1X9MB

T7 dna polymerase in complex with an n-2-acetylaminofluorene-adducted dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*GP*AP*GP*AP*GP*TP*GP*AP*TP*TP*GP*GP*TP*AP*GP*TP*GP*
publication title Crystal structures of 2-acetylaminofluorene and 2-aminofluorene in complex with T7 DNA polymerase reveal mechanisms of mutagenesis.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transferase/electron transport/dna
total genus 29
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1x9mB00
1Z7PA 2H1BA 2C0EA 1BAYA 3DYRA 3WT2A 3VWVA 3ZFBA 4PNGA 3C71A 22GSA 2IMIA 1UVZA 2O7KA 1HQOA 2B7JA 2IMDA 2H0IA 2O85A 1RW1A 1HD2A 1BQ7A 1SKWB 1QQ2A 4FYUA 4JBBA 2E7PA 1F6MC 3A3TA 4EE0A 4ZILA 2NTOA 2KP2A 1HYUA 2EIQA 5DALA 1A2MA 3FZAA 3QFAC 2H0GA 1T4YA 1XW5A 2PERA 2C0GA 3QFBC 1SD9A 5FWGA 5F8BA 1GTAA 1TW9A 3MSZA 4YQVA 5GAND 5L71A 3NOFA 1EP7A 5DQYA 1FB6A 4KUNA 1HNAA 3FKFA 4TR3A 3GL5A 4RI6A 5EY6A 5ECOB 4ILFA 2JACA 3C8EA 1BYEA 2VD0A 2F9SA 2AJQB 1CQGA 5E4WA 2IL3A 2GQKA 1B9XC 1X5EA 2JL4A 2YNXA 2YN1A 1Z7RA 2F8FA 1TK0B 3CMIA 4IQ1A 5B8AA 3IK7A 3TJJA 3GH6A 4TXOB 2V2GA 2B5XA 2K6VA 2DJJA 1A8YA 3A5WA 4EL1A 3ED3A 3VK9A 4KCEA 2VL9A 4I6XA 2B5YA 2CVKA 1J08A 5IPHA 2H6XA 1M9BA 3O76A 4OMVA 4EDYA 4MABA 3L9SA 1VF4A 2GZPA 4MPGA 2YWNA 5IO0A 3GA4A 1JZRA 4KDYA 5JWOB 8GSSA 3U5RE 4XS4B 5B7CA 2XPDA 3QCPA 3BBYA 3G9BA 3HY2A 1WE0A 4KGIA 5D96A 3WGEA 5COHA 1R4WA 1XW6A 1SL1B 3GV1A 2B7KA 3WD6A 4K6XA 1SU9A 2O87A 4JZQA 5H5RA 1FAAA 4ULXA 4IJ3A 5J3RA 1LJRA 5AIVA 3GTUB 4NPBA 1S3AA 3GSSA 1MDJA 4MF6A 1OC8A 3EMPA 2L4CA 4ID0A 3TOUA 1XFLA 2A2RA 2VCQA 3VURA 3H4KA 2WS2A 4OFTA 5IQYA 2GZYA 4TKYA 4GQFA 4G19A 3FY7A 4MF5A 3E3EA 3UAPA 17GSA 3S9FA 3K8NA 2LRNA 3TRQA 3IK9A 4X1UA 1OYJA 4PXOA 2GQMA 4AJ8A 2ON7A 2GSQA 4IP1A 1RQMA 4LL4B 2VM1A 3HZ4A 3L9UA 2YJHA 5EVOA 2I3YA 4PX1A 2O8VB 2VUPA 3KCMA 1X9WB 2MBSA 1KEBA 4MK3A 1TJDA 1GSFA 2V6OA 2PVOC 4BL7A 5IMDA 4MMMA 1GSSA 3KGKA 2LRCA 4MP4A 3KH7A 4IKHA 5DCGA 2KHPA 2JZTA 2IMEA 2GZZA 1PQNA 3RHCA 2I1UA 2NDOA 1MDIA 4IELA 4D73B 5D9TA 3I6AA 4KW6A 4DEJA 2B3SA 2CAQA 3ZIJA 4HQSA 1J0FA 5HR0A 3UVTA 3ZZXA 5ECSA 2LQOA 1KTEA 1WWJA 5ID2A 2ZUPA 1OE8A 2FWHA 1EEMA 2R5GA 1JZOA 3HJPA 4DVCA 3J7Yb 1H4OA 5C00A 3M9JA 3KMOA 14GSA 3KD0A 4F9ZA 3IDVA 1X9MB 1DBYA 3D6IA 4MPFA 1SENA 2CVBA 4V2NA 5KN0A 4PUAA 1ABAA 1URMA 4ML1A 4CDOA 5DAKA 2FWGA 3DMLA 2AUVA 1QGVA 5KN3A 2DSAA 5FT3A 4IQAA 3CYNA 2PGTA 5F07A 4KNDA 2WZ9A 5D9VA 4MJEA 20GSA 3VI7A 3HHVA 1LU4A 4TR1B 6GSSA 2FY6A 4OO5A 4KDUA 4YQUA 1UA5A 4I8BA 3VI5A 5GSSA 1K3YA 3HDCA 1U88A 5A4UA 3IBHA 3VPTA 4F03A 5DQSA 1G6YA 1V40A 1PMTA 4RI7A 3RHBA 2PU9C 1SYXA 5G1LA 5ELAA 4GLTA 3M1GA 1QUWA 3H1NA 3F6FA 2VCZA 4IGJA 3TKQA 4FYCA 5JCWA 2HLSA 3FHKA 1ZCPA 4EKZA 2VCVA 4F2IA 1XBSA 3H79A 3GX0A 1ZYEA 3BD2A 5J41A 1SL2B 4TW5A 2CAIA 1TU7A 2RM5A 1A0FA 5GAPD 1V98A 1K0MA 4POLA 3UEMA 5ECLB 2QKEA 4I97A 4CHSA 4OCFA 4QL9A 1TI1A 1I5GA 5CP1A 5ENUA 3FYGA 1F2EA 3ZMLA 2P0GA 4GF0A 1Z9HA 2IIYA 3HKRA 4H86A 3A2WA 4WEYA 1TXXA 1AC1A 1ERUA 3P7XA 2C8UA 3GYKA 3V1WA 1FOVA 4I5QA 1AIUA 4EF0A 2VCXA 2RLIA 2AAWA 1X5CA 1EWXA 3F8UA 1TK5B 4ECJA 4XS6A 4J2FA 3EYTA 5CAXA 2I81A 3HZ8A 2H8LA 1XPVA 2X64A 2H75A 4O7HA 1Q98A 2DLXA 2KLXA 1NHYA 1PKWA 2HE3A 2OE0A 2R3XA 5D9XA 1Z6MA 3E0UA 1GSDA 4NV5A 3W8SA 2RIIA 1DSBA 3RPPA 4HZ4A 4GRFA 3KZQA 3MDKA 4NMUA 2V1MA 2DMLA 1KNGA 1ACVA 1SKSB 2RUEA 3F9UA 2H6ZA 2E2GA 1O81A 5G2ZA 5H5SA 2H1AA 5ECNB 2HZEB 3IXRA 4TR4A 3PH9A 4MA9A 1GSUA 5IMAA 4K7OA 4ZBBA 2KP1A 4YAPA 3KP9A 1H75A 2DJKA 2G2QA 2LJAA 3ZVJA 3IAS2 3QD9A 4KH7A 2LNTA 4YH2A 4X43A 5JCUA 1SD8A 4HEA2 1T7PB 3M0FA 2B1KA 4OO4A 4LLRA 1ERTA 1E6BA 1R5PA 2G0FA 5ECHB 1XXUA 1XZOA 4I2UA 1GWCA 3ZVJD 3QOUA 2DMMA 5IMFA 11GSA 2PUKC 4TVEA 4V1Ag 1XWKA 4EC0A 2HT9A 1R5AA 2MMAA 4AF2A 3BJ5A 1PL1A 1FHEA 2WDUA 3LXZA 2CZ2A 1B4QA 3C1SA 4TRXA 1T4ZA 4MZCA 2R2JA 1QK8A 4KDXA 1TRVA 2IN3A 1A2JA 1VRSD 4QQ7A 1F3AA 2H0HA 3I9V2 2VLVA 2H1GA 3TJGA 5DBQA 1Z6NA 2LTKA 2YP6A 3AY8A 1YKCA 3LG6A 3TB2A 4GSTA 2LKUA 2FD3A 2KOKA 2CX3A 2JU5A 3PR8A 3CRUA 3DIEA 4E8HA 1YQ1A 6GSYA 3KIJA 4NAXA 3GHAA 4MZBA 3LJRA 5J9CA 3GFKA 1JZWA 3F4RA 3C1RA 6GSUA 1GTIA 1TOFA 1SL0B 1PX6A 3CTFA 3DEXA 3I69A 2C0FA 5JCGA 3EVIA 1ERVA 2CQ9A 2B6MA 4EDZA 5IIZA 4L0WA 2OBIA 1BEDA 2H01A 3QDNA 1SJZA 3ISOA 3GL3A 2TRCP 3ZMKA 3DVXA 4K9ZA 1GNWA 2N5BA 3MWHA 4HU9A 2YWMA 3APOA 4Q5FA 3KP8A 4GSNA 4L5OA 3HCZA 5AN1A 5JWQB 1S3CA 2WJUA 1W89A 3WGXA 4GXZA 5INYA 2K9FA 2GS3A 4I2TA 2R4VA 4MF7A 2L6DA 2C3TA 4G10A 4HU7A 4XTSA 4HDEA 1GUMA 1TTZA 1THXA 5JWRB 3FR6A 5ECQB 4PQHA 3W8JA 3OR5A 3TKSC 1X0RA 5LD0A 5HR2A 5D8IA 2VAFA 4TN8A 2H6YA 1M9AA 2YWOA 1EGOA 5IOXA 1AAZA 4EVMA 2OBKA 1UN2A 4K2DA 1MDKA 1VF3A 3IR4A 4X0XA 4CW9A 1GSEA 3KTBA 4ECCA 3U6VA 3J7Yk 2VL3A 4PQ1A 1C72A 4MH3A 3ZLPA 4FO5A 3GH9A 1V58A 4DSSB 3UBLA 3I43A 4TXOA 3EURA 5C04A 5ID2B 3BOAA 4ZBDA 3HJMA 3QR6A 2B5EA 2P5RA 2GT6A 3DRNA 2WCIA 4KX4A 3FZ9A 2I9HA 5J5NA 3QPMA 1FB0A 1GLQA 1ON4A 4IHUA 2ZNMA 1R7HA 4LMVA 1QXHA 1XCCA 2TRXA 4O92A 1TP9A 2REMA 4QL7A 3P90A 4XS4A 2VCTA 4L5LA 1GL8A 1RK4A 5D9WA 2VLUA 2HSHA 3CSJA 4TXVA 3EMXA 2X8CA 3KEBA 4HJMA 4LL1B 4XCSA 3R2QA 1FG4A 18GSA 3N5OA 1JLWA 1B4PA 1TRSA 2PN8A 3D4TA 4PURA 3VPQA 2OKAA 2FA4A 5FHIA 1M2BA 1EOHA 2GTUA 2HSYA 5EL8A 1M7TA 3PINA 2WB9A 5G5EA 2YV9A 3LSZA 4YQMA 1V2AA 4G9HA 1SJIA 4JU5A 3CRTA 3VLNA 3F4SA 1F3BA 2Z9SA 3H93A 4IW9A 1I9DA 2OADA 5CNWA 2IFQB 1AQVA 2LJRA 3A2XA 1YEXA 2PVQA 1Z5YE 4ML6A 4FIWA 2LS5A 1WJKA 4F0CA 1O8WA 4IBPA 2J23A 1SK0A 1K3OA 2C4JA 1DE2A 3P8WA 5D93A 3TOTA 1GLPA 5AGYA 3RAZA 5A4WA 2PWJA 2RUFA 1WMJA 3UJ1A 3KTLA 5HR1A 5IPGA 3CXGA 1DUGA 4F0BA 3ME7A 3FEUA 1WOUA 3LQ7A 5B6NA 2VM2A 4KCAA 1OKTA 2H74A 4XHMA 3F3QA 1JFUA 10GSA 5ECPB 4KAEA 1TDIA 4K1FA 1ZZYA 4DSQA 1ST9A 3LYPA 1TRWA 4OFMA 6GSTA 3GMFA 4IVFA 4OD7A 1GTBA 4D73A 2MMZA 2NPBA 3TRXA 3HVVA 2GVPA 5ECIB 5G5FA 4ISDA 1T3BA 1DE1A 1WIKA 1EOGA 4EUYA 2EIOA 3WYWA 2LNSA 4POMA 2IWTA 3TKSE 1T8EB 3QAWA 5J4UA 1G7OA 4J56E 2CT6A 1K0AA 1NSWA 4WF5A 1YY7A 1O73A 1TRUA 2LQQA 2E2MA 2K8VA 2AV4A 4O32A 1XIYA 2GQLA 2HXKA 1B9YC 2DJ2A 4J57E 1K0BA 2HYXA 5J9BA 1XWAA 5HQPA 1M2DA 4OFNA 3DXBA 2VL2C 4JRRA 1Y6EA 3M9KA 2GSRA 5H5QA 1PX7A 2TIRA 1BX9A 3HVSA 4BPYA 4K7NA 2V6KA 3LXTA 4IS0A 2VL2A 2LUSA 4ZL9A 1Z3EA 1ZYQB 1X5DA 4WKWA 3ZIVA 3SWLA 2H76A 2VIMA 1A0RP 1A24A 2VD1A 3UMAA 3LORA 2LRTA 4P3YB 1AXDA 3HD5A 2P31A 2LEGA 3WGDA 3G7IA 1OVNA 4L8EA 1K3LA 3APQA 2IMFA 2VOCA 16GSA 3HXSA 1PA3A 1PN9A 3TJKA 3Q19A 3LGCA 1EEJA 3W6GA 2GSTA 4V2MA 4V2LA 4BVYA 3N9JA 5DALB 2JADA 4BA7A 1SJ6A 3O6TA 4V1Ap 2EIRA 2H19A 1HNBA 1O85A 6GSVA 3CBUA 1O7UA 2FUG2 3D0ZA 4PQIA 1PRXA 3TJFA 5A4VA 1N8JA 3DWVA 2CX4A 1Q4JA 3E9JB 3F4TA 1NW2A 1N2AA 5D73A 3FR3A 4N10A 4ZB6A 1AQXA 1U87A 3FZ5A 2GSSA 1BG5A 2XPEA 5CRWA 5B8BA 2C3QA 5IMVA 5HFKA 3VWWA 1ZL9A 1YF0A 3NIVA 4MJCA 4XRAA 2HNLA 2H72A 3Q74A 3NZNA 3TUEA 3VFIA 2HZFA 4LA1A 1AUCA 1EV4A 1BJXA 2H1DA 3FW2A 1G7EA 2DJ3A 4POBA 3F6DA 4LMWA 1F9MA 4AJ7A 4MJBA 4IN0A 3GSTA 5CRHA 3EU3A 4WBJA 3DD3A 2WGRA 3VWXA 3GKNA 3KXOA 2OA7A 2MBTA 1U3IA 4HOJA 3PGTA 2X8HA 2F8AA 5DJMA 2OJLA 2H30A 4POKA 2OE3A 4BWSA 3LYKA 4KE3A 4WETA 4EO3A 5EPFA 1T00A 1TKDB 4JEDA 3RPNA 1YKAA 4FH8A 2CVDA 1YJ6A 1ZGNA 2HZEA 2DIZA 4WR5A 2FNOA 2PBJA 2K8SA 4JR4A 3RDWA 4BVXA 1LBKA 5CREA 2C3NA 4AJ6A 1OE7A 1YF1A 1A2LA 3GX8A 4IP6A 5IM9A 1SYRA 4ZBAA 1U6TA 1G0TA 2MYGA 1WRYA 4HJ2A 6GSXA 3A2VA 3MNGA 2AYTA 1GTUA 1ZMAA 5ECKB 1MTCA 2VLTA 3ME8A 1USBA 1OC9A 1T1VA 4OCEA 5IMZA 4ACSA 3LEFA 4KA0A 2M72A 1GH2A 4HS1A 4EXJA 3UOMA 4NXIA 5LCZA 4ZB9A 3EINA 4K7IA 1X9SB 1NHOA 4TOPA 2AHEA 4N11A 3KM6A 3EC3A 2A2SA 3VWUA 3D4MA 2YCDA 1FO5A 2FWEA 3CTGA 2N5FA 3TKPA 4ZXGA 1OKDA 4WF4A 2FLSA 2WULA 4GCIA 1XVWA 1M0UA 4OWYA 5F05A 3ZTLA 2RM6A 5CO3A 3D22A 3TCOA 4MLYA 1FVJA 1G6WA 4YAVA 4K8MA 2ZCTA 1GUKA 4NHWA 4DSRA 4ZL8A 2EC4A 2K18A 2YZUA 4MH2A 4K0NA 2CA8A 3MAKA 4ZIJA 1JHBA 4Z7XA 5AIXA 3TKSA 1W4VA 2IPAA 4MZWA 2C0DA 3IRAA 3ZRDA 1NM3A 6GSWA 2HFDA 1HNCA 5CRGA 1SKRB 1VGLA 3ERFA 1VF2A 3TRPA 5ECRB 1ML6A 1XW9A 4Q5RA 3LFLA 3QMXA 2DIYA 5HR3A 2HRFA 4GTUA 2XBQA 2QGVA 2YWIA 4L0UA 2WRTA 4NWYA 5KN1A 2YV7A 4RQXA 2OACA 1K0DA 3SBCA 1JLVA 3ERGA 2MMOA 3FZ4A 3ZITA 2CZ3A 2L57A 2WFCA 3Q18A 3ERWA 2O89A 5ELGA 1PD21 2IMKA 1GULA 1KBNA 1YDKA 5IMCA 2H66A 3KJYA 1TK8B 2DJ0A 5DDLA 5DAKB 3UBKA 1J9BA 3GN3A 3TGZA 2AB6A 3F63A 1GSYA 1SK1A 2E0QA 4ECBA 3APSA 5AISA 3DKSA 5HFGA 1E2YA 2M46A 2FCHA 4GWRA 1PGTA 5DJLA 1M99A 4N0ZA 1O8XA 5HFIA 2F51A 2XHFA 1JZDA 5KEJA 3GUSA 1EP8A 2J9HA 2V32A 3JCML 3M8NA 4G2EA 3GKKA 1WP0A 3CSIA 3GTUA 1GNEA 1PKZA 2L59A 5IO2A 7GSSA 2X8GA 3UARA 2IJYA 9GSSA 1B8XA 2JSZA 1V57A 4N30A 3UIWA 1TI3A 3EU4A 3QAVA 2P5QA 3GIXA 3L0HA 4GQCA 4DSSA 2YOIA 1IYIA 2JZSA 5G31A 3RBTA 4KSOA 4TR0A 2YANA 3IPZA 1PL2A 1XOBA 3HYPA 4KB3A 2GDRA 1XWCA 3D21A 1GUHA 1AW9A 5CYYA 3HVXA 3BCIA 3FK8A 5LNKe 2NBSA 1QMVA 2GLRA 1PSQA 4E8EA 2DJ1A 4PUFC 1S3DA 3GKMA 3IE3A 3L4NA 3QAGA 1XWGA 3C7MA 2NVLA 1OAZA 1EGRA 2YJ7A 2PPTA 2L6CA 1GRXA 2L5OA 1SK2A 3ZREA 1MD4A 3ZYWA 4NV2A 3WT1A 1ILOA 2R37A 2BMXA 3D5JA 2B1LA 2H73A 3DVWA 4GSSA 4BWQA 4WBRD 3C73A 1U3AA 4HQZA 1EV9A 4WXTA 1THOA 2GGTA 3DGQA 2F3MA 1AQWA 1WPIA 2C80A 2MMNA 3IHQA 1O6JA 5F0GA 5E59A 1F37A 2DC5A 2JSYA 2LV3A 2FWFA 5G30A 2DBCA 3GRXA 1XWBA 1K0CA 3UVHA 1FW1A 2BJXA 1R26A 3L9VA 2X99A 4HUAA 2IFQA 12GSA 3P2AA 3TJBA 3HA9A 5DVBA 1GSQA 1K0NA 4IJIA 2VCWA 1M2AA 4NHZA 5GZZB 2BTOT 1MEKA 3GURA 2ES7A 13GSA 2YZHA 5IOWA 5KN2A 3FR9A 2KUCA 3LWAA 3BCKA 2QSIA 3H8QA 1OC3A 3O3TA 4JR6A 2JZRA 5B6MA 1ZOFA 2FA8A 2HRNA 4FYBA 2LJKA 2L5LA 4K0GA 4N0VA 2GT5A 4Q5NA 1A8LA 2FHEA 4HI7A 4TR1A 3KH9A 2H71A 2D2ZA 3IC4A 5ABRA 2ON5A 4O5RA 4ZL7A 1GP1A 1TU8A 1CQHA 3IOSA 5G1KA 1B48A 1ERWA 2PMTA 1Y25A 2VO4A 2MZCA 4ECIA 3ZFLA 3F3RA 1EZKA 2LSTA 3G7YA 2XC2A 3EE2A 2N5AA 4MDCA 3ZL5A 3IV4A 3F0IA 4MJAA 5DCHA 4ZB8A 2C1YA 3EWLA 4MCUA 4PGTA 3Q6OA 5F06A 3US3A 3G7JA 2M80A 3FRCA 2YPMA 4KSMA 4Q5QA 19GSA 3HJOA 2A4VA 2H70A 3M3MA 4XS1A 3KMNA 1FVKA 1XVQA 3GNJA 2QC7A 4F82A 4RUVA 1XOAA 4XIHA 4PNFA 4XRDA 1QFNA 4RQRA 3TKRA 1YZXA 5ECMB 2CV4A 2OE1A 2FGXA 4AGSA 2HI7A 3CSHA 1V9WA 1YEPA 1K0OA 2I4AA 1VF1A 4WR4A 3UL3A 3IA1A 5A5KA 1UC7A 2ALBA 5GSTA 2R6KA 2XBIA 4JE1A 5CRDA 3GKXA 3L78A 1MD3A 2V41A 3IAM2 1IYHA 2L4QA 1A23A 1OC9B 4HZ2A 3TDGA
chains in the Genus database with same CATH superfamily
1Z7PA 2H1BA 2C0EA 1BAYA 3DYRA 3WT2A 3VWVA 3ZFBA 4PNGA 3C71A 22GSA 2IMIA 1UVZA 2O7KA 1HQOA 2B7JA 2IMDA 2H0IA 2O85A 1RW1A 1HD2A 1BQ7A 1SKWB 1QQ2A 4FYUA 4JBBA 2E7PA 1F6MC 3A3TA 4EE0A 4ZILA 2NTOA 2KP2A 1HYUA 2EIQA 5DALA 1A2MA 3FZAA 3QFAC 2H0GA 1T4YA 1XW5A 2PERA 2C0GA 4PTSA 3QFBC 1SD9A 5FWGA 5F8BA 1GTAA 1TW9A 3MSZA 4YQVA 5GAND 5L71A 3NOFA 1EP7A 5DQYA 1FB6A 4KUNA 1HNAA 3FKFA 4TR3A 3GL5A 4RI6A 5EY6A 5ECOB 4ILFA 2JACA 3C8EA 1BYEA 2VD0A 2F9SA 2AJQB 1CQGA 5E4WA 2IL3A 2GQKA 1B9XC 1X5EA 2JL4A 2YNXA 2YN1A 1Z7RA 2F8FA 1TK0B 3CMIA 4IQ1A 5B8AA 3IK7A 3TJJA 3GH6A 4TXOB 2V2GA 2B5XA 2K6VA 2DJJA 1A8YA 3A5WA 4EL1A 3ED3A 3VK9A 4KCEA 2VL9A 4I6XA 2B5YA 2CVKA 1J08A 5IPHA 2H6XA 1M9BA 3O76A 4OMVA 4EDYA 4MABA 3L9SA 1VF4A 2GZPA 4MPGA 2YWNA 5IO0A 3GA4A 1JZRA 4KDYA 5JWOB 8GSSA 3U5RE 4XS4B 5B7CA 2XPDA 3QCPA 3BBYA 3G9BA 3HY2A 1WE0A 4KGIA 5D96A 3WGEA 5COHA 1R4WA 1XW6A 1SL1B 3GV1A 2B7KA 3WD6A 4K6XA 1SU9A 2O87A 4JZQA 2R0PA 5H5RA 1FAAA 4ULXA 4IJ3A 3R3EA 5J3RA 1LJRA 5AIVA 3GTUB 4NPBA 1S3AA 3GSSA 1MDJA 4MF6A 1OC8A 3EMPA 2L4CA 4ID0A 3TOUA 1XFLA 2A2RA 2VCQA 1M3IA 3VURA 3H4KA 2WS2A 4OFTA 5IQYA 2GZYA 4TKYA 4GQFA 4G19A 3FY7A 4MF5A 3E3EA 3UAPA 17GSA 3S9FA 3K8NA 2LRNA 3TRQA 3IK9A 4X1UA 1OYJA 4CY6A 4PXOA 4K5RA 2GQMA 4AJ8A 2ON7A 2GSQA 4IP1A 4A5PA 1RQMA 4LL4B 2VM1A 3HZ4A 3L9UA 2YJHA 5EVOA 2I3YA 4PX1A 2O8VB 2VUPA 3KCMA 1X9WB 2MBSA 1KEBA 4MK3A 1TJDA 1GSFA 2V6OA 2PVOC 4BL7A 5IMDA 4MMMA 1GSSA 3KGKA 2LRCA 4MP4A 3KH7A 4IKHA 5DCGA 2KHPA 2JZTA 2IMEA 2GZZA 1PQNA 3RHCA 2I1UA 2NDOA 1MDIA 4IELA 4D73B 5D9TA 3I6AA 4KW6A 4DEJA 2B3SA 2CAQA 3ZIJA 4HQSA 1J0FA 5HR0A 3UVTA 3ZZXA 5KOWA 5ECSA 2LQOA 1KTEA 1WWJA 5ID2A 2ZUPA 1OE8A 2FWHA 1EEMA 2R5GA 1JZOA 3HJPA 4DVCA 3MIXA 3J7Yb 1H4OA 5C00A 3M9JA 3KMOA 14GSA 3KD0A 4F9ZA 3IDVA 1X9MB 1DBYA 3D6IA 4MPFA 1SENA 3IC8A 2CVBA 4V2NA 5KN0A 4PUAA 1ABAA 1URMA 4ML1A 4CDOA 5DAKA 2FWGA 3DMLA 2AUVA 1QGVA 5KN3A 2DSAA 5FT3A 4IQAA 3CYNA 2PGTA 5F07A 4KNDA 2WZ9A 1ZYPA 5D9VA 4MJEA 20GSA 3VI7A 3HHVA 1LU4A 4TR1B 6GSSA 2FY6A 4OO5A 4KDUA 4YQUA 1UA5A 4I8BA 3VI5A 5GSSA 1K3YA 3HDCA 1U88A 5A4UA 3IBHA 3VPTA 4F03A 5DQSA 1G6YA 1V40A 1PMTA 4RI7A 3RHBA 2PU9C 1SYXA 5G1LA 5ELAA 4GLTA 3M1GA 1QUWA 3H1NA 3F6FA 2VCZA 4IGJA 3TKQA 4FYCA 5JCWA 2HLSA 3FHKA 1ZCPA 4EKZA 2VCVA 4BVYB 4F2IA 1XBSA 3H79A 3GX0A 1ZYEA 3BD2A 5J41A 1SL2B 4TW5A 2CAIA 1TU7A 2RM5A 1A0FA 4Z2TA 5GAPD 1V98A 1K0MA 4POLA 3UEMA 5ECLB 2QKEA 4I97A 4CHSA 4OCFA 4QL9A 5BMUA 1TI1A 1I5GA 5CP1A 5ENUA 3FYGA 1F2EA 3ZMLA 2P0GA 4GF0A 1Z9HA 2IIYA 3HKRA 4H86A 3A2WA 4WEYA 1TXXA 1AC1A 1ERUA 3P7XA 2C8UA 3GYKA 3V1WA 1FOVA 4I5QA 1AIUA 4EF0A 2VCXA 2RLIA 2AAWA 1X5CA 1EWXA 3F8UA 1TK5B 4ECJA 4XS6A 4J2FA 3EYTA 5CAXA 2I81A 3HZ8A 2H8LA 1XPVA 2X64A 2H75A 4O7HA 1Q98A 2DLXA 2KLXA 1NHYA 1PKWA 2HE3A 2OE0A 2R3XA 5D9XA 1Z6MA 3E0UA 1GSDA 4NV5A 3W8SA 1ZYNA 2RIIA 1DSBA 3RPPA 4HZ4A 4GRFA 3KZQA 3MDKA 4NMUA 2V1MA 2DMLA 1KNGA 1ACVA 1SKSB 2RUEA 3F9UA 2H6ZA 5BRTA 2E2GA 1O81A 2HSMA 5G2ZA 5H5SA 2H1AA 5ECNB 2HZEB 3IXRA 4TR4A 3PH9A 4MA9A 1GSUA 5IMAA 4K7OA 4BVXB 4ZBBA 2KP1A 4YAPA 1PFOA 3KP9A 1H75A 2DJKA 2G2QA 2LJAA 3ZVJA 3IAS2 3QD9A 4KH7A 2LNTA 4YH2A 4X43A 5JCUA 1SD8A 4HEA2 1T7PB 3M0FA 2B1KA 4KF9A 4OO4A 4LLRA 1ERTA 1E6BA 1R5PA 2G0FA 5ECHB 1XXUA 1XZOA 4I2UA 1GWCA 3ZVJD 3QOUA 2DMMA 5IMFA 11GSA 2PUKC 4TVEA 4V1Ag 1XWKA 4EC0A 2HT9A 2A4HA 4G0KA 1R5AA 2MMAA 4AF2A 3BJ5A 1PL1A 1FHEA 2WDUA 4X4JA 3LXZA 2CZ2A 1B4QA 3C1SA 4TRXA 1T4ZA 4MZCA 2R2JA 1QK8A 4KDXA 4BIKA 1TRVA 2IN3A 1A2JA 1VRSD 2QA2A 4QQ7A 4O5UA 1F3AA 2H0HA 3I9V2 2VLVA 2H1GA 3TJGA 5DBQA 1Z6NA 2LTKA 2YP6A 3AY8A 1YKCA 3LG6A 3TB2A 4GSTA 2LKUA 2FD3A 2KOKA 2CX3A 2JU5A 3PR8A 3CRUA 3DIEA 4E8HA 1YQ1A 6GSYA 3KIJA 4NAXA 3GHAA 4MZBA 3LJRA 5J9CA 3GFKA 1JZWA 3F4RA 3C1RA 6GSUA 1GTIA 1TOFA 1SL0B 3LW9A 1PX6A 3CTFA 3DEXA 3I69A 2C0FA 5JCGA 3EVIA 1ERVA 2CQ9A 2B6MA 4EDZA 5IIZA 4L0WA 2OBIA 1BEDA 2H01A 3QDNA 1SJZA 3ISOA 3GL3A 2TRCP 3ZMKA 3DVXA 4K9ZA 1GNWA 2N5BA 3MWHA 4HU9A 2YWMA 3APOA 4Q5FA 3KP8A 4GSNA 4L5OA 3HCZA 5AN1A 5JWQB 1S3CA 2WJUA 1W89A 3WGXA 4GXZA 5INYA 2K9FA 2GS3A 4I2TA 2R4VA 4MF7A 2L6DA 2X49A 2C3TA 4G10A 4HU7A 4XTSA 4HDEA 1GUMA 1TTZA 1THXA 5JWRB 3FR6A 5ECQB 4PQHA 3W8JA 3OR5A 3TKSC 1X0RA 5LD0A 5HR2A 5D8IA 2VAFA 4TN8A 2H6YA 1M9AA 2YWOA 1EGOA 4BL7B 5IOXA 1AAZA 4EVMA 2OBKA 1UN2A 4K2DA 1MDKA 1VF3A 3IR4A 4X0XA 4CW9A 1GSEA 3KTBA 4ECCA 3U6VA 3J7Yk 2VL3A 4PQ1A 1C72A 4MH3A 3ZLPA 4FO5A 3GH9A 1V58A 4DSSB 3UBLA 3I43A 4TXOA 3EURA 5C04A 5ID2B 3BOAA 4ZBDA 3HJMA 3QR6A 2B5EA 2P5RA 2GT6A 4Z2UA 3DRNA 2WCIA 4KX4A 3FZ9A 2I9HA 5J5NA 3QPMA 1FB0A 1GLQA 1ON4A 4IHUA 2ZNMA 1R7HA 3MYDA 4LMVA 1QXHA 1XCCA 2TRXA 4O92A 1TP9A 2REMA 4QL7A 3P90A 4XS4A 2VCTA 4L5LA 1GL8A 1RK4A 5D9WA 2VLUA 2HSHA 3CSJA 4TXVA 3EMXA 2X8CA 3KEBA 4HJMA 4LL1B 2DKHA 4XCSA 3R2QA 1FG4A 18GSA 3N5OA 1JLWA 1B4PA 1TRSA 2PN8A 3D4TA 4PURA 3VPQA 2OKAA 2FA4A 5FHIA 1M2BA 1EOHA 2GTUA 2HSYA 5EL8A 1M7TA 3PINA 2WB9A 5G5EA 2YV9A 3LSZA 4YQMA 1V2AA 4G9HA 1SJIA 4JU5A 3CRTA 3VLNA 3F4SA 1F3BA 2Z9SA 3H93A 4IW9A 1XG8A 1I9DA 2OADA 5CNWA 2IFQB 1AQVA 2LJRA 3A2XA 1YEXA 2PVQA 1Z5YE 4ML6A 4FIWA 2LS5A 1WJKA 4F0CA 1O8WA 4IBPA 2J23A 1SK0A 1K3OA 2C4JA 1DE2A 3P8WA 5D93A 3TOTA 1GLPA 5AGYA 2HRKA 3RAZA 5A4WA 4YKFA 2PWJA 2RUFA 1WMJA 3UJ1A 3KTLA 5HR1A 5IPGA 3CQFA 3CXGA 1DUGA 4F0BA 3ME7A 3FEUA 1WOUA 3LQ7A 5B6NA 2VM2A 4KCAA 1OKTA 2H74A 4XHMA 3F3QA 1JFUA 10GSA 5ECPB 4KAEA 1TDIA 4K1FA 1ZZYA 4DSQA 1ST9A 3LYPA 1TRWA 4OFMA 6GSTA 3GMFA 4IVFA 4OD7A 1GTBA 4D73A 2MMZA 2NPBA 3TRXA 4EIPA 3HVVA 2GVPA 5ECIB 5G5FA 4ISDA 3EPTA 1T3BA 1DE1A 1WIKA 1EOGA 4EUYA 2EIOA 3WYWA 2LNSA 4POMA 2IWTA 3TKSE 1T8EB 3QAWA 5J4UA 1G7OA 4J56E 2CT6A 1K0AA 1NSWA 4WF5A 1YY7A 1O73A 1TRUA 2LQQA 2E2MA 2K8VA 2AV4A 1FOHA 4O32A 4G0IA 1XIYA 2GQLA 2HXKA 1B9YC 2DJ2A 4J57E 1K0BA 2HYXA 5J9BA 1XWAA 5HQPA 1M2DA 4OFNA 3DXBA 2VL2C 4JRRA 1Y6EA 3M9KA 2GSRA 5H5QA 1PX7A 2TIRA 1BX9A 3HVSA 4BPYA 4K7NA 2V6KA 3LXTA 4IS0A 2VL2A 2LUSA 4ZL9A 1Z3EA 1ZYQB 1X5DA 4WKWA 3ZIVA 3SWLA 2H76A 2VIMA 1A0RP 1A24A 2VD1A 3UMAA 3LORA 2QA1A 2LRTA 4P3YB 1AXDA 3HD5A 2P31A 2LEGA 3WGDA 3G7IA 1OVNA 4L8EA 1K3LA 3APQA 2IMFA 2VOCA 16GSA 3HXSA 1PA3A 1PN9A 3TJKA 3Q19A 3LGCA 1EEJA 3W6GA 2GSTA 4V2MA 4V2LA 4BVYA 3N9JA 5DALB 2JADA 4BA7A 1SJ6A 3O6TA 4V1Ap 2EIRA 2H19A 1HNBA 1O85A 6GSVA 3CBUA 1O7UA 2FUG2 3D0ZA 4PQIA 1PRXA 3TJFA 5A4VA 1N8JA 3DWVA 2CX4A 2A2PA 1Q4JA 2X4AA 3E9JB 3F4TA 1NW2A 1N2AA 5D73A 3FR3A 4N10A 4ZB6A 1AQXA 1U87A 3FZ5A 2GSSA 1BG5A 2XPEA 5CRWA 5B8BA 2C3QA 5IMVA 5HFKA 3VWWA 1ZL9A 1YF0A 3NIVA 4MJCA 4Z2RA 4XRAA 2HNLA 2H72A 3Q74A 3NZNA 3TUEA 3VFIA 2HZFA 4LA1A 1AUCA 1EV4A 1BJXA 2H1DA 4K5SA 3FW2A 1G7EA 2R0GA 2DJ3A 4POBA 3F6DA 4YKGA 4LMWA 1F9MA 4AJ7A 4MJBA 4IN0A 3GSTA 5CRHA 3EU3A 4WBJA 3DD3A 2WGRA 3VWXA 3GKNA 3KXOA 2OA7A 2MBTA 1U3IA 4HOJA 3PGTA 2X8HA 2F8AA 5DJMA 2OJLA 2H30A 4POKA 2OE3A 4BWSA 3LYKA 4KE3A 3PPUA 4WETA 4EO3A 5EPFA 1T00A 1TKDB 4JEDA 3RPNA 1YKAA 4FH8A 2CVDA 1YJ6A 1ZGNA 2HZEA 2DIZA 4WR5A 2FNOA 2PBJA 2K8SA 4JR4A 3RDWA 4BVXA 1LBKA 5CREA 2C3NA 4AJ6A 1OE7A 1YF1A 1A2LA 3GX8A 4IP6A 5IM9A 1SYRA 4ZBAA 1U6TA 5KOXA 1G0TA 2MYGA 1WRYA 4HJ2A 6GSXA 3A2VA 3MNGA 2AYTA 1GTUA 4EIQA 1ZMAA 5ECKB 1MTCA 2VLTA 3ME8A 1PN0A 1USBA 1OC9A 1T1VA 4OCEA 5IMZA 4ACSA 3LEFA 4KA0A 2M72A 1GH2A 4HS1A 4EXJA 3UOMA 4NXIA 5LCZA 4ZB9A 3EINA 4K7IA 1X9SB 1NHOA 4TOPA 2AHEA 4N11A 3KM6A 3EC3A 2A2SA 3VWUA 3D4MA 2YCDA 1FO5A 2FWEA 3CTGA 2N5FA 3TKPA 4ZXGA 1OKDA 4WF4A 2FLSA 2WULA 4GCIA 1XVWA 1M0UA 4OWYA 5F05A 3ZTLA 2RM6A 5CO3A 3D22A 3TCOA 4MLYA 1FVJA 1G6WA 4YAVA 4K8MA 2ZCTA 1GUKA 4NHWA 4USSA 4DSRA 4ZL8A 2EC4A 2K18A 2YZUA 4MH2A 4K0NA 2CA8A 3MAKA 4ZIJA 1JHBA 4Z7XA 5AIXA 3TKSA 1W4VA 2IPAA 4MZWA 2C0DA 3IRAA 3ZRDA 1NM3A 6GSWA 2HFDA 1HNCA 5CRGA 1SKRB 1VGLA 3ERFA 1VF2A 3TRPA 5ECRB 1ML6A 1XW9A 4Q5RA 3LFLA 3QMXA 2DIYA 5HR3A 2HRFA 4GTUA 2XBQA 2QGVA 2YWIA 4L0UA 2WRTA 4NWYA 5KN1A 2YV7A 4RQXA 2OACA 1K0DA 3FMWA 3SBCA 1JLVA 3ERGA 2MMOA 3FZ4A 3ZITA 2CZ3A 2L57A 2WFCA 3Q18A 3ERWA 2O89A 5ELGA 1PD21 2IMKA 1GULA 1KBNA 1YDKA 5IMCA 2H66A 3KJYA 1S3RA 1TK8B 2DJ0A 5DDLA 5DAKB 3UBKA 1J9BA 3GN3A 3TGZA 2AB6A 3F63A 1GSYA 1SK1A 2E0QA 4ECBA 3APSA 5AISA 3DKSA 5HFGA 1E2YA 2M46A 2FCHA 4GWRA 1PGTA 5DJLA 1M99A 4N0ZA 1O8XA 5HFIA 2F51A 2XHFA 1JZDA 5KEJA 3GUSA 1EP8A 2J9HA 2V32A 3JCML 3M8NA 4G2EA 3GKKA 1WP0A 3CSIA 3GTUA 4HSCX 1GNEA 1PKZA 2L59A 4ICYA 5IO2A 7GSSA 2X8GA 3UARA 2IJYA 9GSSA 1B8XA 2JSZA 1V57A 4N30A 3UIWA 1TI3A 3EU4A 2R0CA 2P5QA 3GIXA 3L0HA 3QAVA 4MNNA 2DKIA 4GQCA 4DSSA 2YOIA 1IYIA 2JZSA 5G31A 3RBTA 4KSOA 4TR0A 2YANA 3IPZA 1PL2A 1XOBA 3HYPA 4KB3A 2GDRA 1XWCA 3D21A 1GUHA 1AW9A 2UZ8A 5CYYA 3HVXA 3BCIA 3FK8A 5LNKe 2NBSA 1QMVA 2GLRA 1PSQA 4E8EA 2DJ1A 4PUFC 1S3DA 3GKMA 3IE3A 3L4NA 3QAGA 1XWGA 3C7MA 2NVLA 1OAZA 1EGRA 2YJ7A 2PPTA 2L6CA 1GRXA 2L5OA 1SK2A 3ZREA 1MD4A 4CY8A 3ZYWA 4NV2A 3WT1A 1ILOA 2R37A 2BMXA 3D5JA 2B1LA 2H73A 3DVWA 4GSSA 4BWQA 3HVNA 4WBRD 3C73A 1U3AA 4HQZA 1EV9A 4WXTA 1THOA 2GGTA 3DGQA 2F3MA 1AQWA 1WPIA 2C80A 2MMNA 3IHQA 1O6JA 5F0GA 5E59A 1F37A 2DC5A 2JSYA 2LV3A 2FWFA 5G30A 2DBCA 3GRXA 1XWBA 1K0CA 3UVHA 1FW1A 2BJXA 1R26A 3L9VA 2X99A 4HUAA 2IFQA 12GSA 3P2AA 3TJBA 3HA9A 5DVBA 1GSQA 1K0NA 4IJIA 2VCWA 1M2AA 4NHZA 5GZZB 2BTOT 1MEKA 3GURA 2ES7A 13GSA 2YZHA 5IOWA 5KN2A 2HRAA 3FR9A 2KUCA 3LWAA 3BCKA 2QSIA 3H8QA 1OC3A 3O3TA 4JR6A 2JZRA 5B6MA 1ZOFA 2FA8A 2HRNA 4FYBA 2LJKA 2L5LA 4K0GA 4N0VA 2GT5A 4Q5NA 1A8LA 2FHEA 4HI7A 4TR1A 3KH9A 2H71A 2D2ZA 3IC4A 5ABRA 2ON5A 4O5RA 4ZL7A 1GP1A 1TU8A 4O5QA 1CQHA 3IOSA 5G1KA 1B48A 1ERWA 2PMTA 1Y25A 2VO4A 2MZCA 4ECIA 3ZFLA 3F3RA 1EZKA 2LSTA 3G7YA 2XC2A 3EE2A 2N5AA 4MDCA 3ZL5A 3IV4A 3F0IA 4MJAA 5DCHA 4ZB8A 1M3JA 2C1YA 3EWLA 4MCUA 4PGTA 3A5IA 3Q6OA 5F06A 3US3A 3G7JA 2M80A 3FRCA 2YPMA 4KSMA 4Q5QA 19GSA 3HJOA 2A4VA 2H70A 3M3MA 4XS1A 4G0LA 3KMNA 1FVKA 1XVQA 3GNJA 2QC7A 4F82A 4RUVA 1XOAA 4XIHA 4PNFA 4XRDA 4K2XA 1QFNA 4RQRA 3TKRA 1YZXA 5ECMB 2CV4A 2OE1A 2FGXA 4AGSA 2HI7A 3CSHA 1V9WA 1YEPA 1K0OA 2I4AA 1VF1A 4WR4A 3IHGA 3UL3A 3IA1A 5A5KA 1UC7A 2ALBA 5GSTA 2R6KA 2XBIA 4JE1A 5CRDA 3GKXA 3L78A 1MD3A 4FQUA 2V41A 3IAM2 1IYHA 2L4QA 1A23A 1OC9B 4HZ2A 3TDGA
chains in the Genus database with same CATH topology
1Z7PA 2H1BA 2C0EA 1BAYA 3DYRA 3WT2A 3VWVA 3ZFBA 4PNGA 3C71A 22GSA 2IMIA 1UVZA 2O7KA 1HQOA 2B7JA 2IMDA 2H0IA 2O85A 1RW1A 1HD2A 1BQ7A 1SKWB 1QQ2A 4FYUA 4JBBA 2E7PA 1F6MC 3A3TA 4EE0A 4ZILA 2NTOA 2KP2A 1HYUA 2EIQA 5DALA 1A2MA 3FZAA 3QFAC 2H0GA 1T4YA 1XW5A 2PERA 2C0GA 4PTSA 3QFBC 1SD9A 5FWGA 5F8BA 1GTAA 1TW9A 3MSZA 4YQVA 5GAND 5L71A 3NOFA 1EP7A 5DQYA 1FB6A 4KUNA 1HNAA 3FKFA 4TR3A 3GL5A 4RI6A 5EY6A 5ECOB 4ILFA 2JACA 3C8EA 1BYEA 2VD0A 2F9SA 2AJQB 1CQGA 5E4WA 2IL3A 2GQKA 1B9XC 1X5EA 2JL4A 2YNXA 2YN1A 1Z7RA 2F8FA 1TK0B 3CMIA 4IQ1A 5B8AA 3IK7A 3TJJA 3GH6A 4TXOB 2V2GA 2B5XA 2K6VA 2DJJA 1A8YA 3A5WA 4EL1A 3ED3A 3VK9A 4KCEA 2VL9A 4I6XA 2B5YA 2CVKA 1J08A 5IPHA 2H6XA 1M9BA 3O76A 4OMVA 4EDYA 4MABA 3L9SA 1VF4A 2GZPA 4MPGA 2YWNA 5IO0A 3GA4A 1JZRA 4KDYA 5JWOB 8GSSA 3U5RE 4XS4B 5B7CA 2XPDA 3QCPA 3BBYA 3G9BA 3HY2A 1WE0A 4KGIA 5D96A 3WGEA 5COHA 1R4WA 1XW6A 1SL1B 3GV1A 2B7KA 3WD6A 4K6XA 1SU9A 2O87A 4JZQA 2R0PA 5H5RA 1FAAA 4ULXA 4IJ3A 3R3EA 5J3RA 1LJRA 5AIVA 3GTUB 4NPBA 1S3AA 3GSSA 1MDJA 4MF6A 1OC8A 3EMPA 2L4CA 4ID0A 3TOUA 1XFLA 2A2RA 2VCQA 3VURA 3H4KA 2WS2A 4OFTA 5IQYA 2GZYA 4TKYA 4GQFA 4G19A 3FY7A 4MF5A 3E3EA 3UAPA 17GSA 3S9FA 3K8NA 2LRNA 3TRQA 3IK9A 4X1UA 1OYJA 4CY6A 4PXOA 4K5RA 2GQMA 4AJ8A 2ON7A 2GSQA 4IP1A 4A5PA 1RQMA 4LL4B 2VM1A 3HZ4A 3L9UA 2YJHA 5EVOA 2I3YA 4PX1A 2O8VB 2VUPA 3KCMA 1X9WB 2MBSA 1KEBA 4MK3A 1TJDA 1GSFA 2V6OA 2PVOC 4BL7A 5IMDA 4MMMA 1GSSA 3KGKA 2LRCA 4MP4A 3KH7A 4IKHA 5DCGA 2KHPA 2JZTA 2IMEA 2GZZA 1PQNA 3RHCA 2I1UA 2NDOA 1MDIA 4IELA 4D73B 5D9TA 3I6AA 4KW6A 4DEJA 2B3SA 2CAQA 3ZIJA 4HQSA 1J0FA 5HR0A 3UVTA 3ZZXA 5KOWA 5ECSA 2LQOA 1KTEA 1WWJA 5ID2A 2ZUPA 1OE8A 2FWHA 1EEMA 2R5GA 1JZOA 3HJPA 4DVCA 3MIXA 3J7Yb 1H4OA 5C00A 3M9JA 3KMOA 14GSA 3KD0A 4F9ZA 3IDVA 1X9MB 1DBYA 3D6IA 4MPFA 1SENA 3IC8A 2CVBA 4V2NA 5KN0A 4PUAA 1ABAA 1URMA 4ML1A 4CDOA 5DAKA 2FWGA 3DMLA 2AUVA 1QGVA 5KN3A 2DSAA 5FT3A 4IQAA 3CYNA 2PGTA 5F07A 4KNDA 2WZ9A 1ZYPA 5D9VA 4MJEA 20GSA 3VI7A 3HHVA 1LU4A 4TR1B 6GSSA 2FY6A 4OO5A 4KDUA 4YQUA 1UA5A 4I8BA 3VI5A 5GSSA 1K3YA 3HDCA 1U88A 5A4UA 3IBHA 3VPTA 4F03A 5DQSA 1G6YA 1V40A 1PMTA 4RI7A 3RHBA 2PU9C 1SYXA 5G1LA 5ELAA 4GLTA 3M1GA 1QUWA 3H1NA 3F6FA 2VCZA 4IGJA 3TKQA 4FYCA 5JCWA 2HLSA 3FHKA 1ZCPA 4EKZA 2VCVA 4BVYB 4F2IA 1XBSA 3H79A 3GX0A 1ZYEA 3BD2A 5J41A 1SL2B 4TW5A 2CAIA 1TU7A 2RM5A 1A0FA 4Z2TA 5GAPD 1V98A 1K0MA 4POLA 3UEMA 5ECLB 2QKEA 4I97A 4CHSA 4OCFA 4QL9A 5BMUA 1TI1A 1I5GA 5CP1A 5ENUA 3FYGA 1F2EA 3ZMLA 2P0GA 4GF0A 1Z9HA 2IIYA 3HKRA 4H86A 3A2WA 4WEYA 1TXXA 1AC1A 1ERUA 3P7XA 2C8UA 3GYKA 3V1WA 1FOVA 4I5QA 1AIUA 4EF0A 2VCXA 2RLIA 2AAWA 1X5CA 1EWXA 3F8UA 1TK5B 4ECJA 4XS6A 4J2FA 3EYTA 5CAXA 2I81A 3HZ8A 2H8LA 1XPVA 2X64A 2H75A 4O7HA 1Q98A 2DLXA 2KLXA 1NHYA 1PKWA 2HE3A 2OE0A 2R3XA 5D9XA 1Z6MA 3E0UA 1GSDA 4NV5A 3W8SA 1ZYNA 2RIIA 1DSBA 3RPPA 4HZ4A 4GRFA 3KZQA 3MDKA 4NMUA 2V1MA 2DMLA 1KNGA 1ACVA 1SKSB 2RUEA 3F9UA 2H6ZA 5BRTA 2E2GA 1O81A 2HSMA 5G2ZA 5H5SA 2H1AA 5ECNB 2HZEB 3IXRA 4TR4A 3PH9A 4MA9A 1GSUA 5IMAA 4K7OA 4BVXB 4ZBBA 2KP1A 4YAPA 3KP9A 1H75A 2DJKA 2G2QA 2LJAA 3ZVJA 3IAS2 3QD9A 4KH7A 2LNTA 4YH2A 4X43A 5JCUA 1SD8A 4HEA2 1T7PB 3M0FA 2B1KA 4KF9A 4OO4A 4LLRA 1ERTA 1E6BA 1R5PA 2G0FA 5ECHB 1XXUA 1XZOA 4I2UA 1GWCA 3ZVJD 3QOUA 2DMMA 5IMFA 11GSA 2PUKC 4TVEA 4V1Ag 1XWKA 4EC0A 2HT9A 2A4HA 4G0KA 1R5AA 2MMAA 4AF2A 3BJ5A 1PL1A 1FHEA 2WDUA 4X4JA 3LXZA 2CZ2A 1B4QA 3C1SA 4TRXA 1T4ZA 4MZCA 2R2JA 1QK8A 4KDXA 1TRVA 2IN3A 1A2JA 1VRSD 2QA2A 4QQ7A 4O5UA 1F3AA 2H0HA 3I9V2 2VLVA 2H1GA 3TJGA 5DBQA 1Z6NA 2LTKA 2YP6A 3AY8A 1YKCA 3LG6A 3TB2A 4GSTA 2LKUA 2FD3A 2KOKA 2CX3A 2JU5A 3PR8A 3CRUA 3DIEA 4E8HA 1YQ1A 6GSYA 3KIJA 4NAXA 3GHAA 4MZBA 3LJRA 5J9CA 3GFKA 1JZWA 3F4RA 3C1RA 6GSUA 1GTIA 1TOFA 1SL0B 3LW9A 1PX6A 3CTFA 3DEXA 3I69A 2C0FA 5JCGA 3EVIA 1ERVA 2CQ9A 2B6MA 4EDZA 5IIZA 4L0WA 2OBIA 1BEDA 2H01A 3QDNA 1SJZA 3ISOA 3GL3A 2TRCP 3ZMKA 3DVXA 4K9ZA 1GNWA 2N5BA 3MWHA 4HU9A 2YWMA 3APOA 4Q5FA 3KP8A 4GSNA 4L5OA 3HCZA 5AN1A 5JWQB 1S3CA 2WJUA 1W89A 3WGXA 4GXZA 5INYA 2K9FA 2GS3A 4I2TA 2R4VA 4MF7A 2L6DA 2X49A 2C3TA 4G10A 4HU7A 4XTSA 4HDEA 1GUMA 1TTZA 1THXA 5JWRB 3FR6A 5ECQB 4PQHA 3W8JA 3OR5A 3TKSC 1X0RA 5LD0A 5HR2A 5D8IA 2VAFA 4TN8A 2H6YA 1M9AA 2YWOA 1EGOA 4BL7B 5IOXA 1AAZA 4EVMA 2OBKA 1UN2A 4K2DA 1MDKA 1VF3A 3IR4A 4X0XA 4CW9A 1GSEA 3KTBA 4ECCA 3U6VA 3J7Yk 2VL3A 4PQ1A 1C72A 4MH3A 3ZLPA 4FO5A 3GH9A 1V58A 4DSSB 3UBLA 3I43A 4TXOA 3EURA 5C04A 5ID2B 3BOAA 4ZBDA 3HJMA 3QR6A 2B5EA 2P5RA 2GT6A 4Z2UA 3DRNA 2WCIA 4KX4A 3FZ9A 2I9HA 5J5NA 3QPMA 1FB0A 1GLQA 1ON4A 4IHUA 2ZNMA 1R7HA 3MYDA 4LMVA 1QXHA 1XCCA 2TRXA 4O92A 1TP9A 2REMA 4QL7A 3P90A 4XS4A 2VCTA 4L5LA 1GL8A 1RK4A 5D9WA 2VLUA 2HSHA 3CSJA 4TXVA 3EMXA 2X8CA 3KEBA 4HJMA 4LL1B 2DKHA 4XCSA 3R2QA 1FG4A 18GSA 3N5OA 1JLWA 1B4PA 1TRSA 2PN8A 3D4TA 4PURA 3VPQA 2OKAA 2FA4A 5FHIA 1M2BA 1EOHA 2GTUA 2HSYA 5EL8A 1M7TA 3PINA 2WB9A 5G5EA 2YV9A 3LSZA 4YQMA 1V2AA 4G9HA 1SJIA 4JU5A 3CRTA 3VLNA 3F4SA 1F3BA 2Z9SA 3H93A 4IW9A 1I9DA 2OADA 5CNWA 2IFQB 1AQVA 2LJRA 3A2XA 1YEXA 2PVQA 1Z5YE 4ML6A 4FIWA 2LS5A 1WJKA 4F0CA 1O8WA 4IBPA 2J23A 1SK0A 1K3OA 2C4JA 1DE2A 3P8WA 5D93A 3TOTA 1GLPA 5AGYA 2HRKA 3RAZA 5A4WA 4YKFA 2PWJA 2RUFA 1WMJA 3UJ1A 3KTLA 5HR1A 5IPGA 3CXGA 1DUGA 4F0BA 3ME7A 3FEUA 1WOUA 3LQ7A 5B6NA 2VM2A 4KCAA 1OKTA 2H74A 4XHMA 3F3QA 1JFUA 10GSA 5ECPB 4KAEA 1TDIA 4K1FA 1ZZYA 4DSQA 1ST9A 3LYPA 1TRWA 4OFMA 6GSTA 3GMFA 4IVFA 4OD7A 1GTBA 4D73A 2MMZA 2NPBA 3TRXA 4EIPA 3HVVA 2GVPA 5ECIB 5G5FA 4ISDA 3EPTA 1T3BA 1DE1A 1WIKA 1EOGA 4EUYA 2EIOA 3WYWA 2LNSA 4POMA 2IWTA 3TKSE 1T8EB 3QAWA 5J4UA 1G7OA 4J56E 2CT6A 1K0AA 1NSWA 4WF5A 1YY7A 1O73A 1TRUA 2LQQA 2E2MA 2K8VA 2AV4A 1FOHA 4O32A 4G0IA 1XIYA 2GQLA 2HXKA 1B9YC 2DJ2A 4J57E 1K0BA 2HYXA 5J9BA 1XWAA 5HQPA 1M2DA 4OFNA 3DXBA 2VL2C 4JRRA 1Y6EA 3M9KA 2GSRA 5H5QA 1PX7A 2TIRA 1BX9A 3HVSA 4BPYA 4K7NA 2V6KA 3LXTA 4IS0A 2VL2A 2LUSA 4ZL9A 1Z3EA 1ZYQB 1X5DA 4WKWA 3ZIVA 3SWLA 2H76A 2VIMA 1A0RP 1A24A 2VD1A 3UMAA 3LORA 2QA1A 2LRTA 4P3YB 1AXDA 3HD5A 2P31A 2LEGA 3WGDA 3G7IA 1OVNA 4L8EA 1K3LA 3APQA 2IMFA 2VOCA 16GSA 3HXSA 1PA3A 1PN9A 3TJKA 3Q19A 3LGCA 1EEJA 3W6GA 2GSTA 4V2MA 4V2LA 4BVYA 3N9JA 5DALB 2JADA 4BA7A 1SJ6A 3O6TA 4V1Ap 2EIRA 2H19A 1HNBA 1O85A 6GSVA 3CBUA 1O7UA 2FUG2 3D0ZA 4PQIA 1PRXA 3TJFA 5A4VA 1N8JA 3DWVA 2CX4A 2A2PA 1Q4JA 2X4AA 3E9JB 3F4TA 1NW2A 1N2AA 5D73A 3FR3A 4N10A 4ZB6A 1AQXA 1U87A 3FZ5A 2GSSA 1BG5A 2XPEA 5CRWA 5B8BA 2C3QA 5IMVA 5HFKA 3VWWA 1ZL9A 1YF0A 3NIVA 4MJCA 4Z2RA 4XRAA 2HNLA 2H72A 3Q74A 3NZNA 3TUEA 3VFIA 2HZFA 4LA1A 1AUCA 1EV4A 1BJXA 2H1DA 4K5SA 3FW2A 1G7EA 2R0GA 2DJ3A 4POBA 3F6DA 4YKGA 4LMWA 1F9MA 4AJ7A 4MJBA 4IN0A 3GSTA 5CRHA 3EU3A 4WBJA 3DD3A 2WGRA 3VWXA 3GKNA 3KXOA 2OA7A 2MBTA 1U3IA 4HOJA 3PGTA 2X8HA 2F8AA 5DJMA 2OJLA 2H30A 4POKA 2OE3A 4BWSA 3LYKA 4KE3A 3PPUA 4WETA 4EO3A 5EPFA 1T00A 1TKDB 4JEDA 3RPNA 1YKAA 4FH8A 2CVDA 1YJ6A 1ZGNA 2HZEA 2DIZA 4WR5A 2FNOA 2PBJA 2K8SA 4JR4A 3RDWA 4BVXA 1LBKA 5CREA 2C3NA 4AJ6A 1OE7A 1YF1A 1A2LA 3GX8A 4IP6A 5IM9A 1SYRA 4ZBAA 1U6TA 5KOXA 1G0TA 2MYGA 1WRYA 4HJ2A 6GSXA 3A2VA 3MNGA 2AYTA 1GTUA 4EIQA 1ZMAA 5ECKB 1MTCA 2VLTA 3ME8A 1PN0A 1USBA 1OC9A 1T1VA 4OCEA 5IMZA 4ACSA 3LEFA 4KA0A 2M72A 1GH2A 4HS1A 4EXJA 3UOMA 4NXIA 5LCZA 4ZB9A 3EINA 4K7IA 1X9SB 1NHOA 4TOPA 2AHEA 4N11A 3KM6A 3EC3A 2A2SA 3VWUA 3D4MA 2YCDA 1FO5A 2FWEA 3CTGA 2N5FA 3TKPA 4ZXGA 1OKDA 4WF4A 2FLSA 2WULA 4GCIA 1XVWA 1M0UA 4OWYA 5F05A 3ZTLA 2RM6A 5CO3A 3D22A 3TCOA 4MLYA 1FVJA 1G6WA 4YAVA 4K8MA 2ZCTA 1GUKA 4NHWA 4USSA 4DSRA 4ZL8A 2EC4A 2K18A 2YZUA 4MH2A 4K0NA 2CA8A 3MAKA 4ZIJA 1JHBA 4Z7XA 5AIXA 3TKSA 1W4VA 2IPAA 4MZWA 2C0DA 3IRAA 3ZRDA 1NM3A 6GSWA 2HFDA 1HNCA 5CRGA 1SKRB 1VGLA 3ERFA 1VF2A 3TRPA 5ECRB 1ML6A 1XW9A 4Q5RA 3LFLA 3QMXA 2DIYA 5HR3A 2HRFA 4GTUA 2XBQA 2QGVA 2YWIA 4L0UA 2WRTA 4NWYA 5KN1A 2YV7A 4RQXA 2OACA 1K0DA 3FMWA 3SBCA 1JLVA 3ERGA 2MMOA 3FZ4A 3ZITA 2CZ3A 2L57A 2WFCA 3Q18A 3ERWA 2O89A 5ELGA 1PD21 2IMKA 1GULA 1KBNA 1YDKA 5IMCA 2H66A 3KJYA 1TK8B 2DJ0A 5DDLA 5DAKB 3UBKA 1J9BA 3GN3A 3TGZA 2AB6A 3F63A 1GSYA 1SK1A 2E0QA 4ECBA 3APSA 5AISA 3DKSA 5HFGA 1E2YA 2M46A 2FCHA 4GWRA 1PGTA 5DJLA 1M99A 4N0ZA 1O8XA 5HFIA 2F51A 2XHFA 1JZDA 5KEJA 3GUSA 1EP8A 2J9HA 2V32A 3JCML 3M8NA 4G2EA 3GKKA 1WP0A 3CSIA 3GTUA 1GNEA 1PKZA 2L59A 4ICYA 5IO2A 7GSSA 2X8GA 3UARA 2IJYA 9GSSA 1B8XA 2JSZA 1V57A 4N30A 3UIWA 1TI3A 3EU4A 2R0CA 2P5QA 3GIXA 3L0HA 3QAVA 4MNNA 2DKIA 4GQCA 4DSSA 2YOIA 1IYIA 2JZSA 5G31A 3RBTA 4KSOA 4TR0A 2YANA 3IPZA 1PL2A 1XOBA 3HYPA 4KB3A 2GDRA 1XWCA 3D21A 1GUHA 1AW9A 2UZ8A 5CYYA 3HVXA 3BCIA 3FK8A 5LNKe 2NBSA 1QMVA 2GLRA 1PSQA 4E8EA 2DJ1A 4PUFC 1S3DA 3GKMA 3IE3A 3L4NA 3QAGA 1XWGA 3C7MA 2NVLA 1OAZA 1EGRA 2YJ7A 2PPTA 2L6CA 1GRXA 2L5OA 1SK2A 3ZREA 1MD4A 4CY8A 3ZYWA 4NV2A 3WT1A 1ILOA 2R37A 2BMXA 3D5JA 2B1LA 2H73A 3DVWA 4GSSA 4BWQA 4WBRD 3C73A 1U3AA 4HQZA 1EV9A 4WXTA 1THOA 2GGTA 3DGQA 2F3MA 1AQWA 1WPIA 2C80A 2MMNA 3IHQA 1O6JA 5F0GA 5E59A 1F37A 2DC5A 2JSYA 2LV3A 2FWFA 5G30A 2DBCA 3GRXA 1XWBA 1K0CA 3UVHA 1FW1A 2BJXA 1R26A 3L9VA 2X99A 4HUAA 2IFQA 12GSA 3P2AA 3TJBA 3HA9A 5DVBA 1GSQA 1K0NA 4IJIA 2VCWA 1M2AA 4NHZA 5GZZB 2BTOT 1MEKA 3GURA 2ES7A 13GSA 2YZHA 5IOWA 5KN2A 2HRAA 3FR9A 2KUCA 3LWAA 3BCKA 2QSIA 3H8QA 1OC3A 3O3TA 4JR6A 2JZRA 5B6MA 1ZOFA 2FA8A 2HRNA 4FYBA 2LJKA 2L5LA 4K0GA 4N0VA 2GT5A 4Q5NA 1A8LA 2FHEA 4HI7A 4TR1A 3KH9A 2H71A 2D2ZA 3IC4A 5ABRA 2ON5A 4O5RA 4ZL7A 1GP1A 1TU8A 4O5QA 1CQHA 3IOSA 5G1KA 1B48A 1ERWA 2PMTA 1Y25A 2VO4A 2MZCA 4ECIA 3ZFLA 3F3RA 1EZKA 2LSTA 3G7YA 2XC2A 3EE2A 2N5AA 4MDCA 3ZL5A 3IV4A 3F0IA 4MJAA 5DCHA 4ZB8A 2C1YA 3EWLA 4MCUA 4PGTA 3A5IA 3Q6OA 5F06A 3US3A 3G7JA 2M80A 3FRCA 2YPMA 4KSMA 4Q5QA 19GSA 3HJOA 2A4VA 2H70A 3M3MA 4XS1A 4G0LA 3KMNA 1FVKA 1XVQA 3GNJA 2QC7A 4F82A 4RUVA 1XOAA 4XIHA 4PNFA 4XRDA 4K2XA 1QFNA 4RQRA 3TKRA 1YZXA 5ECMB 2CV4A 2OE1A 2FGXA 4AGSA 2HI7A 3CSHA 1V9WA 1YEPA 1K0OA 2I4AA 1VF1A 4WR4A 3IHGA 3UL3A 3IA1A 5A5KA 1UC7A 2ALBA 5GSTA 2R6KA 2XBIA 4JE1A 5CRDA 3GKXA 3L78A 1MD3A 4FQUA 2V41A 3IAM2 1IYHA 2L4QA 1A23A 1OC9B 4HZ2A 3TDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z7P A;  2H1B A;  2C0E A;  1BAY A;  3DYR A;  3WT2 A;  3VWV A;  3ZFB A;  4PNG A;  3C71 A;  22GS A;  2IMI A;  1UVZ A;  2O7K A;  1HQO A;  2B7J A;  2IMD A;  2H0I A;  2O85 A;  1RW1 A;  1HD2 A;  1BQ7 A;  1SKW B;  1QQ2 A;  4FYU A;  4JBB A;  2E7P A;  1F6M C;  3A3T A;  4EE0 A;  4ZIL A;  2NTO A;  2KP2 A;  1HYU A;  2EIQ A;  5DAL A;  1A2M A;  3FZA A;  3QFA C;  2H0G A;  1T4Y A;  1XW5 A;  2PER A;  2C0G A;  3QFB C;  1SD9 A;  5FWG A;  5F8B A;  1GTA A;  1TW9 A;  3MSZ A;  4YQV A;  5GAN D;  5L71 A;  3NOF A;  1EP7 A;  5DQY A;  1FB6 A;  4KUN A;  1HNA A;  3FKF A;  4TR3 A;  3GL5 A;  4RI6 A;  5EY6 A;  5ECO B;  4ILF A;  2JAC A;  3C8E A;  1BYE A;  2VD0 A;  2F9S A;  2AJQ B;  1CQG A;  5E4W A;  2IL3 A;  2GQK A;  1B9X C;  1X5E A;  2JL4 A;  2YNX A;  2YN1 A;  1Z7R A;  2F8F A;  1TK0 B;  3CMI A;  4IQ1 A;  5B8A A;  3IK7 A;  3TJJ A;  3GH6 A;  4TXO B;  2V2G A;  2B5X A;  2K6V A;  2DJJ A;  1A8Y A;  3A5W A;  4EL1 A;  3ED3 A;  3VK9 A;  4KCE A;  2VL9 A;  4I6X A;  2B5Y A;  2CVK A;  1J08 A;  5IPH A;  2H6X A;  1M9B A;  3O76 A;  4OMV A;  4EDY A;  4MAB A;  3L9S A;  1VF4 A;  2GZP A;  4MPG A;  2YWN A;  5IO0 A;  3GA4 A;  1JZR A;  4KDY A;  5JWO B;  8GSS A;  3U5R E;  4XS4 B;  5B7C A;  2XPD A;  3QCP A;  3BBY A;  3G9B A;  3HY2 A;  1WE0 A;  4KGI A;  5D96 A;  3WGE A;  5COH A;  1R4W A;  1XW6 A;  1SL1 B;  3GV1 A;  2B7K A;  3WD6 A;  4K6X A;  1SU9 A;  2O87 A;  4JZQ A;  5H5R A;  1FAA A;  4ULX A;  4IJ3 A;  5J3R A;  1LJR A;  5AIV A;  3GTU B;  4NPB A;  1S3A A;  3GSS A;  1MDJ A;  4MF6 A;  1OC8 A;  3EMP A;  2L4C A;  4ID0 A;  3TOU A;  1XFL A;  2A2R A;  2VCQ A;  3VUR A;  3H4K A;  2WS2 A;  4OFT A;  5IQY A;  2GZY A;  4TKY A;  4GQF A;  4G19 A;  3FY7 A;  4MF5 A;  3E3E A;  3UAP A;  17GS A;  3S9F A;  3K8N A;  2LRN A;  3TRQ A;  3IK9 A;  4X1U A;  1OYJ A;  4PXO A;  2GQM A;  4AJ8 A;  2ON7 A;  2GSQ A;  4IP1 A;  1RQM A;  4LL4 B;  2VM1 A;  3HZ4 A;  3L9U A;  2YJH A;  5EVO A;  2I3Y A;  4PX1 A;  2O8V B;  2VUP A;  3KCM A;  1X9W B;  2MBS A;  1KEB A;  4MK3 A;  1TJD A;  1GSF A;  2V6O A;  2PVO C;  4BL7 A;  5IMD A;  4MMM A;  1GSS A;  3KGK A;  2LRC A;  4MP4 A;  3KH7 A;  4IKH A;  5DCG A;  2KHP A;  2JZT A;  2IME A;  2GZZ A;  1PQN A;  3RHC A;  2I1U A;  2NDO A;  1MDI A;  4IEL A;  4D73 B;  5D9T A;  3I6A A;  4KW6 A;  4DEJ A;  2B3S A;  2CAQ A;  3ZIJ A;  4HQS A;  1J0F A;  5HR0 A;  3UVT A;  3ZZX A;  5ECS A;  2LQO A;  1KTE A;  1WWJ A;  5ID2 A;  2ZUP A;  1OE8 A;  2FWH A;  1EEM A;  2R5G A;  1JZO A;  3HJP A;  4DVC A;  3J7Y b;  1H4O A;  5C00 A;  3M9J A;  3KMO A;  14GS A;  3KD0 A;  4F9Z A;  3IDV A;  1X9M B;  1DBY A;  3D6I A;  4MPF A;  1SEN A;  2CVB A;  4V2N A;  5KN0 A;  4PUA A;  1ABA A;  1URM A;  4ML1 A;  4CDO A;  5DAK A;  2FWG A;  3DML A;  2AUV A;  1QGV A;  5KN3 A;  2DSA A;  5FT3 A;  4IQA A;  3CYN A;  2PGT A;  5F07 A;  4KND A;  2WZ9 A;  5D9V A;  4MJE A;  20GS A;  3VI7 A;  3HHV A;  1LU4 A;  4TR1 B;  6GSS A;  2FY6 A;  4OO5 A;  4KDU A;  4YQU A;  1UA5 A;  4I8B A;  3VI5 A;  5GSS A;  1K3Y A;  3HDC A;  1U88 A;  5A4U A;  3IBH A;  3VPT A;  4F03 A;  5DQS A;  1G6Y A;  1V40 A;  1PMT A;  4RI7 A;  3RHB A;  2PU9 C;  1SYX A;  5G1L A;  5ELA A;  4GLT A;  3M1G A;  1QUW A;  3H1N A;  3F6F A;  2VCZ A;  4IGJ A;  3TKQ A;  4FYC A;  5JCW A;  2HLS A;  3FHK A;  1ZCP A;  4EKZ A;  2VCV A;  4F2I A;  1XBS A;  3H79 A;  3GX0 A;  1ZYE A;  3BD2 A;  5J41 A;  1SL2 B;  4TW5 A;  2CAI A;  1TU7 A;  2RM5 A;  1A0F A;  5GAP D;  1V98 A;  1K0M A;  4POL A;  3UEM A;  5ECL B;  2QKE A;  4I97 A;  4CHS A;  4OCF A;  4QL9 A;  1TI1 A;  1I5G A;  5CP1 A;  5ENU A;  3FYG A;  1F2E A;  3ZML A;  2P0G A;  4GF0 A;  1Z9H A;  2IIY A;  3HKR A;  4H86 A;  3A2W A;  4WEY A;  1TXX A;  1AC1 A;  1ERU A;  3P7X A;  2C8U A;  3GYK A;  3V1W A;  1FOV A;  4I5Q A;  1AIU A;  4EF0 A;  2VCX A;  2RLI A;  2AAW A;  1X5C A;  1EWX A;  3F8U A;  1TK5 B;  4ECJ A;  4XS6 A;  4J2F A;  3EYT A;  5CAX A;  2I81 A;  3HZ8 A;  2H8L A;  1XPV A;  2X64 A;  2H75 A;  4O7H A;  1Q98 A;  2DLX A;  2KLX A;  1NHY A;  1PKW A;  2HE3 A;  2OE0 A;  2R3X A;  5D9X A;  1Z6M A;  3E0U A;  1GSD A;  4NV5 A;  3W8S A;  2RII A;  1DSB A;  3RPP A;  4HZ4 A;  4GRF A;  3KZQ A;  3MDK A;  4NMU A;  2V1M A;  2DML A;  1KNG A;  1ACV A;  1SKS B;  2RUE A;  3F9U A;  2H6Z A;  2E2G A;  1O81 A;  5G2Z A;  5H5S A;  2H1A A;  5ECN B;  2HZE B;  3IXR A;  4TR4 A;  3PH9 A;  4MA9 A;  1GSU A;  5IMA A;  4K7O A;  4ZBB A;  2KP1 A;  4YAP A;  3KP9 A;  1H75 A;  2DJK A;  2G2Q A;  2LJA A;  3ZVJ A;  3IAS 2;  3QD9 A;  4KH7 A;  2LNT A;  4YH2 A;  4X43 A;  5JCU A;  1SD8 A;  4HEA 2;  1T7P B;  3M0F A;  2B1K A;  4OO4 A;  4LLR A;  1ERT A;  1E6B A;  1R5P A;  2G0F A;  5ECH B;  1XXU A;  1XZO A;  4I2U A;  1GWC A;  3ZVJ D;  3QOU A;  2DMM A;  5IMF A;  11GS A;  2PUK C;  4TVE A;  4V1A g;  1XWK A;  4EC0 A;  2HT9 A;  1R5A A;  2MMA A;  4AF2 A;  3BJ5 A;  1PL1 A;  1FHE A;  2WDU A;  3LXZ A;  2CZ2 A;  1B4Q A;  3C1S A;  4TRX A;  1T4Z A;  4MZC A;  2R2J A;  1QK8 A;  4KDX A;  1TRV A;  2IN3 A;  1A2J A;  1VRS D;  4QQ7 A;  1F3A A;  2H0H A;  3I9V 2;  2VLV A;  2H1G A;  3TJG A;  5DBQ A;  1Z6N A;  2LTK A;  2YP6 A;  3AY8 A;  1YKC A;  3LG6 A;  3TB2 A;  4GST A;  2LKU A;  2FD3 A;  2KOK A;  2CX3 A;  2JU5 A;  3PR8 A;  3CRU A;  3DIE A;  4E8H A;  1YQ1 A;  6GSY A;  3KIJ A;  4NAX A;  3GHA A;  4MZB A;  3LJR A;  5J9C A;  3GFK A;  1JZW A;  3F4R A;  3C1R A;  6GSU A;  1GTI A;  1TOF A;  1SL0 B;  1PX6 A;  3CTF A;  3DEX A;  3I69 A;  2C0F A;  5JCG A;  3EVI A;  1ERV A;  2CQ9 A;  2B6M A;  4EDZ A;  5IIZ A;  4L0W A;  2OBI A;  1BED A;  2H01 A;  3QDN A;  1SJZ A;  3ISO A;  3GL3 A;  2TRC P;  3ZMK A;  3DVX A;  4K9Z A;  1GNW A;  2N5B A;  3MWH A;  4HU9 A;  2YWM A;  3APO A;  4Q5F A;  3KP8 A;  4GSN A;  4L5O A;  3HCZ A;  5AN1 A;  5JWQ B;  1S3C A;  2WJU A;  1W89 A;  3WGX A;  4GXZ A;  5INY A;  2K9F A;  2GS3 A;  4I2T A;  2R4V A;  4MF7 A;  2L6D A;  2C3T A;  4G10 A;  4HU7 A;  4XTS A;  4HDE A;  1GUM A;  1TTZ A;  1THX A;  5JWR B;  3FR6 A;  5ECQ B;  4PQH A;  3W8J A;  3OR5 A;  3TKS C;  1X0R A;  5LD0 A;  5HR2 A;  5D8I A;  2VAF A;  4TN8 A;  2H6Y A;  1M9A A;  2YWO A;  1EGO A;  5IOX A;  1AAZ A;  4EVM A;  2OBK A;  1UN2 A;  4K2D A;  1MDK A;  1VF3 A;  3IR4 A;  4X0X A;  4CW9 A;  1GSE A;  3KTB A;  4ECC A;  3U6V A;  3J7Y k;  2VL3 A;  4PQ1 A;  1C72 A;  4MH3 A;  3ZLP A;  4FO5 A;  3GH9 A;  1V58 A;  4DSS B;  3UBL A;  3I43 A;  4TXO A;  3EUR A;  5C04 A;  5ID2 B;  3BOA A;  4ZBD A;  3HJM A;  3QR6 A;  2B5E A;  2P5R A;  2GT6 A;  3DRN A;  2WCI A;  4KX4 A;  3FZ9 A;  2I9H A;  5J5N A;  3QPM A;  1FB0 A;  1GLQ A;  1ON4 A;  4IHU A;  2ZNM A;  1R7H A;  4LMV A;  1QXH A;  1XCC A;  2TRX A;  4O92 A;  1TP9 A;  2REM A;  4QL7 A;  3P90 A;  4XS4 A;  2VCT A;  4L5L A;  1GL8 A;  1RK4 A;  5D9W A;  2VLU A;  2HSH A;  3CSJ A;  4TXV A;  3EMX A;  2X8C A;  3KEB A;  4HJM A;  4LL1 B;  4XCS A;  3R2Q A;  1FG4 A;  18GS A;  3N5O A;  1JLW A;  1B4P A;  1TRS A;  2PN8 A;  3D4T A;  4PUR A;  3VPQ A;  2OKA A;  2FA4 A;  5FHI A;  1M2B A;  1EOH A;  2GTU A;  2HSY A;  5EL8 A;  1M7T A;  3PIN A;  2WB9 A;  5G5E A;  2YV9 A;  3LSZ A;  4YQM A;  1V2A A;  4G9H A;  1SJI A;  4JU5 A;  3CRT A;  3VLN A;  3F4S A;  1F3B A;  2Z9S A;  3H93 A;  4IW9 A;  1I9D A;  2OAD A;  5CNW A;  2IFQ B;  1AQV A;  2LJR A;  3A2X A;  1YEX A;  2PVQ A;  1Z5Y E;  4ML6 A;  4FIW A;  2LS5 A;  1WJK A;  4F0C A;  1O8W A;  4IBP A;  2J23 A;  1SK0 A;  1K3O A;  2C4J A;  1DE2 A;  3P8W A;  5D93 A;  3TOT A;  1GLP A;  5AGY A;  3RAZ A;  5A4W A;  2PWJ A;  2RUF A;  1WMJ A;  3UJ1 A;  3KTL A;  5HR1 A;  5IPG A;  3CXG A;  1DUG A;  4F0B A;  3ME7 A;  3FEU A;  1WOU A;  3LQ7 A;  5B6N A;  2VM2 A;  4KCA A;  1OKT A;  2H74 A;  4XHM A;  3F3Q A;  1JFU A;  10GS A;  5ECP B;  4KAE A;  1TDI A;  4K1F A;  1ZZY A;  4DSQ A;  1ST9 A;  3LYP A;  1TRW A;  4OFM A;  6GST A;  3GMF A;  4IVF A;  4OD7 A;  1GTB A;  4D73 A;  2MMZ A;  2NPB A;  3TRX A;  3HVV A;  2GVP A;  5ECI B;  5G5F A;  4ISD A;  1T3B A;  1DE1 A;  1WIK A;  1EOG A;  4EUY A;  2EIO A;  3WYW A;  2LNS A;  4POM A;  2IWT A;  3TKS E;  1T8E B;  3QAW A;  5J4U A;  1G7O A;  4J56 E;  2CT6 A;  1K0A A;  1NSW A;  4WF5 A;  1YY7 A;  1O73 A;  1TRU A;  2LQQ A;  2E2M A;  2K8V A;  2AV4 A;  4O32 A;  1XIY A;  2GQL A;  2HXK A;  1B9Y C;  2DJ2 A;  4J57 E;  1K0B A;  2HYX A;  5J9B A;  1XWA A;  5HQP A;  1M2D A;  4OFN A;  3DXB A;  2VL2 C;  4JRR A;  1Y6E A;  3M9K A;  2GSR A;  5H5Q A;  1PX7 A;  2TIR A;  1BX9 A;  3HVS A;  4BPY A;  4K7N A;  2V6K A;  3LXT A;  4IS0 A;  2VL2 A;  2LUS A;  4ZL9 A;  1Z3E A;  1ZYQ B;  1X5D A;  4WKW A;  3ZIV A;  3SWL A;  2H76 A;  2VIM A;  1A0R P;  1A24 A;  2VD1 A;  3UMA A;  3LOR A;  2LRT A;  4P3Y B;  1AXD A;  3HD5 A;  2P31 A;  2LEG A;  3WGD A;  3G7I A;  1OVN A;  4L8E A;  1K3L A;  3APQ A;  2IMF A;  2VOC A;  16GS A;  3HXS A;  1PA3 A;  1PN9 A;  3TJK A;  3Q19 A;  3LGC A;  1EEJ A;  3W6G A;  2GST A;  4V2M A;  4V2L A;  4BVY A;  3N9J A;  5DAL B;  2JAD A;  4BA7 A;  1SJ6 A;  3O6T A;  4V1A p;  2EIR A;  2H19 A;  1HNB A;  1O85 A;  6GSV A;  3CBU A;  1O7U A;  2FUG 2;  3D0Z A;  4PQI A;  1PRX A;  3TJF A;  5A4V A;  1N8J A;  3DWV A;  2CX4 A;  1Q4J A;  3E9J B;  3F4T A;  1NW2 A;  1N2A A;  5D73 A;  3FR3 A;  4N10 A;  4ZB6 A;  1AQX A;  1U87 A;  3FZ5 A;  2GSS A;  1BG5 A;  2XPE A;  5CRW A;  5B8B A;  2C3Q A;  5IMV A;  5HFK A;  3VWW A;  1ZL9 A;  1YF0 A;  3NIV A;  4MJC A;  4XRA A;  2HNL A;  2H72 A;  3Q74 A;  3NZN A;  3TUE A;  3VFI A;  2HZF A;  4LA1 A;  1AUC A;  1EV4 A;  1BJX A;  2H1D A;  3FW2 A;  1G7E A;  2DJ3 A;  4POB A;  3F6D A;  4LMW A;  1F9M A;  4AJ7 A;  4MJB A;  4IN0 A;  3GST A;  5CRH A;  3EU3 A;  4WBJ A;  3DD3 A;  2WGR A;  3VWX A;  3GKN A;  3KXO A;  2OA7 A;  2MBT A;  1U3I A;  4HOJ A;  3PGT A;  2X8H A;  2F8A A;  5DJM A;  2OJL A;  2H30 A;  4POK A;  2OE3 A;  4BWS A;  3LYK A;  4KE3 A;  4WET A;  4EO3 A;  5EPF A;  1T00 A;  1TKD B;  4JED A;  3RPN A;  1YKA A;  4FH8 A;  2CVD A;  1YJ6 A;  1ZGN A;  2HZE A;  2DIZ A;  4WR5 A;  2FNO A;  2PBJ A;  2K8S A;  4JR4 A;  3RDW A;  4BVX A;  1LBK A;  5CRE A;  2C3N A;  4AJ6 A;  1OE7 A;  1YF1 A;  1A2L A;  3GX8 A;  4IP6 A;  5IM9 A;  1SYR A;  4ZBA A;  1U6T A;  1G0T A;  2MYG A;  1WRY A;  4HJ2 A;  6GSX A;  3A2V A;  3MNG A;  2AYT A;  1GTU A;  1ZMA A;  5ECK B;  1MTC A;  2VLT A;  3ME8 A;  1USB A;  1OC9 A;  1T1V A;  4OCE A;  5IMZ A;  4ACS A;  3LEF A;  4KA0 A;  2M72 A;  1GH2 A;  4HS1 A;  4EXJ A;  3UOM A;  4NXI A;  5LCZ A;  4ZB9 A;  3EIN A;  4K7I A;  1X9S B;  1NHO A;  4TOP A;  2AHE A;  4N11 A;  3KM6 A;  3EC3 A;  2A2S A;  3VWU A;  3D4M A;  2YCD A;  1FO5 A;  2FWE A;  3CTG A;  2N5F A;  3TKP A;  4ZXG A;  1OKD A;  4WF4 A;  2FLS A;  2WUL A;  4GCI A;  1XVW A;  1M0U A;  4OWY A;  5F05 A;  3ZTL A;  2RM6 A;  5CO3 A;  3D22 A;  3TCO A;  4MLY A;  1FVJ A;  1G6W A;  4YAV A;  4K8M A;  2ZCT A;  1GUK A;  4NHW A;  4DSR A;  4ZL8 A;  2EC4 A;  2K18 A;  2YZU A;  4MH2 A;  4K0N A;  2CA8 A;  3MAK A;  4ZIJ A;  1JHB A;  4Z7X A;  5AIX A;  3TKS A;  1W4V A;  2IPA A;  4MZW A;  2C0D A;  3IRA A;  3ZRD A;  1NM3 A;  6GSW A;  2HFD A;  1HNC A;  5CRG A;  1SKR B;  1VGL A;  3ERF A;  1VF2 A;  3TRP A;  5ECR B;  1ML6 A;  1XW9 A;  4Q5R A;  3LFL A;  3QMX A;  2DIY A;  5HR3 A;  2HRF A;  4GTU A;  2XBQ A;  2QGV A;  2YWI A;  4L0U A;  2WRT A;  4NWY A;  5KN1 A;  2YV7 A;  4RQX A;  2OAC A;  1K0D A;  3SBC A;  1JLV A;  3ERG A;  2MMO A;  3FZ4 A;  3ZIT A;  2CZ3 A;  2L57 A;  2WFC A;  3Q18 A;  3ERW A;  2O89 A;  5ELG A;  1PD2 1;  2IMK A;  1GUL A;  1KBN A;  1YDK A;  5IMC A;  2H66 A;  3KJY A;  1TK8 B;  2DJ0 A;  5DDL A;  5DAK B;  3UBK A;  1J9B A;  3GN3 A;  3TGZ A;  2AB6 A;  3F63 A;  1GSY A;  1SK1 A;  2E0Q A;  4ECB A;  3APS A;  5AIS A;  3DKS A;  5HFG A;  1E2Y A;  2M46 A;  2FCH A;  4GWR A;  1PGT A;  5DJL A;  1M99 A;  4N0Z A;  1O8X A;  5HFI A;  2F51 A;  2XHF A;  1JZD A;  5KEJ A;  3GUS A;  1EP8 A;  2J9H A;  2V32 A;  3JCM L;  3M8N A;  4G2E A;  3GKK A;  1WP0 A;  3CSI A;  3GTU A;  1GNE A;  1PKZ A;  2L59 A;  5IO2 A;  7GSS A;  2X8G A;  3UAR A;  2IJY A;  9GSS A;  1B8X A;  2JSZ A;  1V57 A;  4N30 A;  3UIW A;  1TI3 A;  3EU4 A;  3QAV A;  2P5Q A;  3GIX A;  3L0H A;  4GQC A;  4DSS A;  2YOI A;  1IYI A;  2JZS A;  5G31 A;  3RBT A;  4KSO A;  4TR0 A;  2YAN A;  3IPZ A;  1PL2 A;  1XOB A;  3HYP A;  4KB3 A;  2GDR A;  1XWC A;  3D21 A;  1GUH A;  1AW9 A;  5CYY A;  3HVX A;  3BCI A;  3FK8 A;  5LNK e;  2NBS A;  1QMV A;  2GLR A;  1PSQ A;  4E8E A;  2DJ1 A;  4PUF C;  1S3D A;  3GKM A;  3IE3 A;  3L4N A;  3QAG A;  1XWG A;  3C7M A;  2NVL A;  1OAZ A;  1EGR A;  2YJ7 A;  2PPT A;  2L6C A;  1GRX A;  2L5O A;  1SK2 A;  3ZRE A;  1MD4 A;  3ZYW A;  4NV2 A;  3WT1 A;  1ILO A;  2R37 A;  2BMX A;  3D5J A;  2B1L A;  2H73 A;  3DVW A;  4GSS A;  4BWQ A;  4WBR D;  3C73 A;  1U3A A;  4HQZ A;  1EV9 A;  4WXT A;  1THO A;  2GGT A;  3DGQ A;  2F3M A;  1AQW A;  1WPI A;  2C80 A;  2MMN A;  3IHQ A;  1O6J A;  5F0G A;  5E59 A;  1F37 A;  2DC5 A;  2JSY A;  2LV3 A;  2FWF A;  5G30 A;  2DBC A;  3GRX A;  1XWB A;  1K0C A;  3UVH A;  1FW1 A;  2BJX A;  1R26 A;  3L9V A;  2X99 A;  4HUA A;  2IFQ A;  12GS A;  3P2A A;  3TJB A;  3HA9 A;  5DVB A;  1GSQ A;  1K0N A;  4IJI A;  2VCW A;  1M2A A;  4NHZ A;  5GZZ B;  2BTO T;  1MEK A;  3GUR A;  2ES7 A;  13GS A;  2YZH A;  5IOW A;  5KN2 A;  3FR9 A;  2KUC A;  3LWA A;  3BCK A;  2QSI A;  3H8Q A;  1OC3 A;  3O3T A;  4JR6 A;  2JZR A;  5B6M A;  1ZOF A;  2FA8 A;  2HRN A;  4FYB A;  2LJK A;  2L5L A;  4K0G A;  4N0V A;  2GT5 A;  4Q5N A;  1A8L A;  2FHE A;  4HI7 A;  4TR1 A;  3KH9 A;  2H71 A;  2D2Z A;  3IC4 A;  5ABR A;  2ON5 A;  4O5R A;  4ZL7 A;  1GP1 A;  1TU8 A;  1CQH A;  3IOS A;  5G1K A;  1B48 A;  1ERW A;  2PMT A;  1Y25 A;  2VO4 A;  2MZC A;  4ECI A;  3ZFL A;  3F3R A;  1EZK A;  2LST A;  3G7Y A;  2XC2 A;  3EE2 A;  2N5A A;  4MDC A;  3ZL5 A;  3IV4 A;  3F0I A;  4MJA A;  5DCH A;  4ZB8 A;  2C1Y A;  3EWL A;  4MCU A;  4PGT A;  3Q6O A;  5F06 A;  3US3 A;  3G7J A;  2M80 A;  3FRC A;  2YPM A;  4KSM A;  4Q5Q A;  19GS A;  3HJO A;  2A4V A;  2H70 A;  3M3M A;  4XS1 A;  3KMN A;  1FVK A;  1XVQ A;  3GNJ A;  2QC7 A;  4F82 A;  4RUV A;  1XOA A;  4XIH A;  4PNF A;  4XRD A;  1QFN A;  4RQR A;  3TKR A;  1YZX A;  5ECM B;  2CV4 A;  2OE1 A;  2FGX A;  4AGS A;  2HI7 A;  3CSH A;  1V9W A;  1YEP A;  1K0O A;  2I4A A;  1VF1 A;  4WR4 A;  3UL3 A;  3IA1 A;  5A5K A;  1UC7 A;  2ALB A;  5GST A;  2R6K A;  2XBI A;  4JE1 A;  5CRD A;  3GKX A;  3L78 A;  1MD3 A;  2V41 A;  3IAM 2;  1IYH A;  2L4Q A;  1A23 A;  1OC9 B;  4HZ2 A;  3TDG A; 
#chains in the Genus database with same CATH topology
 1Z7P A;  2H1B A;  2C0E A;  1BAY A;  3DYR A;  3WT2 A;  3VWV A;  3ZFB A;  4PNG A;  3C71 A;  22GS A;  2IMI A;  1UVZ A;  2O7K A;  1HQO A;  2B7J A;  2IMD A;  2H0I A;  2O85 A;  1RW1 A;  1HD2 A;  1BQ7 A;  1SKW B;  1QQ2 A;  4FYU A;  4JBB A;  2E7P A;  1F6M C;  3A3T A;  4EE0 A;  4ZIL A;  2NTO A;  2KP2 A;  1HYU A;  2EIQ A;  5DAL A;  1A2M A;  3FZA A;  3QFA C;  2H0G A;  1T4Y A;  1XW5 A;  2PER A;  2C0G A;  4PTS A;  3QFB C;  1SD9 A;  5FWG A;  5F8B A;  1GTA A;  1TW9 A;  3MSZ A;  4YQV A;  5GAN D;  5L71 A;  3NOF A;  1EP7 A;  5DQY A;  1FB6 A;  4KUN A;  1HNA A;  3FKF A;  4TR3 A;  3GL5 A;  4RI6 A;  5EY6 A;  5ECO B;  4ILF A;  2JAC A;  3C8E A;  1BYE A;  2VD0 A;  2F9S A;  2AJQ B;  1CQG A;  5E4W A;  2IL3 A;  2GQK A;  1B9X C;  1X5E A;  2JL4 A;  2YNX A;  2YN1 A;  1Z7R A;  2F8F A;  1TK0 B;  3CMI A;  4IQ1 A;  5B8A A;  3IK7 A;  3TJJ A;  3GH6 A;  4TXO B;  2V2G A;  2B5X A;  2K6V A;  2DJJ A;  1A8Y A;  3A5W A;  4EL1 A;  3ED3 A;  3VK9 A;  4KCE A;  2VL9 A;  4I6X A;  2B5Y A;  2CVK A;  1J08 A;  5IPH A;  2H6X A;  1M9B A;  3O76 A;  4OMV A;  4EDY A;  4MAB A;  3L9S A;  1VF4 A;  2GZP A;  4MPG A;  2YWN A;  5IO0 A;  3GA4 A;  1JZR A;  4KDY A;  5JWO B;  8GSS A;  3U5R E;  4XS4 B;  5B7C A;  2XPD A;  3QCP A;  3BBY A;  3G9B A;  3HY2 A;  1WE0 A;  4KGI A;  5D96 A;  3WGE A;  5COH A;  1R4W A;  1XW6 A;  1SL1 B;  3GV1 A;  2B7K A;  3WD6 A;  4K6X A;  1SU9 A;  2O87 A;  4JZQ A;  2R0P A;  5H5R A;  1FAA A;  4ULX A;  4IJ3 A;  3R3E A;  5J3R A;  1LJR A;  5AIV A;  3GTU B;  4NPB A;  1S3A A;  3GSS A;  1MDJ A;  4MF6 A;  1OC8 A;  3EMP A;  2L4C A;  4ID0 A;  3TOU A;  1XFL A;  2A2R A;  2VCQ A;  1M3I A;  3VUR A;  3H4K A;  2WS2 A;  4OFT A;  5IQY A;  2GZY A;  4TKY A;  4GQF A;  4G19 A;  3FY7 A;  4MF5 A;  3E3E A;  3UAP A;  17GS A;  3S9F A;  3K8N A;  2LRN A;  3TRQ A;  3IK9 A;  4X1U A;  1OYJ A;  4CY6 A;  4PXO A;  4K5R A;  2GQM A;  4AJ8 A;  2ON7 A;  2GSQ A;  4IP1 A;  4A5P A;  1RQM A;  4LL4 B;  2VM1 A;  3HZ4 A;  3L9U A;  2YJH A;  5EVO A;  2I3Y A;  4PX1 A;  2O8V B;  2VUP A;  3KCM A;  1X9W B;  2MBS A;  1KEB A;  4MK3 A;  1TJD A;  1GSF A;  2V6O A;  2PVO C;  4BL7 A;  5IMD A;  4MMM A;  1GSS A;  3KGK A;  2LRC A;  4MP4 A;  3KH7 A;  4IKH A;  5DCG A;  2KHP A;  2JZT A;  2IME A;  2GZZ A;  1PQN A;  3RHC A;  2I1U A;  2NDO A;  1MDI A;  4IEL A;  4D73 B;  5D9T A;  3I6A A;  4KW6 A;  4DEJ A;  2B3S A;  2CAQ A;  3ZIJ A;  4HQS A;  1J0F A;  5HR0 A;  3UVT A;  3ZZX A;  5KOW A;  5ECS A;  2LQO A;  1KTE A;  1WWJ A;  5ID2 A;  2ZUP A;  1OE8 A;  2FWH A;  1EEM A;  2R5G A;  1JZO A;  3HJP A;  4DVC A;  3MIX A;  3J7Y b;  1H4O A;  5C00 A;  3M9J A;  3KMO A;  14GS A;  3KD0 A;  4F9Z A;  3IDV A;  1X9M B;  1DBY A;  3D6I A;  4MPF A;  1SEN A;  3IC8 A;  2CVB A;  4V2N A;  5KN0 A;  4PUA A;  1ABA A;  1URM A;  4ML1 A;  4CDO A;  5DAK A;  2FWG A;  3DML A;  2AUV A;  1QGV A;  5KN3 A;  2DSA A;  5FT3 A;  4IQA A;  3CYN A;  2PGT A;  5F07 A;  4KND A;  2WZ9 A;  1ZYP A;  5D9V A;  4MJE A;  20GS A;  3VI7 A;  3HHV A;  1LU4 A;  4TR1 B;  6GSS A;  2FY6 A;  4OO5 A;  4KDU A;  4YQU A;  1UA5 A;  4I8B A;  3VI5 A;  5GSS A;  1K3Y A;  3HDC A;  1U88 A;  5A4U A;  3IBH A;  3VPT A;  4F03 A;  5DQS A;  1G6Y A;  1V40 A;  1PMT A;  4RI7 A;  3RHB A;  2PU9 C;  1SYX A;  5G1L A;  5ELA A;  4GLT A;  3M1G A;  1QUW A;  3H1N A;  3F6F A;  2VCZ A;  4IGJ A;  3TKQ A;  4FYC A;  5JCW A;  2HLS A;  3FHK A;  1ZCP A;  4EKZ A;  2VCV A;  4BVY B;  4F2I A;  1XBS A;  3H79 A;  3GX0 A;  1ZYE A;  3BD2 A;  5J41 A;  1SL2 B;  4TW5 A;  2CAI A;  1TU7 A;  2RM5 A;  1A0F A;  4Z2T A;  5GAP D;  1V98 A;  1K0M A;  4POL A;  3UEM A;  5ECL B;  2QKE A;  4I97 A;  4CHS A;  4OCF A;  4QL9 A;  5BMU A;  1TI1 A;  1I5G A;  5CP1 A;  5ENU A;  3FYG A;  1F2E A;  3ZML A;  2P0G A;  4GF0 A;  1Z9H A;  2IIY A;  3HKR A;  4H86 A;  3A2W A;  4WEY A;  1TXX A;  1AC1 A;  1ERU A;  3P7X A;  2C8U A;  3GYK A;  3V1W A;  1FOV A;  4I5Q A;  1AIU A;  4EF0 A;  2VCX A;  2RLI A;  2AAW A;  1X5C A;  1EWX A;  3F8U A;  1TK5 B;  4ECJ A;  4XS6 A;  4J2F A;  3EYT A;  5CAX A;  2I81 A;  3HZ8 A;  2H8L A;  1XPV A;  2X64 A;  2H75 A;  4O7H A;  1Q98 A;  2DLX A;  2KLX A;  1NHY A;  1PKW A;  2HE3 A;  2OE0 A;  2R3X A;  5D9X A;  1Z6M A;  3E0U A;  1GSD A;  4NV5 A;  3W8S A;  1ZYN A;  2RII A;  1DSB A;  3RPP A;  4HZ4 A;  4GRF A;  3KZQ A;  3MDK A;  4NMU A;  2V1M A;  2DML A;  1KNG A;  1ACV A;  1SKS B;  2RUE A;  3F9U A;  2H6Z A;  5BRT A;  2E2G A;  1O81 A;  2HSM A;  5G2Z A;  5H5S A;  2H1A A;  5ECN B;  2HZE B;  3IXR A;  4TR4 A;  3PH9 A;  4MA9 A;  1GSU A;  5IMA A;  4K7O A;  4BVX B;  4ZBB A;  2KP1 A;  4YAP A;  1PFO A;  3KP9 A;  1H75 A;  2DJK A;  2G2Q A;  2LJA A;  3ZVJ A;  3IAS 2;  3QD9 A;  4KH7 A;  2LNT A;  4YH2 A;  4X43 A;  5JCU A;  1SD8 A;  4HEA 2;  1T7P B;  3M0F A;  2B1K A;  4KF9 A;  4OO4 A;  4LLR A;  1ERT A;  1E6B A;  1R5P A;  2G0F A;  5ECH B;  1XXU A;  1XZO A;  4I2U A;  1GWC A;  3ZVJ D;  3QOU A;  2DMM A;  5IMF A;  11GS A;  2PUK C;  4TVE A;  4V1A g;  1XWK A;  4EC0 A;  2HT9 A;  2A4H A;  4G0K A;  1R5A A;  2MMA A;  4AF2 A;  3BJ5 A;  1PL1 A;  1FHE A;  2WDU A;  4X4J A;  3LXZ A;  2CZ2 A;  1B4Q A;  3C1S A;  4TRX A;  1T4Z A;  4MZC A;  2R2J A;  1QK8 A;  4KDX A;  4BIK A;  1TRV A;  2IN3 A;  1A2J A;  1VRS D;  2QA2 A;  4QQ7 A;  4O5U A;  1F3A A;  2H0H A;  3I9V 2;  2VLV A;  2H1G A;  3TJG A;  5DBQ A;  1Z6N A;  2LTK A;  2YP6 A;  3AY8 A;  1YKC A;  3LG6 A;  3TB2 A;  4GST A;  2LKU A;  2FD3 A;  2KOK A;  2CX3 A;  2JU5 A;  3PR8 A;  3CRU A;  3DIE A;  4E8H A;  1YQ1 A;  6GSY A;  3KIJ A;  4NAX A;  3GHA A;  4MZB A;  3LJR A;  5J9C A;  3GFK A;  1JZW A;  3F4R A;  3C1R A;  6GSU A;  1GTI A;  1TOF A;  1SL0 B;  3LW9 A;  1PX6 A;  3CTF A;  3DEX A;  3I69 A;  2C0F A;  5JCG A;  3EVI A;  1ERV A;  2CQ9 A;  2B6M A;  4EDZ A;  5IIZ A;  4L0W A;  2OBI A;  1BED A;  2H01 A;  3QDN A;  1SJZ A;  3ISO A;  3GL3 A;  2TRC P;  3ZMK A;  3DVX A;  4K9Z A;  1GNW A;  2N5B A;  3MWH A;  4HU9 A;  2YWM A;  3APO A;  4Q5F A;  3KP8 A;  4GSN A;  4L5O A;  3HCZ A;  5AN1 A;  5JWQ B;  1S3C A;  2WJU A;  1W89 A;  3WGX A;  4GXZ A;  5INY A;  2K9F A;  2GS3 A;  4I2T A;  2R4V A;  4MF7 A;  2L6D A;  2X49 A;  2C3T A;  4G10 A;  4HU7 A;  4XTS A;  4HDE A;  1GUM A;  1TTZ A;  1THX A;  5JWR B;  3FR6 A;  5ECQ B;  4PQH A;  3W8J A;  3OR5 A;  3TKS C;  1X0R A;  5LD0 A;  5HR2 A;  5D8I A;  2VAF A;  4TN8 A;  2H6Y A;  1M9A A;  2YWO A;  1EGO A;  4BL7 B;  5IOX A;  1AAZ A;  4EVM A;  2OBK A;  1UN2 A;  4K2D A;  1MDK A;  1VF3 A;  3IR4 A;  4X0X A;  4CW9 A;  1GSE A;  3KTB A;  4ECC A;  3U6V A;  3J7Y k;  2VL3 A;  4PQ1 A;  1C72 A;  4MH3 A;  3ZLP A;  4FO5 A;  3GH9 A;  1V58 A;  4DSS B;  3UBL A;  3I43 A;  4TXO A;  3EUR A;  5C04 A;  5ID2 B;  3BOA A;  4ZBD A;  3HJM A;  3QR6 A;  2B5E A;  2P5R A;  2GT6 A;  4Z2U A;  3DRN A;  2WCI A;  4KX4 A;  3FZ9 A;  2I9H A;  5J5N A;  3QPM A;  1FB0 A;  1GLQ A;  1ON4 A;  4IHU A;  2ZNM A;  1R7H A;  3MYD A;  4LMV A;  1QXH A;  1XCC A;  2TRX A;  4O92 A;  1TP9 A;  2REM A;  4QL7 A;  3P90 A;  4XS4 A;  2VCT A;  4L5L A;  1GL8 A;  1RK4 A;  5D9W A;  2VLU A;  2HSH A;  3CSJ A;  4TXV A;  3EMX A;  2X8C A;  3KEB A;  4HJM A;  4LL1 B;  2DKH A;  4XCS A;  3R2Q A;  1FG4 A;  18GS A;  3N5O A;  1JLW A;  1B4P A;  1TRS A;  2PN8 A;  3D4T A;  4PUR A;  3VPQ A;  2OKA A;  2FA4 A;  5FHI A;  1M2B A;  1EOH A;  2GTU A;  2HSY A;  5EL8 A;  1M7T A;  3PIN A;  2WB9 A;  5G5E A;  2YV9 A;  3LSZ A;  4YQM A;  1V2A A;  4G9H A;  1SJI A;  4JU5 A;  3CRT A;  3VLN A;  3F4S A;  1F3B A;  2Z9S A;  3H93 A;  4IW9 A;  1XG8 A;  1I9D A;  2OAD A;  5CNW A;  2IFQ B;  1AQV A;  2LJR A;  3A2X A;  1YEX A;  2PVQ A;  1Z5Y E;  4ML6 A;  4FIW A;  2LS5 A;  1WJK A;  4F0C A;  1O8W A;  4IBP A;  2J23 A;  1SK0 A;  1K3O A;  2C4J A;  1DE2 A;  3P8W A;  5D93 A;  3TOT A;  1GLP A;  5AGY A;  2HRK A;  3RAZ A;  5A4W A;  4YKF A;  2PWJ A;  2RUF A;  1WMJ A;  3UJ1 A;  3KTL A;  5HR1 A;  5IPG A;  3CQF A;  3CXG A;  1DUG A;  4F0B A;  3ME7 A;  3FEU A;  1WOU A;  3LQ7 A;  5B6N A;  2VM2 A;  4KCA A;  1OKT A;  2H74 A;  4XHM A;  3F3Q A;  1JFU A;  10GS A;  5ECP B;  4KAE A;  1TDI A;  4K1F A;  1ZZY A;  4DSQ A;  1ST9 A;  3LYP A;  1TRW A;  4OFM A;  6GST A;  3GMF A;  4IVF A;  4OD7 A;  1GTB A;  4D73 A;  2MMZ A;  2NPB A;  3TRX A;  4EIP A;  3HVV A;  2GVP A;  5ECI B;  5G5F A;  4ISD A;  3EPT A;  1T3B A;  1DE1 A;  1WIK A;  1EOG A;  4EUY A;  2EIO A;  3WYW A;  2LNS A;  4POM A;  2IWT A;  3TKS E;  1T8E B;  3QAW A;  5J4U A;  1G7O A;  4J56 E;  2CT6 A;  1K0A A;  1NSW A;  4WF5 A;  1YY7 A;  1O73 A;  1TRU A;  2LQQ A;  2E2M A;  2K8V A;  2AV4 A;  1FOH A;  4O32 A;  4G0I A;  1XIY A;  2GQL A;  2HXK A;  1B9Y C;  2DJ2 A;  4J57 E;  1K0B A;  2HYX A;  5J9B A;  1XWA A;  5HQP A;  1M2D A;  4OFN A;  3DXB A;  2VL2 C;  4JRR A;  1Y6E A;  3M9K A;  2GSR A;  5H5Q A;  1PX7 A;  2TIR A;  1BX9 A;  3HVS A;  4BPY A;  4K7N A;  2V6K A;  3LXT A;  4IS0 A;  2VL2 A;  2LUS A;  4ZL9 A;  1Z3E A;  1ZYQ B;  1X5D A;  4WKW A;  3ZIV A;  3SWL A;  2H76 A;  2VIM A;  1A0R P;  1A24 A;  2VD1 A;  3UMA A;  3LOR A;  2QA1 A;  2LRT A;  4P3Y B;  1AXD A;  3HD5 A;  2P31 A;  2LEG A;  3WGD A;  3G7I A;  1OVN A;  4L8E A;  1K3L A;  3APQ A;  2IMF A;  2VOC A;  16GS A;  3HXS A;  1PA3 A;  1PN9 A;  3TJK A;  3Q19 A;  3LGC A;  1EEJ A;  3W6G A;  2GST A;  4V2M A;  4V2L A;  4BVY A;  3N9J A;  5DAL B;  2JAD A;  4BA7 A;  1SJ6 A;  3O6T A;  4V1A p;  2EIR A;  2H19 A;  1HNB A;  1O85 A;  6GSV A;  3CBU A;  1O7U A;  2FUG 2;  3D0Z A;  4PQI A;  1PRX A;  3TJF A;  5A4V A;  1N8J A;  3DWV A;  2CX4 A;  2A2P A;  1Q4J A;  2X4A A;  3E9J B;  3F4T A;  1NW2 A;  1N2A A;  5D73 A;  3FR3 A;  4N10 A;  4ZB6 A;  1AQX A;  1U87 A;  3FZ5 A;  2GSS A;  1BG5 A;  2XPE A;  5CRW A;  5B8B A;  2C3Q A;  5IMV A;  5HFK A;  3VWW A;  1ZL9 A;  1YF0 A;  3NIV A;  4MJC A;  4Z2R A;  4XRA A;  2HNL A;  2H72 A;  3Q74 A;  3NZN A;  3TUE A;  3VFI A;  2HZF A;  4LA1 A;  1AUC A;  1EV4 A;  1BJX A;  2H1D A;  4K5S A;  3FW2 A;  1G7E A;  2R0G A;  2DJ3 A;  4POB A;  3F6D A;  4YKG A;  4LMW A;  1F9M A;  4AJ7 A;  4MJB A;  4IN0 A;  3GST A;  5CRH A;  3EU3 A;  4WBJ A;  3DD3 A;  2WGR A;  3VWX A;  3GKN A;  3KXO A;  2OA7 A;  2MBT A;  1U3I A;  4HOJ A;  3PGT A;  2X8H A;  2F8A A;  5DJM A;  2OJL A;  2H30 A;  4POK A;  2OE3 A;  4BWS A;  3LYK A;  4KE3 A;  3PPU A;  4WET A;  4EO3 A;  5EPF A;  1T00 A;  1TKD B;  4JED A;  3RPN A;  1YKA A;  4FH8 A;  2CVD A;  1YJ6 A;  1ZGN A;  2HZE A;  2DIZ A;  4WR5 A;  2FNO A;  2PBJ A;  2K8S A;  4JR4 A;  3RDW A;  4BVX A;  1LBK A;  5CRE A;  2C3N A;  4AJ6 A;  1OE7 A;  1YF1 A;  1A2L A;  3GX8 A;  4IP6 A;  5IM9 A;  1SYR A;  4ZBA A;  1U6T A;  5KOX A;  1G0T A;  2MYG A;  1WRY A;  4HJ2 A;  6GSX A;  3A2V A;  3MNG A;  2AYT A;  1GTU A;  4EIQ A;  1ZMA A;  5ECK B;  1MTC A;  2VLT A;  3ME8 A;  1PN0 A;  1USB A;  1OC9 A;  1T1V A;  4OCE A;  5IMZ A;  4ACS A;  3LEF A;  4KA0 A;  2M72 A;  1GH2 A;  4HS1 A;  4EXJ A;  3UOM A;  4NXI A;  5LCZ A;  4ZB9 A;  3EIN A;  4K7I A;  1X9S B;  1NHO A;  4TOP A;  2AHE A;  4N11 A;  3KM6 A;  3EC3 A;  2A2S A;  3VWU A;  3D4M A;  2YCD A;  1FO5 A;  2FWE A;  3CTG A;  2N5F A;  3TKP A;  4ZXG A;  1OKD A;  4WF4 A;  2FLS A;  2WUL A;  4GCI A;  1XVW A;  1M0U A;  4OWY A;  5F05 A;  3ZTL A;  2RM6 A;  5CO3 A;  3D22 A;  3TCO A;  4MLY A;  1FVJ A;  1G6W A;  4YAV A;  4K8M A;  2ZCT A;  1GUK A;  4NHW A;  4USS A;  4DSR A;  4ZL8 A;  2EC4 A;  2K18 A;  2YZU A;  4MH2 A;  4K0N A;  2CA8 A;  3MAK A;  4ZIJ A;  1JHB A;  4Z7X A;  5AIX A;  3TKS A;  1W4V A;  2IPA A;  4MZW A;  2C0D A;  3IRA A;  3ZRD A;  1NM3 A;  6GSW A;  2HFD A;  1HNC A;  5CRG A;  1SKR B;  1VGL A;  3ERF A;  1VF2 A;  3TRP A;  5ECR B;  1ML6 A;  1XW9 A;  4Q5R A;  3LFL A;  3QMX A;  2DIY A;  5HR3 A;  2HRF A;  4GTU A;  2XBQ A;  2QGV A;  2YWI A;  4L0U A;  2WRT A;  4NWY A;  5KN1 A;  2YV7 A;  4RQX A;  2OAC A;  1K0D A;  3FMW A;  3SBC A;  1JLV A;  3ERG A;  2MMO A;  3FZ4 A;  3ZIT A;  2CZ3 A;  2L57 A;  2WFC A;  3Q18 A;  3ERW A;  2O89 A;  5ELG A;  1PD2 1;  2IMK A;  1GUL A;  1KBN A;  1YDK A;  5IMC A;  2H66 A;  3KJY A;  1S3R A;  1TK8 B;  2DJ0 A;  5DDL A;  5DAK B;  3UBK A;  1J9B A;  3GN3 A;  3TGZ A;  2AB6 A;  3F63 A;  1GSY A;  1SK1 A;  2E0Q A;  4ECB A;  3APS A;  5AIS A;  3DKS A;  5HFG A;  1E2Y A;  2M46 A;  2FCH A;  4GWR A;  1PGT A;  5DJL A;  1M99 A;  4N0Z A;  1O8X A;  5HFI A;  2F51 A;  2XHF A;  1JZD A;  5KEJ A;  3GUS A;  1EP8 A;  2J9H A;  2V32 A;  3JCM L;  3M8N A;  4G2E A;  3GKK A;  1WP0 A;  3CSI A;  3GTU A;  4HSC X;  1GNE A;  1PKZ A;  2L59 A;  4ICY A;  5IO2 A;  7GSS A;  2X8G A;  3UAR A;  2IJY A;  9GSS A;  1B8X A;  2JSZ A;  1V57 A;  4N30 A;  3UIW A;  1TI3 A;  3EU4 A;  2R0C A;  2P5Q A;  3GIX A;  3L0H A;  3QAV A;  4MNN A;  2DKI A;  4GQC A;  4DSS A;  2YOI A;  1IYI A;  2JZS A;  5G31 A;  3RBT A;  4KSO A;  4TR0 A;  2YAN A;  3IPZ A;  1PL2 A;  1XOB A;  3HYP A;  4KB3 A;  2GDR A;  1XWC A;  3D21 A;  1GUH A;  1AW9 A;  2UZ8 A;  5CYY A;  3HVX A;  3BCI A;  3FK8 A;  5LNK e;  2NBS A;  1QMV A;  2GLR A;  1PSQ A;  4E8E A;  2DJ1 A;  4PUF C;  1S3D A;  3GKM A;  3IE3 A;  3L4N A;  3QAG A;  1XWG A;  3C7M A;  2NVL A;  1OAZ A;  1EGR A;  2YJ7 A;  2PPT A;  2L6C A;  1GRX A;  2L5O A;  1SK2 A;  3ZRE A;  1MD4 A;  4CY8 A;  3ZYW A;  4NV2 A;  3WT1 A;  1ILO A;  2R37 A;  2BMX A;  3D5J A;  2B1L A;  2H73 A;  3DVW A;  4GSS A;  4BWQ A;  3HVN A;  4WBR D;  3C73 A;  1U3A A;  4HQZ A;  1EV9 A;  4WXT A;  1THO A;  2GGT A;  3DGQ A;  2F3M A;  1AQW A;  1WPI A;  2C80 A;  2MMN A;  3IHQ A;  1O6J A;  5F0G A;  5E59 A;  1F37 A;  2DC5 A;  2JSY A;  2LV3 A;  2FWF A;  5G30 A;  2DBC A;  3GRX A;  1XWB A;  1K0C A;  3UVH A;  1FW1 A;  2BJX A;  1R26 A;  3L9V A;  2X99 A;  4HUA A;  2IFQ A;  12GS A;  3P2A A;  3TJB A;  3HA9 A;  5DVB A;  1GSQ A;  1K0N A;  4IJI A;  2VCW A;  1M2A A;  4NHZ A;  5GZZ B;  2BTO T;  1MEK A;  3GUR A;  2ES7 A;  13GS A;  2YZH A;  5IOW A;  5KN2 A;  2HRA A;  3FR9 A;  2KUC A;  3LWA A;  3BCK A;  2QSI A;  3H8Q A;  1OC3 A;  3O3T A;  4JR6 A;  2JZR A;  5B6M A;  1ZOF A;  2FA8 A;  2HRN A;  4FYB A;  2LJK A;  2L5L A;  4K0G A;  4N0V A;  2GT5 A;  4Q5N A;  1A8L A;  2FHE A;  4HI7 A;  4TR1 A;  3KH9 A;  2H71 A;  2D2Z A;  3IC4 A;  5ABR A;  2ON5 A;  4O5R A;  4ZL7 A;  1GP1 A;  1TU8 A;  4O5Q A;  1CQH A;  3IOS A;  5G1K A;  1B48 A;  1ERW A;  2PMT A;  1Y25 A;  2VO4 A;  2MZC A;  4ECI A;  3ZFL A;  3F3R A;  1EZK A;  2LST A;  3G7Y A;  2XC2 A;  3EE2 A;  2N5A A;  4MDC A;  3ZL5 A;  3IV4 A;  3F0I A;  4MJA A;  5DCH A;  4ZB8 A;  1M3J A;  2C1Y A;  3EWL A;  4MCU A;  4PGT A;  3A5I A;  3Q6O A;  5F06 A;  3US3 A;  3G7J A;  2M80 A;  3FRC A;  2YPM A;  4KSM A;  4Q5Q A;  19GS A;  3HJO A;  2A4V A;  2H70 A;  3M3M A;  4XS1 A;  4G0L A;  3KMN A;  1FVK A;  1XVQ A;  3GNJ A;  2QC7 A;  4F82 A;  4RUV A;  1XOA A;  4XIH A;  4PNF A;  4XRD A;  4K2X A;  1QFN A;  4RQR A;  3TKR A;  1YZX A;  5ECM B;  2CV4 A;  2OE1 A;  2FGX A;  4AGS A;  2HI7 A;  3CSH A;  1V9W A;  1YEP A;  1K0O A;  2I4A A;  1VF1 A;  4WR4 A;  3IHG A;  3UL3 A;  3IA1 A;  5A5K A;  1UC7 A;  2ALB A;  5GST A;  2R6K A;  2XBI A;  4JE1 A;  5CRD A;  3GKX A;  3L78 A;  1MD3 A;  4FQU A;  2V41 A;  3IAM 2;  1IYH A;  2L4Q A;  1A23 A;  1OC9 B;  4HZ2 A;  3TDG A; 
#chains in the Genus database with same CATH homology
 1Z7P A;  2H1B A;  2C0E A;  1BAY A;  3DYR A;  3WT2 A;  3VWV A;  3ZFB A;  4PNG A;  3C71 A;  22GS A;  2IMI A;  1UVZ A;  2O7K A;  1HQO A;  2B7J A;  2IMD A;  2H0I A;  2O85 A;  1RW1 A;  1HD2 A;  1BQ7 A;  1SKW B;  1QQ2 A;  4FYU A;  4JBB A;  2E7P A;  1F6M C;  3A3T A;  4EE0 A;  4ZIL A;  2NTO A;  2KP2 A;  1HYU A;  2EIQ A;  5DAL A;  1A2M A;  3FZA A;  3QFA C;  2H0G A;  1T4Y A;  1XW5 A;  2PER A;  2C0G A;  4PTS A;  3QFB C;  1SD9 A;  5FWG A;  5F8B A;  1GTA A;  1TW9 A;  3MSZ A;  4YQV A;  5GAN D;  5L71 A;  3NOF A;  1EP7 A;  5DQY A;  1FB6 A;  4KUN A;  1HNA A;  3FKF A;  4TR3 A;  3GL5 A;  4RI6 A;  5EY6 A;  5ECO B;  4ILF A;  2JAC A;  3C8E A;  1BYE A;  2VD0 A;  2F9S A;  2AJQ B;  1CQG A;  5E4W A;  2IL3 A;  2GQK A;  1B9X C;  1X5E A;  2JL4 A;  2YNX A;  2YN1 A;  1Z7R A;  2F8F A;  1TK0 B;  3CMI A;  4IQ1 A;  5B8A A;  3IK7 A;  3TJJ A;  3GH6 A;  4TXO B;  2V2G A;  2B5X A;  2K6V A;  2DJJ A;  1A8Y A;  3A5W A;  4EL1 A;  3ED3 A;  3VK9 A;  4KCE A;  2VL9 A;  4I6X A;  2B5Y A;  2CVK A;  1J08 A;  5IPH A;  2H6X A;  1M9B A;  3O76 A;  4OMV A;  4EDY A;  4MAB A;  3L9S A;  1VF4 A;  2GZP A;  4MPG A;  2YWN A;  5IO0 A;  3GA4 A;  1JZR A;  4KDY A;  5JWO B;  8GSS A;  3U5R E;  4XS4 B;  5B7C A;  2XPD A;  3QCP A;  3BBY A;  3G9B A;  3HY2 A;  1WE0 A;  4KGI A;  5D96 A;  3WGE A;  5COH A;  1R4W A;  1XW6 A;  1SL1 B;  3GV1 A;  2B7K A;  3WD6 A;  4K6X A;  1SU9 A;  2O87 A;  4JZQ A;  2R0P A;  5H5R A;  1FAA A;  4ULX A;  4IJ3 A;  3R3E A;  5J3R A;  1LJR A;  5AIV A;  3GTU B;  4NPB A;  1S3A A;  3GSS A;  1MDJ A;  4MF6 A;  1OC8 A;  3EMP A;  2L4C A;  4ID0 A;  3TOU A;  1XFL A;  2A2R A;  2VCQ A;  3VUR A;  3H4K A;  2WS2 A;  4OFT A;  5IQY A;  2GZY A;  4TKY A;  4GQF A;  4G19 A;  3FY7 A;  4MF5 A;  3E3E A;  3UAP A;  17GS A;  3S9F A;  3K8N A;  2LRN A;  3TRQ A;  3IK9 A;  4X1U A;  1OYJ A;  4CY6 A;  4PXO A;  4K5R A;  2GQM A;  4AJ8 A;  2ON7 A;  2GSQ A;  4IP1 A;  4A5P A;  1RQM A;  4LL4 B;  2VM1 A;  3HZ4 A;  3L9U A;  2YJH A;  5EVO A;  2I3Y A;  4PX1 A;  2O8V B;  2VUP A;  3KCM A;  1X9W B;  2MBS A;  1KEB A;  4MK3 A;  1TJD A;  1GSF A;  2V6O A;  2PVO C;  4BL7 A;  5IMD A;  4MMM A;  1GSS A;  3KGK A;  2LRC A;  4MP4 A;  3KH7 A;  4IKH A;  5DCG A;  2KHP A;  2JZT A;  2IME A;  2GZZ A;  1PQN A;  3RHC A;  2I1U A;  2NDO A;  1MDI A;  4IEL A;  4D73 B;  5D9T A;  3I6A A;  4KW6 A;  4DEJ A;  2B3S A;  2CAQ A;  3ZIJ A;  4HQS A;  1J0F A;  5HR0 A;  3UVT A;  3ZZX A;  5KOW A;  5ECS A;  2LQO A;  1KTE A;  1WWJ A;  5ID2 A;  2ZUP A;  1OE8 A;  2FWH A;  1EEM A;  2R5G A;  1JZO A;  3HJP A;  4DVC A;  3MIX A;  3J7Y b;  1H4O A;  5C00 A;  3M9J A;  3KMO A;  14GS A;  3KD0 A;  4F9Z A;  3IDV A;  1X9M B;  1DBY A;  3D6I A;  4MPF A;  1SEN A;  3IC8 A;  2CVB A;  4V2N A;  5KN0 A;  4PUA A;  1ABA A;  1URM A;  4ML1 A;  4CDO A;  5DAK A;  2FWG A;  3DML A;  2AUV A;  1QGV A;  5KN3 A;  2DSA A;  5FT3 A;  4IQA A;  3CYN A;  2PGT A;  5F07 A;  4KND A;  2WZ9 A;  1ZYP A;  5D9V A;  4MJE A;  20GS A;  3VI7 A;  3HHV A;  1LU4 A;  4TR1 B;  6GSS A;  2FY6 A;  4OO5 A;  4KDU A;  4YQU A;  1UA5 A;  4I8B A;  3VI5 A;  5GSS A;  1K3Y A;  3HDC A;  1U88 A;  5A4U A;  3IBH A;  3VPT A;  4F03 A;  5DQS A;  1G6Y A;  1V40 A;  1PMT A;  4RI7 A;  3RHB A;  2PU9 C;  1SYX A;  5G1L A;  5ELA A;  4GLT A;  3M1G A;  1QUW A;  3H1N A;  3F6F A;  2VCZ A;  4IGJ A;  3TKQ A;  4FYC A;  5JCW A;  2HLS A;  3FHK A;  1ZCP A;  4EKZ A;  2VCV A;  4BVY B;  4F2I A;  1XBS A;  3H79 A;  3GX0 A;  1ZYE A;  3BD2 A;  5J41 A;  1SL2 B;  4TW5 A;  2CAI A;  1TU7 A;  2RM5 A;  1A0F A;  4Z2T A;  5GAP D;  1V98 A;  1K0M A;  4POL A;  3UEM A;  5ECL B;  2QKE A;  4I97 A;  4CHS A;  4OCF A;  4QL9 A;  5BMU A;  1TI1 A;  1I5G A;  5CP1 A;  5ENU A;  3FYG A;  1F2E A;  3ZML A;  2P0G A;  4GF0 A;  1Z9H A;  2IIY A;  3HKR A;  4H86 A;  3A2W A;  4WEY A;  1TXX A;  1AC1 A;  1ERU A;  3P7X A;  2C8U A;  3GYK A;  3V1W A;  1FOV A;  4I5Q A;  1AIU A;  4EF0 A;  2VCX A;  2RLI A;  2AAW A;  1X5C A;  1EWX A;  3F8U A;  1TK5 B;  4ECJ A;  4XS6 A;  4J2F A;  3EYT A;  5CAX A;  2I81 A;  3HZ8 A;  2H8L A;  1XPV A;  2X64 A;  2H75 A;  4O7H A;  1Q98 A;  2DLX A;  2KLX A;  1NHY A;  1PKW A;  2HE3 A;  2OE0 A;  2R3X A;  5D9X A;  1Z6M A;  3E0U A;  1GSD A;  4NV5 A;  3W8S A;  1ZYN A;  2RII A;  1DSB A;  3RPP A;  4HZ4 A;  4GRF A;  3KZQ A;  3MDK A;  4NMU A;  2V1M A;  2DML A;  1KNG A;  1ACV A;  1SKS B;  2RUE A;  3F9U A;  2H6Z A;  5BRT A;  2E2G A;  1O81 A;  2HSM A;  5G2Z A;  5H5S A;  2H1A A;  5ECN B;  2HZE B;  3IXR A;  4TR4 A;  3PH9 A;  4MA9 A;  1GSU A;  5IMA A;  4K7O A;  4BVX B;  4ZBB A;  2KP1 A;  4YAP A;  3KP9 A;  1H75 A;  2DJK A;  2G2Q A;  2LJA A;  3ZVJ A;  3IAS 2;  3QD9 A;  4KH7 A;  2LNT A;  4YH2 A;  4X43 A;  5JCU A;  1SD8 A;  4HEA 2;  1T7P B;  3M0F A;  2B1K A;  4KF9 A;  4OO4 A;  4LLR A;  1ERT A;  1E6B A;  1R5P A;  2G0F A;  5ECH B;  1XXU A;  1XZO A;  4I2U A;  1GWC A;  3ZVJ D;  3QOU A;  2DMM A;  5IMF A;  11GS A;  2PUK C;  4TVE A;  4V1A g;  1XWK A;  4EC0 A;  2HT9 A;  2A4H A;  4G0K A;  1R5A A;  2MMA A;  4AF2 A;  3BJ5 A;  1PL1 A;  1FHE A;  2WDU A;  4X4J A;  3LXZ A;  2CZ2 A;  1B4Q A;  3C1S A;  4TRX A;  1T4Z A;  4MZC A;  2R2J A;  1QK8 A;  4KDX A;  1TRV A;  2IN3 A;  1A2J A;  1VRS D;  2QA2 A;  4QQ7 A;  4O5U A;  1F3A A;  2H0H A;  3I9V 2;  2VLV A;  2H1G A;  3TJG A;  5DBQ A;  1Z6N A;  2LTK A;  2YP6 A;  3AY8 A;  1YKC A;  3LG6 A;  3TB2 A;  4GST A;  2LKU A;  2FD3 A;  2KOK A;  2CX3 A;  2JU5 A;  3PR8 A;  3CRU A;  3DIE A;  4E8H A;  1YQ1 A;  6GSY A;  3KIJ A;  4NAX A;  3GHA A;  4MZB A;  3LJR A;  5J9C A;  3GFK A;  1JZW A;  3F4R A;  3C1R A;  6GSU A;  1GTI A;  1TOF A;  1SL0 B;  3LW9 A;  1PX6 A;  3CTF A;  3DEX A;  3I69 A;  2C0F A;  5JCG A;  3EVI A;  1ERV A;  2CQ9 A;  2B6M A;  4EDZ A;  5IIZ A;  4L0W A;  2OBI A;  1BED A;  2H01 A;  3QDN A;  1SJZ A;  3ISO A;  3GL3 A;  2TRC P;  3ZMK A;  3DVX A;  4K9Z A;  1GNW A;  2N5B A;  3MWH A;  4HU9 A;  2YWM A;  3APO A;  4Q5F A;  3KP8 A;  4GSN A;  4L5O A;  3HCZ A;  5AN1 A;  5JWQ B;  1S3C A;  2WJU A;  1W89 A;  3WGX A;  4GXZ A;  5INY A;  2K9F A;  2GS3 A;  4I2T A;  2R4V A;  4MF7 A;  2L6D A;  2X49 A;  2C3T A;  4G10 A;  4HU7 A;  4XTS A;  4HDE A;  1GUM A;  1TTZ A;  1THX A;  5JWR B;  3FR6 A;  5ECQ B;  4PQH A;  3W8J A;  3OR5 A;  3TKS C;  1X0R A;  5LD0 A;  5HR2 A;  5D8I A;  2VAF A;  4TN8 A;  2H6Y A;  1M9A A;  2YWO A;  1EGO A;  4BL7 B;  5IOX A;  1AAZ A;  4EVM A;  2OBK A;  1UN2 A;  4K2D A;  1MDK A;  1VF3 A;  3IR4 A;  4X0X A;  4CW9 A;  1GSE A;  3KTB A;  4ECC A;  3U6V A;  3J7Y k;  2VL3 A;  4PQ1 A;  1C72 A;  4MH3 A;  3ZLP A;  4FO5 A;  3GH9 A;  1V58 A;  4DSS B;  3UBL A;  3I43 A;  4TXO A;  3EUR A;  5C04 A;  5ID2 B;  3BOA A;  4ZBD A;  3HJM A;  3QR6 A;  2B5E A;  2P5R A;  2GT6 A;  4Z2U A;  3DRN A;  2WCI A;  4KX4 A;  3FZ9 A;  2I9H A;  5J5N A;  3QPM A;  1FB0 A;  1GLQ A;  1ON4 A;  4IHU A;  2ZNM A;  1R7H A;  3MYD A;  4LMV A;  1QXH A;  1XCC A;  2TRX A;  4O92 A;  1TP9 A;  2REM A;  4QL7 A;  3P90 A;  4XS4 A;  2VCT A;  4L5L A;  1GL8 A;  1RK4 A;  5D9W A;  2VLU A;  2HSH A;  3CSJ A;  4TXV A;  3EMX A;  2X8C A;  3KEB A;  4HJM A;  4LL1 B;  2DKH A;  4XCS A;  3R2Q A;  1FG4 A;  18GS A;  3N5O A;  1JLW A;  1B4P A;  1TRS A;  2PN8 A;  3D4T A;  4PUR A;  3VPQ A;  2OKA A;  2FA4 A;  5FHI A;  1M2B A;  1EOH A;  2GTU A;  2HSY A;  5EL8 A;  1M7T A;  3PIN A;  2WB9 A;  5G5E A;  2YV9 A;  3LSZ A;  4YQM A;  1V2A A;  4G9H A;  1SJI A;  4JU5 A;  3CRT A;  3VLN A;  3F4S A;  1F3B A;  2Z9S A;  3H93 A;  4IW9 A;  1I9D A;  2OAD A;  5CNW A;  2IFQ B;  1AQV A;  2LJR A;  3A2X A;  1YEX A;  2PVQ A;  1Z5Y E;  4ML6 A;  4FIW A;  2LS5 A;  1WJK A;  4F0C A;  1O8W A;  4IBP A;  2J23 A;  1SK0 A;  1K3O A;  2C4J A;  1DE2 A;  3P8W A;  5D93 A;  3TOT A;  1GLP A;  5AGY A;  2HRK A;  3RAZ A;  5A4W A;  4YKF A;  2PWJ A;  2RUF A;  1WMJ A;  3UJ1 A;  3KTL A;  5HR1 A;  5IPG A;  3CXG A;  1DUG A;  4F0B A;  3ME7 A;  3FEU A;  1WOU A;  3LQ7 A;  5B6N A;  2VM2 A;  4KCA A;  1OKT A;  2H74 A;  4XHM A;  3F3Q A;  1JFU A;  10GS A;  5ECP B;  4KAE A;  1TDI A;  4K1F A;  1ZZY A;  4DSQ A;  1ST9 A;  3LYP A;  1TRW A;  4OFM A;  6GST A;  3GMF A;  4IVF A;  4OD7 A;  1GTB A;  4D73 A;  2MMZ A;  2NPB A;  3TRX A;  4EIP A;  3HVV A;  2GVP A;  5ECI B;  5G5F A;  4ISD A;  3EPT A;  1T3B A;  1DE1 A;  1WIK A;  1EOG A;  4EUY A;  2EIO A;  3WYW A;  2LNS A;  4POM A;  2IWT A;  3TKS E;  1T8E B;  3QAW A;  5J4U A;  1G7O A;  4J56 E;  2CT6 A;  1K0A A;  1NSW A;  4WF5 A;  1YY7 A;  1O73 A;  1TRU A;  2LQQ A;  2E2M A;  2K8V A;  2AV4 A;  1FOH A;  4O32 A;  4G0I A;  1XIY A;  2GQL A;  2HXK A;  1B9Y C;  2DJ2 A;  4J57 E;  1K0B A;  2HYX A;  5J9B A;  1XWA A;  5HQP A;  1M2D A;  4OFN A;  3DXB A;  2VL2 C;  4JRR A;  1Y6E A;  3M9K A;  2GSR A;  5H5Q A;  1PX7 A;  2TIR A;  1BX9 A;  3HVS A;  4BPY A;  4K7N A;  2V6K A;  3LXT A;  4IS0 A;  2VL2 A;  2LUS A;  4ZL9 A;  1Z3E A;  1ZYQ B;  1X5D A;  4WKW A;  3ZIV A;  3SWL A;  2H76 A;  2VIM A;  1A0R P;  1A24 A;  2VD1 A;  3UMA A;  3LOR A;  2QA1 A;  2LRT A;  4P3Y B;  1AXD A;  3HD5 A;  2P31 A;  2LEG A;  3WGD A;  3G7I A;  1OVN A;  4L8E A;  1K3L A;  3APQ A;  2IMF A;  2VOC A;  16GS A;  3HXS A;  1PA3 A;  1PN9 A;  3TJK A;  3Q19 A;  3LGC A;  1EEJ A;  3W6G A;  2GST A;  4V2M A;  4V2L A;  4BVY A;  3N9J A;  5DAL B;  2JAD A;  4BA7 A;  1SJ6 A;  3O6T A;  4V1A p;  2EIR A;  2H19 A;  1HNB A;  1O85 A;  6GSV A;  3CBU A;  1O7U A;  2FUG 2;  3D0Z A;  4PQI A;  1PRX A;  3TJF A;  5A4V A;  1N8J A;  3DWV A;  2CX4 A;  2A2P A;  1Q4J A;  2X4A A;  3E9J B;  3F4T A;  1NW2 A;  1N2A A;  5D73 A;  3FR3 A;  4N10 A;  4ZB6 A;  1AQX A;  1U87 A;  3FZ5 A;  2GSS A;  1BG5 A;  2XPE A;  5CRW A;  5B8B A;  2C3Q A;  5IMV A;  5HFK A;  3VWW A;  1ZL9 A;  1YF0 A;  3NIV A;  4MJC A;  4Z2R A;  4XRA A;  2HNL A;  2H72 A;  3Q74 A;  3NZN A;  3TUE A;  3VFI A;  2HZF A;  4LA1 A;  1AUC A;  1EV4 A;  1BJX A;  2H1D A;  4K5S A;  3FW2 A;  1G7E A;  2R0G A;  2DJ3 A;  4POB A;  3F6D A;  4YKG A;  4LMW A;  1F9M A;  4AJ7 A;  4MJB A;  4IN0 A;  3GST A;  5CRH A;  3EU3 A;  4WBJ A;  3DD3 A;  2WGR A;  3VWX A;  3GKN A;  3KXO A;  2OA7 A;  2MBT A;  1U3I A;  4HOJ A;  3PGT A;  2X8H A;  2F8A A;  5DJM A;  2OJL A;  2H30 A;  4POK A;  2OE3 A;  4BWS A;  3LYK A;  4KE3 A;  3PPU A;  4WET A;  4EO3 A;  5EPF A;  1T00 A;  1TKD B;  4JED A;  3RPN A;  1YKA A;  4FH8 A;  2CVD A;  1YJ6 A;  1ZGN A;  2HZE A;  2DIZ A;  4WR5 A;  2FNO A;  2PBJ A;  2K8S A;  4JR4 A;  3RDW A;  4BVX A;  1LBK A;  5CRE A;  2C3N A;  4AJ6 A;  1OE7 A;  1YF1 A;  1A2L A;  3GX8 A;  4IP6 A;  5IM9 A;  1SYR A;  4ZBA A;  1U6T A;  5KOX A;  1G0T A;  2MYG A;  1WRY A;  4HJ2 A;  6GSX A;  3A2V A;  3MNG A;  2AYT A;  1GTU A;  4EIQ A;  1ZMA A;  5ECK B;  1MTC A;  2VLT A;  3ME8 A;  1PN0 A;  1USB A;  1OC9 A;  1T1V A;  4OCE A;  5IMZ A;  4ACS A;  3LEF A;  4KA0 A;  2M72 A;  1GH2 A;  4HS1 A;  4EXJ A;  3UOM A;  4NXI A;  5LCZ A;  4ZB9 A;  3EIN A;  4K7I A;  1X9S B;  1NHO A;  4TOP A;  2AHE A;  4N11 A;  3KM6 A;  3EC3 A;  2A2S A;  3VWU A;  3D4M A;  2YCD A;  1FO5 A;  2FWE A;  3CTG A;  2N5F A;  3TKP A;  4ZXG A;  1OKD A;  4WF4 A;  2FLS A;  2WUL A;  4GCI A;  1XVW A;  1M0U A;  4OWY A;  5F05 A;  3ZTL A;  2RM6 A;  5CO3 A;  3D22 A;  3TCO A;  4MLY A;  1FVJ A;  1G6W A;  4YAV A;  4K8M A;  2ZCT A;  1GUK A;  4NHW A;  4USS A;  4DSR A;  4ZL8 A;  2EC4 A;  2K18 A;  2YZU A;  4MH2 A;  4K0N A;  2CA8 A;  3MAK A;  4ZIJ A;  1JHB A;  4Z7X A;  5AIX A;  3TKS A;  1W4V A;  2IPA A;  4MZW A;  2C0D A;  3IRA A;  3ZRD A;  1NM3 A;  6GSW A;  2HFD A;  1HNC A;  5CRG A;  1SKR B;  1VGL A;  3ERF A;  1VF2 A;  3TRP A;  5ECR B;  1ML6 A;  1XW9 A;  4Q5R A;  3LFL A;  3QMX A;  2DIY A;  5HR3 A;  2HRF A;  4GTU A;  2XBQ A;  2QGV A;  2YWI A;  4L0U A;  2WRT A;  4NWY A;  5KN1 A;  2YV7 A;  4RQX A;  2OAC A;  1K0D A;  3FMW A;  3SBC A;  1JLV A;  3ERG A;  2MMO A;  3FZ4 A;  3ZIT A;  2CZ3 A;  2L57 A;  2WFC A;  3Q18 A;  3ERW A;  2O89 A;  5ELG A;  1PD2 1;  2IMK A;  1GUL A;  1KBN A;  1YDK A;  5IMC A;  2H66 A;  3KJY A;  1TK8 B;  2DJ0 A;  5DDL A;  5DAK B;  3UBK A;  1J9B A;  3GN3 A;  3TGZ A;  2AB6 A;  3F63 A;  1GSY A;  1SK1 A;  2E0Q A;  4ECB A;  3APS A;  5AIS A;  3DKS A;  5HFG A;  1E2Y A;  2M46 A;  2FCH A;  4GWR A;  1PGT A;  5DJL A;  1M99 A;  4N0Z A;  1O8X A;  5HFI A;  2F51 A;  2XHF A;  1JZD A;  5KEJ A;  3GUS A;  1EP8 A;  2J9H A;  2V32 A;  3JCM L;  3M8N A;  4G2E A;  3GKK A;  1WP0 A;  3CSI A;  3GTU A;  1GNE A;  1PKZ A;  2L59 A;  4ICY A;  5IO2 A;  7GSS A;  2X8G A;  3UAR A;  2IJY A;  9GSS A;  1B8X A;  2JSZ A;  1V57 A;  4N30 A;  3UIW A;  1TI3 A;  3EU4 A;  2R0C A;  2P5Q A;  3GIX A;  3L0H A;  3QAV A;  4MNN A;  2DKI A;  4GQC A;  4DSS A;  2YOI A;  1IYI A;  2JZS A;  5G31 A;  3RBT A;  4KSO A;  4TR0 A;  2YAN A;  3IPZ A;  1PL2 A;  1XOB A;  3HYP A;  4KB3 A;  2GDR A;  1XWC A;  3D21 A;  1GUH A;  1AW9 A;  2UZ8 A;  5CYY A;  3HVX A;  3BCI A;  3FK8 A;  5LNK e;  2NBS A;  1QMV A;  2GLR A;  1PSQ A;  4E8E A;  2DJ1 A;  4PUF C;  1S3D A;  3GKM A;  3IE3 A;  3L4N A;  3QAG A;  1XWG A;  3C7M A;  2NVL A;  1OAZ A;  1EGR A;  2YJ7 A;  2PPT A;  2L6C A;  1GRX A;  2L5O A;  1SK2 A;  3ZRE A;  1MD4 A;  4CY8 A;  3ZYW A;  4NV2 A;  3WT1 A;  1ILO A;  2R37 A;  2BMX A;  3D5J A;  2B1L A;  2H73 A;  3DVW A;  4GSS A;  4BWQ A;  4WBR D;  3C73 A;  1U3A A;  4HQZ A;  1EV9 A;  4WXT A;  1THO A;  2GGT A;  3DGQ A;  2F3M A;  1AQW A;  1WPI A;  2C80 A;  2MMN A;  3IHQ A;  1O6J A;  5F0G A;  5E59 A;  1F37 A;  2DC5 A;  2JSY A;  2LV3 A;  2FWF A;  5G30 A;  2DBC A;  3GRX A;  1XWB A;  1K0C A;  3UVH A;  1FW1 A;  2BJX A;  1R26 A;  3L9V A;  2X99 A;  4HUA A;  2IFQ A;  12GS A;  3P2A A;  3TJB A;  3HA9 A;  5DVB A;  1GSQ A;  1K0N A;  4IJI A;  2VCW A;  1M2A A;  4NHZ A;  5GZZ B;  2BTO T;  1MEK A;  3GUR A;  2ES7 A;  13GS A;  2YZH A;  5IOW A;  5KN2 A;  2HRA A;  3FR9 A;  2KUC A;  3LWA A;  3BCK A;  2QSI A;  3H8Q A;  1OC3 A;  3O3T A;  4JR6 A;  2JZR A;  5B6M A;  1ZOF A;  2FA8 A;  2HRN A;  4FYB A;  2LJK A;  2L5L A;  4K0G A;  4N0V A;  2GT5 A;  4Q5N A;  1A8L A;  2FHE A;  4HI7 A;  4TR1 A;  3KH9 A;  2H71 A;  2D2Z A;  3IC4 A;  5ABR A;  2ON5 A;  4O5R A;  4ZL7 A;  1GP1 A;  1TU8 A;  4O5Q A;  1CQH A;  3IOS A;  5G1K A;  1B48 A;  1ERW A;  2PMT A;  1Y25 A;  2VO4 A;  2MZC A;  4ECI A;  3ZFL A;  3F3R A;  1EZK A;  2LST A;  3G7Y A;  2XC2 A;  3EE2 A;  2N5A A;  4MDC A;  3ZL5 A;  3IV4 A;  3F0I A;  4MJA A;  5DCH A;  4ZB8 A;  2C1Y A;  3EWL A;  4MCU A;  4PGT A;  3A5I A;  3Q6O A;  5F06 A;  3US3 A;  3G7J A;  2M80 A;  3FRC A;  2YPM A;  4KSM A;  4Q5Q A;  19GS A;  3HJO A;  2A4V A;  2H70 A;  3M3M A;  4XS1 A;  4G0L A;  3KMN A;  1FVK A;  1XVQ A;  3GNJ A;  2QC7 A;  4F82 A;  4RUV A;  1XOA A;  4XIH A;  4PNF A;  4XRD A;  4K2X A;  1QFN A;  4RQR A;  3TKR A;  1YZX A;  5ECM B;  2CV4 A;  2OE1 A;  2FGX A;  4AGS A;  2HI7 A;  3CSH A;  1V9W A;  1YEP A;  1K0O A;  2I4A A;  1VF1 A;  4WR4 A;  3IHG A;  3UL3 A;  3IA1 A;  5A5K A;  1UC7 A;  2ALB A;  5GST A;  2R6K A;  2XBI A;  4JE1 A;  5CRD A;  3GKX A;  3L78 A;  1MD3 A;  4FQU A;  2V41 A;  3IAM 2;  1IYH A;  2L4Q A;  1A23 A;  1OC9 B;  4HZ2 A;  3TDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...