3RAZA

The crystal structure of thioredoxin-related protein from neisseria meningitidis serogroup b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
135
structure length
135
Chain Sequence
ELAGWKDNTPQSLQSLKAPVRIVNLWATWCGPCRKEMPAMSKWYKAQKKGSVDMVGIALDTSDNIGNFLKQTPVSYPIWRYTGANSRNFMKTYGNTVGVLPFTVVEAPKCGYRQTITGEVNEKSLTDAVKLAHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin-related protein
publication title The crystal structure of thioredoxin-related protein from Neisseria meningitidis serogroup B
rcsb
source organism Neisseria meningitidis serogroup b
total genus 33
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2011-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3razA00
4OCEA 2WZ9A 5ECNB 1ERUA 2VCTA 2R4VA 1G6YA 1AAZA 5ELGA 5IM9A 3HA9A 3KXOA 9GSSA 2TRCP 2DIYA 1QFNA 1M9BA 2MBSA 4OO5A 1TK0B 4DSSB 1VF4A 2YN1A 4EVMA 4JU5A 4ECBA 4QL7A 5GSSA 5HR3A 2WB9A 4F9ZA 4MF6A 5D73A 4RI6A 1W89A 2YOIA 2LJRA 1Z7PA 3KP8A 12GSA 2B5EA 3UARA 4XS1A 5CNWA 3LEFA 1TP9A 3TJFA 4CHSA 5KN2A 1T1VA 2IN3A 2MMAA 4NHWA 1O85A 1PA3A 1SK1A 3A2VA 1I5GA 5IIZA 2WCIA 3GURA 3TJGA 3TKSA 2C1YA 4WBJA 4KUNA 5DQSA 4EKZA 2HE3A 1PX6A 14GSA 5ECKB 5ECPB 3Q18A 5AN1A 5DCGA 1GULA 3D4MA 2H0IA 3VWVA 2GZPA 3HVXA 4BL7A 1ZOFA 1EWXA 2WS2A 1TRUA 3GKMA 3DVXA 4JBBA 2GT6A 2OE3A 5INYA 2HT9A 4HU7A 10GSA 2O89A 2DJ3A 5ABRA 1OC9B 3L78A 1J0FA 1TOFA 2X64A 4J57E 2V41A 3I9V2 1ZYQB 4OCFA 2VLUA 4I8BA 2R6KA 5A5KA 2O85A 4PQHA 5ELAA 1H4OA 2DJ1A 3KZQA 1Z5YE 2HI7A 4LLRA 1SL2B 5DVBA 3HD5A 1ZCPA 1OC8A 2B6MA 2CVDA 3QFBC 2DSAA 3F8UA 2HXKA 5ECOB 2WFCA 2C8UA 1AQWA 3UBKA 1NW2A 2B7KA 1PX7A 1SL1B 4POKA 2XHFA 3LQ7A 1EP7A 1K3OA 1SD9A 1KTEA 5GAPD 4I5QA 4EF0A 2LKUA 4POLA 4Q5NA 3EMXA 4HEA2 1F3AA 22GSA 1ZL9A 4KDYA 1KBNA 1R7HA 2AUVA 2TIRA 1Y6EA 1OE8A 4RUVA 4TVEA 1SKSB 3L9SA 1GTAA 1OKDA 3FY7A 2MBTA 3GNJA 4BWQA 2FNOA 1LU4A 3EWLA 3D4TA 3ERWA 4OFMA 3RPPA 2ON7A 3GX8A 5J3RA 1GUKA 4EDZA 2C3QA 1K0AA 1GUMA 1SU9A 2H1DA 4TKYA 1E2YA 3E9JB 6GSTA 4WEYA 3KP9A 4KDXA 1UN2A 3LORA 4N10A 1V57A 5JCUA 1DE1A 4ACSA 2F3MA 2CZ3A 3GKKA 3IR4A 3UVTA 4NXIA 5A4VA 5EL8A 4IQAA 4MF7A 1QQ2A 4FYUA 3RAZA 3SWLA 5KN1A 4L5LA 2C0FA 5ID2B 2VL2C 1S3CA 1N8JA 3UVHA 3D22A 2IPAA 6GSUA 5D8IA 1QUWA 2PVOC 3KTLA 3VFIA 3KJYA 4WXTA 1GSEA 3G7JA 4HOJA 4K0NA 1BYEA 2LV3A 4XHMA 5GSTA 2RIIA 1THOA 2LUSA 2FHEA 3O6TA 3FR9A 3PR8A 5CREA 7GSSA 4TR4A 4PNGA 1MD4A 2IJYA 1XWBA 4GF0A 3VWXA 4NWYA 4GCIA 2GQLA 2OE1A 2M72A 2VCZA 2F51A 3KM6A 4KAEA 2A2SA 3U6VA 1K0DA 4EE0A 1EOGA 2H75A 5F8BA 2HZFA 4MMMA 2CA8A 1U3IA 5HR2A 3UJ1A 4ZILA 4O32A 1SJZA 1AXDA 4IP1A 4PQ1A 1CQGA 3EU3A 3DVWA 4OD7A 2GQMA 3FRCA 1JLWA 2BMXA 3W8JA 19GSA 1Y25A 3KMNA 3ZVJD 2XC2A 3QPMA 1A2LA 2HFDA 1YEPA 5LCZA 1FOVA 2YP6A 3UEMA 1T3BA 4V1Ap 2CV4A 4Q5RA 4DVCA 3EU4A 3KH9A 3OR5A 4TRXA 2R5GA 3MSZA 2R37A 2IFQB 2CAIA 1IYHA 5DALA 2V6KA 1TRWA 2K8SA 3FR3A 4PUAA 2CX3A 4ZBBA 2TRXA 2RUEA 2ZNMA 3QCPA 1EGRA 3ISOA 4TR1B 2VM2A 2FA4A 3HJMA 2VL2A 4TR0A 3FZAA 4DSQA 3DKSA 1VF2A 5AGYA 3FZ5A 4OMVA 2E0QA 4IHUA 3QDNA 1X9WB 5LNKe 3D6IA 3F3QA 1XOBA 1X5EA 4ZB8A 4AJ7A 3TJBA 1GTIA 2RLIA 1IYIA 2L59A 1MTCA 3J7Yk 3KD0A 5LD0A 4GWRA 2QKEA 3H79A 2NTOA 3ME8A 3US3A 4WKWA 3C7MA 3CSHA 3PINA 2KHPA 2VCQA 3U5RE 2WRTA 4LL4B 3LXTA 4I97A 3WGXA 3ZL5A 5ECLB 2FGXA 4IW9A 2REMA 1XWKA 1R4WA 4RQXA 1QGVA 3D5JA 4KDUA 4ZIJA 2JZRA 5DJMA 2V1MA 1TRVA 1GL8A 1GH2A 2AJQB 4GQCA 2H30A 2FWHA 4V1Ag 5HR1A 3LXZA 1A2JA 1FG4A 3TJJA 3ED3A 1XFLA 1TK8B 4H86A 1R26A 5FWGA 1F3BA 4MK3A 4N30A 2FWGA 2MMOA 4ILFA 4FO5A 2D2ZA 8GSSA 4O5RA 2CZ2A 2NPBA 2GVPA 3FW2A 2AAWA 3HDCA 3BOAA 2K18A 3IE3A 3DMLA 4E8EA 1T8EB 4HDEA 2J23A 4GSSA 2IIYA 3QAVA 2K6VA 4HZ4A 2LRTA 2LSTA 4ZL9A 2C3NA 1H75A 5IMDA 3ERFA 1PQNA 1M2AA 4J2FA 2HZEA 5IMAA 3LYKA 5DAKA 4L0UA 2P5RA 4MA9A 1X5DA 4BWSA 4QL9A 4GSNA 3E0UA 4EXJA 5G30A 2IMKA 3GYKA 3QMXA 5DDLA 4YQMA 3D0ZA 3H93A 4KGIA 1WWJA 2KP2A 3H1NA 4D73A 3F3RA 4HQSA 3UAPA 2GZYA 2LQOA 2P31A 1X0RA 3P2AA 2YV7A 3ZMLA 2FWFA 2AYTA 2X99A 1ZGNA 4MCUA 1UC7A 6GSVA 2CVBA 4KSOA 2OADA 2GSRA 1TDIA 2FLSA 1DSBA 4EC0A 4ZL7A 2XBQA 1YY7A 5B8AA 3GFKA 1FW1A 3Q19A 3NZNA 2N5AA 4K2DA 4YQUA 3CSIA 5B6NA 5G31A 4ZBDA 1HQOA 3EVIA 3PH9A 3CBUA 4G10A 3F6DA 5EVOA 1GNWA 1XW9A 2WULA 3GA4A 3ZREA 4F03A 2RUFA 4HS1A 3QAGA 4MPGA 1GSUA 3TKQA 3GTUB 3EE2A 4IQ1A 1AIUA 2A4VA 3VWUA 3GN3A 3F63A 2VCWA 1PRXA 3IHQA 5L71A 3P7XA 2KOKA 2BTOT 1GTBA 2GLRA 5A4UA 3ZFLA 3S9FA 1O6JA 4K7NA 2LNSA 1TRSA 4K0GA 3FHKA 2C0DA 2CQ9A 3EC3A 4L5OA 5IOWA 2VL3A 4DSSA 3HYPA 2Z9SA 2WGRA 1X9MB 2G2QA 1NSWA 3HXSA 4HJMA 2DMMA 20GSA 5ECQB 2O8VB 5IMVA 5KN3A 1O81A 3KH7A 4JRRA 1PKZA 1PGTA 4XIHA 1AQXA 1ILOA 4NAXA 3FYGA 2FA8A 5DCHA 2QGVA 2L5OA 2H1GA 2PERA 1FB0A 4JE1A 3GV1A 3L4NA 3ZFBA 4IGJA 3RDWA 3GRXA 3N9JA 2F9SA 1A0RP 1ACVA 1PMTA 11GSA 4N0VA 2HRNA 3C8EA 2JZSA 3RHCA 4PUFC 2J9HA 6GSYA 2YWNA 4NPBA 4TW5A 2OJLA 4MP4A 4PQIA 2NVLA 1V2AA 2VLVA 3CTGA 4XRDA 4MZCA 1O8XA 3HVVA 4N11A 2JU5A 1AC1A 1TJDA 2K8VA 4L8EA 2LJAA 5HFKA 1GLQA 4V2MA 3L9VA 3C1RA 2HLSA 4ZXGA 2LRCA 1ML6A 2PWJA 2QC7A 5C00A 4MJEA 4ECIA 1NHOA 2XPEA 4WF4A 5IQYA 3WYWA 5JCWA 4PURA 1SD8A 1TW9A 2YZHA 3APQA 1K0NA 3HJOA 2IMFA 5JWOB 3M8NA 1XBSA 4KX4A 4ZL8A 4NMUA 2EC4A 1B4QA 5J41A 1SK2A 1F9MA 3WT1A 1BEDA 4PNFA 5DBQA 4KB3A 5F06A 3SBCA 1OE7A 1BQ7A 1BJXA 2VLTA 4ID0A 4MDCA 4FYCA 1K0OA 4K9ZA 3ZYWA 1JZDA 3FZ4A 4LL1B 1XW5A 2L4QA 2VIMA 4CW9A 4HI7A 5FT3A 3F4SA 4K8MA 2PGTA 1PD21 4O7HA 3LG6A 2PUKC 1SJ6A 3K8NA 1E6BA 4EO3A 3ZITA 1K0CA 1GSSA 3TRPA 1HNBA 3I6AA 3O76A 2JZTA 3TKSE 4EUYA 1U88A 4ECCA 2OKAA 1MDJA 4OWYA 4LA1A 2LJKA 1JZRA 5CRGA 3QFAC 2PPTA 4V2NA 5AISA 2HSHA 3IPZA 2H0GA 3IA1A 1X5CA 2AV4A 5A4WA 1Z6MA 4WETA 3C73A 3GHAA 1J08A 3GIXA 3CYNA 5B6MA 2VCXA 1FHEA 2L57A 3IC4A 5IMZA 2H74A 2M80A 2OBKA 2H1AA 3CRTA 1YF1A 3EYTA 1MDKA 4XS4A 1PN9A 4YH2A 1A2MA 4G19A 1B4PA 5DALB 3TOTA 3UOMA 4YAPA 1MDIA 1TU8A 2C0EA 2I4AA 1T4YA 1PKWA 3ZRDA 1WRYA 1YF0A 2L5LA 5IMCA 4L0WA 5G2ZA 3D21A 1V40A 2VO4A 1K0BA 1M2DA 1WJKA 3Q6OA 4MF5A 4OFNA 4PXOA 2CX4A 1VRSD 3TKPA 3GSSA 2M46A 1Z7RA 1TKDB 5F05A 1FVKA 2EIRA 2YJHA 2DLXA 5G5FA 3CXGA 1EOHA 2C80A 1DE2A 3TRQA 3WT2A 4RI7A 3ZVJA 1GSYA 3IOSA 2N5BA 4RQRA 1B9XC 2XBIA 1JZWA 4KE3A 2F8AA 1M7TA 2BJXA 4K1FA 2EIOA 2HRFA 2A2RA 5B7CA 2LNTA 4GSTA 2XPDA 4LMWA 1SKWB 1QMVA 4AJ6A 4BPYA 1SENA 3EMPA 2H76A 5ECRB 1ZZYA 3FKFA 3M9JA 5J9BA 2FD3A 4KA0A 1XW6A 5HFGA 1BAYA 5GAND 1PL1A 3QAWA 3M0FA 2FWEA 1SKRB 1YDKA 4JEDA 3E3EA 2E2GA 1XPVA 3DRNA 1YZXA 1SYRA 5CRWA 1ST9A 2MYGA 4TXOA 4XTSA 5J5NA 3GMFA 5DQYA 1F2EA 5CP1A 3HVSA 2X8HA 5CO3A 2X8CA 2PBJA 2GTUA 2CAQA 3EURA 3UMAA 13GSA 5IMFA 1EP8A 2H01A 2OE0A 1PL2A 5DJLA 4F0BA 2JSZA 3BCKA 4E8HA 3DXBA 5F07A 5AIVA 2GZZA 5E59A 5ENUA 2YV9A 2HZEB 4JR4A 5DAKB 1O7UA 5F0GA 3KEBA 5HQPA 4I6XA 4BVXA 2WDUA 1HYUA 5JWRB 2LRNA 1LJRA 2ZCTA 4DEJA 4BA7A 1OC3A 3ZIJA 4D73B 4IELA 1M2BA 2PN8A 4HUAA 2GDRA 2B1KA 1QXHA 3UIWA 2OACA 3GH6A 3GKXA 2HSYA 1U3AA 5HFIA 3VK9A 1DBYA 2V32A 1XIYA 2IMEA 4G9HA 4XS6A 3DIEA 2C3TA 2P5QA 1Z6NA 4ISDA 5COHA 5D9WA 1G6WA 5H5RA 2LS5A 4X43A 1NM3A 4DSRA 2YJ7A 1W4VA 5IO2A 3W6GA 1Q4JA 1RQMA 4GTUA 2IWTA 1A23A 1MD3A 4AGSA 1EEJA 4MJAA 4KH7A 2ZUPA 1AW9A 1T7PB 1YEXA 4MH3A 4IN0A 1F37A 3TKRA 3HCZA 1A8LA 2RM5A 3UL3A 4WF5A 1R5AA 1TI1A 1G0TA 3HHVA 3F0IA 4KCEA 2R2JA 1WMJA 3BD2A 1U6TA 1WOUA 4FYBA 4J56E 1THXA 2LEGA 2DMLA 2GGTA 2GSSA 4XRAA 1GTUA 2VAFA 3H4KA 3WGDA 4ZB6A 5E4WA 3ZIVA 1LBKA 2DJ2A 1RK4A 4AF2A 3G7YA 3LYPA 1ZMAA 1YKCA 2HNLA 3APOA 4F2IA 2YWMA 1A0FA 2VM1A 5AIXA 1XOAA 2FCHA 5GZZB 1G7EA 5G1LA 2F8FA 2RM6A 4KSMA 1GUHA 3HZ8A 1O73A 3GH9A 2R3XA 1M0UA 3GL5A 2DJJA 4IS0A 3FZ9A 3VLNA 2E2MA 2O7KA 4IBPA 5JWQB 1WP0A 1OAZA 2MZCA 1XVWA 4N0ZA 1GWCA 1F6MC 4MJCA 4HQZA 2QSIA 4ECJA 3KMOA 3R2QA 2NBSA 2H73A 3V1WA 1OVNA 3H8QA 3TB2A 4X0XA 1FVJA 1V9WA 3GTUA 2AHEA 4POBA 4TN8A 4AJ8A 1EZKA 1QK8A 1XWGA 2DIZA 2H70A 2NDOA 3TGZA 3ZMKA 3M9KA 3ME7A 3KIJA 3IBHA 4KCAA 2ALBA 4FH8A 1VF1A 2WJUA 1GSQA 3CSJA 3PGTA 1YQ1A 2YZUA 3QOUA 3ZZXA 2DJKA 3UBLA 3IRAA 1A8YA 2ON5A 5CRHA 1HD2A 2LQQA 1VF3A 2VOCA 3F9UA 2VD0A 1CQHA 5ECIB 3VWWA 3WD6A 5ECSA 3NIVA 1XZOA 3CTFA 2H66A 1ON4A 1OC9A 2B7JA 4I2UA 5IPGA 1K0MA 5G1KA 1URMA 5EPFA 4HU9A 3BBYA 5HR0A 1WIKA 2B3SA 4QQ7A 2IMIA 2H6YA 4JR6A 3N5OA 2G0FA 4NHZA 3IAM2 3FK8A 3EINA 5CAXA 2EIQA 4TR3A 1K3LA 2IMDA 4YAVA 2JADA 1XWCA 4ZBAA 2H71A 2MMNA 3GL3A 5H5SA 1TXXA 5H5QA 2JSYA 4WBRD 4F0CA 5JCGA 3BCIA 2IL3A 2K9FA 1UA5A 1SL0B 3TDGA 4EL1A 2X8GA 4IVFA 3LFLA 2YCDA 2PVQA 3C71A 1S3AA 1ABAA 1OYJA 4NV2A 3ZLPA 4OO4A 1K3YA 3CRUA 4X1UA 3G9BA 18GSA 3P8WA 4XS4B 2N5FA 2AB6A 2MMZA 1B9YC 4WR5A 4FIWA 1DUGA 2I1UA 3IDVA 5D96A 3FR6A 3J7Yb 3MAKA 5D93A 1HNAA 1S3DA 2VL9A 4EDYA 3MWHA 16GSA 4XCSA 4WR4A 2YANA 3F4RA 4KNDA 1UVZA 5C04A 4TOPA 3VPTA 1G7OA 2H6XA 5ID2A 1N2AA 1XXUA 4MZBA 2VUPA 3QR6A 1Z3EA 2B5YA 1RW1A 2O87A 3QD9A 4Q5FA 2CVKA 1SJIA 4K7OA 1Q98A 2C4JA 4PX1A 5D9VA 2VCVA 2PU9C 4ML1A 4JZQA 5CYYA 3GX0A 3HJPA 3HZ4A 1EGOA 1USBA 2V2GA 2YPMA 3MDKA 2GSQA 1X9SB 4OFTA 5G5EA 4K6XA 2GT5A 1JFUA 4GXZA 2YWOA 3IK9A 5KEJA 3RBTA 1GSDA 3TJKA 3I69A 2LTKA 1GSFA 3KTBA 1AQVA 3GUSA 3TRXA 1JZOA 1XVQA 1O8WA 4K7IA 4MLYA 1B8XA 3VI7A 1AUCA 1GNEA 4MH2A 3TCOA 2OBIA 1V58A 3KGKA 4TXVA 4HJ2A 1TTZA 4GLTA 1FB6A 3W8SA 2FUG2 3BJ5A 3C1SA 1GP1A 3LGCA 1GLPA 4TXOB 2C0GA 2H72A 4P3YB 2HYXA 1XWAA 3TOUA 3FEUA 3IK7A 3RPNA 3MNGA 4F82A 3DGQA 1PSQA 3HKRA 4G2EA 3VPQA 3LSZA 1TK5B 1YKAA 2H0HA 5D9TA 3DEXA 3DYRA 2E7PA 2H19A 3DD3A 3IV4A 3KCMA 1BX9A 5IOXA 4ML6A 2IFQA 6GSSA 2L4CA 2DC5A 5IPHA 3ERGA 3HY2A 5IO0A 2I9HA 5EY6A 1ERTA 1WE0A 2ES7A 2L6DA 4Q5QA 4MJBA 3O3TA 4HZ2A 4PGTA 4TR1A 1HNCA 3VI5A 1V98A 1YJ6A 5J4UA 4CDOA 1TU7A 2P0GA 1FAAA 3A5WA 1OKTA 5B8BA 1ERWA 3P90A 3NOFA 3F6FA 1ZYEA 3APSA 1KEBA 2V6OA 4IJIA 3M3MA 4Z7XA 1BG5A 3Q74A 2FY6A 1C72A 2H1BA 2KUCA 2OA7A 2I3YA 2GSTA 1VGLA 3L0HA 3GKNA 5ECHB 4ZB9A 1SK0A 5KN0A 5D9XA 2YNXA 3I43A 3LWAA 5ECMB 2B1LA 1M9AA 4KW6A 4YQVA 1A24A 2GQKA 3F4TA 3M1GA 3JCML 5FHIA 3G7IA 2KP1A 2GS3A 4GRFA 2PMTA 4BVYA 3DWVA 1TI3A 1M99A 3CMIA 1MEKA 3IAS2 1T00A 3VURA 3TUEA 1I9DA 4MPFA 3TKSC 4GQFA 5J9CA 2H6ZA 17GSA 3GSTA 1XCCA 1J9BA 2B5XA 1R5PA 1Z9HA 1JLVA 2DJ0A 4IJ3A 3ZTLA 1GRXA 1FO5A 4MABA 3IXRA 2JL4A 3A2XA 4V2LA 1T4ZA 3A3TA 2JACA 1NHYA 3AY8A 1SYXA 1EV9A 4ULXA 3L9UA 4IP6A 4POMA 4I2TA 1B48A 6GSWA 4LMVA 4IKHA 2L6CA 1ERVA 1WPIA 3LJRA 6GSXA 1EV4A 4MZWA 1JHBA 4NV5A 3WGEA 1KNGA 2I81A 2YWIA 3A2WA 1U87A 1EEMA 5CRDA 3RHBA 2H8LA 4O92A 2DBCA 2KLXA 2CT6A 2VD1A
chains in the Genus database with same CATH superfamily
4OCEA 2WZ9A 5ECNB 1ERUA 2VCTA 2R4VA 1G6YA 1AAZA 5ELGA 5IM9A 3HA9A 3KXOA 4USSA 9GSSA 2TRCP 2DIYA 1QFNA 1M9BA 2MBSA 4OO5A 1TK0B 4DSSB 1VF4A 2YN1A 4EVMA 4JU5A 4ECBA 4QL7A 5GSSA 5HR3A 2WB9A 4F9ZA 4MF6A 5D73A 4RI6A 1W89A 2YOIA 2LJRA 1Z7PA 3KP8A 12GSA 2B5EA 3UARA 4XS1A 5CNWA 3LEFA 1TP9A 3TJFA 4CHSA 5KN2A 1T1VA 2IN3A 2MMAA 4NHWA 1O85A 1PA3A 1SK1A 3A2VA 1I5GA 5IIZA 2WCIA 3GURA 3TJGA 3TKSA 2C1YA 4WBJA 4KUNA 5DQSA 4EKZA 2HE3A 1PX6A 14GSA 5ECKB 5ECPB 3Q18A 5AN1A 5DCGA 1GULA 3D4MA 2H0IA 3VWVA 2GZPA 3HVXA 2QA2A 4BL7A 1ZOFA 1EWXA 2WS2A 1TRUA 3GKMA 3DVXA 4JBBA 2GT6A 2OE3A 5INYA 2HT9A 4HU7A 10GSA 2O89A 2DJ3A 5ABRA 1OC9B 3L78A 1J0FA 1TOFA 2X64A 4J57E 2V41A 3I9V2 1ZYQB 4OCFA 2VLUA 4I8BA 2R6KA 5A5KA 2O85A 4PQHA 5ELAA 1H4OA 2DJ1A 3KZQA 1Z5YE 2HI7A 4LLRA 1SL2B 5DVBA 3HD5A 1ZCPA 1OC8A 2B6MA 2CVDA 3QFBC 2DSAA 3F8UA 2HXKA 5ECOB 2WFCA 2C8UA 1AQWA 3UBKA 1NW2A 2B7KA 1PX7A 1SL1B 4POKA 2XHFA 3LQ7A 1EP7A 1K3OA 1SD9A 1KTEA 4K2XA 5GAPD 4I5QA 4EF0A 2LKUA 4POLA 4Q5NA 3EMXA 4HEA2 1F3AA 22GSA 1ZL9A 4KDYA 1KBNA 1R7HA 2AUVA 2TIRA 1Y6EA 1OE8A 4RUVA 4TVEA 1SKSB 3L9SA 1GTAA 4FQUA 1OKDA 3FY7A 2MBTA 3GNJA 4BWQA 2FNOA 1LU4A 3EWLA 3D4TA 3ERWA 4OFMA 3RPPA 2ON7A 3GX8A 5J3RA 1GUKA 4EDZA 2C3QA 1K0AA 1GUMA 1SU9A 2H1DA 4TKYA 1E2YA 3E9JB 6GSTA 4WEYA 3KP9A 4KDXA 1UN2A 3LORA 4N10A 1V57A 5JCUA 1DE1A 4ACSA 2F3MA 2CZ3A 3GKKA 3IR4A 3UVTA 4NXIA 5A4VA 5EL8A 4IQAA 4MF7A 1QQ2A 4FYUA 3RAZA 3SWLA 5KN1A 4L5LA 2C0FA 5ID2B 2VL2C 1S3CA 1N8JA 3UVHA 3D22A 2IPAA 6GSUA 5D8IA 1QUWA 2PVOC 3KTLA 3VFIA 3KJYA 4WXTA 1GSEA 3G7JA 4HOJA 4K0NA 1BYEA 2LV3A 4XHMA 5GSTA 2RIIA 1THOA 2LUSA 2FHEA 3O6TA 3FR9A 3PR8A 5CREA 7GSSA 4TR4A 4PNGA 1MD4A 2IJYA 1XWBA 4GF0A 3VWXA 4NWYA 4GCIA 2GQLA 2OE1A 2M72A 4O5UA 2VCZA 2F51A 3KM6A 4KAEA 2A2SA 3U6VA 1K0DA 4EE0A 1EOGA 2H75A 5F8BA 2HZFA 4MMMA 2CA8A 1U3IA 5HR2A 3UJ1A 4ZILA 4O32A 1SJZA 1AXDA 4IP1A 4PQ1A 1CQGA 3EU3A 3DVWA 4OD7A 2GQMA 3FRCA 1JLWA 2BMXA 3W8JA 19GSA 1Y25A 3KMNA 3ZVJD 2XC2A 3QPMA 1A2LA 2HFDA 3MYDA 1YEPA 5LCZA 1FOVA 2YP6A 3UEMA 1T3BA 4V1Ap 2CV4A 4Q5RA 4DVCA 3EU4A 3KH9A 3OR5A 4TRXA 2R5GA 3MSZA 2R37A 1PN0A 2IFQB 2CAIA 1IYHA 5DALA 2V6KA 1TRWA 5BMUA 2K8SA 3FR3A 4PUAA 2CX3A 4ZBBA 2TRXA 2RUEA 2ZNMA 3QCPA 1EGRA 3ISOA 4TR1B 2VM2A 2FA4A 3HJMA 2VL2A 4TR0A 3FZAA 4DSQA 3DKSA 1VF2A 5AGYA 3FZ5A 4OMVA 2E0QA 4IHUA 3QDNA 1X9WB 5LNKe 3D6IA 3F3QA 1XOBA 2X49A 1X5EA 4ZB8A 4AJ7A 3TJBA 1GTIA 2RLIA 1IYIA 2L59A 1MTCA 3J7Yk 3KD0A 5LD0A 4GWRA 2QKEA 3H79A 2NTOA 3ME8A 3US3A 4WKWA 3C7MA 3CSHA 3PINA 2KHPA 2VCQA 3U5RE 2WRTA 4LL4B 3LXTA 4I97A 4BVXB 3WGXA 3ZL5A 5ECLB 4G0IA 2FGXA 4IW9A 2REMA 1XWKA 4BVYB 4CY8A 1R4WA 4RQXA 1QGVA 3D5JA 4KDUA 4ZIJA 2JZRA 5DJMA 2V1MA 1TRVA 1GL8A 1GH2A 2AJQB 4GQCA 2H30A 2FWHA 4V1Ag 5HR1A 3LXZA 1A2JA 1FG4A 3TJJA 3ED3A 1XFLA 2UZ8A 1TK8B 4H86A 1R26A 5FWGA 1F3BA 4MK3A 5KOXA 4N30A 2FWGA 2MMOA 4ILFA 4FO5A 2D2ZA 8GSSA 3IHGA 4O5RA 2CZ2A 2NPBA 2GVPA 3FW2A 2AAWA 3HDCA 3BOAA 2K18A 3IE3A 3DMLA 4E8EA 1T8EB 4HDEA 4G0LA 2J23A 4GSSA 2IIYA 3QAVA 2K6VA 4HZ4A 2LRTA 2LSTA 4ZL9A 2C3NA 1H75A 5IMDA 3ERFA 1PQNA 1M2AA 4J2FA 2HZEA 5IMAA 3LYKA 5DAKA 4L0UA 2P5RA 3CQFA 4MA9A 1X5DA 4BWSA 4QL9A 4GSNA 3E0UA 4EXJA 5G30A 2IMKA 2R0GA 3GYKA 3QMXA 5DDLA 4YQMA 3D0ZA 3H93A 4KGIA 1WWJA 2KP2A 3H1NA 4D73A 3F3RA 4HQSA 3UAPA 2GZYA 2LQOA 2P31A 1X0RA 3P2AA 2YV7A 3ZMLA 2FWFA 2AYTA 2X99A 1ZGNA 4MCUA 1UC7A 6GSVA 2CVBA 4KSOA 2OADA 2GSRA 1TDIA 2FLSA 1DSBA 4EC0A 4ZL7A 2XBQA 1YY7A 5B8AA 3GFKA 1FW1A 3Q19A 3NZNA 2N5AA 4K2DA 4YQUA 3CSIA 5B6NA 5G31A 4ZBDA 1HQOA 3EVIA 3PH9A 3CBUA 4G10A 3F6DA 5EVOA 1GNWA 1XW9A 2WULA 3GA4A 3ZREA 4F03A 2RUFA 4HS1A 3QAGA 4MPGA 1GSUA 3TKQA 3GTUB 3EE2A 4IQ1A 1AIUA 2A4VA 3VWUA 3GN3A 3F63A 2VCWA 1PRXA 3IHQA 5L71A 3P7XA 2KOKA 2BTOT 1GTBA 2GLRA 5A4UA 3ZFLA 3S9FA 1ZYNA 1O6JA 4K7NA 2LNSA 1TRSA 4K0GA 3FHKA 2C0DA 2CQ9A 3EC3A 4L5OA 5IOWA 4HSCX 2VL3A 4DSSA 3HYPA 2Z9SA 2WGRA 1X9MB 2G2QA 1NSWA 3HXSA 4HJMA 2DMMA 20GSA 5ECQB 2O8VB 5IMVA 5KN3A 1FOHA 1O81A 3KH7A 4JRRA 1PKZA 1PGTA 4XIHA 1AQXA 1ILOA 4NAXA 3FYGA 2FA8A 5DCHA 1XG8A 2QGVA 2L5OA 2H1GA 2PERA 1FB0A 4JE1A 3GV1A 3L4NA 3ZFBA 4IGJA 3RDWA 3GRXA 3N9JA 2F9SA 1A0RP 1ACVA 1PMTA 11GSA 4N0VA 2HRNA 3C8EA 2JZSA 3RHCA 4PUFC 2J9HA 6GSYA 2YWNA 4NPBA 4TW5A 2OJLA 4MP4A 4PQIA 2NVLA 1V2AA 2VLVA 3CTGA 4XRDA 4MZCA 1O8XA 5BRTA 2R0CA 3HVVA 4N11A 2JU5A 1AC1A 1TJDA 2K8VA 4L8EA 2LJAA 5HFKA 1GLQA 4V2MA 3L9VA 3C1RA 2HLSA 4ZXGA 2LRCA 1ML6A 2PWJA 2QC7A 5C00A 4MJEA 4ECIA 1NHOA 2XPEA 4WF4A 5IQYA 3WYWA 5JCWA 4PURA 1SD8A 1TW9A 2YZHA 3APQA 1K0NA 3HJOA 2IMFA 5JWOB 3M8NA 1XBSA 4KX4A 4ZL8A 4NMUA 2EC4A 1B4QA 5J41A 1SK2A 1F9MA 3WT1A 1BEDA 4PNFA 4BIKA 5DBQA 4KB3A 5F06A 3SBCA 1OE7A 1BQ7A 1BJXA 2VLTA 4ID0A 4MDCA 4FYCA 1K0OA 4K9ZA 3ZYWA 1JZDA 3FZ4A 4LL1B 1XW5A 2L4QA 2VIMA 4CW9A 4HI7A 5FT3A 3F4SA 4K8MA 2PGTA 1PD21 4O7HA 3LG6A 2PUKC 1SJ6A 3K8NA 1E6BA 4EO3A 3ZITA 1K0CA 1GSSA 3TRPA 1HNBA 3I6AA 3O76A 2JZTA 4YKFA 3TKSE 4EUYA 1U88A 4ECCA 2OKAA 1MDJA 4OWYA 4LA1A 2LJKA 1JZRA 4MNNA 5CRGA 3QFAC 2PPTA 4V2NA 5AISA 2HSHA 3IPZA 2H0GA 4EIQA 3IA1A 1X5CA 2AV4A 5A4WA 1Z6MA 4WETA 3C73A 3GHAA 1J08A 3GIXA 3CYNA 5B6MA 2VCXA 1FHEA 2L57A 3IC4A 5IMZA 2H74A 2M80A 2OBKA 2H1AA 3CRTA 1YF1A 3EYTA 1MDKA 4XS4A 1PN9A 4YH2A 4EIPA 1A2MA 4KF9A 4G19A 1B4PA 5DALB 3TOTA 3UOMA 4YAPA 1MDIA 1TU8A 2C0EA 2I4AA 1T4YA 1PKWA 3ZRDA 1WRYA 1YF0A 2L5LA 5IMCA 4L0WA 5G2ZA 3D21A 1V40A 4Z2RA 2VO4A 3A5IA 1K0BA 1M2DA 1WJKA 3Q6OA 4MF5A 4OFNA 4PXOA 2CX4A 1VRSD 3TKPA 3GSSA 2M46A 1Z7RA 1TKDB 5F05A 1FVKA 2EIRA 2YJHA 2DLXA 5G5FA 3CXGA 1EOHA 2C80A 1DE2A 3TRQA 3WT2A 4RI7A 3ZVJA 1GSYA 3IOSA 2N5BA 4RQRA 3FMWA 2HRKA 1B9XC 4KE3A 2XBIA 1JZWA 2F8AA 1M7TA 2BJXA 4K1FA 2EIOA 2HRFA 2A2RA 5B7CA 2LNTA 4GSTA 2XPDA 4LMWA 1SKWB 1QMVA 4AJ6A 4BPYA 1SENA 3EMPA 2H76A 5ECRB 1ZZYA 2X4AA 3FKFA 3M9JA 5J9BA 2FD3A 4KA0A 1XW6A 5HFGA 1BAYA 5GAND 1PL1A 3QAWA 3M0FA 2FWEA 1SKRB 1YDKA 4JEDA 3E3EA 2E2GA 3LW9A 1XPVA 3DRNA 1YZXA 1SYRA 5CRWA 1ST9A 2MYGA 4TXOA 4XTSA 5J5NA 3GMFA 5DQYA 1F2EA 5CP1A 3HVSA 2X8HA 5CO3A 2X8CA 2PBJA 2GTUA 2CAQA 3EURA 3UMAA 13GSA 4ICYA 5IMFA 1EP8A 2H01A 2OE0A 1PL2A 5DJLA 4F0BA 2JSZA 3BCKA 4E8HA 3DXBA 5F07A 5AIVA 2GZZA 5E59A 5ENUA 2YV9A 2HZEB 4JR4A 5DAKB 1O7UA 5F0GA 3KEBA 4G0KA 5HQPA 4I6XA 2R0PA 4BVXA 2WDUA 1HYUA 5JWRB 2LRNA 1LJRA 2ZCTA 4DEJA 4BA7A 1OC3A 3ZIJA 4D73B 4IELA 1M2BA 2PN8A 4HUAA 2GDRA 2B1KA 1QXHA 3UIWA 2OACA 3GH6A 3GKXA 2HSYA 1U3AA 5HFIA 3VK9A 1DBYA 2V32A 1XIYA 2IMEA 4G9HA 4XS6A 3DIEA 2C3TA 2P5QA 1Z6NA 4ISDA 5COHA 5D9WA 1G6WA 4YKGA 5H5RA 2LS5A 4X43A 1NM3A 4DSRA 2YJ7A 1W4VA 5IO2A 3W6GA 1Q4JA 1RQMA 4GTUA 2IWTA 1A23A 1MD3A 1ZYPA 4AGSA 1EEJA 4MJAA 4KH7A 2ZUPA 1AW9A 1T7PB 1YEXA 4MH3A 4IN0A 1F37A 3TKRA 3HCZA 1A8LA 4PTSA 2RM5A 3UL3A 4WF5A 1R5AA 1TI1A 3HVNA 1G0TA 3HHVA 3F0IA 3PPUA 4KCEA 2R2JA 1WMJA 3BD2A 1U6TA 1WOUA 4FYBA 4J56E 1THXA 2LEGA 2DMLA 2GGTA 2GSSA 4XRAA 1GTUA 4Z2UA 2VAFA 3H4KA 3WGDA 4ZB6A 5E4WA 3ZIVA 1LBKA 2DJ2A 1RK4A 4AF2A 3G7YA 4BL7B 3LYPA 1ZMAA 1YKCA 2HNLA 3APOA 4F2IA 2YWMA 1A0FA 2VM1A 5AIXA 1XOAA 2FCHA 5GZZB 3IC8A 4K5RA 1G7EA 5G1LA 2F8FA 2RM6A 4KSMA 1GUHA 3HZ8A 1O73A 3GH9A 2R3XA 1M0UA 3GL5A 2DJJA 4IS0A 3FZ9A 3VLNA 2E2MA 2O7KA 4IBPA 5JWQB 1WP0A 1OAZA 4A5PA 2MZCA 1XVWA 4N0ZA 1GWCA 1F6MC 4MJCA 4HQZA 2QSIA 4ECJA 3KMOA 3R2QA 2NBSA 2H73A 3V1WA 1OVNA 3H8QA 3TB2A 4X0XA 1FVJA 1V9WA 3GTUA 2AHEA 4POBA 4TN8A 4AJ8A 1EZKA 1QK8A 1XWGA 2DIZA 2H70A 2NDOA 3TGZA 3ZMKA 3M9KA 4Z2TA 3ME7A 3KIJA 3IBHA 4KCAA 2ALBA 4FH8A 1VF1A 2WJUA 1GSQA 3CSJA 3PGTA 3EPTA 1YQ1A 2YZUA 3QOUA 3ZZXA 2DJKA 3UBLA 3IRAA 1A8YA 2ON5A 5CRHA 1HD2A 2LQQA 5KOWA 1VF3A 2VOCA 3F9UA 2VD0A 1CQHA 5ECIB 3VWWA 3WD6A 5ECSA 3NIVA 1XZOA 3CTFA 2H66A 1ON4A 1OC9A 2B7JA 4I2UA 5IPGA 1S3RA 1K0MA 5G1KA 1URMA 5EPFA 4HU9A 3BBYA 5HR0A 1WIKA 2B3SA 4QQ7A 2IMIA 2H6YA 4JR6A 3N5OA 2G0FA 4NHZA 3IAM2 2DKIA 3FK8A 3EINA 5CAXA 2EIQA 4TR3A 1K3LA 2IMDA 4YAVA 2JADA 1XWCA 4ZBAA 2HRAA 2H71A 2MMNA 3GL3A 5H5SA 1TXXA 5H5QA 2JSYA 4WBRD 4F0CA 5JCGA 3BCIA 2IL3A 2K9FA 1UA5A 1SL0B 3TDGA 3R3EA 4EL1A 2X8GA 4IVFA 3LFLA 2YCDA 2PVQA 3C71A 1S3AA 1ABAA 1OYJA 4NV2A 3ZLPA 4OO4A 1K3YA 3CRUA 4X1UA 3G9BA 18GSA 3P8WA 4XS4B 2N5FA 2AB6A 2MMZA 1B9YC 4WR5A 4FIWA 1DUGA 2I1UA 3IDVA 5D96A 3FR6A 3J7Yb 3MAKA 5D93A 4X4JA 4K5SA 1HNAA 1S3DA 2VL9A 4EDYA 3MWHA 16GSA 4XCSA 4WR4A 2YANA 3F4RA 4KNDA 1UVZA 5C04A 4TOPA 3VPTA 1G7OA 2H6XA 5ID2A 1N2AA 1XXUA 4MZBA 1PFOA 2VUPA 3QR6A 1Z3EA 2B5YA 1RW1A 2O87A 3QD9A 4Q5FA 2CVKA 2A4HA 4CY6A 1SJIA 4K7OA 1Q98A 2C4JA 4PX1A 5D9VA 2VCVA 2PU9C 4ML1A 4JZQA 5CYYA 3GX0A 3HJPA 3HZ4A 1EGOA 1USBA 2V2GA 2YPMA 3MDKA 2GSQA 1X9SB 4OFTA 5G5EA 4K6XA 2GT5A 1JFUA 4GXZA 2YWOA 3IK9A 5KEJA 3RBTA 1GSDA 3TJKA 3I69A 2LTKA 1GSFA 3KTBA 1AQVA 3GUSA 3TRXA 1JZOA 1XVQA 1O8WA 4K7IA 4MLYA 1B8XA 3VI7A 1AUCA 1GNEA 4MH2A 3TCOA 2DKHA 2OBIA 1V58A 3KGKA 4TXVA 4HJ2A 2A2PA 1TTZA 4GLTA 1FB6A 3W8SA 2FUG2 3BJ5A 3C1SA 1GP1A 3LGCA 1GLPA 4TXOB 2C0GA 2H72A 4P3YB 2HYXA 1XWAA 3TOUA 3FEUA 3IK7A 3RPNA 3MNGA 4F82A 3DGQA 1PSQA 3HKRA 4G2EA 3VPQA 3LSZA 1TK5B 1YKAA 2H0HA 5D9TA 3DEXA 3DYRA 2E7PA 2H19A 3DD3A 3IV4A 3KCMA 2QA1A 1BX9A 5IOXA 4ML6A 2IFQA 6GSSA 2L4CA 2DC5A 5IPHA 3ERGA 3HY2A 5IO0A 2I9HA 5EY6A 1ERTA 1WE0A 2ES7A 2L6DA 4Q5QA 4MJBA 3O3TA 4HZ2A 4PGTA 4TR1A 1HNCA 3VI5A 1V98A 1YJ6A 5J4UA 4O5QA 4CDOA 1TU7A 2P0GA 1FAAA 3A5WA 1OKTA 5B8BA 1ERWA 3P90A 3NOFA 3F6FA 1ZYEA 3APSA 1KEBA 2V6OA 4IJIA 3M3MA 4Z7XA 1BG5A 3Q74A 2FY6A 1C72A 2H1BA 2KUCA 2OA7A 2I3YA 2GSTA 1VGLA 3L0HA 3GKNA 5ECHB 4ZB9A 1SK0A 5KN0A 5D9XA 2YNXA 3I43A 3LWAA 5ECMB 2B1LA 1M9AA 4KW6A 4YQVA 1A24A 2GQKA 3F4TA 3M1GA 3JCML 5FHIA 3G7IA 2KP1A 2GS3A 4GRFA 2PMTA 4BVYA 1M3IA 3DWVA 1TI3A 1M99A 3CMIA 1MEKA 3IAS2 1T00A 3VURA 3TUEA 1I9DA 4MPFA 3TKSC 4GQFA 5J9CA 2H6ZA 17GSA 3GSTA 1XCCA 1J9BA 2B5XA 1R5PA 1Z9HA 1JLVA 2DJ0A 4IJ3A 3ZTLA 1GRXA 1FO5A 1M3JA 4MABA 3IXRA 2JL4A 3A2XA 4V2LA 1T4ZA 3A3TA 2JACA 1NHYA 3AY8A 1SYXA 1EV9A 4ULXA 3L9UA 4IP6A 4POMA 4I2TA 1B48A 6GSWA 4LMVA 4IKHA 2L6CA 1ERVA 1WPIA 3LJRA 6GSXA 1EV4A 4MZWA 1JHBA 2HSMA 4NV5A 3WGEA 1KNGA 2I81A 2YWIA 3A2WA 1U87A 1EEMA 5CRDA 3RHBA 2H8LA 4O92A 2DBCA 2KLXA 3MIXA 2CT6A 2VD1A
chains in the Genus database with same CATH topology
4OCEA 2WZ9A 5ECNB 1ERUA 2VCTA 2R4VA 1G6YA 1AAZA 5ELGA 5IM9A 3HA9A 3KXOA 4USSA 9GSSA 2TRCP 2DIYA 1QFNA 1M9BA 2MBSA 4OO5A 1TK0B 4DSSB 1VF4A 2YN1A 4EVMA 4JU5A 4ECBA 4QL7A 5GSSA 5HR3A 2WB9A 4F9ZA 4MF6A 5D73A 4RI6A 1W89A 2YOIA 2LJRA 1Z7PA 3KP8A 12GSA 2B5EA 3UARA 4XS1A 5CNWA 3LEFA 1TP9A 3TJFA 4CHSA 5KN2A 1T1VA 2IN3A 2MMAA 4NHWA 1O85A 1PA3A 1SK1A 3A2VA 1I5GA 5IIZA 2WCIA 3GURA 3TJGA 3TKSA 2C1YA 4WBJA 4KUNA 5DQSA 4EKZA 2HE3A 1PX6A 14GSA 5ECKB 5ECPB 3Q18A 5AN1A 5DCGA 1GULA 3D4MA 2H0IA 3VWVA 2GZPA 3HVXA 2QA2A 4BL7A 1ZOFA 1EWXA 2WS2A 1TRUA 3GKMA 3DVXA 4JBBA 2GT6A 2OE3A 5INYA 2HT9A 4HU7A 10GSA 2O89A 2DJ3A 5ABRA 1OC9B 3L78A 1J0FA 1TOFA 2X64A 4J57E 2V41A 3I9V2 1ZYQB 4OCFA 2VLUA 4I8BA 2R6KA 5A5KA 2O85A 4PQHA 5ELAA 1H4OA 2DJ1A 3KZQA 1Z5YE 2HI7A 4LLRA 1SL2B 5DVBA 3HD5A 1ZCPA 1OC8A 2B6MA 2CVDA 3QFBC 2DSAA 3F8UA 2HXKA 5ECOB 2WFCA 2C8UA 1AQWA 3UBKA 1NW2A 2B7KA 1PX7A 1SL1B 4POKA 2XHFA 3LQ7A 1EP7A 1K3OA 1SD9A 1KTEA 4K2XA 5GAPD 4I5QA 4EF0A 2LKUA 4POLA 4Q5NA 3EMXA 4HEA2 1F3AA 22GSA 1ZL9A 4KDYA 1KBNA 1R7HA 2AUVA 2TIRA 1Y6EA 1OE8A 4RUVA 4TVEA 1SKSB 3L9SA 1GTAA 4FQUA 1OKDA 3FY7A 2MBTA 3GNJA 4BWQA 2FNOA 1LU4A 3EWLA 3D4TA 3ERWA 4OFMA 3RPPA 2ON7A 3GX8A 5J3RA 1GUKA 4EDZA 2C3QA 1K0AA 1GUMA 1SU9A 2H1DA 4TKYA 1E2YA 3E9JB 6GSTA 4WEYA 3KP9A 4KDXA 1UN2A 3LORA 4N10A 1V57A 5JCUA 1DE1A 4ACSA 2F3MA 2CZ3A 3GKKA 3IR4A 3UVTA 4NXIA 5A4VA 5EL8A 4IQAA 4MF7A 1QQ2A 4FYUA 3RAZA 3SWLA 5KN1A 4L5LA 2C0FA 5ID2B 2VL2C 1S3CA 1N8JA 3UVHA 3D22A 2IPAA 6GSUA 5D8IA 1QUWA 2PVOC 3KTLA 3VFIA 3KJYA 4WXTA 1GSEA 3G7JA 4HOJA 4K0NA 1BYEA 2LV3A 4XHMA 5GSTA 2RIIA 1THOA 2LUSA 2FHEA 3O6TA 3FR9A 3PR8A 5CREA 7GSSA 4TR4A 4PNGA 1MD4A 2IJYA 1XWBA 4GF0A 3VWXA 4NWYA 4GCIA 2GQLA 2OE1A 2M72A 4O5UA 2VCZA 2F51A 3KM6A 4KAEA 2A2SA 3U6VA 1K0DA 4EE0A 1EOGA 2H75A 5F8BA 2HZFA 4MMMA 2CA8A 1U3IA 5HR2A 3UJ1A 4ZILA 4O32A 1SJZA 1AXDA 4IP1A 4PQ1A 1CQGA 3EU3A 3DVWA 4OD7A 2GQMA 3FRCA 1JLWA 2BMXA 3W8JA 19GSA 1Y25A 3KMNA 3ZVJD 2XC2A 3QPMA 1A2LA 2HFDA 3MYDA 1YEPA 5LCZA 1FOVA 2YP6A 3UEMA 1T3BA 4V1Ap 2CV4A 4Q5RA 4DVCA 3EU4A 3KH9A 3OR5A 4TRXA 2R5GA 3MSZA 2R37A 1PN0A 2IFQB 2CAIA 1IYHA 5DALA 2V6KA 1TRWA 5BMUA 2K8SA 3FR3A 4PUAA 2CX3A 4ZBBA 2TRXA 2RUEA 2ZNMA 3QCPA 1EGRA 3ISOA 4TR1B 2VM2A 2FA4A 3HJMA 2VL2A 4TR0A 3FZAA 4DSQA 3DKSA 1VF2A 5AGYA 3FZ5A 4OMVA 2E0QA 4IHUA 3QDNA 1X9WB 5LNKe 3D6IA 3F3QA 1XOBA 2X49A 1X5EA 4ZB8A 4AJ7A 3TJBA 1GTIA 2RLIA 1IYIA 2L59A 1MTCA 3J7Yk 3KD0A 5LD0A 4GWRA 2QKEA 3H79A 2NTOA 3ME8A 3US3A 4WKWA 3C7MA 3CSHA 3PINA 2KHPA 2VCQA 3U5RE 2WRTA 4LL4B 3LXTA 4I97A 4BVXB 3WGXA 3ZL5A 5ECLB 4G0IA 2FGXA 4IW9A 2REMA 1XWKA 4BVYB 4CY8A 1R4WA 4RQXA 1QGVA 3D5JA 4KDUA 4ZIJA 2JZRA 5DJMA 2V1MA 1TRVA 1GL8A 1GH2A 2AJQB 4GQCA 2H30A 2FWHA 4V1Ag 5HR1A 3LXZA 1A2JA 1FG4A 3TJJA 3ED3A 1XFLA 2UZ8A 1TK8B 4H86A 1R26A 5FWGA 1F3BA 4MK3A 5KOXA 4N30A 2FWGA 2MMOA 4ILFA 4FO5A 2D2ZA 8GSSA 3IHGA 4O5RA 2CZ2A 2NPBA 2GVPA 3FW2A 2AAWA 3HDCA 3BOAA 2K18A 3IE3A 3DMLA 4E8EA 1T8EB 4HDEA 4G0LA 2J23A 4GSSA 2IIYA 3QAVA 2K6VA 4HZ4A 2LRTA 2LSTA 4ZL9A 2C3NA 1H75A 5IMDA 3ERFA 1PQNA 1M2AA 4J2FA 2HZEA 5IMAA 3LYKA 5DAKA 4L0UA 2P5RA 4MA9A 1X5DA 4BWSA 4QL9A 4GSNA 3E0UA 4EXJA 5G30A 2IMKA 2R0GA 3GYKA 3QMXA 5DDLA 4YQMA 3D0ZA 3H93A 4KGIA 1WWJA 2KP2A 3H1NA 4D73A 3F3RA 4HQSA 3UAPA 2GZYA 2LQOA 2P31A 1X0RA 3P2AA 2YV7A 3ZMLA 2FWFA 2AYTA 2X99A 1ZGNA 4MCUA 1UC7A 6GSVA 2CVBA 4KSOA 2OADA 2GSRA 1TDIA 2FLSA 1DSBA 4EC0A 4ZL7A 2XBQA 1YY7A 5B8AA 3GFKA 1FW1A 3Q19A 3NZNA 2N5AA 4K2DA 4YQUA 3CSIA 5B6NA 5G31A 4ZBDA 1HQOA 3EVIA 3PH9A 3CBUA 4G10A 3F6DA 5EVOA 1GNWA 1XW9A 2WULA 3GA4A 3ZREA 4F03A 2RUFA 4HS1A 3QAGA 4MPGA 1GSUA 3TKQA 3GTUB 3EE2A 4IQ1A 1AIUA 2A4VA 3VWUA 3GN3A 3F63A 2VCWA 1PRXA 3IHQA 5L71A 3P7XA 2KOKA 2BTOT 1GTBA 2GLRA 5A4UA 3ZFLA 3S9FA 1ZYNA 1O6JA 4K7NA 2LNSA 1TRSA 4K0GA 3FHKA 2C0DA 2CQ9A 3EC3A 4L5OA 5IOWA 2VL3A 4DSSA 3HYPA 2Z9SA 2WGRA 1X9MB 2G2QA 1NSWA 3HXSA 4HJMA 2DMMA 20GSA 5ECQB 2O8VB 5IMVA 5KN3A 1FOHA 1O81A 3KH7A 4JRRA 1PKZA 1PGTA 4XIHA 1AQXA 1ILOA 4NAXA 3FYGA 2FA8A 5DCHA 2QGVA 2L5OA 2H1GA 2PERA 1FB0A 4JE1A 3GV1A 3L4NA 3ZFBA 4IGJA 3RDWA 3GRXA 3N9JA 2F9SA 1A0RP 1ACVA 1PMTA 11GSA 4N0VA 2HRNA 3C8EA 2JZSA 3RHCA 4PUFC 2J9HA 6GSYA 2YWNA 4NPBA 4TW5A 2OJLA 4MP4A 4PQIA 2NVLA 1V2AA 2VLVA 3CTGA 4XRDA 4MZCA 1O8XA 5BRTA 2R0CA 3HVVA 4N11A 2JU5A 1AC1A 1TJDA 2K8VA 4L8EA 2LJAA 5HFKA 1GLQA 4V2MA 3L9VA 3C1RA 2HLSA 4ZXGA 2LRCA 1ML6A 2PWJA 2QC7A 5C00A 4MJEA 4ECIA 1NHOA 2XPEA 4WF4A 5IQYA 3WYWA 5JCWA 4PURA 1SD8A 1TW9A 2YZHA 3APQA 1K0NA 3HJOA 2IMFA 5JWOB 3M8NA 1XBSA 4KX4A 4ZL8A 4NMUA 2EC4A 1B4QA 5J41A 1SK2A 1F9MA 3WT1A 1BEDA 4PNFA 5DBQA 4KB3A 5F06A 3SBCA 1OE7A 1BQ7A 1BJXA 2VLTA 4ID0A 4MDCA 4FYCA 1K0OA 4K9ZA 3ZYWA 1JZDA 3FZ4A 4LL1B 1XW5A 2L4QA 2VIMA 4CW9A 4HI7A 5FT3A 3F4SA 4K8MA 2PGTA 1PD21 4O7HA 3LG6A 2PUKC 1SJ6A 3K8NA 1E6BA 4EO3A 3ZITA 1K0CA 1GSSA 3TRPA 1HNBA 3I6AA 3O76A 2JZTA 4YKFA 3TKSE 4EUYA 1U88A 4ECCA 2OKAA 1MDJA 4OWYA 4LA1A 2LJKA 1JZRA 4MNNA 5CRGA 3QFAC 2PPTA 4V2NA 5AISA 2HSHA 3IPZA 2H0GA 4EIQA 3IA1A 1X5CA 2AV4A 5A4WA 1Z6MA 4WETA 3C73A 3GHAA 1J08A 3GIXA 3CYNA 5B6MA 2VCXA 1FHEA 2L57A 3IC4A 5IMZA 2H74A 2M80A 2OBKA 2H1AA 3CRTA 1YF1A 3EYTA 1MDKA 4XS4A 1PN9A 4YH2A 4EIPA 1A2MA 4KF9A 4G19A 1B4PA 5DALB 3TOTA 3UOMA 4YAPA 1MDIA 1TU8A 2C0EA 2I4AA 1T4YA 1PKWA 3ZRDA 1WRYA 1YF0A 2L5LA 5IMCA 4L0WA 5G2ZA 3D21A 1V40A 4Z2RA 2VO4A 3A5IA 1K0BA 1M2DA 1WJKA 3Q6OA 4MF5A 4OFNA 4PXOA 2CX4A 1VRSD 3TKPA 3GSSA 2M46A 1Z7RA 1TKDB 5F05A 1FVKA 2EIRA 2YJHA 2DLXA 5G5FA 3CXGA 1EOHA 2C80A 1DE2A 3TRQA 3WT2A 4RI7A 3ZVJA 1GSYA 3IOSA 2N5BA 4RQRA 3FMWA 2HRKA 1B9XC 4KE3A 2XBIA 1JZWA 2F8AA 1M7TA 2BJXA 4K1FA 2EIOA 2HRFA 2A2RA 5B7CA 2LNTA 4GSTA 2XPDA 4LMWA 1SKWB 1QMVA 4AJ6A 4BPYA 1SENA 3EMPA 2H76A 5ECRB 1ZZYA 2X4AA 3FKFA 3M9JA 5J9BA 2FD3A 4KA0A 1XW6A 5HFGA 1BAYA 5GAND 1PL1A 3QAWA 3M0FA 2FWEA 1SKRB 1YDKA 4JEDA 3E3EA 2E2GA 3LW9A 1XPVA 3DRNA 1YZXA 1SYRA 5CRWA 1ST9A 2MYGA 4TXOA 4XTSA 5J5NA 3GMFA 5DQYA 1F2EA 5CP1A 3HVSA 2X8HA 5CO3A 2X8CA 2PBJA 2GTUA 2CAQA 3EURA 3UMAA 13GSA 4ICYA 5IMFA 1EP8A 2H01A 2OE0A 1PL2A 5DJLA 4F0BA 2JSZA 3BCKA 4E8HA 3DXBA 5F07A 5AIVA 2GZZA 5E59A 5ENUA 2YV9A 2HZEB 4JR4A 5DAKB 1O7UA 5F0GA 3KEBA 4G0KA 5HQPA 4I6XA 2R0PA 4BVXA 2WDUA 1HYUA 5JWRB 2LRNA 1LJRA 2ZCTA 4DEJA 4BA7A 1OC3A 3ZIJA 4D73B 4IELA 1M2BA 2PN8A 4HUAA 2GDRA 2B1KA 1QXHA 3UIWA 2OACA 3GH6A 3GKXA 2HSYA 1U3AA 5HFIA 3VK9A 1DBYA 2V32A 1XIYA 2IMEA 4G9HA 4XS6A 3DIEA 2C3TA 2P5QA 1Z6NA 4ISDA 5COHA 5D9WA 1G6WA 4YKGA 5H5RA 2LS5A 4X43A 1NM3A 4DSRA 2YJ7A 1W4VA 5IO2A 3W6GA 1Q4JA 1RQMA 4GTUA 2IWTA 1A23A 1MD3A 1ZYPA 4AGSA 1EEJA 4MJAA 4KH7A 2ZUPA 1AW9A 1T7PB 1YEXA 4MH3A 4IN0A 1F37A 3TKRA 3HCZA 1A8LA 4PTSA 2RM5A 3UL3A 4WF5A 1R5AA 1TI1A 1G0TA 3HHVA 3F0IA 3PPUA 4KCEA 2R2JA 1WMJA 3BD2A 1U6TA 1WOUA 4FYBA 4J56E 1THXA 2LEGA 2DMLA 2GGTA 2GSSA 4XRAA 1GTUA 4Z2UA 2VAFA 3H4KA 3WGDA 4ZB6A 5E4WA 3ZIVA 1LBKA 2DJ2A 1RK4A 4AF2A 3G7YA 4BL7B 3LYPA 1ZMAA 1YKCA 2HNLA 3APOA 4F2IA 2YWMA 1A0FA 2VM1A 5AIXA 1XOAA 2FCHA 5GZZB 3IC8A 4K5RA 1G7EA 5G1LA 2F8FA 2RM6A 4KSMA 1GUHA 3HZ8A 1O73A 3GH9A 2R3XA 1M0UA 3GL5A 2DJJA 4IS0A 3FZ9A 3VLNA 2E2MA 2O7KA 4IBPA 5JWQB 1WP0A 1OAZA 4A5PA 2MZCA 1XVWA 4N0ZA 1GWCA 1F6MC 4MJCA 4HQZA 2QSIA 4ECJA 3KMOA 3R2QA 2NBSA 2H73A 3V1WA 1OVNA 3H8QA 3TB2A 4X0XA 1FVJA 1V9WA 3GTUA 2AHEA 4POBA 4TN8A 4AJ8A 1EZKA 1QK8A 1XWGA 2DIZA 2H70A 2NDOA 3TGZA 3ZMKA 3M9KA 4Z2TA 3ME7A 3KIJA 3IBHA 4KCAA 2ALBA 4FH8A 1VF1A 2WJUA 1GSQA 3CSJA 3PGTA 3EPTA 1YQ1A 2YZUA 3QOUA 3ZZXA 2DJKA 3UBLA 3IRAA 1A8YA 2ON5A 5CRHA 1HD2A 2LQQA 5KOWA 1VF3A 2VOCA 3F9UA 2VD0A 1CQHA 5ECIB 3VWWA 3WD6A 5ECSA 3NIVA 1XZOA 3CTFA 2H66A 1ON4A 1OC9A 2B7JA 4I2UA 5IPGA 1K0MA 5G1KA 1URMA 5EPFA 4HU9A 3BBYA 5HR0A 1WIKA 2B3SA 4QQ7A 2IMIA 2H6YA 4JR6A 3N5OA 2G0FA 4NHZA 3IAM2 2DKIA 3FK8A 3EINA 5CAXA 2EIQA 4TR3A 1K3LA 2IMDA 4YAVA 2JADA 1XWCA 4ZBAA 2HRAA 2H71A 2MMNA 3GL3A 5H5SA 1TXXA 5H5QA 2JSYA 4WBRD 4F0CA 5JCGA 3BCIA 2IL3A 2K9FA 1UA5A 1SL0B 3TDGA 3R3EA 4EL1A 2X8GA 4IVFA 3LFLA 2YCDA 2PVQA 3C71A 1S3AA 1ABAA 1OYJA 4NV2A 3ZLPA 4OO4A 1K3YA 3CRUA 4X1UA 3G9BA 18GSA 3P8WA 4XS4B 2N5FA 2AB6A 2MMZA 1B9YC 4WR5A 4FIWA 1DUGA 2I1UA 3IDVA 5D96A 3FR6A 3J7Yb 3MAKA 5D93A 4X4JA 4K5SA 1HNAA 1S3DA 2VL9A 4EDYA 3MWHA 16GSA 4XCSA 4WR4A 2YANA 3F4RA 4KNDA 1UVZA 5C04A 4TOPA 3VPTA 1G7OA 2H6XA 5ID2A 1N2AA 1XXUA 4MZBA 2VUPA 3QR6A 1Z3EA 2B5YA 1RW1A 2O87A 3QD9A 4Q5FA 2CVKA 2A4HA 4CY6A 1SJIA 4K7OA 1Q98A 2C4JA 4PX1A 5D9VA 2VCVA 2PU9C 4ML1A 4JZQA 5CYYA 3GX0A 3HJPA 3HZ4A 1EGOA 1USBA 2V2GA 2YPMA 3MDKA 2GSQA 1X9SB 4OFTA 5G5EA 4K6XA 2GT5A 1JFUA 4GXZA 2YWOA 3IK9A 5KEJA 3RBTA 1GSDA 3TJKA 3I69A 2LTKA 1GSFA 3KTBA 1AQVA 3GUSA 3TRXA 1JZOA 1XVQA 1O8WA 4K7IA 4MLYA 1B8XA 3VI7A 1AUCA 1GNEA 4MH2A 3TCOA 2DKHA 2OBIA 1V58A 3KGKA 4TXVA 4HJ2A 2A2PA 1TTZA 4GLTA 1FB6A 3W8SA 2FUG2 3BJ5A 3C1SA 1GP1A 3LGCA 1GLPA 4TXOB 2C0GA 2H72A 4P3YB 2HYXA 1XWAA 3TOUA 3FEUA 3IK7A 3RPNA 3MNGA 4F82A 3DGQA 1PSQA 3HKRA 4G2EA 3VPQA 3LSZA 1TK5B 1YKAA 2H0HA 5D9TA 3DEXA 3DYRA 2E7PA 2H19A 3DD3A 3IV4A 3KCMA 2QA1A 1BX9A 5IOXA 4ML6A 2IFQA 6GSSA 2L4CA 2DC5A 5IPHA 3ERGA 3HY2A 5IO0A 2I9HA 5EY6A 1ERTA 1WE0A 2ES7A 2L6DA 4Q5QA 4MJBA 3O3TA 4HZ2A 4PGTA 4TR1A 1HNCA 3VI5A 1V98A 1YJ6A 5J4UA 4O5QA 4CDOA 1TU7A 2P0GA 1FAAA 3A5WA 1OKTA 5B8BA 1ERWA 3P90A 3NOFA 3F6FA 1ZYEA 3APSA 1KEBA 2V6OA 4IJIA 3M3MA 4Z7XA 1BG5A 3Q74A 2FY6A 1C72A 2H1BA 2KUCA 2OA7A 2I3YA 2GSTA 1VGLA 3L0HA 3GKNA 5ECHB 4ZB9A 1SK0A 5KN0A 5D9XA 2YNXA 3I43A 3LWAA 5ECMB 2B1LA 1M9AA 4KW6A 4YQVA 1A24A 2GQKA 3F4TA 3M1GA 3JCML 5FHIA 3G7IA 2KP1A 2GS3A 4GRFA 2PMTA 4BVYA 3DWVA 1TI3A 1M99A 3CMIA 1MEKA 3IAS2 1T00A 3VURA 3TUEA 1I9DA 4MPFA 3TKSC 4GQFA 5J9CA 2H6ZA 17GSA 3GSTA 1XCCA 1J9BA 2B5XA 1R5PA 1Z9HA 1JLVA 2DJ0A 4IJ3A 3ZTLA 1GRXA 1FO5A 4MABA 3IXRA 2JL4A 3A2XA 4V2LA 1T4ZA 3A3TA 2JACA 1NHYA 3AY8A 1SYXA 1EV9A 4ULXA 3L9UA 4IP6A 4POMA 4I2TA 1B48A 6GSWA 4LMVA 4IKHA 2L6CA 1ERVA 1WPIA 3LJRA 6GSXA 1EV4A 4MZWA 1JHBA 2HSMA 4NV5A 3WGEA 1KNGA 2I81A 2YWIA 3A2WA 1U87A 1EEMA 5CRDA 3RHBA 2H8LA 4O92A 2DBCA 2KLXA 3MIXA 2CT6A 2VD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OCE A;  2WZ9 A;  5ECN B;  1ERU A;  2VCT A;  2R4V A;  1G6Y A;  1AAZ A;  5ELG A;  5IM9 A;  3HA9 A;  3KXO A;  9GSS A;  2TRC P;  2DIY A;  1QFN A;  1M9B A;  2MBS A;  4OO5 A;  1TK0 B;  4DSS B;  1VF4 A;  2YN1 A;  4EVM A;  4JU5 A;  4ECB A;  4QL7 A;  5GSS A;  5HR3 A;  2WB9 A;  4F9Z A;  4MF6 A;  5D73 A;  4RI6 A;  1W89 A;  2YOI A;  2LJR A;  1Z7P A;  3KP8 A;  12GS A;  2B5E A;  3UAR A;  4XS1 A;  5CNW A;  3LEF A;  1TP9 A;  3TJF A;  4CHS A;  5KN2 A;  1T1V A;  2IN3 A;  2MMA A;  4NHW A;  1O85 A;  1PA3 A;  1SK1 A;  3A2V A;  1I5G A;  5IIZ A;  2WCI A;  3GUR A;  3TJG A;  3TKS A;  2C1Y A;  4WBJ A;  4KUN A;  5DQS A;  4EKZ A;  2HE3 A;  1PX6 A;  14GS A;  5ECK B;  5ECP B;  3Q18 A;  5AN1 A;  5DCG A;  1GUL A;  3D4M A;  2H0I A;  3VWV A;  2GZP A;  3HVX A;  4BL7 A;  1ZOF A;  1EWX A;  2WS2 A;  1TRU A;  3GKM A;  3DVX A;  4JBB A;  2GT6 A;  2OE3 A;  5INY A;  2HT9 A;  4HU7 A;  10GS A;  2O89 A;  2DJ3 A;  5ABR A;  1OC9 B;  3L78 A;  1J0F A;  1TOF A;  2X64 A;  4J57 E;  2V41 A;  3I9V 2;  1ZYQ B;  4OCF A;  2VLU A;  4I8B A;  2R6K A;  5A5K A;  2O85 A;  4PQH A;  5ELA A;  1H4O A;  2DJ1 A;  3KZQ A;  1Z5Y E;  2HI7 A;  4LLR A;  1SL2 B;  5DVB A;  3HD5 A;  1ZCP A;  1OC8 A;  2B6M A;  2CVD A;  3QFB C;  2DSA A;  3F8U A;  2HXK A;  5ECO B;  2WFC A;  2C8U A;  1AQW A;  3UBK A;  1NW2 A;  2B7K A;  1PX7 A;  1SL1 B;  4POK A;  2XHF A;  3LQ7 A;  1EP7 A;  1K3O A;  1SD9 A;  1KTE A;  5GAP D;  4I5Q A;  4EF0 A;  2LKU A;  4POL A;  4Q5N A;  3EMX A;  4HEA 2;  1F3A A;  22GS A;  1ZL9 A;  4KDY A;  1KBN A;  1R7H A;  2AUV A;  2TIR A;  1Y6E A;  1OE8 A;  4RUV A;  4TVE A;  1SKS B;  3L9S A;  1GTA A;  1OKD A;  3FY7 A;  2MBT A;  3GNJ A;  4BWQ A;  2FNO A;  1LU4 A;  3EWL A;  3D4T A;  3ERW A;  4OFM A;  3RPP A;  2ON7 A;  3GX8 A;  5J3R A;  1GUK A;  4EDZ A;  2C3Q A;  1K0A A;  1GUM A;  1SU9 A;  2H1D A;  4TKY A;  1E2Y A;  3E9J B;  6GST A;  4WEY A;  3KP9 A;  4KDX A;  1UN2 A;  3LOR A;  4N10 A;  1V57 A;  5JCU A;  1DE1 A;  4ACS A;  2F3M A;  2CZ3 A;  3GKK A;  3IR4 A;  3UVT A;  4NXI A;  5A4V A;  5EL8 A;  4IQA A;  4MF7 A;  1QQ2 A;  4FYU A;  3RAZ A;  3SWL A;  5KN1 A;  4L5L A;  2C0F A;  5ID2 B;  2VL2 C;  1S3C A;  1N8J A;  3UVH A;  3D22 A;  2IPA A;  6GSU A;  5D8I A;  1QUW A;  2PVO C;  3KTL A;  3VFI A;  3KJY A;  4WXT A;  1GSE A;  3G7J A;  4HOJ A;  4K0N A;  1BYE A;  2LV3 A;  4XHM A;  5GST A;  2RII A;  1THO A;  2LUS A;  2FHE A;  3O6T A;  3FR9 A;  3PR8 A;  5CRE A;  7GSS A;  4TR4 A;  4PNG A;  1MD4 A;  2IJY A;  1XWB A;  4GF0 A;  3VWX A;  4NWY A;  4GCI A;  2GQL A;  2OE1 A;  2M72 A;  2VCZ A;  2F51 A;  3KM6 A;  4KAE A;  2A2S A;  3U6V A;  1K0D A;  4EE0 A;  1EOG A;  2H75 A;  5F8B A;  2HZF A;  4MMM A;  2CA8 A;  1U3I A;  5HR2 A;  3UJ1 A;  4ZIL A;  4O32 A;  1SJZ A;  1AXD A;  4IP1 A;  4PQ1 A;  1CQG A;  3EU3 A;  3DVW A;  4OD7 A;  2GQM A;  3FRC A;  1JLW A;  2BMX A;  3W8J A;  19GS A;  1Y25 A;  3KMN A;  3ZVJ D;  2XC2 A;  3QPM A;  1A2L A;  2HFD A;  1YEP A;  5LCZ A;  1FOV A;  2YP6 A;  3UEM A;  1T3B A;  4V1A p;  2CV4 A;  4Q5R A;  4DVC A;  3EU4 A;  3KH9 A;  3OR5 A;  4TRX A;  2R5G A;  3MSZ A;  2R37 A;  2IFQ B;  2CAI A;  1IYH A;  5DAL A;  2V6K A;  1TRW A;  2K8S A;  3FR3 A;  4PUA A;  2CX3 A;  4ZBB A;  2TRX A;  2RUE A;  2ZNM A;  3QCP A;  1EGR A;  3ISO A;  4TR1 B;  2VM2 A;  2FA4 A;  3HJM A;  2VL2 A;  4TR0 A;  3FZA A;  4DSQ A;  3DKS A;  1VF2 A;  5AGY A;  3FZ5 A;  4OMV A;  2E0Q A;  4IHU A;  3QDN A;  1X9W B;  5LNK e;  3D6I A;  3F3Q A;  1XOB A;  1X5E A;  4ZB8 A;  4AJ7 A;  3TJB A;  1GTI A;  2RLI A;  1IYI A;  2L59 A;  1MTC A;  3J7Y k;  3KD0 A;  5LD0 A;  4GWR A;  2QKE A;  3H79 A;  2NTO A;  3ME8 A;  3US3 A;  4WKW A;  3C7M A;  3CSH A;  3PIN A;  2KHP A;  2VCQ A;  3U5R E;  2WRT A;  4LL4 B;  3LXT A;  4I97 A;  3WGX A;  3ZL5 A;  5ECL B;  2FGX A;  4IW9 A;  2REM A;  1XWK A;  1R4W A;  4RQX A;  1QGV A;  3D5J A;  4KDU A;  4ZIJ A;  2JZR A;  5DJM A;  2V1M A;  1TRV A;  1GL8 A;  1GH2 A;  2AJQ B;  4GQC A;  2H30 A;  2FWH A;  4V1A g;  5HR1 A;  3LXZ A;  1A2J A;  1FG4 A;  3TJJ A;  3ED3 A;  1XFL A;  1TK8 B;  4H86 A;  1R26 A;  5FWG A;  1F3B A;  4MK3 A;  4N30 A;  2FWG A;  2MMO A;  4ILF A;  4FO5 A;  2D2Z A;  8GSS A;  4O5R A;  2CZ2 A;  2NPB A;  2GVP A;  3FW2 A;  2AAW A;  3HDC A;  3BOA A;  2K18 A;  3IE3 A;  3DML A;  4E8E A;  1T8E B;  4HDE A;  2J23 A;  4GSS A;  2IIY A;  3QAV A;  2K6V A;  4HZ4 A;  2LRT A;  2LST A;  4ZL9 A;  2C3N A;  1H75 A;  5IMD A;  3ERF A;  1PQN A;  1M2A A;  4J2F A;  2HZE A;  5IMA A;  3LYK A;  5DAK A;  4L0U A;  2P5R A;  4MA9 A;  1X5D A;  4BWS A;  4QL9 A;  4GSN A;  3E0U A;  4EXJ A;  5G30 A;  2IMK A;  3GYK A;  3QMX A;  5DDL A;  4YQM A;  3D0Z A;  3H93 A;  4KGI A;  1WWJ A;  2KP2 A;  3H1N A;  4D73 A;  3F3R A;  4HQS A;  3UAP A;  2GZY A;  2LQO A;  2P31 A;  1X0R A;  3P2A A;  2YV7 A;  3ZML A;  2FWF A;  2AYT A;  2X99 A;  1ZGN A;  4MCU A;  1UC7 A;  6GSV A;  2CVB A;  4KSO A;  2OAD A;  2GSR A;  1TDI A;  2FLS A;  1DSB A;  4EC0 A;  4ZL7 A;  2XBQ A;  1YY7 A;  5B8A A;  3GFK A;  1FW1 A;  3Q19 A;  3NZN A;  2N5A A;  4K2D A;  4YQU A;  3CSI A;  5B6N A;  5G31 A;  4ZBD A;  1HQO A;  3EVI A;  3PH9 A;  3CBU A;  4G10 A;  3F6D A;  5EVO A;  1GNW A;  1XW9 A;  2WUL A;  3GA4 A;  3ZRE A;  4F03 A;  2RUF A;  4HS1 A;  3QAG A;  4MPG A;  1GSU A;  3TKQ A;  3GTU B;  3EE2 A;  4IQ1 A;  1AIU A;  2A4V A;  3VWU A;  3GN3 A;  3F63 A;  2VCW A;  1PRX A;  3IHQ A;  5L71 A;  3P7X A;  2KOK A;  2BTO T;  1GTB A;  2GLR A;  5A4U A;  3ZFL A;  3S9F A;  1O6J A;  4K7N A;  2LNS A;  1TRS A;  4K0G A;  3FHK A;  2C0D A;  2CQ9 A;  3EC3 A;  4L5O A;  5IOW A;  2VL3 A;  4DSS A;  3HYP A;  2Z9S A;  2WGR A;  1X9M B;  2G2Q A;  1NSW A;  3HXS A;  4HJM A;  2DMM A;  20GS A;  5ECQ B;  2O8V B;  5IMV A;  5KN3 A;  1O81 A;  3KH7 A;  4JRR A;  1PKZ A;  1PGT A;  4XIH A;  1AQX A;  1ILO A;  4NAX A;  3FYG A;  2FA8 A;  5DCH A;  2QGV A;  2L5O A;  2H1G A;  2PER A;  1FB0 A;  4JE1 A;  3GV1 A;  3L4N A;  3ZFB A;  4IGJ A;  3RDW A;  3GRX A;  3N9J A;  2F9S A;  1A0R P;  1ACV A;  1PMT A;  11GS A;  4N0V A;  2HRN A;  3C8E A;  2JZS A;  3RHC A;  4PUF C;  2J9H A;  6GSY A;  2YWN A;  4NPB A;  4TW5 A;  2OJL A;  4MP4 A;  4PQI A;  2NVL A;  1V2A A;  2VLV A;  3CTG A;  4XRD A;  4MZC A;  1O8X A;  3HVV A;  4N11 A;  2JU5 A;  1AC1 A;  1TJD A;  2K8V A;  4L8E A;  2LJA A;  5HFK A;  1GLQ A;  4V2M A;  3L9V A;  3C1R A;  2HLS A;  4ZXG A;  2LRC A;  1ML6 A;  2PWJ A;  2QC7 A;  5C00 A;  4MJE A;  4ECI A;  1NHO A;  2XPE A;  4WF4 A;  5IQY A;  3WYW A;  5JCW A;  4PUR A;  1SD8 A;  1TW9 A;  2YZH A;  3APQ A;  1K0N A;  3HJO A;  2IMF A;  5JWO B;  3M8N A;  1XBS A;  4KX4 A;  4ZL8 A;  4NMU A;  2EC4 A;  1B4Q A;  5J41 A;  1SK2 A;  1F9M A;  3WT1 A;  1BED A;  4PNF A;  5DBQ A;  4KB3 A;  5F06 A;  3SBC A;  1OE7 A;  1BQ7 A;  1BJX A;  2VLT A;  4ID0 A;  4MDC A;  4FYC A;  1K0O A;  4K9Z A;  3ZYW A;  1JZD A;  3FZ4 A;  4LL1 B;  1XW5 A;  2L4Q A;  2VIM A;  4CW9 A;  4HI7 A;  5FT3 A;  3F4S A;  4K8M A;  2PGT A;  1PD2 1;  4O7H A;  3LG6 A;  2PUK C;  1SJ6 A;  3K8N A;  1E6B A;  4EO3 A;  3ZIT A;  1K0C A;  1GSS A;  3TRP A;  1HNB A;  3I6A A;  3O76 A;  2JZT A;  3TKS E;  4EUY A;  1U88 A;  4ECC A;  2OKA A;  1MDJ A;  4OWY A;  4LA1 A;  2LJK A;  1JZR A;  5CRG A;  3QFA C;  2PPT A;  4V2N A;  5AIS A;  2HSH A;  3IPZ A;  2H0G A;  3IA1 A;  1X5C A;  2AV4 A;  5A4W A;  1Z6M A;  4WET A;  3C73 A;  3GHA A;  1J08 A;  3GIX A;  3CYN A;  5B6M A;  2VCX A;  1FHE A;  2L57 A;  3IC4 A;  5IMZ A;  2H74 A;  2M80 A;  2OBK A;  2H1A A;  3CRT A;  1YF1 A;  3EYT A;  1MDK A;  4XS4 A;  1PN9 A;  4YH2 A;  1A2M A;  4G19 A;  1B4P A;  5DAL B;  3TOT A;  3UOM A;  4YAP A;  1MDI A;  1TU8 A;  2C0E A;  2I4A A;  1T4Y A;  1PKW A;  3ZRD A;  1WRY A;  1YF0 A;  2L5L A;  5IMC A;  4L0W A;  5G2Z A;  3D21 A;  1V40 A;  2VO4 A;  1K0B A;  1M2D A;  1WJK A;  3Q6O A;  4MF5 A;  4OFN A;  4PXO A;  2CX4 A;  1VRS D;  3TKP A;  3GSS A;  2M46 A;  1Z7R A;  1TKD B;  5F05 A;  1FVK A;  2EIR A;  2YJH A;  2DLX A;  5G5F A;  3CXG A;  1EOH A;  2C80 A;  1DE2 A;  3TRQ A;  3WT2 A;  4RI7 A;  3ZVJ A;  1GSY A;  3IOS A;  2N5B A;  4RQR A;  1B9X C;  2XBI A;  1JZW A;  4KE3 A;  2F8A A;  1M7T A;  2BJX A;  4K1F A;  2EIO A;  2HRF A;  2A2R A;  5B7C A;  2LNT A;  4GST A;  2XPD A;  4LMW A;  1SKW B;  1QMV A;  4AJ6 A;  4BPY A;  1SEN A;  3EMP A;  2H76 A;  5ECR B;  1ZZY A;  3FKF A;  3M9J A;  5J9B A;  2FD3 A;  4KA0 A;  1XW6 A;  5HFG A;  1BAY A;  5GAN D;  1PL1 A;  3QAW A;  3M0F A;  2FWE A;  1SKR B;  1YDK A;  4JED A;  3E3E A;  2E2G A;  1XPV A;  3DRN A;  1YZX A;  1SYR A;  5CRW A;  1ST9 A;  2MYG A;  4TXO A;  4XTS A;  5J5N A;  3GMF A;  5DQY A;  1F2E A;  5CP1 A;  3HVS A;  2X8H A;  5CO3 A;  2X8C A;  2PBJ A;  2GTU A;  2CAQ A;  3EUR A;  3UMA A;  13GS A;  5IMF A;  1EP8 A;  2H01 A;  2OE0 A;  1PL2 A;  5DJL A;  4F0B A;  2JSZ A;  3BCK A;  4E8H A;  3DXB A;  5F07 A;  5AIV A;  2GZZ A;  5E59 A;  5ENU A;  2YV9 A;  2HZE B;  4JR4 A;  5DAK B;  1O7U A;  5F0G A;  3KEB A;  5HQP A;  4I6X A;  4BVX A;  2WDU A;  1HYU A;  5JWR B;  2LRN A;  1LJR A;  2ZCT A;  4DEJ A;  4BA7 A;  1OC3 A;  3ZIJ A;  4D73 B;  4IEL A;  1M2B A;  2PN8 A;  4HUA A;  2GDR A;  2B1K A;  1QXH A;  3UIW A;  2OAC A;  3GH6 A;  3GKX A;  2HSY A;  1U3A A;  5HFI A;  3VK9 A;  1DBY A;  2V32 A;  1XIY A;  2IME A;  4G9H A;  4XS6 A;  3DIE A;  2C3T A;  2P5Q A;  1Z6N A;  4ISD A;  5COH A;  5D9W A;  1G6W A;  5H5R A;  2LS5 A;  4X43 A;  1NM3 A;  4DSR A;  2YJ7 A;  1W4V A;  5IO2 A;  3W6G A;  1Q4J A;  1RQM A;  4GTU A;  2IWT A;  1A23 A;  1MD3 A;  4AGS A;  1EEJ A;  4MJA A;  4KH7 A;  2ZUP A;  1AW9 A;  1T7P B;  1YEX A;  4MH3 A;  4IN0 A;  1F37 A;  3TKR A;  3HCZ A;  1A8L A;  2RM5 A;  3UL3 A;  4WF5 A;  1R5A A;  1TI1 A;  1G0T A;  3HHV A;  3F0I A;  4KCE A;  2R2J A;  1WMJ A;  3BD2 A;  1U6T A;  1WOU A;  4FYB A;  4J56 E;  1THX A;  2LEG A;  2DML A;  2GGT A;  2GSS A;  4XRA A;  1GTU A;  2VAF A;  3H4K A;  3WGD A;  4ZB6 A;  5E4W A;  3ZIV A;  1LBK A;  2DJ2 A;  1RK4 A;  4AF2 A;  3G7Y A;  3LYP A;  1ZMA A;  1YKC A;  2HNL A;  3APO A;  4F2I A;  2YWM A;  1A0F A;  2VM1 A;  5AIX A;  1XOA A;  2FCH A;  5GZZ B;  1G7E A;  5G1L A;  2F8F A;  2RM6 A;  4KSM A;  1GUH A;  3HZ8 A;  1O73 A;  3GH9 A;  2R3X A;  1M0U A;  3GL5 A;  2DJJ A;  4IS0 A;  3FZ9 A;  3VLN A;  2E2M A;  2O7K A;  4IBP A;  5JWQ B;  1WP0 A;  1OAZ A;  2MZC A;  1XVW A;  4N0Z A;  1GWC A;  1F6M C;  4MJC A;  4HQZ A;  2QSI A;  4ECJ A;  3KMO A;  3R2Q A;  2NBS A;  2H73 A;  3V1W A;  1OVN A;  3H8Q A;  3TB2 A;  4X0X A;  1FVJ A;  1V9W A;  3GTU A;  2AHE A;  4POB A;  4TN8 A;  4AJ8 A;  1EZK A;  1QK8 A;  1XWG A;  2DIZ A;  2H70 A;  2NDO A;  3TGZ A;  3ZMK A;  3M9K A;  3ME7 A;  3KIJ A;  3IBH A;  4KCA A;  2ALB A;  4FH8 A;  1VF1 A;  2WJU A;  1GSQ A;  3CSJ A;  3PGT A;  1YQ1 A;  2YZU A;  3QOU A;  3ZZX A;  2DJK A;  3UBL A;  3IRA A;  1A8Y A;  2ON5 A;  5CRH A;  1HD2 A;  2LQQ A;  1VF3 A;  2VOC A;  3F9U A;  2VD0 A;  1CQH A;  5ECI B;  3VWW A;  3WD6 A;  5ECS A;  3NIV A;  1XZO A;  3CTF A;  2H66 A;  1ON4 A;  1OC9 A;  2B7J A;  4I2U A;  5IPG A;  1K0M A;  5G1K A;  1URM A;  5EPF A;  4HU9 A;  3BBY A;  5HR0 A;  1WIK A;  2B3S A;  4QQ7 A;  2IMI A;  2H6Y A;  4JR6 A;  3N5O A;  2G0F A;  4NHZ A;  3IAM 2;  3FK8 A;  3EIN A;  5CAX A;  2EIQ A;  4TR3 A;  1K3L A;  2IMD A;  4YAV A;  2JAD A;  1XWC A;  4ZBA A;  2H71 A;  2MMN A;  3GL3 A;  5H5S A;  1TXX A;  5H5Q A;  2JSY A;  4WBR D;  4F0C A;  5JCG A;  3BCI A;  2IL3 A;  2K9F A;  1UA5 A;  1SL0 B;  3TDG A;  4EL1 A;  2X8G A;  4IVF A;  3LFL A;  2YCD A;  2PVQ A;  3C71 A;  1S3A A;  1ABA A;  1OYJ A;  4NV2 A;  3ZLP A;  4OO4 A;  1K3Y A;  3CRU A;  4X1U A;  3G9B A;  18GS A;  3P8W A;  4XS4 B;  2N5F A;  2AB6 A;  2MMZ A;  1B9Y C;  4WR5 A;  4FIW A;  1DUG A;  2I1U A;  3IDV A;  5D96 A;  3FR6 A;  3J7Y b;  3MAK A;  5D93 A;  1HNA A;  1S3D A;  2VL9 A;  4EDY A;  3MWH A;  16GS A;  4XCS A;  4WR4 A;  2YAN A;  3F4R A;  4KND A;  1UVZ A;  5C04 A;  4TOP A;  3VPT A;  1G7O A;  2H6X A;  5ID2 A;  1N2A A;  1XXU A;  4MZB A;  2VUP A;  3QR6 A;  1Z3E A;  2B5Y A;  1RW1 A;  2O87 A;  3QD9 A;  4Q5F A;  2CVK A;  1SJI A;  4K7O A;  1Q98 A;  2C4J A;  4PX1 A;  5D9V A;  2VCV A;  2PU9 C;  4ML1 A;  4JZQ A;  5CYY A;  3GX0 A;  3HJP A;  3HZ4 A;  1EGO A;  1USB A;  2V2G A;  2YPM A;  3MDK A;  2GSQ A;  1X9S B;  4OFT A;  5G5E A;  4K6X A;  2GT5 A;  1JFU A;  4GXZ A;  2YWO A;  3IK9 A;  5KEJ A;  3RBT A;  1GSD A;  3TJK A;  3I69 A;  2LTK A;  1GSF A;  3KTB A;  1AQV A;  3GUS A;  3TRX A;  1JZO A;  1XVQ A;  1O8W A;  4K7I A;  4MLY A;  1B8X A;  3VI7 A;  1AUC A;  1GNE A;  4MH2 A;  3TCO A;  2OBI A;  1V58 A;  3KGK A;  4TXV A;  4HJ2 A;  1TTZ A;  4GLT A;  1FB6 A;  3W8S A;  2FUG 2;  3BJ5 A;  3C1S A;  1GP1 A;  3LGC A;  1GLP A;  4TXO B;  2C0G A;  2H72 A;  4P3Y B;  2HYX A;  1XWA A;  3TOU A;  3FEU A;  3IK7 A;  3RPN A;  3MNG A;  4F82 A;  3DGQ A;  1PSQ A;  3HKR A;  4G2E A;  3VPQ A;  3LSZ A;  1TK5 B;  1YKA A;  2H0H A;  5D9T A;  3DEX A;  3DYR A;  2E7P A;  2H19 A;  3DD3 A;  3IV4 A;  3KCM A;  1BX9 A;  5IOX A;  4ML6 A;  2IFQ A;  6GSS A;  2L4C A;  2DC5 A;  5IPH A;  3ERG A;  3HY2 A;  5IO0 A;  2I9H A;  5EY6 A;  1ERT A;  1WE0 A;  2ES7 A;  2L6D A;  4Q5Q A;  4MJB A;  3O3T A;  4HZ2 A;  4PGT A;  4TR1 A;  1HNC A;  3VI5 A;  1V98 A;  1YJ6 A;  5J4U A;  4CDO A;  1TU7 A;  2P0G A;  1FAA A;  3A5W A;  1OKT A;  5B8B A;  1ERW A;  3P90 A;  3NOF A;  3F6F A;  1ZYE A;  3APS A;  1KEB A;  2V6O A;  4IJI A;  3M3M A;  4Z7X A;  1BG5 A;  3Q74 A;  2FY6 A;  1C72 A;  2H1B A;  2KUC A;  2OA7 A;  2I3Y A;  2GST A;  1VGL A;  3L0H A;  3GKN A;  5ECH B;  4ZB9 A;  1SK0 A;  5KN0 A;  5D9X A;  2YNX A;  3I43 A;  3LWA A;  5ECM B;  2B1L A;  1M9A A;  4KW6 A;  4YQV A;  1A24 A;  2GQK A;  3F4T A;  3M1G A;  3JCM L;  5FHI A;  3G7I A;  2KP1 A;  2GS3 A;  4GRF A;  2PMT A;  4BVY A;  3DWV A;  1TI3 A;  1M99 A;  3CMI A;  1MEK A;  3IAS 2;  1T00 A;  3VUR A;  3TUE A;  1I9D A;  4MPF A;  3TKS C;  4GQF A;  5J9C A;  2H6Z A;  17GS A;  3GST A;  1XCC A;  1J9B A;  2B5X A;  1R5P A;  1Z9H A;  1JLV A;  2DJ0 A;  4IJ3 A;  3ZTL A;  1GRX A;  1FO5 A;  4MAB A;  3IXR A;  2JL4 A;  3A2X A;  4V2L A;  1T4Z A;  3A3T A;  2JAC A;  1NHY A;  3AY8 A;  1SYX A;  1EV9 A;  4ULX A;  3L9U A;  4IP6 A;  4POM A;  4I2T A;  1B48 A;  6GSW A;  4LMV A;  4IKH A;  2L6C A;  1ERV A;  1WPI A;  3LJR A;  6GSX A;  1EV4 A;  4MZW A;  1JHB A;  4NV5 A;  3WGE A;  1KNG A;  2I81 A;  2YWI A;  3A2W A;  1U87 A;  1EEM A;  5CRD A;  3RHB A;  2H8L A;  4O92 A;  2DBC A;  2KLX A;  2CT6 A;  2VD1 A; 
#chains in the Genus database with same CATH topology
 4OCE A;  2WZ9 A;  5ECN B;  1ERU A;  2VCT A;  2R4V A;  1G6Y A;  1AAZ A;  5ELG A;  5IM9 A;  3HA9 A;  3KXO A;  4USS A;  9GSS A;  2TRC P;  2DIY A;  1QFN A;  1M9B A;  2MBS A;  4OO5 A;  1TK0 B;  4DSS B;  1VF4 A;  2YN1 A;  4EVM A;  4JU5 A;  4ECB A;  4QL7 A;  5GSS A;  5HR3 A;  2WB9 A;  4F9Z A;  4MF6 A;  5D73 A;  4RI6 A;  1W89 A;  2YOI A;  2LJR A;  1Z7P A;  3KP8 A;  12GS A;  2B5E A;  3UAR A;  4XS1 A;  5CNW A;  3LEF A;  1TP9 A;  3TJF A;  4CHS A;  5KN2 A;  1T1V A;  2IN3 A;  2MMA A;  4NHW A;  1O85 A;  1PA3 A;  1SK1 A;  3A2V A;  1I5G A;  5IIZ A;  2WCI A;  3GUR A;  3TJG A;  3TKS A;  2C1Y A;  4WBJ A;  4KUN A;  5DQS A;  4EKZ A;  2HE3 A;  1PX6 A;  14GS A;  5ECK B;  5ECP B;  3Q18 A;  5AN1 A;  5DCG A;  1GUL A;  3D4M A;  2H0I A;  3VWV A;  2GZP A;  3HVX A;  2QA2 A;  4BL7 A;  1ZOF A;  1EWX A;  2WS2 A;  1TRU A;  3GKM A;  3DVX A;  4JBB A;  2GT6 A;  2OE3 A;  5INY A;  2HT9 A;  4HU7 A;  10GS A;  2O89 A;  2DJ3 A;  5ABR A;  1OC9 B;  3L78 A;  1J0F A;  1TOF A;  2X64 A;  4J57 E;  2V41 A;  3I9V 2;  1ZYQ B;  4OCF A;  2VLU A;  4I8B A;  2R6K A;  5A5K A;  2O85 A;  4PQH A;  5ELA A;  1H4O A;  2DJ1 A;  3KZQ A;  1Z5Y E;  2HI7 A;  4LLR A;  1SL2 B;  5DVB A;  3HD5 A;  1ZCP A;  1OC8 A;  2B6M A;  2CVD A;  3QFB C;  2DSA A;  3F8U A;  2HXK A;  5ECO B;  2WFC A;  2C8U A;  1AQW A;  3UBK A;  1NW2 A;  2B7K A;  1PX7 A;  1SL1 B;  4POK A;  2XHF A;  3LQ7 A;  1EP7 A;  1K3O A;  1SD9 A;  1KTE A;  4K2X A;  5GAP D;  4I5Q A;  4EF0 A;  2LKU A;  4POL A;  4Q5N A;  3EMX A;  4HEA 2;  1F3A A;  22GS A;  1ZL9 A;  4KDY A;  1KBN A;  1R7H A;  2AUV A;  2TIR A;  1Y6E A;  1OE8 A;  4RUV A;  4TVE A;  1SKS B;  3L9S A;  1GTA A;  4FQU A;  1OKD A;  3FY7 A;  2MBT A;  3GNJ A;  4BWQ A;  2FNO A;  1LU4 A;  3EWL A;  3D4T A;  3ERW A;  4OFM A;  3RPP A;  2ON7 A;  3GX8 A;  5J3R A;  1GUK A;  4EDZ A;  2C3Q A;  1K0A A;  1GUM A;  1SU9 A;  2H1D A;  4TKY A;  1E2Y A;  3E9J B;  6GST A;  4WEY A;  3KP9 A;  4KDX A;  1UN2 A;  3LOR A;  4N10 A;  1V57 A;  5JCU A;  1DE1 A;  4ACS A;  2F3M A;  2CZ3 A;  3GKK A;  3IR4 A;  3UVT A;  4NXI A;  5A4V A;  5EL8 A;  4IQA A;  4MF7 A;  1QQ2 A;  4FYU A;  3RAZ A;  3SWL A;  5KN1 A;  4L5L A;  2C0F A;  5ID2 B;  2VL2 C;  1S3C A;  1N8J A;  3UVH A;  3D22 A;  2IPA A;  6GSU A;  5D8I A;  1QUW A;  2PVO C;  3KTL A;  3VFI A;  3KJY A;  4WXT A;  1GSE A;  3G7J A;  4HOJ A;  4K0N A;  1BYE A;  2LV3 A;  4XHM A;  5GST A;  2RII A;  1THO A;  2LUS A;  2FHE A;  3O6T A;  3FR9 A;  3PR8 A;  5CRE A;  7GSS A;  4TR4 A;  4PNG A;  1MD4 A;  2IJY A;  1XWB A;  4GF0 A;  3VWX A;  4NWY A;  4GCI A;  2GQL A;  2OE1 A;  2M72 A;  4O5U A;  2VCZ A;  2F51 A;  3KM6 A;  4KAE A;  2A2S A;  3U6V A;  1K0D A;  4EE0 A;  1EOG A;  2H75 A;  5F8B A;  2HZF A;  4MMM A;  2CA8 A;  1U3I A;  5HR2 A;  3UJ1 A;  4ZIL A;  4O32 A;  1SJZ A;  1AXD A;  4IP1 A;  4PQ1 A;  1CQG A;  3EU3 A;  3DVW A;  4OD7 A;  2GQM A;  3FRC A;  1JLW A;  2BMX A;  3W8J A;  19GS A;  1Y25 A;  3KMN A;  3ZVJ D;  2XC2 A;  3QPM A;  1A2L A;  2HFD A;  3MYD A;  1YEP A;  5LCZ A;  1FOV A;  2YP6 A;  3UEM A;  1T3B A;  4V1A p;  2CV4 A;  4Q5R A;  4DVC A;  3EU4 A;  3KH9 A;  3OR5 A;  4TRX A;  2R5G A;  3MSZ A;  2R37 A;  1PN0 A;  2IFQ B;  2CAI A;  1IYH A;  5DAL A;  2V6K A;  1TRW A;  5BMU A;  2K8S A;  3FR3 A;  4PUA A;  2CX3 A;  4ZBB A;  2TRX A;  2RUE A;  2ZNM A;  3QCP A;  1EGR A;  3ISO A;  4TR1 B;  2VM2 A;  2FA4 A;  3HJM A;  2VL2 A;  4TR0 A;  3FZA A;  4DSQ A;  3DKS A;  1VF2 A;  5AGY A;  3FZ5 A;  4OMV A;  2E0Q A;  4IHU A;  3QDN A;  1X9W B;  5LNK e;  3D6I A;  3F3Q A;  1XOB A;  2X49 A;  1X5E A;  4ZB8 A;  4AJ7 A;  3TJB A;  1GTI A;  2RLI A;  1IYI A;  2L59 A;  1MTC A;  3J7Y k;  3KD0 A;  5LD0 A;  4GWR A;  2QKE A;  3H79 A;  2NTO A;  3ME8 A;  3US3 A;  4WKW A;  3C7M A;  3CSH A;  3PIN A;  2KHP A;  2VCQ A;  3U5R E;  2WRT A;  4LL4 B;  3LXT A;  4I97 A;  4BVX B;  3WGX A;  3ZL5 A;  5ECL B;  4G0I A;  2FGX A;  4IW9 A;  2REM A;  1XWK A;  4BVY B;  4CY8 A;  1R4W A;  4RQX A;  1QGV A;  3D5J A;  4KDU A;  4ZIJ A;  2JZR A;  5DJM A;  2V1M A;  1TRV A;  1GL8 A;  1GH2 A;  2AJQ B;  4GQC A;  2H30 A;  2FWH A;  4V1A g;  5HR1 A;  3LXZ A;  1A2J A;  1FG4 A;  3TJJ A;  3ED3 A;  1XFL A;  2UZ8 A;  1TK8 B;  4H86 A;  1R26 A;  5FWG A;  1F3B A;  4MK3 A;  5KOX A;  4N30 A;  2FWG A;  2MMO A;  4ILF A;  4FO5 A;  2D2Z A;  8GSS A;  3IHG A;  4O5R A;  2CZ2 A;  2NPB A;  2GVP A;  3FW2 A;  2AAW A;  3HDC A;  3BOA A;  2K18 A;  3IE3 A;  3DML A;  4E8E A;  1T8E B;  4HDE A;  4G0L A;  2J23 A;  4GSS A;  2IIY A;  3QAV A;  2K6V A;  4HZ4 A;  2LRT A;  2LST A;  4ZL9 A;  2C3N A;  1H75 A;  5IMD A;  3ERF A;  1PQN A;  1M2A A;  4J2F A;  2HZE A;  5IMA A;  3LYK A;  5DAK A;  4L0U A;  2P5R A;  3CQF A;  4MA9 A;  1X5D A;  4BWS A;  4QL9 A;  4GSN A;  3E0U A;  4EXJ A;  5G30 A;  2IMK A;  2R0G A;  3GYK A;  3QMX A;  5DDL A;  4YQM A;  3D0Z A;  3H93 A;  4KGI A;  1WWJ A;  2KP2 A;  3H1N A;  4D73 A;  3F3R A;  4HQS A;  3UAP A;  2GZY A;  2LQO A;  2P31 A;  1X0R A;  3P2A A;  2YV7 A;  3ZML A;  2FWF A;  2AYT A;  2X99 A;  1ZGN A;  4MCU A;  1UC7 A;  6GSV A;  2CVB A;  4KSO A;  2OAD A;  2GSR A;  1TDI A;  2FLS A;  1DSB A;  4EC0 A;  4ZL7 A;  2XBQ A;  1YY7 A;  5B8A A;  3GFK A;  1FW1 A;  3Q19 A;  3NZN A;  2N5A A;  4K2D A;  4YQU A;  3CSI A;  5B6N A;  5G31 A;  4ZBD A;  1HQO A;  3EVI A;  3PH9 A;  3CBU A;  4G10 A;  3F6D A;  5EVO A;  1GNW A;  1XW9 A;  2WUL A;  3GA4 A;  3ZRE A;  4F03 A;  2RUF A;  4HS1 A;  3QAG A;  4MPG A;  1GSU A;  3TKQ A;  3GTU B;  3EE2 A;  4IQ1 A;  1AIU A;  2A4V A;  3VWU A;  3GN3 A;  3F63 A;  2VCW A;  1PRX A;  3IHQ A;  5L71 A;  3P7X A;  2KOK A;  2BTO T;  1GTB A;  2GLR A;  5A4U A;  3ZFL A;  3S9F A;  1ZYN A;  1O6J A;  4K7N A;  2LNS A;  1TRS A;  4K0G A;  3FHK A;  2C0D A;  2CQ9 A;  3EC3 A;  4L5O A;  5IOW A;  4HSC X;  2VL3 A;  4DSS A;  3HYP A;  2Z9S A;  2WGR A;  1X9M B;  2G2Q A;  1NSW A;  3HXS A;  4HJM A;  2DMM A;  20GS A;  5ECQ B;  2O8V B;  5IMV A;  5KN3 A;  1FOH A;  1O81 A;  3KH7 A;  4JRR A;  1PKZ A;  1PGT A;  4XIH A;  1AQX A;  1ILO A;  4NAX A;  3FYG A;  2FA8 A;  5DCH A;  1XG8 A;  2QGV A;  2L5O A;  2H1G A;  2PER A;  1FB0 A;  4JE1 A;  3GV1 A;  3L4N A;  3ZFB A;  4IGJ A;  3RDW A;  3GRX A;  3N9J A;  2F9S A;  1A0R P;  1ACV A;  1PMT A;  11GS A;  4N0V A;  2HRN A;  3C8E A;  2JZS A;  3RHC A;  4PUF C;  2J9H A;  6GSY A;  2YWN A;  4NPB A;  4TW5 A;  2OJL A;  4MP4 A;  4PQI A;  2NVL A;  1V2A A;  2VLV A;  3CTG A;  4XRD A;  4MZC A;  1O8X A;  5BRT A;  2R0C A;  3HVV A;  4N11 A;  2JU5 A;  1AC1 A;  1TJD A;  2K8V A;  4L8E A;  2LJA A;  5HFK A;  1GLQ A;  4V2M A;  3L9V A;  3C1R A;  2HLS A;  4ZXG A;  2LRC A;  1ML6 A;  2PWJ A;  2QC7 A;  5C00 A;  4MJE A;  4ECI A;  1NHO A;  2XPE A;  4WF4 A;  5IQY A;  3WYW A;  5JCW A;  4PUR A;  1SD8 A;  1TW9 A;  2YZH A;  3APQ A;  1K0N A;  3HJO A;  2IMF A;  5JWO B;  3M8N A;  1XBS A;  4KX4 A;  4ZL8 A;  4NMU A;  2EC4 A;  1B4Q A;  5J41 A;  1SK2 A;  1F9M A;  3WT1 A;  1BED A;  4PNF A;  4BIK A;  5DBQ A;  4KB3 A;  5F06 A;  3SBC A;  1OE7 A;  1BQ7 A;  1BJX A;  2VLT A;  4ID0 A;  4MDC A;  4FYC A;  1K0O A;  4K9Z A;  3ZYW A;  1JZD A;  3FZ4 A;  4LL1 B;  1XW5 A;  2L4Q A;  2VIM A;  4CW9 A;  4HI7 A;  5FT3 A;  3F4S A;  4K8M A;  2PGT A;  1PD2 1;  4O7H A;  3LG6 A;  2PUK C;  1SJ6 A;  3K8N A;  1E6B A;  4EO3 A;  3ZIT A;  1K0C A;  1GSS A;  3TRP A;  1HNB A;  3I6A A;  3O76 A;  2JZT A;  4YKF A;  3TKS E;  4EUY A;  1U88 A;  4ECC A;  2OKA A;  1MDJ A;  4OWY A;  4LA1 A;  2LJK A;  1JZR A;  4MNN A;  5CRG A;  3QFA C;  2PPT A;  4V2N A;  5AIS A;  2HSH A;  3IPZ A;  2H0G A;  4EIQ A;  3IA1 A;  1X5C A;  2AV4 A;  5A4W A;  1Z6M A;  4WET A;  3C73 A;  3GHA A;  1J08 A;  3GIX A;  3CYN A;  5B6M A;  2VCX A;  1FHE A;  2L57 A;  3IC4 A;  5IMZ A;  2H74 A;  2M80 A;  2OBK A;  2H1A A;  3CRT A;  1YF1 A;  3EYT A;  1MDK A;  4XS4 A;  1PN9 A;  4YH2 A;  4EIP A;  1A2M A;  4KF9 A;  4G19 A;  1B4P A;  5DAL B;  3TOT A;  3UOM A;  4YAP A;  1MDI A;  1TU8 A;  2C0E A;  2I4A A;  1T4Y A;  1PKW A;  3ZRD A;  1WRY A;  1YF0 A;  2L5L A;  5IMC A;  4L0W A;  5G2Z A;  3D21 A;  1V40 A;  4Z2R A;  2VO4 A;  3A5I A;  1K0B A;  1M2D A;  1WJK A;  3Q6O A;  4MF5 A;  4OFN A;  4PXO A;  2CX4 A;  1VRS D;  3TKP A;  3GSS A;  2M46 A;  1Z7R A;  1TKD B;  5F05 A;  1FVK A;  2EIR A;  2YJH A;  2DLX A;  5G5F A;  3CXG A;  1EOH A;  2C80 A;  1DE2 A;  3TRQ A;  3WT2 A;  4RI7 A;  3ZVJ A;  1GSY A;  3IOS A;  2N5B A;  4RQR A;  3FMW A;  2HRK A;  1B9X C;  4KE3 A;  2XBI A;  1JZW A;  2F8A A;  1M7T A;  2BJX A;  4K1F A;  2EIO A;  2HRF A;  2A2R A;  5B7C A;  2LNT A;  4GST A;  2XPD A;  4LMW A;  1SKW B;  1QMV A;  4AJ6 A;  4BPY A;  1SEN A;  3EMP A;  2H76 A;  5ECR B;  1ZZY A;  2X4A A;  3FKF A;  3M9J A;  5J9B A;  2FD3 A;  4KA0 A;  1XW6 A;  5HFG A;  1BAY A;  5GAN D;  1PL1 A;  3QAW A;  3M0F A;  2FWE A;  1SKR B;  1YDK A;  4JED A;  3E3E A;  2E2G A;  3LW9 A;  1XPV A;  3DRN A;  1YZX A;  1SYR A;  5CRW A;  1ST9 A;  2MYG A;  4TXO A;  4XTS A;  5J5N A;  3GMF A;  5DQY A;  1F2E A;  5CP1 A;  3HVS A;  2X8H A;  5CO3 A;  2X8C A;  2PBJ A;  2GTU A;  2CAQ A;  3EUR A;  3UMA A;  13GS A;  4ICY A;  5IMF A;  1EP8 A;  2H01 A;  2OE0 A;  1PL2 A;  5DJL A;  4F0B A;  2JSZ A;  3BCK A;  4E8H A;  3DXB A;  5F07 A;  5AIV A;  2GZZ A;  5E59 A;  5ENU A;  2YV9 A;  2HZE B;  4JR4 A;  5DAK B;  1O7U A;  5F0G A;  3KEB A;  4G0K A;  5HQP A;  4I6X A;  2R0P A;  4BVX A;  2WDU A;  1HYU A;  5JWR B;  2LRN A;  1LJR A;  2ZCT A;  4DEJ A;  4BA7 A;  1OC3 A;  3ZIJ A;  4D73 B;  4IEL A;  1M2B A;  2PN8 A;  4HUA A;  2GDR A;  2B1K A;  1QXH A;  3UIW A;  2OAC A;  3GH6 A;  3GKX A;  2HSY A;  1U3A A;  5HFI A;  3VK9 A;  1DBY A;  2V32 A;  1XIY A;  2IME A;  4G9H A;  4XS6 A;  3DIE A;  2C3T A;  2P5Q A;  1Z6N A;  4ISD A;  5COH A;  5D9W A;  1G6W A;  4YKG A;  5H5R A;  2LS5 A;  4X43 A;  1NM3 A;  4DSR A;  2YJ7 A;  1W4V A;  5IO2 A;  3W6G A;  1Q4J A;  1RQM A;  4GTU A;  2IWT A;  1A23 A;  1MD3 A;  1ZYP A;  4AGS A;  1EEJ A;  4MJA A;  4KH7 A;  2ZUP A;  1AW9 A;  1T7P B;  1YEX A;  4MH3 A;  4IN0 A;  1F37 A;  3TKR A;  3HCZ A;  1A8L A;  4PTS A;  2RM5 A;  3UL3 A;  4WF5 A;  1R5A A;  1TI1 A;  3HVN A;  1G0T A;  3HHV A;  3F0I A;  3PPU A;  4KCE A;  2R2J A;  1WMJ A;  3BD2 A;  1U6T A;  1WOU A;  4FYB A;  4J56 E;  1THX A;  2LEG A;  2DML A;  2GGT A;  2GSS A;  4XRA A;  1GTU A;  4Z2U A;  2VAF A;  3H4K A;  3WGD A;  4ZB6 A;  5E4W A;  3ZIV A;  1LBK A;  2DJ2 A;  1RK4 A;  4AF2 A;  3G7Y A;  4BL7 B;  3LYP A;  1ZMA A;  1YKC A;  2HNL A;  3APO A;  4F2I A;  2YWM A;  1A0F A;  2VM1 A;  5AIX A;  1XOA A;  2FCH A;  5GZZ B;  3IC8 A;  4K5R A;  1G7E A;  5G1L A;  2F8F A;  2RM6 A;  4KSM A;  1GUH A;  3HZ8 A;  1O73 A;  3GH9 A;  2R3X A;  1M0U A;  3GL5 A;  2DJJ A;  4IS0 A;  3FZ9 A;  3VLN A;  2E2M A;  2O7K A;  4IBP A;  5JWQ B;  1WP0 A;  1OAZ A;  4A5P A;  2MZC A;  1XVW A;  4N0Z A;  1GWC A;  1F6M C;  4MJC A;  4HQZ A;  2QSI A;  4ECJ A;  3KMO A;  3R2Q A;  2NBS A;  2H73 A;  3V1W A;  1OVN A;  3H8Q A;  3TB2 A;  4X0X A;  1FVJ A;  1V9W A;  3GTU A;  2AHE A;  4POB A;  4TN8 A;  4AJ8 A;  1EZK A;  1QK8 A;  1XWG A;  2DIZ A;  2H70 A;  2NDO A;  3TGZ A;  3ZMK A;  3M9K A;  4Z2T A;  3ME7 A;  3KIJ A;  3IBH A;  4KCA A;  2ALB A;  4FH8 A;  1VF1 A;  2WJU A;  1GSQ A;  3CSJ A;  3PGT A;  3EPT A;  1YQ1 A;  2YZU A;  3QOU A;  3ZZX A;  2DJK A;  3UBL A;  3IRA A;  1A8Y A;  2ON5 A;  5CRH A;  1HD2 A;  2LQQ A;  5KOW A;  1VF3 A;  2VOC A;  3F9U A;  2VD0 A;  1CQH A;  5ECI B;  3VWW A;  3WD6 A;  5ECS A;  3NIV A;  1XZO A;  3CTF A;  2H66 A;  1ON4 A;  1OC9 A;  2B7J A;  4I2U A;  5IPG A;  1S3R A;  1K0M A;  5G1K A;  1URM A;  5EPF A;  4HU9 A;  3BBY A;  5HR0 A;  1WIK A;  2B3S A;  4QQ7 A;  2IMI A;  2H6Y A;  4JR6 A;  3N5O A;  2G0F A;  4NHZ A;  3IAM 2;  2DKI A;  3FK8 A;  3EIN A;  5CAX A;  2EIQ A;  4TR3 A;  1K3L A;  2IMD A;  4YAV A;  2JAD A;  1XWC A;  4ZBA A;  2HRA A;  2H71 A;  2MMN A;  3GL3 A;  5H5S A;  1TXX A;  5H5Q A;  2JSY A;  4WBR D;  4F0C A;  5JCG A;  3BCI A;  2IL3 A;  2K9F A;  1UA5 A;  1SL0 B;  3TDG A;  3R3E A;  4EL1 A;  2X8G A;  4IVF A;  3LFL A;  2YCD A;  2PVQ A;  3C71 A;  1S3A A;  1ABA A;  1OYJ A;  4NV2 A;  3ZLP A;  4OO4 A;  1K3Y A;  3CRU A;  4X1U A;  3G9B A;  18GS A;  3P8W A;  4XS4 B;  2N5F A;  2AB6 A;  2MMZ A;  1B9Y C;  4WR5 A;  4FIW A;  1DUG A;  2I1U A;  3IDV A;  5D96 A;  3FR6 A;  3J7Y b;  3MAK A;  5D93 A;  4X4J A;  4K5S A;  1HNA A;  1S3D A;  2VL9 A;  4EDY A;  3MWH A;  16GS A;  4XCS A;  4WR4 A;  2YAN A;  3F4R A;  4KND A;  1UVZ A;  5C04 A;  4TOP A;  3VPT A;  1G7O A;  2H6X A;  5ID2 A;  1N2A A;  1XXU A;  4MZB A;  1PFO A;  2VUP A;  3QR6 A;  1Z3E A;  2B5Y A;  1RW1 A;  2O87 A;  3QD9 A;  4Q5F A;  2CVK A;  2A4H A;  4CY6 A;  1SJI A;  4K7O A;  1Q98 A;  2C4J A;  4PX1 A;  5D9V A;  2VCV A;  2PU9 C;  4ML1 A;  4JZQ A;  5CYY A;  3GX0 A;  3HJP A;  3HZ4 A;  1EGO A;  1USB A;  2V2G A;  2YPM A;  3MDK A;  2GSQ A;  1X9S B;  4OFT A;  5G5E A;  4K6X A;  2GT5 A;  1JFU A;  4GXZ A;  2YWO A;  3IK9 A;  5KEJ A;  3RBT A;  1GSD A;  3TJK A;  3I69 A;  2LTK A;  1GSF A;  3KTB A;  1AQV A;  3GUS A;  3TRX A;  1JZO A;  1XVQ A;  1O8W A;  4K7I A;  4MLY A;  1B8X A;  3VI7 A;  1AUC A;  1GNE A;  4MH2 A;  3TCO A;  2DKH A;  2OBI A;  1V58 A;  3KGK A;  4TXV A;  4HJ2 A;  2A2P A;  1TTZ A;  4GLT A;  1FB6 A;  3W8S A;  2FUG 2;  3BJ5 A;  3C1S A;  1GP1 A;  3LGC A;  1GLP A;  4TXO B;  2C0G A;  2H72 A;  4P3Y B;  2HYX A;  1XWA A;  3TOU A;  3FEU A;  3IK7 A;  3RPN A;  3MNG A;  4F82 A;  3DGQ A;  1PSQ A;  3HKR A;  4G2E A;  3VPQ A;  3LSZ A;  1TK5 B;  1YKA A;  2H0H A;  5D9T A;  3DEX A;  3DYR A;  2E7P A;  2H19 A;  3DD3 A;  3IV4 A;  3KCM A;  2QA1 A;  1BX9 A;  5IOX A;  4ML6 A;  2IFQ A;  6GSS A;  2L4C A;  2DC5 A;  5IPH A;  3ERG A;  3HY2 A;  5IO0 A;  2I9H A;  5EY6 A;  1ERT A;  1WE0 A;  2ES7 A;  2L6D A;  4Q5Q A;  4MJB A;  3O3T A;  4HZ2 A;  4PGT A;  4TR1 A;  1HNC A;  3VI5 A;  1V98 A;  1YJ6 A;  5J4U A;  4O5Q A;  4CDO A;  1TU7 A;  2P0G A;  1FAA A;  3A5W A;  1OKT A;  5B8B A;  1ERW A;  3P90 A;  3NOF A;  3F6F A;  1ZYE A;  3APS A;  1KEB A;  2V6O A;  4IJI A;  3M3M A;  4Z7X A;  1BG5 A;  3Q74 A;  2FY6 A;  1C72 A;  2H1B A;  2KUC A;  2OA7 A;  2I3Y A;  2GST A;  1VGL A;  3L0H A;  3GKN A;  5ECH B;  4ZB9 A;  1SK0 A;  5KN0 A;  5D9X A;  2YNX A;  3I43 A;  3LWA A;  5ECM B;  2B1L A;  1M9A A;  4KW6 A;  4YQV A;  1A24 A;  2GQK A;  3F4T A;  3M1G A;  3JCM L;  5FHI A;  3G7I A;  2KP1 A;  2GS3 A;  4GRF A;  2PMT A;  4BVY A;  1M3I A;  3DWV A;  1TI3 A;  1M99 A;  3CMI A;  1MEK A;  3IAS 2;  1T00 A;  3VUR A;  3TUE A;  1I9D A;  4MPF A;  3TKS C;  4GQF A;  5J9C A;  2H6Z A;  17GS A;  3GST A;  1XCC A;  1J9B A;  2B5X A;  1R5P A;  1Z9H A;  1JLV A;  2DJ0 A;  4IJ3 A;  3ZTL A;  1GRX A;  1FO5 A;  1M3J A;  4MAB A;  3IXR A;  2JL4 A;  3A2X A;  4V2L A;  1T4Z A;  3A3T A;  2JAC A;  1NHY A;  3AY8 A;  1SYX A;  1EV9 A;  4ULX A;  3L9U A;  4IP6 A;  4POM A;  4I2T A;  1B48 A;  6GSW A;  4LMV A;  4IKH A;  2L6C A;  1ERV A;  1WPI A;  3LJR A;  6GSX A;  1EV4 A;  4MZW A;  1JHB A;  2HSM A;  4NV5 A;  3WGE A;  1KNG A;  2I81 A;  2YWI A;  3A2W A;  1U87 A;  1EEM A;  5CRD A;  3RHB A;  2H8L A;  4O92 A;  2DBC A;  2KLX A;  3MIX A;  2CT6 A;  2VD1 A; 
#chains in the Genus database with same CATH homology
 4OCE A;  2WZ9 A;  5ECN B;  1ERU A;  2VCT A;  2R4V A;  1G6Y A;  1AAZ A;  5ELG A;  5IM9 A;  3HA9 A;  3KXO A;  4USS A;  9GSS A;  2TRC P;  2DIY A;  1QFN A;  1M9B A;  2MBS A;  4OO5 A;  1TK0 B;  4DSS B;  1VF4 A;  2YN1 A;  4EVM A;  4JU5 A;  4ECB A;  4QL7 A;  5GSS A;  5HR3 A;  2WB9 A;  4F9Z A;  4MF6 A;  5D73 A;  4RI6 A;  1W89 A;  2YOI A;  2LJR A;  1Z7P A;  3KP8 A;  12GS A;  2B5E A;  3UAR A;  4XS1 A;  5CNW A;  3LEF A;  1TP9 A;  3TJF A;  4CHS A;  5KN2 A;  1T1V A;  2IN3 A;  2MMA A;  4NHW A;  1O85 A;  1PA3 A;  1SK1 A;  3A2V A;  1I5G A;  5IIZ A;  2WCI A;  3GUR A;  3TJG A;  3TKS A;  2C1Y A;  4WBJ A;  4KUN A;  5DQS A;  4EKZ A;  2HE3 A;  1PX6 A;  14GS A;  5ECK B;  5ECP B;  3Q18 A;  5AN1 A;  5DCG A;  1GUL A;  3D4M A;  2H0I A;  3VWV A;  2GZP A;  3HVX A;  2QA2 A;  4BL7 A;  1ZOF A;  1EWX A;  2WS2 A;  1TRU A;  3GKM A;  3DVX A;  4JBB A;  2GT6 A;  2OE3 A;  5INY A;  2HT9 A;  4HU7 A;  10GS A;  2O89 A;  2DJ3 A;  5ABR A;  1OC9 B;  3L78 A;  1J0F A;  1TOF A;  2X64 A;  4J57 E;  2V41 A;  3I9V 2;  1ZYQ B;  4OCF A;  2VLU A;  4I8B A;  2R6K A;  5A5K A;  2O85 A;  4PQH A;  5ELA A;  1H4O A;  2DJ1 A;  3KZQ A;  1Z5Y E;  2HI7 A;  4LLR A;  1SL2 B;  5DVB A;  3HD5 A;  1ZCP A;  1OC8 A;  2B6M A;  2CVD A;  3QFB C;  2DSA A;  3F8U A;  2HXK A;  5ECO B;  2WFC A;  2C8U A;  1AQW A;  3UBK A;  1NW2 A;  2B7K A;  1PX7 A;  1SL1 B;  4POK A;  2XHF A;  3LQ7 A;  1EP7 A;  1K3O A;  1SD9 A;  1KTE A;  4K2X A;  5GAP D;  4I5Q A;  4EF0 A;  2LKU A;  4POL A;  4Q5N A;  3EMX A;  4HEA 2;  1F3A A;  22GS A;  1ZL9 A;  4KDY A;  1KBN A;  1R7H A;  2AUV A;  2TIR A;  1Y6E A;  1OE8 A;  4RUV A;  4TVE A;  1SKS B;  3L9S A;  1GTA A;  4FQU A;  1OKD A;  3FY7 A;  2MBT A;  3GNJ A;  4BWQ A;  2FNO A;  1LU4 A;  3EWL A;  3D4T A;  3ERW A;  4OFM A;  3RPP A;  2ON7 A;  3GX8 A;  5J3R A;  1GUK A;  4EDZ A;  2C3Q A;  1K0A A;  1GUM A;  1SU9 A;  2H1D A;  4TKY A;  1E2Y A;  3E9J B;  6GST A;  4WEY A;  3KP9 A;  4KDX A;  1UN2 A;  3LOR A;  4N10 A;  1V57 A;  5JCU A;  1DE1 A;  4ACS A;  2F3M A;  2CZ3 A;  3GKK A;  3IR4 A;  3UVT A;  4NXI A;  5A4V A;  5EL8 A;  4IQA A;  4MF7 A;  1QQ2 A;  4FYU A;  3RAZ A;  3SWL A;  5KN1 A;  4L5L A;  2C0F A;  5ID2 B;  2VL2 C;  1S3C A;  1N8J A;  3UVH A;  3D22 A;  2IPA A;  6GSU A;  5D8I A;  1QUW A;  2PVO C;  3KTL A;  3VFI A;  3KJY A;  4WXT A;  1GSE A;  3G7J A;  4HOJ A;  4K0N A;  1BYE A;  2LV3 A;  4XHM A;  5GST A;  2RII A;  1THO A;  2LUS A;  2FHE A;  3O6T A;  3FR9 A;  3PR8 A;  5CRE A;  7GSS A;  4TR4 A;  4PNG A;  1MD4 A;  2IJY A;  1XWB A;  4GF0 A;  3VWX A;  4NWY A;  4GCI A;  2GQL A;  2OE1 A;  2M72 A;  4O5U A;  2VCZ A;  2F51 A;  3KM6 A;  4KAE A;  2A2S A;  3U6V A;  1K0D A;  4EE0 A;  1EOG A;  2H75 A;  5F8B A;  2HZF A;  4MMM A;  2CA8 A;  1U3I A;  5HR2 A;  3UJ1 A;  4ZIL A;  4O32 A;  1SJZ A;  1AXD A;  4IP1 A;  4PQ1 A;  1CQG A;  3EU3 A;  3DVW A;  4OD7 A;  2GQM A;  3FRC A;  1JLW A;  2BMX A;  3W8J A;  19GS A;  1Y25 A;  3KMN A;  3ZVJ D;  2XC2 A;  3QPM A;  1A2L A;  2HFD A;  3MYD A;  1YEP A;  5LCZ A;  1FOV A;  2YP6 A;  3UEM A;  1T3B A;  4V1A p;  2CV4 A;  4Q5R A;  4DVC A;  3EU4 A;  3KH9 A;  3OR5 A;  4TRX A;  2R5G A;  3MSZ A;  2R37 A;  1PN0 A;  2IFQ B;  2CAI A;  1IYH A;  5DAL A;  2V6K A;  1TRW A;  5BMU A;  2K8S A;  3FR3 A;  4PUA A;  2CX3 A;  4ZBB A;  2TRX A;  2RUE A;  2ZNM A;  3QCP A;  1EGR A;  3ISO A;  4TR1 B;  2VM2 A;  2FA4 A;  3HJM A;  2VL2 A;  4TR0 A;  3FZA A;  4DSQ A;  3DKS A;  1VF2 A;  5AGY A;  3FZ5 A;  4OMV A;  2E0Q A;  4IHU A;  3QDN A;  1X9W B;  5LNK e;  3D6I A;  3F3Q A;  1XOB A;  2X49 A;  1X5E A;  4ZB8 A;  4AJ7 A;  3TJB A;  1GTI A;  2RLI A;  1IYI A;  2L59 A;  1MTC A;  3J7Y k;  3KD0 A;  5LD0 A;  4GWR A;  2QKE A;  3H79 A;  2NTO A;  3ME8 A;  3US3 A;  4WKW A;  3C7M A;  3CSH A;  3PIN A;  2KHP A;  2VCQ A;  3U5R E;  2WRT A;  4LL4 B;  3LXT A;  4I97 A;  4BVX B;  3WGX A;  3ZL5 A;  5ECL B;  4G0I A;  2FGX A;  4IW9 A;  2REM A;  1XWK A;  4BVY B;  4CY8 A;  1R4W A;  4RQX A;  1QGV A;  3D5J A;  4KDU A;  4ZIJ A;  2JZR A;  5DJM A;  2V1M A;  1TRV A;  1GL8 A;  1GH2 A;  2AJQ B;  4GQC A;  2H30 A;  2FWH A;  4V1A g;  5HR1 A;  3LXZ A;  1A2J A;  1FG4 A;  3TJJ A;  3ED3 A;  1XFL A;  2UZ8 A;  1TK8 B;  4H86 A;  1R26 A;  5FWG A;  1F3B A;  4MK3 A;  5KOX A;  4N30 A;  2FWG A;  2MMO A;  4ILF A;  4FO5 A;  2D2Z A;  8GSS A;  3IHG A;  4O5R A;  2CZ2 A;  2NPB A;  2GVP A;  3FW2 A;  2AAW A;  3HDC A;  3BOA A;  2K18 A;  3IE3 A;  3DML A;  4E8E A;  1T8E B;  4HDE A;  4G0L A;  2J23 A;  4GSS A;  2IIY A;  3QAV A;  2K6V A;  4HZ4 A;  2LRT A;  2LST A;  4ZL9 A;  2C3N A;  1H75 A;  5IMD A;  3ERF A;  1PQN A;  1M2A A;  4J2F A;  2HZE A;  5IMA A;  3LYK A;  5DAK A;  4L0U A;  2P5R A;  4MA9 A;  1X5D A;  4BWS A;  4QL9 A;  4GSN A;  3E0U A;  4EXJ A;  5G30 A;  2IMK A;  2R0G A;  3GYK A;  3QMX A;  5DDL A;  4YQM A;  3D0Z A;  3H93 A;  4KGI A;  1WWJ A;  2KP2 A;  3H1N A;  4D73 A;  3F3R A;  4HQS A;  3UAP A;  2GZY A;  2LQO A;  2P31 A;  1X0R A;  3P2A A;  2YV7 A;  3ZML A;  2FWF A;  2AYT A;  2X99 A;  1ZGN A;  4MCU A;  1UC7 A;  6GSV A;  2CVB A;  4KSO A;  2OAD A;  2GSR A;  1TDI A;  2FLS A;  1DSB A;  4EC0 A;  4ZL7 A;  2XBQ A;  1YY7 A;  5B8A A;  3GFK A;  1FW1 A;  3Q19 A;  3NZN A;  2N5A A;  4K2D A;  4YQU A;  3CSI A;  5B6N A;  5G31 A;  4ZBD A;  1HQO A;  3EVI A;  3PH9 A;  3CBU A;  4G10 A;  3F6D A;  5EVO A;  1GNW A;  1XW9 A;  2WUL A;  3GA4 A;  3ZRE A;  4F03 A;  2RUF A;  4HS1 A;  3QAG A;  4MPG A;  1GSU A;  3TKQ A;  3GTU B;  3EE2 A;  4IQ1 A;  1AIU A;  2A4V A;  3VWU A;  3GN3 A;  3F63 A;  2VCW A;  1PRX A;  3IHQ A;  5L71 A;  3P7X A;  2KOK A;  2BTO T;  1GTB A;  2GLR A;  5A4U A;  3ZFL A;  3S9F A;  1ZYN A;  1O6J A;  4K7N A;  2LNS A;  1TRS A;  4K0G A;  3FHK A;  2C0D A;  2CQ9 A;  3EC3 A;  4L5O A;  5IOW A;  2VL3 A;  4DSS A;  3HYP A;  2Z9S A;  2WGR A;  1X9M B;  2G2Q A;  1NSW A;  3HXS A;  4HJM A;  2DMM A;  20GS A;  5ECQ B;  2O8V B;  5IMV A;  5KN3 A;  1FOH A;  1O81 A;  3KH7 A;  4JRR A;  1PKZ A;  1PGT A;  4XIH A;  1AQX A;  1ILO A;  4NAX A;  3FYG A;  2FA8 A;  5DCH A;  2QGV A;  2L5O A;  2H1G A;  2PER A;  1FB0 A;  4JE1 A;  3GV1 A;  3L4N A;  3ZFB A;  4IGJ A;  3RDW A;  3GRX A;  3N9J A;  2F9S A;  1A0R P;  1ACV A;  1PMT A;  11GS A;  4N0V A;  2HRN A;  3C8E A;  2JZS A;  3RHC A;  4PUF C;  2J9H A;  6GSY A;  2YWN A;  4NPB A;  4TW5 A;  2OJL A;  4MP4 A;  4PQI A;  2NVL A;  1V2A A;  2VLV A;  3CTG A;  4XRD A;  4MZC A;  1O8X A;  5BRT A;  2R0C A;  3HVV A;  4N11 A;  2JU5 A;  1AC1 A;  1TJD A;  2K8V A;  4L8E A;  2LJA A;  5HFK A;  1GLQ A;  4V2M A;  3L9V A;  3C1R A;  2HLS A;  4ZXG A;  2LRC A;  1ML6 A;  2PWJ A;  2QC7 A;  5C00 A;  4MJE A;  4ECI A;  1NHO A;  2XPE A;  4WF4 A;  5IQY A;  3WYW A;  5JCW A;  4PUR A;  1SD8 A;  1TW9 A;  2YZH A;  3APQ A;  1K0N A;  3HJO A;  2IMF A;  5JWO B;  3M8N A;  1XBS A;  4KX4 A;  4ZL8 A;  4NMU A;  2EC4 A;  1B4Q A;  5J41 A;  1SK2 A;  1F9M A;  3WT1 A;  1BED A;  4PNF A;  5DBQ A;  4KB3 A;  5F06 A;  3SBC A;  1OE7 A;  1BQ7 A;  1BJX A;  2VLT A;  4ID0 A;  4MDC A;  4FYC A;  1K0O A;  4K9Z A;  3ZYW A;  1JZD A;  3FZ4 A;  4LL1 B;  1XW5 A;  2L4Q A;  2VIM A;  4CW9 A;  4HI7 A;  5FT3 A;  3F4S A;  4K8M A;  2PGT A;  1PD2 1;  4O7H A;  3LG6 A;  2PUK C;  1SJ6 A;  3K8N A;  1E6B A;  4EO3 A;  3ZIT A;  1K0C A;  1GSS A;  3TRP A;  1HNB A;  3I6A A;  3O76 A;  2JZT A;  4YKF A;  3TKS E;  4EUY A;  1U88 A;  4ECC A;  2OKA A;  1MDJ A;  4OWY A;  4LA1 A;  2LJK A;  1JZR A;  4MNN A;  5CRG A;  3QFA C;  2PPT A;  4V2N A;  5AIS A;  2HSH A;  3IPZ A;  2H0G A;  4EIQ A;  3IA1 A;  1X5C A;  2AV4 A;  5A4W A;  1Z6M A;  4WET A;  3C73 A;  3GHA A;  1J08 A;  3GIX A;  3CYN A;  5B6M A;  2VCX A;  1FHE A;  2L57 A;  3IC4 A;  5IMZ A;  2H74 A;  2M80 A;  2OBK A;  2H1A A;  3CRT A;  1YF1 A;  3EYT A;  1MDK A;  4XS4 A;  1PN9 A;  4YH2 A;  4EIP A;  1A2M A;  4KF9 A;  4G19 A;  1B4P A;  5DAL B;  3TOT A;  3UOM A;  4YAP A;  1MDI A;  1TU8 A;  2C0E A;  2I4A A;  1T4Y A;  1PKW A;  3ZRD A;  1WRY A;  1YF0 A;  2L5L A;  5IMC A;  4L0W A;  5G2Z A;  3D21 A;  1V40 A;  4Z2R A;  2VO4 A;  3A5I A;  1K0B A;  1M2D A;  1WJK A;  3Q6O A;  4MF5 A;  4OFN A;  4PXO A;  2CX4 A;  1VRS D;  3TKP A;  3GSS A;  2M46 A;  1Z7R A;  1TKD B;  5F05 A;  1FVK A;  2EIR A;  2YJH A;  2DLX A;  5G5F A;  3CXG A;  1EOH A;  2C80 A;  1DE2 A;  3TRQ A;  3WT2 A;  4RI7 A;  3ZVJ A;  1GSY A;  3IOS A;  2N5B A;  4RQR A;  3FMW A;  2HRK A;  1B9X C;  4KE3 A;  2XBI A;  1JZW A;  2F8A A;  1M7T A;  2BJX A;  4K1F A;  2EIO A;  2HRF A;  2A2R A;  5B7C A;  2LNT A;  4GST A;  2XPD A;  4LMW A;  1SKW B;  1QMV A;  4AJ6 A;  4BPY A;  1SEN A;  3EMP A;  2H76 A;  5ECR B;  1ZZY A;  2X4A A;  3FKF A;  3M9J A;  5J9B A;  2FD3 A;  4KA0 A;  1XW6 A;  5HFG A;  1BAY A;  5GAN D;  1PL1 A;  3QAW A;  3M0F A;  2FWE A;  1SKR B;  1YDK A;  4JED A;  3E3E A;  2E2G A;  3LW9 A;  1XPV A;  3DRN A;  1YZX A;  1SYR A;  5CRW A;  1ST9 A;  2MYG A;  4TXO A;  4XTS A;  5J5N A;  3GMF A;  5DQY A;  1F2E A;  5CP1 A;  3HVS A;  2X8H A;  5CO3 A;  2X8C A;  2PBJ A;  2GTU A;  2CAQ A;  3EUR A;  3UMA A;  13GS A;  4ICY A;  5IMF A;  1EP8 A;  2H01 A;  2OE0 A;  1PL2 A;  5DJL A;  4F0B A;  2JSZ A;  3BCK A;  4E8H A;  3DXB A;  5F07 A;  5AIV A;  2GZZ A;  5E59 A;  5ENU A;  2YV9 A;  2HZE B;  4JR4 A;  5DAK B;  1O7U A;  5F0G A;  3KEB A;  4G0K A;  5HQP A;  4I6X A;  2R0P A;  4BVX A;  2WDU A;  1HYU A;  5JWR B;  2LRN A;  1LJR A;  2ZCT A;  4DEJ A;  4BA7 A;  1OC3 A;  3ZIJ A;  4D73 B;  4IEL A;  1M2B A;  2PN8 A;  4HUA A;  2GDR A;  2B1K A;  1QXH A;  3UIW A;  2OAC A;  3GH6 A;  3GKX A;  2HSY A;  1U3A A;  5HFI A;  3VK9 A;  1DBY A;  2V32 A;  1XIY A;  2IME A;  4G9H A;  4XS6 A;  3DIE A;  2C3T A;  2P5Q A;  1Z6N A;  4ISD A;  5COH A;  5D9W A;  1G6W A;  4YKG A;  5H5R A;  2LS5 A;  4X43 A;  1NM3 A;  4DSR A;  2YJ7 A;  1W4V A;  5IO2 A;  3W6G A;  1Q4J A;  1RQM A;  4GTU A;  2IWT A;  1A23 A;  1MD3 A;  1ZYP A;  4AGS A;  1EEJ A;  4MJA A;  4KH7 A;  2ZUP A;  1AW9 A;  1T7P B;  1YEX A;  4MH3 A;  4IN0 A;  1F37 A;  3TKR A;  3HCZ A;  1A8L A;  4PTS A;  2RM5 A;  3UL3 A;  4WF5 A;  1R5A A;  1TI1 A;  1G0T A;  3HHV A;  3F0I A;  3PPU A;  4KCE A;  2R2J A;  1WMJ A;  3BD2 A;  1U6T A;  1WOU A;  4FYB A;  4J56 E;  1THX A;  2LEG A;  2DML A;  2GGT A;  2GSS A;  4XRA A;  1GTU A;  4Z2U A;  2VAF A;  3H4K A;  3WGD A;  4ZB6 A;  5E4W A;  3ZIV A;  1LBK A;  2DJ2 A;  1RK4 A;  4AF2 A;  3G7Y A;  4BL7 B;  3LYP A;  1ZMA A;  1YKC A;  2HNL A;  3APO A;  4F2I A;  2YWM A;  1A0F A;  2VM1 A;  5AIX A;  1XOA A;  2FCH A;  5GZZ B;  3IC8 A;  4K5R A;  1G7E A;  5G1L A;  2F8F A;  2RM6 A;  4KSM A;  1GUH A;  3HZ8 A;  1O73 A;  3GH9 A;  2R3X A;  1M0U A;  3GL5 A;  2DJJ A;  4IS0 A;  3FZ9 A;  3VLN A;  2E2M A;  2O7K A;  4IBP A;  5JWQ B;  1WP0 A;  1OAZ A;  4A5P A;  2MZC A;  1XVW A;  4N0Z A;  1GWC A;  1F6M C;  4MJC A;  4HQZ A;  2QSI A;  4ECJ A;  3KMO A;  3R2Q A;  2NBS A;  2H73 A;  3V1W A;  1OVN A;  3H8Q A;  3TB2 A;  4X0X A;  1FVJ A;  1V9W A;  3GTU A;  2AHE A;  4POB A;  4TN8 A;  4AJ8 A;  1EZK A;  1QK8 A;  1XWG A;  2DIZ A;  2H70 A;  2NDO A;  3TGZ A;  3ZMK A;  3M9K A;  4Z2T A;  3ME7 A;  3KIJ A;  3IBH A;  4KCA A;  2ALB A;  4FH8 A;  1VF1 A;  2WJU A;  1GSQ A;  3CSJ A;  3PGT A;  3EPT A;  1YQ1 A;  2YZU A;  3QOU A;  3ZZX A;  2DJK A;  3UBL A;  3IRA A;  1A8Y A;  2ON5 A;  5CRH A;  1HD2 A;  2LQQ A;  5KOW A;  1VF3 A;  2VOC A;  3F9U A;  2VD0 A;  1CQH A;  5ECI B;  3VWW A;  3WD6 A;  5ECS A;  3NIV A;  1XZO A;  3CTF A;  2H66 A;  1ON4 A;  1OC9 A;  2B7J A;  4I2U A;  5IPG A;  1K0M A;  5G1K A;  1URM A;  5EPF A;  4HU9 A;  3BBY A;  5HR0 A;  1WIK A;  2B3S A;  4QQ7 A;  2IMI A;  2H6Y A;  4JR6 A;  3N5O A;  2G0F A;  4NHZ A;  3IAM 2;  2DKI A;  3FK8 A;  3EIN A;  5CAX A;  2EIQ A;  4TR3 A;  1K3L A;  2IMD A;  4YAV A;  2JAD A;  1XWC A;  4ZBA A;  2HRA A;  2H71 A;  2MMN A;  3GL3 A;  5H5S A;  1TXX A;  5H5Q A;  2JSY A;  4WBR D;  4F0C A;  5JCG A;  3BCI A;  2IL3 A;  2K9F A;  1UA5 A;  1SL0 B;  3TDG A;  3R3E A;  4EL1 A;  2X8G A;  4IVF A;  3LFL A;  2YCD A;  2PVQ A;  3C71 A;  1S3A A;  1ABA A;  1OYJ A;  4NV2 A;  3ZLP A;  4OO4 A;  1K3Y A;  3CRU A;  4X1U A;  3G9B A;  18GS A;  3P8W A;  4XS4 B;  2N5F A;  2AB6 A;  2MMZ A;  1B9Y C;  4WR5 A;  4FIW A;  1DUG A;  2I1U A;  3IDV A;  5D96 A;  3FR6 A;  3J7Y b;  3MAK A;  5D93 A;  4X4J A;  4K5S A;  1HNA A;  1S3D A;  2VL9 A;  4EDY A;  3MWH A;  16GS A;  4XCS A;  4WR4 A;  2YAN A;  3F4R A;  4KND A;  1UVZ A;  5C04 A;  4TOP A;  3VPT A;  1G7O A;  2H6X A;  5ID2 A;  1N2A A;  1XXU A;  4MZB A;  2VUP A;  3QR6 A;  1Z3E A;  2B5Y A;  1RW1 A;  2O87 A;  3QD9 A;  4Q5F A;  2CVK A;  2A4H A;  4CY6 A;  1SJI A;  4K7O A;  1Q98 A;  2C4J A;  4PX1 A;  5D9V A;  2VCV A;  2PU9 C;  4ML1 A;  4JZQ A;  5CYY A;  3GX0 A;  3HJP A;  3HZ4 A;  1EGO A;  1USB A;  2V2G A;  2YPM A;  3MDK A;  2GSQ A;  1X9S B;  4OFT A;  5G5E A;  4K6X A;  2GT5 A;  1JFU A;  4GXZ A;  2YWO A;  3IK9 A;  5KEJ A;  3RBT A;  1GSD A;  3TJK A;  3I69 A;  2LTK A;  1GSF A;  3KTB A;  1AQV A;  3GUS A;  3TRX A;  1JZO A;  1XVQ A;  1O8W A;  4K7I A;  4MLY A;  1B8X A;  3VI7 A;  1AUC A;  1GNE A;  4MH2 A;  3TCO A;  2DKH A;  2OBI A;  1V58 A;  3KGK A;  4TXV A;  4HJ2 A;  2A2P A;  1TTZ A;  4GLT A;  1FB6 A;  3W8S A;  2FUG 2;  3BJ5 A;  3C1S A;  1GP1 A;  3LGC A;  1GLP A;  4TXO B;  2C0G A;  2H72 A;  4P3Y B;  2HYX A;  1XWA A;  3TOU A;  3FEU A;  3IK7 A;  3RPN A;  3MNG A;  4F82 A;  3DGQ A;  1PSQ A;  3HKR A;  4G2E A;  3VPQ A;  3LSZ A;  1TK5 B;  1YKA A;  2H0H A;  5D9T A;  3DEX A;  3DYR A;  2E7P A;  2H19 A;  3DD3 A;  3IV4 A;  3KCM A;  2QA1 A;  1BX9 A;  5IOX A;  4ML6 A;  2IFQ A;  6GSS A;  2L4C A;  2DC5 A;  5IPH A;  3ERG A;  3HY2 A;  5IO0 A;  2I9H A;  5EY6 A;  1ERT A;  1WE0 A;  2ES7 A;  2L6D A;  4Q5Q A;  4MJB A;  3O3T A;  4HZ2 A;  4PGT A;  4TR1 A;  1HNC A;  3VI5 A;  1V98 A;  1YJ6 A;  5J4U A;  4O5Q A;  4CDO A;  1TU7 A;  2P0G A;  1FAA A;  3A5W A;  1OKT A;  5B8B A;  1ERW A;  3P90 A;  3NOF A;  3F6F A;  1ZYE A;  3APS A;  1KEB A;  2V6O A;  4IJI A;  3M3M A;  4Z7X A;  1BG5 A;  3Q74 A;  2FY6 A;  1C72 A;  2H1B A;  2KUC A;  2OA7 A;  2I3Y A;  2GST A;  1VGL A;  3L0H A;  3GKN A;  5ECH B;  4ZB9 A;  1SK0 A;  5KN0 A;  5D9X A;  2YNX A;  3I43 A;  3LWA A;  5ECM B;  2B1L A;  1M9A A;  4KW6 A;  4YQV A;  1A24 A;  2GQK A;  3F4T A;  3M1G A;  3JCM L;  5FHI A;  3G7I A;  2KP1 A;  2GS3 A;  4GRF A;  2PMT A;  4BVY A;  3DWV A;  1TI3 A;  1M99 A;  3CMI A;  1MEK A;  3IAS 2;  1T00 A;  3VUR A;  3TUE A;  1I9D A;  4MPF A;  3TKS C;  4GQF A;  5J9C A;  2H6Z A;  17GS A;  3GST A;  1XCC A;  1J9B A;  2B5X A;  1R5P A;  1Z9H A;  1JLV A;  2DJ0 A;  4IJ3 A;  3ZTL A;  1GRX A;  1FO5 A;  4MAB A;  3IXR A;  2JL4 A;  3A2X A;  4V2L A;  1T4Z A;  3A3T A;  2JAC A;  1NHY A;  3AY8 A;  1SYX A;  1EV9 A;  4ULX A;  3L9U A;  4IP6 A;  4POM A;  4I2T A;  1B48 A;  6GSW A;  4LMV A;  4IKH A;  2L6C A;  1ERV A;  1WPI A;  3LJR A;  6GSX A;  1EV4 A;  4MZW A;  1JHB A;  2HSM A;  4NV5 A;  3WGE A;  1KNG A;  2I81 A;  2YWI A;  3A2W A;  1U87 A;  1EEM A;  5CRD A;  3RHB A;  2H8L A;  4O92 A;  2DBC A;  2KLX A;  3MIX A;  2CT6 A;  2VD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...