3RAZA

The crystal structure of thioredoxin-related protein from neisseria meningitidis serogroup b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
135
structure length
135
Chain Sequence
ELAGWKDNTPQSLQSLKAPVRIVNLWATWCGPCRKEMPAMSKWYKAQKKGSVDMVGIALDTSDNIGNFLKQTPVSYPIWRYTGANSRNFMKTYGNTVGVLPFTVVEAPKCGYRQTITGEVNEKSLTDAVKLAHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin-related protein
publication title The crystal structure of thioredoxin-related protein from Neisseria meningitidis serogroup B
rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Oxidoreductase
total genus 33
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2011-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3razA00
2YV9A 1R7HA 5DQSA 5IIZA 2LTKA 1MDKA 5AISA 2BJXA 2B5YA 3HA9A 1TKDB 4ML1A 5ECSA 2OA7A 3ZLPA 1CQHA 4RI6A 3QD9A 1SENA 1AQXA 2MBTA 20GSA 1XW9A 2RM6A 1GSSA 2B5EA 4MA9A 4MZWA 5ECMB 2YANA 1ACVA 1T7PB 1QQ2A 5LCZA 1A24A 2IMEA 1URMA 3GURA 4IS0A 4XRAA 3DGQA 1VF1A 3P7XA 4ZBBA 5ID2A 2H75A 3BBYA 2IJYA 1QGVA 4K0NA 4NAXA 1YEPA 5HQPA 2KLXA 5HR2A 2D2ZA 2VL3A 1TRVA 4IP1A 2NBSA 4K7OA 1U88A 1T3BA 1GSYA 3ME7A 5B7CA 3DXBA 3VURA 3IDVA 1FB6A 4N10A 1K3OA 1GTAA 4X43A 2XC2A 4Q5NA 2HZFA 2N5AA 1OKTA 3IBHA 3GKMA 5D8IA 3M3MA 4J2FA 5IM9A 5J41A 4TXOB 2PWJA 3ZMLA 3ERFA 2NDOA 2CQ9A 2YV7A 6GSSA 1YEXA 4TXVA 2DJ2A 5H5RA 3A5WA 4CHSA 2VD1A 1YZXA 2I9HA 1ZCPA 4HI7A 3F4RA 3U6VA 1Y25A 3QFAC 3D5JA 3UEMA 2VL9A 4Q5FA 2H73A 4OMVA 3FRCA 2VD0A 1EOHA 4XIHA 2YP6A 5ECLB 2J23A 2RLIA 3ZIJA 5IO2A 3CRTA 3CXGA 2YZHA 1PKWA 4HOJA 1GH2A 2X64A 5HR1A 1WOUA 4ZL7A 1AIUA 3R2QA 1J08A 1PL1A 5D93A 2C0DA 2HZEB 3ZVJA 2K18A 1PD21 3MSZA 1C72A 3UJ1A 4F9ZA 3F8UA 5D9WA 3ZREA 1GP1A 1H4OA 3GH6A 3RBTA 2E2MA 4L8EA 2RUFA 2LUSA 1TK0B 4GTUA 3KEBA 2AB6A 2HSHA 4Z7XA 5A4UA 1Z5YE 4J57E 3H8QA 1BG5A 4F0CA 2P5QA 6GSXA 1XWGA 1RQMA 4OFTA 2FHEA 1PSQA 1TJDA 2WJUA 3CMIA 4PX1A 2E2GA 4KUNA 2IWTA 5J5NA 4OFNA 2GVPA 2ON7A 2JSYA 4AJ8A 1PQNA 3M9KA 2H76A 1GRXA 1TI3A 2GQLA 4OCFA 3M0FA 3DVXA 1YQ1A 1OE7A 3MDKA 1K3YA 4HQZA 5ECIB 1TDIA 1FOVA 1OC9B 1GL8A 3UL3A 3HYPA 2L6CA 1DE2A 3DIEA 4KW6A 3H93A 1SJ6A 3GX0A 3UAPA 3TJKA 2GTUA 2F9SA 4WF4A 1TK8B 1GSEA 3VWVA 1PKZA 1JZDA 5F0GA 3G7IA 1FB0A 2YN1A 5IMAA 3VPQA 2HSYA 3HDCA 1MD3A 1IYHA 3I6AA 2VO4A 3QMXA 2B5XA 2V32A 5JWQB 3HY2A 1XW5A 1X9MB 1U3AA 3TKPA 5KN1A 1B9YC 5IOXA 2PUKC 4JU5A 1SK1A 2C0EA 2VLTA 2ALBA 4KCAA 3KTBA 5EPFA 2MZCA 2H30A 1WWJA 2IMIA 3EU4A 4TXOA 2R2JA 1VF3A 1B4QA 1ZYEA 4YQMA 4K6XA 3TGZA 3GX8A 1DE1A 1RK4A 1K3LA 5IPGA 3F4TA 3A2VA 4ECJA 1M2DA 2H19A 3FW2A 4V1Ag 1G7OA 3KTLA 1FHEA 4WBRD 2H70A 3CTFA 2AYTA 1XOBA 3P2AA 5IMDA 5GSTA 3LYKA 5KN3A 4DSSA 2WCIA 3ERWA 2LEGA 2GSRA 2VLVA 2EIQA 2YWOA 1Z6MA 4NWYA 1AQVA 2H1DA 3LFLA 2GT5A 2C3NA 4NHZA 5CNWA 1PGTA 3KMOA 1G6WA 5ID2B 1SJZA 1PMTA 4EDZA 3WGEA 4ZL8A 5J3RA 2GSTA 4JBBA 1FAAA 4F2IA 2YZUA 3L0HA 1XWAA 1A0RP 1F9MA 3EINA 1HNAA 3EMPA 2L5LA 2H66A 3TJFA 1O8WA 2B1LA 1TK5B 1A2MA 1TTZA 3TOUA 4CW9A 3WT2A 2DMMA 2H1AA 4POLA 3ZFBA 2A4VA 3KH9A 1TU8A 1GUMA 2KP2A 4EUYA 4MH2A 1PX7A 2DC5A 3ZITA 3UBKA 1GLQA 1GUKA 2K8SA 3UMAA 5D9VA 1CQGA 1K0DA 3FZ4A 3W8JA 1XBSA 2CAIA 3VPTA 2VCZA 3A2XA 1XPVA 5KEJA 1XVWA 3N9JA 1PL2A 1S3AA 4IQAA 3GUSA 1R5AA 2CVBA 3TKQA 2YWNA 2HNLA 4PNGA 2GSSA 1T1VA 4MDCA 2P5RA 2CAQA 2O89A 1MEKA 2H6YA 3KP9A 1XCCA 2FA4A 3JCML 1WJKA 4ILFA 5G30A 3DD3A 3ZTLA 1ON4A 1GTBA 3Q18A 3W6GA 4DSQA 3VWUA 1GSFA 2H1GA 1MTCA 3MNGA 4DSRA 2LJRA 5CP1A 2RM5A 3HJOA 1K0MA 1UC7A 4F03A 3QOUA 1VF2A 2XHFA 4TOPA 3BOAA 5JCWA 3TKSC 2EIOA 2C3TA 1S3CA 9GSSA 4GQFA 1S3DA 4F0BA 3J7Yk 2VIMA 1YKAA 5CRDA 3FZ5A 3L9UA 2I4AA 3GMFA 3LG6A 2O7KA 1V98A 3G7JA 4MK3A 1THXA 4NXIA 4XHMA 4EF0A 2L5OA 3D22A 1BJXA 4BVYA 1OC8A 2X8CA 3QAGA 4G19A 5DQYA 1X9SB 4QL7A 2PN8A 2OJLA 6GSTA 1E2YA 4TW5A 1NHYA 2VM1A 1AC1A 2JACA 4IW9A 5COHA 4HZ4A 3Q19A 3KJYA 2XPDA 3DRNA 2PGTA 3GFKA 4HDEA 5GSSA 4HU7A 3GRXA 3UIWA 4ZB9A 2JSZA 2F8AA 2HFDA 3QPMA 1WP0A 2B1KA 2DJKA 4MCUA 3ME8A 5DCGA 3EC3A 5KN2A 5A4WA 5B6MA 3ERGA 4L5OA 2FGXA 4XCSA 1MD4A 3EU3A 2IMKA 3E9JB 2MYGA 1SL0B 2LS5A 5FT3A 3GHAA 1JZRA 2FWEA 1XOAA 1QFNA 2C0FA 3BD2A 3CBUA 4IELA 4NV5A 2LKUA 2H71A 5CO3A 1EGOA 3BCKA 2XPEA 1YDKA 3FY7A 3F9UA 3FHKA 4POMA 2FLSA 4KDUA 3BCIA 1T00A 2LNSA 3ZVJD 1SU9A 2XBQA 1QUWA 1BEDA 4N11A 1R5PA 1EZKA 2N5FA 5IOWA 1N8JA 2R6KA 4ECIA 3FR3A 3H1NA 16GSA 3GL3A 2H6XA 3QAVA 3M1GA 2LSTA 3M8NA 2CT6A 1PN9A 1YY7A 1GNEA 2GQKA 2I1UA 5D9XA 1OC3A 2RIIA 3SBCA 1SYRA 2LJKA 6GSWA 2VUPA 2QGVA 5CYYA 4PQ1A 4LMVA 4DSSB 5G2ZA 4L0UA 3HVVA 2F51A 3FR6A 3IC4A 4XS4A 3TB2A 5J4UA 2ON5A 4MPFA 2WB9A 3I69A 5AGYA 4AJ6A 2LNTA 2GS3A 1AW9A 3DYRA 3ISOA 5ELGA 3ZFLA 2WS2A 2FWGA 14GSA 1F6MC 4EL1A 4EXJA 2OBKA 2GZYA 2DSAA 3HHVA 2H1BA 3UBLA 1FW1A 2C0GA 1XFLA 1EEMA 3HXSA 1TU7A 3GTUA 4K2DA 1FVJA 5LD0A 2LRCA 4JE1A 3L9VA 2P0GA 2WDUA 3F3RA 4TKYA 3VI5A 5A5KA 3RDWA 2CZ3A 1XWCA 3FZ9A 2AHEA 3UOMA 5HR3A 2YOIA 5IMZA 1X5EA 4IGJA 3Q6OA 2GDRA 4E8EA 5ECKB 4Q5RA 1AAZA 1ERWA 4GF0A 4IJIA 2ES7A 3DVWA 1WMJA 2QKEA 1SYXA 2YPMA 2I3YA 1J0FA 4XS6A 2B6MA 4BWSA 1JFUA 4WXTA 2A2SA 3DMLA 5CRHA 3GYKA 1ZZYA 3C1SA 3KD0A 4ID0A 4I6XA 2GGTA 4FYBA 3FEUA 2FWHA 1W89A 4ZB6A 3O6TA 4FYCA 1XWKA 4PUAA 3KXOA 3PR8A 1TW9A 1UVZA 2V41A 3E0UA 2V6KA 2JZRA 2FCHA 1ERVA 2VM2A 4JR4A 4IBPA 1PA3A 5ECRB 4G2EA 1X9WB 3L9SA 3PH9A 4GSTA 1U3IA 3GNJA 1A8LA 2FA8A 1GUHA 1ERTA 1O6JA 4MF6A 1O81A 3K8NA 3ZMKA 4L5LA 3WGDA 4X1UA 5F07A 3AY8A 3CSHA 3IPZA 2TRCP 5E4WA 22GSA 3NOFA 1ML6A 4JZQA 2JZTA 4DVCA 2HRFA 1G7EA 5DCHA 3FK8A 3CYNA 4I5QA 4XRDA 5IMFA 3TRXA 3HVSA 2R37A 5HFIA 1GWCA 1JZWA 1BX9A 4PNFA 4GSNA 3LQ7A 3IHQA 1ERUA 4JR6A 1IYIA 5EL8A 8GSSA 2R3XA 2B3SA 3LEFA 1EGRA 5AN1A 3LWAA 4DEJA 3DKSA 1U6TA 1MDIA 4FYUA 5CRGA 4N0ZA 5A4VA 1EWXA 3L78A 3I9V2 3RPPA 1V9WA 2HT9A 4GLTA 1EP8A 2MMOA 1JZOA 2DBCA 4BL7A 1SK2A 3FR9A 1SKWB 3HVXA 5DBQA 2PVQA 3TOTA 5G1LA 5EVOA 4OD7A 1I9DA 4K7NA 4BWQA 4V2NA 1X5CA 4ZBAA 2VCQA 1T8EB 2LV3A 3EVIA 5H5QA 4K8MA 2NPBA 1YJ6A 2WRTA 3D4TA 2OACA 1YF0A 4OO5A 1WRYA 5DJMA 2GZZA 2V1MA 3G9BA 3OR5A 2WULA 3C1RA 1LBKA 2HLSA 1B8XA 4ZIJA 3VK9A 5CAXA 1WE0A 3F63A 1EP7A 1OE8A 2ZUPA 5C04A 13GSA 2DMLA 3QR6A 3RHBA 2BTOT 3G7YA 5DAKA 3CRUA 2FY6A 3IR4A 3HZ4A 3C8EA 2YCDA 3GKXA 5G5EA 3GN3A 5CRWA 1VGLA 3WD6A 1XVQA 3TKRA 1O8XA 3VI7A 1VF4A 1GSDA 1F37A 1EOGA 2VCXA 1ZOFA 4TRXA 1M7TA 4WEYA 2IPAA 2CVDA 3F0IA 4ZB8A 3FYGA 1UA5A 1GSQA 2CV4A 5HFKA 3SWLA 2WZ9A 4GXZA 1M2BA 2KUCA 3UARA 4F82A 2VAFA 4IP6A 3GH9A 2RUEA 4MP4A 1XWBA 1HYUA 3IAM2 1XXUA 3TKSA 1EEJA 4KH7A 5ECQB 2H0HA 4WR5A 3PINA 4IVFA 2BMXA 3HJPA 3IE3A 4I2TA 4WETA 1T4YA 3WT1A 2C80A 2OKAA 4AJ7A 1V58A 3IXRA 1V2AA 3GA4A 1OVNA 2HYXA 4HJMA 3HCZA 4KGIA 3TJGA 4PURA 4XS4B 5F05A 4LL4B 4AF2A 1GTIA 4V2LA 2G0FA 1NW2A 4YAVA 2C1YA 1QXHA 4HS1A 4ZL9A 4TR4A 3GIXA 1SL1B 4EVMA 3P8WA 2LQOA 3KP8A 1G0TA 4KDYA 2E0QA 4MLYA 4GQCA 3HD5A 5DDLA 3QFBC 4KX4A 4YH2A 5IPHA 5KN0A 3US3A 3NZNA 4L0WA 5G31A 2H0IA 1GNWA 2TIRA 3WYWA 3GTUB 4ACSA 2F3MA 1HNBA 1NHOA 1B4PA 2N5BA 2YJ7A 4EKZA 1ZYQB 1TP9A 4RI7A 1ABAA 3U5RE 3GSSA 2PPTA 2L6DA 3HZ8A 3D0ZA 1A8YA 3TRPA 1GLPA 1WIKA 1M9AA 2VCTA 6GSVA 4O5RA 3IK7A 1VRSD 2PERA 2M72A 4CDOA 3VLNA 1YF1A 4MF5A 3IRAA 5HR0A 5B8BA 5CREA 3WGXA 2B7KA 2WFCA 1A2LA 4GWRA 3IA1A 4MJCA 4YAPA 1AQWA 5E59A 2DJ3A 2AV4A 2V2GA 2PBJA 4PQHA 2IL3A 4GCIA 2FWFA 1W4VA 3RHCA 3D21A 3KCMA 2DIZA 3VWXA 2CVKA 3EE2A 4NV2A 1F3BA 5DVBA 2CX4A 4TVEA 1XW6A 2C4JA 5G1KA 3VWWA 3VFIA 2MBSA 3O76A 2GT6A 5D96A 5B8AA 2HXKA 1NSWA 4KCEA 4ZILA 1PRXA 2XBIA 2DIYA 4MABA 1GTUA 4WBJA 4HJ2A 2DLXA 1BAYA 2IMDA 4MF7A 3IV4A 1V40A 4RQRA 1TRSA 3EYTA 3TUEA 4KB3A 1GSUA 1B9XC 3LJRA 2AUVA 3W8SA 1HQOA 4LMWA 3D4MA 3ZZXA 3A3TA 4KNDA 12GSA 1ST9A 3C73A 4MJAA 4PQIA 1TXXA 1V57A 5D73A 2HRNA 1RW1A 4I2UA 2C3QA 4JEDA 2CA8A 2B7JA 5ABRA 3HJMA 4MZCA 2LRTA 1OAZA 4MPGA 2LJAA 4BVXA 2F8FA 5HFGA 5GAPD 1Y6EA 2LQQA 1LJRA 4PXOA 1Z7PA 2P31A 4H86A 4ML6A 2HI7A 1NM3A 4TR3A 3BJ5A 4K0GA 5B6NA 4EC0A 2OE3A 1AUCA 1SKRB 1GULA 3ZIVA 1KEBA 4JRRA 2R5GA 2JL4A 5IMVA 2HE3A 4TR1A 4K1FA 5AIXA 4FH8A 5EY6A 2M46A 2IFQA 4K7IA 3LYPA 4LLRA 5GAND 3LSZA 1M9BA 4HEA2 1OKDA 1G6YA 2NTOA 5IO0A 2H72A 2IN3A 1HNCA 3APOA 3TDGA 1DSBA 5DAKB 3LXTA 2TRXA 3GKKA 1XIYA 4O32A 2K8VA 3Q74A 5DJLA 1EV4A 2H74A 5DALA 4YQUA 4KE3A 1SKSB 1N2AA 1TOFA 3IAS2 3QDNA 2ZNMA 3MAKA 2JZSA 5GZZB 5ELAA 2AAWA 1MDJA 4Q5QA 2A2RA 2L57A 4D73A 4AGSA 3EURA 1LU4A 1EV9A 4OCEA 2O85A 1JLWA 1M0UA 1HD2A 2GQMA 1ILOA 1I5GA 2PU9C 3PGTA 5AIVA 4HU9A 2PMTA 1ZMAA 1Q98A 3M9JA 2E7PA 1K0OA 5J9BA 1J9BA 1Z3EA 4IKHA 17GSA 3IOSA 4EDYA 5L71A 4MZBA 1Z7RA 2K9FA 2VL2A 6GSYA 3TRQA 3TJBA 1XZOA 5ECOB 5LNKe 1USBA 4YQVA 4P3YB 4V2MA 2VCVA 1X5DA 2VOCA 2X99A 4IN0A 1M99A 4NMUA 2H01A 19GSA 1ZL9A 3APSA 4ULXA 3D6IA 2FNOA 4BA7A 2CZ2A 3RPNA 1TRUA 1R26A 2O8VB 4GSSA 4PUFC 4XS1A 3F4SA 3GV1A 4NPBA 2NVLA 2K6VA 4N30A 4KAEA 2X8HA 4BPYA 2KP1A 4KSMA 5FWGA 5ECNB 3J7Yb 1KTEA 1TRWA 1O7UA 3F6DA 4WR4A 5F8BA 2J9HA 3LGCA 2JU5A 2MMAA 2VCWA 3E3EA 5INYA 4QQ7A 1KBNA 4WKWA 3I43A 1O85A 3EMXA 3HKRA 2DJJA 2VL2C 3A2WA 3KM6A 2KHPA 1U87A 5JCGA 4OFMA 3P90A 4QL9A 1PX6A 4FIWA 1FO5A 2V6OA 4MJEA 4O92A 1SK0A 1T4ZA 1QMVA 2REMA 5IQYA 5JWRB 3CTGA 1K0AA 1WPIA 7GSSA 4MJBA 1SL2B 3H4KA 3ZRDA 3TKSE 5D9TA 3S9FA 2QSIA 3FZAA 5ECHB 2OBIA 1DBYA 2H6ZA 3KMNA 4V1Ap 4TR0A 4WF5A 4K9ZA 4GRFA 2ZCTA 2GZPA 4EO3A 1K0BA 1A23A 1A0FA 2GLRA 4G9HA 4POKA 2DJ1A 2I81A 2WGRA 2OE1A 5J9CA 1H75A 3C7MA 3RAZA 3APQA 3KH7A 2EC4A 3KZQA 2H0GA 3TCOA 4LL1B 4KDXA 2EIRA 1A2JA 3C71A 4HZ2A 5ENUA 4FO5A 3V1WA 1K0NA 3F6FA 4HQSA 1DUGA 2YWMA 4OO4A 4J56E 2H8LA 4I97A 1QK8A 2O87A 3DEXA 1Z9HA 3GL5A 1Z6NA 3GSTA 11GSA 2MMNA 2HZEA 1X0RA 2LRNA 3DWVA 3N5OA 4OWYA 1JLVA 1BYEA 4POBA 2L4CA 1KNGA 4IHUA 1SD8A 1O73A 2X8GA 1R4WA 2Z9SA 4XTSA 4NHWA 1SJIA 2M80A 3UVHA 4ECCA 4X0XA 4RUVA 1SD9A 1OYJA 2OADA 1TI1A 5ECPB 2YNXA 3CSJA 2IIYA 2L4QA 2FD3A 4KSOA 4E8HA 4TR1B 3LORA 4ISDA 2G2QA 3EWLA 3O3TA 3LXZA 2IFQB 3H79A 5JWOB 3KGKA 1K0CA 1YKCA 4MH3A 2R4VA 4N0VA 4EE0A 1AXDA 3UVTA 2CX3A 4O7HA 3CSIA 3QCPA 2OE0A 2L59A 2YJHA 5H5SA 2JADA 4PGTA 4KA0A 3L4NA 4RQXA 2PVOC 5IMCA 1OC9A 4IQ1A 5DALB 3IK9A 10GSA 2C8UA 3ZL5A 5JCUA 4G10A 1JHBA 5C00A 6GSUA 18GSA 2FUG2 2IMFA 3QAWA 4HUAA 1ZGNA 3MWHA 3ZYWA 2KOKA 4D73B 1M2AA 4IJ3A 3F3QA 1F2EA 3FKFA 1UN2A 5FHIA 2AJQB 1FVKA 1F3AA 2VLUA 3NIVA 5G5FA 2YWIA 4ZXGA 3ED3A 1FG4A 3KIJA 1B48A 2MMZA 4MMMA 1THOA 4ECBA 5F06A 4TN8A 1Q4JA 3TJJA 1BQ7A 2QC7A 4ZBDA 2GSQA 4I8BA 1E6BA 3GKNA 2DJ0A 4LA1A
chains in the Genus database with same CATH superfamily
2YV9A 1R7HA 5DQSA 5IIZA 4CY6A 2LTKA 1MDKA 5AISA 2BJXA 2B5YA 3HA9A 1TKDB 4ML1A 5ECSA 2OA7A 3ZLPA 1CQHA 4RI6A 3QD9A 1SENA 1AQXA 2MBTA 20GSA 1XW9A 2RM6A 1GSSA 3IC8A 2B5EA 4MA9A 4MZWA 5ECMB 2YANA 4O5UA 1ACVA 1T7PB 1QQ2A 5LCZA 1A24A 2IMEA 1URMA 3GURA 4IS0A 4XRAA 3DGQA 1VF1A 3P7XA 4ZBBA 4K5SA 5ID2A 2H75A 3EPTA 3BBYA 2IJYA 1QGVA 4K0NA 4NAXA 1YEPA 5HQPA 2KLXA 5HR2A 2D2ZA 2VL3A 1ZYNA 1TRVA 4IP1A 2NBSA 4K7OA 1U88A 1T3BA 1GSYA 3ME7A 5B7CA 3DXBA 3VURA 3IDVA 1FB6A 4N10A 1K3OA 1GTAA 4X43A 2XC2A 4Q5NA 2HZFA 2N5AA 1OKTA 3IBHA 3GKMA 5D8IA 3M3MA 4J2FA 5IM9A 5J41A 4TXOB 2PWJA 3ZMLA 3ERFA 2NDOA 2CQ9A 2YV7A 6GSSA 1YEXA 4TXVA 2DJ2A 5H5RA 3A5WA 4CHSA 2VD1A 1YZXA 2I9HA 1ZCPA 4HI7A 3F4RA 3U6VA 1Y25A 3QFAC 3D5JA 3UEMA 2VL9A 4Q5FA 2H73A 4OMVA 3FRCA 2VD0A 1EOHA 4XIHA 2YP6A 5ECLB 2J23A 2RLIA 3ZIJA 5IO2A 3CRTA 3CXGA 2YZHA 1PKWA 4HOJA 1GH2A 2X64A 5HR1A 1WOUA 4ZL7A 1AIUA 3R2QA 1J08A 1PL1A 5D93A 2C0DA 2HZEB 3ZVJA 2K18A 1PD21 3MSZA 1C72A 3UJ1A 4F9ZA 3F8UA 5D9WA 3ZREA 1GP1A 1H4OA 3GH6A 3RBTA 2E2MA 4L8EA 2RUFA 2LUSA 1TK0B 4GTUA 3KEBA 2AB6A 2HSHA 4Z7XA 5A4UA 1Z5YE 4J57E 3H8QA 1BG5A 4F0CA 2P5QA 1S3RA 6GSXA 1XWGA 1RQMA 4OFTA 2FHEA 1PSQA 1TJDA 2WJUA 3CMIA 4PX1A 2E2GA 4KUNA 2IWTA 5J5NA 3CQFA 4OFNA 2GVPA 2ON7A 2JSYA 4AJ8A 1PQNA 3M9KA 2H76A 1GRXA 1TI3A 2GQLA 4OCFA 3M0FA 3DVXA 1YQ1A 1OE7A 3MDKA 1K3YA 4HQZA 5ECIB 1TDIA 1FOVA 1OC9B 1GL8A 3UL3A 3HYPA 2L6CA 1DE2A 3DIEA 4KW6A 3H93A 1SJ6A 3GX0A 3UAPA 3TJKA 2GTUA 2F9SA 4WF4A 1TK8B 1GSEA 3VWVA 1PKZA 1JZDA 5F0GA 3G7IA 1FB0A 2YN1A 5IMAA 3VPQA 2HSYA 3HDCA 4EIQA 1MD3A 1IYHA 3I6AA 2VO4A 3QMXA 2B5XA 2V32A 5JWQB 3HY2A 1XW5A 1X9MB 1U3AA 3TKPA 5KN1A 1M3JA 1B9YC 5IOXA 2PUKC 4JU5A 1SK1A 2C0EA 2VLTA 2ALBA 4KCAA 3KTBA 5EPFA 2MZCA 2H30A 1WWJA 2IMIA 3EU4A 4TXOA 2R2JA 1VF3A 1B4QA 1ZYEA 4YQMA 4K6XA 3TGZA 3GX8A 1DE1A 1RK4A 1K3LA 5IPGA 3F4TA 3A2VA 4ECJA 1M2DA 2H19A 3FW2A 4V1Ag 1G7OA 3KTLA 1FHEA 4WBRD 2H70A 3HVNA 3CTFA 2AYTA 1XOBA 3P2AA 5IMDA 5GSTA 3LYKA 5KN3A 4DSSA 2WCIA 3ERWA 2LEGA 2GSRA 2VLVA 2EIQA 2YWOA 4K5RA 1Z6MA 4NWYA 1AQVA 2H1DA 3LFLA 2GT5A 2C3NA 4NHZA 5CNWA 1PGTA 3KMOA 1G6WA 3MIXA 5ID2B 1SJZA 1PMTA 4EDZA 2R0PA 3WGEA 4ZL8A 5J3RA 2GSTA 4JBBA 1FAAA 4F2IA 2YZUA 3L0HA 1XWAA 1A0RP 1F9MA 3EINA 1HNAA 3EMPA 2L5LA 2H66A 3TJFA 1O8WA 2B1LA 1TK5B 1A2MA 1TTZA 3TOUA 4CW9A 3WT2A 2DMMA 2H1AA 4POLA 3ZFBA 2A4VA 3KH9A 2X49A 1TU8A 1GUMA 2KP2A 4EUYA 4MH2A 1PX7A 2DC5A 3ZITA 3UBKA 1GLQA 1GUKA 2K8SA 3UMAA 5D9VA 1CQGA 4X4JA 1K0DA 3FZ4A 3W8JA 1XBSA 2CAIA 3VPTA 2VCZA 4Z2TA 3A2XA 1XPVA 5KEJA 1XVWA 3N9JA 1PL2A 1S3AA 4IQAA 3GUSA 1R5AA 2CVBA 3TKQA 2YWNA 2HNLA 4PNGA 2GSSA 1T1VA 4MDCA 2P5RA 2CAQA 2O89A 1MEKA 4KF9A 2H6YA 3KP9A 1XCCA 2FA4A 3JCML 1WJKA 4ILFA 5G30A 3DD3A 3ZTLA 1ON4A 1GTBA 3Q18A 3W6GA 4DSQA 3VWUA 1GSFA 2H1GA 1MTCA 3MNGA 4DSRA 2LJRA 1M3IA 5CP1A 2RM5A 2A4HA 3HJOA 1K0MA 1UC7A 4F03A 3QOUA 1VF2A 2XHFA 4TOPA 3BOAA 5JCWA 3TKSC 2EIOA 2C3TA 1S3CA 1XG8A 2R0CA 9GSSA 4GQFA 1S3DA 4F0BA 3J7Yk 2VIMA 1YKAA 5CRDA 3FZ5A 4HSCX 3L9UA 2I4AA 3GMFA 3LG6A 2O7KA 1V98A 3G7JA 4MK3A 1THXA 4NXIA 4XHMA 4EF0A 2L5OA 3D22A 1BJXA 4BVYA 1OC8A 2X8CA 2X4AA 3QAGA 4G19A 5DQYA 1X9SB 4QL7A 2PN8A 2OJLA 6GSTA 1E2YA 4TW5A 1NHYA 2VM1A 1AC1A 2JACA 4IW9A 5COHA 4HZ4A 3Q19A 3KJYA 2XPDA 3DRNA 2PGTA 3GFKA 4HDEA 5GSSA 4HU7A 3GRXA 3UIWA 4ZB9A 2JSZA 2F8AA 2HFDA 3QPMA 1WP0A 2B1KA 2DJKA 4MCUA 3ME8A 5DCGA 4USSA 3EC3A 5KN2A 5A4WA 5B6MA 3ERGA 4L5OA 2FGXA 4XCSA 1MD4A 3EU3A 2IMKA 3E9JB 2MYGA 1SL0B 2LS5A 5FT3A 3GHAA 1JZRA 2FWEA 1XOAA 1QFNA 2C0FA 3BD2A 3CBUA 4IELA 4NV5A 2LKUA 2H71A 5CO3A 1EGOA 3BCKA 2XPEA 1YDKA 3FY7A 3F9UA 3FHKA 4POMA 2FLSA 4KDUA 3BCIA 1T00A 2LNSA 3ZVJD 1SU9A 2XBQA 1QUWA 1BEDA 4N11A 1R5PA 1EZKA 2N5FA 5IOWA 1N8JA 2R6KA 4ECIA 3FR3A 3H1NA 16GSA 3GL3A 2H6XA 3QAVA 3M1GA 2LSTA 3M8NA 2CT6A 1PN9A 1YY7A 1GNEA 2GQKA 2I1UA 5D9XA 1OC3A 4G0IA 2RIIA 3SBCA 1SYRA 2LJKA 6GSWA 2VUPA 2QGVA 5CYYA 4PQ1A 4LMVA 4DSSB 5G2ZA 4L0UA 3HVVA 2F51A 3FR6A 3IC4A 4XS4A 3TB2A 5J4UA 2ON5A 4MPFA 2WB9A 3I69A 5AGYA 4AJ6A 2LNTA 2GS3A 1AW9A 4BIKA 3DYRA 3ISOA 5ELGA 3ZFLA 2WS2A 1ZYPA 2FWGA 14GSA 1F6MC 4EL1A 4EXJA 2OBKA 2GZYA 2DSAA 3HHVA 2H1BA 3UBLA 2DKHA 1FW1A 2C0GA 1XFLA 1EEMA 3HXSA 1TU7A 3GTUA 4K2DA 1FVJA 5LD0A 2LRCA 4JE1A 3L9VA 2P0GA 2WDUA 3F3RA 4TKYA 3VI5A 5A5KA 3RDWA 2CZ3A 1XWCA 3FZ9A 2HRKA 2AHEA 3UOMA 5HR3A 2YOIA 5IMZA 1X5EA 4IGJA 3Q6OA 2GDRA 4E8EA 5ECKB 4Q5RA 1AAZA 1ERWA 4GF0A 4IJIA 2ES7A 3DVWA 1WMJA 2QKEA 1SYXA 2YPMA 2I3YA 1J0FA 4XS6A 3FMWA 2B6MA 4BWSA 1JFUA 4WXTA 2A2SA 3DMLA 5CRHA 5KOWA 3GYKA 1ZZYA 3C1SA 3KD0A 4ID0A 4I6XA 2GGTA 4FYBA 3FEUA 2FWHA 1W89A 4ZB6A 3O6TA 4FYCA 4G0LA 1PN0A 1XWKA 4PUAA 2DKIA 3KXOA 3PR8A 1TW9A 1UVZA 2V41A 3E0UA 2V6KA 2JZRA 2FCHA 1ERVA 2VM2A 4JR4A 4IBPA 1PA3A 5ECRB 4G2EA 2UZ8A 1X9WB 3L9SA 3PH9A 4GSTA 1U3IA 3GNJA 1A8LA 2FA8A 1GUHA 1ERTA 1O6JA 4MF6A 1O81A 3K8NA 3ZMKA 4L5LA 3WGDA 4X1UA 5F07A 3AY8A 3CSHA 3IPZA 2TRCP 5E4WA 22GSA 3NOFA 1ML6A 4JZQA 2JZTA 4DVCA 2HRFA 1G7EA 5DCHA 3FK8A 3CYNA 4I5QA 4XRDA 5IMFA 3TRXA 3HVSA 2R37A 5HFIA 1GWCA 1JZWA 1BX9A 4PNFA 4GSNA 3LQ7A 3IHQA 1ERUA 4JR6A 1IYIA 5EL8A 8GSSA 2R3XA 2B3SA 2A2PA 3LEFA 1EGRA 5AN1A 3LWAA 4DEJA 4BVYB 3DKSA 1U6TA 1MDIA 4FYUA 5CRGA 4N0ZA 5A4VA 1EWXA 3L78A 2HSMA 3I9V2 3RPPA 1V9WA 2HT9A 4GLTA 1EP8A 2MMOA 1JZOA 2DBCA 1PFOA 4BL7A 1SK2A 3FR9A 1SKWB 3HVXA 5DBQA 2PVQA 3TOTA 5G1LA 5EVOA 4OD7A 1I9DA 4K7NA 4BWQA 4V2NA 1X5CA 1FOHA 4YKGA 4ZBAA 2VCQA 1T8EB 2LV3A 3EVIA 5H5QA 4K8MA 2NPBA 1YJ6A 2WRTA 3D4TA 2OACA 1YF0A 4OO5A 1WRYA 3IHGA 5DJMA 2GZZA 2V1MA 3LW9A 3G9BA 3OR5A 2WULA 3C1RA 1LBKA 2HLSA 1B8XA 4ZIJA 3VK9A 5CAXA 1WE0A 3F63A 1EP7A 1OE8A 2ZUPA 5C04A 13GSA 2DMLA 3QR6A 3RHBA 2BTOT 3G7YA 5DAKA 3CRUA 2FY6A 3IR4A 3HZ4A 3C8EA 2YCDA 3GKXA 5G5EA 3GN3A 5CRWA 1VGLA 3WD6A 1XVQA 3TKRA 1O8XA 3VI7A 1VF4A 1GSDA 1F37A 1EOGA 2VCXA 1ZOFA 4TRXA 1M7TA 4WEYA 2IPAA 2CVDA 3F0IA 4ZB8A 3FYGA 1UA5A 1GSQA 2CV4A 5HFKA 3SWLA 2WZ9A 4GXZA 1M2BA 2KUCA 3UARA 4F82A 2VAFA 4IP6A 3GH9A 2RUEA 4MP4A 1XWBA 1HYUA 3IAM2 1XXUA 3TKSA 1EEJA 3R3EA 4KH7A 5ECQB 2H0HA 4WR5A 3PINA 4IVFA 2BMXA 3HJPA 3IE3A 4I2TA 4WETA 1T4YA 3WT1A 2C80A 2OKAA 4AJ7A 4MNNA 1V58A 3IXRA 1V2AA 3GA4A 1OVNA 2HYXA 4HJMA 3HCZA 4KGIA 3TJGA 4PURA 4XS4B 5F05A 4LL4B 4AF2A 1GTIA 4V2LA 2G0FA 1NW2A 4YAVA 2C1YA 1QXHA 4HS1A 4ZL9A 4TR4A 3GIXA 1SL1B 4EVMA 3P8WA 2LQOA 3KP8A 1G0TA 4KDYA 2E0QA 4MLYA 4GQCA 3HD5A 5DDLA 3QFBC 4KX4A 4YH2A 5IPHA 5KN0A 3US3A 3NZNA 4L0WA 5G31A 2H0IA 1GNWA 2TIRA 3WYWA 3GTUB 4ACSA 2F3MA 1HNBA 1NHOA 1B4PA 2N5BA 2YJ7A 4EKZA 1ZYQB 1TP9A 4RI7A 1ABAA 3U5RE 3GSSA 2PPTA 2L6DA 3HZ8A 3D0ZA 1A8YA 3TRPA 1GLPA 1WIKA 1M9AA 2VCTA 6GSVA 4O5RA 3IK7A 1VRSD 2PERA 2M72A 4CDOA 3VLNA 1YF1A 4MF5A 3IRAA 5HR0A 5B8BA 5CREA 3WGXA 2B7KA 2WFCA 1A2LA 4GWRA 3IA1A 4MJCA 4YAPA 1AQWA 5E59A 2DJ3A 2AV4A 2V2GA 2PBJA 4PQHA 2IL3A 4GCIA 2FWFA 1W4VA 3RHCA 3D21A 3KCMA 2DIZA 3VWXA 2CVKA 3EE2A 3PPUA 4NV2A 1F3BA 5DVBA 2CX4A 4TVEA 1XW6A 2C4JA 5G1KA 3VWWA 3VFIA 2MBSA 3O76A 2GT6A 5D96A 4YKFA 5B8AA 2HXKA 1NSWA 4KCEA 4ZILA 1PRXA 2XBIA 2DIYA 4MABA 1GTUA 5BRTA 4WBJA 4HJ2A 2DLXA 1BAYA 2IMDA 4MF7A 3IV4A 1V40A 4RQRA 1TRSA 3EYTA 3TUEA 4KB3A 1GSUA 1B9XC 3LJRA 2AUVA 3W8SA 1HQOA 4LMWA 3D4MA 3ZZXA 3A3TA 4KNDA 12GSA 1ST9A 4EIPA 3C73A 4MJAA 4G0KA 4PQIA 1TXXA 1V57A 5D73A 2HRNA 1RW1A 4I2UA 2C3QA 4JEDA 2CA8A 2B7JA 5ABRA 3HJMA 4MZCA 2LRTA 1OAZA 4MPGA 2LJAA 4BVXA 2F8FA 4BL7B 5HFGA 5GAPD 1Y6EA 2LQQA 3MYDA 1LJRA 4PXOA 1Z7PA 2P31A 4H86A 4ML6A 2HI7A 1NM3A 4TR3A 3BJ5A 4K0GA 5B6NA 4EC0A 2OE3A 1AUCA 1SKRB 1GULA 3ZIVA 1KEBA 4JRRA 2R5GA 2JL4A 5IMVA 2HE3A 4TR1A 4K1FA 5AIXA 4FH8A 5EY6A 2M46A 2IFQA 4K7IA 3LYPA 4LLRA 5GAND 3LSZA 1M9BA 4HEA2 1OKDA 1G6YA 2NTOA 5IO0A 2H72A 2IN3A 4FQUA 1HNCA 3APOA 3TDGA 1DSBA 4PTSA 5DAKB 3LXTA 2TRXA 3GKKA 1XIYA 4O32A 2K8VA 3Q74A 5DJLA 1EV4A 2H74A 5DALA 4YQUA 4KE3A 1SKSB 1N2AA 1TOFA 3IAS2 3QDNA 2ZNMA 3MAKA 2JZSA 5GZZB 5ELAA 2AAWA 1MDJA 4Q5QA 2A2RA 2L57A 4D73A 4AGSA 3EURA 1LU4A 1EV9A 4K2XA 4OCEA 2O85A 4CY8A 1JLWA 1M0UA 1HD2A 2GQMA 1ILOA 1I5GA 2PU9C 3PGTA 5AIVA 4HU9A 2PMTA 1ZMAA 1Q98A 3M9JA 2E7PA 1K0OA 5J9BA 1J9BA 1Z3EA 4IKHA 17GSA 3IOSA 4ICYA 4EDYA 5L71A 4MZBA 1Z7RA 2K9FA 2VL2A 6GSYA 5KOXA 3TRQA 3TJBA 1XZOA 5ECOB 5LNKe 1USBA 4YQVA 4P3YB 4V2MA 2VCVA 1X5DA 2VOCA 2X99A 4IN0A 1M99A 4NMUA 2H01A 19GSA 1ZL9A 3APSA 4ULXA 3D6IA 2FNOA 4BA7A 2CZ2A 3RPNA 1TRUA 1R26A 2O8VB 4GSSA 4PUFC 4XS1A 4Z2UA 3F4SA 3GV1A 4NPBA 2NVLA 2K6VA 4N30A 4KAEA 2X8HA 4BPYA 2KP1A 4KSMA 5FWGA 5ECNB 3J7Yb 1KTEA 1TRWA 1O7UA 3F6DA 4WR4A 5F8BA 2J9HA 3LGCA 2JU5A 2MMAA 2VCWA 3E3EA 5INYA 4QQ7A 1KBNA 4WKWA 3I43A 1O85A 3A5IA 3EMXA 3HKRA 2DJJA 2VL2C 3A2WA 3KM6A 2KHPA 1U87A 5JCGA 4OFMA 3P90A 4QL9A 1PX6A 4FIWA 1FO5A 2V6OA 4MJEA 4O92A 1SK0A 1T4ZA 1QMVA 2REMA 5IQYA 5JWRB 3CTGA 1K0AA 1WPIA 2HRAA 7GSSA 4MJBA 1SL2B 3H4KA 3ZRDA 3TKSE 5D9TA 3S9FA 2QSIA 3FZAA 5ECHB 2OBIA 1DBYA 2H6ZA 3KMNA 4V1Ap 4TR0A 4WF5A 4K9ZA 4GRFA 2ZCTA 2GZPA 4EO3A 1K0BA 1A23A 1A0FA 2GLRA 4G9HA 4POKA 2DJ1A 2I81A 2WGRA 2OE1A 5J9CA 1H75A 3C7MA 3RAZA 3APQA 3KH7A 2EC4A 3KZQA 2H0GA 3TCOA 4LL1B 4KDXA 2EIRA 2R0GA 1A2JA 3C71A 4HZ2A 2QA1A 5ENUA 4FO5A 3V1WA 1K0NA 3F6FA 4HQSA 1DUGA 2YWMA 4OO4A 4J56E 2H8LA 4I97A 1QK8A 2O87A 3DEXA 1Z9HA 3GL5A 1Z6NA 3GSTA 11GSA 2MMNA 2HZEA 1X0RA 2LRNA 3DWVA 3N5OA 4OWYA 1JLVA 4A5PA 1BYEA 4POBA 2L4CA 1KNGA 4IHUA 1SD8A 1O73A 2X8GA 1R4WA 4BVXB 4O5QA 2Z9SA 4XTSA 4NHWA 1SJIA 2M80A 3UVHA 4ECCA 4X0XA 4RUVA 1SD9A 1OYJA 2OADA 1TI1A 5ECPB 2YNXA 3CSJA 2IIYA 2L4QA 2FD3A 4KSOA 4E8HA 4TR1B 3LORA 4ISDA 2G2QA 3EWLA 4Z2RA 3O3TA 3LXZA 2IFQB 3H79A 5JWOB 3KGKA 1K0CA 1YKCA 4MH3A 2R4VA 4N0VA 4EE0A 1AXDA 3UVTA 2CX3A 4O7HA 3CSIA 3QCPA 2OE0A 2L59A 2YJHA 5H5SA 5BMUA 2JADA 4PGTA 4KA0A 3L4NA 4RQXA 2PVOC 5IMCA 1OC9A 4IQ1A 5DALB 3IK9A 10GSA 2C8UA 3ZL5A 5JCUA 4G10A 1JHBA 5C00A 6GSUA 18GSA 2FUG2 2IMFA 3QAWA 4HUAA 1ZGNA 3MWHA 3ZYWA 2KOKA 4D73B 1M2AA 4IJ3A 3F3QA 1F2EA 3FKFA 1UN2A 5FHIA 2AJQB 1FVKA 1F3AA 2VLUA 3NIVA 5G5FA 2YWIA 4ZXGA 3ED3A 1FG4A 3KIJA 1B48A 2QA2A 2MMZA 4MMMA 1THOA 4ECBA 5F06A 4TN8A 1Q4JA 3TJJA 1BQ7A 2QC7A 4ZBDA 2GSQA 4I8BA 1E6BA 3GKNA 2DJ0A 4LA1A
chains in the Genus database with same CATH topology
2YV9A 1R7HA 5DQSA 5IIZA 4CY6A 2LTKA 1MDKA 5AISA 2BJXA 2B5YA 3HA9A 1TKDB 4ML1A 5ECSA 2OA7A 3ZLPA 1CQHA 4RI6A 3QD9A 1SENA 1AQXA 2MBTA 20GSA 1XW9A 2RM6A 1GSSA 3IC8A 2B5EA 4MA9A 4MZWA 5ECMB 2YANA 4O5UA 1ACVA 1T7PB 1QQ2A 5LCZA 1A24A 2IMEA 1URMA 3GURA 4IS0A 4XRAA 3DGQA 1VF1A 3P7XA 4ZBBA 4K5SA 5ID2A 2H75A 3EPTA 3BBYA 2IJYA 1QGVA 4K0NA 4NAXA 1YEPA 5HQPA 2KLXA 5HR2A 2D2ZA 2VL3A 1ZYNA 1TRVA 4IP1A 2NBSA 4K7OA 1U88A 1T3BA 1GSYA 3ME7A 5B7CA 3DXBA 3VURA 3IDVA 1FB6A 4N10A 1K3OA 1GTAA 4X43A 2XC2A 4Q5NA 2HZFA 2N5AA 1OKTA 3IBHA 3GKMA 5D8IA 3M3MA 4J2FA 5IM9A 5J41A 4TXOB 2PWJA 3ZMLA 3ERFA 2NDOA 2CQ9A 2YV7A 6GSSA 1YEXA 4TXVA 2DJ2A 5H5RA 3A5WA 4CHSA 2VD1A 1YZXA 2I9HA 1ZCPA 4HI7A 3F4RA 3U6VA 1Y25A 3QFAC 3D5JA 3UEMA 2VL9A 4Q5FA 2H73A 4OMVA 3FRCA 2VD0A 1EOHA 4XIHA 2YP6A 5ECLB 2J23A 2RLIA 3ZIJA 5IO2A 3CRTA 3CXGA 2YZHA 1PKWA 4HOJA 1GH2A 2X64A 5HR1A 1WOUA 4ZL7A 1AIUA 3R2QA 1J08A 1PL1A 5D93A 2C0DA 2HZEB 3ZVJA 2K18A 1PD21 3MSZA 1C72A 3UJ1A 4F9ZA 3F8UA 5D9WA 3ZREA 1GP1A 1H4OA 3GH6A 3RBTA 2E2MA 4L8EA 2RUFA 2LUSA 1TK0B 4GTUA 3KEBA 2AB6A 2HSHA 4Z7XA 5A4UA 1Z5YE 4J57E 3H8QA 1BG5A 4F0CA 2P5QA 6GSXA 1XWGA 1RQMA 4OFTA 2FHEA 1PSQA 1TJDA 2WJUA 3CMIA 4PX1A 2E2GA 4KUNA 2IWTA 5J5NA 4OFNA 2GVPA 2ON7A 2JSYA 4AJ8A 1PQNA 3M9KA 2H76A 1GRXA 1TI3A 2GQLA 4OCFA 3M0FA 3DVXA 1YQ1A 1OE7A 3MDKA 1K3YA 4HQZA 5ECIB 1TDIA 1FOVA 1OC9B 1GL8A 3UL3A 3HYPA 2L6CA 1DE2A 3DIEA 4KW6A 3H93A 1SJ6A 3GX0A 3UAPA 3TJKA 2GTUA 2F9SA 4WF4A 1TK8B 1GSEA 3VWVA 1PKZA 1JZDA 5F0GA 3G7IA 1FB0A 2YN1A 5IMAA 3VPQA 2HSYA 3HDCA 4EIQA 1MD3A 1IYHA 3I6AA 2VO4A 3QMXA 2B5XA 2V32A 5JWQB 3HY2A 1XW5A 1X9MB 1U3AA 3TKPA 5KN1A 1B9YC 5IOXA 2PUKC 4JU5A 1SK1A 2C0EA 2VLTA 2ALBA 4KCAA 3KTBA 5EPFA 2MZCA 2H30A 1WWJA 2IMIA 3EU4A 4TXOA 2R2JA 1VF3A 1B4QA 1ZYEA 4YQMA 4K6XA 3TGZA 3GX8A 1DE1A 1RK4A 1K3LA 5IPGA 3F4TA 3A2VA 4ECJA 1M2DA 2H19A 3FW2A 4V1Ag 1G7OA 3KTLA 1FHEA 4WBRD 2H70A 3CTFA 2AYTA 1XOBA 3P2AA 5IMDA 5GSTA 3LYKA 5KN3A 4DSSA 2WCIA 3ERWA 2LEGA 2GSRA 2VLVA 2EIQA 2YWOA 4K5RA 1Z6MA 4NWYA 1AQVA 2H1DA 3LFLA 2GT5A 2C3NA 4NHZA 5CNWA 1PGTA 3KMOA 1G6WA 3MIXA 5ID2B 1SJZA 1PMTA 4EDZA 2R0PA 3WGEA 4ZL8A 5J3RA 2GSTA 4JBBA 1FAAA 4F2IA 2YZUA 3L0HA 1XWAA 1A0RP 1F9MA 3EINA 1HNAA 3EMPA 2L5LA 2H66A 3TJFA 1O8WA 2B1LA 1TK5B 1A2MA 1TTZA 3TOUA 4CW9A 3WT2A 2DMMA 2H1AA 4POLA 3ZFBA 2A4VA 3KH9A 2X49A 1TU8A 1GUMA 2KP2A 4EUYA 4MH2A 1PX7A 2DC5A 3ZITA 3UBKA 1GLQA 1GUKA 2K8SA 3UMAA 5D9VA 1CQGA 4X4JA 1K0DA 3FZ4A 3W8JA 1XBSA 2CAIA 3VPTA 2VCZA 4Z2TA 3A2XA 1XPVA 5KEJA 1XVWA 3N9JA 1PL2A 1S3AA 4IQAA 3GUSA 1R5AA 2CVBA 3TKQA 2YWNA 2HNLA 4PNGA 2GSSA 1T1VA 4MDCA 2P5RA 2CAQA 2O89A 1MEKA 4KF9A 2H6YA 3KP9A 1XCCA 2FA4A 3JCML 1WJKA 4ILFA 5G30A 3DD3A 3ZTLA 1ON4A 1GTBA 3Q18A 3W6GA 4DSQA 3VWUA 1GSFA 2H1GA 1MTCA 3MNGA 4DSRA 2LJRA 5CP1A 2RM5A 2A4HA 3HJOA 1K0MA 1UC7A 4F03A 3QOUA 1VF2A 2XHFA 4TOPA 3BOAA 5JCWA 3TKSC 2EIOA 2C3TA 1S3CA 2R0CA 9GSSA 4GQFA 1S3DA 4F0BA 3J7Yk 2VIMA 1YKAA 5CRDA 3FZ5A 3L9UA 2I4AA 3GMFA 3LG6A 2O7KA 1V98A 3G7JA 4MK3A 1THXA 4NXIA 4XHMA 4EF0A 2L5OA 3D22A 1BJXA 4BVYA 1OC8A 2X8CA 2X4AA 3QAGA 4G19A 5DQYA 1X9SB 4QL7A 2PN8A 2OJLA 6GSTA 1E2YA 4TW5A 1NHYA 2VM1A 1AC1A 2JACA 4IW9A 5COHA 4HZ4A 3Q19A 3KJYA 2XPDA 3DRNA 2PGTA 3GFKA 4HDEA 5GSSA 4HU7A 3GRXA 3UIWA 4ZB9A 2JSZA 2F8AA 2HFDA 3QPMA 1WP0A 2B1KA 2DJKA 4MCUA 3ME8A 5DCGA 4USSA 3EC3A 5KN2A 5A4WA 5B6MA 3ERGA 4L5OA 2FGXA 4XCSA 1MD4A 3EU3A 2IMKA 3E9JB 2MYGA 1SL0B 2LS5A 5FT3A 3GHAA 1JZRA 2FWEA 1XOAA 1QFNA 2C0FA 3BD2A 3CBUA 4IELA 4NV5A 2LKUA 2H71A 5CO3A 1EGOA 3BCKA 2XPEA 1YDKA 3FY7A 3F9UA 3FHKA 4POMA 2FLSA 4KDUA 3BCIA 1T00A 2LNSA 3ZVJD 1SU9A 2XBQA 1QUWA 1BEDA 4N11A 1R5PA 1EZKA 2N5FA 5IOWA 1N8JA 2R6KA 4ECIA 3FR3A 3H1NA 16GSA 3GL3A 2H6XA 3QAVA 3M1GA 2LSTA 3M8NA 2CT6A 1PN9A 1YY7A 1GNEA 2GQKA 2I1UA 5D9XA 1OC3A 4G0IA 2RIIA 3SBCA 1SYRA 2LJKA 6GSWA 2VUPA 2QGVA 5CYYA 4PQ1A 4LMVA 4DSSB 5G2ZA 4L0UA 3HVVA 2F51A 3FR6A 3IC4A 4XS4A 3TB2A 5J4UA 2ON5A 4MPFA 2WB9A 3I69A 5AGYA 4AJ6A 2LNTA 2GS3A 1AW9A 3DYRA 3ISOA 5ELGA 3ZFLA 2WS2A 1ZYPA 2FWGA 14GSA 1F6MC 4EL1A 4EXJA 2OBKA 2GZYA 2DSAA 3HHVA 2H1BA 3UBLA 2DKHA 1FW1A 2C0GA 1XFLA 1EEMA 3HXSA 1TU7A 3GTUA 4K2DA 1FVJA 5LD0A 2LRCA 4JE1A 3L9VA 2P0GA 2WDUA 3F3RA 4TKYA 3VI5A 5A5KA 3RDWA 2CZ3A 1XWCA 3FZ9A 2HRKA 2AHEA 3UOMA 5HR3A 2YOIA 5IMZA 1X5EA 4IGJA 3Q6OA 2GDRA 4E8EA 5ECKB 4Q5RA 1AAZA 1ERWA 4GF0A 4IJIA 2ES7A 3DVWA 1WMJA 2QKEA 1SYXA 2YPMA 2I3YA 1J0FA 4XS6A 3FMWA 2B6MA 4BWSA 1JFUA 4WXTA 2A2SA 3DMLA 5CRHA 5KOWA 3GYKA 1ZZYA 3C1SA 3KD0A 4ID0A 4I6XA 2GGTA 4FYBA 3FEUA 2FWHA 1W89A 4ZB6A 3O6TA 4FYCA 4G0LA 1PN0A 1XWKA 4PUAA 2DKIA 3KXOA 3PR8A 1TW9A 1UVZA 2V41A 3E0UA 2V6KA 2JZRA 2FCHA 1ERVA 2VM2A 4JR4A 4IBPA 1PA3A 5ECRB 4G2EA 2UZ8A 1X9WB 3L9SA 3PH9A 4GSTA 1U3IA 3GNJA 1A8LA 2FA8A 1GUHA 1ERTA 1O6JA 4MF6A 1O81A 3K8NA 3ZMKA 4L5LA 3WGDA 4X1UA 5F07A 3AY8A 3CSHA 3IPZA 2TRCP 5E4WA 22GSA 3NOFA 1ML6A 4JZQA 2JZTA 4DVCA 2HRFA 1G7EA 5DCHA 3FK8A 3CYNA 4I5QA 4XRDA 5IMFA 3TRXA 3HVSA 2R37A 5HFIA 1GWCA 1JZWA 1BX9A 4PNFA 4GSNA 3LQ7A 3IHQA 1ERUA 4JR6A 1IYIA 5EL8A 8GSSA 2R3XA 2B3SA 2A2PA 3LEFA 1EGRA 5AN1A 3LWAA 4DEJA 4BVYB 3DKSA 1U6TA 1MDIA 4FYUA 5CRGA 4N0ZA 5A4VA 1EWXA 3L78A 2HSMA 3I9V2 3RPPA 1V9WA 2HT9A 4GLTA 1EP8A 2MMOA 1JZOA 2DBCA 4BL7A 1SK2A 3FR9A 1SKWB 3HVXA 5DBQA 2PVQA 3TOTA 5G1LA 5EVOA 4OD7A 1I9DA 4K7NA 4BWQA 4V2NA 1X5CA 1FOHA 4YKGA 4ZBAA 2VCQA 1T8EB 2LV3A 3EVIA 5H5QA 4K8MA 2NPBA 1YJ6A 2WRTA 3D4TA 2OACA 1YF0A 4OO5A 1WRYA 3IHGA 5DJMA 2GZZA 2V1MA 3LW9A 3G9BA 3OR5A 2WULA 3C1RA 1LBKA 2HLSA 1B8XA 4ZIJA 3VK9A 5CAXA 1WE0A 3F63A 1EP7A 1OE8A 2ZUPA 5C04A 13GSA 2DMLA 3QR6A 3RHBA 2BTOT 3G7YA 5DAKA 3CRUA 2FY6A 3IR4A 3HZ4A 3C8EA 2YCDA 3GKXA 5G5EA 3GN3A 5CRWA 1VGLA 3WD6A 1XVQA 3TKRA 1O8XA 3VI7A 1VF4A 1GSDA 1F37A 1EOGA 2VCXA 1ZOFA 4TRXA 1M7TA 4WEYA 2IPAA 2CVDA 3F0IA 4ZB8A 3FYGA 1UA5A 1GSQA 2CV4A 5HFKA 3SWLA 2WZ9A 4GXZA 1M2BA 2KUCA 3UARA 4F82A 2VAFA 4IP6A 3GH9A 2RUEA 4MP4A 1XWBA 1HYUA 3IAM2 1XXUA 3TKSA 1EEJA 3R3EA 4KH7A 5ECQB 2H0HA 4WR5A 3PINA 4IVFA 2BMXA 3HJPA 3IE3A 4I2TA 4WETA 1T4YA 3WT1A 2C80A 2OKAA 4AJ7A 4MNNA 1V58A 3IXRA 1V2AA 3GA4A 1OVNA 2HYXA 4HJMA 3HCZA 4KGIA 3TJGA 4PURA 4XS4B 5F05A 4LL4B 4AF2A 1GTIA 4V2LA 2G0FA 1NW2A 4YAVA 2C1YA 1QXHA 4HS1A 4ZL9A 4TR4A 3GIXA 1SL1B 4EVMA 3P8WA 2LQOA 3KP8A 1G0TA 4KDYA 2E0QA 4MLYA 4GQCA 3HD5A 5DDLA 3QFBC 4KX4A 4YH2A 5IPHA 5KN0A 3US3A 3NZNA 4L0WA 5G31A 2H0IA 1GNWA 2TIRA 3WYWA 3GTUB 4ACSA 2F3MA 1HNBA 1NHOA 1B4PA 2N5BA 2YJ7A 4EKZA 1ZYQB 1TP9A 4RI7A 1ABAA 3U5RE 3GSSA 2PPTA 2L6DA 3HZ8A 3D0ZA 1A8YA 3TRPA 1GLPA 1WIKA 1M9AA 2VCTA 6GSVA 4O5RA 3IK7A 1VRSD 2PERA 2M72A 4CDOA 3VLNA 1YF1A 4MF5A 3IRAA 5HR0A 5B8BA 5CREA 3WGXA 2B7KA 2WFCA 1A2LA 4GWRA 3IA1A 4MJCA 4YAPA 1AQWA 5E59A 2DJ3A 2AV4A 2V2GA 2PBJA 4PQHA 2IL3A 4GCIA 2FWFA 1W4VA 3RHCA 3D21A 3KCMA 2DIZA 3VWXA 2CVKA 3EE2A 3PPUA 4NV2A 1F3BA 5DVBA 2CX4A 4TVEA 1XW6A 2C4JA 5G1KA 3VWWA 3VFIA 2MBSA 3O76A 2GT6A 5D96A 4YKFA 5B8AA 2HXKA 1NSWA 4KCEA 4ZILA 1PRXA 2XBIA 2DIYA 4MABA 1GTUA 5BRTA 4WBJA 4HJ2A 2DLXA 1BAYA 2IMDA 4MF7A 3IV4A 1V40A 4RQRA 1TRSA 3EYTA 3TUEA 4KB3A 1GSUA 1B9XC 3LJRA 2AUVA 3W8SA 1HQOA 4LMWA 3D4MA 3ZZXA 3A3TA 4KNDA 12GSA 1ST9A 4EIPA 3C73A 4MJAA 4G0KA 4PQIA 1TXXA 1V57A 5D73A 2HRNA 1RW1A 4I2UA 2C3QA 4JEDA 2CA8A 2B7JA 5ABRA 3HJMA 4MZCA 2LRTA 1OAZA 4MPGA 2LJAA 4BVXA 2F8FA 4BL7B 5HFGA 5GAPD 1Y6EA 2LQQA 3MYDA 1LJRA 4PXOA 1Z7PA 2P31A 4H86A 4ML6A 2HI7A 1NM3A 4TR3A 3BJ5A 4K0GA 5B6NA 4EC0A 2OE3A 1AUCA 1SKRB 1GULA 3ZIVA 1KEBA 4JRRA 2R5GA 2JL4A 5IMVA 2HE3A 4TR1A 4K1FA 5AIXA 4FH8A 5EY6A 2M46A 2IFQA 4K7IA 3LYPA 4LLRA 5GAND 3LSZA 1M9BA 4HEA2 1OKDA 1G6YA 2NTOA 5IO0A 2H72A 2IN3A 4FQUA 1HNCA 3APOA 3TDGA 1DSBA 4PTSA 5DAKB 3LXTA 2TRXA 3GKKA 1XIYA 4O32A 2K8VA 3Q74A 5DJLA 1EV4A 2H74A 5DALA 4YQUA 4KE3A 1SKSB 1N2AA 1TOFA 3IAS2 3QDNA 2ZNMA 3MAKA 2JZSA 5GZZB 5ELAA 2AAWA 1MDJA 4Q5QA 2A2RA 2L57A 4D73A 4AGSA 3EURA 1LU4A 1EV9A 4K2XA 4OCEA 2O85A 4CY8A 1JLWA 1M0UA 1HD2A 2GQMA 1ILOA 1I5GA 2PU9C 3PGTA 5AIVA 4HU9A 2PMTA 1ZMAA 1Q98A 3M9JA 2E7PA 1K0OA 5J9BA 1J9BA 1Z3EA 4IKHA 17GSA 3IOSA 4ICYA 4EDYA 5L71A 4MZBA 1Z7RA 2K9FA 2VL2A 6GSYA 5KOXA 3TRQA 3TJBA 1XZOA 5ECOB 5LNKe 1USBA 4YQVA 4P3YB 4V2MA 2VCVA 1X5DA 2VOCA 2X99A 4IN0A 1M99A 4NMUA 2H01A 19GSA 1ZL9A 3APSA 4ULXA 3D6IA 2FNOA 4BA7A 2CZ2A 3RPNA 1TRUA 1R26A 2O8VB 4GSSA 4PUFC 4XS1A 4Z2UA 3F4SA 3GV1A 4NPBA 2NVLA 2K6VA 4N30A 4KAEA 2X8HA 4BPYA 2KP1A 4KSMA 5FWGA 5ECNB 3J7Yb 1KTEA 1TRWA 1O7UA 3F6DA 4WR4A 5F8BA 2J9HA 3LGCA 2JU5A 2MMAA 2VCWA 3E3EA 5INYA 4QQ7A 1KBNA 4WKWA 3I43A 1O85A 3A5IA 3EMXA 3HKRA 2DJJA 2VL2C 3A2WA 3KM6A 2KHPA 1U87A 5JCGA 4OFMA 3P90A 4QL9A 1PX6A 4FIWA 1FO5A 2V6OA 4MJEA 4O92A 1SK0A 1T4ZA 1QMVA 2REMA 5IQYA 5JWRB 3CTGA 1K0AA 1WPIA 2HRAA 7GSSA 4MJBA 1SL2B 3H4KA 3ZRDA 3TKSE 5D9TA 3S9FA 2QSIA 3FZAA 5ECHB 2OBIA 1DBYA 2H6ZA 3KMNA 4V1Ap 4TR0A 4WF5A 4K9ZA 4GRFA 2ZCTA 2GZPA 4EO3A 1K0BA 1A23A 1A0FA 2GLRA 4G9HA 4POKA 2DJ1A 2I81A 2WGRA 2OE1A 5J9CA 1H75A 3C7MA 3RAZA 3APQA 3KH7A 2EC4A 3KZQA 2H0GA 3TCOA 4LL1B 4KDXA 2EIRA 2R0GA 1A2JA 3C71A 4HZ2A 2QA1A 5ENUA 4FO5A 3V1WA 1K0NA 3F6FA 4HQSA 1DUGA 2YWMA 4OO4A 4J56E 2H8LA 4I97A 1QK8A 2O87A 3DEXA 1Z9HA 3GL5A 1Z6NA 3GSTA 11GSA 2MMNA 2HZEA 1X0RA 2LRNA 3DWVA 3N5OA 4OWYA 1JLVA 4A5PA 1BYEA 4POBA 2L4CA 1KNGA 4IHUA 1SD8A 1O73A 2X8GA 1R4WA 4BVXB 4O5QA 2Z9SA 4XTSA 4NHWA 1SJIA 2M80A 3UVHA 4ECCA 4X0XA 4RUVA 1SD9A 1OYJA 2OADA 1TI1A 5ECPB 2YNXA 3CSJA 2IIYA 2L4QA 2FD3A 4KSOA 4E8HA 4TR1B 3LORA 4ISDA 2G2QA 3EWLA 4Z2RA 3O3TA 3LXZA 2IFQB 3H79A 5JWOB 3KGKA 1K0CA 1YKCA 4MH3A 2R4VA 4N0VA 4EE0A 1AXDA 3UVTA 2CX3A 4O7HA 3CSIA 3QCPA 2OE0A 2L59A 2YJHA 5H5SA 5BMUA 2JADA 4PGTA 4KA0A 3L4NA 4RQXA 2PVOC 5IMCA 1OC9A 4IQ1A 5DALB 3IK9A 10GSA 2C8UA 3ZL5A 5JCUA 4G10A 1JHBA 5C00A 6GSUA 18GSA 2FUG2 2IMFA 3QAWA 4HUAA 1ZGNA 3MWHA 3ZYWA 2KOKA 4D73B 1M2AA 4IJ3A 3F3QA 1F2EA 3FKFA 1UN2A 5FHIA 2AJQB 1FVKA 1F3AA 2VLUA 3NIVA 5G5FA 2YWIA 4ZXGA 3ED3A 1FG4A 3KIJA 1B48A 2QA2A 2MMZA 4MMMA 1THOA 4ECBA 5F06A 4TN8A 1Q4JA 3TJJA 1BQ7A 2QC7A 4ZBDA 2GSQA 4I8BA 1E6BA 3GKNA 2DJ0A 4LA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YV9 A;  1R7H A;  5DQS A;  5IIZ A;  2LTK A;  1MDK A;  5AIS A;  2BJX A;  2B5Y A;  3HA9 A;  1TKD B;  4ML1 A;  5ECS A;  2OA7 A;  3ZLP A;  1CQH A;  4RI6 A;  3QD9 A;  1SEN A;  1AQX A;  2MBT A;  20GS A;  1XW9 A;  2RM6 A;  1GSS A;  2B5E A;  4MA9 A;  4MZW A;  5ECM B;  2YAN A;  1ACV A;  1T7P B;  1QQ2 A;  5LCZ A;  1A24 A;  2IME A;  1URM A;  3GUR A;  4IS0 A;  4XRA A;  3DGQ A;  1VF1 A;  3P7X A;  4ZBB A;  5ID2 A;  2H75 A;  3BBY A;  2IJY A;  1QGV A;  4K0N A;  4NAX A;  1YEP A;  5HQP A;  2KLX A;  5HR2 A;  2D2Z A;  2VL3 A;  1TRV A;  4IP1 A;  2NBS A;  4K7O A;  1U88 A;  1T3B A;  1GSY A;  3ME7 A;  5B7C A;  3DXB A;  3VUR A;  3IDV A;  1FB6 A;  4N10 A;  1K3O A;  1GTA A;  4X43 A;  2XC2 A;  4Q5N A;  2HZF A;  2N5A A;  1OKT A;  3IBH A;  3GKM A;  5D8I A;  3M3M A;  4J2F A;  5IM9 A;  5J41 A;  4TXO B;  2PWJ A;  3ZML A;  3ERF A;  2NDO A;  2CQ9 A;  2YV7 A;  6GSS A;  1YEX A;  4TXV A;  2DJ2 A;  5H5R A;  3A5W A;  4CHS A;  2VD1 A;  1YZX A;  2I9H A;  1ZCP A;  4HI7 A;  3F4R A;  3U6V A;  1Y25 A;  3QFA C;  3D5J A;  3UEM A;  2VL9 A;  4Q5F A;  2H73 A;  4OMV A;  3FRC A;  2VD0 A;  1EOH A;  4XIH A;  2YP6 A;  5ECL B;  2J23 A;  2RLI A;  3ZIJ A;  5IO2 A;  3CRT A;  3CXG A;  2YZH A;  1PKW A;  4HOJ A;  1GH2 A;  2X64 A;  5HR1 A;  1WOU A;  4ZL7 A;  1AIU A;  3R2Q A;  1J08 A;  1PL1 A;  5D93 A;  2C0D A;  2HZE B;  3ZVJ A;  2K18 A;  1PD2 1;  3MSZ A;  1C72 A;  3UJ1 A;  4F9Z A;  3F8U A;  5D9W A;  3ZRE A;  1GP1 A;  1H4O A;  3GH6 A;  3RBT A;  2E2M A;  4L8E A;  2RUF A;  2LUS A;  1TK0 B;  4GTU A;  3KEB A;  2AB6 A;  2HSH A;  4Z7X A;  5A4U A;  1Z5Y E;  4J57 E;  3H8Q A;  1BG5 A;  4F0C A;  2P5Q A;  6GSX A;  1XWG A;  1RQM A;  4OFT A;  2FHE A;  1PSQ A;  1TJD A;  2WJU A;  3CMI A;  4PX1 A;  2E2G A;  4KUN A;  2IWT A;  5J5N A;  4OFN A;  2GVP A;  2ON7 A;  2JSY A;  4AJ8 A;  1PQN A;  3M9K A;  2H76 A;  1GRX A;  1TI3 A;  2GQL A;  4OCF A;  3M0F A;  3DVX A;  1YQ1 A;  1OE7 A;  3MDK A;  1K3Y A;  4HQZ A;  5ECI B;  1TDI A;  1FOV A;  1OC9 B;  1GL8 A;  3UL3 A;  3HYP A;  2L6C A;  1DE2 A;  3DIE A;  4KW6 A;  3H93 A;  1SJ6 A;  3GX0 A;  3UAP A;  3TJK A;  2GTU A;  2F9S A;  4WF4 A;  1TK8 B;  1GSE A;  3VWV A;  1PKZ A;  1JZD A;  5F0G A;  3G7I A;  1FB0 A;  2YN1 A;  5IMA A;  3VPQ A;  2HSY A;  3HDC A;  1MD3 A;  1IYH A;  3I6A A;  2VO4 A;  3QMX A;  2B5X A;  2V32 A;  5JWQ B;  3HY2 A;  1XW5 A;  1X9M B;  1U3A A;  3TKP A;  5KN1 A;  1B9Y C;  5IOX A;  2PUK C;  4JU5 A;  1SK1 A;  2C0E A;  2VLT A;  2ALB A;  4KCA A;  3KTB A;  5EPF A;  2MZC A;  2H30 A;  1WWJ A;  2IMI A;  3EU4 A;  4TXO A;  2R2J A;  1VF3 A;  1B4Q A;  1ZYE A;  4YQM A;  4K6X A;  3TGZ A;  3GX8 A;  1DE1 A;  1RK4 A;  1K3L A;  5IPG A;  3F4T A;  3A2V A;  4ECJ A;  1M2D A;  2H19 A;  3FW2 A;  4V1A g;  1G7O A;  3KTL A;  1FHE A;  4WBR D;  2H70 A;  3CTF A;  2AYT A;  1XOB A;  3P2A A;  5IMD A;  5GST A;  3LYK A;  5KN3 A;  4DSS A;  2WCI A;  3ERW A;  2LEG A;  2GSR A;  2VLV A;  2EIQ A;  2YWO A;  1Z6M A;  4NWY A;  1AQV A;  2H1D A;  3LFL A;  2GT5 A;  2C3N A;  4NHZ A;  5CNW A;  1PGT A;  3KMO A;  1G6W A;  5ID2 B;  1SJZ A;  1PMT A;  4EDZ A;  3WGE A;  4ZL8 A;  5J3R A;  2GST A;  4JBB A;  1FAA A;  4F2I A;  2YZU A;  3L0H A;  1XWA A;  1A0R P;  1F9M A;  3EIN A;  1HNA A;  3EMP A;  2L5L A;  2H66 A;  3TJF A;  1O8W A;  2B1L A;  1TK5 B;  1A2M A;  1TTZ A;  3TOU A;  4CW9 A;  3WT2 A;  2DMM A;  2H1A A;  4POL A;  3ZFB A;  2A4V A;  3KH9 A;  1TU8 A;  1GUM A;  2KP2 A;  4EUY A;  4MH2 A;  1PX7 A;  2DC5 A;  3ZIT A;  3UBK A;  1GLQ A;  1GUK A;  2K8S A;  3UMA A;  5D9V A;  1CQG A;  1K0D A;  3FZ4 A;  3W8J A;  1XBS A;  2CAI A;  3VPT A;  2VCZ A;  3A2X A;  1XPV A;  5KEJ A;  1XVW A;  3N9J A;  1PL2 A;  1S3A A;  4IQA A;  3GUS A;  1R5A A;  2CVB A;  3TKQ A;  2YWN A;  2HNL A;  4PNG A;  2GSS A;  1T1V A;  4MDC A;  2P5R A;  2CAQ A;  2O89 A;  1MEK A;  2H6Y A;  3KP9 A;  1XCC A;  2FA4 A;  3JCM L;  1WJK A;  4ILF A;  5G30 A;  3DD3 A;  3ZTL A;  1ON4 A;  1GTB A;  3Q18 A;  3W6G A;  4DSQ A;  3VWU A;  1GSF A;  2H1G A;  1MTC A;  3MNG A;  4DSR A;  2LJR A;  5CP1 A;  2RM5 A;  3HJO A;  1K0M A;  1UC7 A;  4F03 A;  3QOU A;  1VF2 A;  2XHF A;  4TOP A;  3BOA A;  5JCW A;  3TKS C;  2EIO A;  2C3T A;  1S3C A;  9GSS A;  4GQF A;  1S3D A;  4F0B A;  3J7Y k;  2VIM A;  1YKA A;  5CRD A;  3FZ5 A;  3L9U A;  2I4A A;  3GMF A;  3LG6 A;  2O7K A;  1V98 A;  3G7J A;  4MK3 A;  1THX A;  4NXI A;  4XHM A;  4EF0 A;  2L5O A;  3D22 A;  1BJX A;  4BVY A;  1OC8 A;  2X8C A;  3QAG A;  4G19 A;  5DQY A;  1X9S B;  4QL7 A;  2PN8 A;  2OJL A;  6GST A;  1E2Y A;  4TW5 A;  1NHY A;  2VM1 A;  1AC1 A;  2JAC A;  4IW9 A;  5COH A;  4HZ4 A;  3Q19 A;  3KJY A;  2XPD A;  3DRN A;  2PGT A;  3GFK A;  4HDE A;  5GSS A;  4HU7 A;  3GRX A;  3UIW A;  4ZB9 A;  2JSZ A;  2F8A A;  2HFD A;  3QPM A;  1WP0 A;  2B1K A;  2DJK A;  4MCU A;  3ME8 A;  5DCG A;  3EC3 A;  5KN2 A;  5A4W A;  5B6M A;  3ERG A;  4L5O A;  2FGX A;  4XCS A;  1MD4 A;  3EU3 A;  2IMK A;  3E9J B;  2MYG A;  1SL0 B;  2LS5 A;  5FT3 A;  3GHA A;  1JZR A;  2FWE A;  1XOA A;  1QFN A;  2C0F A;  3BD2 A;  3CBU A;  4IEL A;  4NV5 A;  2LKU A;  2H71 A;  5CO3 A;  1EGO A;  3BCK A;  2XPE A;  1YDK A;  3FY7 A;  3F9U A;  3FHK A;  4POM A;  2FLS A;  4KDU A;  3BCI A;  1T00 A;  2LNS A;  3ZVJ D;  1SU9 A;  2XBQ A;  1QUW A;  1BED A;  4N11 A;  1R5P A;  1EZK A;  2N5F A;  5IOW A;  1N8J A;  2R6K A;  4ECI A;  3FR3 A;  3H1N A;  16GS A;  3GL3 A;  2H6X A;  3QAV A;  3M1G A;  2LST A;  3M8N A;  2CT6 A;  1PN9 A;  1YY7 A;  1GNE A;  2GQK A;  2I1U A;  5D9X A;  1OC3 A;  2RII A;  3SBC A;  1SYR A;  2LJK A;  6GSW A;  2VUP A;  2QGV A;  5CYY A;  4PQ1 A;  4LMV A;  4DSS B;  5G2Z A;  4L0U A;  3HVV A;  2F51 A;  3FR6 A;  3IC4 A;  4XS4 A;  3TB2 A;  5J4U A;  2ON5 A;  4MPF A;  2WB9 A;  3I69 A;  5AGY A;  4AJ6 A;  2LNT A;  2GS3 A;  1AW9 A;  3DYR A;  3ISO A;  5ELG A;  3ZFL A;  2WS2 A;  2FWG A;  14GS A;  1F6M C;  4EL1 A;  4EXJ A;  2OBK A;  2GZY A;  2DSA A;  3HHV A;  2H1B A;  3UBL A;  1FW1 A;  2C0G A;  1XFL A;  1EEM A;  3HXS A;  1TU7 A;  3GTU A;  4K2D A;  1FVJ A;  5LD0 A;  2LRC A;  4JE1 A;  3L9V A;  2P0G A;  2WDU A;  3F3R A;  4TKY A;  3VI5 A;  5A5K A;  3RDW A;  2CZ3 A;  1XWC A;  3FZ9 A;  2AHE A;  3UOM A;  5HR3 A;  2YOI A;  5IMZ A;  1X5E A;  4IGJ A;  3Q6O A;  2GDR A;  4E8E A;  5ECK B;  4Q5R A;  1AAZ A;  1ERW A;  4GF0 A;  4IJI A;  2ES7 A;  3DVW A;  1WMJ A;  2QKE A;  1SYX A;  2YPM A;  2I3Y A;  1J0F A;  4XS6 A;  2B6M A;  4BWS A;  1JFU A;  4WXT A;  2A2S A;  3DML A;  5CRH A;  3GYK A;  1ZZY A;  3C1S A;  3KD0 A;  4ID0 A;  4I6X A;  2GGT A;  4FYB A;  3FEU A;  2FWH A;  1W89 A;  4ZB6 A;  3O6T A;  4FYC A;  1XWK A;  4PUA A;  3KXO A;  3PR8 A;  1TW9 A;  1UVZ A;  2V41 A;  3E0U A;  2V6K A;  2JZR A;  2FCH A;  1ERV A;  2VM2 A;  4JR4 A;  4IBP A;  1PA3 A;  5ECR B;  4G2E A;  1X9W B;  3L9S A;  3PH9 A;  4GST A;  1U3I A;  3GNJ A;  1A8L A;  2FA8 A;  1GUH A;  1ERT A;  1O6J A;  4MF6 A;  1O81 A;  3K8N A;  3ZMK A;  4L5L A;  3WGD A;  4X1U A;  5F07 A;  3AY8 A;  3CSH A;  3IPZ A;  2TRC P;  5E4W A;  22GS A;  3NOF A;  1ML6 A;  4JZQ A;  2JZT A;  4DVC A;  2HRF A;  1G7E A;  5DCH A;  3FK8 A;  3CYN A;  4I5Q A;  4XRD A;  5IMF A;  3TRX A;  3HVS A;  2R37 A;  5HFI A;  1GWC A;  1JZW A;  1BX9 A;  4PNF A;  4GSN A;  3LQ7 A;  3IHQ A;  1ERU A;  4JR6 A;  1IYI A;  5EL8 A;  8GSS A;  2R3X A;  2B3S A;  3LEF A;  1EGR A;  5AN1 A;  3LWA A;  4DEJ A;  3DKS A;  1U6T A;  1MDI A;  4FYU A;  5CRG A;  4N0Z A;  5A4V A;  1EWX A;  3L78 A;  3I9V 2;  3RPP A;  1V9W A;  2HT9 A;  4GLT A;  1EP8 A;  2MMO A;  1JZO A;  2DBC A;  4BL7 A;  1SK2 A;  3FR9 A;  1SKW B;  3HVX A;  5DBQ A;  2PVQ A;  3TOT A;  5G1L A;  5EVO A;  4OD7 A;  1I9D A;  4K7N A;  4BWQ A;  4V2N A;  1X5C A;  4ZBA A;  2VCQ A;  1T8E B;  2LV3 A;  3EVI A;  5H5Q A;  4K8M A;  2NPB A;  1YJ6 A;  2WRT A;  3D4T A;  2OAC A;  1YF0 A;  4OO5 A;  1WRY A;  5DJM A;  2GZZ A;  2V1M A;  3G9B A;  3OR5 A;  2WUL A;  3C1R A;  1LBK A;  2HLS A;  1B8X A;  4ZIJ A;  3VK9 A;  5CAX A;  1WE0 A;  3F63 A;  1EP7 A;  1OE8 A;  2ZUP A;  5C04 A;  13GS A;  2DML A;  3QR6 A;  3RHB A;  2BTO T;  3G7Y A;  5DAK A;  3CRU A;  2FY6 A;  3IR4 A;  3HZ4 A;  3C8E A;  2YCD A;  3GKX A;  5G5E A;  3GN3 A;  5CRW A;  1VGL A;  3WD6 A;  1XVQ A;  3TKR A;  1O8X A;  3VI7 A;  1VF4 A;  1GSD A;  1F37 A;  1EOG A;  2VCX A;  1ZOF A;  4TRX A;  1M7T A;  4WEY A;  2IPA A;  2CVD A;  3F0I A;  4ZB8 A;  3FYG A;  1UA5 A;  1GSQ A;  2CV4 A;  5HFK A;  3SWL A;  2WZ9 A;  4GXZ A;  1M2B A;  2KUC A;  3UAR A;  4F82 A;  2VAF A;  4IP6 A;  3GH9 A;  2RUE A;  4MP4 A;  1XWB A;  1HYU A;  3IAM 2;  1XXU A;  3TKS A;  1EEJ A;  4KH7 A;  5ECQ B;  2H0H A;  4WR5 A;  3PIN A;  4IVF A;  2BMX A;  3HJP A;  3IE3 A;  4I2T A;  4WET A;  1T4Y A;  3WT1 A;  2C80 A;  2OKA A;  4AJ7 A;  1V58 A;  3IXR A;  1V2A A;  3GA4 A;  1OVN A;  2HYX A;  4HJM A;  3HCZ A;  4KGI A;  3TJG A;  4PUR A;  4XS4 B;  5F05 A;  4LL4 B;  4AF2 A;  1GTI A;  4V2L A;  2G0F A;  1NW2 A;  4YAV A;  2C1Y A;  1QXH A;  4HS1 A;  4ZL9 A;  4TR4 A;  3GIX A;  1SL1 B;  4EVM A;  3P8W A;  2LQO A;  3KP8 A;  1G0T A;  4KDY A;  2E0Q A;  4MLY A;  4GQC A;  3HD5 A;  5DDL A;  3QFB C;  4KX4 A;  4YH2 A;  5IPH A;  5KN0 A;  3US3 A;  3NZN A;  4L0W A;  5G31 A;  2H0I A;  1GNW A;  2TIR A;  3WYW A;  3GTU B;  4ACS A;  2F3M A;  1HNB A;  1NHO A;  1B4P A;  2N5B A;  2YJ7 A;  4EKZ A;  1ZYQ B;  1TP9 A;  4RI7 A;  1ABA A;  3U5R E;  3GSS A;  2PPT A;  2L6D A;  3HZ8 A;  3D0Z A;  1A8Y A;  3TRP A;  1GLP A;  1WIK A;  1M9A A;  2VCT A;  6GSV A;  4O5R A;  3IK7 A;  1VRS D;  2PER A;  2M72 A;  4CDO A;  3VLN A;  1YF1 A;  4MF5 A;  3IRA A;  5HR0 A;  5B8B A;  5CRE A;  3WGX A;  2B7K A;  2WFC A;  1A2L A;  4GWR A;  3IA1 A;  4MJC A;  4YAP A;  1AQW A;  5E59 A;  2DJ3 A;  2AV4 A;  2V2G A;  2PBJ A;  4PQH A;  2IL3 A;  4GCI A;  2FWF A;  1W4V A;  3RHC A;  3D21 A;  3KCM A;  2DIZ A;  3VWX A;  2CVK A;  3EE2 A;  4NV2 A;  1F3B A;  5DVB A;  2CX4 A;  4TVE A;  1XW6 A;  2C4J A;  5G1K A;  3VWW A;  3VFI A;  2MBS A;  3O76 A;  2GT6 A;  5D96 A;  5B8A A;  2HXK A;  1NSW A;  4KCE A;  4ZIL A;  1PRX A;  2XBI A;  2DIY A;  4MAB A;  1GTU A;  4WBJ A;  4HJ2 A;  2DLX A;  1BAY A;  2IMD A;  4MF7 A;  3IV4 A;  1V40 A;  4RQR A;  1TRS A;  3EYT A;  3TUE A;  4KB3 A;  1GSU A;  1B9X C;  3LJR A;  2AUV A;  3W8S A;  1HQO A;  4LMW A;  3D4M A;  3ZZX A;  3A3T A;  4KND A;  12GS A;  1ST9 A;  3C73 A;  4MJA A;  4PQI A;  1TXX A;  1V57 A;  5D73 A;  2HRN A;  1RW1 A;  4I2U A;  2C3Q A;  4JED A;  2CA8 A;  2B7J A;  5ABR A;  3HJM A;  4MZC A;  2LRT A;  1OAZ A;  4MPG A;  2LJA A;  4BVX A;  2F8F A;  5HFG A;  5GAP D;  1Y6E A;  2LQQ A;  1LJR A;  4PXO A;  1Z7P A;  2P31 A;  4H86 A;  4ML6 A;  2HI7 A;  1NM3 A;  4TR3 A;  3BJ5 A;  4K0G A;  5B6N A;  4EC0 A;  2OE3 A;  1AUC A;  1SKR B;  1GUL A;  3ZIV A;  1KEB A;  4JRR A;  2R5G A;  2JL4 A;  5IMV A;  2HE3 A;  4TR1 A;  4K1F A;  5AIX A;  4FH8 A;  5EY6 A;  2M46 A;  2IFQ A;  4K7I A;  3LYP A;  4LLR A;  5GAN D;  3LSZ A;  1M9B A;  4HEA 2;  1OKD A;  1G6Y A;  2NTO A;  5IO0 A;  2H72 A;  2IN3 A;  1HNC A;  3APO A;  3TDG A;  1DSB A;  5DAK B;  3LXT A;  2TRX A;  3GKK A;  1XIY A;  4O32 A;  2K8V A;  3Q74 A;  5DJL A;  1EV4 A;  2H74 A;  5DAL A;  4YQU A;  4KE3 A;  1SKS B;  1N2A A;  1TOF A;  3IAS 2;  3QDN A;  2ZNM A;  3MAK A;  2JZS A;  5GZZ B;  5ELA A;  2AAW A;  1MDJ A;  4Q5Q A;  2A2R A;  2L57 A;  4D73 A;  4AGS A;  3EUR A;  1LU4 A;  1EV9 A;  4OCE A;  2O85 A;  1JLW A;  1M0U A;  1HD2 A;  2GQM A;  1ILO A;  1I5G A;  2PU9 C;  3PGT A;  5AIV A;  4HU9 A;  2PMT A;  1ZMA A;  1Q98 A;  3M9J A;  2E7P A;  1K0O A;  5J9B A;  1J9B A;  1Z3E A;  4IKH A;  17GS A;  3IOS A;  4EDY A;  5L71 A;  4MZB A;  1Z7R A;  2K9F A;  2VL2 A;  6GSY A;  3TRQ A;  3TJB A;  1XZO A;  5ECO B;  5LNK e;  1USB A;  4YQV A;  4P3Y B;  4V2M A;  2VCV A;  1X5D A;  2VOC A;  2X99 A;  4IN0 A;  1M99 A;  4NMU A;  2H01 A;  19GS A;  1ZL9 A;  3APS A;  4ULX A;  3D6I A;  2FNO A;  4BA7 A;  2CZ2 A;  3RPN A;  1TRU A;  1R26 A;  2O8V B;  4GSS A;  4PUF C;  4XS1 A;  3F4S A;  3GV1 A;  4NPB A;  2NVL A;  2K6V A;  4N30 A;  4KAE A;  2X8H A;  4BPY A;  2KP1 A;  4KSM A;  5FWG A;  5ECN B;  3J7Y b;  1KTE A;  1TRW A;  1O7U A;  3F6D A;  4WR4 A;  5F8B A;  2J9H A;  3LGC A;  2JU5 A;  2MMA A;  2VCW A;  3E3E A;  5INY A;  4QQ7 A;  1KBN A;  4WKW A;  3I43 A;  1O85 A;  3EMX A;  3HKR A;  2DJJ A;  2VL2 C;  3A2W A;  3KM6 A;  2KHP A;  1U87 A;  5JCG A;  4OFM A;  3P90 A;  4QL9 A;  1PX6 A;  4FIW A;  1FO5 A;  2V6O A;  4MJE A;  4O92 A;  1SK0 A;  1T4Z A;  1QMV A;  2REM A;  5IQY A;  5JWR B;  3CTG A;  1K0A A;  1WPI A;  7GSS A;  4MJB A;  1SL2 B;  3H4K A;  3ZRD A;  3TKS E;  5D9T A;  3S9F A;  2QSI A;  3FZA A;  5ECH B;  2OBI A;  1DBY A;  2H6Z A;  3KMN A;  4V1A p;  4TR0 A;  4WF5 A;  4K9Z A;  4GRF A;  2ZCT A;  2GZP A;  4EO3 A;  1K0B A;  1A23 A;  1A0F A;  2GLR A;  4G9H A;  4POK A;  2DJ1 A;  2I81 A;  2WGR A;  2OE1 A;  5J9C A;  1H75 A;  3C7M A;  3RAZ A;  3APQ A;  3KH7 A;  2EC4 A;  3KZQ A;  2H0G A;  3TCO A;  4LL1 B;  4KDX A;  2EIR A;  1A2J A;  3C71 A;  4HZ2 A;  5ENU A;  4FO5 A;  3V1W A;  1K0N A;  3F6F A;  4HQS A;  1DUG A;  2YWM A;  4OO4 A;  4J56 E;  2H8L A;  4I97 A;  1QK8 A;  2O87 A;  3DEX A;  1Z9H A;  3GL5 A;  1Z6N A;  3GST A;  11GS A;  2MMN A;  2HZE A;  1X0R A;  2LRN A;  3DWV A;  3N5O A;  4OWY A;  1JLV A;  1BYE A;  4POB A;  2L4C A;  1KNG A;  4IHU A;  1SD8 A;  1O73 A;  2X8G A;  1R4W A;  2Z9S A;  4XTS A;  4NHW A;  1SJI A;  2M80 A;  3UVH A;  4ECC A;  4X0X A;  4RUV A;  1SD9 A;  1OYJ A;  2OAD A;  1TI1 A;  5ECP B;  2YNX A;  3CSJ A;  2IIY A;  2L4Q A;  2FD3 A;  4KSO A;  4E8H A;  4TR1 B;  3LOR A;  4ISD A;  2G2Q A;  3EWL A;  3O3T A;  3LXZ A;  2IFQ B;  3H79 A;  5JWO B;  3KGK A;  1K0C A;  1YKC A;  4MH3 A;  2R4V A;  4N0V A;  4EE0 A;  1AXD A;  3UVT A;  2CX3 A;  4O7H A;  3CSI A;  3QCP A;  2OE0 A;  2L59 A;  2YJH A;  5H5S A;  2JAD A;  4PGT A;  4KA0 A;  3L4N A;  4RQX A;  2PVO C;  5IMC A;  1OC9 A;  4IQ1 A;  5DAL B;  3IK9 A;  10GS A;  2C8U A;  3ZL5 A;  5JCU A;  4G10 A;  1JHB A;  5C00 A;  6GSU A;  18GS A;  2FUG 2;  2IMF A;  3QAW A;  4HUA A;  1ZGN A;  3MWH A;  3ZYW A;  2KOK A;  4D73 B;  1M2A A;  4IJ3 A;  3F3Q A;  1F2E A;  3FKF A;  1UN2 A;  5FHI A;  2AJQ B;  1FVK A;  1F3A A;  2VLU A;  3NIV A;  5G5F A;  2YWI A;  4ZXG A;  3ED3 A;  1FG4 A;  3KIJ A;  1B48 A;  2MMZ A;  4MMM A;  1THO A;  4ECB A;  5F06 A;  4TN8 A;  1Q4J A;  3TJJ A;  1BQ7 A;  2QC7 A;  4ZBD A;  2GSQ A;  4I8B A;  1E6B A;  3GKN A;  2DJ0 A;  4LA1 A; 
#chains in the Genus database with same CATH topology
 2YV9 A;  1R7H A;  5DQS A;  5IIZ A;  4CY6 A;  2LTK A;  1MDK A;  5AIS A;  2BJX A;  2B5Y A;  3HA9 A;  1TKD B;  4ML1 A;  5ECS A;  2OA7 A;  3ZLP A;  1CQH A;  4RI6 A;  3QD9 A;  1SEN A;  1AQX A;  2MBT A;  20GS A;  1XW9 A;  2RM6 A;  1GSS A;  3IC8 A;  2B5E A;  4MA9 A;  4MZW A;  5ECM B;  2YAN A;  4O5U A;  1ACV A;  1T7P B;  1QQ2 A;  5LCZ A;  1A24 A;  2IME A;  1URM A;  3GUR A;  4IS0 A;  4XRA A;  3DGQ A;  1VF1 A;  3P7X A;  4ZBB A;  4K5S A;  5ID2 A;  2H75 A;  3EPT A;  3BBY A;  2IJY A;  1QGV A;  4K0N A;  4NAX A;  1YEP A;  5HQP A;  2KLX A;  5HR2 A;  2D2Z A;  2VL3 A;  1ZYN A;  1TRV A;  4IP1 A;  2NBS A;  4K7O A;  1U88 A;  1T3B A;  1GSY A;  3ME7 A;  5B7C A;  3DXB A;  3VUR A;  3IDV A;  1FB6 A;  4N10 A;  1K3O A;  1GTA A;  4X43 A;  2XC2 A;  4Q5N A;  2HZF A;  2N5A A;  1OKT A;  3IBH A;  3GKM A;  5D8I A;  3M3M A;  4J2F A;  5IM9 A;  5J41 A;  4TXO B;  2PWJ A;  3ZML A;  3ERF A;  2NDO A;  2CQ9 A;  2YV7 A;  6GSS A;  1YEX A;  4TXV A;  2DJ2 A;  5H5R A;  3A5W A;  4CHS A;  2VD1 A;  1YZX A;  2I9H A;  1ZCP A;  4HI7 A;  3F4R A;  3U6V A;  1Y25 A;  3QFA C;  3D5J A;  3UEM A;  2VL9 A;  4Q5F A;  2H73 A;  4OMV A;  3FRC A;  2VD0 A;  1EOH A;  4XIH A;  2YP6 A;  5ECL B;  2J23 A;  2RLI A;  3ZIJ A;  5IO2 A;  3CRT A;  3CXG A;  2YZH A;  1PKW A;  4HOJ A;  1GH2 A;  2X64 A;  5HR1 A;  1WOU A;  4ZL7 A;  1AIU A;  3R2Q A;  1J08 A;  1PL1 A;  5D93 A;  2C0D A;  2HZE B;  3ZVJ A;  2K18 A;  1PD2 1;  3MSZ A;  1C72 A;  3UJ1 A;  4F9Z A;  3F8U A;  5D9W A;  3ZRE A;  1GP1 A;  1H4O A;  3GH6 A;  3RBT A;  2E2M A;  4L8E A;  2RUF A;  2LUS A;  1TK0 B;  4GTU A;  3KEB A;  2AB6 A;  2HSH A;  4Z7X A;  5A4U A;  1Z5Y E;  4J57 E;  3H8Q A;  1BG5 A;  4F0C A;  2P5Q A;  1S3R A;  6GSX A;  1XWG A;  1RQM A;  4OFT A;  2FHE A;  1PSQ A;  1TJD A;  2WJU A;  3CMI A;  4PX1 A;  2E2G A;  4KUN A;  2IWT A;  5J5N A;  3CQF A;  4OFN A;  2GVP A;  2ON7 A;  2JSY A;  4AJ8 A;  1PQN A;  3M9K A;  2H76 A;  1GRX A;  1TI3 A;  2GQL A;  4OCF A;  3M0F A;  3DVX A;  1YQ1 A;  1OE7 A;  3MDK A;  1K3Y A;  4HQZ A;  5ECI B;  1TDI A;  1FOV A;  1OC9 B;  1GL8 A;  3UL3 A;  3HYP A;  2L6C A;  1DE2 A;  3DIE A;  4KW6 A;  3H93 A;  1SJ6 A;  3GX0 A;  3UAP A;  3TJK A;  2GTU A;  2F9S A;  4WF4 A;  1TK8 B;  1GSE A;  3VWV A;  1PKZ A;  1JZD A;  5F0G A;  3G7I A;  1FB0 A;  2YN1 A;  5IMA A;  3VPQ A;  2HSY A;  3HDC A;  4EIQ A;  1MD3 A;  1IYH A;  3I6A A;  2VO4 A;  3QMX A;  2B5X A;  2V32 A;  5JWQ B;  3HY2 A;  1XW5 A;  1X9M B;  1U3A A;  3TKP A;  5KN1 A;  1M3J A;  1B9Y C;  5IOX A;  2PUK C;  4JU5 A;  1SK1 A;  2C0E A;  2VLT A;  2ALB A;  4KCA A;  3KTB A;  5EPF A;  2MZC A;  2H30 A;  1WWJ A;  2IMI A;  3EU4 A;  4TXO A;  2R2J A;  1VF3 A;  1B4Q A;  1ZYE A;  4YQM A;  4K6X A;  3TGZ A;  3GX8 A;  1DE1 A;  1RK4 A;  1K3L A;  5IPG A;  3F4T A;  3A2V A;  4ECJ A;  1M2D A;  2H19 A;  3FW2 A;  4V1A g;  1G7O A;  3KTL A;  1FHE A;  4WBR D;  2H70 A;  3HVN A;  3CTF A;  2AYT A;  1XOB A;  3P2A A;  5IMD A;  5GST A;  3LYK A;  5KN3 A;  4DSS A;  2WCI A;  3ERW A;  2LEG A;  2GSR A;  2VLV A;  2EIQ A;  2YWO A;  4K5R A;  1Z6M A;  4NWY A;  1AQV A;  2H1D A;  3LFL A;  2GT5 A;  2C3N A;  4NHZ A;  5CNW A;  1PGT A;  3KMO A;  1G6W A;  3MIX A;  5ID2 B;  1SJZ A;  1PMT A;  4EDZ A;  2R0P A;  3WGE A;  4ZL8 A;  5J3R A;  2GST A;  4JBB A;  1FAA A;  4F2I A;  2YZU A;  3L0H A;  1XWA A;  1A0R P;  1F9M A;  3EIN A;  1HNA A;  3EMP A;  2L5L A;  2H66 A;  3TJF A;  1O8W A;  2B1L A;  1TK5 B;  1A2M A;  1TTZ A;  3TOU A;  4CW9 A;  3WT2 A;  2DMM A;  2H1A A;  4POL A;  3ZFB A;  2A4V A;  3KH9 A;  2X49 A;  1TU8 A;  1GUM A;  2KP2 A;  4EUY A;  4MH2 A;  1PX7 A;  2DC5 A;  3ZIT A;  3UBK A;  1GLQ A;  1GUK A;  2K8S A;  3UMA A;  5D9V A;  1CQG A;  4X4J A;  1K0D A;  3FZ4 A;  3W8J A;  1XBS A;  2CAI A;  3VPT A;  2VCZ A;  4Z2T A;  3A2X A;  1XPV A;  5KEJ A;  1XVW A;  3N9J A;  1PL2 A;  1S3A A;  4IQA A;  3GUS A;  1R5A A;  2CVB A;  3TKQ A;  2YWN A;  2HNL A;  4PNG A;  2GSS A;  1T1V A;  4MDC A;  2P5R A;  2CAQ A;  2O89 A;  1MEK A;  4KF9 A;  2H6Y A;  3KP9 A;  1XCC A;  2FA4 A;  3JCM L;  1WJK A;  4ILF A;  5G30 A;  3DD3 A;  3ZTL A;  1ON4 A;  1GTB A;  3Q18 A;  3W6G A;  4DSQ A;  3VWU A;  1GSF A;  2H1G A;  1MTC A;  3MNG A;  4DSR A;  2LJR A;  1M3I A;  5CP1 A;  2RM5 A;  2A4H A;  3HJO A;  1K0M A;  1UC7 A;  4F03 A;  3QOU A;  1VF2 A;  2XHF A;  4TOP A;  3BOA A;  5JCW A;  3TKS C;  2EIO A;  2C3T A;  1S3C A;  1XG8 A;  2R0C A;  9GSS A;  4GQF A;  1S3D A;  4F0B A;  3J7Y k;  2VIM A;  1YKA A;  5CRD A;  3FZ5 A;  4HSC X;  3L9U A;  2I4A A;  3GMF A;  3LG6 A;  2O7K A;  1V98 A;  3G7J A;  4MK3 A;  1THX A;  4NXI A;  4XHM A;  4EF0 A;  2L5O A;  3D22 A;  1BJX A;  4BVY A;  1OC8 A;  2X8C A;  2X4A A;  3QAG A;  4G19 A;  5DQY A;  1X9S B;  4QL7 A;  2PN8 A;  2OJL A;  6GST A;  1E2Y A;  4TW5 A;  1NHY A;  2VM1 A;  1AC1 A;  2JAC A;  4IW9 A;  5COH A;  4HZ4 A;  3Q19 A;  3KJY A;  2XPD A;  3DRN A;  2PGT A;  3GFK A;  4HDE A;  5GSS A;  4HU7 A;  3GRX A;  3UIW A;  4ZB9 A;  2JSZ A;  2F8A A;  2HFD A;  3QPM A;  1WP0 A;  2B1K A;  2DJK A;  4MCU A;  3ME8 A;  5DCG A;  4USS A;  3EC3 A;  5KN2 A;  5A4W A;  5B6M A;  3ERG A;  4L5O A;  2FGX A;  4XCS A;  1MD4 A;  3EU3 A;  2IMK A;  3E9J B;  2MYG A;  1SL0 B;  2LS5 A;  5FT3 A;  3GHA A;  1JZR A;  2FWE A;  1XOA A;  1QFN A;  2C0F A;  3BD2 A;  3CBU A;  4IEL A;  4NV5 A;  2LKU A;  2H71 A;  5CO3 A;  1EGO A;  3BCK A;  2XPE A;  1YDK A;  3FY7 A;  3F9U A;  3FHK A;  4POM A;  2FLS A;  4KDU A;  3BCI A;  1T00 A;  2LNS A;  3ZVJ D;  1SU9 A;  2XBQ A;  1QUW A;  1BED A;  4N11 A;  1R5P A;  1EZK A;  2N5F A;  5IOW A;  1N8J A;  2R6K A;  4ECI A;  3FR3 A;  3H1N A;  16GS A;  3GL3 A;  2H6X A;  3QAV A;  3M1G A;  2LST A;  3M8N A;  2CT6 A;  1PN9 A;  1YY7 A;  1GNE A;  2GQK A;  2I1U A;  5D9X A;  1OC3 A;  4G0I A;  2RII A;  3SBC A;  1SYR A;  2LJK A;  6GSW A;  2VUP A;  2QGV A;  5CYY A;  4PQ1 A;  4LMV A;  4DSS B;  5G2Z A;  4L0U A;  3HVV A;  2F51 A;  3FR6 A;  3IC4 A;  4XS4 A;  3TB2 A;  5J4U A;  2ON5 A;  4MPF A;  2WB9 A;  3I69 A;  5AGY A;  4AJ6 A;  2LNT A;  2GS3 A;  1AW9 A;  4BIK A;  3DYR A;  3ISO A;  5ELG A;  3ZFL A;  2WS2 A;  1ZYP A;  2FWG A;  14GS A;  1F6M C;  4EL1 A;  4EXJ A;  2OBK A;  2GZY A;  2DSA A;  3HHV A;  2H1B A;  3UBL A;  2DKH A;  1FW1 A;  2C0G A;  1XFL A;  1EEM A;  3HXS A;  1TU7 A;  3GTU A;  4K2D A;  1FVJ A;  5LD0 A;  2LRC A;  4JE1 A;  3L9V A;  2P0G A;  2WDU A;  3F3R A;  4TKY A;  3VI5 A;  5A5K A;  3RDW A;  2CZ3 A;  1XWC A;  3FZ9 A;  2HRK A;  2AHE A;  3UOM A;  5HR3 A;  2YOI A;  5IMZ A;  1X5E A;  4IGJ A;  3Q6O A;  2GDR A;  4E8E A;  5ECK B;  4Q5R A;  1AAZ A;  1ERW A;  4GF0 A;  4IJI A;  2ES7 A;  3DVW A;  1WMJ A;  2QKE A;  1SYX A;  2YPM A;  2I3Y A;  1J0F A;  4XS6 A;  3FMW A;  2B6M A;  4BWS A;  1JFU A;  4WXT A;  2A2S A;  3DML A;  5CRH A;  5KOW A;  3GYK A;  1ZZY A;  3C1S A;  3KD0 A;  4ID0 A;  4I6X A;  2GGT A;  4FYB A;  3FEU A;  2FWH A;  1W89 A;  4ZB6 A;  3O6T A;  4FYC A;  4G0L A;  1PN0 A;  1XWK A;  4PUA A;  2DKI A;  3KXO A;  3PR8 A;  1TW9 A;  1UVZ A;  2V41 A;  3E0U A;  2V6K A;  2JZR A;  2FCH A;  1ERV A;  2VM2 A;  4JR4 A;  4IBP A;  1PA3 A;  5ECR B;  4G2E A;  2UZ8 A;  1X9W B;  3L9S A;  3PH9 A;  4GST A;  1U3I A;  3GNJ A;  1A8L A;  2FA8 A;  1GUH A;  1ERT A;  1O6J A;  4MF6 A;  1O81 A;  3K8N A;  3ZMK A;  4L5L A;  3WGD A;  4X1U A;  5F07 A;  3AY8 A;  3CSH A;  3IPZ A;  2TRC P;  5E4W A;  22GS A;  3NOF A;  1ML6 A;  4JZQ A;  2JZT A;  4DVC A;  2HRF A;  1G7E A;  5DCH A;  3FK8 A;  3CYN A;  4I5Q A;  4XRD A;  5IMF A;  3TRX A;  3HVS A;  2R37 A;  5HFI A;  1GWC A;  1JZW A;  1BX9 A;  4PNF A;  4GSN A;  3LQ7 A;  3IHQ A;  1ERU A;  4JR6 A;  1IYI A;  5EL8 A;  8GSS A;  2R3X A;  2B3S A;  2A2P A;  3LEF A;  1EGR A;  5AN1 A;  3LWA A;  4DEJ A;  4BVY B;  3DKS A;  1U6T A;  1MDI A;  4FYU A;  5CRG A;  4N0Z A;  5A4V A;  1EWX A;  3L78 A;  2HSM A;  3I9V 2;  3RPP A;  1V9W A;  2HT9 A;  4GLT A;  1EP8 A;  2MMO A;  1JZO A;  2DBC A;  1PFO A;  4BL7 A;  1SK2 A;  3FR9 A;  1SKW B;  3HVX A;  5DBQ A;  2PVQ A;  3TOT A;  5G1L A;  5EVO A;  4OD7 A;  1I9D A;  4K7N A;  4BWQ A;  4V2N A;  1X5C A;  1FOH A;  4YKG A;  4ZBA A;  2VCQ A;  1T8E B;  2LV3 A;  3EVI A;  5H5Q A;  4K8M A;  2NPB A;  1YJ6 A;  2WRT A;  3D4T A;  2OAC A;  1YF0 A;  4OO5 A;  1WRY A;  3IHG A;  5DJM A;  2GZZ A;  2V1M A;  3LW9 A;  3G9B A;  3OR5 A;  2WUL A;  3C1R A;  1LBK A;  2HLS A;  1B8X A;  4ZIJ A;  3VK9 A;  5CAX A;  1WE0 A;  3F63 A;  1EP7 A;  1OE8 A;  2ZUP A;  5C04 A;  13GS A;  2DML A;  3QR6 A;  3RHB A;  2BTO T;  3G7Y A;  5DAK A;  3CRU A;  2FY6 A;  3IR4 A;  3HZ4 A;  3C8E A;  2YCD A;  3GKX A;  5G5E A;  3GN3 A;  5CRW A;  1VGL A;  3WD6 A;  1XVQ A;  3TKR A;  1O8X A;  3VI7 A;  1VF4 A;  1GSD A;  1F37 A;  1EOG A;  2VCX A;  1ZOF A;  4TRX A;  1M7T A;  4WEY A;  2IPA A;  2CVD A;  3F0I A;  4ZB8 A;  3FYG A;  1UA5 A;  1GSQ A;  2CV4 A;  5HFK A;  3SWL A;  2WZ9 A;  4GXZ A;  1M2B A;  2KUC A;  3UAR A;  4F82 A;  2VAF A;  4IP6 A;  3GH9 A;  2RUE A;  4MP4 A;  1XWB A;  1HYU A;  3IAM 2;  1XXU A;  3TKS A;  1EEJ A;  3R3E A;  4KH7 A;  5ECQ B;  2H0H A;  4WR5 A;  3PIN A;  4IVF A;  2BMX A;  3HJP A;  3IE3 A;  4I2T A;  4WET A;  1T4Y A;  3WT1 A;  2C80 A;  2OKA A;  4AJ7 A;  4MNN A;  1V58 A;  3IXR A;  1V2A A;  3GA4 A;  1OVN A;  2HYX A;  4HJM A;  3HCZ A;  4KGI A;  3TJG A;  4PUR A;  4XS4 B;  5F05 A;  4LL4 B;  4AF2 A;  1GTI A;  4V2L A;  2G0F A;  1NW2 A;  4YAV A;  2C1Y A;  1QXH A;  4HS1 A;  4ZL9 A;  4TR4 A;  3GIX A;  1SL1 B;  4EVM A;  3P8W A;  2LQO A;  3KP8 A;  1G0T A;  4KDY A;  2E0Q A;  4MLY A;  4GQC A;  3HD5 A;  5DDL A;  3QFB C;  4KX4 A;  4YH2 A;  5IPH A;  5KN0 A;  3US3 A;  3NZN A;  4L0W A;  5G31 A;  2H0I A;  1GNW A;  2TIR A;  3WYW A;  3GTU B;  4ACS A;  2F3M A;  1HNB A;  1NHO A;  1B4P A;  2N5B A;  2YJ7 A;  4EKZ A;  1ZYQ B;  1TP9 A;  4RI7 A;  1ABA A;  3U5R E;  3GSS A;  2PPT A;  2L6D A;  3HZ8 A;  3D0Z A;  1A8Y A;  3TRP A;  1GLP A;  1WIK A;  1M9A A;  2VCT A;  6GSV A;  4O5R A;  3IK7 A;  1VRS D;  2PER A;  2M72 A;  4CDO A;  3VLN A;  1YF1 A;  4MF5 A;  3IRA A;  5HR0 A;  5B8B A;  5CRE A;  3WGX A;  2B7K A;  2WFC A;  1A2L A;  4GWR A;  3IA1 A;  4MJC A;  4YAP A;  1AQW A;  5E59 A;  2DJ3 A;  2AV4 A;  2V2G A;  2PBJ A;  4PQH A;  2IL3 A;  4GCI A;  2FWF A;  1W4V A;  3RHC A;  3D21 A;  3KCM A;  2DIZ A;  3VWX A;  2CVK A;  3EE2 A;  3PPU A;  4NV2 A;  1F3B A;  5DVB A;  2CX4 A;  4TVE A;  1XW6 A;  2C4J A;  5G1K A;  3VWW A;  3VFI A;  2MBS A;  3O76 A;  2GT6 A;  5D96 A;  4YKF A;  5B8A A;  2HXK A;  1NSW A;  4KCE A;  4ZIL A;  1PRX A;  2XBI A;  2DIY A;  4MAB A;  1GTU A;  5BRT A;  4WBJ A;  4HJ2 A;  2DLX A;  1BAY A;  2IMD A;  4MF7 A;  3IV4 A;  1V40 A;  4RQR A;  1TRS A;  3EYT A;  3TUE A;  4KB3 A;  1GSU A;  1B9X C;  3LJR A;  2AUV A;  3W8S A;  1HQO A;  4LMW A;  3D4M A;  3ZZX A;  3A3T A;  4KND A;  12GS A;  1ST9 A;  4EIP A;  3C73 A;  4MJA A;  4G0K A;  4PQI A;  1TXX A;  1V57 A;  5D73 A;  2HRN A;  1RW1 A;  4I2U A;  2C3Q A;  4JED A;  2CA8 A;  2B7J A;  5ABR A;  3HJM A;  4MZC A;  2LRT A;  1OAZ A;  4MPG A;  2LJA A;  4BVX A;  2F8F A;  4BL7 B;  5HFG A;  5GAP D;  1Y6E A;  2LQQ A;  3MYD A;  1LJR A;  4PXO A;  1Z7P A;  2P31 A;  4H86 A;  4ML6 A;  2HI7 A;  1NM3 A;  4TR3 A;  3BJ5 A;  4K0G A;  5B6N A;  4EC0 A;  2OE3 A;  1AUC A;  1SKR B;  1GUL A;  3ZIV A;  1KEB A;  4JRR A;  2R5G A;  2JL4 A;  5IMV A;  2HE3 A;  4TR1 A;  4K1F A;  5AIX A;  4FH8 A;  5EY6 A;  2M46 A;  2IFQ A;  4K7I A;  3LYP A;  4LLR A;  5GAN D;  3LSZ A;  1M9B A;  4HEA 2;  1OKD A;  1G6Y A;  2NTO A;  5IO0 A;  2H72 A;  2IN3 A;  4FQU A;  1HNC A;  3APO A;  3TDG A;  1DSB A;  4PTS A;  5DAK B;  3LXT A;  2TRX A;  3GKK A;  1XIY A;  4O32 A;  2K8V A;  3Q74 A;  5DJL A;  1EV4 A;  2H74 A;  5DAL A;  4YQU A;  4KE3 A;  1SKS B;  1N2A A;  1TOF A;  3IAS 2;  3QDN A;  2ZNM A;  3MAK A;  2JZS A;  5GZZ B;  5ELA A;  2AAW A;  1MDJ A;  4Q5Q A;  2A2R A;  2L57 A;  4D73 A;  4AGS A;  3EUR A;  1LU4 A;  1EV9 A;  4K2X A;  4OCE A;  2O85 A;  4CY8 A;  1JLW A;  1M0U A;  1HD2 A;  2GQM A;  1ILO A;  1I5G A;  2PU9 C;  3PGT A;  5AIV A;  4HU9 A;  2PMT A;  1ZMA A;  1Q98 A;  3M9J A;  2E7P A;  1K0O A;  5J9B A;  1J9B A;  1Z3E A;  4IKH A;  17GS A;  3IOS A;  4ICY A;  4EDY A;  5L71 A;  4MZB A;  1Z7R A;  2K9F A;  2VL2 A;  6GSY A;  5KOX A;  3TRQ A;  3TJB A;  1XZO A;  5ECO B;  5LNK e;  1USB A;  4YQV A;  4P3Y B;  4V2M A;  2VCV A;  1X5D A;  2VOC A;  2X99 A;  4IN0 A;  1M99 A;  4NMU A;  2H01 A;  19GS A;  1ZL9 A;  3APS A;  4ULX A;  3D6I A;  2FNO A;  4BA7 A;  2CZ2 A;  3RPN A;  1TRU A;  1R26 A;  2O8V B;  4GSS A;  4PUF C;  4XS1 A;  4Z2U A;  3F4S A;  3GV1 A;  4NPB A;  2NVL A;  2K6V A;  4N30 A;  4KAE A;  2X8H A;  4BPY A;  2KP1 A;  4KSM A;  5FWG A;  5ECN B;  3J7Y b;  1KTE A;  1TRW A;  1O7U A;  3F6D A;  4WR4 A;  5F8B A;  2J9H A;  3LGC A;  2JU5 A;  2MMA A;  2VCW A;  3E3E A;  5INY A;  4QQ7 A;  1KBN A;  4WKW A;  3I43 A;  1O85 A;  3A5I A;  3EMX A;  3HKR A;  2DJJ A;  2VL2 C;  3A2W A;  3KM6 A;  2KHP A;  1U87 A;  5JCG A;  4OFM A;  3P90 A;  4QL9 A;  1PX6 A;  4FIW A;  1FO5 A;  2V6O A;  4MJE A;  4O92 A;  1SK0 A;  1T4Z A;  1QMV A;  2REM A;  5IQY A;  5JWR B;  3CTG A;  1K0A A;  1WPI A;  2HRA A;  7GSS A;  4MJB A;  1SL2 B;  3H4K A;  3ZRD A;  3TKS E;  5D9T A;  3S9F A;  2QSI A;  3FZA A;  5ECH B;  2OBI A;  1DBY A;  2H6Z A;  3KMN A;  4V1A p;  4TR0 A;  4WF5 A;  4K9Z A;  4GRF A;  2ZCT A;  2GZP A;  4EO3 A;  1K0B A;  1A23 A;  1A0F A;  2GLR A;  4G9H A;  4POK A;  2DJ1 A;  2I81 A;  2WGR A;  2OE1 A;  5J9C A;  1H75 A;  3C7M A;  3RAZ A;  3APQ A;  3KH7 A;  2EC4 A;  3KZQ A;  2H0G A;  3TCO A;  4LL1 B;  4KDX A;  2EIR A;  2R0G A;  1A2J A;  3C71 A;  4HZ2 A;  2QA1 A;  5ENU A;  4FO5 A;  3V1W A;  1K0N A;  3F6F A;  4HQS A;  1DUG A;  2YWM A;  4OO4 A;  4J56 E;  2H8L A;  4I97 A;  1QK8 A;  2O87 A;  3DEX A;  1Z9H A;  3GL5 A;  1Z6N A;  3GST A;  11GS A;  2MMN A;  2HZE A;  1X0R A;  2LRN A;  3DWV A;  3N5O A;  4OWY A;  1JLV A;  4A5P A;  1BYE A;  4POB A;  2L4C A;  1KNG A;  4IHU A;  1SD8 A;  1O73 A;  2X8G A;  1R4W A;  4BVX B;  4O5Q A;  2Z9S A;  4XTS A;  4NHW A;  1SJI A;  2M80 A;  3UVH A;  4ECC A;  4X0X A;  4RUV A;  1SD9 A;  1OYJ A;  2OAD A;  1TI1 A;  5ECP B;  2YNX A;  3CSJ A;  2IIY A;  2L4Q A;  2FD3 A;  4KSO A;  4E8H A;  4TR1 B;  3LOR A;  4ISD A;  2G2Q A;  3EWL A;  4Z2R A;  3O3T A;  3LXZ A;  2IFQ B;  3H79 A;  5JWO B;  3KGK A;  1K0C A;  1YKC A;  4MH3 A;  2R4V A;  4N0V A;  4EE0 A;  1AXD A;  3UVT A;  2CX3 A;  4O7H A;  3CSI A;  3QCP A;  2OE0 A;  2L59 A;  2YJH A;  5H5S A;  5BMU A;  2JAD A;  4PGT A;  4KA0 A;  3L4N A;  4RQX A;  2PVO C;  5IMC A;  1OC9 A;  4IQ1 A;  5DAL B;  3IK9 A;  10GS A;  2C8U A;  3ZL5 A;  5JCU A;  4G10 A;  1JHB A;  5C00 A;  6GSU A;  18GS A;  2FUG 2;  2IMF A;  3QAW A;  4HUA A;  1ZGN A;  3MWH A;  3ZYW A;  2KOK A;  4D73 B;  1M2A A;  4IJ3 A;  3F3Q A;  1F2E A;  3FKF A;  1UN2 A;  5FHI A;  2AJQ B;  1FVK A;  1F3A A;  2VLU A;  3NIV A;  5G5F A;  2YWI A;  4ZXG A;  3ED3 A;  1FG4 A;  3KIJ A;  1B48 A;  2QA2 A;  2MMZ A;  4MMM A;  1THO A;  4ECB A;  5F06 A;  4TN8 A;  1Q4J A;  3TJJ A;  1BQ7 A;  2QC7 A;  4ZBD A;  2GSQ A;  4I8B A;  1E6B A;  3GKN A;  2DJ0 A;  4LA1 A; 
#chains in the Genus database with same CATH homology
 2YV9 A;  1R7H A;  5DQS A;  5IIZ A;  4CY6 A;  2LTK A;  1MDK A;  5AIS A;  2BJX A;  2B5Y A;  3HA9 A;  1TKD B;  4ML1 A;  5ECS A;  2OA7 A;  3ZLP A;  1CQH A;  4RI6 A;  3QD9 A;  1SEN A;  1AQX A;  2MBT A;  20GS A;  1XW9 A;  2RM6 A;  1GSS A;  3IC8 A;  2B5E A;  4MA9 A;  4MZW A;  5ECM B;  2YAN A;  4O5U A;  1ACV A;  1T7P B;  1QQ2 A;  5LCZ A;  1A24 A;  2IME A;  1URM A;  3GUR A;  4IS0 A;  4XRA A;  3DGQ A;  1VF1 A;  3P7X A;  4ZBB A;  4K5S A;  5ID2 A;  2H75 A;  3EPT A;  3BBY A;  2IJY A;  1QGV A;  4K0N A;  4NAX A;  1YEP A;  5HQP A;  2KLX A;  5HR2 A;  2D2Z A;  2VL3 A;  1ZYN A;  1TRV A;  4IP1 A;  2NBS A;  4K7O A;  1U88 A;  1T3B A;  1GSY A;  3ME7 A;  5B7C A;  3DXB A;  3VUR A;  3IDV A;  1FB6 A;  4N10 A;  1K3O A;  1GTA A;  4X43 A;  2XC2 A;  4Q5N A;  2HZF A;  2N5A A;  1OKT A;  3IBH A;  3GKM A;  5D8I A;  3M3M A;  4J2F A;  5IM9 A;  5J41 A;  4TXO B;  2PWJ A;  3ZML A;  3ERF A;  2NDO A;  2CQ9 A;  2YV7 A;  6GSS A;  1YEX A;  4TXV A;  2DJ2 A;  5H5R A;  3A5W A;  4CHS A;  2VD1 A;  1YZX A;  2I9H A;  1ZCP A;  4HI7 A;  3F4R A;  3U6V A;  1Y25 A;  3QFA C;  3D5J A;  3UEM A;  2VL9 A;  4Q5F A;  2H73 A;  4OMV A;  3FRC A;  2VD0 A;  1EOH A;  4XIH A;  2YP6 A;  5ECL B;  2J23 A;  2RLI A;  3ZIJ A;  5IO2 A;  3CRT A;  3CXG A;  2YZH A;  1PKW A;  4HOJ A;  1GH2 A;  2X64 A;  5HR1 A;  1WOU A;  4ZL7 A;  1AIU A;  3R2Q A;  1J08 A;  1PL1 A;  5D93 A;  2C0D A;  2HZE B;  3ZVJ A;  2K18 A;  1PD2 1;  3MSZ A;  1C72 A;  3UJ1 A;  4F9Z A;  3F8U A;  5D9W A;  3ZRE A;  1GP1 A;  1H4O A;  3GH6 A;  3RBT A;  2E2M A;  4L8E A;  2RUF A;  2LUS A;  1TK0 B;  4GTU A;  3KEB A;  2AB6 A;  2HSH A;  4Z7X A;  5A4U A;  1Z5Y E;  4J57 E;  3H8Q A;  1BG5 A;  4F0C A;  2P5Q A;  6GSX A;  1XWG A;  1RQM A;  4OFT A;  2FHE A;  1PSQ A;  1TJD A;  2WJU A;  3CMI A;  4PX1 A;  2E2G A;  4KUN A;  2IWT A;  5J5N A;  4OFN A;  2GVP A;  2ON7 A;  2JSY A;  4AJ8 A;  1PQN A;  3M9K A;  2H76 A;  1GRX A;  1TI3 A;  2GQL A;  4OCF A;  3M0F A;  3DVX A;  1YQ1 A;  1OE7 A;  3MDK A;  1K3Y A;  4HQZ A;  5ECI B;  1TDI A;  1FOV A;  1OC9 B;  1GL8 A;  3UL3 A;  3HYP A;  2L6C A;  1DE2 A;  3DIE A;  4KW6 A;  3H93 A;  1SJ6 A;  3GX0 A;  3UAP A;  3TJK A;  2GTU A;  2F9S A;  4WF4 A;  1TK8 B;  1GSE A;  3VWV A;  1PKZ A;  1JZD A;  5F0G A;  3G7I A;  1FB0 A;  2YN1 A;  5IMA A;  3VPQ A;  2HSY A;  3HDC A;  4EIQ A;  1MD3 A;  1IYH A;  3I6A A;  2VO4 A;  3QMX A;  2B5X A;  2V32 A;  5JWQ B;  3HY2 A;  1XW5 A;  1X9M B;  1U3A A;  3TKP A;  5KN1 A;  1B9Y C;  5IOX A;  2PUK C;  4JU5 A;  1SK1 A;  2C0E A;  2VLT A;  2ALB A;  4KCA A;  3KTB A;  5EPF A;  2MZC A;  2H30 A;  1WWJ A;  2IMI A;  3EU4 A;  4TXO A;  2R2J A;  1VF3 A;  1B4Q A;  1ZYE A;  4YQM A;  4K6X A;  3TGZ A;  3GX8 A;  1DE1 A;  1RK4 A;  1K3L A;  5IPG A;  3F4T A;  3A2V A;  4ECJ A;  1M2D A;  2H19 A;  3FW2 A;  4V1A g;  1G7O A;  3KTL A;  1FHE A;  4WBR D;  2H70 A;  3CTF A;  2AYT A;  1XOB A;  3P2A A;  5IMD A;  5GST A;  3LYK A;  5KN3 A;  4DSS A;  2WCI A;  3ERW A;  2LEG A;  2GSR A;  2VLV A;  2EIQ A;  2YWO A;  4K5R A;  1Z6M A;  4NWY A;  1AQV A;  2H1D A;  3LFL A;  2GT5 A;  2C3N A;  4NHZ A;  5CNW A;  1PGT A;  3KMO A;  1G6W A;  3MIX A;  5ID2 B;  1SJZ A;  1PMT A;  4EDZ A;  2R0P A;  3WGE A;  4ZL8 A;  5J3R A;  2GST A;  4JBB A;  1FAA A;  4F2I A;  2YZU A;  3L0H A;  1XWA A;  1A0R P;  1F9M A;  3EIN A;  1HNA A;  3EMP A;  2L5L A;  2H66 A;  3TJF A;  1O8W A;  2B1L A;  1TK5 B;  1A2M A;  1TTZ A;  3TOU A;  4CW9 A;  3WT2 A;  2DMM A;  2H1A A;  4POL A;  3ZFB A;  2A4V A;  3KH9 A;  2X49 A;  1TU8 A;  1GUM A;  2KP2 A;  4EUY A;  4MH2 A;  1PX7 A;  2DC5 A;  3ZIT A;  3UBK A;  1GLQ A;  1GUK A;  2K8S A;  3UMA A;  5D9V A;  1CQG A;  4X4J A;  1K0D A;  3FZ4 A;  3W8J A;  1XBS A;  2CAI A;  3VPT A;  2VCZ A;  4Z2T A;  3A2X A;  1XPV A;  5KEJ A;  1XVW A;  3N9J A;  1PL2 A;  1S3A A;  4IQA A;  3GUS A;  1R5A A;  2CVB A;  3TKQ A;  2YWN A;  2HNL A;  4PNG A;  2GSS A;  1T1V A;  4MDC A;  2P5R A;  2CAQ A;  2O89 A;  1MEK A;  4KF9 A;  2H6Y A;  3KP9 A;  1XCC A;  2FA4 A;  3JCM L;  1WJK A;  4ILF A;  5G30 A;  3DD3 A;  3ZTL A;  1ON4 A;  1GTB A;  3Q18 A;  3W6G A;  4DSQ A;  3VWU A;  1GSF A;  2H1G A;  1MTC A;  3MNG A;  4DSR A;  2LJR A;  5CP1 A;  2RM5 A;  2A4H A;  3HJO A;  1K0M A;  1UC7 A;  4F03 A;  3QOU A;  1VF2 A;  2XHF A;  4TOP A;  3BOA A;  5JCW A;  3TKS C;  2EIO A;  2C3T A;  1S3C A;  2R0C A;  9GSS A;  4GQF A;  1S3D A;  4F0B A;  3J7Y k;  2VIM A;  1YKA A;  5CRD A;  3FZ5 A;  3L9U A;  2I4A A;  3GMF A;  3LG6 A;  2O7K A;  1V98 A;  3G7J A;  4MK3 A;  1THX A;  4NXI A;  4XHM A;  4EF0 A;  2L5O A;  3D22 A;  1BJX A;  4BVY A;  1OC8 A;  2X8C A;  2X4A A;  3QAG A;  4G19 A;  5DQY A;  1X9S B;  4QL7 A;  2PN8 A;  2OJL A;  6GST A;  1E2Y A;  4TW5 A;  1NHY A;  2VM1 A;  1AC1 A;  2JAC A;  4IW9 A;  5COH A;  4HZ4 A;  3Q19 A;  3KJY A;  2XPD A;  3DRN A;  2PGT A;  3GFK A;  4HDE A;  5GSS A;  4HU7 A;  3GRX A;  3UIW A;  4ZB9 A;  2JSZ A;  2F8A A;  2HFD A;  3QPM A;  1WP0 A;  2B1K A;  2DJK A;  4MCU A;  3ME8 A;  5DCG A;  4USS A;  3EC3 A;  5KN2 A;  5A4W A;  5B6M A;  3ERG A;  4L5O A;  2FGX A;  4XCS A;  1MD4 A;  3EU3 A;  2IMK A;  3E9J B;  2MYG A;  1SL0 B;  2LS5 A;  5FT3 A;  3GHA A;  1JZR A;  2FWE A;  1XOA A;  1QFN A;  2C0F A;  3BD2 A;  3CBU A;  4IEL A;  4NV5 A;  2LKU A;  2H71 A;  5CO3 A;  1EGO A;  3BCK A;  2XPE A;  1YDK A;  3FY7 A;  3F9U A;  3FHK A;  4POM A;  2FLS A;  4KDU A;  3BCI A;  1T00 A;  2LNS A;  3ZVJ D;  1SU9 A;  2XBQ A;  1QUW A;  1BED A;  4N11 A;  1R5P A;  1EZK A;  2N5F A;  5IOW A;  1N8J A;  2R6K A;  4ECI A;  3FR3 A;  3H1N A;  16GS A;  3GL3 A;  2H6X A;  3QAV A;  3M1G A;  2LST A;  3M8N A;  2CT6 A;  1PN9 A;  1YY7 A;  1GNE A;  2GQK A;  2I1U A;  5D9X A;  1OC3 A;  4G0I A;  2RII A;  3SBC A;  1SYR A;  2LJK A;  6GSW A;  2VUP A;  2QGV A;  5CYY A;  4PQ1 A;  4LMV A;  4DSS B;  5G2Z A;  4L0U A;  3HVV A;  2F51 A;  3FR6 A;  3IC4 A;  4XS4 A;  3TB2 A;  5J4U A;  2ON5 A;  4MPF A;  2WB9 A;  3I69 A;  5AGY A;  4AJ6 A;  2LNT A;  2GS3 A;  1AW9 A;  3DYR A;  3ISO A;  5ELG A;  3ZFL A;  2WS2 A;  1ZYP A;  2FWG A;  14GS A;  1F6M C;  4EL1 A;  4EXJ A;  2OBK A;  2GZY A;  2DSA A;  3HHV A;  2H1B A;  3UBL A;  2DKH A;  1FW1 A;  2C0G A;  1XFL A;  1EEM A;  3HXS A;  1TU7 A;  3GTU A;  4K2D A;  1FVJ A;  5LD0 A;  2LRC A;  4JE1 A;  3L9V A;  2P0G A;  2WDU A;  3F3R A;  4TKY A;  3VI5 A;  5A5K A;  3RDW A;  2CZ3 A;  1XWC A;  3FZ9 A;  2HRK A;  2AHE A;  3UOM A;  5HR3 A;  2YOI A;  5IMZ A;  1X5E A;  4IGJ A;  3Q6O A;  2GDR A;  4E8E A;  5ECK B;  4Q5R A;  1AAZ A;  1ERW A;  4GF0 A;  4IJI A;  2ES7 A;  3DVW A;  1WMJ A;  2QKE A;  1SYX A;  2YPM A;  2I3Y A;  1J0F A;  4XS6 A;  3FMW A;  2B6M A;  4BWS A;  1JFU A;  4WXT A;  2A2S A;  3DML A;  5CRH A;  5KOW A;  3GYK A;  1ZZY A;  3C1S A;  3KD0 A;  4ID0 A;  4I6X A;  2GGT A;  4FYB A;  3FEU A;  2FWH A;  1W89 A;  4ZB6 A;  3O6T A;  4FYC A;  4G0L A;  1PN0 A;  1XWK A;  4PUA A;  2DKI A;  3KXO A;  3PR8 A;  1TW9 A;  1UVZ A;  2V41 A;  3E0U A;  2V6K A;  2JZR A;  2FCH A;  1ERV A;  2VM2 A;  4JR4 A;  4IBP A;  1PA3 A;  5ECR B;  4G2E A;  2UZ8 A;  1X9W B;  3L9S A;  3PH9 A;  4GST A;  1U3I A;  3GNJ A;  1A8L A;  2FA8 A;  1GUH A;  1ERT A;  1O6J A;  4MF6 A;  1O81 A;  3K8N A;  3ZMK A;  4L5L A;  3WGD A;  4X1U A;  5F07 A;  3AY8 A;  3CSH A;  3IPZ A;  2TRC P;  5E4W A;  22GS A;  3NOF A;  1ML6 A;  4JZQ A;  2JZT A;  4DVC A;  2HRF A;  1G7E A;  5DCH A;  3FK8 A;  3CYN A;  4I5Q A;  4XRD A;  5IMF A;  3TRX A;  3HVS A;  2R37 A;  5HFI A;  1GWC A;  1JZW A;  1BX9 A;  4PNF A;  4GSN A;  3LQ7 A;  3IHQ A;  1ERU A;  4JR6 A;  1IYI A;  5EL8 A;  8GSS A;  2R3X A;  2B3S A;  2A2P A;  3LEF A;  1EGR A;  5AN1 A;  3LWA A;  4DEJ A;  4BVY B;  3DKS A;  1U6T A;  1MDI A;  4FYU A;  5CRG A;  4N0Z A;  5A4V A;  1EWX A;  3L78 A;  2HSM A;  3I9V 2;  3RPP A;  1V9W A;  2HT9 A;  4GLT A;  1EP8 A;  2MMO A;  1JZO A;  2DBC A;  4BL7 A;  1SK2 A;  3FR9 A;  1SKW B;  3HVX A;  5DBQ A;  2PVQ A;  3TOT A;  5G1L A;  5EVO A;  4OD7 A;  1I9D A;  4K7N A;  4BWQ A;  4V2N A;  1X5C A;  1FOH A;  4YKG A;  4ZBA A;  2VCQ A;  1T8E B;  2LV3 A;  3EVI A;  5H5Q A;  4K8M A;  2NPB A;  1YJ6 A;  2WRT A;  3D4T A;  2OAC A;  1YF0 A;  4OO5 A;  1WRY A;  3IHG A;  5DJM A;  2GZZ A;  2V1M A;  3LW9 A;  3G9B A;  3OR5 A;  2WUL A;  3C1R A;  1LBK A;  2HLS A;  1B8X A;  4ZIJ A;  3VK9 A;  5CAX A;  1WE0 A;  3F63 A;  1EP7 A;  1OE8 A;  2ZUP A;  5C04 A;  13GS A;  2DML A;  3QR6 A;  3RHB A;  2BTO T;  3G7Y A;  5DAK A;  3CRU A;  2FY6 A;  3IR4 A;  3HZ4 A;  3C8E A;  2YCD A;  3GKX A;  5G5E A;  3GN3 A;  5CRW A;  1VGL A;  3WD6 A;  1XVQ A;  3TKR A;  1O8X A;  3VI7 A;  1VF4 A;  1GSD A;  1F37 A;  1EOG A;  2VCX A;  1ZOF A;  4TRX A;  1M7T A;  4WEY A;  2IPA A;  2CVD A;  3F0I A;  4ZB8 A;  3FYG A;  1UA5 A;  1GSQ A;  2CV4 A;  5HFK A;  3SWL A;  2WZ9 A;  4GXZ A;  1M2B A;  2KUC A;  3UAR A;  4F82 A;  2VAF A;  4IP6 A;  3GH9 A;  2RUE A;  4MP4 A;  1XWB A;  1HYU A;  3IAM 2;  1XXU A;  3TKS A;  1EEJ A;  3R3E A;  4KH7 A;  5ECQ B;  2H0H A;  4WR5 A;  3PIN A;  4IVF A;  2BMX A;  3HJP A;  3IE3 A;  4I2T A;  4WET A;  1T4Y A;  3WT1 A;  2C80 A;  2OKA A;  4AJ7 A;  4MNN A;  1V58 A;  3IXR A;  1V2A A;  3GA4 A;  1OVN A;  2HYX A;  4HJM A;  3HCZ A;  4KGI A;  3TJG A;  4PUR A;  4XS4 B;  5F05 A;  4LL4 B;  4AF2 A;  1GTI A;  4V2L A;  2G0F A;  1NW2 A;  4YAV A;  2C1Y A;  1QXH A;  4HS1 A;  4ZL9 A;  4TR4 A;  3GIX A;  1SL1 B;  4EVM A;  3P8W A;  2LQO A;  3KP8 A;  1G0T A;  4KDY A;  2E0Q A;  4MLY A;  4GQC A;  3HD5 A;  5DDL A;  3QFB C;  4KX4 A;  4YH2 A;  5IPH A;  5KN0 A;  3US3 A;  3NZN A;  4L0W A;  5G31 A;  2H0I A;  1GNW A;  2TIR A;  3WYW A;  3GTU B;  4ACS A;  2F3M A;  1HNB A;  1NHO A;  1B4P A;  2N5B A;  2YJ7 A;  4EKZ A;  1ZYQ B;  1TP9 A;  4RI7 A;  1ABA A;  3U5R E;  3GSS A;  2PPT A;  2L6D A;  3HZ8 A;  3D0Z A;  1A8Y A;  3TRP A;  1GLP A;  1WIK A;  1M9A A;  2VCT A;  6GSV A;  4O5R A;  3IK7 A;  1VRS D;  2PER A;  2M72 A;  4CDO A;  3VLN A;  1YF1 A;  4MF5 A;  3IRA A;  5HR0 A;  5B8B A;  5CRE A;  3WGX A;  2B7K A;  2WFC A;  1A2L A;  4GWR A;  3IA1 A;  4MJC A;  4YAP A;  1AQW A;  5E59 A;  2DJ3 A;  2AV4 A;  2V2G A;  2PBJ A;  4PQH A;  2IL3 A;  4GCI A;  2FWF A;  1W4V A;  3RHC A;  3D21 A;  3KCM A;  2DIZ A;  3VWX A;  2CVK A;  3EE2 A;  3PPU A;  4NV2 A;  1F3B A;  5DVB A;  2CX4 A;  4TVE A;  1XW6 A;  2C4J A;  5G1K A;  3VWW A;  3VFI A;  2MBS A;  3O76 A;  2GT6 A;  5D96 A;  4YKF A;  5B8A A;  2HXK A;  1NSW A;  4KCE A;  4ZIL A;  1PRX A;  2XBI A;  2DIY A;  4MAB A;  1GTU A;  5BRT A;  4WBJ A;  4HJ2 A;  2DLX A;  1BAY A;  2IMD A;  4MF7 A;  3IV4 A;  1V40 A;  4RQR A;  1TRS A;  3EYT A;  3TUE A;  4KB3 A;  1GSU A;  1B9X C;  3LJR A;  2AUV A;  3W8S A;  1HQO A;  4LMW A;  3D4M A;  3ZZX A;  3A3T A;  4KND A;  12GS A;  1ST9 A;  4EIP A;  3C73 A;  4MJA A;  4G0K A;  4PQI A;  1TXX A;  1V57 A;  5D73 A;  2HRN A;  1RW1 A;  4I2U A;  2C3Q A;  4JED A;  2CA8 A;  2B7J A;  5ABR A;  3HJM A;  4MZC A;  2LRT A;  1OAZ A;  4MPG A;  2LJA A;  4BVX A;  2F8F A;  4BL7 B;  5HFG A;  5GAP D;  1Y6E A;  2LQQ A;  3MYD A;  1LJR A;  4PXO A;  1Z7P A;  2P31 A;  4H86 A;  4ML6 A;  2HI7 A;  1NM3 A;  4TR3 A;  3BJ5 A;  4K0G A;  5B6N A;  4EC0 A;  2OE3 A;  1AUC A;  1SKR B;  1GUL A;  3ZIV A;  1KEB A;  4JRR A;  2R5G A;  2JL4 A;  5IMV A;  2HE3 A;  4TR1 A;  4K1F A;  5AIX A;  4FH8 A;  5EY6 A;  2M46 A;  2IFQ A;  4K7I A;  3LYP A;  4LLR A;  5GAN D;  3LSZ A;  1M9B A;  4HEA 2;  1OKD A;  1G6Y A;  2NTO A;  5IO0 A;  2H72 A;  2IN3 A;  4FQU A;  1HNC A;  3APO A;  3TDG A;  1DSB A;  4PTS A;  5DAK B;  3LXT A;  2TRX A;  3GKK A;  1XIY A;  4O32 A;  2K8V A;  3Q74 A;  5DJL A;  1EV4 A;  2H74 A;  5DAL A;  4YQU A;  4KE3 A;  1SKS B;  1N2A A;  1TOF A;  3IAS 2;  3QDN A;  2ZNM A;  3MAK A;  2JZS A;  5GZZ B;  5ELA A;  2AAW A;  1MDJ A;  4Q5Q A;  2A2R A;  2L57 A;  4D73 A;  4AGS A;  3EUR A;  1LU4 A;  1EV9 A;  4K2X A;  4OCE A;  2O85 A;  4CY8 A;  1JLW A;  1M0U A;  1HD2 A;  2GQM A;  1ILO A;  1I5G A;  2PU9 C;  3PGT A;  5AIV A;  4HU9 A;  2PMT A;  1ZMA A;  1Q98 A;  3M9J A;  2E7P A;  1K0O A;  5J9B A;  1J9B A;  1Z3E A;  4IKH A;  17GS A;  3IOS A;  4ICY A;  4EDY A;  5L71 A;  4MZB A;  1Z7R A;  2K9F A;  2VL2 A;  6GSY A;  5KOX A;  3TRQ A;  3TJB A;  1XZO A;  5ECO B;  5LNK e;  1USB A;  4YQV A;  4P3Y B;  4V2M A;  2VCV A;  1X5D A;  2VOC A;  2X99 A;  4IN0 A;  1M99 A;  4NMU A;  2H01 A;  19GS A;  1ZL9 A;  3APS A;  4ULX A;  3D6I A;  2FNO A;  4BA7 A;  2CZ2 A;  3RPN A;  1TRU A;  1R26 A;  2O8V B;  4GSS A;  4PUF C;  4XS1 A;  4Z2U A;  3F4S A;  3GV1 A;  4NPB A;  2NVL A;  2K6V A;  4N30 A;  4KAE A;  2X8H A;  4BPY A;  2KP1 A;  4KSM A;  5FWG A;  5ECN B;  3J7Y b;  1KTE A;  1TRW A;  1O7U A;  3F6D A;  4WR4 A;  5F8B A;  2J9H A;  3LGC A;  2JU5 A;  2MMA A;  2VCW A;  3E3E A;  5INY A;  4QQ7 A;  1KBN A;  4WKW A;  3I43 A;  1O85 A;  3A5I A;  3EMX A;  3HKR A;  2DJJ A;  2VL2 C;  3A2W A;  3KM6 A;  2KHP A;  1U87 A;  5JCG A;  4OFM A;  3P90 A;  4QL9 A;  1PX6 A;  4FIW A;  1FO5 A;  2V6O A;  4MJE A;  4O92 A;  1SK0 A;  1T4Z A;  1QMV A;  2REM A;  5IQY A;  5JWR B;  3CTG A;  1K0A A;  1WPI A;  2HRA A;  7GSS A;  4MJB A;  1SL2 B;  3H4K A;  3ZRD A;  3TKS E;  5D9T A;  3S9F A;  2QSI A;  3FZA A;  5ECH B;  2OBI A;  1DBY A;  2H6Z A;  3KMN A;  4V1A p;  4TR0 A;  4WF5 A;  4K9Z A;  4GRF A;  2ZCT A;  2GZP A;  4EO3 A;  1K0B A;  1A23 A;  1A0F A;  2GLR A;  4G9H A;  4POK A;  2DJ1 A;  2I81 A;  2WGR A;  2OE1 A;  5J9C A;  1H75 A;  3C7M A;  3RAZ A;  3APQ A;  3KH7 A;  2EC4 A;  3KZQ A;  2H0G A;  3TCO A;  4LL1 B;  4KDX A;  2EIR A;  2R0G A;  1A2J A;  3C71 A;  4HZ2 A;  2QA1 A;  5ENU A;  4FO5 A;  3V1W A;  1K0N A;  3F6F A;  4HQS A;  1DUG A;  2YWM A;  4OO4 A;  4J56 E;  2H8L A;  4I97 A;  1QK8 A;  2O87 A;  3DEX A;  1Z9H A;  3GL5 A;  1Z6N A;  3GST A;  11GS A;  2MMN A;  2HZE A;  1X0R A;  2LRN A;  3DWV A;  3N5O A;  4OWY A;  1JLV A;  4A5P A;  1BYE A;  4POB A;  2L4C A;  1KNG A;  4IHU A;  1SD8 A;  1O73 A;  2X8G A;  1R4W A;  4BVX B;  4O5Q A;  2Z9S A;  4XTS A;  4NHW A;  1SJI A;  2M80 A;  3UVH A;  4ECC A;  4X0X A;  4RUV A;  1SD9 A;  1OYJ A;  2OAD A;  1TI1 A;  5ECP B;  2YNX A;  3CSJ A;  2IIY A;  2L4Q A;  2FD3 A;  4KSO A;  4E8H A;  4TR1 B;  3LOR A;  4ISD A;  2G2Q A;  3EWL A;  4Z2R A;  3O3T A;  3LXZ A;  2IFQ B;  3H79 A;  5JWO B;  3KGK A;  1K0C A;  1YKC A;  4MH3 A;  2R4V A;  4N0V A;  4EE0 A;  1AXD A;  3UVT A;  2CX3 A;  4O7H A;  3CSI A;  3QCP A;  2OE0 A;  2L59 A;  2YJH A;  5H5S A;  5BMU A;  2JAD A;  4PGT A;  4KA0 A;  3L4N A;  4RQX A;  2PVO C;  5IMC A;  1OC9 A;  4IQ1 A;  5DAL B;  3IK9 A;  10GS A;  2C8U A;  3ZL5 A;  5JCU A;  4G10 A;  1JHB A;  5C00 A;  6GSU A;  18GS A;  2FUG 2;  2IMF A;  3QAW A;  4HUA A;  1ZGN A;  3MWH A;  3ZYW A;  2KOK A;  4D73 B;  1M2A A;  4IJ3 A;  3F3Q A;  1F2E A;  3FKF A;  1UN2 A;  5FHI A;  2AJQ B;  1FVK A;  1F3A A;  2VLU A;  3NIV A;  5G5F A;  2YWI A;  4ZXG A;  3ED3 A;  1FG4 A;  3KIJ A;  1B48 A;  2QA2 A;  2MMZ A;  4MMM A;  1THO A;  4ECB A;  5F06 A;  4TN8 A;  1Q4J A;  3TJJ A;  1BQ7 A;  2QC7 A;  4ZBD A;  2GSQ A;  4I8B A;  1E6B A;  3GKN A;  2DJ0 A;  4LA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...