2B7JA

Crystal structure of yeast sco1 with copper bound
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
172
structure length
158
Chain Sequence
GKPSLGGPFHLEDMYGNEFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNTLSSKYGITLQPLFITCDPARDSPAVLKEYLSDFHPSILGLTGTFDEVKNACKKYRVYVDHSIFFYLMDPEGQFVDALGRNYDEKTGVDKIVEHVKSYVPAEQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords SCO1 protein
publication title Crystal structure of yeast Sco1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 46
structure length 158
sequence length 172
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2b7jA00
3CBUA 5JWRB 1TDIA 4XRDA 3ISOA 1A24A 2F8AA 3D6IA 3TDGA 2LRNA 1AXDA 2VCVA 2VAFA 2NBSA 2DJ1A 1QFNA 1G7EA 5DVBA 2IWTA 4ZB8A 2LTKA 2B3SA 3EMXA 4ZB6A 1SL1B 4HJMA 1A0FA 2HYXA 1OE7A 1XVQA 1XBSA 4V2MA 5C00A 4JU5A 1QXHA 2QKEA 3IA1A 3MNGA 4ZIJA 2O85A 4MZWA 2MZCA 4J56E 4MJAA 2XBQA 1GSYA 3W8SA 2R37A 1ZYQB 2HRFA 2MBTA 2HSHA 5ECLB 1K0MA 2AJQB 1TK0B 3ZVJA 4GRFA 4PNGA 5HR0A 1XWCA 2H1BA 3KXOA 3FR6A 1F6MC 1A8LA 3KGKA 2LS5A 3C7MA 5GSTA 4IJIA 5IO2A 1ZZYA 1VF2A 2CVDA 1LBKA 1U87A 1E6BA 3Q18A 2H0IA 1X5CA 3EMPA 5CRDA 2YNXA 3GL5A 3GH6A 3HD5A 2VCZA 1G6YA 2WJUA 1WRYA 6GSTA 1AC1A 4AGSA 4AF2A 2JSZA 2G2QA 5G1KA 5CREA 4POLA 4V1Ag 2MYGA 1B9XC 2QGVA 3A2XA 1BYEA 1SENA 3FZ4A 4KH7A 5CRHA 2L4CA 3CXGA 2GTUA 3CSJA 2G0FA 4KAEA 2LQQA 1PQNA 5COHA 3VK9A 7GSSA 1GSFA 1TI3A 4WXTA 1JLVA 3GURA 4V2LA 1OYJA 2E7PA 2IJYA 2KP1A 5HR2A 3EVIA 2CVKA 4QL7A 2P5QA 3ZZXA 1XPVA 3IRAA 3VI7A 4N0VA 1UN2A 3NIVA 5G1LA 1QK8A 3TKSE 5ECSA 5ECQB 1YJ6A 3BCIA 1EEJA 4MP4A 4Q5QA 2CT6A 2VOCA 13GSA 5JCUA 4ZL8A 3WGXA 3E9JB 4XHMA 2DJ2A 3DKSA 3QAGA 2PGTA 4MJBA 1FB6A 1J0FA 2L5LA 3I9V2 2ON7A 4IQAA 1I9DA 4EO3A 1VF3A 1F37A 1TRSA 1XWKA 11GSA 4K7NA 5CO3A 2AUVA 1JFUA 3HVXA 2DJ0A 1X0RA 1R7HA 1O8XA 3HZ4A 3LXTA 4KB3A 1SU9A 5IM9A 3L0HA 1JZOA 5H5QA 1ABAA 1PA3A 1B9YC 1S3AA 1XW5A 2OA7A 1Z3EA 3EURA 1M0UA 1TU8A 4DEJA 1UVZA 2N5BA 3HVSA 3O76A 3HCZA 3MDKA 2IMKA 4HZ2A 2AYTA 1Y6EA 4KSMA 4EE0A 3FZ5A 4IP1A 2J9HA 2CZ3A 5F06A 4MLYA 5KN3A 3BOAA 2CQ9A 2JZRA 1PSQA 1RW1A 5EL8A 4XCSA 1XOAA 2NVLA 5IMCA 4NWYA 2F3MA 1X5EA 1MDKA 3G7JA 1A0RP 4ML1A 1T4ZA 2H75A 1R5AA 4IGJA 1VGLA 2E2MA 3KTLA 1YZXA 4O5RA 1X9MB 4PXOA 3KH7A 3E0UA 2GS3A 1TRUA 2R6KA 3C71A 2H8LA 4JBBA 1JZRA 2EIRA 3O3TA 5B7CA 3U5RE 5IMFA 1EOGA 2RUFA 5J9CA 2GVPA 2ALBA 2BJXA 3FYGA 4ZL9A 4QL9A 5CP1A 5H5RA 4AJ8A 1FVKA 3LYKA 2FWGA 4HZ4A 2GSQA 2V6OA 5GZZB 6GSXA 5B8BA 4V2NA 5DQYA 3P7XA 1BQ7A 2DJKA 4ZBDA 3KP9A 2QSIA 4EF0A 4OFNA 1PRXA 9GSSA 3MWHA 1T00A 1O73A 1HD2A 1Z9HA 2N5AA 1T4YA 3LYPA 2E2GA 3H8QA 3D5JA 2LRTA 4G10A 3F63A 1TRWA 2C0FA 4L0UA 3EYTA 4N30A 3JCML 5J4UA 4V1Ap 1GWCA 3DYRA 4EC0A 4GSNA 4X43A 5DCHA 2H70A 3G7YA 2VCQA 1Y25A 2GLRA 2X8CA 2C0GA 5B8AA 3V1WA 3APSA 1DE1A 2FCHA 3CYNA 2ON5A 4F0BA 4IHUA 4NXIA 1M2DA 3HDCA 1Z6MA 2PU9C 4ECBA 4NV2A 5D96A 3M9JA 3Q6OA 1BG5A 4K0NA 1TTZA 8GSSA 4KDXA 2LJKA 2FWFA 2HXKA 3ZIJA 1GLQA 2CVBA 2WCIA 5D9WA 2N5FA 3CRTA 4P3YB 5IMVA 1F3BA 3VWUA 5D8IA 2WFCA 2HZEB 3IV4A 4WEYA 5HQPA 1X9WB 3FR3A 5E4WA 2GSSA 1GNWA 4OFTA 2H1AA 1GTUA 1TJDA 1EP7A 1AAZA 1GSSA 5DALB 4HQSA 2WRTA 3P8WA 3C8EA 2HZEA 4MF6A 2XC2A 1FOVA 2WDUA 3TKSA 3ZYWA 3H93A 5G5EA 1V2AA 4KSOA 3N9JA 2GZZA 2IFQB 1VF4A 5DALA 2B1LA 1K0NA 2DIZA 4HU7A 1WP0A 4BPYA 2H76A 4JR4A 2H30A 4GSTA 1NHOA 4E8EA 4NHZA 2YP6A 2ZCTA 5ABRA 5J5NA 5AISA 2XPDA 2IFQA 1EGRA 4O92A 1QQ2A 2DC5A 3VWWA 4I2TA 5FWGA 1PL2A 3HJMA 1OKTA 5HFIA 5FT3A 1R26A 1MD4A 4NV5A 4DSSB 1ILOA 5ELGA 2VLUA 1GSEA 3UEMA 2FA8A 1V98A 2CAQA 2CX4A 4YQUA 5DBQA 5F8BA 2IL3A 2WB9A 5CYYA 4ML6A 1NM3A 4DSSA 3GKKA 3UL3A 3W8JA 4ECIA 5LNKe 3IC4A 1WOUA 2FUG2 5HR3A 4ZILA 4K7IA 1EP8A 3F8UA 3EU4A 5IIZA 3TKQA 2VL2C 4YQVA 3M8NA 4DSRA 2JSYA 2HNLA 1FW1A 3RPNA 1ON4A 1ERVA 2FHEA 4J2FA 3CSIA 4BWSA 2KOKA 1ERTA 4K8MA 2JU5A 1PX7A 1TK8B 4CHSA 4TVEA 2IN3A 2F51A 1WWJA 2K9FA 1U3AA 2LRCA 4GTUA 5J3RA 5IMZA 3GN3A 3BD2A 4N0ZA 2VO4A 4OD7A 2PPTA 1GTBA 2JADA 3CRUA 1WIKA 2B7JA 1KTEA 4ZL7A 2GZPA 1BX9A 1O8WA 3VI5A 2YWIA 4KW6A 4IQ1A 2JL4A 4MABA 4EDZA 1ST9A 5E59A 1V40A 2IMFA 4GF0A 5KN2A 1YEPA 1SK1A 2CA8A 3ZFBA 1HQOA 2B1KA 6GSVA 4OWYA 2DMLA 5ECOB 5A4UA 4GXZA 1BAYA 2I1UA 3GNJA 5ID2B 4X1UA 5F0GA 3I6AA 2I81A 1M7TA 4TXVA 1A2JA 4JRRA 4L5LA 4AJ6A 1WJKA 3GHAA 2ZNMA 3VWVA 3DWVA 2VCTA 4L8EA 1WPIA 3N5OA 4ID0A 3DD3A 2GGTA 1K3YA 2LUSA 5G5FA 4JZQA 5ID2A 4LMWA 1V58A 1DUGA 3KM6A 1B4QA 1X5DA 1SYXA 4KNDA 1KBNA 2LSTA 3ERWA 3ZLPA 3IPZA 1YF1A 2V6KA 3GKXA 4EUYA 2FA4A 3VFIA 1PKWA 1RQMA 4K2DA 4HEA2 2L6CA 1A2MA 5C04A 4OO4A 1AQWA 1UC7A 2H72A 2VM2A 1I5GA 2L57A 3VPQA 12GSA 2OKAA 3L78A 5EPFA 1F2EA 3QR6A 3S9FA 2P5RA 1LJRA 2REMA 5DDLA 1TRVA 1FVJA 1XW9A 1FB0A 5DAKB 1XFLA 4G9HA 5HR1A 3ZVJD 1TK5B 3RAZA 2CX3A 6GSWA 1SD8A 2K8SA 1S3DA 3ZIVA 1YKAA 3GL3A 1WMJA 4RI7A 2HFDA 1AQVA 4PNFA 5G30A 3GYKA 5DAKA 2HT9A 4HDEA 4Q5FA 2K8VA 2YN1A 1Z5YE 2L6DA 4IW9A 3TJBA 2H1DA 4WBJA 3UVTA 2DJ3A 3HZ8A 4LLRA 3QOUA 5F07A 4XS4B 3A5WA 3FZ9A 3LWAA 4HU9A 1XZOA 2HRNA 4HUAA 3VPTA 1K0CA 1GUKA 3F6DA 3A2VA 1Z7PA 3HKRA 4KUNA 3TRXA 4HI7A 4F9ZA 1KNGA 2B5EA 4XS4A 3GA4A 2HI7A 3EE2A 1YDKA 17GSA 2FWEA 1GSQA 4L0WA 3IDVA 2NPBA 2D2ZA 2VLTA 4PX1A 3APOA 5IPHA 1SKSB 1X9SB 4GCIA 4ZBBA 5ECMB 4TRXA 4MZCA 4PURA 3BCKA 1MEKA 3WT2A 1BJXA 1BEDA 5JCWA 4I8BA 3DEXA 1PGTA 2GQMA 2P31A 3HXSA 3U6VA 3EINA 3PR8A 1PL1A 5DQSA 1XCCA 2LJAA 1V9WA 3QAVA 1H4OA 1OKDA 1YQ1A 1OAZA 1EV9A 4CDOA 2C80A 3PGTA 4X0XA 5CRWA 2H73A 1THXA 1K3OA 1PD21 2LV3A 3C1RA 3LJRA 2OACA 4GQCA 2VD1A 3DIEA 1U3IA 2M80A 2R2JA 5LCZA 3VWXA 4OFMA 4KDUA 5KN1A 2DSAA 4RI6A 3SBCA 5HFKA 2IMDA 3BJ5A 4GWRA 2JZSA 4XS6A 3TRPA 3ED3A 4MCUA 1Q4JA 1TKDB 2RLIA 1M2BA 5A4VA 19GSA 5D93A 5GSSA 4IVFA 4ECJA 2P0GA 2FNOA 2C1YA 3IAM2 5IQYA 3CMIA 1ACVA 2C4JA 2V2GA 3TUEA 1GNEA 2VCWA 4BVYA 2V32A 3M3MA 2LQOA 3F3QA 4WF5A 2K6VA 2H74A 1DBYA 2CV4A 4LL4B 4MF7A 4G19A 2OBKA 5ECHB 1GSDA 4Q5NA 2YPMA 2HE3A 4IELA 2C3NA 3UMAA 1AUCA 2IMIA 5ECIB 3TJKA 3OR5A 3QD9A 1S3CA 3APQA 1JLWA 1XWAA 3TGZA 1XIYA 2JACA 2PMTA 3QPMA 1U88A 1JZWA 5A5KA 1O85A 2PUKC 4MDCA 3IBHA 3UBLA 4FYUA 3GIXA 5J9BA 2MBSA 4CW9A 5EY6A 5A4WA 1ZOFA 1O6JA 5ELAA 3M1GA 3CSHA 5IO0A 4MJCA 4YQMA 2B6MA 4O32A 5CNWA 1A23A 2VM1A 2LEGA 2ZUPA 3I43A 4MF5A 2GDRA 4HQZA 2YWNA 4EXJA 5GAPD 4E8HA 3UOMA 1DE2A 2LJRA 2C0DA 5HFGA 2MMOA 3QFBC 1A8YA 1ZMAA 1T1VA 3TOUA 3HJPA 1OC9B 3WGDA 14GSA 4IS0A 4ULXA 2FD3A 1GH2A 4KX4A 4BVXA 5CAXA 2DBCA 2H71A 2GT5A 2YWMA 3G7IA 3FEUA 1OC9A 2J23A 4J57E 1JZDA 3GH9A 5D73A 3TJGA 20GSA 3C1SA 4IN0A 1W4VA 1B48A 1M9AA 4WF4A 3GUSA 4GQFA 1SJZA 3F3RA 3PINA 3F0IA 5D9XA 1SL2B 1HYUA 2AAWA 3KIJA 1SJIA 1EEMA 2RUEA 3TOTA 2A2RA 3Q19A 3H4KA 3IR4A 4EL1A 2YOIA 4WETA 2BMXA 5KN0A 2H6XA 2O89A 4POBA 3ZL5A 3A2WA 4F82A 4HS1A 2OE0A 5IOXA 3F4SA 4TR1B 4XS1A 3IHQA 2H19A 2FGXA 2FWHA 2RM6A 5ECKB 4RQXA 1GUHA 3FRCA 4MH2A 3C73A 3DVWA 3RPPA 2R5GA 3GX0A 2KUCA 4TR1A 4I6XA 4I5QA 3H79A 2QC7A 5IMAA 2M72A 4PQ1A 3IE3A 1WE0A 1AQXA 3VURA 3IK7A 4MMMA 6GSUA 2HZFA 3F4TA 2MMAA 3ME8A 2AB6A 1GL8A 3BBYA 3TKPA 5ENUA 4TN8A 2TRCP 4IJ3A 3KEBA 1RK4A 4QQ7A 3GKMA 4BL7A 1CQGA 22GSA 5IPGA 3FKFA 3ERGA 3LGCA 4RUVA 5FHIA 5IOWA 5D9TA 3ZREA 1VF1A 3GSSA 1TU7A 3FR9A 2PWJA 3FY7A 2WGRA 1YY7A 3E3EA 4OCEA 3J7Yk 1LU4A 2GZYA 3KMNA 3L9SA 1FAAA 1JHBA 3P2AA 5JWOB 4K7OA 2O8VB 2OBIA 2R3XA 2I3YA 1Z7RA 2H6ZA 1F3AA 3GKNA 4WKWA 3F4RA 1IYIA 2JZTA 4PUFC 5DJMA 1N2AA 2YZHA 2OE3A 1ERWA 4YAVA 3DRNA 4F03A 4HOJA 4POMA 3CTGA 3H1NA 2LNTA 1T7PB 4XTSA 3P90A 1C72A 3HHVA 2X8HA 4YH2A 3LEFA 1EWXA 4WBRD 2YCDA 3KZQA 3PH9A 4NHWA 1XVWA 3D4MA 4FYBA 10GSA 2YANA 1XOBA 3O6TA 1TXXA 4MPGA 2V41A 2VL9A 2DJJA 3EC3A 4G2EA 2YZUA 1F9MA 1GP1A 3GX8A 2GQLA 4K9ZA 2A4VA 4TR0A 4ACSA 4JEDA 4MPFA 3R2QA 1UA5A 2AHEA 3FW2A 3RDWA 2X99A 3IK9A 3GMFA 2XHFA 2I4AA 1SK2A 3RHCA 3TCOA 1PN9A 2L5OA 2HLSA 1O7UA 5INYA 3HA9A 1DSBA 4TXOB 1GULA 3UIWA 3UVHA 4N11A 1VRSD 3A3TA 2GSTA 2PN8A 4KDYA 1FG4A 2C8UA 5KEJA 4TXOA 2BTOT 3HVVA 5AIVA 4IP6A 3EWLA 3HYPA 5AGYA 4EKZA 1AIUA 1MTCA 2B5YA 5G31A 2LNSA 3KMOA 5GAND 4ZXGA 5AN1A 2YJHA 3TJJA 1EZKA 1H75A 1QMVA 3TKRA 1ZGNA 2WULA 3LXZA 2B5XA 2VUPA 1EGOA 3HJOA 3ZTLA 1GRXA 4Q5RA 1SL0B 1T8EB 3ME7A 3I69A 2NDOA 4TOPA 5LD0A 1GLPA 1EOHA 3Q74A 1OC3A 3IAS2 3WD6A 4LMVA 2F9SA 2VL2A 18GSA 3ZITA 3TJFA 2OJLA 2GSRA 1K0AA 3UBKA 3GRXA 1B8XA 2O7KA 3AY8A 2IMEA 3ZRDA 4H86A 3KJYA 3NOFA 5ECRB 1NSWA 3LFLA 2DLXA 3QMXA 2PERA 3QDNA 1OC8A 5L71A 4JE1A 2L4QA 2AV4A 3TKSC 4WR5A 2TIRA 5G2ZA 3TB2A 3K8NA 3UAPA 3QCPA 3NZNA 2MMZA 1G7OA 2NTOA 2XBIA 5EVOA 2DIYA 2VCXA 2MMNA 3HY2A 2A2SA 1CQHA 4TR4A 3F6FA 4ZBAA 1A2LA 1QUWA 5AIXA 2EIQA 1GTAA 4LA1A 5F05A 4TKYA 4JR6A 1YF0A 1M9BA 3KD0A 2YV7A 5JWQB 3DMLA 4FH8A 4ECCA 2IPAA 4KCAA 4GLTA 1MDJA 4K6XA 4IKHA 1TI1A 4POKA 5DJLA 1ZCPA 1QGVA 3UARA 1GSUA 1O81A 4LL1B 2H1GA 2K18A 2H66A 1PX6A 1USBA 1URMA 2RM5A 4XRAA 1THOA 2KLXA 4F0CA 3ZMLA 1N8JA 2H01A 2YWOA 4PGTA 2V1MA 3L9UA 4IBPA 2IIYA 1TOFA 3KP8A 3KTBA 4I97A 3L9VA 3QAWA 4F2IA 2H6YA 4KCEA 1R5PA 1XXUA 5D9VA 2PVQA 1W89A 4NAXA 1NHYA 1SJ6A 3D0ZA 3LORA 1ML6A 2EC4A 1HNCA 4Z7XA 1E2YA 4DVCA 4YAPA 1XWGA 4AJ7A 1FO5A 4MZBA 1V57A 2RIIA 3G9BA 1MDIA 6GSSA 6GSYA 3W6GA 2GQKA 2VL3A 3TRQA 2H0GA 1OVNA 1G0TA 3D4TA 1TP9A 5JCGA 4TR3A 4OCFA 3D21A 4KGIA 2X64A 4N10A 1IYHA 3MSZA 1HNBA 2HSYA 2C3QA 3LG6A 3GV1A 2KHPA 2CZ2A 2FLSA 5ECPB 1B4PA 2ES7A 3US3A 1GTIA 1XWBA 1OE8A 4WR4A 5B6NA 3CTFA 3QFAC 1J9BA 5J41A 1HNAA 1Q98A 3RHBA 1AW9A 2LKUA 2VLVA 3F9UA 4OMVA 1J08A 4EVMA 1MD3A 1M2AA 5H5SA 2WS2A 1G6WA 2L59A 2C0EA 4FYCA 4MH3A 2I9HA 3FK8A 3L4NA 1EV4A 3M9KA 3GFKA 3IXRA 2B7KA 1YKCA 4PQHA 4EDYA 1U6TA 1SKWB 1K0DA 2EIOA 2DMMA 4ISDA 2OADA 4GSSA 1PMTA 3LQ7A 4K1FA 3ZFLA 1K0OA 3M0FA 1SK0A 4XIHA 1T3BA 1FHEA 1TW9A 1PKZA 1K0BA 4HJ2A 1Z6NA 4L5OA 4KE3A 2VIMA 3MAKA 4FIWA 2YJ7A 1M99A 2E0QA 4PUAA 1NW2A 3LSZA 3SWLA 3J7Yb 3WGEA 2KP2A 2CAIA 4RQRA 5IMDA 5B6MA 5ECNB 3DVXA 4NPBA 3KCMA 4ZB9A 2WZ9A 2FY6A 2H0HA 4MJEA 1KEBA 1SKRB 3DXBA 2O87A 2X8GA 3GSTA 3ZMKA 4KA0A 2XPEA 4O7HA 3WT1A 4MK3A 3GTUB 3FHKA 5DCGA 4I2UA 4D73B 2TRXA 4K0GA 4MA9A 1ZYEA 3RBTA 2M46A 4ILFA 3DGQA 2C3TA 4NMUA 1K3LA 1SYRA 4PQIA 3KH9A 1ERUA 4FO5A 2F8FA 3GTUA 2GT6A 2YV9A 4D73A 4BA7A 3ERFA 2R4VA 2OE1A 2Z9SA 16GSA 3EU3A 2PVOC 1SD9A 4TW5A 1XW6A 2VD0A 5CRGA 1ZL9A 3FZAA 3IOSA 3VLNA 3D22A 4DSQA 3UJ1A 3WYWA 4BWQA 4OO5A 1GUMA 1R4WA 2PBJA 1YEXA
chains in the Genus database with same CATH superfamily
3CBUA 1ZYNA 5JWRB 1TDIA 4XRDA 3ISOA 1A24A 2F8AA 3D6IA 3TDGA 2LRNA 1AXDA 2VCVA 2VAFA 2NBSA 2DJ1A 1QFNA 1G7EA 4USSA 5DVBA 2IWTA 4ZB8A 2LTKA 2B3SA 3EMXA 4ZB6A 1SL1B 4HJMA 1A0FA 2HYXA 1OE7A 1XVQA 1XBSA 4V2MA 5C00A 4JU5A 1QXHA 2QKEA 3IA1A 3IC8A 3MNGA 4ZIJA 2O85A 4MZWA 2MZCA 4J56E 4MJAA 2XBQA 1GSYA 3W8SA 2R37A 1ZYQB 2HRFA 2MBTA 2HSHA 5ECLB 4K5SA 1K0MA 2AJQB 1TK0B 3ZVJA 4GRFA 4PNGA 5HR0A 1XWCA 2H1BA 3KXOA 3FR6A 1F6MC 1A8LA 3KGKA 2LS5A 3C7MA 5GSTA 4IJIA 5IO2A 1ZZYA 1VF2A 2CVDA 1LBKA 1U87A 1E6BA 3Q18A 2H0IA 1X5CA 3EMPA 5CRDA 2YNXA 3GL5A 3GH6A 3HD5A 2VCZA 2DKHA 1G6YA 2WJUA 1WRYA 6GSTA 1AC1A 4AGSA 4AF2A 2JSZA 2G2QA 1XG8A 5G1KA 5CREA 3PPUA 4POLA 4V1Ag 2MYGA 1B9XC 2QGVA 3A2XA 1BYEA 1SENA 3FZ4A 4KH7A 5CRHA 2L4CA 3CXGA 2GTUA 3CSJA 2G0FA 4KAEA 2LQQA 1PQNA 5COHA 3VK9A 7GSSA 1GSFA 1TI3A 4WXTA 1JLVA 3GURA 4V2LA 1OYJA 2E7PA 2IJYA 2KP1A 5HR2A 3EVIA 4Z2TA 2CVKA 4QL7A 2P5QA 3ZZXA 3LW9A 1XPVA 3IRAA 3VI7A 4N0VA 1UN2A 3NIVA 5G1LA 2HRAA 1QK8A 3TKSE 5ECSA 5ECQB 1YJ6A 3BCIA 1EEJA 4MP4A 4Q5QA 2CT6A 2VOCA 13GSA 5JCUA 4ZL8A 3WGXA 3E9JB 4XHMA 2DJ2A 3DKSA 3QAGA 2PGTA 4MJBA 1FB6A 1J0FA 2L5LA 3I9V2 2ON7A 4IQAA 1I9DA 4EO3A 1VF3A 1F37A 1TRSA 1XWKA 11GSA 4K7NA 5CO3A 2AUVA 1JFUA 3HVXA 2DJ0A 1X0RA 1R7HA 1O8XA 3HZ4A 3LXTA 4KB3A 1SU9A 5IM9A 3L0HA 1JZOA 5H5QA 1ABAA 1PA3A 1B9YC 1S3AA 1XW5A 2OA7A 1Z3EA 3EURA 1M0UA 1TU8A 4DEJA 1UVZA 2N5BA 3HVSA 3O76A 3HCZA 3MDKA 2IMKA 4HZ2A 2AYTA 1Y6EA 4KSMA 4EE0A 3FZ5A 4IP1A 2J9HA 2CZ3A 5F06A 4MLYA 5KN3A 3BOAA 2CQ9A 2JZRA 1PSQA 1RW1A 5EL8A 4XCSA 1XOAA 2NVLA 5IMCA 4NWYA 5KOWA 2F3MA 1X5EA 1MDKA 3G7JA 1A0RP 4ML1A 1T4ZA 2H75A 1R5AA 4IGJA 1VGLA 2E2MA 3KTLA 1YZXA 4O5RA 1X9MB 4PXOA 3KH7A 3E0UA 2GS3A 1TRUA 2R6KA 3C71A 2H8LA 4JBBA 1JZRA 2EIRA 3O3TA 5B7CA 3U5RE 5IMFA 1EOGA 2RUFA 5J9CA 2GVPA 2ALBA 2BJXA 3FYGA 4ZL9A 4QL9A 5CP1A 5H5RA 4AJ8A 1FVKA 3LYKA 2FWGA 4HZ4A 2GSQA 2V6OA 5GZZB 6GSXA 5B8BA 4V2NA 5DQYA 3P7XA 1BQ7A 2DJKA 4ZBDA 3KP9A 2QSIA 4EF0A 4OFNA 1PRXA 9GSSA 3MWHA 1T00A 1O73A 1HD2A 1Z9HA 2N5AA 1T4YA 3LYPA 2E2GA 3H8QA 3D5JA 2LRTA 4G10A 3F63A 1TRWA 2C0FA 4L0UA 3EYTA 4MNNA 4N30A 3JCML 5J4UA 4V1Ap 1GWCA 3DYRA 4EC0A 4GSNA 4X43A 5DCHA 2H70A 3G7YA 2VCQA 1Y25A 4YKFA 2GLRA 2X8CA 2C0GA 5B8AA 3V1WA 3APSA 1DE1A 2FCHA 3CYNA 2ON5A 4F0BA 4IHUA 4NXIA 1M2DA 3HDCA 1Z6MA 2PU9C 4ECBA 4NV2A 5D96A 3M9JA 3Q6OA 1BG5A 4K0NA 1TTZA 8GSSA 4KDXA 2LJKA 2FWFA 2HXKA 3ZIJA 1GLQA 2CVBA 2WCIA 5D9WA 2N5FA 3CRTA 4P3YB 5IMVA 1F3BA 3VWUA 5D8IA 2WFCA 2HZEB 1ZYPA 3IV4A 4WEYA 5HQPA 1X9WB 3FR3A 5E4WA 2GSSA 1GNWA 4OFTA 2H1AA 1GTUA 1TJDA 1EP7A 1AAZA 1GSSA 5DALB 4HQSA 2WRTA 3P8WA 3C8EA 2HZEA 4MF6A 2XC2A 1FOVA 2WDUA 3TKSA 3ZYWA 3H93A 5G5EA 1V2AA 4KSOA 3N9JA 2GZZA 2IFQB 1VF4A 5DALA 2B1LA 1K0NA 2DIZA 4HU7A 1WP0A 4BPYA 2H76A 4JR4A 2H30A 4GSTA 1NHOA 4E8EA 4NHZA 2YP6A 2ZCTA 5ABRA 5J5NA 5AISA 2XPDA 2IFQA 1EGRA 4O92A 2A4HA 1QQ2A 2DC5A 3VWWA 4I2TA 5FWGA 1PL2A 3HJMA 1OKTA 5HFIA 5FT3A 1R26A 1MD4A 4NV5A 4DSSB 1ILOA 5ELGA 2VLUA 2X49A 1GSEA 3UEMA 2FA8A 1V98A 2CAQA 2CX4A 4YQUA 5DBQA 5F8BA 2IL3A 2WB9A 5CYYA 4ML6A 1NM3A 4DSSA 3GKKA 3UL3A 3W8JA 4ECIA 4O5UA 5LNKe 3IC4A 1WOUA 2FUG2 5HR3A 4ZILA 4K7IA 1EP8A 3F8UA 3EU4A 5IIZA 3TKQA 2VL2C 4YQVA 3M8NA 4DSRA 2JSYA 1S3RA 2HNLA 1FW1A 3RPNA 1ON4A 1ERVA 2FHEA 4J2FA 3CSIA 4BWSA 2KOKA 1ERTA 4G0KA 4K8MA 2JU5A 1PX7A 1TK8B 4CHSA 4TVEA 2IN3A 2F51A 1WWJA 2K9FA 1U3AA 2LRCA 4GTUA 5J3RA 5IMZA 3GN3A 3BD2A 4N0ZA 2VO4A 4OD7A 2PPTA 1GTBA 2JADA 3CRUA 1WIKA 2B7JA 1KTEA 4ZL7A 2GZPA 1BX9A 1O8WA 3VI5A 2YWIA 4KW6A 4IQ1A 2JL4A 4MABA 4EDZA 1ST9A 5E59A 1V40A 2IMFA 4GF0A 5KN2A 1YEPA 1SK1A 2CA8A 3ZFBA 1HQOA 2B1KA 6GSVA 4OWYA 2DMLA 5ECOB 5A4UA 4GXZA 1BAYA 2I1UA 3GNJA 5ID2B 4X1UA 5F0GA 3I6AA 2I81A 1M7TA 4TXVA 1A2JA 4JRRA 4L5LA 4AJ6A 1WJKA 3GHAA 2ZNMA 3VWVA 3DWVA 2VCTA 4L8EA 1WPIA 3N5OA 4ID0A 3DD3A 2GGTA 1K3YA 2LUSA 5G5FA 4JZQA 5ID2A 4LMWA 1V58A 1DUGA 3KM6A 1B4QA 2R0PA 1X5DA 1SYXA 4KNDA 1KBNA 2LSTA 3ERWA 3ZLPA 3IPZA 1YF1A 2V6KA 3GKXA 4EUYA 2FA4A 3VFIA 1PKWA 1RQMA 4K2DA 4HEA2 2L6CA 3CQFA 1A2MA 5C04A 4OO4A 1AQWA 1UC7A 2H72A 2VM2A 1I5GA 2L57A 3VPQA 12GSA 2OKAA 3L78A 5EPFA 1F2EA 3QR6A 3S9FA 2P5RA 1LJRA 2REMA 5DDLA 1TRVA 1FVJA 1XW9A 1FB0A 5DAKB 1XFLA 4G9HA 5HR1A 3ZVJD 1TK5B 3RAZA 2CX3A 6GSWA 1SD8A 2K8SA 1S3DA 3ZIVA 1YKAA 3GL3A 1WMJA 4RI7A 2HFDA 1AQVA 4PNFA 5G30A 3GYKA 2HT9A 4HDEA 4Q5FA 5DAKA 2K8VA 2YN1A 1Z5YE 2L6DA 4IW9A 3TJBA 2H1DA 4WBJA 3UVTA 2DJ3A 3HZ8A 2A2PA 4LLRA 3QOUA 5F07A 4XS4B 3A5WA 3FZ9A 3LWAA 4HU9A 1XZOA 2HRNA 4HUAA 3VPTA 1K0CA 1GUKA 3F6DA 3A2VA 1Z7PA 3HKRA 4KUNA 3TRXA 4HI7A 4F9ZA 1KNGA 2B5EA 4XS4A 3GA4A 2HI7A 3EE2A 1YDKA 17GSA 2FWEA 1GSQA 4L0WA 3IDVA 2NPBA 2D2ZA 2VLTA 4PX1A 3APOA 5IPHA 1SKSB 1X9SB 4GCIA 4ZBBA 5ECMB 4TRXA 4MZCA 4PURA 3BCKA 1MEKA 3WT2A 1BJXA 1BEDA 3HVNA 5JCWA 4I8BA 3DEXA 1PGTA 2GQMA 2P31A 3HXSA 3U6VA 3EINA 3PR8A 4ICYA 1PL1A 5DQSA 1XCCA 2LJAA 1V9WA 3QAVA 1H4OA 1OKDA 1YQ1A 1OAZA 1EV9A 4CDOA 2C80A 3PGTA 4X0XA 5CRWA 2H73A 1THXA 1K3OA 1PD21 2LV3A 3C1RA 3LJRA 2OACA 4GQCA 2VD1A 3DIEA 1U3IA 2M80A 2R2JA 5LCZA 3VWXA 4OFMA 4KDUA 4KF9A 5KN1A 2DSAA 4RI6A 3SBCA 5HFKA 2IMDA 3BJ5A 4GWRA 2JZSA 4XS6A 3TRPA 3ED3A 4MCUA 1Q4JA 1TKDB 2RLIA 1M2BA 5A4VA 19GSA 5D93A 4PTSA 5GSSA 4IVFA 4BVYB 4ECJA 2P0GA 2FNOA 2C1YA 3IAM2 5IQYA 3CMIA 1ACVA 2C4JA 2V2GA 3TUEA 1GNEA 2VCWA 4BVYA 2V32A 3M3MA 2LQOA 3F3QA 4WF5A 2K6VA 2H74A 1DBYA 2CV4A 4LL4B 4MF7A 4G19A 2OBKA 5ECHB 1GSDA 3MIXA 4Q5NA 2YPMA 2HE3A 4IELA 2C3NA 3UMAA 1AUCA 2IMIA 5ECIB 3TJKA 3OR5A 3QD9A 1S3CA 3APQA 1JLWA 1XWAA 3TGZA 1XIYA 2JACA 2PMTA 3QPMA 1U88A 1JZWA 5A5KA 1O85A 2PUKC 4MDCA 3IBHA 3UBLA 4FYUA 3GIXA 5J9BA 2MBSA 4CW9A 5EY6A 5A4WA 1ZOFA 1O6JA 5ELAA 3M1GA 3CSHA 5IO0A 4MJCA 4YQMA 4EIPA 2HRKA 2B6MA 4O32A 5CNWA 1A23A 2VM1A 2LEGA 2ZUPA 3I43A 4MF5A 2GDRA 4HQZA 2YWNA 4EXJA 5GAPD 4E8HA 3UOMA 1DE2A 2LJRA 2C0DA 5HFGA 4HSCX 2MMOA 3QFBC 4BVXB 1A8YA 1ZMAA 1T1VA 3TOUA 3HJPA 1OC9B 3WGDA 14GSA 4IS0A 4ULXA 2FD3A 1GH2A 4KX4A 4BVXA 5CAXA 2DBCA 2H71A 2GT5A 2YWMA 3G7IA 3FEUA 1OC9A 2J23A 4J57E 1JZDA 3GH9A 5D73A 3TJGA 20GSA 3C1SA 4IN0A 1W4VA 1B48A 1M9AA 4WF4A 3GUSA 4GQFA 1SJZA 2HSMA 3F3RA 3PINA 3F0IA 5D9XA 1SL2B 1HYUA 2AAWA 3KIJA 1SJIA 1EEMA 3IHGA 2RUEA 3TOTA 2A2RA 3Q19A 3H4KA 3IR4A 4EL1A 2YOIA 4WETA 2BMXA 5KN0A 2H6XA 2O89A 4POBA 3ZL5A 3A2WA 4F82A 4HS1A 2OE0A 5IOXA 3F4SA 4TR1B 4XS1A 3IHQA 2H19A 2FGXA 2FWHA 2RM6A 5ECKB 4RQXA 1GUHA 3FRCA 4MH2A 3C73A 3DVWA 3RPPA 2R5GA 3GX0A 2KUCA 4TR1A 4I6XA 4I5QA 3H79A 2QC7A 5IMAA 2M72A 4PQ1A 5BMUA 3IE3A 2R0CA 1WE0A 1AQXA 3VURA 3IK7A 4BL7B 4MMMA 6GSUA 2HZFA 3F4TA 2MMAA 3ME8A 2AB6A 3MYDA 1GL8A 3BBYA 3TKPA 5ENUA 4TN8A 2TRCP 4IJ3A 3KEBA 1RK4A 4QQ7A 3GKMA 4BL7A 1M3IA 1CQGA 22GSA 5IPGA 3FKFA 3ERGA 3LGCA 4O5QA 4RUVA 5FHIA 5IOWA 5D9TA 3ZREA 1VF1A 3GSSA 1TU7A 3FR9A 2PWJA 3FY7A 2WGRA 1YY7A 3E3EA 4OCEA 3J7Yk 1LU4A 2GZYA 3KMNA 3L9SA 1FAAA 1JHBA 3P2AA 5JWOB 4K7OA 2O8VB 2OBIA 2R3XA 2I3YA 1Z7RA 2H6ZA 1F3AA 3GKNA 4WKWA 3F4RA 1IYIA 2JZTA 4PUFC 5DJMA 1N2AA 2YZHA 2OE3A 1ERWA 4YAVA 3DRNA 4F03A 4HOJA 4POMA 3CTGA 3H1NA 2LNTA 1T7PB 4XTSA 3P90A 1C72A 3HHVA 2X8HA 4YH2A 3LEFA 1EWXA 4WBRD 2YCDA 3KZQA 3PH9A 4NHWA 1XVWA 3D4MA 4FYBA 10GSA 4G0LA 2YANA 1XOBA 3O6TA 1TXXA 4MPGA 2V41A 2VL9A 2DJJA 3EC3A 4G2EA 2YZUA 1F9MA 1GP1A 3GX8A 2GQLA 4K9ZA 2A4VA 4TR0A 4ACSA 4JEDA 4MPFA 3R2QA 1UA5A 2AHEA 3FW2A 3RDWA 2X99A 3IK9A 3GMFA 2XHFA 2I4AA 1SK2A 3RHCA 3TCOA 1PN9A 2L5OA 2HLSA 4YKGA 1O7UA 5INYA 3HA9A 1DSBA 4TXOB 1GULA 3UIWA 3UVHA 4N11A 1VRSD 3A3TA 2GSTA 2UZ8A 2PN8A 4KDYA 1FG4A 2C8UA 5KEJA 4TXOA 2BTOT 3HVVA 5AIVA 4IP6A 3EWLA 3HYPA 5AGYA 4EKZA 1AIUA 1MTCA 2B5YA 5G31A 2LNSA 1M3JA 3KMOA 5GAND 4ZXGA 5AN1A 2YJHA 3TJJA 1EZKA 1H75A 1QMVA 3TKRA 1ZGNA 2QA1A 2WULA 3LXZA 2B5XA 2VUPA 1EGOA 3HJOA 3ZTLA 1GRXA 4Q5RA 1SL0B 1T8EB 3ME7A 2R0GA 3I69A 2NDOA 4TOPA 5LD0A 1GLPA 1EOHA 3A5IA 3Q74A 1OC3A 3IAS2 3WD6A 4LMVA 2F9SA 2VL2A 18GSA 3ZITA 3TJFA 2OJLA 2GSRA 1K0AA 3UBKA 3GRXA 1B8XA 2O7KA 3AY8A 2IMEA 3ZRDA 4H86A 4G0IA 3KJYA 3NOFA 5ECRB 1NSWA 3LFLA 2DLXA 3QMXA 2PERA 3QDNA 1OC8A 5L71A 4JE1A 2L4QA 2AV4A 3TKSC 4WR5A 2TIRA 3FMWA 5G2ZA 3TB2A 3K8NA 5KOXA 3UAPA 3QCPA 3NZNA 2MMZA 1G7OA 2NTOA 2XBIA 5EVOA 2DIYA 2VCXA 2MMNA 3HY2A 2A2SA 1CQHA 4TR4A 3F6FA 4ZBAA 1A2LA 1QUWA 4BIKA 5AIXA 2EIQA 1GTAA 4LA1A 5F05A 4TKYA 4JR6A 1YF0A 1M9BA 3KD0A 2YV7A 5JWQB 3DMLA 4K2XA 5BRTA 4FH8A 4ECCA 2IPAA 4KCAA 4GLTA 1MDJA 4K6XA 4IKHA 1TI1A 4POKA 5DJLA 1ZCPA 1QGVA 3UARA 1GSUA 1O81A 2QA2A 2H1GA 4LL1B 2X4AA 2K18A 2H66A 1PX6A 1USBA 1URMA 2RM5A 4Z2UA 4XRAA 1THOA 2KLXA 4F0CA 3ZMLA 1N8JA 2H01A 2YWOA 4PGTA 2V1MA 3L9UA 4IBPA 2IIYA 1TOFA 3KP8A 3KTBA 3EPTA 1PN0A 4I97A 3L9VA 4CY6A 3QAWA 1PFOA 4F2IA 2H6YA 4KCEA 1R5PA 1XXUA 5D9VA 2PVQA 1W89A 4NAXA 1NHYA 1SJ6A 3D0ZA 3LORA 1ML6A 2EC4A 3R3EA 1HNCA 4Z7XA 1E2YA 4DVCA 4YAPA 1XWGA 4AJ7A 1FO5A 4MZBA 1V57A 2RIIA 3G9BA 1MDIA 6GSSA 6GSYA 3W6GA 2GQKA 2VL3A 3TRQA 2H0GA 1OVNA 1G0TA 3D4TA 1TP9A 5JCGA 4TR3A 4OCFA 1FOHA 3D21A 4KGIA 2X64A 4N10A 1IYHA 3MSZA 1HNBA 2HSYA 2C3QA 3LG6A 3GV1A 2KHPA 2CZ2A 2FLSA 5ECPB 4K5RA 4CY8A 1B4PA 2ES7A 3US3A 1GTIA 1XWBA 1OE8A 2DKIA 4WR4A 5B6NA 3CTFA 3QFAC 1J9BA 5J41A 1HNAA 1Q98A 3RHBA 4X4JA 1AW9A 4FQUA 2LKUA 2VLVA 3F9UA 4OMVA 1J08A 4EVMA 1MD3A 1M2AA 5H5SA 2WS2A 1G6WA 2L59A 2C0EA 4FYCA 4MH3A 2I9HA 3FK8A 3L4NA 1EV4A 3M9KA 3GFKA 3IXRA 2B7KA 1YKCA 4PQHA 4EDYA 1U6TA 1SKWB 1K0DA 2EIOA 2DMMA 4ISDA 2OADA 4GSSA 1PMTA 3LQ7A 4K1FA 3ZFLA 1K0OA 3M0FA 1SK0A 4XIHA 1T3BA 1FHEA 1TW9A 1PKZA 1K0BA 4HJ2A 1Z6NA 4L5OA 4KE3A 2VIMA 3MAKA 4FIWA 2YJ7A 1M99A 2E0QA 4PUAA 1NW2A 3LSZA 3SWLA 3J7Yb 3WGEA 2KP2A 2CAIA 4RQRA 5IMDA 5B6MA 5ECNB 3DVXA 4NPBA 3KCMA 4ZB9A 2WZ9A 4EIQA 2FY6A 2H0HA 4MJEA 1KEBA 1SKRB 3DXBA 2O87A 2X8GA 3GSTA 3ZMKA 4KA0A 2XPEA 4O7HA 3WT1A 4MK3A 3GTUB 3FHKA 5DCGA 4I2UA 4D73B 2TRXA 4K0GA 4MA9A 1ZYEA 3RBTA 2M46A 4ILFA 3DGQA 2C3TA 4NMUA 1K3LA 1SYRA 4PQIA 3KH9A 1ERUA 4FO5A 2F8FA 3GTUA 2GT6A 2YV9A 4D73A 4BA7A 4Z2RA 3ERFA 2R4VA 2OE1A 2Z9SA 16GSA 3EU3A 2PVOC 1SD9A 4TW5A 1XW6A 2VD0A 5CRGA 1ZL9A 3FZAA 3IOSA 3VLNA 3D22A 4DSQA 3UJ1A 3WYWA 4A5PA 4BWQA 4OO5A 1GUMA 1R4WA 2PBJA 1YEXA
chains in the Genus database with same CATH topology
3CBUA 1ZYNA 5JWRB 1TDIA 4XRDA 3ISOA 1A24A 2F8AA 3D6IA 3TDGA 2LRNA 1AXDA 2VCVA 2VAFA 2NBSA 2DJ1A 1QFNA 1G7EA 4USSA 5DVBA 2IWTA 4ZB8A 2LTKA 2B3SA 3EMXA 4ZB6A 1SL1B 4HJMA 1A0FA 2HYXA 1OE7A 1XVQA 1XBSA 4V2MA 5C00A 4JU5A 1QXHA 2QKEA 3IA1A 3IC8A 3MNGA 4ZIJA 2O85A 4MZWA 2MZCA 4J56E 4MJAA 2XBQA 1GSYA 3W8SA 2R37A 1ZYQB 2HRFA 2MBTA 2HSHA 5ECLB 4K5SA 1K0MA 2AJQB 1TK0B 3ZVJA 4GRFA 4PNGA 5HR0A 1XWCA 2H1BA 3KXOA 3FR6A 1F6MC 1A8LA 3KGKA 2LS5A 3C7MA 5GSTA 4IJIA 5IO2A 1ZZYA 1VF2A 2CVDA 1LBKA 1U87A 1E6BA 3Q18A 2H0IA 1X5CA 3EMPA 5CRDA 2YNXA 3GL5A 3GH6A 3HD5A 2VCZA 2DKHA 1G6YA 2WJUA 1WRYA 6GSTA 1AC1A 4AGSA 4AF2A 2JSZA 2G2QA 5G1KA 5CREA 3PPUA 4POLA 4V1Ag 2MYGA 1B9XC 2QGVA 3A2XA 1BYEA 1SENA 3FZ4A 4KH7A 5CRHA 2L4CA 3CXGA 2GTUA 3CSJA 2G0FA 4KAEA 2LQQA 1PQNA 5COHA 3VK9A 7GSSA 1GSFA 1TI3A 4WXTA 1JLVA 3GURA 4V2LA 1OYJA 2E7PA 2IJYA 2KP1A 5HR2A 3EVIA 4Z2TA 2CVKA 4QL7A 2P5QA 3ZZXA 3LW9A 1XPVA 3IRAA 3VI7A 4N0VA 1UN2A 3NIVA 5G1LA 2HRAA 1QK8A 3TKSE 5ECSA 5ECQB 1YJ6A 3BCIA 1EEJA 4MP4A 4Q5QA 2CT6A 2VOCA 13GSA 5JCUA 4ZL8A 3WGXA 3E9JB 4XHMA 2DJ2A 3DKSA 3QAGA 2PGTA 4MJBA 1FB6A 1J0FA 2L5LA 3I9V2 2ON7A 4IQAA 1I9DA 4EO3A 1VF3A 1F37A 1TRSA 1XWKA 11GSA 4K7NA 5CO3A 2AUVA 1JFUA 3HVXA 2DJ0A 1X0RA 1R7HA 1O8XA 3HZ4A 3LXTA 4KB3A 1SU9A 5IM9A 3L0HA 1JZOA 5H5QA 1ABAA 1PA3A 1B9YC 1S3AA 1XW5A 2OA7A 1Z3EA 3EURA 1M0UA 1TU8A 4DEJA 1UVZA 2N5BA 3HVSA 3O76A 3HCZA 3MDKA 2IMKA 4HZ2A 2AYTA 1Y6EA 4KSMA 4EE0A 3FZ5A 4IP1A 2J9HA 2CZ3A 5F06A 4MLYA 5KN3A 3BOAA 2CQ9A 2JZRA 1PSQA 1RW1A 5EL8A 4XCSA 1XOAA 2NVLA 5IMCA 4NWYA 5KOWA 2F3MA 1X5EA 1MDKA 3G7JA 1A0RP 4ML1A 1T4ZA 2H75A 1R5AA 4IGJA 1VGLA 2E2MA 3KTLA 1YZXA 4O5RA 1X9MB 4PXOA 3KH7A 3E0UA 2GS3A 1TRUA 2R6KA 3C71A 2H8LA 4JBBA 1JZRA 2EIRA 3O3TA 5B7CA 3U5RE 5IMFA 1EOGA 2RUFA 5J9CA 2GVPA 2ALBA 2BJXA 3FYGA 4ZL9A 4QL9A 5CP1A 5H5RA 4AJ8A 1FVKA 3LYKA 2FWGA 4HZ4A 2GSQA 2V6OA 5GZZB 6GSXA 5B8BA 4V2NA 5DQYA 3P7XA 1BQ7A 2DJKA 4ZBDA 3KP9A 2QSIA 4EF0A 4OFNA 1PRXA 9GSSA 3MWHA 1T00A 1O73A 1HD2A 1Z9HA 2N5AA 1T4YA 3LYPA 2E2GA 3H8QA 3D5JA 2LRTA 4G10A 3F63A 1TRWA 2C0FA 4L0UA 3EYTA 4MNNA 4N30A 3JCML 5J4UA 4V1Ap 1GWCA 3DYRA 4EC0A 4GSNA 4X43A 5DCHA 2H70A 3G7YA 2VCQA 1Y25A 4YKFA 2GLRA 2X8CA 2C0GA 5B8AA 3V1WA 3APSA 1DE1A 2FCHA 3CYNA 2ON5A 4F0BA 4IHUA 4NXIA 1M2DA 3HDCA 1Z6MA 2PU9C 4ECBA 4NV2A 5D96A 3M9JA 3Q6OA 1BG5A 4K0NA 1TTZA 8GSSA 4KDXA 2LJKA 2FWFA 2HXKA 3ZIJA 1GLQA 2CVBA 2WCIA 5D9WA 2N5FA 3CRTA 4P3YB 5IMVA 1F3BA 3VWUA 5D8IA 2WFCA 2HZEB 1ZYPA 3IV4A 4WEYA 5HQPA 1X9WB 3FR3A 5E4WA 2GSSA 1GNWA 4OFTA 2H1AA 1GTUA 1TJDA 1EP7A 1AAZA 1GSSA 5DALB 4HQSA 2WRTA 3P8WA 3C8EA 2HZEA 4MF6A 2XC2A 1FOVA 2WDUA 3TKSA 3ZYWA 3H93A 5G5EA 1V2AA 4KSOA 3N9JA 2GZZA 2IFQB 1VF4A 5DALA 2B1LA 1K0NA 2DIZA 4HU7A 1WP0A 4BPYA 2H76A 4JR4A 2H30A 4GSTA 1NHOA 4E8EA 4NHZA 2YP6A 2ZCTA 5ABRA 5J5NA 5AISA 2XPDA 2IFQA 1EGRA 4O92A 2A4HA 1QQ2A 2DC5A 3VWWA 4I2TA 5FWGA 1PL2A 3HJMA 1OKTA 5HFIA 5FT3A 1R26A 1MD4A 4NV5A 4DSSB 1ILOA 5ELGA 2VLUA 2X49A 1GSEA 3UEMA 2FA8A 1V98A 2CAQA 2CX4A 4YQUA 5DBQA 5F8BA 2IL3A 2WB9A 5CYYA 4ML6A 1NM3A 4DSSA 3GKKA 3UL3A 3W8JA 4ECIA 4O5UA 5LNKe 3IC4A 1WOUA 2FUG2 5HR3A 4ZILA 4K7IA 1EP8A 3F8UA 3EU4A 5IIZA 3TKQA 2VL2C 4YQVA 3M8NA 4DSRA 2JSYA 2HNLA 1FW1A 3RPNA 1ON4A 1ERVA 2FHEA 4J2FA 3CSIA 4BWSA 2KOKA 1ERTA 4G0KA 4K8MA 2JU5A 1PX7A 1TK8B 4CHSA 4TVEA 2IN3A 2F51A 1WWJA 2K9FA 1U3AA 2LRCA 4GTUA 5J3RA 5IMZA 3GN3A 3BD2A 4N0ZA 2VO4A 4OD7A 2PPTA 1GTBA 2JADA 3CRUA 1WIKA 2B7JA 1KTEA 4ZL7A 2GZPA 1BX9A 1O8WA 3VI5A 2YWIA 4KW6A 4IQ1A 2JL4A 4MABA 4EDZA 1ST9A 5E59A 1V40A 2IMFA 4GF0A 5KN2A 1YEPA 1SK1A 2CA8A 3ZFBA 1HQOA 2B1KA 6GSVA 4OWYA 2DMLA 5ECOB 5A4UA 4GXZA 1BAYA 2I1UA 3GNJA 5ID2B 4X1UA 5F0GA 3I6AA 2I81A 1M7TA 4TXVA 1A2JA 4JRRA 4L5LA 4AJ6A 1WJKA 3GHAA 2ZNMA 3VWVA 3DWVA 2VCTA 4L8EA 1WPIA 3N5OA 4ID0A 3DD3A 2GGTA 1K3YA 2LUSA 5G5FA 4JZQA 5ID2A 4LMWA 1V58A 1DUGA 3KM6A 1B4QA 2R0PA 1X5DA 1SYXA 4KNDA 1KBNA 2LSTA 3ERWA 3ZLPA 3IPZA 1YF1A 2V6KA 3GKXA 4EUYA 2FA4A 3VFIA 1PKWA 1RQMA 4K2DA 4HEA2 2L6CA 1A2MA 5C04A 4OO4A 1AQWA 1UC7A 2H72A 2VM2A 1I5GA 2L57A 3VPQA 12GSA 2OKAA 3L78A 5EPFA 1F2EA 3QR6A 3S9FA 2P5RA 1LJRA 2REMA 5DDLA 1TRVA 1FVJA 1XW9A 1FB0A 5DAKB 1XFLA 4G9HA 5HR1A 3ZVJD 1TK5B 3RAZA 2CX3A 6GSWA 1SD8A 2K8SA 1S3DA 3ZIVA 1YKAA 3GL3A 1WMJA 4RI7A 2HFDA 1AQVA 4PNFA 5G30A 3GYKA 2HT9A 4HDEA 4Q5FA 5DAKA 2K8VA 2YN1A 1Z5YE 2L6DA 4IW9A 3TJBA 2H1DA 4WBJA 3UVTA 2DJ3A 3HZ8A 2A2PA 4LLRA 3QOUA 5F07A 4XS4B 3A5WA 3FZ9A 3LWAA 4HU9A 1XZOA 2HRNA 4HUAA 3VPTA 1K0CA 1GUKA 3F6DA 3A2VA 1Z7PA 3HKRA 4KUNA 3TRXA 4HI7A 4F9ZA 1KNGA 2B5EA 4XS4A 3GA4A 2HI7A 3EE2A 1YDKA 17GSA 2FWEA 1GSQA 4L0WA 3IDVA 2NPBA 2D2ZA 2VLTA 4PX1A 3APOA 5IPHA 1SKSB 1X9SB 4GCIA 4ZBBA 5ECMB 4TRXA 4MZCA 4PURA 3BCKA 1MEKA 3WT2A 1BJXA 1BEDA 5JCWA 4I8BA 3DEXA 1PGTA 2GQMA 2P31A 3HXSA 3U6VA 3EINA 3PR8A 4ICYA 1PL1A 5DQSA 1XCCA 2LJAA 1V9WA 3QAVA 1H4OA 1OKDA 1YQ1A 1OAZA 1EV9A 4CDOA 2C80A 3PGTA 4X0XA 5CRWA 2H73A 1THXA 1K3OA 1PD21 2LV3A 3C1RA 3LJRA 2OACA 4GQCA 2VD1A 3DIEA 1U3IA 2M80A 2R2JA 5LCZA 3VWXA 4OFMA 4KDUA 4KF9A 5KN1A 2DSAA 4RI6A 3SBCA 5HFKA 2IMDA 3BJ5A 4GWRA 2JZSA 4XS6A 3TRPA 3ED3A 4MCUA 1Q4JA 1TKDB 2RLIA 1M2BA 5A4VA 19GSA 5D93A 4PTSA 5GSSA 4IVFA 4BVYB 4ECJA 2P0GA 2FNOA 2C1YA 3IAM2 5IQYA 3CMIA 1ACVA 2C4JA 2V2GA 3TUEA 1GNEA 2VCWA 4BVYA 2V32A 3M3MA 2LQOA 3F3QA 4WF5A 2K6VA 2H74A 1DBYA 2CV4A 4LL4B 4MF7A 4G19A 2OBKA 5ECHB 1GSDA 3MIXA 4Q5NA 2YPMA 2HE3A 4IELA 2C3NA 3UMAA 1AUCA 2IMIA 5ECIB 3TJKA 3OR5A 3QD9A 1S3CA 3APQA 1JLWA 1XWAA 3TGZA 1XIYA 2JACA 2PMTA 3QPMA 1U88A 1JZWA 5A5KA 1O85A 2PUKC 4MDCA 3IBHA 3UBLA 4FYUA 3GIXA 5J9BA 2MBSA 4CW9A 5EY6A 5A4WA 1ZOFA 1O6JA 5ELAA 3M1GA 3CSHA 5IO0A 4MJCA 4YQMA 4EIPA 2HRKA 2B6MA 4O32A 5CNWA 1A23A 2VM1A 2LEGA 2ZUPA 3I43A 4MF5A 2GDRA 4HQZA 2YWNA 4EXJA 5GAPD 4E8HA 3UOMA 1DE2A 2LJRA 2C0DA 5HFGA 2MMOA 3QFBC 4BVXB 1A8YA 1ZMAA 1T1VA 3TOUA 3HJPA 1OC9B 3WGDA 14GSA 4IS0A 4ULXA 2FD3A 1GH2A 4KX4A 4BVXA 5CAXA 2DBCA 2H71A 2GT5A 2YWMA 3G7IA 3FEUA 1OC9A 2J23A 4J57E 1JZDA 3GH9A 5D73A 3TJGA 20GSA 3C1SA 4IN0A 1W4VA 1B48A 1M9AA 4WF4A 3GUSA 4GQFA 1SJZA 2HSMA 3F3RA 3PINA 3F0IA 5D9XA 1SL2B 1HYUA 2AAWA 3KIJA 1SJIA 1EEMA 3IHGA 2RUEA 3TOTA 2A2RA 3Q19A 3H4KA 3IR4A 4EL1A 2YOIA 4WETA 2BMXA 5KN0A 2H6XA 2O89A 4POBA 3ZL5A 3A2WA 4F82A 4HS1A 2OE0A 5IOXA 3F4SA 4TR1B 4XS1A 3IHQA 2H19A 2FGXA 2FWHA 2RM6A 5ECKB 4RQXA 1GUHA 3FRCA 4MH2A 3C73A 3DVWA 3RPPA 2R5GA 3GX0A 2KUCA 4TR1A 4I6XA 4I5QA 3H79A 2QC7A 5IMAA 2M72A 4PQ1A 5BMUA 3IE3A 2R0CA 1WE0A 1AQXA 3VURA 3IK7A 4BL7B 4MMMA 6GSUA 2HZFA 3F4TA 2MMAA 3ME8A 2AB6A 3MYDA 1GL8A 3BBYA 3TKPA 5ENUA 4TN8A 2TRCP 4IJ3A 3KEBA 1RK4A 4QQ7A 3GKMA 4BL7A 1CQGA 22GSA 5IPGA 3FKFA 3ERGA 3LGCA 4O5QA 4RUVA 5FHIA 5IOWA 5D9TA 3ZREA 1VF1A 3GSSA 1TU7A 3FR9A 2PWJA 3FY7A 2WGRA 1YY7A 3E3EA 4OCEA 3J7Yk 1LU4A 2GZYA 3KMNA 3L9SA 1FAAA 1JHBA 3P2AA 5JWOB 4K7OA 2O8VB 2OBIA 2R3XA 2I3YA 1Z7RA 2H6ZA 1F3AA 3GKNA 4WKWA 3F4RA 1IYIA 2JZTA 4PUFC 5DJMA 1N2AA 2YZHA 2OE3A 1ERWA 4YAVA 3DRNA 4F03A 4HOJA 4POMA 3CTGA 3H1NA 2LNTA 1T7PB 4XTSA 3P90A 1C72A 3HHVA 2X8HA 4YH2A 3LEFA 1EWXA 4WBRD 2YCDA 3KZQA 3PH9A 4NHWA 1XVWA 3D4MA 4FYBA 10GSA 4G0LA 2YANA 1XOBA 3O6TA 1TXXA 4MPGA 2V41A 2VL9A 2DJJA 3EC3A 4G2EA 2YZUA 1F9MA 1GP1A 3GX8A 2GQLA 4K9ZA 2A4VA 4TR0A 4ACSA 4JEDA 4MPFA 3R2QA 1UA5A 2AHEA 3FW2A 3RDWA 2X99A 3IK9A 3GMFA 2XHFA 2I4AA 1SK2A 3RHCA 3TCOA 1PN9A 2L5OA 2HLSA 4YKGA 1O7UA 5INYA 3HA9A 1DSBA 4TXOB 1GULA 3UIWA 3UVHA 4N11A 1VRSD 3A3TA 2GSTA 2UZ8A 2PN8A 4KDYA 1FG4A 2C8UA 5KEJA 4TXOA 2BTOT 3HVVA 5AIVA 4IP6A 3EWLA 3HYPA 5AGYA 4EKZA 1AIUA 1MTCA 2B5YA 5G31A 2LNSA 3KMOA 5GAND 4ZXGA 5AN1A 2YJHA 3TJJA 1EZKA 1H75A 1QMVA 3TKRA 1ZGNA 2QA1A 2WULA 3LXZA 2B5XA 2VUPA 1EGOA 3HJOA 3ZTLA 1GRXA 4Q5RA 1SL0B 1T8EB 3ME7A 2R0GA 3I69A 2NDOA 4TOPA 5LD0A 1GLPA 1EOHA 3A5IA 3Q74A 1OC3A 3IAS2 3WD6A 4LMVA 2F9SA 2VL2A 18GSA 3ZITA 3TJFA 2OJLA 2GSRA 1K0AA 3UBKA 3GRXA 1B8XA 2O7KA 3AY8A 2IMEA 3ZRDA 4H86A 4G0IA 3KJYA 3NOFA 5ECRB 1NSWA 3LFLA 2DLXA 3QMXA 2PERA 3QDNA 1OC8A 5L71A 4JE1A 2L4QA 2AV4A 3TKSC 4WR5A 2TIRA 3FMWA 5G2ZA 3TB2A 3K8NA 5KOXA 3UAPA 3QCPA 3NZNA 2MMZA 1G7OA 2NTOA 2XBIA 5EVOA 2DIYA 2VCXA 2MMNA 3HY2A 2A2SA 1CQHA 4TR4A 3F6FA 4ZBAA 1A2LA 1QUWA 5AIXA 2EIQA 1GTAA 4LA1A 5F05A 4TKYA 4JR6A 1YF0A 1M9BA 3KD0A 2YV7A 5JWQB 3DMLA 4K2XA 5BRTA 4FH8A 4ECCA 2IPAA 4KCAA 4GLTA 1MDJA 4K6XA 4IKHA 1TI1A 4POKA 5DJLA 1ZCPA 1QGVA 3UARA 1GSUA 1O81A 2QA2A 2H1GA 4LL1B 2X4AA 2K18A 2H66A 1PX6A 1USBA 1URMA 2RM5A 4Z2UA 4XRAA 1THOA 2KLXA 4F0CA 3ZMLA 1N8JA 2H01A 2YWOA 4PGTA 2V1MA 3L9UA 4IBPA 2IIYA 1TOFA 3KP8A 3KTBA 3EPTA 1PN0A 4I97A 3L9VA 4CY6A 3QAWA 4F2IA 2H6YA 4KCEA 1R5PA 1XXUA 5D9VA 2PVQA 1W89A 4NAXA 1NHYA 1SJ6A 3D0ZA 3LORA 1ML6A 2EC4A 3R3EA 1HNCA 4Z7XA 1E2YA 4DVCA 4YAPA 1XWGA 4AJ7A 1FO5A 4MZBA 1V57A 2RIIA 3G9BA 1MDIA 6GSSA 6GSYA 3W6GA 2GQKA 2VL3A 3TRQA 2H0GA 1OVNA 1G0TA 3D4TA 1TP9A 5JCGA 4TR3A 4OCFA 1FOHA 3D21A 4KGIA 2X64A 4N10A 1IYHA 3MSZA 1HNBA 2HSYA 2C3QA 3LG6A 3GV1A 2KHPA 2CZ2A 2FLSA 5ECPB 4K5RA 4CY8A 1B4PA 2ES7A 3US3A 1GTIA 1XWBA 1OE8A 2DKIA 4WR4A 5B6NA 3CTFA 3QFAC 1J9BA 5J41A 1HNAA 1Q98A 3RHBA 4X4JA 1AW9A 4FQUA 2LKUA 2VLVA 3F9UA 4OMVA 1J08A 4EVMA 1MD3A 1M2AA 5H5SA 2WS2A 1G6WA 2L59A 2C0EA 4FYCA 4MH3A 2I9HA 3FK8A 3L4NA 1EV4A 3M9KA 3GFKA 3IXRA 2B7KA 1YKCA 4PQHA 4EDYA 1U6TA 1SKWB 1K0DA 2EIOA 2DMMA 4ISDA 2OADA 4GSSA 1PMTA 3LQ7A 4K1FA 3ZFLA 1K0OA 3M0FA 1SK0A 4XIHA 1T3BA 1FHEA 1TW9A 1PKZA 1K0BA 4HJ2A 1Z6NA 4L5OA 4KE3A 2VIMA 3MAKA 4FIWA 2YJ7A 1M99A 2E0QA 4PUAA 1NW2A 3LSZA 3SWLA 3J7Yb 3WGEA 2KP2A 2CAIA 4RQRA 5IMDA 5B6MA 5ECNB 3DVXA 4NPBA 3KCMA 4ZB9A 2WZ9A 4EIQA 2FY6A 2H0HA 4MJEA 1KEBA 1SKRB 3DXBA 2O87A 2X8GA 3GSTA 3ZMKA 4KA0A 2XPEA 4O7HA 3WT1A 4MK3A 3GTUB 3FHKA 5DCGA 4I2UA 4D73B 2TRXA 4K0GA 4MA9A 1ZYEA 3RBTA 2M46A 4ILFA 3DGQA 2C3TA 4NMUA 1K3LA 1SYRA 4PQIA 3KH9A 1ERUA 4FO5A 2F8FA 3GTUA 2GT6A 2YV9A 4D73A 4BA7A 4Z2RA 3ERFA 2R4VA 2OE1A 2Z9SA 16GSA 3EU3A 2PVOC 1SD9A 4TW5A 1XW6A 2VD0A 5CRGA 1ZL9A 3FZAA 3IOSA 3VLNA 3D22A 4DSQA 3UJ1A 3WYWA 4A5PA 4BWQA 4OO5A 1GUMA 1R4WA 2PBJA 1YEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CBU A;  5JWR B;  1TDI A;  4XRD A;  3ISO A;  1A24 A;  2F8A A;  3D6I A;  3TDG A;  2LRN A;  1AXD A;  2VCV A;  2VAF A;  2NBS A;  2DJ1 A;  1QFN A;  1G7E A;  5DVB A;  2IWT A;  4ZB8 A;  2LTK A;  2B3S A;  3EMX A;  4ZB6 A;  1SL1 B;  4HJM A;  1A0F A;  2HYX A;  1OE7 A;  1XVQ A;  1XBS A;  4V2M A;  5C00 A;  4JU5 A;  1QXH A;  2QKE A;  3IA1 A;  3MNG A;  4ZIJ A;  2O85 A;  4MZW A;  2MZC A;  4J56 E;  4MJA A;  2XBQ A;  1GSY A;  3W8S A;  2R37 A;  1ZYQ B;  2HRF A;  2MBT A;  2HSH A;  5ECL B;  1K0M A;  2AJQ B;  1TK0 B;  3ZVJ A;  4GRF A;  4PNG A;  5HR0 A;  1XWC A;  2H1B A;  3KXO A;  3FR6 A;  1F6M C;  1A8L A;  3KGK A;  2LS5 A;  3C7M A;  5GST A;  4IJI A;  5IO2 A;  1ZZY A;  1VF2 A;  2CVD A;  1LBK A;  1U87 A;  1E6B A;  3Q18 A;  2H0I A;  1X5C A;  3EMP A;  5CRD A;  2YNX A;  3GL5 A;  3GH6 A;  3HD5 A;  2VCZ A;  1G6Y A;  2WJU A;  1WRY A;  6GST A;  1AC1 A;  4AGS A;  4AF2 A;  2JSZ A;  2G2Q A;  5G1K A;  5CRE A;  4POL A;  4V1A g;  2MYG A;  1B9X C;  2QGV A;  3A2X A;  1BYE A;  1SEN A;  3FZ4 A;  4KH7 A;  5CRH A;  2L4C A;  3CXG A;  2GTU A;  3CSJ A;  2G0F A;  4KAE A;  2LQQ A;  1PQN A;  5COH A;  3VK9 A;  7GSS A;  1GSF A;  1TI3 A;  4WXT A;  1JLV A;  3GUR A;  4V2L A;  1OYJ A;  2E7P A;  2IJY A;  2KP1 A;  5HR2 A;  3EVI A;  2CVK A;  4QL7 A;  2P5Q A;  3ZZX A;  1XPV A;  3IRA A;  3VI7 A;  4N0V A;  1UN2 A;  3NIV A;  5G1L A;  1QK8 A;  3TKS E;  5ECS A;  5ECQ B;  1YJ6 A;  3BCI A;  1EEJ A;  4MP4 A;  4Q5Q A;  2CT6 A;  2VOC A;  13GS A;  5JCU A;  4ZL8 A;  3WGX A;  3E9J B;  4XHM A;  2DJ2 A;  3DKS A;  3QAG A;  2PGT A;  4MJB A;  1FB6 A;  1J0F A;  2L5L A;  3I9V 2;  2ON7 A;  4IQA A;  1I9D A;  4EO3 A;  1VF3 A;  1F37 A;  1TRS A;  1XWK A;  11GS A;  4K7N A;  5CO3 A;  2AUV A;  1JFU A;  3HVX A;  2DJ0 A;  1X0R A;  1R7H A;  1O8X A;  3HZ4 A;  3LXT A;  4KB3 A;  1SU9 A;  5IM9 A;  3L0H A;  1JZO A;  5H5Q A;  1ABA A;  1PA3 A;  1B9Y C;  1S3A A;  1XW5 A;  2OA7 A;  1Z3E A;  3EUR A;  1M0U A;  1TU8 A;  4DEJ A;  1UVZ A;  2N5B A;  3HVS A;  3O76 A;  3HCZ A;  3MDK A;  2IMK A;  4HZ2 A;  2AYT A;  1Y6E A;  4KSM A;  4EE0 A;  3FZ5 A;  4IP1 A;  2J9H A;  2CZ3 A;  5F06 A;  4MLY A;  5KN3 A;  3BOA A;  2CQ9 A;  2JZR A;  1PSQ A;  1RW1 A;  5EL8 A;  4XCS A;  1XOA A;  2NVL A;  5IMC A;  4NWY A;  2F3M A;  1X5E A;  1MDK A;  3G7J A;  1A0R P;  4ML1 A;  1T4Z A;  2H75 A;  1R5A A;  4IGJ A;  1VGL A;  2E2M A;  3KTL A;  1YZX A;  4O5R A;  1X9M B;  4PXO A;  3KH7 A;  3E0U A;  2GS3 A;  1TRU A;  2R6K A;  3C71 A;  2H8L A;  4JBB A;  1JZR A;  2EIR A;  3O3T A;  5B7C A;  3U5R E;  5IMF A;  1EOG A;  2RUF A;  5J9C A;  2GVP A;  2ALB A;  2BJX A;  3FYG A;  4ZL9 A;  4QL9 A;  5CP1 A;  5H5R A;  4AJ8 A;  1FVK A;  3LYK A;  2FWG A;  4HZ4 A;  2GSQ A;  2V6O A;  5GZZ B;  6GSX A;  5B8B A;  4V2N A;  5DQY A;  3P7X A;  1BQ7 A;  2DJK A;  4ZBD A;  3KP9 A;  2QSI A;  4EF0 A;  4OFN A;  1PRX A;  9GSS A;  3MWH A;  1T00 A;  1O73 A;  1HD2 A;  1Z9H A;  2N5A A;  1T4Y A;  3LYP A;  2E2G A;  3H8Q A;  3D5J A;  2LRT A;  4G10 A;  3F63 A;  1TRW A;  2C0F A;  4L0U A;  3EYT A;  4N30 A;  3JCM L;  5J4U A;  4V1A p;  1GWC A;  3DYR A;  4EC0 A;  4GSN A;  4X43 A;  5DCH A;  2H70 A;  3G7Y A;  2VCQ A;  1Y25 A;  2GLR A;  2X8C A;  2C0G A;  5B8A A;  3V1W A;  3APS A;  1DE1 A;  2FCH A;  3CYN A;  2ON5 A;  4F0B A;  4IHU A;  4NXI A;  1M2D A;  3HDC A;  1Z6M A;  2PU9 C;  4ECB A;  4NV2 A;  5D96 A;  3M9J A;  3Q6O A;  1BG5 A;  4K0N A;  1TTZ A;  8GSS A;  4KDX A;  2LJK A;  2FWF A;  2HXK A;  3ZIJ A;  1GLQ A;  2CVB A;  2WCI A;  5D9W A;  2N5F A;  3CRT A;  4P3Y B;  5IMV A;  1F3B A;  3VWU A;  5D8I A;  2WFC A;  2HZE B;  3IV4 A;  4WEY A;  5HQP A;  1X9W B;  3FR3 A;  5E4W A;  2GSS A;  1GNW A;  4OFT A;  2H1A A;  1GTU A;  1TJD A;  1EP7 A;  1AAZ A;  1GSS A;  5DAL B;  4HQS A;  2WRT A;  3P8W A;  3C8E A;  2HZE A;  4MF6 A;  2XC2 A;  1FOV A;  2WDU A;  3TKS A;  3ZYW A;  3H93 A;  5G5E A;  1V2A A;  4KSO A;  3N9J A;  2GZZ A;  2IFQ B;  1VF4 A;  5DAL A;  2B1L A;  1K0N A;  2DIZ A;  4HU7 A;  1WP0 A;  4BPY A;  2H76 A;  4JR4 A;  2H30 A;  4GST A;  1NHO A;  4E8E A;  4NHZ A;  2YP6 A;  2ZCT A;  5ABR A;  5J5N A;  5AIS A;  2XPD A;  2IFQ A;  1EGR A;  4O92 A;  1QQ2 A;  2DC5 A;  3VWW A;  4I2T A;  5FWG A;  1PL2 A;  3HJM A;  1OKT A;  5HFI A;  5FT3 A;  1R26 A;  1MD4 A;  4NV5 A;  4DSS B;  1ILO A;  5ELG A;  2VLU A;  1GSE A;  3UEM A;  2FA8 A;  1V98 A;  2CAQ A;  2CX4 A;  4YQU A;  5DBQ A;  5F8B A;  2IL3 A;  2WB9 A;  5CYY A;  4ML6 A;  1NM3 A;  4DSS A;  3GKK A;  3UL3 A;  3W8J A;  4ECI A;  5LNK e;  3IC4 A;  1WOU A;  2FUG 2;  5HR3 A;  4ZIL A;  4K7I A;  1EP8 A;  3F8U A;  3EU4 A;  5IIZ A;  3TKQ A;  2VL2 C;  4YQV A;  3M8N A;  4DSR A;  2JSY A;  2HNL A;  1FW1 A;  3RPN A;  1ON4 A;  1ERV A;  2FHE A;  4J2F A;  3CSI A;  4BWS A;  2KOK A;  1ERT A;  4K8M A;  2JU5 A;  1PX7 A;  1TK8 B;  4CHS A;  4TVE A;  2IN3 A;  2F51 A;  1WWJ A;  2K9F A;  1U3A A;  2LRC A;  4GTU A;  5J3R A;  5IMZ A;  3GN3 A;  3BD2 A;  4N0Z A;  2VO4 A;  4OD7 A;  2PPT A;  1GTB A;  2JAD A;  3CRU A;  1WIK A;  2B7J A;  1KTE A;  4ZL7 A;  2GZP A;  1BX9 A;  1O8W A;  3VI5 A;  2YWI A;  4KW6 A;  4IQ1 A;  2JL4 A;  4MAB A;  4EDZ A;  1ST9 A;  5E59 A;  1V40 A;  2IMF A;  4GF0 A;  5KN2 A;  1YEP A;  1SK1 A;  2CA8 A;  3ZFB A;  1HQO A;  2B1K A;  6GSV A;  4OWY A;  2DML A;  5ECO B;  5A4U A;  4GXZ A;  1BAY A;  2I1U A;  3GNJ A;  5ID2 B;  4X1U A;  5F0G A;  3I6A A;  2I81 A;  1M7T A;  4TXV A;  1A2J A;  4JRR A;  4L5L A;  4AJ6 A;  1WJK A;  3GHA A;  2ZNM A;  3VWV A;  3DWV A;  2VCT A;  4L8E A;  1WPI A;  3N5O A;  4ID0 A;  3DD3 A;  2GGT A;  1K3Y A;  2LUS A;  5G5F A;  4JZQ A;  5ID2 A;  4LMW A;  1V58 A;  1DUG A;  3KM6 A;  1B4Q A;  1X5D A;  1SYX A;  4KND A;  1KBN A;  2LST A;  3ERW A;  3ZLP A;  3IPZ A;  1YF1 A;  2V6K A;  3GKX A;  4EUY A;  2FA4 A;  3VFI A;  1PKW A;  1RQM A;  4K2D A;  4HEA 2;  2L6C A;  1A2M A;  5C04 A;  4OO4 A;  1AQW A;  1UC7 A;  2H72 A;  2VM2 A;  1I5G A;  2L57 A;  3VPQ A;  12GS A;  2OKA A;  3L78 A;  5EPF A;  1F2E A;  3QR6 A;  3S9F A;  2P5R A;  1LJR A;  2REM A;  5DDL A;  1TRV A;  1FVJ A;  1XW9 A;  1FB0 A;  5DAK B;  1XFL A;  4G9H A;  5HR1 A;  3ZVJ D;  1TK5 B;  3RAZ A;  2CX3 A;  6GSW A;  1SD8 A;  2K8S A;  1S3D A;  3ZIV A;  1YKA A;  3GL3 A;  1WMJ A;  4RI7 A;  2HFD A;  1AQV A;  4PNF A;  5G30 A;  3GYK A;  5DAK A;  2HT9 A;  4HDE A;  4Q5F A;  2K8V A;  2YN1 A;  1Z5Y E;  2L6D A;  4IW9 A;  3TJB A;  2H1D A;  4WBJ A;  3UVT A;  2DJ3 A;  3HZ8 A;  4LLR A;  3QOU A;  5F07 A;  4XS4 B;  3A5W A;  3FZ9 A;  3LWA A;  4HU9 A;  1XZO A;  2HRN A;  4HUA A;  3VPT A;  1K0C A;  1GUK A;  3F6D A;  3A2V A;  1Z7P A;  3HKR A;  4KUN A;  3TRX A;  4HI7 A;  4F9Z A;  1KNG A;  2B5E A;  4XS4 A;  3GA4 A;  2HI7 A;  3EE2 A;  1YDK A;  17GS A;  2FWE A;  1GSQ A;  4L0W A;  3IDV A;  2NPB A;  2D2Z A;  2VLT A;  4PX1 A;  3APO A;  5IPH A;  1SKS B;  1X9S B;  4GCI A;  4ZBB A;  5ECM B;  4TRX A;  4MZC A;  4PUR A;  3BCK A;  1MEK A;  3WT2 A;  1BJX A;  1BED A;  5JCW A;  4I8B A;  3DEX A;  1PGT A;  2GQM A;  2P31 A;  3HXS A;  3U6V A;  3EIN A;  3PR8 A;  1PL1 A;  5DQS A;  1XCC A;  2LJA A;  1V9W A;  3QAV A;  1H4O A;  1OKD A;  1YQ1 A;  1OAZ A;  1EV9 A;  4CDO A;  2C80 A;  3PGT A;  4X0X A;  5CRW A;  2H73 A;  1THX A;  1K3O A;  1PD2 1;  2LV3 A;  3C1R A;  3LJR A;  2OAC A;  4GQC A;  2VD1 A;  3DIE A;  1U3I A;  2M80 A;  2R2J A;  5LCZ A;  3VWX A;  4OFM A;  4KDU A;  5KN1 A;  2DSA A;  4RI6 A;  3SBC A;  5HFK A;  2IMD A;  3BJ5 A;  4GWR A;  2JZS A;  4XS6 A;  3TRP A;  3ED3 A;  4MCU A;  1Q4J A;  1TKD B;  2RLI A;  1M2B A;  5A4V A;  19GS A;  5D93 A;  5GSS A;  4IVF A;  4ECJ A;  2P0G A;  2FNO A;  2C1Y A;  3IAM 2;  5IQY A;  3CMI A;  1ACV A;  2C4J A;  2V2G A;  3TUE A;  1GNE A;  2VCW A;  4BVY A;  2V32 A;  3M3M A;  2LQO A;  3F3Q A;  4WF5 A;  2K6V A;  2H74 A;  1DBY A;  2CV4 A;  4LL4 B;  4MF7 A;  4G19 A;  2OBK A;  5ECH B;  1GSD A;  4Q5N A;  2YPM A;  2HE3 A;  4IEL A;  2C3N A;  3UMA A;  1AUC A;  2IMI A;  5ECI B;  3TJK A;  3OR5 A;  3QD9 A;  1S3C A;  3APQ A;  1JLW A;  1XWA A;  3TGZ A;  1XIY A;  2JAC A;  2PMT A;  3QPM A;  1U88 A;  1JZW A;  5A5K A;  1O85 A;  2PUK C;  4MDC A;  3IBH A;  3UBL A;  4FYU A;  3GIX A;  5J9B A;  2MBS A;  4CW9 A;  5EY6 A;  5A4W A;  1ZOF A;  1O6J A;  5ELA A;  3M1G A;  3CSH A;  5IO0 A;  4MJC A;  4YQM A;  2B6M A;  4O32 A;  5CNW A;  1A23 A;  2VM1 A;  2LEG A;  2ZUP A;  3I43 A;  4MF5 A;  2GDR A;  4HQZ A;  2YWN A;  4EXJ A;  5GAP D;  4E8H A;  3UOM A;  1DE2 A;  2LJR A;  2C0D A;  5HFG A;  2MMO A;  3QFB C;  1A8Y A;  1ZMA A;  1T1V A;  3TOU A;  3HJP A;  1OC9 B;  3WGD A;  14GS A;  4IS0 A;  4ULX A;  2FD3 A;  1GH2 A;  4KX4 A;  4BVX A;  5CAX A;  2DBC A;  2H71 A;  2GT5 A;  2YWM A;  3G7I A;  3FEU A;  1OC9 A;  2J23 A;  4J57 E;  1JZD A;  3GH9 A;  5D73 A;  3TJG A;  20GS A;  3C1S A;  4IN0 A;  1W4V A;  1B48 A;  1M9A A;  4WF4 A;  3GUS A;  4GQF A;  1SJZ A;  3F3R A;  3PIN A;  3F0I A;  5D9X A;  1SL2 B;  1HYU A;  2AAW A;  3KIJ A;  1SJI A;  1EEM A;  2RUE A;  3TOT A;  2A2R A;  3Q19 A;  3H4K A;  3IR4 A;  4EL1 A;  2YOI A;  4WET A;  2BMX A;  5KN0 A;  2H6X A;  2O89 A;  4POB A;  3ZL5 A;  3A2W A;  4F82 A;  4HS1 A;  2OE0 A;  5IOX A;  3F4S A;  4TR1 B;  4XS1 A;  3IHQ A;  2H19 A;  2FGX A;  2FWH A;  2RM6 A;  5ECK B;  4RQX A;  1GUH A;  3FRC A;  4MH2 A;  3C73 A;  3DVW A;  3RPP A;  2R5G A;  3GX0 A;  2KUC A;  4TR1 A;  4I6X A;  4I5Q A;  3H79 A;  2QC7 A;  5IMA A;  2M72 A;  4PQ1 A;  3IE3 A;  1WE0 A;  1AQX A;  3VUR A;  3IK7 A;  4MMM A;  6GSU A;  2HZF A;  3F4T A;  2MMA A;  3ME8 A;  2AB6 A;  1GL8 A;  3BBY A;  3TKP A;  5ENU A;  4TN8 A;  2TRC P;  4IJ3 A;  3KEB A;  1RK4 A;  4QQ7 A;  3GKM A;  4BL7 A;  1CQG A;  22GS A;  5IPG A;  3FKF A;  3ERG A;  3LGC A;  4RUV A;  5FHI A;  5IOW A;  5D9T A;  3ZRE A;  1VF1 A;  3GSS A;  1TU7 A;  3FR9 A;  2PWJ A;  3FY7 A;  2WGR A;  1YY7 A;  3E3E A;  4OCE A;  3J7Y k;  1LU4 A;  2GZY A;  3KMN A;  3L9S A;  1FAA A;  1JHB A;  3P2A A;  5JWO B;  4K7O A;  2O8V B;  2OBI A;  2R3X A;  2I3Y A;  1Z7R A;  2H6Z A;  1F3A A;  3GKN A;  4WKW A;  3F4R A;  1IYI A;  2JZT A;  4PUF C;  5DJM A;  1N2A A;  2YZH A;  2OE3 A;  1ERW A;  4YAV A;  3DRN A;  4F03 A;  4HOJ A;  4POM A;  3CTG A;  3H1N A;  2LNT A;  1T7P B;  4XTS A;  3P90 A;  1C72 A;  3HHV A;  2X8H A;  4YH2 A;  3LEF A;  1EWX A;  4WBR D;  2YCD A;  3KZQ A;  3PH9 A;  4NHW A;  1XVW A;  3D4M A;  4FYB A;  10GS A;  2YAN A;  1XOB A;  3O6T A;  1TXX A;  4MPG A;  2V41 A;  2VL9 A;  2DJJ A;  3EC3 A;  4G2E A;  2YZU A;  1F9M A;  1GP1 A;  3GX8 A;  2GQL A;  4K9Z A;  2A4V A;  4TR0 A;  4ACS A;  4JED A;  4MPF A;  3R2Q A;  1UA5 A;  2AHE A;  3FW2 A;  3RDW A;  2X99 A;  3IK9 A;  3GMF A;  2XHF A;  2I4A A;  1SK2 A;  3RHC A;  3TCO A;  1PN9 A;  2L5O A;  2HLS A;  1O7U A;  5INY A;  3HA9 A;  1DSB A;  4TXO B;  1GUL A;  3UIW A;  3UVH A;  4N11 A;  1VRS D;  3A3T A;  2GST A;  2PN8 A;  4KDY A;  1FG4 A;  2C8U A;  5KEJ A;  4TXO A;  2BTO T;  3HVV A;  5AIV A;  4IP6 A;  3EWL A;  3HYP A;  5AGY A;  4EKZ A;  1AIU A;  1MTC A;  2B5Y A;  5G31 A;  2LNS A;  3KMO A;  5GAN D;  4ZXG A;  5AN1 A;  2YJH A;  3TJJ A;  1EZK A;  1H75 A;  1QMV A;  3TKR A;  1ZGN A;  2WUL A;  3LXZ A;  2B5X A;  2VUP A;  1EGO A;  3HJO A;  3ZTL A;  1GRX A;  4Q5R A;  1SL0 B;  1T8E B;  3ME7 A;  3I69 A;  2NDO A;  4TOP A;  5LD0 A;  1GLP A;  1EOH A;  3Q74 A;  1OC3 A;  3IAS 2;  3WD6 A;  4LMV A;  2F9S A;  2VL2 A;  18GS A;  3ZIT A;  3TJF A;  2OJL A;  2GSR A;  1K0A A;  3UBK A;  3GRX A;  1B8X A;  2O7K A;  3AY8 A;  2IME A;  3ZRD A;  4H86 A;  3KJY A;  3NOF A;  5ECR B;  1NSW A;  3LFL A;  2DLX A;  3QMX A;  2PER A;  3QDN A;  1OC8 A;  5L71 A;  4JE1 A;  2L4Q A;  2AV4 A;  3TKS C;  4WR5 A;  2TIR A;  5G2Z A;  3TB2 A;  3K8N A;  3UAP A;  3QCP A;  3NZN A;  2MMZ A;  1G7O A;  2NTO A;  2XBI A;  5EVO A;  2DIY A;  2VCX A;  2MMN A;  3HY2 A;  2A2S A;  1CQH A;  4TR4 A;  3F6F A;  4ZBA A;  1A2L A;  1QUW A;  5AIX A;  2EIQ A;  1GTA A;  4LA1 A;  5F05 A;  4TKY A;  4JR6 A;  1YF0 A;  1M9B A;  3KD0 A;  2YV7 A;  5JWQ B;  3DML A;  4FH8 A;  4ECC A;  2IPA A;  4KCA A;  4GLT A;  1MDJ A;  4K6X A;  4IKH A;  1TI1 A;  4POK A;  5DJL A;  1ZCP A;  1QGV A;  3UAR A;  1GSU A;  1O81 A;  4LL1 B;  2H1G A;  2K18 A;  2H66 A;  1PX6 A;  1USB A;  1URM A;  2RM5 A;  4XRA A;  1THO A;  2KLX A;  4F0C A;  3ZML A;  1N8J A;  2H01 A;  2YWO A;  4PGT A;  2V1M A;  3L9U A;  4IBP A;  2IIY A;  1TOF A;  3KP8 A;  3KTB A;  4I97 A;  3L9V A;  3QAW A;  4F2I A;  2H6Y A;  4KCE A;  1R5P A;  1XXU A;  5D9V A;  2PVQ A;  1W89 A;  4NAX A;  1NHY A;  1SJ6 A;  3D0Z A;  3LOR A;  1ML6 A;  2EC4 A;  1HNC A;  4Z7X A;  1E2Y A;  4DVC A;  4YAP A;  1XWG A;  4AJ7 A;  1FO5 A;  4MZB A;  1V57 A;  2RII A;  3G9B A;  1MDI A;  6GSS A;  6GSY A;  3W6G A;  2GQK A;  2VL3 A;  3TRQ A;  2H0G A;  1OVN A;  1G0T A;  3D4T A;  1TP9 A;  5JCG A;  4TR3 A;  4OCF A;  3D21 A;  4KGI A;  2X64 A;  4N10 A;  1IYH A;  3MSZ A;  1HNB A;  2HSY A;  2C3Q A;  3LG6 A;  3GV1 A;  2KHP A;  2CZ2 A;  2FLS A;  5ECP B;  1B4P A;  2ES7 A;  3US3 A;  1GTI A;  1XWB A;  1OE8 A;  4WR4 A;  5B6N A;  3CTF A;  3QFA C;  1J9B A;  5J41 A;  1HNA A;  1Q98 A;  3RHB A;  1AW9 A;  2LKU A;  2VLV A;  3F9U A;  4OMV A;  1J08 A;  4EVM A;  1MD3 A;  1M2A A;  5H5S A;  2WS2 A;  1G6W A;  2L59 A;  2C0E A;  4FYC A;  4MH3 A;  2I9H A;  3FK8 A;  3L4N A;  1EV4 A;  3M9K A;  3GFK A;  3IXR A;  2B7K A;  1YKC A;  4PQH A;  4EDY A;  1U6T A;  1SKW B;  1K0D A;  2EIO A;  2DMM A;  4ISD A;  2OAD A;  4GSS A;  1PMT A;  3LQ7 A;  4K1F A;  3ZFL A;  1K0O A;  3M0F A;  1SK0 A;  4XIH A;  1T3B A;  1FHE A;  1TW9 A;  1PKZ A;  1K0B A;  4HJ2 A;  1Z6N A;  4L5O A;  4KE3 A;  2VIM A;  3MAK A;  4FIW A;  2YJ7 A;  1M99 A;  2E0Q A;  4PUA A;  1NW2 A;  3LSZ A;  3SWL A;  3J7Y b;  3WGE A;  2KP2 A;  2CAI A;  4RQR A;  5IMD A;  5B6M A;  5ECN B;  3DVX A;  4NPB A;  3KCM A;  4ZB9 A;  2WZ9 A;  2FY6 A;  2H0H A;  4MJE A;  1KEB A;  1SKR B;  3DXB A;  2O87 A;  2X8G A;  3GST A;  3ZMK A;  4KA0 A;  2XPE A;  4O7H A;  3WT1 A;  4MK3 A;  3GTU B;  3FHK A;  5DCG A;  4I2U A;  4D73 B;  2TRX A;  4K0G A;  4MA9 A;  1ZYE A;  3RBT A;  2M46 A;  4ILF A;  3DGQ A;  2C3T A;  4NMU A;  1K3L A;  1SYR A;  4PQI A;  3KH9 A;  1ERU A;  4FO5 A;  2F8F A;  3GTU A;  2GT6 A;  2YV9 A;  4D73 A;  4BA7 A;  3ERF A;  2R4V A;  2OE1 A;  2Z9S A;  16GS A;  3EU3 A;  2PVO C;  1SD9 A;  4TW5 A;  1XW6 A;  2VD0 A;  5CRG A;  1ZL9 A;  3FZA A;  3IOS A;  3VLN A;  3D22 A;  4DSQ A;  3UJ1 A;  3WYW A;  4BWQ A;  4OO5 A;  1GUM A;  1R4W A;  2PBJ A;  1YEX A; 
#chains in the Genus database with same CATH topology
 3CBU A;  1ZYN A;  5JWR B;  1TDI A;  4XRD A;  3ISO A;  1A24 A;  2F8A A;  3D6I A;  3TDG A;  2LRN A;  1AXD A;  2VCV A;  2VAF A;  2NBS A;  2DJ1 A;  1QFN A;  1G7E A;  4USS A;  5DVB A;  2IWT A;  4ZB8 A;  2LTK A;  2B3S A;  3EMX A;  4ZB6 A;  1SL1 B;  4HJM A;  1A0F A;  2HYX A;  1OE7 A;  1XVQ A;  1XBS A;  4V2M A;  5C00 A;  4JU5 A;  1QXH A;  2QKE A;  3IA1 A;  3IC8 A;  3MNG A;  4ZIJ A;  2O85 A;  4MZW A;  2MZC A;  4J56 E;  4MJA A;  2XBQ A;  1GSY A;  3W8S A;  2R37 A;  1ZYQ B;  2HRF A;  2MBT A;  2HSH A;  5ECL B;  4K5S A;  1K0M A;  2AJQ B;  1TK0 B;  3ZVJ A;  4GRF A;  4PNG A;  5HR0 A;  1XWC A;  2H1B A;  3KXO A;  3FR6 A;  1F6M C;  1A8L A;  3KGK A;  2LS5 A;  3C7M A;  5GST A;  4IJI A;  5IO2 A;  1ZZY A;  1VF2 A;  2CVD A;  1LBK A;  1U87 A;  1E6B A;  3Q18 A;  2H0I A;  1X5C A;  3EMP A;  5CRD A;  2YNX A;  3GL5 A;  3GH6 A;  3HD5 A;  2VCZ A;  2DKH A;  1G6Y A;  2WJU A;  1WRY A;  6GST A;  1AC1 A;  4AGS A;  4AF2 A;  2JSZ A;  2G2Q A;  1XG8 A;  5G1K A;  5CRE A;  3PPU A;  4POL A;  4V1A g;  2MYG A;  1B9X C;  2QGV A;  3A2X A;  1BYE A;  1SEN A;  3FZ4 A;  4KH7 A;  5CRH A;  2L4C A;  3CXG A;  2GTU A;  3CSJ A;  2G0F A;  4KAE A;  2LQQ A;  1PQN A;  5COH A;  3VK9 A;  7GSS A;  1GSF A;  1TI3 A;  4WXT A;  1JLV A;  3GUR A;  4V2L A;  1OYJ A;  2E7P A;  2IJY A;  2KP1 A;  5HR2 A;  3EVI A;  4Z2T A;  2CVK A;  4QL7 A;  2P5Q A;  3ZZX A;  3LW9 A;  1XPV A;  3IRA A;  3VI7 A;  4N0V A;  1UN2 A;  3NIV A;  5G1L A;  2HRA A;  1QK8 A;  3TKS E;  5ECS A;  5ECQ B;  1YJ6 A;  3BCI A;  1EEJ A;  4MP4 A;  4Q5Q A;  2CT6 A;  2VOC A;  13GS A;  5JCU A;  4ZL8 A;  3WGX A;  3E9J B;  4XHM A;  2DJ2 A;  3DKS A;  3QAG A;  2PGT A;  4MJB A;  1FB6 A;  1J0F A;  2L5L A;  3I9V 2;  2ON7 A;  4IQA A;  1I9D A;  4EO3 A;  1VF3 A;  1F37 A;  1TRS A;  1XWK A;  11GS A;  4K7N A;  5CO3 A;  2AUV A;  1JFU A;  3HVX A;  2DJ0 A;  1X0R A;  1R7H A;  1O8X A;  3HZ4 A;  3LXT A;  4KB3 A;  1SU9 A;  5IM9 A;  3L0H A;  1JZO A;  5H5Q A;  1ABA A;  1PA3 A;  1B9Y C;  1S3A A;  1XW5 A;  2OA7 A;  1Z3E A;  3EUR A;  1M0U A;  1TU8 A;  4DEJ A;  1UVZ A;  2N5B A;  3HVS A;  3O76 A;  3HCZ A;  3MDK A;  2IMK A;  4HZ2 A;  2AYT A;  1Y6E A;  4KSM A;  4EE0 A;  3FZ5 A;  4IP1 A;  2J9H A;  2CZ3 A;  5F06 A;  4MLY A;  5KN3 A;  3BOA A;  2CQ9 A;  2JZR A;  1PSQ A;  1RW1 A;  5EL8 A;  4XCS A;  1XOA A;  2NVL A;  5IMC A;  4NWY A;  5KOW A;  2F3M A;  1X5E A;  1MDK A;  3G7J A;  1A0R P;  4ML1 A;  1T4Z A;  2H75 A;  1R5A A;  4IGJ A;  1VGL A;  2E2M A;  3KTL A;  1YZX A;  4O5R A;  1X9M B;  4PXO A;  3KH7 A;  3E0U A;  2GS3 A;  1TRU A;  2R6K A;  3C71 A;  2H8L A;  4JBB A;  1JZR A;  2EIR A;  3O3T A;  5B7C A;  3U5R E;  5IMF A;  1EOG A;  2RUF A;  5J9C A;  2GVP A;  2ALB A;  2BJX A;  3FYG A;  4ZL9 A;  4QL9 A;  5CP1 A;  5H5R A;  4AJ8 A;  1FVK A;  3LYK A;  2FWG A;  4HZ4 A;  2GSQ A;  2V6O A;  5GZZ B;  6GSX A;  5B8B A;  4V2N A;  5DQY A;  3P7X A;  1BQ7 A;  2DJK A;  4ZBD A;  3KP9 A;  2QSI A;  4EF0 A;  4OFN A;  1PRX A;  9GSS A;  3MWH A;  1T00 A;  1O73 A;  1HD2 A;  1Z9H A;  2N5A A;  1T4Y A;  3LYP A;  2E2G A;  3H8Q A;  3D5J A;  2LRT A;  4G10 A;  3F63 A;  1TRW A;  2C0F A;  4L0U A;  3EYT A;  4MNN A;  4N30 A;  3JCM L;  5J4U A;  4V1A p;  1GWC A;  3DYR A;  4EC0 A;  4GSN A;  4X43 A;  5DCH A;  2H70 A;  3G7Y A;  2VCQ A;  1Y25 A;  4YKF A;  2GLR A;  2X8C A;  2C0G A;  5B8A A;  3V1W A;  3APS A;  1DE1 A;  2FCH A;  3CYN A;  2ON5 A;  4F0B A;  4IHU A;  4NXI A;  1M2D A;  3HDC A;  1Z6M A;  2PU9 C;  4ECB A;  4NV2 A;  5D96 A;  3M9J A;  3Q6O A;  1BG5 A;  4K0N A;  1TTZ A;  8GSS A;  4KDX A;  2LJK A;  2FWF A;  2HXK A;  3ZIJ A;  1GLQ A;  2CVB A;  2WCI A;  5D9W A;  2N5F A;  3CRT A;  4P3Y B;  5IMV A;  1F3B A;  3VWU A;  5D8I A;  2WFC A;  2HZE B;  1ZYP A;  3IV4 A;  4WEY A;  5HQP A;  1X9W B;  3FR3 A;  5E4W A;  2GSS A;  1GNW A;  4OFT A;  2H1A A;  1GTU A;  1TJD A;  1EP7 A;  1AAZ A;  1GSS A;  5DAL B;  4HQS A;  2WRT A;  3P8W A;  3C8E A;  2HZE A;  4MF6 A;  2XC2 A;  1FOV A;  2WDU A;  3TKS A;  3ZYW A;  3H93 A;  5G5E A;  1V2A A;  4KSO A;  3N9J A;  2GZZ A;  2IFQ B;  1VF4 A;  5DAL A;  2B1L A;  1K0N A;  2DIZ A;  4HU7 A;  1WP0 A;  4BPY A;  2H76 A;  4JR4 A;  2H30 A;  4GST A;  1NHO A;  4E8E A;  4NHZ A;  2YP6 A;  2ZCT A;  5ABR A;  5J5N A;  5AIS A;  2XPD A;  2IFQ A;  1EGR A;  4O92 A;  2A4H A;  1QQ2 A;  2DC5 A;  3VWW A;  4I2T A;  5FWG A;  1PL2 A;  3HJM A;  1OKT A;  5HFI A;  5FT3 A;  1R26 A;  1MD4 A;  4NV5 A;  4DSS B;  1ILO A;  5ELG A;  2VLU A;  2X49 A;  1GSE A;  3UEM A;  2FA8 A;  1V98 A;  2CAQ A;  2CX4 A;  4YQU A;  5DBQ A;  5F8B A;  2IL3 A;  2WB9 A;  5CYY A;  4ML6 A;  1NM3 A;  4DSS A;  3GKK A;  3UL3 A;  3W8J A;  4ECI A;  4O5U A;  5LNK e;  3IC4 A;  1WOU A;  2FUG 2;  5HR3 A;  4ZIL A;  4K7I A;  1EP8 A;  3F8U A;  3EU4 A;  5IIZ A;  3TKQ A;  2VL2 C;  4YQV A;  3M8N A;  4DSR A;  2JSY A;  1S3R A;  2HNL A;  1FW1 A;  3RPN A;  1ON4 A;  1ERV A;  2FHE A;  4J2F A;  3CSI A;  4BWS A;  2KOK A;  1ERT A;  4G0K A;  4K8M A;  2JU5 A;  1PX7 A;  1TK8 B;  4CHS A;  4TVE A;  2IN3 A;  2F51 A;  1WWJ A;  2K9F A;  1U3A A;  2LRC A;  4GTU A;  5J3R A;  5IMZ A;  3GN3 A;  3BD2 A;  4N0Z A;  2VO4 A;  4OD7 A;  2PPT A;  1GTB A;  2JAD A;  3CRU A;  1WIK A;  2B7J A;  1KTE A;  4ZL7 A;  2GZP A;  1BX9 A;  1O8W A;  3VI5 A;  2YWI A;  4KW6 A;  4IQ1 A;  2JL4 A;  4MAB A;  4EDZ A;  1ST9 A;  5E59 A;  1V40 A;  2IMF A;  4GF0 A;  5KN2 A;  1YEP A;  1SK1 A;  2CA8 A;  3ZFB A;  1HQO A;  2B1K A;  6GSV A;  4OWY A;  2DML A;  5ECO B;  5A4U A;  4GXZ A;  1BAY A;  2I1U A;  3GNJ A;  5ID2 B;  4X1U A;  5F0G A;  3I6A A;  2I81 A;  1M7T A;  4TXV A;  1A2J A;  4JRR A;  4L5L A;  4AJ6 A;  1WJK A;  3GHA A;  2ZNM A;  3VWV A;  3DWV A;  2VCT A;  4L8E A;  1WPI A;  3N5O A;  4ID0 A;  3DD3 A;  2GGT A;  1K3Y A;  2LUS A;  5G5F A;  4JZQ A;  5ID2 A;  4LMW A;  1V58 A;  1DUG A;  3KM6 A;  1B4Q A;  2R0P A;  1X5D A;  1SYX A;  4KND A;  1KBN A;  2LST A;  3ERW A;  3ZLP A;  3IPZ A;  1YF1 A;  2V6K A;  3GKX A;  4EUY A;  2FA4 A;  3VFI A;  1PKW A;  1RQM A;  4K2D A;  4HEA 2;  2L6C A;  3CQF A;  1A2M A;  5C04 A;  4OO4 A;  1AQW A;  1UC7 A;  2H72 A;  2VM2 A;  1I5G A;  2L57 A;  3VPQ A;  12GS A;  2OKA A;  3L78 A;  5EPF A;  1F2E A;  3QR6 A;  3S9F A;  2P5R A;  1LJR A;  2REM A;  5DDL A;  1TRV A;  1FVJ A;  1XW9 A;  1FB0 A;  5DAK B;  1XFL A;  4G9H A;  5HR1 A;  3ZVJ D;  1TK5 B;  3RAZ A;  2CX3 A;  6GSW A;  1SD8 A;  2K8S A;  1S3D A;  3ZIV A;  1YKA A;  3GL3 A;  1WMJ A;  4RI7 A;  2HFD A;  1AQV A;  4PNF A;  5G30 A;  3GYK A;  2HT9 A;  4HDE A;  4Q5F A;  5DAK A;  2K8V A;  2YN1 A;  1Z5Y E;  2L6D A;  4IW9 A;  3TJB A;  2H1D A;  4WBJ A;  3UVT A;  2DJ3 A;  3HZ8 A;  2A2P A;  4LLR A;  3QOU A;  5F07 A;  4XS4 B;  3A5W A;  3FZ9 A;  3LWA A;  4HU9 A;  1XZO A;  2HRN A;  4HUA A;  3VPT A;  1K0C A;  1GUK A;  3F6D A;  3A2V A;  1Z7P A;  3HKR A;  4KUN A;  3TRX A;  4HI7 A;  4F9Z A;  1KNG A;  2B5E A;  4XS4 A;  3GA4 A;  2HI7 A;  3EE2 A;  1YDK A;  17GS A;  2FWE A;  1GSQ A;  4L0W A;  3IDV A;  2NPB A;  2D2Z A;  2VLT A;  4PX1 A;  3APO A;  5IPH A;  1SKS B;  1X9S B;  4GCI A;  4ZBB A;  5ECM B;  4TRX A;  4MZC A;  4PUR A;  3BCK A;  1MEK A;  3WT2 A;  1BJX A;  1BED A;  3HVN A;  5JCW A;  4I8B A;  3DEX A;  1PGT A;  2GQM A;  2P31 A;  3HXS A;  3U6V A;  3EIN A;  3PR8 A;  4ICY A;  1PL1 A;  5DQS A;  1XCC A;  2LJA A;  1V9W A;  3QAV A;  1H4O A;  1OKD A;  1YQ1 A;  1OAZ A;  1EV9 A;  4CDO A;  2C80 A;  3PGT A;  4X0X A;  5CRW A;  2H73 A;  1THX A;  1K3O A;  1PD2 1;  2LV3 A;  3C1R A;  3LJR A;  2OAC A;  4GQC A;  2VD1 A;  3DIE A;  1U3I A;  2M80 A;  2R2J A;  5LCZ A;  3VWX A;  4OFM A;  4KDU A;  4KF9 A;  5KN1 A;  2DSA A;  4RI6 A;  3SBC A;  5HFK A;  2IMD A;  3BJ5 A;  4GWR A;  2JZS A;  4XS6 A;  3TRP A;  3ED3 A;  4MCU A;  1Q4J A;  1TKD B;  2RLI A;  1M2B A;  5A4V A;  19GS A;  5D93 A;  4PTS A;  5GSS A;  4IVF A;  4BVY B;  4ECJ A;  2P0G A;  2FNO A;  2C1Y A;  3IAM 2;  5IQY A;  3CMI A;  1ACV A;  2C4J A;  2V2G A;  3TUE A;  1GNE A;  2VCW A;  4BVY A;  2V32 A;  3M3M A;  2LQO A;  3F3Q A;  4WF5 A;  2K6V A;  2H74 A;  1DBY A;  2CV4 A;  4LL4 B;  4MF7 A;  4G19 A;  2OBK A;  5ECH B;  1GSD A;  3MIX A;  4Q5N A;  2YPM A;  2HE3 A;  4IEL A;  2C3N A;  3UMA A;  1AUC A;  2IMI A;  5ECI B;  3TJK A;  3OR5 A;  3QD9 A;  1S3C A;  3APQ A;  1JLW A;  1XWA A;  3TGZ A;  1XIY A;  2JAC A;  2PMT A;  3QPM A;  1U88 A;  1JZW A;  5A5K A;  1O85 A;  2PUK C;  4MDC A;  3IBH A;  3UBL A;  4FYU A;  3GIX A;  5J9B A;  2MBS A;  4CW9 A;  5EY6 A;  5A4W A;  1ZOF A;  1O6J A;  5ELA A;  3M1G A;  3CSH A;  5IO0 A;  4MJC A;  4YQM A;  4EIP A;  2HRK A;  2B6M A;  4O32 A;  5CNW A;  1A23 A;  2VM1 A;  2LEG A;  2ZUP A;  3I43 A;  4MF5 A;  2GDR A;  4HQZ A;  2YWN A;  4EXJ A;  5GAP D;  4E8H A;  3UOM A;  1DE2 A;  2LJR A;  2C0D A;  5HFG A;  4HSC X;  2MMO A;  3QFB C;  4BVX B;  1A8Y A;  1ZMA A;  1T1V A;  3TOU A;  3HJP A;  1OC9 B;  3WGD A;  14GS A;  4IS0 A;  4ULX A;  2FD3 A;  1GH2 A;  4KX4 A;  4BVX A;  5CAX A;  2DBC A;  2H71 A;  2GT5 A;  2YWM A;  3G7I A;  3FEU A;  1OC9 A;  2J23 A;  4J57 E;  1JZD A;  3GH9 A;  5D73 A;  3TJG A;  20GS A;  3C1S A;  4IN0 A;  1W4V A;  1B48 A;  1M9A A;  4WF4 A;  3GUS A;  4GQF A;  1SJZ A;  2HSM A;  3F3R A;  3PIN A;  3F0I A;  5D9X A;  1SL2 B;  1HYU A;  2AAW A;  3KIJ A;  1SJI A;  1EEM A;  3IHG A;  2RUE A;  3TOT A;  2A2R A;  3Q19 A;  3H4K A;  3IR4 A;  4EL1 A;  2YOI A;  4WET A;  2BMX A;  5KN0 A;  2H6X A;  2O89 A;  4POB A;  3ZL5 A;  3A2W A;  4F82 A;  4HS1 A;  2OE0 A;  5IOX A;  3F4S A;  4TR1 B;  4XS1 A;  3IHQ A;  2H19 A;  2FGX A;  2FWH A;  2RM6 A;  5ECK B;  4RQX A;  1GUH A;  3FRC A;  4MH2 A;  3C73 A;  3DVW A;  3RPP A;  2R5G A;  3GX0 A;  2KUC A;  4TR1 A;  4I6X A;  4I5Q A;  3H79 A;  2QC7 A;  5IMA A;  2M72 A;  4PQ1 A;  5BMU A;  3IE3 A;  2R0C A;  1WE0 A;  1AQX A;  3VUR A;  3IK7 A;  4BL7 B;  4MMM A;  6GSU A;  2HZF A;  3F4T A;  2MMA A;  3ME8 A;  2AB6 A;  3MYD A;  1GL8 A;  3BBY A;  3TKP A;  5ENU A;  4TN8 A;  2TRC P;  4IJ3 A;  3KEB A;  1RK4 A;  4QQ7 A;  3GKM A;  4BL7 A;  1M3I A;  1CQG A;  22GS A;  5IPG A;  3FKF A;  3ERG A;  3LGC A;  4O5Q A;  4RUV A;  5FHI A;  5IOW A;  5D9T A;  3ZRE A;  1VF1 A;  3GSS A;  1TU7 A;  3FR9 A;  2PWJ A;  3FY7 A;  2WGR A;  1YY7 A;  3E3E A;  4OCE A;  3J7Y k;  1LU4 A;  2GZY A;  3KMN A;  3L9S A;  1FAA A;  1JHB A;  3P2A A;  5JWO B;  4K7O A;  2O8V B;  2OBI A;  2R3X A;  2I3Y A;  1Z7R A;  2H6Z A;  1F3A A;  3GKN A;  4WKW A;  3F4R A;  1IYI A;  2JZT A;  4PUF C;  5DJM A;  1N2A A;  2YZH A;  2OE3 A;  1ERW A;  4YAV A;  3DRN A;  4F03 A;  4HOJ A;  4POM A;  3CTG A;  3H1N A;  2LNT A;  1T7P B;  4XTS A;  3P90 A;  1C72 A;  3HHV A;  2X8H A;  4YH2 A;  3LEF A;  1EWX A;  4WBR D;  2YCD A;  3KZQ A;  3PH9 A;  4NHW A;  1XVW A;  3D4M A;  4FYB A;  10GS A;  4G0L A;  2YAN A;  1XOB A;  3O6T A;  1TXX A;  4MPG A;  2V41 A;  2VL9 A;  2DJJ A;  3EC3 A;  4G2E A;  2YZU A;  1F9M A;  1GP1 A;  3GX8 A;  2GQL A;  4K9Z A;  2A4V A;  4TR0 A;  4ACS A;  4JED A;  4MPF A;  3R2Q A;  1UA5 A;  2AHE A;  3FW2 A;  3RDW A;  2X99 A;  3IK9 A;  3GMF A;  2XHF A;  2I4A A;  1SK2 A;  3RHC A;  3TCO A;  1PN9 A;  2L5O A;  2HLS A;  4YKG A;  1O7U A;  5INY A;  3HA9 A;  1DSB A;  4TXO B;  1GUL A;  3UIW A;  3UVH A;  4N11 A;  1VRS D;  3A3T A;  2GST A;  2UZ8 A;  2PN8 A;  4KDY A;  1FG4 A;  2C8U A;  5KEJ A;  4TXO A;  2BTO T;  3HVV A;  5AIV A;  4IP6 A;  3EWL A;  3HYP A;  5AGY A;  4EKZ A;  1AIU A;  1MTC A;  2B5Y A;  5G31 A;  2LNS A;  1M3J A;  3KMO A;  5GAN D;  4ZXG A;  5AN1 A;  2YJH A;  3TJJ A;  1EZK A;  1H75 A;  1QMV A;  3TKR A;  1ZGN A;  2QA1 A;  2WUL A;  3LXZ A;  2B5X A;  2VUP A;  1EGO A;  3HJO A;  3ZTL A;  1GRX A;  4Q5R A;  1SL0 B;  1T8E B;  3ME7 A;  2R0G A;  3I69 A;  2NDO A;  4TOP A;  5LD0 A;  1GLP A;  1EOH A;  3A5I A;  3Q74 A;  1OC3 A;  3IAS 2;  3WD6 A;  4LMV A;  2F9S A;  2VL2 A;  18GS A;  3ZIT A;  3TJF A;  2OJL A;  2GSR A;  1K0A A;  3UBK A;  3GRX A;  1B8X A;  2O7K A;  3AY8 A;  2IME A;  3ZRD A;  4H86 A;  4G0I A;  3KJY A;  3NOF A;  5ECR B;  1NSW A;  3LFL A;  2DLX A;  3QMX A;  2PER A;  3QDN A;  1OC8 A;  5L71 A;  4JE1 A;  2L4Q A;  2AV4 A;  3TKS C;  4WR5 A;  2TIR A;  3FMW A;  5G2Z A;  3TB2 A;  3K8N A;  5KOX A;  3UAP A;  3QCP A;  3NZN A;  2MMZ A;  1G7O A;  2NTO A;  2XBI A;  5EVO A;  2DIY A;  2VCX A;  2MMN A;  3HY2 A;  2A2S A;  1CQH A;  4TR4 A;  3F6F A;  4ZBA A;  1A2L A;  1QUW A;  4BIK A;  5AIX A;  2EIQ A;  1GTA A;  4LA1 A;  5F05 A;  4TKY A;  4JR6 A;  1YF0 A;  1M9B A;  3KD0 A;  2YV7 A;  5JWQ B;  3DML A;  4K2X A;  5BRT A;  4FH8 A;  4ECC A;  2IPA A;  4KCA A;  4GLT A;  1MDJ A;  4K6X A;  4IKH A;  1TI1 A;  4POK A;  5DJL A;  1ZCP A;  1QGV A;  3UAR A;  1GSU A;  1O81 A;  2QA2 A;  2H1G A;  4LL1 B;  2X4A A;  2K18 A;  2H66 A;  1PX6 A;  1USB A;  1URM A;  2RM5 A;  4Z2U A;  4XRA A;  1THO A;  2KLX A;  4F0C A;  3ZML A;  1N8J A;  2H01 A;  2YWO A;  4PGT A;  2V1M A;  3L9U A;  4IBP A;  2IIY A;  1TOF A;  3KP8 A;  3KTB A;  3EPT A;  1PN0 A;  4I97 A;  3L9V A;  4CY6 A;  3QAW A;  1PFO A;  4F2I A;  2H6Y A;  4KCE A;  1R5P A;  1XXU A;  5D9V A;  2PVQ A;  1W89 A;  4NAX A;  1NHY A;  1SJ6 A;  3D0Z A;  3LOR A;  1ML6 A;  2EC4 A;  3R3E A;  1HNC A;  4Z7X A;  1E2Y A;  4DVC A;  4YAP A;  1XWG A;  4AJ7 A;  1FO5 A;  4MZB A;  1V57 A;  2RII A;  3G9B A;  1MDI A;  6GSS A;  6GSY A;  3W6G A;  2GQK A;  2VL3 A;  3TRQ A;  2H0G A;  1OVN A;  1G0T A;  3D4T A;  1TP9 A;  5JCG A;  4TR3 A;  4OCF A;  1FOH A;  3D21 A;  4KGI A;  2X64 A;  4N10 A;  1IYH A;  3MSZ A;  1HNB A;  2HSY A;  2C3Q A;  3LG6 A;  3GV1 A;  2KHP A;  2CZ2 A;  2FLS A;  5ECP B;  4K5R A;  4CY8 A;  1B4P A;  2ES7 A;  3US3 A;  1GTI A;  1XWB A;  1OE8 A;  2DKI A;  4WR4 A;  5B6N A;  3CTF A;  3QFA C;  1J9B A;  5J41 A;  1HNA A;  1Q98 A;  3RHB A;  4X4J A;  1AW9 A;  4FQU A;  2LKU A;  2VLV A;  3F9U A;  4OMV A;  1J08 A;  4EVM A;  1MD3 A;  1M2A A;  5H5S A;  2WS2 A;  1G6W A;  2L59 A;  2C0E A;  4FYC A;  4MH3 A;  2I9H A;  3FK8 A;  3L4N A;  1EV4 A;  3M9K A;  3GFK A;  3IXR A;  2B7K A;  1YKC A;  4PQH A;  4EDY A;  1U6T A;  1SKW B;  1K0D A;  2EIO A;  2DMM A;  4ISD A;  2OAD A;  4GSS A;  1PMT A;  3LQ7 A;  4K1F A;  3ZFL A;  1K0O A;  3M0F A;  1SK0 A;  4XIH A;  1T3B A;  1FHE A;  1TW9 A;  1PKZ A;  1K0B A;  4HJ2 A;  1Z6N A;  4L5O A;  4KE3 A;  2VIM A;  3MAK A;  4FIW A;  2YJ7 A;  1M99 A;  2E0Q A;  4PUA A;  1NW2 A;  3LSZ A;  3SWL A;  3J7Y b;  3WGE A;  2KP2 A;  2CAI A;  4RQR A;  5IMD A;  5B6M A;  5ECN B;  3DVX A;  4NPB A;  3KCM A;  4ZB9 A;  2WZ9 A;  4EIQ A;  2FY6 A;  2H0H A;  4MJE A;  1KEB A;  1SKR B;  3DXB A;  2O87 A;  2X8G A;  3GST A;  3ZMK A;  4KA0 A;  2XPE A;  4O7H A;  3WT1 A;  4MK3 A;  3GTU B;  3FHK A;  5DCG A;  4I2U A;  4D73 B;  2TRX A;  4K0G A;  4MA9 A;  1ZYE A;  3RBT A;  2M46 A;  4ILF A;  3DGQ A;  2C3T A;  4NMU A;  1K3L A;  1SYR A;  4PQI A;  3KH9 A;  1ERU A;  4FO5 A;  2F8F A;  3GTU A;  2GT6 A;  2YV9 A;  4D73 A;  4BA7 A;  4Z2R A;  3ERF A;  2R4V A;  2OE1 A;  2Z9S A;  16GS A;  3EU3 A;  2PVO C;  1SD9 A;  4TW5 A;  1XW6 A;  2VD0 A;  5CRG A;  1ZL9 A;  3FZA A;  3IOS A;  3VLN A;  3D22 A;  4DSQ A;  3UJ1 A;  3WYW A;  4A5P A;  4BWQ A;  4OO5 A;  1GUM A;  1R4W A;  2PBJ A;  1YEX A; 
#chains in the Genus database with same CATH homology
 3CBU A;  1ZYN A;  5JWR B;  1TDI A;  4XRD A;  3ISO A;  1A24 A;  2F8A A;  3D6I A;  3TDG A;  2LRN A;  1AXD A;  2VCV A;  2VAF A;  2NBS A;  2DJ1 A;  1QFN A;  1G7E A;  4USS A;  5DVB A;  2IWT A;  4ZB8 A;  2LTK A;  2B3S A;  3EMX A;  4ZB6 A;  1SL1 B;  4HJM A;  1A0F A;  2HYX A;  1OE7 A;  1XVQ A;  1XBS A;  4V2M A;  5C00 A;  4JU5 A;  1QXH A;  2QKE A;  3IA1 A;  3IC8 A;  3MNG A;  4ZIJ A;  2O85 A;  4MZW A;  2MZC A;  4J56 E;  4MJA A;  2XBQ A;  1GSY A;  3W8S A;  2R37 A;  1ZYQ B;  2HRF A;  2MBT A;  2HSH A;  5ECL B;  4K5S A;  1K0M A;  2AJQ B;  1TK0 B;  3ZVJ A;  4GRF A;  4PNG A;  5HR0 A;  1XWC A;  2H1B A;  3KXO A;  3FR6 A;  1F6M C;  1A8L A;  3KGK A;  2LS5 A;  3C7M A;  5GST A;  4IJI A;  5IO2 A;  1ZZY A;  1VF2 A;  2CVD A;  1LBK A;  1U87 A;  1E6B A;  3Q18 A;  2H0I A;  1X5C A;  3EMP A;  5CRD A;  2YNX A;  3GL5 A;  3GH6 A;  3HD5 A;  2VCZ A;  2DKH A;  1G6Y A;  2WJU A;  1WRY A;  6GST A;  1AC1 A;  4AGS A;  4AF2 A;  2JSZ A;  2G2Q A;  5G1K A;  5CRE A;  3PPU A;  4POL A;  4V1A g;  2MYG A;  1B9X C;  2QGV A;  3A2X A;  1BYE A;  1SEN A;  3FZ4 A;  4KH7 A;  5CRH A;  2L4C A;  3CXG A;  2GTU A;  3CSJ A;  2G0F A;  4KAE A;  2LQQ A;  1PQN A;  5COH A;  3VK9 A;  7GSS A;  1GSF A;  1TI3 A;  4WXT A;  1JLV A;  3GUR A;  4V2L A;  1OYJ A;  2E7P A;  2IJY A;  2KP1 A;  5HR2 A;  3EVI A;  4Z2T A;  2CVK A;  4QL7 A;  2P5Q A;  3ZZX A;  3LW9 A;  1XPV A;  3IRA A;  3VI7 A;  4N0V A;  1UN2 A;  3NIV A;  5G1L A;  2HRA A;  1QK8 A;  3TKS E;  5ECS A;  5ECQ B;  1YJ6 A;  3BCI A;  1EEJ A;  4MP4 A;  4Q5Q A;  2CT6 A;  2VOC A;  13GS A;  5JCU A;  4ZL8 A;  3WGX A;  3E9J B;  4XHM A;  2DJ2 A;  3DKS A;  3QAG A;  2PGT A;  4MJB A;  1FB6 A;  1J0F A;  2L5L A;  3I9V 2;  2ON7 A;  4IQA A;  1I9D A;  4EO3 A;  1VF3 A;  1F37 A;  1TRS A;  1XWK A;  11GS A;  4K7N A;  5CO3 A;  2AUV A;  1JFU A;  3HVX A;  2DJ0 A;  1X0R A;  1R7H A;  1O8X A;  3HZ4 A;  3LXT A;  4KB3 A;  1SU9 A;  5IM9 A;  3L0H A;  1JZO A;  5H5Q A;  1ABA A;  1PA3 A;  1B9Y C;  1S3A A;  1XW5 A;  2OA7 A;  1Z3E A;  3EUR A;  1M0U A;  1TU8 A;  4DEJ A;  1UVZ A;  2N5B A;  3HVS A;  3O76 A;  3HCZ A;  3MDK A;  2IMK A;  4HZ2 A;  2AYT A;  1Y6E A;  4KSM A;  4EE0 A;  3FZ5 A;  4IP1 A;  2J9H A;  2CZ3 A;  5F06 A;  4MLY A;  5KN3 A;  3BOA A;  2CQ9 A;  2JZR A;  1PSQ A;  1RW1 A;  5EL8 A;  4XCS A;  1XOA A;  2NVL A;  5IMC A;  4NWY A;  5KOW A;  2F3M A;  1X5E A;  1MDK A;  3G7J A;  1A0R P;  4ML1 A;  1T4Z A;  2H75 A;  1R5A A;  4IGJ A;  1VGL A;  2E2M A;  3KTL A;  1YZX A;  4O5R A;  1X9M B;  4PXO A;  3KH7 A;  3E0U A;  2GS3 A;  1TRU A;  2R6K A;  3C71 A;  2H8L A;  4JBB A;  1JZR A;  2EIR A;  3O3T A;  5B7C A;  3U5R E;  5IMF A;  1EOG A;  2RUF A;  5J9C A;  2GVP A;  2ALB A;  2BJX A;  3FYG A;  4ZL9 A;  4QL9 A;  5CP1 A;  5H5R A;  4AJ8 A;  1FVK A;  3LYK A;  2FWG A;  4HZ4 A;  2GSQ A;  2V6O A;  5GZZ B;  6GSX A;  5B8B A;  4V2N A;  5DQY A;  3P7X A;  1BQ7 A;  2DJK A;  4ZBD A;  3KP9 A;  2QSI A;  4EF0 A;  4OFN A;  1PRX A;  9GSS A;  3MWH A;  1T00 A;  1O73 A;  1HD2 A;  1Z9H A;  2N5A A;  1T4Y A;  3LYP A;  2E2G A;  3H8Q A;  3D5J A;  2LRT A;  4G10 A;  3F63 A;  1TRW A;  2C0F A;  4L0U A;  3EYT A;  4MNN A;  4N30 A;  3JCM L;  5J4U A;  4V1A p;  1GWC A;  3DYR A;  4EC0 A;  4GSN A;  4X43 A;  5DCH A;  2H70 A;  3G7Y A;  2VCQ A;  1Y25 A;  4YKF A;  2GLR A;  2X8C A;  2C0G A;  5B8A A;  3V1W A;  3APS A;  1DE1 A;  2FCH A;  3CYN A;  2ON5 A;  4F0B A;  4IHU A;  4NXI A;  1M2D A;  3HDC A;  1Z6M A;  2PU9 C;  4ECB A;  4NV2 A;  5D96 A;  3M9J A;  3Q6O A;  1BG5 A;  4K0N A;  1TTZ A;  8GSS A;  4KDX A;  2LJK A;  2FWF A;  2HXK A;  3ZIJ A;  1GLQ A;  2CVB A;  2WCI A;  5D9W A;  2N5F A;  3CRT A;  4P3Y B;  5IMV A;  1F3B A;  3VWU A;  5D8I A;  2WFC A;  2HZE B;  1ZYP A;  3IV4 A;  4WEY A;  5HQP A;  1X9W B;  3FR3 A;  5E4W A;  2GSS A;  1GNW A;  4OFT A;  2H1A A;  1GTU A;  1TJD A;  1EP7 A;  1AAZ A;  1GSS A;  5DAL B;  4HQS A;  2WRT A;  3P8W A;  3C8E A;  2HZE A;  4MF6 A;  2XC2 A;  1FOV A;  2WDU A;  3TKS A;  3ZYW A;  3H93 A;  5G5E A;  1V2A A;  4KSO A;  3N9J A;  2GZZ A;  2IFQ B;  1VF4 A;  5DAL A;  2B1L A;  1K0N A;  2DIZ A;  4HU7 A;  1WP0 A;  4BPY A;  2H76 A;  4JR4 A;  2H30 A;  4GST A;  1NHO A;  4E8E A;  4NHZ A;  2YP6 A;  2ZCT A;  5ABR A;  5J5N A;  5AIS A;  2XPD A;  2IFQ A;  1EGR A;  4O92 A;  2A4H A;  1QQ2 A;  2DC5 A;  3VWW A;  4I2T A;  5FWG A;  1PL2 A;  3HJM A;  1OKT A;  5HFI A;  5FT3 A;  1R26 A;  1MD4 A;  4NV5 A;  4DSS B;  1ILO A;  5ELG A;  2VLU A;  2X49 A;  1GSE A;  3UEM A;  2FA8 A;  1V98 A;  2CAQ A;  2CX4 A;  4YQU A;  5DBQ A;  5F8B A;  2IL3 A;  2WB9 A;  5CYY A;  4ML6 A;  1NM3 A;  4DSS A;  3GKK A;  3UL3 A;  3W8J A;  4ECI A;  4O5U A;  5LNK e;  3IC4 A;  1WOU A;  2FUG 2;  5HR3 A;  4ZIL A;  4K7I A;  1EP8 A;  3F8U A;  3EU4 A;  5IIZ A;  3TKQ A;  2VL2 C;  4YQV A;  3M8N A;  4DSR A;  2JSY A;  2HNL A;  1FW1 A;  3RPN A;  1ON4 A;  1ERV A;  2FHE A;  4J2F A;  3CSI A;  4BWS A;  2KOK A;  1ERT A;  4G0K A;  4K8M A;  2JU5 A;  1PX7 A;  1TK8 B;  4CHS A;  4TVE A;  2IN3 A;  2F51 A;  1WWJ A;  2K9F A;  1U3A A;  2LRC A;  4GTU A;  5J3R A;  5IMZ A;  3GN3 A;  3BD2 A;  4N0Z A;  2VO4 A;  4OD7 A;  2PPT A;  1GTB A;  2JAD A;  3CRU A;  1WIK A;  2B7J A;  1KTE A;  4ZL7 A;  2GZP A;  1BX9 A;  1O8W A;  3VI5 A;  2YWI A;  4KW6 A;  4IQ1 A;  2JL4 A;  4MAB A;  4EDZ A;  1ST9 A;  5E59 A;  1V40 A;  2IMF A;  4GF0 A;  5KN2 A;  1YEP A;  1SK1 A;  2CA8 A;  3ZFB A;  1HQO A;  2B1K A;  6GSV A;  4OWY A;  2DML A;  5ECO B;  5A4U A;  4GXZ A;  1BAY A;  2I1U A;  3GNJ A;  5ID2 B;  4X1U A;  5F0G A;  3I6A A;  2I81 A;  1M7T A;  4TXV A;  1A2J A;  4JRR A;  4L5L A;  4AJ6 A;  1WJK A;  3GHA A;  2ZNM A;  3VWV A;  3DWV A;  2VCT A;  4L8E A;  1WPI A;  3N5O A;  4ID0 A;  3DD3 A;  2GGT A;  1K3Y A;  2LUS A;  5G5F A;  4JZQ A;  5ID2 A;  4LMW A;  1V58 A;  1DUG A;  3KM6 A;  1B4Q A;  2R0P A;  1X5D A;  1SYX A;  4KND A;  1KBN A;  2LST A;  3ERW A;  3ZLP A;  3IPZ A;  1YF1 A;  2V6K A;  3GKX A;  4EUY A;  2FA4 A;  3VFI A;  1PKW A;  1RQM A;  4K2D A;  4HEA 2;  2L6C A;  1A2M A;  5C04 A;  4OO4 A;  1AQW A;  1UC7 A;  2H72 A;  2VM2 A;  1I5G A;  2L57 A;  3VPQ A;  12GS A;  2OKA A;  3L78 A;  5EPF A;  1F2E A;  3QR6 A;  3S9F A;  2P5R A;  1LJR A;  2REM A;  5DDL A;  1TRV A;  1FVJ A;  1XW9 A;  1FB0 A;  5DAK B;  1XFL A;  4G9H A;  5HR1 A;  3ZVJ D;  1TK5 B;  3RAZ A;  2CX3 A;  6GSW A;  1SD8 A;  2K8S A;  1S3D A;  3ZIV A;  1YKA A;  3GL3 A;  1WMJ A;  4RI7 A;  2HFD A;  1AQV A;  4PNF A;  5G30 A;  3GYK A;  2HT9 A;  4HDE A;  4Q5F A;  5DAK A;  2K8V A;  2YN1 A;  1Z5Y E;  2L6D A;  4IW9 A;  3TJB A;  2H1D A;  4WBJ A;  3UVT A;  2DJ3 A;  3HZ8 A;  2A2P A;  4LLR A;  3QOU A;  5F07 A;  4XS4 B;  3A5W A;  3FZ9 A;  3LWA A;  4HU9 A;  1XZO A;  2HRN A;  4HUA A;  3VPT A;  1K0C A;  1GUK A;  3F6D A;  3A2V A;  1Z7P A;  3HKR A;  4KUN A;  3TRX A;  4HI7 A;  4F9Z A;  1KNG A;  2B5E A;  4XS4 A;  3GA4 A;  2HI7 A;  3EE2 A;  1YDK A;  17GS A;  2FWE A;  1GSQ A;  4L0W A;  3IDV A;  2NPB A;  2D2Z A;  2VLT A;  4PX1 A;  3APO A;  5IPH A;  1SKS B;  1X9S B;  4GCI A;  4ZBB A;  5ECM B;  4TRX A;  4MZC A;  4PUR A;  3BCK A;  1MEK A;  3WT2 A;  1BJX A;  1BED A;  5JCW A;  4I8B A;  3DEX A;  1PGT A;  2GQM A;  2P31 A;  3HXS A;  3U6V A;  3EIN A;  3PR8 A;  4ICY A;  1PL1 A;  5DQS A;  1XCC A;  2LJA A;  1V9W A;  3QAV A;  1H4O A;  1OKD A;  1YQ1 A;  1OAZ A;  1EV9 A;  4CDO A;  2C80 A;  3PGT A;  4X0X A;  5CRW A;  2H73 A;  1THX A;  1K3O A;  1PD2 1;  2LV3 A;  3C1R A;  3LJR A;  2OAC A;  4GQC A;  2VD1 A;  3DIE A;  1U3I A;  2M80 A;  2R2J A;  5LCZ A;  3VWX A;  4OFM A;  4KDU A;  4KF9 A;  5KN1 A;  2DSA A;  4RI6 A;  3SBC A;  5HFK A;  2IMD A;  3BJ5 A;  4GWR A;  2JZS A;  4XS6 A;  3TRP A;  3ED3 A;  4MCU A;  1Q4J A;  1TKD B;  2RLI A;  1M2B A;  5A4V A;  19GS A;  5D93 A;  4PTS A;  5GSS A;  4IVF A;  4BVY B;  4ECJ A;  2P0G A;  2FNO A;  2C1Y A;  3IAM 2;  5IQY A;  3CMI A;  1ACV A;  2C4J A;  2V2G A;  3TUE A;  1GNE A;  2VCW A;  4BVY A;  2V32 A;  3M3M A;  2LQO A;  3F3Q A;  4WF5 A;  2K6V A;  2H74 A;  1DBY A;  2CV4 A;  4LL4 B;  4MF7 A;  4G19 A;  2OBK A;  5ECH B;  1GSD A;  3MIX A;  4Q5N A;  2YPM A;  2HE3 A;  4IEL A;  2C3N A;  3UMA A;  1AUC A;  2IMI A;  5ECI B;  3TJK A;  3OR5 A;  3QD9 A;  1S3C A;  3APQ A;  1JLW A;  1XWA A;  3TGZ A;  1XIY A;  2JAC A;  2PMT A;  3QPM A;  1U88 A;  1JZW A;  5A5K A;  1O85 A;  2PUK C;  4MDC A;  3IBH A;  3UBL A;  4FYU A;  3GIX A;  5J9B A;  2MBS A;  4CW9 A;  5EY6 A;  5A4W A;  1ZOF A;  1O6J A;  5ELA A;  3M1G A;  3CSH A;  5IO0 A;  4MJC A;  4YQM A;  4EIP A;  2HRK A;  2B6M A;  4O32 A;  5CNW A;  1A23 A;  2VM1 A;  2LEG A;  2ZUP A;  3I43 A;  4MF5 A;  2GDR A;  4HQZ A;  2YWN A;  4EXJ A;  5GAP D;  4E8H A;  3UOM A;  1DE2 A;  2LJR A;  2C0D A;  5HFG A;  2MMO A;  3QFB C;  4BVX B;  1A8Y A;  1ZMA A;  1T1V A;  3TOU A;  3HJP A;  1OC9 B;  3WGD A;  14GS A;  4IS0 A;  4ULX A;  2FD3 A;  1GH2 A;  4KX4 A;  4BVX A;  5CAX A;  2DBC A;  2H71 A;  2GT5 A;  2YWM A;  3G7I A;  3FEU A;  1OC9 A;  2J23 A;  4J57 E;  1JZD A;  3GH9 A;  5D73 A;  3TJG A;  20GS A;  3C1S A;  4IN0 A;  1W4V A;  1B48 A;  1M9A A;  4WF4 A;  3GUS A;  4GQF A;  1SJZ A;  2HSM A;  3F3R A;  3PIN A;  3F0I A;  5D9X A;  1SL2 B;  1HYU A;  2AAW A;  3KIJ A;  1SJI A;  1EEM A;  3IHG A;  2RUE A;  3TOT A;  2A2R A;  3Q19 A;  3H4K A;  3IR4 A;  4EL1 A;  2YOI A;  4WET A;  2BMX A;  5KN0 A;  2H6X A;  2O89 A;  4POB A;  3ZL5 A;  3A2W A;  4F82 A;  4HS1 A;  2OE0 A;  5IOX A;  3F4S A;  4TR1 B;  4XS1 A;  3IHQ A;  2H19 A;  2FGX A;  2FWH A;  2RM6 A;  5ECK B;  4RQX A;  1GUH A;  3FRC A;  4MH2 A;  3C73 A;  3DVW A;  3RPP A;  2R5G A;  3GX0 A;  2KUC A;  4TR1 A;  4I6X A;  4I5Q A;  3H79 A;  2QC7 A;  5IMA A;  2M72 A;  4PQ1 A;  5BMU A;  3IE3 A;  2R0C A;  1WE0 A;  1AQX A;  3VUR A;  3IK7 A;  4BL7 B;  4MMM A;  6GSU A;  2HZF A;  3F4T A;  2MMA A;  3ME8 A;  2AB6 A;  3MYD A;  1GL8 A;  3BBY A;  3TKP A;  5ENU A;  4TN8 A;  2TRC P;  4IJ3 A;  3KEB A;  1RK4 A;  4QQ7 A;  3GKM A;  4BL7 A;  1CQG A;  22GS A;  5IPG A;  3FKF A;  3ERG A;  3LGC A;  4O5Q A;  4RUV A;  5FHI A;  5IOW A;  5D9T A;  3ZRE A;  1VF1 A;  3GSS A;  1TU7 A;  3FR9 A;  2PWJ A;  3FY7 A;  2WGR A;  1YY7 A;  3E3E A;  4OCE A;  3J7Y k;  1LU4 A;  2GZY A;  3KMN A;  3L9S A;  1FAA A;  1JHB A;  3P2A A;  5JWO B;  4K7O A;  2O8V B;  2OBI A;  2R3X A;  2I3Y A;  1Z7R A;  2H6Z A;  1F3A A;  3GKN A;  4WKW A;  3F4R A;  1IYI A;  2JZT A;  4PUF C;  5DJM A;  1N2A A;  2YZH A;  2OE3 A;  1ERW A;  4YAV A;  3DRN A;  4F03 A;  4HOJ A;  4POM A;  3CTG A;  3H1N A;  2LNT A;  1T7P B;  4XTS A;  3P90 A;  1C72 A;  3HHV A;  2X8H A;  4YH2 A;  3LEF A;  1EWX A;  4WBR D;  2YCD A;  3KZQ A;  3PH9 A;  4NHW A;  1XVW A;  3D4M A;  4FYB A;  10GS A;  4G0L A;  2YAN A;  1XOB A;  3O6T A;  1TXX A;  4MPG A;  2V41 A;  2VL9 A;  2DJJ A;  3EC3 A;  4G2E A;  2YZU A;  1F9M A;  1GP1 A;  3GX8 A;  2GQL A;  4K9Z A;  2A4V A;  4TR0 A;  4ACS A;  4JED A;  4MPF A;  3R2Q A;  1UA5 A;  2AHE A;  3FW2 A;  3RDW A;  2X99 A;  3IK9 A;  3GMF A;  2XHF A;  2I4A A;  1SK2 A;  3RHC A;  3TCO A;  1PN9 A;  2L5O A;  2HLS A;  4YKG A;  1O7U A;  5INY A;  3HA9 A;  1DSB A;  4TXO B;  1GUL A;  3UIW A;  3UVH A;  4N11 A;  1VRS D;  3A3T A;  2GST A;  2UZ8 A;  2PN8 A;  4KDY A;  1FG4 A;  2C8U A;  5KEJ A;  4TXO A;  2BTO T;  3HVV A;  5AIV A;  4IP6 A;  3EWL A;  3HYP A;  5AGY A;  4EKZ A;  1AIU A;  1MTC A;  2B5Y A;  5G31 A;  2LNS A;  3KMO A;  5GAN D;  4ZXG A;  5AN1 A;  2YJH A;  3TJJ A;  1EZK A;  1H75 A;  1QMV A;  3TKR A;  1ZGN A;  2QA1 A;  2WUL A;  3LXZ A;  2B5X A;  2VUP A;  1EGO A;  3HJO A;  3ZTL A;  1GRX A;  4Q5R A;  1SL0 B;  1T8E B;  3ME7 A;  2R0G A;  3I69 A;  2NDO A;  4TOP A;  5LD0 A;  1GLP A;  1EOH A;  3A5I A;  3Q74 A;  1OC3 A;  3IAS 2;  3WD6 A;  4LMV A;  2F9S A;  2VL2 A;  18GS A;  3ZIT A;  3TJF A;  2OJL A;  2GSR A;  1K0A A;  3UBK A;  3GRX A;  1B8X A;  2O7K A;  3AY8 A;  2IME A;  3ZRD A;  4H86 A;  4G0I A;  3KJY A;  3NOF A;  5ECR B;  1NSW A;  3LFL A;  2DLX A;  3QMX A;  2PER A;  3QDN A;  1OC8 A;  5L71 A;  4JE1 A;  2L4Q A;  2AV4 A;  3TKS C;  4WR5 A;  2TIR A;  3FMW A;  5G2Z A;  3TB2 A;  3K8N A;  5KOX A;  3UAP A;  3QCP A;  3NZN A;  2MMZ A;  1G7O A;  2NTO A;  2XBI A;  5EVO A;  2DIY A;  2VCX A;  2MMN A;  3HY2 A;  2A2S A;  1CQH A;  4TR4 A;  3F6F A;  4ZBA A;  1A2L A;  1QUW A;  5AIX A;  2EIQ A;  1GTA A;  4LA1 A;  5F05 A;  4TKY A;  4JR6 A;  1YF0 A;  1M9B A;  3KD0 A;  2YV7 A;  5JWQ B;  3DML A;  4K2X A;  5BRT A;  4FH8 A;  4ECC A;  2IPA A;  4KCA A;  4GLT A;  1MDJ A;  4K6X A;  4IKH A;  1TI1 A;  4POK A;  5DJL A;  1ZCP A;  1QGV A;  3UAR A;  1GSU A;  1O81 A;  2QA2 A;  2H1G A;  4LL1 B;  2X4A A;  2K18 A;  2H66 A;  1PX6 A;  1USB A;  1URM A;  2RM5 A;  4Z2U A;  4XRA A;  1THO A;  2KLX A;  4F0C A;  3ZML A;  1N8J A;  2H01 A;  2YWO A;  4PGT A;  2V1M A;  3L9U A;  4IBP A;  2IIY A;  1TOF A;  3KP8 A;  3KTB A;  3EPT A;  1PN0 A;  4I97 A;  3L9V A;  4CY6 A;  3QAW A;  4F2I A;  2H6Y A;  4KCE A;  1R5P A;  1XXU A;  5D9V A;  2PVQ A;  1W89 A;  4NAX A;  1NHY A;  1SJ6 A;  3D0Z A;  3LOR A;  1ML6 A;  2EC4 A;  3R3E A;  1HNC A;  4Z7X A;  1E2Y A;  4DVC A;  4YAP A;  1XWG A;  4AJ7 A;  1FO5 A;  4MZB A;  1V57 A;  2RII A;  3G9B A;  1MDI A;  6GSS A;  6GSY A;  3W6G A;  2GQK A;  2VL3 A;  3TRQ A;  2H0G A;  1OVN A;  1G0T A;  3D4T A;  1TP9 A;  5JCG A;  4TR3 A;  4OCF A;  1FOH A;  3D21 A;  4KGI A;  2X64 A;  4N10 A;  1IYH A;  3MSZ A;  1HNB A;  2HSY A;  2C3Q A;  3LG6 A;  3GV1 A;  2KHP A;  2CZ2 A;  2FLS A;  5ECP B;  4K5R A;  4CY8 A;  1B4P A;  2ES7 A;  3US3 A;  1GTI A;  1XWB A;  1OE8 A;  2DKI A;  4WR4 A;  5B6N A;  3CTF A;  3QFA C;  1J9B A;  5J41 A;  1HNA A;  1Q98 A;  3RHB A;  4X4J A;  1AW9 A;  4FQU A;  2LKU A;  2VLV A;  3F9U A;  4OMV A;  1J08 A;  4EVM A;  1MD3 A;  1M2A A;  5H5S A;  2WS2 A;  1G6W A;  2L59 A;  2C0E A;  4FYC A;  4MH3 A;  2I9H A;  3FK8 A;  3L4N A;  1EV4 A;  3M9K A;  3GFK A;  3IXR A;  2B7K A;  1YKC A;  4PQH A;  4EDY A;  1U6T A;  1SKW B;  1K0D A;  2EIO A;  2DMM A;  4ISD A;  2OAD A;  4GSS A;  1PMT A;  3LQ7 A;  4K1F A;  3ZFL A;  1K0O A;  3M0F A;  1SK0 A;  4XIH A;  1T3B A;  1FHE A;  1TW9 A;  1PKZ A;  1K0B A;  4HJ2 A;  1Z6N A;  4L5O A;  4KE3 A;  2VIM A;  3MAK A;  4FIW A;  2YJ7 A;  1M99 A;  2E0Q A;  4PUA A;  1NW2 A;  3LSZ A;  3SWL A;  3J7Y b;  3WGE A;  2KP2 A;  2CAI A;  4RQR A;  5IMD A;  5B6M A;  5ECN B;  3DVX A;  4NPB A;  3KCM A;  4ZB9 A;  2WZ9 A;  4EIQ A;  2FY6 A;  2H0H A;  4MJE A;  1KEB A;  1SKR B;  3DXB A;  2O87 A;  2X8G A;  3GST A;  3ZMK A;  4KA0 A;  2XPE A;  4O7H A;  3WT1 A;  4MK3 A;  3GTU B;  3FHK A;  5DCG A;  4I2U A;  4D73 B;  2TRX A;  4K0G A;  4MA9 A;  1ZYE A;  3RBT A;  2M46 A;  4ILF A;  3DGQ A;  2C3T A;  4NMU A;  1K3L A;  1SYR A;  4PQI A;  3KH9 A;  1ERU A;  4FO5 A;  2F8F A;  3GTU A;  2GT6 A;  2YV9 A;  4D73 A;  4BA7 A;  4Z2R A;  3ERF A;  2R4V A;  2OE1 A;  2Z9S A;  16GS A;  3EU3 A;  2PVO C;  1SD9 A;  4TW5 A;  1XW6 A;  2VD0 A;  5CRG A;  1ZL9 A;  3FZA A;  3IOS A;  3VLN A;  3D22 A;  4DSQ A;  3UJ1 A;  3WYW A;  4A5P A;  4BWQ A;  4OO5 A;  1GUM A;  1R4W A;  2PBJ A;  1YEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...