2AYT A;  4I2U A;  22GS A;  4IN0 A;  2GT6 A;  3FEU A;  3KP9 A;  1T7P B;  3TJB A;  1TOF A;  2GQM A;  2KOK A;  3O76 A;  5G1K A;  1GSU A;  5B6N A;  2LJA A;  4N0Z A;  2GLR A;  3FR3 A;  1B9Y C;  4MPG A;  1XIY A;  3ERW A;  5G5F A;  1Q4J A;  1Z7P A;  2H70 A;  1JZD A;  2EIQ A;  2H1G A;  1QK8 A;  4G19 A;  3LYP A;  2DJ3 A;  2XBI A;  5G31 A;  4ECI A;  2PGT A;  1QFN A;  3QMX A;  2CVD A;  5CRE A;  2F8F A;  4RI6 A;  4MJC A;  4IS0 A;  1W4V A;  4IKH A;  1G0T A;  1TRU A;  1EP8 A;  3MNG A;  1NW2 A;  5D93 A;  4A5P A;  2VCX A;  2ZUP A;  1B4P A;  1YZX A;  1Y6E A;  1CQG A;  3L9U A;  2HE3 A;  3R2Q A;  1IYH A;  1ST9 A;  1K0D A;  2X8C A;  3EPT A;  3ZMK A;  1EP7 A;  4WXT A;  1K3Y A;  2FHE A;  2GST A;  2JZT A;  4PUR A;  3EVI A;  2HLS A;  5ECO B;  4N11 A;  4WF5 A;  5G1L A;  2V6K A;  1M0U A;  3VI7 A;  4O5R A;  1Y25 A;  1U3I A;  4MNN A;  2VCZ A;  4ECC A;  5D9V A;  3FZ5 A;  2GS3 A;  1PX6 A;  3GL3 A;  2H71 A;  4HU7 A;  1SU9 A;  3Q18 A;  3MDK A;  2VLV A;  3GRX A;  3HD5 A;  2H1A A;  2MMA A;  4K5R A;  3EE2 A;  2C4J A;  4HQZ A;  5F8B A;  4POM A;  3IDV A;  1U88 A;  2YZH A;  1QQ2 A;  2NDO A;  3CSJ A;  4KF9 A;  3ZFL A;  1XW9 A;  5CAX A;  2F9S A;  2CZ2 A;  2R0P A;  4XRA A;  3PPU A;  1PMT A;  5D9W A;  1ML6 A;  5DAK A;  4MF7 A;  1MEK A;  3HY2 A;  3HJM A;  2V41 A;  2VL2 A;  2PMT A;  4KDU A;  4NV5 A;  4BL7 A;  5KN0 A;  1ZYP A;  3UVT A;  3HVX A;  3HYP A;  5IO0 A;  4CW9 A;  4KSO A;  4MP4 A;  1VRS D;  4MF6 A;  2FA8 A;  5EL8 A;  3DVX A;  3GTU A;  5JCG A;  2BTO T;  5A4W A;  5FT3 A;  2P5R A;  3M9J A;  4YKF A;  5HQP A;  2C80 A;  2WZ9 A;  6GSV A;  13GS A;  3LGC A;  4G0I A;  5KN1 A;  1XVQ A;  3FHK A;  4K0N A;  4P3Y B;  2A2P A;  4MJB A;  2XC2 A;  1R5A A;  4GWR A;  1TU7 A;  4EE0 A;  3KXO A;  1GL8 A;  2V2G A;  5AIV A;  1YF0 A;  2D2Z A;  4BIK A;  1XFL A;  1XWG A;  3ZVJ A;  2R2J A;  4HZ4 A;  5IIZ A;  2I81 A;  4TOP A;  3QCP A;  1WJK A;  5AIS A;  5CRD A;  1WWJ A;  4K2X A;  3HXS A;  2WGR A;  2WDU A;  1MD4 A;  1EEM A;  4ICY A;  1FOH A;  4ZB6 A;  1TDI A;  2LNT A;  1FW1 A;  2PBJ A;  2X8H A;  3J7Y k;  5ECK B;  1N8J A;  2F51 A;  2P0G A;  1PL1 A;  2H8L A;  2IMD A;  2AUV A;  4KE3 A;  1X5E A;  2RII A;  4KND A;  4ML1 A;  1MDJ A;  2YCD A;  1AW9 A;  2MBT A;  1DSB A;  5ECL B;  2O8V B;  3F6F A;  5ELA A;  3H93 A;  2VCV A;  3EYT A;  3S9F A;  4ILF A;  4D73 B;  5F06 A;  3FZ9 A;  2IJY A;  4KB3 A;  1JZO A;  4XS6 A;  4MH3 A;  6GST A;  1G7E A;  3HZ8 A;  1GP1 A;  3RBT A;  1NHY A;  4IJI A;  1V98 A;  5DQS A;  3FZA A;  5D96 A;  5IMV A;  3MSZ A;  3ZRD A;  4TR4 A;  3DXB A;  2WCI A;  3GHA A;  4HOJ A;  3TCO A;  3LEF A;  2CT6 A;  5J9B A;  3GFK A;  2AV4 A;  2GZZ A;  3TB2 A;  2DIY A;  4WF4 A;  1FOV A;  4G2E A;  2CVK A;  4CDO A;  1TRS A;  4MZW A;  2LRN A;  3MIX A;  4WR4 A;  1BAY A;  3ZIJ A;  2LUS A;  2YZU A;  1B8X A;  3IHG A;  4NAX A;  1M9B A;  4ZIL A;  3L78 A;  4PGT A;  2CQ9 A;  3IC8 A;  1K0O A;  3C1S A;  3KH9 A;  3HA9 A;  3V1W A;  3LXT A;  4Z2U A;  1EV9 A;  4J56 E;  1ERU A;  2E0Q A;  1Z6M A;  5CP1 A;  4TR1 A;  2IIY A;  4OD7 A;  4I5Q A;  3UBK A;  6GSS A;  10GS A;  4IGJ A;  1F37 A;  5HR1 A;  4O32 A;  1A2J A;  3TKR A;  4V1A g;  1SL2 B;  19GS A;  2VM1 A;  3CSH A;  3HCZ A;  3IPZ A;  1HNA A;  1BYE A;  4GQC A;  2GQK A;  3DML A;  3BD2 A;  2H0G A;  4F82 A;  4PTS A;  4YKG A;  3IK9 A;  3KMO A;  1IYI A;  1V57 A;  4NHZ A;  3DIE A;  1T8E B;  4FYB A;  4GF0 A;  4Z7X A;  1XOB A;  1XOA A;  2YP6 A;  4GSS A;  5IM9 A;  3KIJ A;  5IPG A;  2H66 A;  1EZK A;  2OE3 A;  3TKQ A;  5DJM A;  1FB0 A;  4CY8 A;  4XS4 A;  2WS2 A;  4O5U A;  5ECR B;  2YJ7 A;  1YKA A;  1SD9 A;  5IOW A;  4NHW A;  2XHF A;  1G7O A;  2IL3 A;  4K7I A;  5HFG A;  3ZIV A;  3GKK A;  2HFD A;  5ID2 B;  2LRT A;  4MA9 A;  3HKR A;  3CTG A;  2IMF A;  5H5S A;  3LG6 A;  1O81 A;  4ZBB A;  3K8N A;  5G5E A;  1OAZ A;  2H01 A;  3LSZ A;  4L0U A;  1CQH A;  3NIV A;  3F3Q A;  5IMC A;  4NPB A;  2BJX A;  2VLU A;  3CTF A;  2VL2 C;  5LNK e;  2M72 A;  3DD3 A;  4HJ2 A;  1SKS B;  1S3R A;  1KNG A;  1OC3 A;  2FWH A;  12GS A;  3WGD A;  4Z2T A;  9GSS A;  4GCI A;  2E7P A;  5ECI B;  1GSS A;  2OJL A;  4KX4 A;  5E59 A;  4PXO A;  1PQN A;  5B8A A;  5J41 A;  2WUL A;  4FYU A;  3FK8 A;  4RI7 A;  2I4A A;  1U3A A;  1RQM A;  4IVF A;  4EVM A;  4PNG A;  4V2L A;  3KCM A;  4Q5Q A;  2HRF A;  2MMN A;  1NHO A;  4FH8 A;  4O7H A;  4MF5 A;  2A2S A;  4KUN A;  4N0V A;  1OYJ A;  4ZL8 A;  1UN2 A;  3HVV A;  2O7K A;  4JR4 A;  4ML6 A;  4PQ1 A;  3DYR A;  5CO3 A;  3FW2 A;  3G7Y A;  3IAS 2;  3EWL A;  5ABR A;  2C1Y A;  4I97 A;  1FAA A;  2DJ2 A;  3KMN A;  3F4T A;  2G0F A;  2YWO A;  3BJ5 A;  1FG4 A;  3A2X A;  2HRA A;  1SL0 B;  3TDG A;  3UJ1 A;  5J4U A;  4J2F A;  1KEB A;  2C0E A;  1TK0 B;  4KCE A;  2OKA A;  2DJJ A;  1SYX A;  2L57 A;  2DC5 A;  2DJK A;  3MAK A;  4DEJ A;  3ED3 A;  1M2A A;  4E8H A;  2IFQ B;  1E2Y A;  2NBS A;  1LU4 A;  3IHQ A;  7GSS A;  3GA4 A;  2DJ1 A;  5J9C A;  1XWB A;  2HSH A;  3HHV A;  2QGV A;  3VWW A;  4K0G A;  1SKR B;  3C1R A;  4MDC A;  3ME8 A;  2GT5 A;  3GH9 A;  5INY A;  1X5C A;  1ZL9 A;  2A4V A;  2JAC A;  2YJH A;  4DVC A;  1U87 A;  2E2G A;  2K6V A;  5IO2 A;  3M0F A;  2VOC A;  4GLT A;  4AJ6 A;  2VO4 A;  3A3T A;  1XXU A;  3DKS A;  1ZMA A;  5ECP B;  2PN8 A;  1TJD A;  1Q98 A;  3ZZX A;  2DJ0 A;  1K0C A;  1ACV A;  3KJY A;  2CAQ A;  4X1U A;  4TRX A;  2L6C A;  4HUA A;  4NV2 A;  1BG5 A;  4EF0 A;  1VGL A;  3GV1 A;  3GIX A;  4G9H A;  1M7T A;  1Z7R A;  3D5J A;  3UAP A;  4OO5 A;  11GS A;  3UEM A;  2GTU A;  4OO4 A;  4BVX B;  2L4C A;  1T1V A;  3CRU A;  2CX3 A;  3O3T A;  1ZYN A;  1YEP A;  5ENU A;  2L6D A;  2DBC A;  3GKX A;  2JSZ A;  2HZE B;  3W8J A;  1YJ6 A;  2E2M A;  3KTB A;  3GYK A;  1SEN A;  1H75 A;  2G2Q A;  3GKN A;  3D6I A;  3DGQ A;  4IJ3 A;  3IV4 A;  2L5L A;  3G7J A;  1TRW A;  5GAP D;  2VLT A;  3QD9 A;  1TTZ A;  3Q6O A;  2LRC A;  2AJQ B;  1PX7 A;  1THX A;  3HVS A;  2REM A;  5B7C A;  1M3J A;  1HYU A;  4AJ7 A;  1ON4 A;  3L0H A;  1OE7 A;  1PA3 A;  2OE0 A;  3I6A A;  2DML A;  1PL2 A;  1R5P A;  2CA8 A;  3CRT A;  1KBN A;  3EUR A;  1AXD A;  2GSS A;  3M3M A;  4RQX A;  5ECS A;  4ZL7 A;  2YWN A;  2KP1 A;  2H6Z A;  5C00 A;  1X5D A;  4F0C A;  1AQW A;  4HJM A;  3BCK A;  4GTU A;  2X99 A;  4TVE A;  3KM6 A;  4Q5F A;  1OC9 B;  2WB9 A;  4PUA A;  2H0H A;  3F4S A;  2HRK A;  2BMX A;  3D0Z A;  4MJA A;  2RM6 A;  3Q74 A;  4JZQ A;  3APS A;  4EIP A;  3EU3 A;  4TXV A;  3LOR A;  1W89 A;  1T4Z A; 
#chains in the Genus database with same CATH homology
 1RK4 A;  5F05 A;  2GVP A;  2YPM A;  5EY6 A;  3SWL A;  1M99 A;  3CMI A;  1TXX A;  1EOH A;  4HZ2 A;  4LMV A;  3BOA A;  3PH9 A;  3ZL5 A;  5CRG A;  1M2D A;  18GS A;  3GKM A;  4K6X A;  2FY6 A;  3LFL A;  4L5L A;  4KH7 A;  1EGO A;  2VAF A;  1ZZY A;  3L9S A;  1GUM A;  5GZZ B;  4POK A;  4JRR A;  5KN3 A;  5B6M A;  1LBK A;  2JU5 A;  2OE1 A;  5HR0 A;  4AF2 A;  2L5O A;  2R4V A;  5ECQ B;  1JFU A;  16GS A;  2WRT A;  4MMM A;  4JE1 A;  2V32 A;  4CY6 A;  4MPF A;  1PKZ A;  3IK7 A;  5CNW A;  2VCQ A;  1WMJ A;  1XW5 A;  3PGT A;  2N5F A;  4OMV A;  3ME7 A;  3F3R A;  4ULX A;  1R7H A;  2X49 A;  3GNJ A;  4X4J A;  1VF4 A;  1V9W A;  4JED A;  5CRW A;  3H4K A;  3FYG A;  1AUC A;  1JLW A;  1BJX A;  1SD8 A;  3KH7 A;  2B5Y A;  4LL1 B;  2OBI A;  5DBQ A;  1EOG A;  3TKS E;  2LNS A;  4D73 A;  3LQ7 A;  3UMA A;  3L4N A;  2CAI A;  3ERG A;  1YEX A;  4I6X A;  1F3B A;  2PVQ A;  4E8E A;  4V2N A;  4DSS B;  17GS A;  4LA1 A;  5ECM B;  2KUC A;  5KOX A;  3I9V 2;  4EIQ A;  1XPV A;  5GST A;  5ELG A;  3QPM A;  2C3T A;  1BQ7 A;  1FB6 A;  4EO3 A;  3QFA C;  4PUF C;  3F8U A;  4Q5R A;  2A2R A;  4K2D A;  5BRT A;  1G6W A;  2PUK C;  1X9M B;  1HD2 A;  2HSY A;  5D9X A;  2L4Q A;  4YH2 A;  4EL1 A;  3PIN A;  1O8W A;  1GNW A;  3VK9 A;  1ERV A;  1EWX A;  4L5O A;  2DKH A;  2CZ3 A;  1A0F A;  3W8S A;  4ECJ A;  2K8S A;  3KEB A;  1SK0 A;  1ZGN A;  3SBC A;  3WGX A;  1C72 A;  1A0R P;  2QA2 A;  3GMF A;  3IBH A;  1V40 A;  2IMI A;  1ZOF A;  2B5X A;  4ECB A;  4LLR A;  2H76 A;  3TGZ A;  2HI7 A;  5GSS A;  4K1F A;  1I5G A;  3E9J B;  2MZC A;  4EDY A;  5DCG A;  2MMO A;  5B8B A;  5JWR B;  2R5G A;  1H4O A;  2FWE A;  4G0L A;  3HDC A;  3QR6 A;  4N10 A;  1SK1 A;  2FGX A;  4KGI A;  1PGT A;  1B9X C;  3W6G A;  2VUP A;  4ZBA A;  4ZB8 A;  3TKS A;  2YV7 A;  2GZP A;  4ID0 A;  4J57 E;  1GNE A;  5JWO B;  4QL9 A;  4NWY A;  1DE1 A;  4PX1 A;  4EDZ A;  2I3Y A;  2Z9S A;  5IQY A;  2K9F A;  1GWC A;  2N5A A;  1MDK A;  3ZTL A;  3APO A;  1GUL A;  3N5O A;  3APQ A;  5HFK A;  5H5Q A;  3NZN A;  1M9A A;  3VPT A;  2CV4 A;  2H30 A;  3F63 A;  2LJR A;  5ID2 A;  1K0B A;  2JZR A;  1ERT A;  1GTI A;  2YWI A;  1WP0 A;  2H19 A;  3AY8 A;  5AN1 A;  3ISO A;  1F2E A;  4KAE A;  2LJK A;  1B4Q A;  5F07 A;  1GSF A;  1GSD A;  3M9K A;  5EVO A;  3TRQ A;  1A8L A;  4KCA A;  4O5Q A;  2FUG 2;  2JSY A;  3D22 A;  4BWS A;  2QSI A;  2ZNM A;  1AIU A;  2FD3 A;  1ZYE A;  2VL9 A;  2F8A A;  2QA1 A;  1PKW A;  1XWA A;  1GTA A;  4TXO B;  6GSX A;  5DDL A;  5KN2 A;  5IMD A;  2I1U A;  1R26 A;  1YDK A;  5JCW A;  3FRC A;  2MBS A;  2IN3 A;  4O92 A;  1VF2 A;  2ON5 A;  1AC1 A;  5KEJ A;  2TRC P;  6GSY A;  5DAL B;  4F2I A;  4WR5 A;  2GZY A;  2FNO A;  3KZQ A;  2TRX A;  2JL4 A;  4XRD A;  1THO A;  2XBQ A;  2KHP A;  1TW9 A;  2AB6 A;  2NTO A;  2VD0 A;  2JZS A;  4K7O A;  3TRX A;  4XS1 A;  5DVB A;  3TOT A;  3J7Y b;  1KTE A;  2O87 A;  2I9H A;  1RW1 A;  1YY7 A;  3H8Q A;  4FO5 A;  4XIH A;  3IAM 2;  1AQX A;  2EIO A;  1GUH A;  3DEX A;  4AGS A;  3ZFB A;  3D4T A;  1UA5 A;  3QFB C;  2P5Q A;  4FIW A;  4OFN A;  2LV3 A;  2H1D A;  4RQR A;  2PVO C;  2J9H A;  3BBY A;  4HQS A;  1O7U A;  3GX0 A;  2NPB A;  3C7M A;  1AQV A;  3TUE A;  3OR5 A;  3VWX A;  5DJL A;  3U5R E;  4V1A p;  2PER A;  1SK2 A;  3DRN A;  4L8E A;  3KTL A;  2IFQ A;  1XW6 A;  4YAP A;  3HJP A;  5H5R A;  2LST A;  2NVL A;  2M80 A;  3DVW A;  3US3 A;  3QOU A;  2XPD A;  4I8B A;  3RHB A;  5DQY A;  2OAC A;  3CXG A;  4K8M A;  3N9J A;  1O85 A;  2KP2 A;  3EMP A;  4MLY A;  3UBL A;  1BED A;  3CSI A;  3TJF A;  1Z6N A;  3HZ4 A;  3EMX A;  3QAV A;  4POB A;  2F3M A;  3TOU A;  4ZBD A;  1TP9 A;  2YWM A;  5E4W A;  3A2W A;  3L9V A;  5COH A;  2H73 A;  2B5E A;  1N2A A;  1J9B A;  4BVY B;  4DSQ A;  4CHS A;  1TI1 A;  3BCI A;  4LMW A;  3A5W A;  3RHC A;  3GL5 A;  1S3D A;  5G30 A;  3P2A A;  4IP6 A;  4BA7 A;  2TIR A;  4BVX A;  4MZB A;  1T4Y A;  3QAW A;  1K0A A;  4IQ1 A;  1Z9H A;  3U6V A;  1J08 A;  3LW9 A;  4NMU A;  3ZML A;  1MDI A;  3VPQ A;  1HNC A;  2HZE A;  5ECH B;  5A4V A;  2V1M A;  3VFI A;  3FY7 A;  8GSS A;  4MAB A;  1T00 A;  1K0N A;  1MTC A;  1DUG A;  2GSQ A;  2N5B A;  1J0F A;  1URM A;  1TI3 A;  1GRX A;  4ZIJ A;  2HRN A;  1HNB A;  5DCH A;  4IW9 A;  2VIM A;  2DLX A;  5C04 A;  2C0G A;  3IE3 A;  4YQU A;  3TKS C;  5FWG A;  2VD1 A;  3FMW A;  1XVW A;  3O6T A;  1UVZ A;  4OWY A;  3H1N A;  5J5N A;  2OBK A;  2HYX A;  2LKU A;  4JU5 A;  2MMZ A;  2HT9 A;  3FKF A;  1GLQ A;  4RUV A;  1X9W B;  3I69 A;  4GRF A;  1DE2 A;  1X9S B;  4WBR D;  4WEY A;  3ERF A;  4POL A;  4JBB A;  3A5I A;  1OC9 A;  1F9M A;  2LTK A;  1JHB A;  4N30 A;  4PQH A;  3EIN A;  1OVN A;  2RUE A;  3ZYW A;  3QAG A;  2J23 A;  5D9T A;  4K5S A;  2V6O A;  2B1L A;  5GAN D;  1I9D A;  2C3N A;  4EUY A;  2DSA A;  5IPH A;  4NXI A;  5D73 A;  3UIW A;  4QQ7 A;  2R6K A;  5AGY A;  2LS5 A;  2B1K A;  2K8V A;  3EC3 A;  3LXZ A;  5IMF A;  4JR6 A;  5DAK B;  3IA1 A;  2WFC A;  2FWG A;  4WET A;  1QGV A;  3RDW A;  3G9B A;  3GUR A;  4BL7 B;  3F0I A;  3WGE A;  2DIZ A;  1EGR A;  4OFT A;  2XPE A;  1V2A A;  3ZRE A;  3GTU B;  4XCS A;  1S3A A;  3IC4 A;  6GSW A;  1LJR A;  2A4H A;  4KDY A;  3JCM L;  3EU4 A;  1GH2 A;  1DBY A;  1EEJ A;  5JWQ B;  3PR8 A;  4TN8 A;  2C3Q A;  3VUR A;  2YAN A;  1JZW A;  3IXR A;  1USB A;  2CX4 A;  2EC4 A;  5BMU A;  2AAW A;  2HNL A;  2B7J A;  2ES7 A;  2GDR A;  2X64 A;  1FVJ A;  4KW6 A;  1GSY A;  1SYR A;  1K3O A;  1PRX A;  1A23 A;  1VF1 A;  3M8N A;  1QUW A;  4HU9 A;  3UOM A;  2VL3 A;  2R0C A;  1ZCP A;  3LYK A;  1XZO A;  3TJG A;  5KOW A;  5A4U A;  4DSS A;  1SJ6 A;  5J3R A;  2O85 A;  2H75 A;  2FWF A;  4EC0 A;  4BWQ A;  4TW5 A;  5JCU A;  1GUK A;  5L71 A;  5LCZ A;  1Z5Y E;  4ISD A;  3GUS A;  4MJE A;  3TRP A;  4K7N A;  3VLN A;  4TR3 A;  5HFI A;  3F9U A;  3MWH A;  4HEA 2;  2H0I A;  4MZC A;  5LD0 A;  4Z2R A;  1F6M C;  3A2V A;  1PN9 A;  1QMV A;  2FA4 A;  3CBU A;  1R4W A;  5EPF A;  1FO5 A;  1FVK A;  3TJJ A;  3ZIT A;  1S3C A;  1VF3 A;  20GS A;  1WOU A;  4EKZ A;  2L59 A;  3TJK A;  3LJR A;  3GSS A;  1YF1 A;  2X4A A;  4IP1 A;  3KP8 A;  2P31 A;  2R3X A;  14GS A;  2CVB A;  2GGT A;  1QXH A;  1BX9 A;  2R37 A;  1WIK A;  1TRV A;  3WT2 A;  2RM5 A;  1XWK A;  2WJU A;  1GLP A;  2R0G A;  2JAD A;  2YV9 A;  2O89 A;  1ABA A;  3IOS A;  4OFM A;  3ZLP A;  4MCU A;  3F4R A;  1SL1 B;  2VCT A;  4GST A;  1YQ1 A;  4XHM A;  3H79 A;  3LWA A;  5IOX A;  1XWC A;  4FYC A;  4BPY A;  1OKD A;  4K9Z A;  2H6Y A;  3KGK A;  3UL3 A;  1ILO A;  3IR4 A;  4KA0 A;  1MD3 A;  1YKC A;  1A2L A;  5G2Z A;  4TR1 B;  4MK3 A;  2GQL A;  1UC7 A;  4GSN A;  5D8I A;  1TKD B;  4IBP A;  1ERW A;  4KSM A;  3D4M A;  1M2B A;  2HSM A;  3ZVJ D;  4IQA A;  3M1G A;  4WKW A;  4L0W A;  1B48 A;  2IWT A;  1F3A A;  3CYN A;  2KLX A;  1T3B A;  3DWV A;  4LL4 B;  1GTB A;  1TK8 B;  4IHU A;  4DSR A;  3C8E A;  5IMA A;  1NSW A;  1TU8 A;  1G6Y A;  1NM3 A;  2IMK A;  3D21 A;  4TR0 A;  1WPI A;  4HS1 A;  3FR6 A;  2MYG A;  3KD0 A;  1WRY A;  4TXO A;  2OA7 A;  4HI7 A;  2B3S A;  2C0F A;  2B6M A;  2YN1 A;  4HDE A;  2VM2 A;  2B7K A;  4XS4 B;  2PWJ A;  1A8Y A;  3P90 A;  4IEL A;  1XBS A;  1Z3E A;  2PPT A;  4OCE A;  1OC8 A;  5DAL A;  4ZL9 A;  5AIX A;  2AHE A;  5ECN B;  1O6J A;  3C71 A;  4YAV A;  3VWV A;  4EXJ A;  3GN3 A;  5IMZ A;  3FR9 A;  3Q19 A;  5A5K A;  2YNX A;  4KDX A;  1E6B A;  1PD2 1;  4FQU A;  3F6D A;  1JLV A;  2UZ8 A;  4ACS A;  2H1B A;  1O73 A;  1GSQ A;  1TK5 B;  1A2M A;  2IPA A;  1SKW B;  3HJO A;  4I2T A;  2QKE A;  6GSU A;  2HXK A;  4X43 A;  3P7X A;  2C8U A;  2M46 A;  1FHE A;  3RPP A;  1OE8 A;  1XCC A;  1OKT A;  2ALB A;  1GSE A;  2QC7 A;  3C73 A;  3TKP A;  4F03 A;  3GX8 A;  3RAZ A;  1WE0 A;  4GQF A;  2ZCT A;  3WT1 A;  1SJI A;  2EIR A;  2PU9 C;  1AAZ A;  4USS A;  4GXZ A;  4WBJ A;  1K3L A;  4F0B A;  1V58 A;  4YQM A;  5CYY A;  1ZYQ B;  2HZF A;  3WYW A;  2K18 A;  1EV4 A;  2LEG A;  2IME A;  4PNF A;  2DMM A;  4ZB9 A;  3VWU A;  4YQV A;  3IRA A;  2RLI A;  4AJ8 A;  3E0U A;  3WD6 A;  1PN0 A;  4H86 A;  2FLS A;  4G10 A;  2ON7 A;  3I43 A;  4MH2 A;  5HR2 A;  2H74 A;  3P8W A;  4TKY A;  5HR3 A;  3QDN A;  4Q5N A;  1GTU A;  2H72 A;  2C0D A;  1K0M A;  5FHI A;  3MYD A;  3NOF A;  4G0K A;  3GH6 A;  2X8G A;  1X0R A;  2LQO A;  4X0X A;  5F0G A;  4PQI A;  2YOI A;  4XTS A;  1O8X A;  2VCW A;  4QL7 A;  2OAD A;  1JZR A;  3G7I A;  1PSQ A;  4BVY A;  3UVH A;  2FCH A;  4ZXG A;  2RUF A;  2DKI A;  3GST A;  2H6X A;  1HQO A;  2LQQ A;  4OCF A;  3RPN A;  1U6T A;  3R3E A;  5CRH A;  2GSR A;  1A24 A;  3FZ4 A;  3E3E A;  4V2M A;  3UAR A;  3VI5 A;  1SJZ A;  4F9Z A;  2AYT A;  4I2U A;  22GS A;  4IN0 A;  2GT6 A;  3FEU A;  3KP9 A;  1T7P B;  3TJB A;  1TOF A;  2GQM A;  2KOK A;  3O76 A;  5G1K A;  1GSU A;  5B6N A;  2LJA A;  4N0Z A;  2GLR A;  3FR3 A;  1B9Y C;  4MPG A;  1XIY A;  3ERW A;  5G5F A;  1Q4J A;  1Z7P A;  2H70 A;  1JZD A;  2EIQ A;  2H1G A;  1QK8 A;  4G19 A;  3LYP A;  2DJ3 A;  2XBI A;  5G31 A;  4ECI A;  2PGT A;  1QFN A;  3QMX A;  2CVD A;  5CRE A;  2F8F A;  4RI6 A;  4MJC A;  4IS0 A;  1W4V A;  4IKH A;  1G0T A;  1TRU A;  1EP8 A;  3MNG A;  1NW2 A;  5D93 A;  4A5P A;  2VCX A;  2ZUP A;  1B4P A;  1YZX A;  1Y6E A;  1CQG A;  3L9U A;  2HE3 A;  3R2Q A;  1IYH A;  1ST9 A;  1K0D A;  2X8C A;  3EPT A;  3ZMK A;  1EP7 A;  4WXT A;  1K3Y A;  2FHE A;  2GST A;  2JZT A;  4PUR A;  3EVI A;  2HLS A;  5ECO B;  4N11 A;  4WF5 A;  5G1L A;  2V6K A;  1M0U A;  3VI7 A;  4O5R A;  1Y25 A;  1U3I A;  4MNN A;  2VCZ A;  4ECC A;  5D9V A;  3FZ5 A;  2GS3 A;  1PX6 A;  3GL3 A;  2H71 A;  4HU7 A;  1SU9 A;  3Q18 A;  3MDK A;  2VLV A;  3GRX A;  3HD5 A;  2H1A A;  2MMA A;  4K5R A;  3EE2 A;  2C4J A;  4HQZ A;  5F8B A;  4POM A;  3IDV A;  1U88 A;  2YZH A;  1QQ2 A;  2NDO A;  3CSJ A;  4KF9 A;  3ZFL A;  1XW9 A;  5CAX A;  2F9S A;  2CZ2 A;  2R0P A;  4XRA A;  3PPU A;  1PMT A;  5D9W A;  1ML6 A;  5DAK A;  4MF7 A;  1MEK A;  3HY2 A;  3HJM A;  2V41 A;  2VL2 A;  2PMT A;  4KDU A;  4NV5 A;  4BL7 A;  5KN0 A;  1ZYP A;  3UVT A;  3HVX A;  3HYP A;  5IO0 A;  4CW9 A;  4KSO A;  4MP4 A;  1VRS D;  4MF6 A;  2FA8 A;  5EL8 A;  3DVX A;  3GTU A;  5JCG A;  2BTO T;  5A4W A;  5FT3 A;  2P5R A;  3M9J A;  4YKF A;  5HQP A;  2C80 A;  2WZ9 A;  6GSV A;  13GS A;  3LGC A;  4G0I A;  5KN1 A;  1XVQ A;  3FHK A;  4K0N A;  4P3Y B;  2A2P A;  4MJB A;  2XC2 A;  1R5A A;  4GWR A;  1TU7 A;  4EE0 A;  3KXO A;  1GL8 A;  2V2G A;  5AIV A;  1YF0 A;  2D2Z A;  1XFL A;  1XWG A;  3ZVJ A;  2R2J A;  4HZ4 A;  5IIZ A;  2I81 A;  4TOP A;  3QCP A;  1WJK A;  5AIS A;  5CRD A;  1WWJ A;  4K2X A;  3HXS A;  2WGR A;  2WDU A;  1MD4 A;  1EEM A;  4ICY A;  1FOH A;  4ZB6 A;  1TDI A;  2LNT A;  1FW1 A;  2PBJ A;  2X8H A;  3J7Y k;  5ECK B;  1N8J A;  2F51 A;  2P0G A;  1PL1 A;  2H8L A;  2IMD A;  2AUV A;  4KE3 A;  1X5E A;  2RII A;  4KND A;  4ML1 A;  1MDJ A;  2YCD A;  1AW9 A;  2MBT A;  1DSB A;  5ECL B;  2O8V B;  3F6F A;  5ELA A;  3H93 A;  2VCV A;  3EYT A;  3S9F A;  4ILF A;  4D73 B;  5F06 A;  3FZ9 A;  2IJY A;  4KB3 A;  1JZO A;  4XS6 A;  4MH3 A;  6GST A;  1G7E A;  3HZ8 A;  1GP1 A;  3RBT A;  1NHY A;  4IJI A;  1V98 A;  5DQS A;  3FZA A;  5D96 A;  5IMV A;  3MSZ A;  3ZRD A;  4TR4 A;  3DXB A;  2WCI A;  3GHA A;  4HOJ A;  3TCO A;  3LEF A;  2CT6 A;  5J9B A;  3GFK A;  2AV4 A;  2GZZ A;  3TB2 A;  2DIY A;  4WF4 A;  1FOV A;  4G2E A;  2CVK A;  4CDO A;  1TRS A;  4MZW A;  2LRN A;  3MIX A;  4WR4 A;  1BAY A;  3ZIJ A;  2LUS A;  2YZU A;  1B8X A;  3IHG A;  4NAX A;  1M9B A;  4ZIL A;  3L78 A;  4PGT A;  2CQ9 A;  3IC8 A;  1K0O A;  3C1S A;  3KH9 A;  3HA9 A;  3V1W A;  3LXT A;  4Z2U A;  1EV9 A;  4J56 E;  1ERU A;  2E0Q A;  1Z6M A;  5CP1 A;  4TR1 A;  2IIY A;  4OD7 A;  4I5Q A;  3UBK A;  6GSS A;  10GS A;  4IGJ A;  1F37 A;  5HR1 A;  4O32 A;  1A2J A;  3TKR A;  4V1A g;  1SL2 B;  19GS A;  2VM1 A;  3CSH A;  3HCZ A;  3IPZ A;  1HNA A;  1BYE A;  4GQC A;  2GQK A;  3DML A;  3BD2 A;  2H0G A;  4F82 A;  4PTS A;  4YKG A;  3IK9 A;  3KMO A;  1IYI A;  1V57 A;  4NHZ A;  3DIE A;  1T8E B;  4FYB A;  4GF0 A;  4Z7X A;  1XOB A;  1XOA A;  2YP6 A;  4GSS A;  5IM9 A;  3KIJ A;  5IPG A;  2H66 A;  1EZK A;  2OE3 A;  3TKQ A;  5DJM A;  1FB0 A;  4CY8 A;  4XS4 A;  2WS2 A;  4O5U A;  5ECR B;  2YJ7 A;  1YKA A;  1SD9 A;  5IOW A;  4NHW A;  2XHF A;  1G7O A;  2IL3 A;  4K7I A;  5HFG A;  3ZIV A;  3GKK A;  2HFD A;  5ID2 B;  2LRT A;  4MA9 A;  3HKR A;  3CTG A;  2IMF A;  5H5S A;  3LG6 A;  1O81 A;  4ZBB A;  3K8N A;  5G5E A;  1OAZ A;  2H01 A;  3LSZ A;  4L0U A;  1CQH A;  3NIV A;  3F3Q A;  5IMC A;  4NPB A;  2BJX A;  2VLU A;  3CTF A;  2VL2 C;  5LNK e;  2M72 A;  3DD3 A;  4HJ2 A;  1SKS B;  1KNG A;  1OC3 A;  2FWH A;  12GS A;  3WGD A;  4Z2T A;  9GSS A;  4GCI A;  2E7P A;  5ECI B;  1GSS A;  2OJL A;  4KX4 A;  5E59 A;  4PXO A;  1PQN A;  5B8A A;  5J41 A;  2WUL A;  4FYU A;  3FK8 A;  4RI7 A;  2I4A A;  1U3A A;  1RQM A;  4IVF A;  4EVM A;  4PNG A;  4V2L A;  3KCM A;  4Q5Q A;  2HRF A;  2MMN A;  1NHO A;  4FH8 A;  4O7H A;  4MF5 A;  2A2S A;  4KUN A;  4N0V A;  1OYJ A;  4ZL8 A;  1UN2 A;  3HVV A;  2O7K A;  4JR4 A;  4ML6 A;  4PQ1 A;  3DYR A;  5CO3 A;  3FW2 A;  3G7Y A;  3IAS 2;  3EWL A;  5ABR A;  2C1Y A;  4I97 A;  1FAA A;  2DJ2 A;  3KMN A;  3F4T A;  2G0F A;  2YWO A;  3BJ5 A;  1FG4 A;  3A2X A;  2HRA A;  1SL0 B;  3TDG A;  3UJ1 A;  5J4U A;  4J2F A;  1KEB A;  2C0E A;  1TK0 B;  4KCE A;  2OKA A;  2DJJ A;  1SYX A;  2L57 A;  2DC5 A;  2DJK A;  3MAK A;  4DEJ A;  3ED3 A;  1M2A A;  4E8H A;  2IFQ B;  1E2Y A;  2NBS A;  1LU4 A;  3IHQ A;  7GSS A;  3GA4 A;  2DJ1 A;  5J9C A;  1XWB A;  2HSH A;  3HHV A;  2QGV A;  3VWW A;  4K0G A;  1SKR B;  3C1R A;  4MDC A;  3ME8 A;  2GT5 A;  3GH9 A;  5INY A;  1X5C A;  1ZL9 A;  2A4V A;  2JAC A;  2YJH A;  4DVC A;  1U87 A;  2E2G A;  2K6V A;  5IO2 A;  3M0F A;  2VOC A;  4GLT A;  4AJ6 A;  2VO4 A;  3A3T A;  1XXU A;  3DKS A;  1ZMA A;  5ECP B;  2PN8 A;  1TJD A;  1Q98 A;  3ZZX A;  2DJ0 A;  1K0C A;  1ACV A;  3KJY A;  2CAQ A;  4X1U A;  4TRX A;  2L6C A;  4HUA A;  4NV2 A;  1BG5 A;  4EF0 A;  1VGL A;  3GV1 A;  3GIX A;  4G9H A;  1M7T A;  1Z7R A;  3D5J A;  3UAP A;  4OO5 A;  11GS A;  3UEM A;  2GTU A;  4OO4 A;  4BVX B;  2L4C A;  1T1V A;  3CRU A;  2CX3 A;  3O3T A;  1ZYN A;  1YEP A;  5ENU A;  2L6D A;  2DBC A;  3GKX A;  2JSZ A;  2HZE B;  3W8J A;  1YJ6 A;  2E2M A;  3KTB A;  3GYK A;  1SEN A;  1H75 A;  2G2Q A;  3GKN A;  3D6I A;  3DGQ A;  4IJ3 A;  3IV4 A;  2L5L A;  3G7J A;  1TRW A;  5GAP D;  2VLT A;  3QD9 A;  1TTZ A;  3Q6O A;  2LRC A;  2AJQ B;  1PX7 A;  1THX A;  3HVS A;  2REM A;  5B7C A;  1HYU A;  4AJ7 A;  1ON4 A;  3L0H A;  1OE7 A;  1PA3 A;  2OE0 A;  3I6A A;  2DML A;  1PL2 A;  1R5P A;  2CA8 A;  3CRT A;  1KBN A;  3EUR A;  1AXD A;  2GSS A;  3M3M A;  4RQX A;  5ECS A;  4ZL7 A;  2YWN A;  2KP1 A;  2H6Z A;  5C00 A;  1X5D A;  4F0C A;  1AQW A;  4HJM A;  3BCK A;  4GTU A;  2X99 A;  4TVE A;  3KM6 A;  4Q5F A;  1OC9 B;  2WB9 A;  4PUA A;  2H0H A;  3F4S A;  2HRK A;  2BMX A;  3D0Z A;  4MJA A;  2RM6 A;  3Q74 A;  4JZQ A;  3APS A;  4EIP A;  3EU3 A;  4TXV A;  3LOR A;  1W89 A;  1T4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...