2B7JA

Crystal structure of yeast sco1 with copper bound
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
172
structure length
158
Chain Sequence
GKPSLGGPFHLEDMYGNEFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNTLSSKYGITLQPLFITCDPARDSPAVLKEYLSDFHPSILGLTGTFDEVKNACKKYRVYVDHSIFFYLMDPEGQFVDALGRNYDEKTGVDKIVEHVKSYVPAEQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCO1 protein
publication title Crystal structure of yeast Sco1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal binding protein
total genus 46
structure length 158
sequence length 172
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2b7jA00
5INYA 3EINA 1ZMAA 4BVYA 1PSQA 1S3AA 4DSQA 1G7OA 1SK1A 2JL4A 2JZRA 4XRAA 5DVBA 1K0MA 3TJBA 3FK8A 2V32A 2QSIA 3GH6A 3DMLA 3TKSC 4KCEA 2CVDA 2A2SA 2C0GA 2AAWA 2CQ9A 1TI3A 16GSA 2V6OA 1AC1A 1PKWA 4X0XA 4EVMA 1V2AA 2CAQA 4OO4A 1BJXA 1T8EB 2CAIA 2YANA 5CNWA 2OADA 1T00A 3P7XA 4FO5A 1O8WA 1MDJA 3LORA 3P2AA 2R2JA 2H71A 1E2YA 3KIJA 2OA7A 2GDRA 5ECKB 4F9ZA 2VLTA 3GYKA 3UBKA 3WGEA 3VK9A 2M72A 3MNGA 2MMNA 3M9JA 3R2QA 3WD6A 2HFDA 4TRXA 1EGRA 4WF4A 2X64A 2O87A 1WOUA 2QKEA 1CQGA 2C3QA 1SD8A 1NHYA 3CRTA 2CX4A 2O85A 3CMIA 4JR4A 4JR6A 1OYJA 2FNOA 5G1LA 3VFIA 3KH7A 1VRSD 2VL9A 3QPMA 3VWUA 1AQWA 3VI7A 1K3OA 4GLTA 3U5RE 1VF1A 2VCXA 1EP7A 3N9JA 4JU5A 5IMZA 5AIVA 3FZ9A 4IQ1A 2AJQB 2OBKA 1FAAA 5DQYA 1GUKA 3RHBA 2LQOA 1A24A 2WGRA 2LV3A 3DEXA 1AIUA 5D9VA 3KTBA 4LLRA 4HUAA 3FEUA 4J57E 3IAM2 4OD7A 2DBCA 5COHA 4PNFA 2F3MA 3OR5A 3D0ZA 2DMLA 3GTUB 1YZXA 2D2ZA 2HNLA 3VWWA 2A2RA 4MZWA 3I69A 5DJMA 2VD0A 3F4SA 5A4VA 5ECIB 1Y6EA 4KCAA 2WRTA 1J9BA 1DUGA 1F2EA 4MJAA 1EWXA 2VAFA 4MCUA 2H74A 3KXOA 3GN3A 2HI7A 1BX9A 5DBQA 1EEJA 4ID0A 3W8SA 2H72A 4TR0A 3ZFLA 3HA9A 3MWHA 5HFKA 3IR4A 1XWCA 3IHQA 1PD21 2GQMA 1J0FA 2H0IA 4DEJA 4Q5FA 3EE2A 3K8NA 5DAKB 4MPGA 3MAKA 5GSSA 1GSYA 4NHWA 4N30A 3IK9A 1R26A 3WT1A 1DSBA 3ZVJA 2DMMA 3LGCA 3EU3A 2DJ3A 1JZWA 3GURA 3C7MA 1M2BA 2A4VA 1A2LA 1KEBA 2ES7A 2CVKA 2IMFA 4EL1A 5D9TA 2PGTA 1F6MC 2VL3A 3DWVA 3EMPA 3HXSA 3HCZA 1ILOA 1AW9A 2XPDA 2OE1A 3TKPA 5CRGA 2PERA 5C04A 1G6YA 2IJYA 3O3TA 3P90A 3PR8A 5J9CA 5ECOB 2RM5A 3FRCA 2JSZA 4XS4A 5A5KA 3EVIA 3GHAA 4HI7A 1YDKA 4PUFC 1GSQA 5G1KA 2GS3A 1GTAA 2I4AA 11GSA 2AYTA 4XS1A 2WFCA 2LEGA 2XBIA 3GKXA 4L8EA 1B8XA 1KBNA 2LKUA 2YV7A 3TRPA 3F8UA 3F3RA 2GTUA 1B48A 3E3EA 3G7IA 3HVSA 4TOPA 5FWGA 1PX7A 4X1UA 4MJBA 1GTUA 3DVWA 3RAZA 3RPPA 4AJ6A 4TR3A 3F9UA 5J4UA 4EF0A 4IJ3A 1B4PA 5ECQB 3L9UA 1SKRB 1TRVA 4PX1A 4YAVA 4GSTA 1EZKA 1IYIA 1F3BA 3TJFA 1XFLA 2G2QA 1A2JA 5ECRB 4JEDA 4TXVA 2JSYA 2DJ0A 4MF7A 1M9BA 3A2XA 2N5BA 1Z9HA 2VD1A 3JCML 2ON7A 3KEBA 2R3XA 1GSDA 5IO2A 2VM2A 2YCDA 3ZLPA 2K18A 2MBSA 1ZGNA 4ZIJA 3QAWA 3F0IA 3A2WA 1GSEA 1GWCA 2X8HA 2R37A 4HOJA 2HXKA 4V1Ag 3L4NA 2B1KA 2R6KA 4K9ZA 2VCQA 4WXTA 4CW9A 1SL0B 2FD3A 2HRNA 4HZ4A 5B8BA 3QMXA 2KHPA 2ON5A 1OAZA 2H1AA 3M3MA 1B9XC 4LL1B 2HZEB 3W6GA 5DCHA 1WE0A 4K2DA 2YZHA 2LJKA 3Q19A 1XW5A 1HQOA 4MJCA 1O85A 1YY7A 1WP0A 3TCOA 3GKKA 3VPQA 2YWMA 3GX8A 2H1BA 4L0UA 2VM1A 1WIKA 3FW2A 2EC4A 5HFIA 1XW6A 5KN3A 3BD2A 2I3YA 5KN1A 2OE3A 3TUEA 1LJRA 3I9V2 2YN1A 1TW9A 2PMTA 3A3TA 1TTZA 4ILFA 5C00A 4F0CA 3IA1A 1AAZA 3GKNA 2XPEA 2N5AA 4KNDA 1XIYA 1ZL9A 4MABA 1Y25A 1YKCA 3UIWA 3F6FA 1EV4A 2F9SA 3RPNA 1QMVA 1DE1A 4RI6A 1ACVA 2M46A 3TJGA 4NWYA 4ECCA 3LYPA 4OFNA 1OC8A 2XHFA 3ZVJD 1I9DA 1SL2B 3QFAC 1JHBA 5A4UA 2EIRA 4WBJA 2FWFA 1AQVA 4I5QA 3EMXA 4RUVA 4F03A 4IQAA 3TOTA 5EVOA 1U87A 5D73A 5DALA 1HYUA 2V2GA 5LD0A 2B3SA 4EO3A 4TN8A 1YQ1A 2CZ3A 1OE8A 2L5LA 2B1LA 1ML6A 4FYCA 5JCWA 3LEFA 1GLQA 1TK8B 1Z7RA 1AXDA 3FR6A 3ZL5A 4F82A 3L78A 2GZYA 1GNEA 4HEA2 4ML1A 2K6VA 1B9YC 4KH7A 3LQ7A 1FO5A 6GSWA 2H70A 5GAND 5CP1A 1TI1A 2OE0A 3HVXA 1TU8A 4PQHA 3KH9A 5HR3A 3KZQA 1M2AA 1G7EA 1UN2A 4NPBA 4N10A 4YAPA 1AUCA 4BPYA 2DIYA 4YQVA 2NDOA 1FB6A 4HZ2A 3ZMKA 2MYGA 2YPMA 1A2MA 2BMXA 2HE3A 3LJRA 3UL3A 4MK3A 4HS1A 4N0VA 1NSWA 5CAXA 1TKDB 5IMCA 3L9VA 1R5PA 1THXA 1FOVA 1GTIA 4V2LA 1OC9B 3UAPA 1JZDA 4N0ZA 4JBBA 1ON4A 3GSSA 3GX0A 4NV2A 3UVTA 2LS5A 1EEMA 4V1Ap 3GKMA 1H4OA 1TJDA 4NHZA 2K8VA 2CA8A 4HJMA 2JZSA 1H75A 3ERGA 2LNTA 1XVQA 2L59A 3KTLA 1RK4A 1DE2A 1X5DA 1GSSA 3IBHA 1XVWA 4MF5A 3VURA 3GL5A 5CRWA 1V57A 4EE0A 3FY7A 4PUAA 3NZNA 2HZFA 2VCTA 3ERFA 2PWJA 2P31A 2YJHA 4NXIA 1PL1A 1BAYA 3IDVA 2CV4A 1W4VA 2JU5A 4IS0A 1TOFA 2GSSA 3GUSA 3DD3A 3EC3A 3MSZA 1GL8A 1XOBA 13GSA 4NV5A 3SBCA 3O76A 3UMAA 5AGYA 1FB0A 4HDEA 1K0OA 5FT3A 4XS4B 1QGVA 3QOUA 4K0GA 5AN1A 3F3QA 2CT6A 3LG6A 2N5FA 4I2TA 5FHIA 3IV4A 4MJEA 4IVFA 3APQA 4ML6A 5H5SA 4FH8A 4GQFA 2MMOA 5ENUA 2HYXA 1MDIA 1XWBA 2X99A 4LL4B 3F4RA 1WRYA 4KDUA 5CO3A 3ZFBA 3ED3A 4D73A 3HKRA 3UEMA 2K8SA 3QR6A 3TJKA 2GQKA 4ZILA 2H1GA 1TK0B 12GSA 2LRNA 1NHOA 1TRWA 1YKAA 1XOAA 5B6NA 2IFQA 2KP1A 2FA4A 4KB3A 1URMA 1X5CA 3KJYA 3IK7A 1BQ7A 1SD9A 3ZIJA 2JACA 5B6MA 3IC4A 2LJAA 2C0FA 5F05A 4AF2A 2H73A 1PMTA 4Q5NA 1SK0A 5HR0A 1TK5B 2ZUPA 1PKZA 1ERVA 3TKSE 2WDUA 1SYXA 1M7TA 4IP6A 2AUVA 5F8BA 3GSTA 1K0BA 1N8JA 4ECJA 1SKSB 5F0GA 3S9FA 1ST9A 4MF6A 4ULXA 4XIHA 3E9JB 2YWOA 4GQCA 2P5RA 1U3IA 4G2EA 2H6ZA 3NOFA 2C80A 1DBYA 4ZXGA 1YF1A 3LFLA 4KSOA 3W8JA 3CBUA 3F6DA 1LBKA 3KD0A 2AV4A 4XCSA 2O8VB 4TR1B 4WR4A 4KUNA 4H86A 1MTCA 4ECIA 1O6JA 5KEJA 5J5NA 1J08A 1T1VA 3H1NA 4KDYA 2F51A 2HRFA 3AY8A 2VOCA 3QCPA 1KNGA 1MEKA 1O81A 1TRSA 3FYGA 1XWKA 1N2AA 2B5EA 1EGOA 2B6MA 1O8XA 1Z3EA 4EC0A 5AISA 5L71A 2CZ2A 3HDCA 2H0GA 5F07A 2DLXA 1A8YA 3H79A 2H0HA 1PA3A 4PGTA 1JLVA 2O7KA 4KX4A 3L9SA 4GF0A 5KN0A 2GLRA 2WS2A 3HHVA 2IL3A 4HQZA 4TW5A 2IMDA 4KSMA 1EOGA 3FHKA 2LRCA 4MLYA 3HVVA 1ERTA 1EOHA 4IP1A 1V40A 5IPHA 1T7PB 5DJLA 4Q5RA 4XRDA 1YEPA 4WKWA 2TRXA 3PH9A 5D9WA 1NM3A 4CHSA 4AGSA 1U3AA 1ZYEA 1HNBA 2TRCP 5J3RA 1SK2A 3GV1A 2IN3A 3P8WA 2PVOC 1XW9A 4J2FA 4L5OA 1OC3A 1GNWA 5LCZA 5IOXA 1SJ6A 2E7PA 3IPZA 2C3NA 1JLWA 2MBTA 2Z9SA 4NAXA 3ZITA 1V9WA 2B7KA 4POMA 1ZOFA 4MA9A 3RHCA 2C0EA 4O32A 2BTOT 3GTUA 3HJPA 4P3YB 2DJ2A 2LJRA 2PUKC 5HR1A 1G6WA 3N5OA 1M9AA 3C8EA 3IAS2 1I5GA 2HLSA 1X9MB 1RQMA 4WETA 4BWSA 4FYBA 1FVJA 2V41A 5B8AA 2IIYA 3GL3A 3E0UA 4ZL7A 2FGXA 20GSA 4K7IA 3TGZA 1FG4A 2I1UA 5ECNB 2IMEA 2ZNMA 1A23A 2R5GA 3I6AA 1XWAA 3BBYA 5D8IA 2LUSA 4JRRA 3ZMLA 5HFGA 1SKWB 1TRUA 3IXRA 4AJ7A 3F4TA 6GSUA 2QGVA 2VIMA 3M9KA 5AIXA 5IOWA 3D21A 8GSSA 1O7UA 2GSQA 1GSFA 2L5OA 5J41A 3J7Yb 2DJ1A 3CXGA 4O7HA 2YNXA 4ZB9A 2J9HA 1X9WB 4I6XA 4J56E 4POLA 3C71A 5IM9A 2MMAA 1ABAA 1F9MA 4KDXA 5G31A 1MD4A 2DC5A 1M99A 4GTUA 3IOSA 3HD5A 5IO0A 4OFMA 2C4JA 2E2MA 3C1RA 4OFTA 1NW2A 2KP2A 2H1DA 3ME7A 3VWXA 2YOIA 4LMWA 2NVLA 10GSA 4PQ1A 3LSZA 3HY2A 3FKFA 2VLUA 2L4QA 4EDYA 4I97A 2H75A 3A5WA 3G7YA 2C0DA 3J7Yk 4EKZA 5JWQB 3UARA 1EV9A 1VF4A 5E59A 5ECPB 1GSUA 3CSIA 2E2GA 2L4CA 2E0QA 2IPAA 3M0FA 1R7HA 4MH3A 3GIXA 3US3A 2NTOA 1XWGA 2V6KA 5IMAA 2L6CA 4K7OA 1SL1B 1VF2A 5JCGA 2HT9A 4WBRD 2GSTA 5GZZB 2H76A 4TVEA 2F8FA 2HSHA 1GLPA 5G30A 1KTEA 2VL2A 2YJ7A 4POKA 2PVQA 3TRXA 1XBSA 4KAEA 5IPGA 2XBQA 1K0AA 2VLVA 4RQRA 1JZOA 4XHMA 1PQNA 4ZB8A 4WEYA 4D73B 1WJKA 2P5QA 1FHEA 1K0DA 2RUFA 3BCIA 1T4YA 1WWJA 3RDWA 4ZBDA 2H6XA 2IFQB 5ELAA 4L5LA 5JWRB 1ZCPA 2H8LA 1VF3A 1TXXA 4HQSA 3KP8A 3APSA 3DXBA 4IN0A 2YZUA 1ZZYA 4DSSA 1ERWA 6GSTA 2FUG2 2H30A 3A2VA 5CRHA 2HZEA 5J9BA 3PGTA 1X5EA 2RLIA 2I81A 4KW6A 3FZAA 2IMIA 3I43A 18GSA 2CVBA 4MP4A 2WB9A 5ECLB 2JZTA 3ZRDA 1S3DA 3EYTA 3CSHA 5IMVA 3TKQA 4PQIA 1XZOA 4MMMA 4AJ8A 1G0TA 1SYRA 9GSSA 4F2IA 3ZIVA 2V1MA 5HQPA 4YH2A 5B7CA 4MH2A 1USBA 5D9XA 5IIZA 1OKDA 4ZL9A 2MMZA 3KGKA 1UC7A 3KMOA 1YF0A 1Z6NA 3FZ5A 1Z6MA 2C3TA 4LA1A 2CX3A 1X0RA 1LU4A 4TXOA 1EP8A 4BWQA 1FVKA 2B7JA 1YEXA 3O6TA 7GSSA 1ERUA 1GP1A 1OE7A 4ECBA 2WJUA 5H5QA 1GUHA 3HYPA 3UOMA 1BYEA 1PX6A 1GUMA 1ZYQB 1IYHA 2VUPA 4K7NA 2PU9C 4DSRA 5A4WA 5ID2A 2FLSA 2NBSA 4RQXA 3Q74A 3U6VA 3CTGA 1O73A 3TKRA 5IMDA 4QL9A 2GZZA 3UJ1A 3IRAA 4N11A 19GSA 4MZBA 2L57A 3IE3A 1U88A 3HJMA 1OKTA 2PBJA 1PRXA 3M8NA 1R4WA 4WF5A 5GSTA 1JFUA 2NPBA 2OBIA 2REMA 3HZ8A 2KOKA 3EURA 6GSSA 22GSA 4ACSA 4OMVA 1Z5YE 1HNAA 5CREA 4BL7A 3VPTA 3KP9A 1X9SB 2MZCA 2OACA 2H6YA 3SWLA 6GSVA 3QD9A 4OWYA 3ZTLA 3RBTA 2M80A 2DJJA 2PN8A 3M1GA 3TKSA 1K0NA 4MDCA 1UA5A 4IBPA 2LTKA 1RW1A 4Q5QA 5D96A 4K6XA 3PINA 1CQHA 2F8AA 3KM6A 1SU9A 1GRXA 4I8BA 5GAPD 4XTSA 4G10A 4E8EA 2JADA 1B4QA 4HU7A 4KE3A 1A0RP 1OC9A 1K3LA 3FZ4A 3Q6OA 2KUCA 4K1FA 3CYNA 2VCVA 3H93A 2J23A 4YQMA 3DGQA 4ZL8A 5G2ZA 3G9BA 1VGLA 3C73A 2DSAA 3EU4A 2HSYA 1TDIA 4GSNA 5LNKe 3ME8A 1PGTA 2OKAA 2KLXA 1HNCA 4CDOA 2WCIA 3D6IA 4KA0A 2AHEA 2R4VA 3WGXA 2GSRA 2YWNA 4POBA 5DDLA 4PXOA 3GNJA 5ECMB 1XPVA 4GWRA 3FR3A 2DIZA 3NIVA 1OVNA 2K9FA 2WULA 1W89A 4HU9A 5ECHB 3DVXA 3D5JA 2YP6A 3ISOA 4RI7A 5E4WA 2EIQA 1GH2A 2RM6A 4LMVA 4K8MA 1E6BA 4X43A 5EPFA 2RIIA 4ZBBA 2LRTA 3UVHA 3ZYWA 1SENA 2VCWA 1XXUA 4GCIA 3DRNA 2BJXA 4IHUA 5DQSA 4MPFA 3ERWA 3H8QA 5HR2A 2YWIA 5ABRA 1T4ZA 4TR4A 4E8HA 2H66A 4KGIA 1BG5A 4IGJA 3ZZXA 4V2MA 2O89A 1MDKA 1K3YA 2OJLA 3BOAA 1C72A 4BVXA 1JZRA 2GVPA 2LSTA 5DALB 4ZBAA 2P0GA 4O5RA 2GT6A 3V1WA 1TP9A 1V98A 3D4TA 4EXJA 5IMFA 2I9HA 3H4KA 3HJOA 2IMKA 2LNSA 3WT2A 3FR9A 6GSYA 3VWVA 5G5EA 1K0CA 1M2DA 2G0FA 1GULA 2L6DA 5JWOB 3TDGA 2B5YA 1F3AA 4IW9A 2X8GA 5H5RA 2VL2C 2ZCTA 1QK8A 4WR5A 4ISDA 2GQLA 5DAKA 4PURA 1WMJA 4FYUA 1UVZA 5ECSA 3G7JA 4TR1A 3VI5A 1M0UA 4YQUA 3WGDA 4JZQA 1U6TA 3L0HA 3KCMA 4OCFA 4EUYA 4DSSB 4GRFA 4IELA 2YV9A 3CSJA 4QL7A 4F0BA 1QXHA 5G5FA 2FWEA 4HJ2A 1S3CA 2VCZA 4ZB6A 4OCEA 1PL2A 1HD2A 3Q18A 5DCGA 3TOUA 2FHEA 1THOA 5EL8A 1PN9A 4EDZA 4QQ7A 2ALBA 3TB2A 2H01A 3WYWA 2X8CA 1FW1A 2FCHA 3VLNA 4K0NA 1Q98A 2C8UA 5D93A 3MDKA 1V58A 1A0FA 3BCKA 4GXZA 5ELGA 4L0WA 2XC2A 1Q4JA 3GH9A 2GZPA 1A8LA 1MD3A 3QFBC 3GA4A 3BJ5A 2DJKA 2LQQA 3DYRA 4TXOB 3ZREA 1T3BA 1Z7PA 2FWGA 5CRDA 2RUEA 1WPIA 4I2UA 5JCUA 4DVCA 3LYKA 4FIWA 3DIEA 1QFNA 1SJIA 3TJJA 3QAVA 2FWHA 3F63A 3QAGA 1XCCA 2QC7A 3TRQA 4PNGA 4Z7XA 2EIOA 3CTFA 1QQ2A 5ID2B 2FY6A 1SJZA 3GMFA 3GFKA 3HZ4A 4NMUA 14GSA 5CYYA 3EWLA 2VO4A 4GSSA 1AQXA 1YJ6A 2IWTA 2GT5A 2WZ9A 3UBLA 5KN2A 3APOA 4XS6A 4G19A 4IKHA 3GRXA 3LXZA 6GSXA 2PPTA 4BA7A 3D22A 4MZCA 2GGTA 1R5AA 17GSA 2B5XA 4OO5A 3QDNA 3DKSA 2AB6A 1TU7A 2FA8A 4O92A 5EY6A 3LXTA 4IJIA 3LWAA 2TIRA 1QUWA 3D4MA 1BEDA 1GTBA 5F06A 4V2NA 4TKYA 1F37A 2H19A 2C1YA 3C1SA 5IQYA 4JE1A 3KMNA 4G9HA 3CRUA
chains in the Genus database with same CATH superfamily
5INYA 3EINA 1ZMAA 4BVYA 1PSQA 1S3AA 4DSQA 1G7OA 1SK1A 2JL4A 2JZRA 4XRAA 5DVBA 1K0MA 3TJBA 3FK8A 2V32A 2QSIA 3GH6A 3DMLA 3TKSC 4KCEA 2CVDA 2A2SA 2C0GA 2AAWA 2CQ9A 1TI3A 3EPTA 16GSA 2V6OA 1AC1A 1PKWA 4X0XA 4EVMA 1V2AA 2CAQA 4OO4A 1BJXA 1T8EB 2CAIA 2YANA 5CNWA 2OADA 1PFOA 1T00A 3P7XA 4FO5A 1O8WA 1MDJA 3LORA 3P2AA 2R2JA 1FOHA 4O5QA 2H71A 1E2YA 3KIJA 2OA7A 2GDRA 5ECKB 4F9ZA 2VLTA 3GYKA 3UBKA 3WGEA 1ZYPA 3VK9A 2M72A 3MNGA 2MMNA 1M3JA 3M9JA 3R2QA 3WD6A 2HFDA 4TRXA 1EGRA 4WF4A 2X64A 2O87A 1WOUA 2QKEA 1CQGA 2C3QA 1SD8A 1NHYA 3CRTA 2CX4A 2O85A 3CMIA 4JR4A 4JR6A 1OYJA 2FNOA 5G1LA 3VFIA 3KH7A 1VRSD 2VL9A 3QPMA 3VWUA 1AQWA 3VI7A 1K3OA 4GLTA 3U5RE 1VF1A 2VCXA 1EP7A 3N9JA 4JU5A 5IMZA 5AIVA 3FZ9A 4IQ1A 2AJQB 2OBKA 1FAAA 5DQYA 1GUKA 3RHBA 2LQOA 1A24A 2WGRA 2LV3A 3DEXA 1AIUA 5D9VA 4PTSA 3KTBA 4LLRA 4HUAA 3FEUA 4J57E 3IAM2 4OD7A 2DBCA 5COHA 4PNFA 2F3MA 3OR5A 3D0ZA 2DMLA 3GTUB 1YZXA 2D2ZA 2HNLA 3VWWA 2A2RA 4MZWA 3I69A 5DJMA 2VD0A 3F4SA 5A4VA 5ECIB 1Y6EA 4KCAA 2WRTA 1J9BA 1DUGA 1F2EA 4MJAA 1EWXA 2VAFA 4MCUA 2H74A 3KXOA 3GN3A 2HI7A 2HRAA 1BX9A 5DBQA 5BRTA 1EEJA 4ID0A 3W8SA 2H72A 4TR0A 3ZFLA 3HA9A 3MWHA 5HFKA 3IR4A 1XWCA 3IHQA 1PD21 2GQMA 1J0FA 2H0IA 4DEJA 4Q5FA 3EE2A 3K8NA 5DAKB 4MPGA 3MAKA 5GSSA 1GSYA 4NHWA 4N30A 3IK9A 1R26A 3WT1A 1DSBA 3ZVJA 2DMMA 3LGCA 3EU3A 2DJ3A 1JZWA 3GURA 3C7MA 1M2BA 2A4VA 1A2LA 3IC8A 1KEBA 2ES7A 2CVKA 2IMFA 4EL1A 5D9TA 2PGTA 1F6MC 2VL3A 3DWVA 3EMPA 3HXSA 3HCZA 1ILOA 1AW9A 2XPDA 2OE1A 3TKPA 5CRGA 2PERA 5C04A 1G6YA 2IJYA 3O3TA 3P90A 3PR8A 5J9CA 5ECOB 2RM5A 3FRCA 2JSZA 4XS4A 5A5KA 3EVIA 3GHAA 4HI7A 1YDKA 4PUFC 1GSQA 5G1KA 2GS3A 1GTAA 2I4AA 11GSA 4ICYA 2AYTA 4XS1A 2WFCA 2LEGA 2XBIA 3GKXA 4L8EA 1B8XA 1KBNA 2LKUA 2YV7A 3TRPA 3F8UA 3F3RA 2GTUA 1B48A 3E3EA 3G7IA 3HVSA 4TOPA 5FWGA 1PX7A 4X1UA 4MJBA 1GTUA 3DVWA 3RAZA 3RPPA 4AJ6A 4TR3A 3F9UA 3MYDA 5J4UA 4EF0A 4IJ3A 1B4PA 5ECQB 3L9UA 1SKRB 1TRVA 4PX1A 4YAVA 4GSTA 1EZKA 1IYIA 1F3BA 3TJFA 1XFLA 2G2QA 1A2JA 5ECRB 4JEDA 4TXVA 2JSYA 2DJ0A 4MF7A 1M9BA 3A2XA 2N5BA 1Z9HA 2VD1A 3JCML 2ON7A 3KEBA 2R3XA 1GSDA 5IO2A 2VM2A 2YCDA 3ZLPA 2K18A 2MBSA 1ZGNA 4ZIJA 3QAWA 3F0IA 1PN0A 3A2WA 1GSEA 1GWCA 2X8HA 2R37A 4HOJA 2HXKA 4V1Ag 3L4NA 2B1KA 2R6KA 4K9ZA 2VCQA 4WXTA 4CW9A 4BIKA 1SL0B 2FD3A 2HRNA 4HZ4A 5B8BA 3QMXA 2KHPA 2ON5A 1OAZA 2H1AA 4BVYB 3M3MA 1B9XC 4LL1B 2HZEB 3W6GA 5DCHA 1WE0A 4K2DA 2YZHA 2LJKA 3Q19A 1XW5A 1HQOA 4MJCA 1O85A 1YY7A 1WP0A 3TCOA 3GKKA 3VPQA 2YWMA 3GX8A 2H1BA 4L0UA 2VM1A 1WIKA 4CY8A 3FW2A 2EC4A 5HFIA 1XW6A 5KN3A 3BD2A 2I3YA 4USSA 5KN1A 2OE3A 3TUEA 1LJRA 3I9V2 2YN1A 1TW9A 2PMTA 3A3TA 1TTZA 4ILFA 5C00A 4F0CA 3IA1A 1AAZA 3GKNA 2XPEA 2N5AA 4KNDA 1XIYA 1ZL9A 4MABA 2QA2A 1Y25A 1YKCA 1XG8A 3UIWA 3F6FA 1EV4A 2F9SA 3RPNA 1QMVA 1DE1A 4RI6A 1ACVA 2M46A 3TJGA 4YKFA 4NWYA 4ECCA 3LYPA 4OFNA 1OC8A 2XHFA 3ZVJD 1I9DA 1SL2B 3QFAC 1JHBA 5A4UA 2EIRA 4WBJA 2FWFA 4CY6A 1AQVA 4I5QA 3EMXA 4RUVA 4F03A 4IQAA 3TOTA 5EVOA 1U87A 5D73A 5DALA 1HYUA 2V2GA 5LD0A 2B3SA 4EO3A 4TN8A 1YQ1A 2CZ3A 1OE8A 2L5LA 2B1LA 1ML6A 4FYCA 5JCWA 3LEFA 1GLQA 1TK8B 1Z7RA 1AXDA 3FR6A 3ZL5A 4F82A 3L78A 2GZYA 1GNEA 4HEA2 4ML1A 2K6VA 1B9YC 4KH7A 3LQ7A 1FO5A 6GSWA 2H70A 5GAND 5CP1A 1TI1A 2OE0A 3HVXA 1TU8A 4PQHA 3KH9A 5HR3A 3KZQA 1M2AA 1G7EA 1UN2A 4NPBA 4N10A 4YAPA 1AUCA 4BPYA 2DIYA 4YQVA 2NDOA 1FB6A 4HZ2A 3ZMKA 2MYGA 2YPMA 1A2MA 2BMXA 2HE3A 3LJRA 3UL3A 4MK3A 4HS1A 4N0VA 1NSWA 5CAXA 1TKDB 5IMCA 3L9VA 1R5PA 1THXA 1FOVA 1GTIA 4V2LA 2R0CA 1OC9B 3UAPA 2QA1A 1JZDA 4N0ZA 4JBBA 1ON4A 3GSSA 3GX0A 4NV2A 3UVTA 2LS5A 1EEMA 4V1Ap 4K5RA 3GKMA 1H4OA 1TJDA 4NHZA 2K8VA 2CA8A 4HJMA 2JZSA 1H75A 3ERGA 2LNTA 1XVQA 2L59A 3KTLA 1RK4A 1DE2A 1X5DA 1GSSA 3IBHA 1XVWA 4MF5A 3VURA 3GL5A 5CRWA 1V57A 4EE0A 3FY7A 4PUAA 3NZNA 2HZFA 2VCTA 3ERFA 2PWJA 2P31A 2YJHA 4NXIA 1PL1A 1BAYA 3IDVA 2CV4A 1W4VA 2JU5A 4IS0A 1TOFA 2GSSA 3GUSA 3DD3A 3EC3A 3MSZA 1GL8A 1XOBA 13GSA 4NV5A 3SBCA 3O76A 3UMAA 5AGYA 1FB0A 4HDEA 1K0OA 5FT3A 4XS4B 1QGVA 3QOUA 4K0GA 5AN1A 3F3QA 2CT6A 3LG6A 2N5FA 2X4AA 4I2TA 4K5SA 5FHIA 3IV4A 4MJEA 4IVFA 3APQA 4ML6A 5H5SA 4FH8A 4GQFA 2MMOA 5ENUA 2HYXA 1MDIA 1XWBA 2X99A 4LL4B 3F4RA 1WRYA 4KDUA 5CO3A 3ZFBA 3ED3A 4D73A 3HKRA 3UEMA 2K8SA 3QR6A 3TJKA 2GQKA 4ZILA 2H1GA 1TK0B 12GSA 4BVXB 2LRNA 1NHOA 1TRWA 1YKAA 1XOAA 5B6NA 2IFQA 2KP1A 2FA4A 4KB3A 1URMA 1X5CA 3KJYA 3IK7A 1BQ7A 1SD9A 3ZIJA 2JACA 5B6MA 3IC4A 2HSMA 2LJAA 2C0FA 5F05A 4AF2A 5BMUA 2H73A 1PMTA 4Q5NA 1SK0A 5HR0A 1TK5B 2ZUPA 1PKZA 1ERVA 3TKSE 2WDUA 1SYXA 1M7TA 4IP6A 2AUVA 5F8BA 3GSTA 1K0BA 1N8JA 4ECJA 1SKSB 5F0GA 3S9FA 1ST9A 4MF6A 4ULXA 4XIHA 3E9JB 2YWOA 4GQCA 2P5RA 1U3IA 4G2EA 2H6ZA 3NOFA 2C80A 1DBYA 4ZXGA 1YF1A 3LFLA 4KSOA 3W8JA 3CBUA 3A5IA 3F6DA 1LBKA 3KD0A 2AV4A 4XCSA 2O8VB 4TR1B 4WR4A 4KUNA 4H86A 1MTCA 4ECIA 1O6JA 5KEJA 5J5NA 1J08A 1T1VA 3H1NA 4KDYA 2F51A 2HRFA 3AY8A 2VOCA 3QCPA 1KNGA 1MEKA 1O81A 1TRSA 3FYGA 1XWKA 1N2AA 2B5EA 1EGOA 2B6MA 1O8XA 1Z3EA 4EC0A 5AISA 5L71A 1M3IA 2CZ2A 3HDCA 2H0GA 5F07A 2DLXA 1A8YA 3H79A 2H0HA 1PA3A 4PGTA 1JLVA 2O7KA 4KX4A 3L9SA 4GF0A 5KN0A 2GLRA 2WS2A 3HHVA 2IL3A 4HQZA 4TW5A 2IMDA 4KSMA 1EOGA 3FHKA 2LRCA 4MLYA 3HVVA 1ERTA 1EOHA 4IP1A 4G0KA 4MNNA 1V40A 5IPHA 1T7PB 5DJLA 4Q5RA 4XRDA 1YEPA 4WKWA 2TRXA 3PH9A 5D9WA 1NM3A 4CHSA 4AGSA 1U3AA 1ZYEA 1HNBA 2TRCP 5J3RA 1SK2A 3GV1A 2IN3A 3P8WA 2PVOC 1XW9A 4J2FA 4L5OA 1OC3A 1GNWA 5LCZA 5IOXA 1SJ6A 2E7PA 3IPZA 2C3NA 1JLWA 2MBTA 2Z9SA 4NAXA 3ZITA 1V9WA 4X4JA 2B7KA 4POMA 1ZOFA 4MA9A 3RHCA 2C0EA 4O32A 2BTOT 3GTUA 3HJPA 4P3YB 2DJ2A 2LJRA 2PUKC 5HR1A 1G6WA 3N5OA 1M9AA 3C8EA 3IAS2 1I5GA 2HLSA 1X9MB 1RQMA 4WETA 4BWSA 4FYBA 1FVJA 2V41A 5B8AA 2IIYA 3GL3A 3E0UA 4ZL7A 2FGXA 20GSA 4K7IA 3TGZA 1FG4A 2I1UA 5ECNB 2IMEA 2ZNMA 1A23A 2R5GA 3I6AA 1XWAA 3BBYA 5D8IA 2LUSA 4JRRA 3CQFA 3ZMLA 5HFGA 1SKWB 1TRUA 3IXRA 4AJ7A 3F4TA 6GSUA 2QGVA 2VIMA 3M9KA 3HVNA 5AIXA 5IOWA 3D21A 8GSSA 1O7UA 2GSQA 1GSFA 2L5OA 5J41A 3J7Yb 2DJ1A 3CXGA 4O7HA 2YNXA 4ZB9A 4FQUA 2J9HA 1X9WB 4I6XA 4J56E 4POLA 3C71A 5IM9A 2MMAA 1ABAA 1F9MA 4KDXA 5G31A 1MD4A 2DC5A 1M99A 4GTUA 3IOSA 3HD5A 5IO0A 4OFMA 2C4JA 2E2MA 3C1RA 4OFTA 1NW2A 2KP2A 2H1DA 3ME7A 3VWXA 2YOIA 4LMWA 2NVLA 10GSA 4PQ1A 3LSZA 5KOWA 3HY2A 3FKFA 2VLUA 2L4QA 4EDYA 4I97A 2H75A 3A5WA 3G7YA 2C0DA 3J7Yk 1S3RA 4EIPA 4EKZA 3MIXA 5JWQB 2A4HA 3UARA 1EV9A 1VF4A 5E59A 5ECPB 1GSUA 3CSIA 2E2GA 2L4CA 2E0QA 2IPAA 3M0FA 1R7HA 4MH3A 3GIXA 3US3A 2NTOA 1XWGA 2V6KA 5IMAA 2L6CA 4K7OA 1SL1B 1VF2A 5JCGA 2HT9A 4WBRD 2GSTA 5GZZB 2H76A 4TVEA 2F8FA 2HSHA 1GLPA 5G30A 4YKGA 1KTEA 2VL2A 2YJ7A 4POKA 2PVQA 3TRXA 1XBSA 4EIQA 4KAEA 5IPGA 2XBQA 1K0AA 2VLVA 4RQRA 1JZOA 4XHMA 1PQNA 4ZB8A 4WEYA 4D73B 1WJKA 2P5QA 1FHEA 1K0DA 2RUFA 3BCIA 1T4YA 1WWJA 3RDWA 4ZBDA 2H6XA 2IFQB 5ELAA 4L5LA 5JWRB 1ZCPA 2H8LA 1VF3A 1TXXA 4HQSA 3KP8A 3APSA 3DXBA 4IN0A 2YZUA 1ZZYA 1ZYNA 4DSSA 1ERWA 6GSTA 2FUG2 2H30A 3A2VA 5CRHA 2HZEA 5J9BA 3PGTA 1X5EA 2RLIA 2I81A 4KW6A 3FZAA 2IMIA 3I43A 18GSA 2CVBA 4MP4A 2WB9A 5ECLB 2JZTA 3ZRDA 1S3DA 3EYTA 3CSHA 5IMVA 3TKQA 4PQIA 1XZOA 4HSCX 4MMMA 4AJ8A 1G0TA 1SYRA 9GSSA 4F2IA 3ZIVA 2V1MA 5HQPA 4YH2A 5B7CA 4MH2A 1USBA 5D9XA 5IIZA 1OKDA 4ZL9A 2MMZA 2DKIA 3KGKA 1UC7A 3KMOA 1YF0A 1Z6NA 3FZ5A 1Z6MA 2C3TA 4LA1A 2CX3A 2UZ8A 1X0RA 1LU4A 4TXOA 1EP8A 4BWQA 1FVKA 2B7JA 2R0PA 1YEXA 3O6TA 7GSSA 1ERUA 1GP1A 1OE7A 4ECBA 2WJUA 5H5QA 1GUHA 3HYPA 3UOMA 1BYEA 1PX6A 1GUMA 1ZYQB 1IYHA 2VUPA 4K7NA 2PU9C 2A2PA 4DSRA 5A4WA 5ID2A 2FLSA 2NBSA 4RQXA 3Q74A 3U6VA 3CTGA 1O73A 3TKRA 5IMDA 4QL9A 4A5PA 2GZZA 3UJ1A 3IRAA 4N11A 19GSA 4MZBA 2L57A 3IE3A 1U88A 3HJMA 1OKTA 4KF9A 4G0LA 2PBJA 4K2XA 1PRXA 3M8NA 1R4WA 4WF5A 5GSTA 1JFUA 2NPBA 2OBIA 2REMA 3HZ8A 2KOKA 3EURA 6GSSA 22GSA 4ACSA 4OMVA 1Z5YE 1HNAA 5CREA 4BL7A 3VPTA 3KP9A 1X9SB 2MZCA 2OACA 2H6YA 3SWLA 6GSVA 3QD9A 4OWYA 3ZTLA 3RBTA 2M80A 2DJJA 2PN8A 3M1GA 3TKSA 1K0NA 4MDCA 1UA5A 4IBPA 2LTKA 1RW1A 4Q5QA 5D96A 4K6XA 3PINA 1CQHA 3PPUA 2F8AA 3KM6A 1SU9A 1GRXA 4I8BA 5GAPD 4XTSA 4G10A 4E8EA 2JADA 1B4QA 4HU7A 4KE3A 1A0RP 1OC9A 1K3LA 3FZ4A 3Q6OA 2KUCA 4K1FA 3FMWA 3CYNA 2VCVA 3H93A 2J23A 4YQMA 3DGQA 4ZL8A 5G2ZA 3G9BA 1VGLA 3C73A 2DSAA 3EU4A 2HSYA 1TDIA 4GSNA 5LNKe 3ME8A 1PGTA 2OKAA 2KLXA 1HNCA 4CDOA 2WCIA 3D6IA 4KA0A 2DKHA 2AHEA 2R4VA 3WGXA 2GSRA 2YWNA 4POBA 5DDLA 4PXOA 3GNJA 5ECMB 4Z2RA 1XPVA 4GWRA 5KOXA 3FR3A 2DIZA 3NIVA 1OVNA 2K9FA 2WULA 1W89A 4HU9A 5ECHB 3DVXA 3D5JA 2YP6A 3ISOA 4RI7A 5E4WA 2EIQA 1GH2A 2RM6A 4LMVA 4K8MA 1E6BA 4X43A 5EPFA 2RIIA 4ZBBA 2LRTA 3UVHA 3ZYWA 1SENA 2VCWA 1XXUA 4GCIA 3DRNA 2BJXA 4IHUA 5DQSA 3R3EA 4MPFA 3ERWA 3H8QA 5HR2A 2YWIA 5ABRA 1T4ZA 4Z2UA 4TR4A 4E8HA 2H66A 4KGIA 1BG5A 4IGJA 3ZZXA 4V2MA 2O89A 1MDKA 1K3YA 2OJLA 3BOAA 1C72A 4BVXA 1JZRA 2GVPA 2LSTA 5DALB 4ZBAA 2P0GA 4O5RA 2GT6A 3V1WA 1TP9A 1V98A 3D4TA 4EXJA 5IMFA 2I9HA 3H4KA 3HJOA 2IMKA 2LNSA 3WT2A 3FR9A 6GSYA 3VWVA 5G5EA 1K0CA 1M2DA 2G0FA 1GULA 2L6DA 5JWOB 3TDGA 2B5YA 1F3AA 4IW9A 2X8GA 5H5RA 2VL2C 2ZCTA 1QK8A 4WR5A 4ISDA 2GQLA 5DAKA 4PURA 1WMJA 4FYUA 1UVZA 3IHGA 3G7JA 4TR1A 5ECSA 3VI5A 2X49A 1M0UA 4YQUA 3WGDA 4JZQA 1U6TA 3L0HA 3KCMA 4OCFA 4EUYA 4DSSB 4GRFA 4IELA 2YV9A 3CSJA 4QL7A 4F0BA 1QXHA 5G5FA 2FWEA 4HJ2A 1S3CA 2VCZA 4ZB6A 4OCEA 1PL2A 1HD2A 3Q18A 5DCGA 3TOUA 2FHEA 1THOA 5EL8A 1PN9A 4EDZA 4QQ7A 2ALBA 3TB2A 2H01A 3WYWA 2X8CA 1FW1A 2FCHA 4O5UA 3VLNA 4K0NA 1Q98A 2C8UA 5D93A 3MDKA 1V58A 1A0FA 3BCKA 4GXZA 5ELGA 4L0WA 2XC2A 1Q4JA 3GH9A 2GZPA 1A8LA 1MD3A 3QFBC 3GA4A 3BJ5A 2DJKA 2LQQA 3DYRA 4TXOB 3ZREA 1T3BA 1Z7PA 3LW9A 2FWGA 5CRDA 2RUEA 1WPIA 4I2UA 5JCUA 4DVCA 3LYKA 4FIWA 3DIEA 2R0GA 1QFNA 1SJIA 3TJJA 3QAVA 2FWHA 3F63A 3QAGA 1XCCA 2QC7A 3TRQA 4PNGA 4Z7XA 2EIOA 3CTFA 1QQ2A 4G0IA 5ID2B 2FY6A 1SJZA 3GMFA 3GFKA 3HZ4A 4NMUA 4Z2TA 14GSA 5CYYA 3EWLA 2VO4A 4GSSA 1AQXA 1YJ6A 2IWTA 2GT5A 2WZ9A 3UBLA 5KN2A 3APOA 4XS6A 4G19A 4IKHA 3GRXA 3LXZA 6GSXA 2PPTA 4BA7A 3D22A 4MZCA 2GGTA 4BL7B 1R5AA 17GSA 2B5XA 4OO5A 3QDNA 3DKSA 2AB6A 1TU7A 2FA8A 4O92A 5EY6A 3LXTA 4IJIA 3LWAA 2TIRA 1QUWA 3D4MA 1BEDA 1GTBA 5F06A 4V2NA 4TKYA 1F37A 2H19A 2C1YA 2HRKA 3C1SA 5IQYA 4JE1A 3KMNA 4G9HA 3CRUA
chains in the Genus database with same CATH topology
5INYA 3EINA 1ZMAA 4BVYA 1PSQA 1S3AA 4DSQA 1G7OA 1SK1A 2JL4A 2JZRA 4XRAA 5DVBA 1K0MA 3TJBA 3FK8A 2V32A 2QSIA 3GH6A 3DMLA 3TKSC 4KCEA 2CVDA 2A2SA 2C0GA 2AAWA 2CQ9A 1TI3A 3EPTA 16GSA 2V6OA 1AC1A 1PKWA 4X0XA 4EVMA 1V2AA 2CAQA 4OO4A 1BJXA 1T8EB 2CAIA 2YANA 5CNWA 2OADA 1T00A 3P7XA 4FO5A 1O8WA 1MDJA 3LORA 3P2AA 2R2JA 1FOHA 4O5QA 2H71A 1E2YA 3KIJA 2OA7A 2GDRA 5ECKB 4F9ZA 2VLTA 3GYKA 3UBKA 3WGEA 1ZYPA 3VK9A 2M72A 3MNGA 2MMNA 3M9JA 3R2QA 3WD6A 2HFDA 4TRXA 1EGRA 4WF4A 2X64A 2O87A 1WOUA 2QKEA 1CQGA 2C3QA 1SD8A 1NHYA 3CRTA 2CX4A 2O85A 3CMIA 4JR4A 4JR6A 1OYJA 2FNOA 5G1LA 3VFIA 3KH7A 1VRSD 2VL9A 3QPMA 3VWUA 1AQWA 3VI7A 1K3OA 4GLTA 3U5RE 1VF1A 2VCXA 1EP7A 3N9JA 4JU5A 5IMZA 5AIVA 3FZ9A 4IQ1A 2AJQB 2OBKA 1FAAA 5DQYA 1GUKA 3RHBA 2LQOA 1A24A 2WGRA 2LV3A 3DEXA 1AIUA 5D9VA 4PTSA 3KTBA 4LLRA 4HUAA 3FEUA 4J57E 3IAM2 4OD7A 2DBCA 5COHA 4PNFA 2F3MA 3OR5A 3D0ZA 2DMLA 3GTUB 1YZXA 2D2ZA 2HNLA 3VWWA 2A2RA 4MZWA 3I69A 5DJMA 2VD0A 3F4SA 5A4VA 5ECIB 1Y6EA 4KCAA 2WRTA 1J9BA 1DUGA 1F2EA 4MJAA 1EWXA 2VAFA 4MCUA 2H74A 3KXOA 3GN3A 2HI7A 2HRAA 1BX9A 5DBQA 5BRTA 1EEJA 4ID0A 3W8SA 2H72A 4TR0A 3ZFLA 3HA9A 3MWHA 5HFKA 3IR4A 1XWCA 3IHQA 1PD21 2GQMA 1J0FA 2H0IA 4DEJA 4Q5FA 3EE2A 3K8NA 5DAKB 4MPGA 3MAKA 5GSSA 1GSYA 4NHWA 4N30A 3IK9A 1R26A 3WT1A 1DSBA 3ZVJA 2DMMA 3LGCA 3EU3A 2DJ3A 1JZWA 3GURA 3C7MA 1M2BA 2A4VA 1A2LA 3IC8A 1KEBA 2ES7A 2CVKA 2IMFA 4EL1A 5D9TA 2PGTA 1F6MC 2VL3A 3DWVA 3EMPA 3HXSA 3HCZA 1ILOA 1AW9A 2XPDA 2OE1A 3TKPA 5CRGA 2PERA 5C04A 1G6YA 2IJYA 3O3TA 3P90A 3PR8A 5J9CA 5ECOB 2RM5A 3FRCA 2JSZA 4XS4A 5A5KA 3EVIA 3GHAA 4HI7A 1YDKA 4PUFC 1GSQA 5G1KA 2GS3A 1GTAA 2I4AA 11GSA 4ICYA 2AYTA 4XS1A 2WFCA 2LEGA 2XBIA 3GKXA 4L8EA 1B8XA 1KBNA 2LKUA 2YV7A 3TRPA 3F8UA 3F3RA 2GTUA 1B48A 3E3EA 3G7IA 3HVSA 4TOPA 5FWGA 1PX7A 4X1UA 4MJBA 1GTUA 3DVWA 3RAZA 3RPPA 4AJ6A 4TR3A 3F9UA 3MYDA 5J4UA 4EF0A 4IJ3A 1B4PA 5ECQB 3L9UA 1SKRB 1TRVA 4PX1A 4YAVA 4GSTA 1EZKA 1IYIA 1F3BA 3TJFA 1XFLA 2G2QA 1A2JA 5ECRB 4JEDA 4TXVA 2JSYA 2DJ0A 4MF7A 1M9BA 3A2XA 2N5BA 1Z9HA 2VD1A 3JCML 2ON7A 3KEBA 2R3XA 1GSDA 5IO2A 2VM2A 2YCDA 3ZLPA 2K18A 2MBSA 1ZGNA 4ZIJA 3QAWA 3F0IA 1PN0A 3A2WA 1GSEA 1GWCA 2X8HA 2R37A 4HOJA 2HXKA 4V1Ag 3L4NA 2B1KA 2R6KA 4K9ZA 2VCQA 4WXTA 4CW9A 1SL0B 2FD3A 2HRNA 4HZ4A 5B8BA 3QMXA 2KHPA 2ON5A 1OAZA 2H1AA 4BVYB 3M3MA 1B9XC 4LL1B 2HZEB 3W6GA 5DCHA 1WE0A 4K2DA 2YZHA 2LJKA 3Q19A 1XW5A 1HQOA 4MJCA 1O85A 1YY7A 1WP0A 3TCOA 3GKKA 3VPQA 2YWMA 3GX8A 2H1BA 4L0UA 2VM1A 1WIKA 4CY8A 3FW2A 2EC4A 5HFIA 1XW6A 5KN3A 3BD2A 2I3YA 4USSA 5KN1A 2OE3A 3TUEA 1LJRA 3I9V2 2YN1A 1TW9A 2PMTA 3A3TA 1TTZA 4ILFA 5C00A 4F0CA 3IA1A 1AAZA 3GKNA 2XPEA 2N5AA 4KNDA 1XIYA 1ZL9A 4MABA 2QA2A 1Y25A 1YKCA 3UIWA 3F6FA 1EV4A 2F9SA 3RPNA 1QMVA 1DE1A 4RI6A 1ACVA 2M46A 3TJGA 4YKFA 4NWYA 4ECCA 3LYPA 4OFNA 1OC8A 2XHFA 3ZVJD 1I9DA 1SL2B 3QFAC 1JHBA 5A4UA 2EIRA 4WBJA 2FWFA 4CY6A 1AQVA 4I5QA 3EMXA 4RUVA 4F03A 4IQAA 3TOTA 5EVOA 1U87A 5D73A 5DALA 1HYUA 2V2GA 5LD0A 2B3SA 4EO3A 4TN8A 1YQ1A 2CZ3A 1OE8A 2L5LA 2B1LA 1ML6A 4FYCA 5JCWA 3LEFA 1GLQA 1TK8B 1Z7RA 1AXDA 3FR6A 3ZL5A 4F82A 3L78A 2GZYA 1GNEA 4HEA2 4ML1A 2K6VA 1B9YC 4KH7A 3LQ7A 1FO5A 6GSWA 2H70A 5GAND 5CP1A 1TI1A 2OE0A 3HVXA 1TU8A 4PQHA 3KH9A 5HR3A 3KZQA 1M2AA 1G7EA 1UN2A 4NPBA 4N10A 4YAPA 1AUCA 4BPYA 2DIYA 4YQVA 2NDOA 1FB6A 4HZ2A 3ZMKA 2MYGA 2YPMA 1A2MA 2BMXA 2HE3A 3LJRA 3UL3A 4MK3A 4HS1A 4N0VA 1NSWA 5CAXA 1TKDB 5IMCA 3L9VA 1R5PA 1THXA 1FOVA 1GTIA 4V2LA 2R0CA 1OC9B 3UAPA 2QA1A 1JZDA 4N0ZA 4JBBA 1ON4A 3GSSA 3GX0A 4NV2A 3UVTA 2LS5A 1EEMA 4V1Ap 4K5RA 3GKMA 1H4OA 1TJDA 4NHZA 2K8VA 2CA8A 4HJMA 2JZSA 1H75A 3ERGA 2LNTA 1XVQA 2L59A 3KTLA 1RK4A 1DE2A 1X5DA 1GSSA 3IBHA 1XVWA 4MF5A 3VURA 3GL5A 5CRWA 1V57A 4EE0A 3FY7A 4PUAA 3NZNA 2HZFA 2VCTA 3ERFA 2PWJA 2P31A 2YJHA 4NXIA 1PL1A 1BAYA 3IDVA 2CV4A 1W4VA 2JU5A 4IS0A 1TOFA 2GSSA 3GUSA 3DD3A 3EC3A 3MSZA 1GL8A 1XOBA 13GSA 4NV5A 3SBCA 3O76A 3UMAA 5AGYA 1FB0A 4HDEA 1K0OA 5FT3A 4XS4B 1QGVA 3QOUA 4K0GA 5AN1A 3F3QA 2CT6A 3LG6A 2N5FA 2X4AA 4I2TA 4K5SA 5FHIA 3IV4A 4MJEA 4IVFA 3APQA 4ML6A 5H5SA 4FH8A 4GQFA 2MMOA 5ENUA 2HYXA 1MDIA 1XWBA 2X99A 4LL4B 3F4RA 1WRYA 4KDUA 5CO3A 3ZFBA 3ED3A 4D73A 3HKRA 3UEMA 2K8SA 3QR6A 3TJKA 2GQKA 4ZILA 2H1GA 1TK0B 12GSA 4BVXB 2LRNA 1NHOA 1TRWA 1YKAA 1XOAA 5B6NA 2IFQA 2KP1A 2FA4A 4KB3A 1URMA 1X5CA 3KJYA 3IK7A 1BQ7A 1SD9A 3ZIJA 2JACA 5B6MA 3IC4A 2HSMA 2LJAA 2C0FA 5F05A 4AF2A 5BMUA 2H73A 1PMTA 4Q5NA 1SK0A 5HR0A 1TK5B 2ZUPA 1PKZA 1ERVA 3TKSE 2WDUA 1SYXA 1M7TA 4IP6A 2AUVA 5F8BA 3GSTA 1K0BA 1N8JA 4ECJA 1SKSB 5F0GA 3S9FA 1ST9A 4MF6A 4ULXA 4XIHA 3E9JB 2YWOA 4GQCA 2P5RA 1U3IA 4G2EA 2H6ZA 3NOFA 2C80A 1DBYA 4ZXGA 1YF1A 3LFLA 4KSOA 3W8JA 3CBUA 3A5IA 3F6DA 1LBKA 3KD0A 2AV4A 4XCSA 2O8VB 4TR1B 4WR4A 4KUNA 4H86A 1MTCA 4ECIA 1O6JA 5KEJA 5J5NA 1J08A 1T1VA 3H1NA 4KDYA 2F51A 2HRFA 3AY8A 2VOCA 3QCPA 1KNGA 1MEKA 1O81A 1TRSA 3FYGA 1XWKA 1N2AA 2B5EA 1EGOA 2B6MA 1O8XA 1Z3EA 4EC0A 5AISA 5L71A 2CZ2A 3HDCA 2H0GA 5F07A 2DLXA 1A8YA 3H79A 2H0HA 1PA3A 4PGTA 1JLVA 2O7KA 4KX4A 3L9SA 4GF0A 5KN0A 2GLRA 2WS2A 3HHVA 2IL3A 4HQZA 4TW5A 2IMDA 4KSMA 1EOGA 3FHKA 2LRCA 4MLYA 3HVVA 1ERTA 1EOHA 4IP1A 4G0KA 4MNNA 1V40A 5IPHA 1T7PB 5DJLA 4Q5RA 4XRDA 1YEPA 4WKWA 2TRXA 3PH9A 5D9WA 1NM3A 4CHSA 4AGSA 1U3AA 1ZYEA 1HNBA 2TRCP 5J3RA 1SK2A 3GV1A 2IN3A 3P8WA 2PVOC 1XW9A 4J2FA 4L5OA 1OC3A 1GNWA 5LCZA 5IOXA 1SJ6A 2E7PA 3IPZA 2C3NA 1JLWA 2MBTA 2Z9SA 4NAXA 3ZITA 1V9WA 4X4JA 2B7KA 4POMA 1ZOFA 4MA9A 3RHCA 2C0EA 4O32A 2BTOT 3GTUA 3HJPA 4P3YB 2DJ2A 2LJRA 2PUKC 5HR1A 1G6WA 3N5OA 1M9AA 3C8EA 3IAS2 1I5GA 2HLSA 1X9MB 1RQMA 4WETA 4BWSA 4FYBA 1FVJA 2V41A 5B8AA 2IIYA 3GL3A 3E0UA 4ZL7A 2FGXA 20GSA 4K7IA 3TGZA 1FG4A 2I1UA 5ECNB 2IMEA 2ZNMA 1A23A 2R5GA 3I6AA 1XWAA 3BBYA 5D8IA 2LUSA 4JRRA 3ZMLA 5HFGA 1SKWB 1TRUA 3IXRA 4AJ7A 3F4TA 6GSUA 2QGVA 2VIMA 3M9KA 5AIXA 5IOWA 3D21A 8GSSA 1O7UA 2GSQA 1GSFA 2L5OA 5J41A 3J7Yb 2DJ1A 3CXGA 4O7HA 2YNXA 4ZB9A 4FQUA 2J9HA 1X9WB 4I6XA 4J56E 4POLA 3C71A 5IM9A 2MMAA 1ABAA 1F9MA 4KDXA 5G31A 1MD4A 2DC5A 1M99A 4GTUA 3IOSA 3HD5A 5IO0A 4OFMA 2C4JA 2E2MA 3C1RA 4OFTA 1NW2A 2KP2A 2H1DA 3ME7A 3VWXA 2YOIA 4LMWA 2NVLA 10GSA 4PQ1A 3LSZA 5KOWA 3HY2A 3FKFA 2VLUA 2L4QA 4EDYA 4I97A 2H75A 3A5WA 3G7YA 2C0DA 3J7Yk 4EIPA 4EKZA 3MIXA 5JWQB 2A4HA 3UARA 1EV9A 1VF4A 5E59A 5ECPB 1GSUA 3CSIA 2E2GA 2L4CA 2E0QA 2IPAA 3M0FA 1R7HA 4MH3A 3GIXA 3US3A 2NTOA 1XWGA 2V6KA 5IMAA 2L6CA 4K7OA 1SL1B 1VF2A 5JCGA 2HT9A 4WBRD 2GSTA 5GZZB 2H76A 4TVEA 2F8FA 2HSHA 1GLPA 5G30A 4YKGA 1KTEA 2VL2A 2YJ7A 4POKA 2PVQA 3TRXA 1XBSA 4EIQA 4KAEA 5IPGA 2XBQA 1K0AA 2VLVA 4RQRA 1JZOA 4XHMA 1PQNA 4ZB8A 4WEYA 4D73B 1WJKA 2P5QA 1FHEA 1K0DA 2RUFA 3BCIA 1T4YA 1WWJA 3RDWA 4ZBDA 2H6XA 2IFQB 5ELAA 4L5LA 5JWRB 1ZCPA 2H8LA 1VF3A 1TXXA 4HQSA 3KP8A 3APSA 3DXBA 4IN0A 2YZUA 1ZZYA 1ZYNA 4DSSA 1ERWA 6GSTA 2FUG2 2H30A 3A2VA 5CRHA 2HZEA 5J9BA 3PGTA 1X5EA 2RLIA 2I81A 4KW6A 3FZAA 2IMIA 3I43A 18GSA 2CVBA 4MP4A 2WB9A 5ECLB 2JZTA 3ZRDA 1S3DA 3EYTA 3CSHA 5IMVA 3TKQA 4PQIA 1XZOA 4MMMA 4AJ8A 1G0TA 1SYRA 9GSSA 4F2IA 3ZIVA 2V1MA 5HQPA 4YH2A 5B7CA 4MH2A 1USBA 5D9XA 5IIZA 1OKDA 4ZL9A 2MMZA 2DKIA 3KGKA 1UC7A 3KMOA 1YF0A 1Z6NA 3FZ5A 1Z6MA 2C3TA 4LA1A 2CX3A 2UZ8A 1X0RA 1LU4A 4TXOA 1EP8A 4BWQA 1FVKA 2B7JA 2R0PA 1YEXA 3O6TA 7GSSA 1ERUA 1GP1A 1OE7A 4ECBA 2WJUA 5H5QA 1GUHA 3HYPA 3UOMA 1BYEA 1PX6A 1GUMA 1ZYQB 1IYHA 2VUPA 4K7NA 2PU9C 2A2PA 4DSRA 5A4WA 5ID2A 2FLSA 2NBSA 4RQXA 3Q74A 3U6VA 3CTGA 1O73A 3TKRA 5IMDA 4QL9A 4A5PA 2GZZA 3UJ1A 3IRAA 4N11A 19GSA 4MZBA 2L57A 3IE3A 1U88A 3HJMA 1OKTA 4KF9A 4G0LA 2PBJA 4K2XA 1PRXA 3M8NA 1R4WA 4WF5A 5GSTA 1JFUA 2NPBA 2OBIA 2REMA 3HZ8A 2KOKA 3EURA 6GSSA 22GSA 4ACSA 4OMVA 1Z5YE 1HNAA 5CREA 4BL7A 3VPTA 3KP9A 1X9SB 2MZCA 2OACA 2H6YA 3SWLA 6GSVA 3QD9A 4OWYA 3ZTLA 3RBTA 2M80A 2DJJA 2PN8A 3M1GA 3TKSA 1K0NA 4MDCA 1UA5A 4IBPA 2LTKA 1RW1A 4Q5QA 5D96A 4K6XA 3PINA 1CQHA 3PPUA 2F8AA 3KM6A 1SU9A 1GRXA 4I8BA 5GAPD 4XTSA 4G10A 4E8EA 2JADA 1B4QA 4HU7A 4KE3A 1A0RP 1OC9A 1K3LA 3FZ4A 3Q6OA 2KUCA 4K1FA 3FMWA 3CYNA 2VCVA 3H93A 2J23A 4YQMA 3DGQA 4ZL8A 5G2ZA 3G9BA 1VGLA 3C73A 2DSAA 3EU4A 2HSYA 1TDIA 4GSNA 5LNKe 3ME8A 1PGTA 2OKAA 2KLXA 1HNCA 4CDOA 2WCIA 3D6IA 4KA0A 2DKHA 2AHEA 2R4VA 3WGXA 2GSRA 2YWNA 4POBA 5DDLA 4PXOA 3GNJA 5ECMB 4Z2RA 1XPVA 4GWRA 5KOXA 3FR3A 2DIZA 3NIVA 1OVNA 2K9FA 2WULA 1W89A 4HU9A 5ECHB 3DVXA 3D5JA 2YP6A 3ISOA 4RI7A 5E4WA 2EIQA 1GH2A 2RM6A 4LMVA 4K8MA 1E6BA 4X43A 5EPFA 2RIIA 4ZBBA 2LRTA 3UVHA 3ZYWA 1SENA 2VCWA 1XXUA 4GCIA 3DRNA 2BJXA 4IHUA 5DQSA 3R3EA 4MPFA 3ERWA 3H8QA 5HR2A 2YWIA 5ABRA 1T4ZA 4Z2UA 4TR4A 4E8HA 2H66A 4KGIA 1BG5A 4IGJA 3ZZXA 4V2MA 2O89A 1MDKA 1K3YA 2OJLA 3BOAA 1C72A 4BVXA 1JZRA 2GVPA 2LSTA 5DALB 4ZBAA 2P0GA 4O5RA 2GT6A 3V1WA 1TP9A 1V98A 3D4TA 4EXJA 5IMFA 2I9HA 3H4KA 3HJOA 2IMKA 2LNSA 3WT2A 3FR9A 6GSYA 3VWVA 5G5EA 1K0CA 1M2DA 2G0FA 1GULA 2L6DA 5JWOB 3TDGA 2B5YA 1F3AA 4IW9A 2X8GA 5H5RA 2VL2C 2ZCTA 1QK8A 4WR5A 4ISDA 2GQLA 5DAKA 4PURA 1WMJA 4FYUA 1UVZA 3IHGA 3G7JA 4TR1A 5ECSA 3VI5A 2X49A 1M0UA 4YQUA 3WGDA 4JZQA 1U6TA 3L0HA 3KCMA 4OCFA 4EUYA 4DSSB 4GRFA 4IELA 2YV9A 3CSJA 4QL7A 4F0BA 1QXHA 5G5FA 2FWEA 4HJ2A 1S3CA 2VCZA 4ZB6A 4OCEA 1PL2A 1HD2A 3Q18A 5DCGA 3TOUA 2FHEA 1THOA 5EL8A 1PN9A 4EDZA 4QQ7A 2ALBA 3TB2A 2H01A 3WYWA 2X8CA 1FW1A 2FCHA 4O5UA 3VLNA 4K0NA 1Q98A 2C8UA 5D93A 3MDKA 1V58A 1A0FA 3BCKA 4GXZA 5ELGA 4L0WA 2XC2A 1Q4JA 3GH9A 2GZPA 1A8LA 1MD3A 3QFBC 3GA4A 3BJ5A 2DJKA 2LQQA 3DYRA 4TXOB 3ZREA 1T3BA 1Z7PA 3LW9A 2FWGA 5CRDA 2RUEA 1WPIA 4I2UA 5JCUA 4DVCA 3LYKA 4FIWA 3DIEA 2R0GA 1QFNA 1SJIA 3TJJA 3QAVA 2FWHA 3F63A 3QAGA 1XCCA 2QC7A 3TRQA 4PNGA 4Z7XA 2EIOA 3CTFA 1QQ2A 4G0IA 5ID2B 2FY6A 1SJZA 3GMFA 3GFKA 3HZ4A 4NMUA 4Z2TA 14GSA 5CYYA 3EWLA 2VO4A 4GSSA 1AQXA 1YJ6A 2IWTA 2GT5A 2WZ9A 3UBLA 5KN2A 3APOA 4XS6A 4G19A 4IKHA 3GRXA 3LXZA 6GSXA 2PPTA 4BA7A 3D22A 4MZCA 2GGTA 4BL7B 1R5AA 17GSA 2B5XA 4OO5A 3QDNA 3DKSA 2AB6A 1TU7A 2FA8A 4O92A 5EY6A 3LXTA 4IJIA 3LWAA 2TIRA 1QUWA 3D4MA 1BEDA 1GTBA 5F06A 4V2NA 4TKYA 1F37A 2H19A 2C1YA 2HRKA 3C1SA 5IQYA 4JE1A 3KMNA 4G9HA 3CRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5INY A;  3EIN A;  1ZMA A;  4BVY A;  1PSQ A;  1S3A A;  4DSQ A;  1G7O A;  1SK1 A;  2JL4 A;  2JZR A;  4XRA A;  5DVB A;  1K0M A;  3TJB A;  3FK8 A;  2V32 A;  2QSI A;  3GH6 A;  3DML A;  3TKS C;  4KCE A;  2CVD A;  2A2S A;  2C0G A;  2AAW A;  2CQ9 A;  1TI3 A;  16GS A;  2V6O A;  1AC1 A;  1PKW A;  4X0X A;  4EVM A;  1V2A A;  2CAQ A;  4OO4 A;  1BJX A;  1T8E B;  2CAI A;  2YAN A;  5CNW A;  2OAD A;  1T00 A;  3P7X A;  4FO5 A;  1O8W A;  1MDJ A;  3LOR A;  3P2A A;  2R2J A;  2H71 A;  1E2Y A;  3KIJ A;  2OA7 A;  2GDR A;  5ECK B;  4F9Z A;  2VLT A;  3GYK A;  3UBK A;  3WGE A;  3VK9 A;  2M72 A;  3MNG A;  2MMN A;  3M9J A;  3R2Q A;  3WD6 A;  2HFD A;  4TRX A;  1EGR A;  4WF4 A;  2X64 A;  2O87 A;  1WOU A;  2QKE A;  1CQG A;  2C3Q A;  1SD8 A;  1NHY A;  3CRT A;  2CX4 A;  2O85 A;  3CMI A;  4JR4 A;  4JR6 A;  1OYJ A;  2FNO A;  5G1L A;  3VFI A;  3KH7 A;  1VRS D;  2VL9 A;  3QPM A;  3VWU A;  1AQW A;  3VI7 A;  1K3O A;  4GLT A;  3U5R E;  1VF1 A;  2VCX A;  1EP7 A;  3N9J A;  4JU5 A;  5IMZ A;  5AIV A;  3FZ9 A;  4IQ1 A;  2AJQ B;  2OBK A;  1FAA A;  5DQY A;  1GUK A;  3RHB A;  2LQO A;  1A24 A;  2WGR A;  2LV3 A;  3DEX A;  1AIU A;  5D9V A;  3KTB A;  4LLR A;  4HUA A;  3FEU A;  4J57 E;  3IAM 2;  4OD7 A;  2DBC A;  5COH A;  4PNF A;  2F3M A;  3OR5 A;  3D0Z A;  2DML A;  3GTU B;  1YZX A;  2D2Z A;  2HNL A;  3VWW A;  2A2R A;  4MZW A;  3I69 A;  5DJM A;  2VD0 A;  3F4S A;  5A4V A;  5ECI B;  1Y6E A;  4KCA A;  2WRT A;  1J9B A;  1DUG A;  1F2E A;  4MJA A;  1EWX A;  2VAF A;  4MCU A;  2H74 A;  3KXO A;  3GN3 A;  2HI7 A;  1BX9 A;  5DBQ A;  1EEJ A;  4ID0 A;  3W8S A;  2H72 A;  4TR0 A;  3ZFL A;  3HA9 A;  3MWH A;  5HFK A;  3IR4 A;  1XWC A;  3IHQ A;  1PD2 1;  2GQM A;  1J0F A;  2H0I A;  4DEJ A;  4Q5F A;  3EE2 A;  3K8N A;  5DAK B;  4MPG A;  3MAK A;  5GSS A;  1GSY A;  4NHW A;  4N30 A;  3IK9 A;  1R26 A;  3WT1 A;  1DSB A;  3ZVJ A;  2DMM A;  3LGC A;  3EU3 A;  2DJ3 A;  1JZW A;  3GUR A;  3C7M A;  1M2B A;  2A4V A;  1A2L A;  1KEB A;  2ES7 A;  2CVK A;  2IMF A;  4EL1 A;  5D9T A;  2PGT A;  1F6M C;  2VL3 A;  3DWV A;  3EMP A;  3HXS A;  3HCZ A;  1ILO A;  1AW9 A;  2XPD A;  2OE1 A;  3TKP A;  5CRG A;  2PER A;  5C04 A;  1G6Y A;  2IJY A;  3O3T A;  3P90 A;  3PR8 A;  5J9C A;  5ECO B;  2RM5 A;  3FRC A;  2JSZ A;  4XS4 A;  5A5K A;  3EVI A;  3GHA A;  4HI7 A;  1YDK A;  4PUF C;  1GSQ A;  5G1K A;  2GS3 A;  1GTA A;  2I4A A;  11GS A;  2AYT A;  4XS1 A;  2WFC A;  2LEG A;  2XBI A;  3GKX A;  4L8E A;  1B8X A;  1KBN A;  2LKU A;  2YV7 A;  3TRP A;  3F8U A;  3F3R A;  2GTU A;  1B48 A;  3E3E A;  3G7I A;  3HVS A;  4TOP A;  5FWG A;  1PX7 A;  4X1U A;  4MJB A;  1GTU A;  3DVW A;  3RAZ A;  3RPP A;  4AJ6 A;  4TR3 A;  3F9U A;  5J4U A;  4EF0 A;  4IJ3 A;  1B4P A;  5ECQ B;  3L9U A;  1SKR B;  1TRV A;  4PX1 A;  4YAV A;  4GST A;  1EZK A;  1IYI A;  1F3B A;  3TJF A;  1XFL A;  2G2Q A;  1A2J A;  5ECR B;  4JED A;  4TXV A;  2JSY A;  2DJ0 A;  4MF7 A;  1M9B A;  3A2X A;  2N5B A;  1Z9H A;  2VD1 A;  3JCM L;  2ON7 A;  3KEB A;  2R3X A;  1GSD A;  5IO2 A;  2VM2 A;  2YCD A;  3ZLP A;  2K18 A;  2MBS A;  1ZGN A;  4ZIJ A;  3QAW A;  3F0I A;  3A2W A;  1GSE A;  1GWC A;  2X8H A;  2R37 A;  4HOJ A;  2HXK A;  4V1A g;  3L4N A;  2B1K A;  2R6K A;  4K9Z A;  2VCQ A;  4WXT A;  4CW9 A;  1SL0 B;  2FD3 A;  2HRN A;  4HZ4 A;  5B8B A;  3QMX A;  2KHP A;  2ON5 A;  1OAZ A;  2H1A A;  3M3M A;  1B9X C;  4LL1 B;  2HZE B;  3W6G A;  5DCH A;  1WE0 A;  4K2D A;  2YZH A;  2LJK A;  3Q19 A;  1XW5 A;  1HQO A;  4MJC A;  1O85 A;  1YY7 A;  1WP0 A;  3TCO A;  3GKK A;  3VPQ A;  2YWM A;  3GX8 A;  2H1B A;  4L0U A;  2VM1 A;  1WIK A;  3FW2 A;  2EC4 A;  5HFI A;  1XW6 A;  5KN3 A;  3BD2 A;  2I3Y A;  5KN1 A;  2OE3 A;  3TUE A;  1LJR A;  3I9V 2;  2YN1 A;  1TW9 A;  2PMT A;  3A3T A;  1TTZ A;  4ILF A;  5C00 A;  4F0C A;  3IA1 A;  1AAZ A;  3GKN A;  2XPE A;  2N5A A;  4KND A;  1XIY A;  1ZL9 A;  4MAB A;  1Y25 A;  1YKC A;  3UIW A;  3F6F A;  1EV4 A;  2F9S A;  3RPN A;  1QMV A;  1DE1 A;  4RI6 A;  1ACV A;  2M46 A;  3TJG A;  4NWY A;  4ECC A;  3LYP A;  4OFN A;  1OC8 A;  2XHF A;  3ZVJ D;  1I9D A;  1SL2 B;  3QFA C;  1JHB A;  5A4U A;  2EIR A;  4WBJ A;  2FWF A;  1AQV A;  4I5Q A;  3EMX A;  4RUV A;  4F03 A;  4IQA A;  3TOT A;  5EVO A;  1U87 A;  5D73 A;  5DAL A;  1HYU A;  2V2G A;  5LD0 A;  2B3S A;  4EO3 A;  4TN8 A;  1YQ1 A;  2CZ3 A;  1OE8 A;  2L5L A;  2B1L A;  1ML6 A;  4FYC A;  5JCW A;  3LEF A;  1GLQ A;  1TK8 B;  1Z7R A;  1AXD A;  3FR6 A;  3ZL5 A;  4F82 A;  3L78 A;  2GZY A;  1GNE A;  4HEA 2;  4ML1 A;  2K6V A;  1B9Y C;  4KH7 A;  3LQ7 A;  1FO5 A;  6GSW A;  2H70 A;  5GAN D;  5CP1 A;  1TI1 A;  2OE0 A;  3HVX A;  1TU8 A;  4PQH A;  3KH9 A;  5HR3 A;  3KZQ A;  1M2A A;  1G7E A;  1UN2 A;  4NPB A;  4N10 A;  4YAP A;  1AUC A;  4BPY A;  2DIY A;  4YQV A;  2NDO A;  1FB6 A;  4HZ2 A;  3ZMK A;  2MYG A;  2YPM A;  1A2M A;  2BMX A;  2HE3 A;  3LJR A;  3UL3 A;  4MK3 A;  4HS1 A;  4N0V A;  1NSW A;  5CAX A;  1TKD B;  5IMC A;  3L9V A;  1R5P A;  1THX A;  1FOV A;  1GTI A;  4V2L A;  1OC9 B;  3UAP A;  1JZD A;  4N0Z A;  4JBB A;  1ON4 A;  3GSS A;  3GX0 A;  4NV2 A;  3UVT A;  2LS5 A;  1EEM A;  4V1A p;  3GKM A;  1H4O A;  1TJD A;  4NHZ A;  2K8V A;  2CA8 A;  4HJM A;  2JZS A;  1H75 A;  3ERG A;  2LNT A;  1XVQ A;  2L59 A;  3KTL A;  1RK4 A;  1DE2 A;  1X5D A;  1GSS A;  3IBH A;  1XVW A;  4MF5 A;  3VUR A;  3GL5 A;  5CRW A;  1V57 A;  4EE0 A;  3FY7 A;  4PUA A;  3NZN A;  2HZF A;  2VCT A;  3ERF A;  2PWJ A;  2P31 A;  2YJH A;  4NXI A;  1PL1 A;  1BAY A;  3IDV A;  2CV4 A;  1W4V A;  2JU5 A;  4IS0 A;  1TOF A;  2GSS A;  3GUS A;  3DD3 A;  3EC3 A;  3MSZ A;  1GL8 A;  1XOB A;  13GS A;  4NV5 A;  3SBC A;  3O76 A;  3UMA A;  5AGY A;  1FB0 A;  4HDE A;  1K0O A;  5FT3 A;  4XS4 B;  1QGV A;  3QOU A;  4K0G A;  5AN1 A;  3F3Q A;  2CT6 A;  3LG6 A;  2N5F A;  4I2T A;  5FHI A;  3IV4 A;  4MJE A;  4IVF A;  3APQ A;  4ML6 A;  5H5S A;  4FH8 A;  4GQF A;  2MMO A;  5ENU A;  2HYX A;  1MDI A;  1XWB A;  2X99 A;  4LL4 B;  3F4R A;  1WRY A;  4KDU A;  5CO3 A;  3ZFB A;  3ED3 A;  4D73 A;  3HKR A;  3UEM A;  2K8S A;  3QR6 A;  3TJK A;  2GQK A;  4ZIL A;  2H1G A;  1TK0 B;  12GS A;  2LRN A;  1NHO A;  1TRW A;  1YKA A;  1XOA A;  5B6N A;  2IFQ A;  2KP1 A;  2FA4 A;  4KB3 A;  1URM A;  1X5C A;  3KJY A;  3IK7 A;  1BQ7 A;  1SD9 A;  3ZIJ A;  2JAC A;  5B6M A;  3IC4 A;  2LJA A;  2C0F A;  5F05 A;  4AF2 A;  2H73 A;  1PMT A;  4Q5N A;  1SK0 A;  5HR0 A;  1TK5 B;  2ZUP A;  1PKZ A;  1ERV A;  3TKS E;  2WDU A;  1SYX A;  1M7T A;  4IP6 A;  2AUV A;  5F8B A;  3GST A;  1K0B A;  1N8J A;  4ECJ A;  1SKS B;  5F0G A;  3S9F A;  1ST9 A;  4MF6 A;  4ULX A;  4XIH A;  3E9J B;  2YWO A;  4GQC A;  2P5R A;  1U3I A;  4G2E A;  2H6Z A;  3NOF A;  2C80 A;  1DBY A;  4ZXG A;  1YF1 A;  3LFL A;  4KSO A;  3W8J A;  3CBU A;  3F6D A;  1LBK A;  3KD0 A;  2AV4 A;  4XCS A;  2O8V B;  4TR1 B;  4WR4 A;  4KUN A;  4H86 A;  1MTC A;  4ECI A;  1O6J A;  5KEJ A;  5J5N A;  1J08 A;  1T1V A;  3H1N A;  4KDY A;  2F51 A;  2HRF A;  3AY8 A;  2VOC A;  3QCP A;  1KNG A;  1MEK A;  1O81 A;  1TRS A;  3FYG A;  1XWK A;  1N2A A;  2B5E A;  1EGO A;  2B6M A;  1O8X A;  1Z3E A;  4EC0 A;  5AIS A;  5L71 A;  2CZ2 A;  3HDC A;  2H0G A;  5F07 A;  2DLX A;  1A8Y A;  3H79 A;  2H0H A;  1PA3 A;  4PGT A;  1JLV A;  2O7K A;  4KX4 A;  3L9S A;  4GF0 A;  5KN0 A;  2GLR A;  2WS2 A;  3HHV A;  2IL3 A;  4HQZ A;  4TW5 A;  2IMD A;  4KSM A;  1EOG A;  3FHK A;  2LRC A;  4MLY A;  3HVV A;  1ERT A;  1EOH A;  4IP1 A;  1V40 A;  5IPH A;  1T7P B;  5DJL A;  4Q5R A;  4XRD A;  1YEP A;  4WKW A;  2TRX A;  3PH9 A;  5D9W A;  1NM3 A;  4CHS A;  4AGS A;  1U3A A;  1ZYE A;  1HNB A;  2TRC P;  5J3R A;  1SK2 A;  3GV1 A;  2IN3 A;  3P8W A;  2PVO C;  1XW9 A;  4J2F A;  4L5O A;  1OC3 A;  1GNW A;  5LCZ A;  5IOX A;  1SJ6 A;  2E7P A;  3IPZ A;  2C3N A;  1JLW A;  2MBT A;  2Z9S A;  4NAX A;  3ZIT A;  1V9W A;  2B7K A;  4POM A;  1ZOF A;  4MA9 A;  3RHC A;  2C0E A;  4O32 A;  2BTO T;  3GTU A;  3HJP A;  4P3Y B;  2DJ2 A;  2LJR A;  2PUK C;  5HR1 A;  1G6W A;  3N5O A;  1M9A A;  3C8E A;  3IAS 2;  1I5G A;  2HLS A;  1X9M B;  1RQM A;  4WET A;  4BWS A;  4FYB A;  1FVJ A;  2V41 A;  5B8A A;  2IIY A;  3GL3 A;  3E0U A;  4ZL7 A;  2FGX A;  20GS A;  4K7I A;  3TGZ A;  1FG4 A;  2I1U A;  5ECN B;  2IME A;  2ZNM A;  1A23 A;  2R5G A;  3I6A A;  1XWA A;  3BBY A;  5D8I A;  2LUS A;  4JRR A;  3ZML A;  5HFG A;  1SKW B;  1TRU A;  3IXR A;  4AJ7 A;  3F4T A;  6GSU A;  2QGV A;  2VIM A;  3M9K A;  5AIX A;  5IOW A;  3D21 A;  8GSS A;  1O7U A;  2GSQ A;  1GSF A;  2L5O A;  5J41 A;  3J7Y b;  2DJ1 A;  3CXG A;  4O7H A;  2YNX A;  4ZB9 A;  2J9H A;  1X9W B;  4I6X A;  4J56 E;  4POL A;  3C71 A;  5IM9 A;  2MMA A;  1ABA A;  1F9M A;  4KDX A;  5G31 A;  1MD4 A;  2DC5 A;  1M99 A;  4GTU A;  3IOS A;  3HD5 A;  5IO0 A;  4OFM A;  2C4J A;  2E2M A;  3C1R A;  4OFT A;  1NW2 A;  2KP2 A;  2H1D A;  3ME7 A;  3VWX A;  2YOI A;  4LMW A;  2NVL A;  10GS A;  4PQ1 A;  3LSZ A;  3HY2 A;  3FKF A;  2VLU A;  2L4Q A;  4EDY A;  4I97 A;  2H75 A;  3A5W A;  3G7Y A;  2C0D A;  3J7Y k;  4EKZ A;  5JWQ B;  3UAR A;  1EV9 A;  1VF4 A;  5E59 A;  5ECP B;  1GSU A;  3CSI A;  2E2G A;  2L4C A;  2E0Q A;  2IPA A;  3M0F A;  1R7H A;  4MH3 A;  3GIX A;  3US3 A;  2NTO A;  1XWG A;  2V6K A;  5IMA A;  2L6C A;  4K7O A;  1SL1 B;  1VF2 A;  5JCG A;  2HT9 A;  4WBR D;  2GST A;  5GZZ B;  2H76 A;  4TVE A;  2F8F A;  2HSH A;  1GLP A;  5G30 A;  1KTE A;  2VL2 A;  2YJ7 A;  4POK A;  2PVQ A;  3TRX A;  1XBS A;  4KAE A;  5IPG A;  2XBQ A;  1K0A A;  2VLV A;  4RQR A;  1JZO A;  4XHM A;  1PQN A;  4ZB8 A;  4WEY A;  4D73 B;  1WJK A;  2P5Q A;  1FHE A;  1K0D A;  2RUF A;  3BCI A;  1T4Y A;  1WWJ A;  3RDW A;  4ZBD A;  2H6X A;  2IFQ B;  5ELA A;  4L5L A;  5JWR B;  1ZCP A;  2H8L A;  1VF3 A;  1TXX A;  4HQS A;  3KP8 A;  3APS A;  3DXB A;  4IN0 A;  2YZU A;  1ZZY A;  4DSS A;  1ERW A;  6GST A;  2FUG 2;  2H30 A;  3A2V A;  5CRH A;  2HZE A;  5J9B A;  3PGT A;  1X5E A;  2RLI A;  2I81 A;  4KW6 A;  3FZA A;  2IMI A;  3I43 A;  18GS A;  2CVB A;  4MP4 A;  2WB9 A;  5ECL B;  2JZT A;  3ZRD A;  1S3D A;  3EYT A;  3CSH A;  5IMV A;  3TKQ A;  4PQI A;  1XZO A;  4MMM A;  4AJ8 A;  1G0T A;  1SYR A;  9GSS A;  4F2I A;  3ZIV A;  2V1M A;  5HQP A;  4YH2 A;  5B7C A;  4MH2 A;  1USB A;  5D9X A;  5IIZ A;  1OKD A;  4ZL9 A;  2MMZ A;  3KGK A;  1UC7 A;  3KMO A;  1YF0 A;  1Z6N A;  3FZ5 A;  1Z6M A;  2C3T A;  4LA1 A;  2CX3 A;  1X0R A;  1LU4 A;  4TXO A;  1EP8 A;  4BWQ A;  1FVK A;  2B7J A;  1YEX A;  3O6T A;  7GSS A;  1ERU A;  1GP1 A;  1OE7 A;  4ECB A;  2WJU A;  5H5Q A;  1GUH A;  3HYP A;  3UOM A;  1BYE A;  1PX6 A;  1GUM A;  1ZYQ B;  1IYH A;  2VUP A;  4K7N A;  2PU9 C;  4DSR A;  5A4W A;  5ID2 A;  2FLS A;  2NBS A;  4RQX A;  3Q74 A;  3U6V A;  3CTG A;  1O73 A;  3TKR A;  5IMD A;  4QL9 A;  2GZZ A;  3UJ1 A;  3IRA A;  4N11 A;  19GS A;  4MZB A;  2L57 A;  3IE3 A;  1U88 A;  3HJM A;  1OKT A;  2PBJ A;  1PRX A;  3M8N A;  1R4W A;  4WF5 A;  5GST A;  1JFU A;  2NPB A;  2OBI A;  2REM A;  3HZ8 A;  2KOK A;  3EUR A;  6GSS A;  22GS A;  4ACS A;  4OMV A;  1Z5Y E;  1HNA A;  5CRE A;  4BL7 A;  3VPT A;  3KP9 A;  1X9S B;  2MZC A;  2OAC A;  2H6Y A;  3SWL A;  6GSV A;  3QD9 A;  4OWY A;  3ZTL A;  3RBT A;  2M80 A;  2DJJ A;  2PN8 A;  3M1G A;  3TKS A;  1K0N A;  4MDC A;  1UA5 A;  4IBP A;  2LTK A;  1RW1 A;  4Q5Q A;  5D96 A;  4K6X A;  3PIN A;  1CQH A;  2F8A A;  3KM6 A;  1SU9 A;  1GRX A;  4I8B A;  5GAP D;  4XTS A;  4G10 A;  4E8E A;  2JAD A;  1B4Q A;  4HU7 A;  4KE3 A;  1A0R P;  1OC9 A;  1K3L A;  3FZ4 A;  3Q6O A;  2KUC A;  4K1F A;  3CYN A;  2VCV A;  3H93 A;  2J23 A;  4YQM A;  3DGQ A;  4ZL8 A;  5G2Z A;  3G9B A;  1VGL A;  3C73 A;  2DSA A;  3EU4 A;  2HSY A;  1TDI A;  4GSN A;  5LNK e;  3ME8 A;  1PGT A;  2OKA A;  2KLX A;  1HNC A;  4CDO A;  2WCI A;  3D6I A;  4KA0 A;  2AHE A;  2R4V A;  3WGX A;  2GSR A;  2YWN A;  4POB A;  5DDL A;  4PXO A;  3GNJ A;  5ECM B;  1XPV A;  4GWR A;  3FR3 A;  2DIZ A;  3NIV A;  1OVN A;  2K9F A;  2WUL A;  1W89 A;  4HU9 A;  5ECH B;  3DVX A;  3D5J A;  2YP6 A;  3ISO A;  4RI7 A;  5E4W A;  2EIQ A;  1GH2 A;  2RM6 A;  4LMV A;  4K8M A;  1E6B A;  4X43 A;  5EPF A;  2RII A;  4ZBB A;  2LRT A;  3UVH A;  3ZYW A;  1SEN A;  2VCW A;  1XXU A;  4GCI A;  3DRN A;  2BJX A;  4IHU A;  5DQS A;  4MPF A;  3ERW A;  3H8Q A;  5HR2 A;  2YWI A;  5ABR A;  1T4Z A;  4TR4 A;  4E8H A;  2H66 A;  4KGI A;  1BG5 A;  4IGJ A;  3ZZX A;  4V2M A;  2O89 A;  1MDK A;  1K3Y A;  2OJL A;  3BOA A;  1C72 A;  4BVX A;  1JZR A;  2GVP A;  2LST A;  5DAL B;  4ZBA A;  2P0G A;  4O5R A;  2GT6 A;  3V1W A;  1TP9 A;  1V98 A;  3D4T A;  4EXJ A;  5IMF A;  2I9H A;  3H4K A;  3HJO A;  2IMK A;  2LNS A;  3WT2 A;  3FR9 A;  6GSY A;  3VWV A;  5G5E A;  1K0C A;  1M2D A;  2G0F A;  1GUL A;  2L6D A;  5JWO B;  3TDG A;  2B5Y A;  1F3A A;  4IW9 A;  2X8G A;  5H5R A;  2VL2 C;  2ZCT A;  1QK8 A;  4WR5 A;  4ISD A;  2GQL A;  5DAK A;  4PUR A;  1WMJ A;  4FYU A;  1UVZ A;  5ECS A;  3G7J A;  4TR1 A;  3VI5 A;  1M0U A;  4YQU A;  3WGD A;  4JZQ A;  1U6T A;  3L0H A;  3KCM A;  4OCF A;  4EUY A;  4DSS B;  4GRF A;  4IEL A;  2YV9 A;  3CSJ A;  4QL7 A;  4F0B A;  1QXH A;  5G5F A;  2FWE A;  4HJ2 A;  1S3C A;  2VCZ A;  4ZB6 A;  4OCE A;  1PL2 A;  1HD2 A;  3Q18 A;  5DCG A;  3TOU A;  2FHE A;  1THO A;  5EL8 A;  1PN9 A;  4EDZ A;  4QQ7 A;  2ALB A;  3TB2 A;  2H01 A;  3WYW A;  2X8C A;  1FW1 A;  2FCH A;  3VLN A;  4K0N A;  1Q98 A;  2C8U A;  5D93 A;  3MDK A;  1V58 A;  1A0F A;  3BCK A;  4GXZ A;  5ELG A;  4L0W A;  2XC2 A;  1Q4J A;  3GH9 A;  2GZP A;  1A8L A;  1MD3 A;  3QFB C;  3GA4 A;  3BJ5 A;  2DJK A;  2LQQ A;  3DYR A;  4TXO B;  3ZRE A;  1T3B A;  1Z7P A;  2FWG A;  5CRD A;  2RUE A;  1WPI A;  4I2U A;  5JCU A;  4DVC A;  3LYK A;  4FIW A;  3DIE A;  1QFN A;  1SJI A;  3TJJ A;  3QAV A;  2FWH A;  3F63 A;  3QAG A;  1XCC A;  2QC7 A;  3TRQ A;  4PNG A;  4Z7X A;  2EIO A;  3CTF A;  1QQ2 A;  5ID2 B;  2FY6 A;  1SJZ A;  3GMF A;  3GFK A;  3HZ4 A;  4NMU A;  14GS A;  5CYY A;  3EWL A;  2VO4 A;  4GSS A;  1AQX A;  1YJ6 A;  2IWT A;  2GT5 A;  2WZ9 A;  3UBL A;  5KN2 A;  3APO A;  4XS6 A;  4G19 A;  4IKH A;  3GRX A;  3LXZ A;  6GSX A;  2PPT A;  4BA7 A;  3D22 A;  4MZC A;  2GGT A;  1R5A A;  17GS A;  2B5X A;  4OO5 A;  3QDN A;  3DKS A;  2AB6 A;  1TU7 A;  2FA8 A;  4O92 A;  5EY6 A;  3LXT A;  4IJI A;  3LWA A;  2TIR A;  1QUW A;  3D4M A;  1BED A;  1GTB A;  5F06 A;  4V2N A;  4TKY A;  1F37 A;  2H19 A;  2C1Y A;  3C1S A;  5IQY A;  4JE1 A;  3KMN A;  4G9H A;  3CRU A; 
#chains in the Genus database with same CATH topology
 5INY A;  3EIN A;  1ZMA A;  4BVY A;  1PSQ A;  1S3A A;  4DSQ A;  1G7O A;  1SK1 A;  2JL4 A;  2JZR A;  4XRA A;  5DVB A;  1K0M A;  3TJB A;  3FK8 A;  2V32 A;  2QSI A;  3GH6 A;  3DML A;  3TKS C;  4KCE A;  2CVD A;  2A2S A;  2C0G A;  2AAW A;  2CQ9 A;  1TI3 A;  3EPT A;  16GS A;  2V6O A;  1AC1 A;  1PKW A;  4X0X A;  4EVM A;  1V2A A;  2CAQ A;  4OO4 A;  1BJX A;  1T8E B;  2CAI A;  2YAN A;  5CNW A;  2OAD A;  1PFO A;  1T00 A;  3P7X A;  4FO5 A;  1O8W A;  1MDJ A;  3LOR A;  3P2A A;  2R2J A;  1FOH A;  4O5Q A;  2H71 A;  1E2Y A;  3KIJ A;  2OA7 A;  2GDR A;  5ECK B;  4F9Z A;  2VLT A;  3GYK A;  3UBK A;  3WGE A;  1ZYP A;  3VK9 A;  2M72 A;  3MNG A;  2MMN A;  1M3J A;  3M9J A;  3R2Q A;  3WD6 A;  2HFD A;  4TRX A;  1EGR A;  4WF4 A;  2X64 A;  2O87 A;  1WOU A;  2QKE A;  1CQG A;  2C3Q A;  1SD8 A;  1NHY A;  3CRT A;  2CX4 A;  2O85 A;  3CMI A;  4JR4 A;  4JR6 A;  1OYJ A;  2FNO A;  5G1L A;  3VFI A;  3KH7 A;  1VRS D;  2VL9 A;  3QPM A;  3VWU A;  1AQW A;  3VI7 A;  1K3O A;  4GLT A;  3U5R E;  1VF1 A;  2VCX A;  1EP7 A;  3N9J A;  4JU5 A;  5IMZ A;  5AIV A;  3FZ9 A;  4IQ1 A;  2AJQ B;  2OBK A;  1FAA A;  5DQY A;  1GUK A;  3RHB A;  2LQO A;  1A24 A;  2WGR A;  2LV3 A;  3DEX A;  1AIU A;  5D9V A;  4PTS A;  3KTB A;  4LLR A;  4HUA A;  3FEU A;  4J57 E;  3IAM 2;  4OD7 A;  2DBC A;  5COH A;  4PNF A;  2F3M A;  3OR5 A;  3D0Z A;  2DML A;  3GTU B;  1YZX A;  2D2Z A;  2HNL A;  3VWW A;  2A2R A;  4MZW A;  3I69 A;  5DJM A;  2VD0 A;  3F4S A;  5A4V A;  5ECI B;  1Y6E A;  4KCA A;  2WRT A;  1J9B A;  1DUG A;  1F2E A;  4MJA A;  1EWX A;  2VAF A;  4MCU A;  2H74 A;  3KXO A;  3GN3 A;  2HI7 A;  2HRA A;  1BX9 A;  5DBQ A;  5BRT A;  1EEJ A;  4ID0 A;  3W8S A;  2H72 A;  4TR0 A;  3ZFL A;  3HA9 A;  3MWH A;  5HFK A;  3IR4 A;  1XWC A;  3IHQ A;  1PD2 1;  2GQM A;  1J0F A;  2H0I A;  4DEJ A;  4Q5F A;  3EE2 A;  3K8N A;  5DAK B;  4MPG A;  3MAK A;  5GSS A;  1GSY A;  4NHW A;  4N30 A;  3IK9 A;  1R26 A;  3WT1 A;  1DSB A;  3ZVJ A;  2DMM A;  3LGC A;  3EU3 A;  2DJ3 A;  1JZW A;  3GUR A;  3C7M A;  1M2B A;  2A4V A;  1A2L A;  3IC8 A;  1KEB A;  2ES7 A;  2CVK A;  2IMF A;  4EL1 A;  5D9T A;  2PGT A;  1F6M C;  2VL3 A;  3DWV A;  3EMP A;  3HXS A;  3HCZ A;  1ILO A;  1AW9 A;  2XPD A;  2OE1 A;  3TKP A;  5CRG A;  2PER A;  5C04 A;  1G6Y A;  2IJY A;  3O3T A;  3P90 A;  3PR8 A;  5J9C A;  5ECO B;  2RM5 A;  3FRC A;  2JSZ A;  4XS4 A;  5A5K A;  3EVI A;  3GHA A;  4HI7 A;  1YDK A;  4PUF C;  1GSQ A;  5G1K A;  2GS3 A;  1GTA A;  2I4A A;  11GS A;  4ICY A;  2AYT A;  4XS1 A;  2WFC A;  2LEG A;  2XBI A;  3GKX A;  4L8E A;  1B8X A;  1KBN A;  2LKU A;  2YV7 A;  3TRP A;  3F8U A;  3F3R A;  2GTU A;  1B48 A;  3E3E A;  3G7I A;  3HVS A;  4TOP A;  5FWG A;  1PX7 A;  4X1U A;  4MJB A;  1GTU A;  3DVW A;  3RAZ A;  3RPP A;  4AJ6 A;  4TR3 A;  3F9U A;  3MYD A;  5J4U A;  4EF0 A;  4IJ3 A;  1B4P A;  5ECQ B;  3L9U A;  1SKR B;  1TRV A;  4PX1 A;  4YAV A;  4GST A;  1EZK A;  1IYI A;  1F3B A;  3TJF A;  1XFL A;  2G2Q A;  1A2J A;  5ECR B;  4JED A;  4TXV A;  2JSY A;  2DJ0 A;  4MF7 A;  1M9B A;  3A2X A;  2N5B A;  1Z9H A;  2VD1 A;  3JCM L;  2ON7 A;  3KEB A;  2R3X A;  1GSD A;  5IO2 A;  2VM2 A;  2YCD A;  3ZLP A;  2K18 A;  2MBS A;  1ZGN A;  4ZIJ A;  3QAW A;  3F0I A;  1PN0 A;  3A2W A;  1GSE A;  1GWC A;  2X8H A;  2R37 A;  4HOJ A;  2HXK A;  4V1A g;  3L4N A;  2B1K A;  2R6K A;  4K9Z A;  2VCQ A;  4WXT A;  4CW9 A;  4BIK A;  1SL0 B;  2FD3 A;  2HRN A;  4HZ4 A;  5B8B A;  3QMX A;  2KHP A;  2ON5 A;  1OAZ A;  2H1A A;  4BVY B;  3M3M A;  1B9X C;  4LL1 B;  2HZE B;  3W6G A;  5DCH A;  1WE0 A;  4K2D A;  2YZH A;  2LJK A;  3Q19 A;  1XW5 A;  1HQO A;  4MJC A;  1O85 A;  1YY7 A;  1WP0 A;  3TCO A;  3GKK A;  3VPQ A;  2YWM A;  3GX8 A;  2H1B A;  4L0U A;  2VM1 A;  1WIK A;  4CY8 A;  3FW2 A;  2EC4 A;  5HFI A;  1XW6 A;  5KN3 A;  3BD2 A;  2I3Y A;  4USS A;  5KN1 A;  2OE3 A;  3TUE A;  1LJR A;  3I9V 2;  2YN1 A;  1TW9 A;  2PMT A;  3A3T A;  1TTZ A;  4ILF A;  5C00 A;  4F0C A;  3IA1 A;  1AAZ A;  3GKN A;  2XPE A;  2N5A A;  4KND A;  1XIY A;  1ZL9 A;  4MAB A;  2QA2 A;  1Y25 A;  1YKC A;  1XG8 A;  3UIW A;  3F6F A;  1EV4 A;  2F9S A;  3RPN A;  1QMV A;  1DE1 A;  4RI6 A;  1ACV A;  2M46 A;  3TJG A;  4YKF A;  4NWY A;  4ECC A;  3LYP A;  4OFN A;  1OC8 A;  2XHF A;  3ZVJ D;  1I9D A;  1SL2 B;  3QFA C;  1JHB A;  5A4U A;  2EIR A;  4WBJ A;  2FWF A;  4CY6 A;  1AQV A;  4I5Q A;  3EMX A;  4RUV A;  4F03 A;  4IQA A;  3TOT A;  5EVO A;  1U87 A;  5D73 A;  5DAL A;  1HYU A;  2V2G A;  5LD0 A;  2B3S A;  4EO3 A;  4TN8 A;  1YQ1 A;  2CZ3 A;  1OE8 A;  2L5L A;  2B1L A;  1ML6 A;  4FYC A;  5JCW A;  3LEF A;  1GLQ A;  1TK8 B;  1Z7R A;  1AXD A;  3FR6 A;  3ZL5 A;  4F82 A;  3L78 A;  2GZY A;  1GNE A;  4HEA 2;  4ML1 A;  2K6V A;  1B9Y C;  4KH7 A;  3LQ7 A;  1FO5 A;  6GSW A;  2H70 A;  5GAN D;  5CP1 A;  1TI1 A;  2OE0 A;  3HVX A;  1TU8 A;  4PQH A;  3KH9 A;  5HR3 A;  3KZQ A;  1M2A A;  1G7E A;  1UN2 A;  4NPB A;  4N10 A;  4YAP A;  1AUC A;  4BPY A;  2DIY A;  4YQV A;  2NDO A;  1FB6 A;  4HZ2 A;  3ZMK A;  2MYG A;  2YPM A;  1A2M A;  2BMX A;  2HE3 A;  3LJR A;  3UL3 A;  4MK3 A;  4HS1 A;  4N0V A;  1NSW A;  5CAX A;  1TKD B;  5IMC A;  3L9V A;  1R5P A;  1THX A;  1FOV A;  1GTI A;  4V2L A;  2R0C A;  1OC9 B;  3UAP A;  2QA1 A;  1JZD A;  4N0Z A;  4JBB A;  1ON4 A;  3GSS A;  3GX0 A;  4NV2 A;  3UVT A;  2LS5 A;  1EEM A;  4V1A p;  4K5R A;  3GKM A;  1H4O A;  1TJD A;  4NHZ A;  2K8V A;  2CA8 A;  4HJM A;  2JZS A;  1H75 A;  3ERG A;  2LNT A;  1XVQ A;  2L59 A;  3KTL A;  1RK4 A;  1DE2 A;  1X5D A;  1GSS A;  3IBH A;  1XVW A;  4MF5 A;  3VUR A;  3GL5 A;  5CRW A;  1V57 A;  4EE0 A;  3FY7 A;  4PUA A;  3NZN A;  2HZF A;  2VCT A;  3ERF A;  2PWJ A;  2P31 A;  2YJH A;  4NXI A;  1PL1 A;  1BAY A;  3IDV A;  2CV4 A;  1W4V A;  2JU5 A;  4IS0 A;  1TOF A;  2GSS A;  3GUS A;  3DD3 A;  3EC3 A;  3MSZ A;  1GL8 A;  1XOB A;  13GS A;  4NV5 A;  3SBC A;  3O76 A;  3UMA A;  5AGY A;  1FB0 A;  4HDE A;  1K0O A;  5FT3 A;  4XS4 B;  1QGV A;  3QOU A;  4K0G A;  5AN1 A;  3F3Q A;  2CT6 A;  3LG6 A;  2N5F A;  2X4A A;  4I2T A;  4K5S A;  5FHI A;  3IV4 A;  4MJE A;  4IVF A;  3APQ A;  4ML6 A;  5H5S A;  4FH8 A;  4GQF A;  2MMO A;  5ENU A;  2HYX A;  1MDI A;  1XWB A;  2X99 A;  4LL4 B;  3F4R A;  1WRY A;  4KDU A;  5CO3 A;  3ZFB A;  3ED3 A;  4D73 A;  3HKR A;  3UEM A;  2K8S A;  3QR6 A;  3TJK A;  2GQK A;  4ZIL A;  2H1G A;  1TK0 B;  12GS A;  4BVX B;  2LRN A;  1NHO A;  1TRW A;  1YKA A;  1XOA A;  5B6N A;  2IFQ A;  2KP1 A;  2FA4 A;  4KB3 A;  1URM A;  1X5C A;  3KJY A;  3IK7 A;  1BQ7 A;  1SD9 A;  3ZIJ A;  2JAC A;  5B6M A;  3IC4 A;  2HSM A;  2LJA A;  2C0F A;  5F05 A;  4AF2 A;  5BMU A;  2H73 A;  1PMT A;  4Q5N A;  1SK0 A;  5HR0 A;  1TK5 B;  2ZUP A;  1PKZ A;  1ERV A;  3TKS E;  2WDU A;  1SYX A;  1M7T A;  4IP6 A;  2AUV A;  5F8B A;  3GST A;  1K0B A;  1N8J A;  4ECJ A;  1SKS B;  5F0G A;  3S9F A;  1ST9 A;  4MF6 A;  4ULX A;  4XIH A;  3E9J B;  2YWO A;  4GQC A;  2P5R A;  1U3I A;  4G2E A;  2H6Z A;  3NOF A;  2C80 A;  1DBY A;  4ZXG A;  1YF1 A;  3LFL A;  4KSO A;  3W8J A;  3CBU A;  3A5I A;  3F6D A;  1LBK A;  3KD0 A;  2AV4 A;  4XCS A;  2O8V B;  4TR1 B;  4WR4 A;  4KUN A;  4H86 A;  1MTC A;  4ECI A;  1O6J A;  5KEJ A;  5J5N A;  1J08 A;  1T1V A;  3H1N A;  4KDY A;  2F51 A;  2HRF A;  3AY8 A;  2VOC A;  3QCP A;  1KNG A;  1MEK A;  1O81 A;  1TRS A;  3FYG A;  1XWK A;  1N2A A;  2B5E A;  1EGO A;  2B6M A;  1O8X A;  1Z3E A;  4EC0 A;  5AIS A;  5L71 A;  1M3I A;  2CZ2 A;  3HDC A;  2H0G A;  5F07 A;  2DLX A;  1A8Y A;  3H79 A;  2H0H A;  1PA3 A;  4PGT A;  1JLV A;  2O7K A;  4KX4 A;  3L9S A;  4GF0 A;  5KN0 A;  2GLR A;  2WS2 A;  3HHV A;  2IL3 A;  4HQZ A;  4TW5 A;  2IMD A;  4KSM A;  1EOG A;  3FHK A;  2LRC A;  4MLY A;  3HVV A;  1ERT A;  1EOH A;  4IP1 A;  4G0K A;  4MNN A;  1V40 A;  5IPH A;  1T7P B;  5DJL A;  4Q5R A;  4XRD A;  1YEP A;  4WKW A;  2TRX A;  3PH9 A;  5D9W A;  1NM3 A;  4CHS A;  4AGS A;  1U3A A;  1ZYE A;  1HNB A;  2TRC P;  5J3R A;  1SK2 A;  3GV1 A;  2IN3 A;  3P8W A;  2PVO C;  1XW9 A;  4J2F A;  4L5O A;  1OC3 A;  1GNW A;  5LCZ A;  5IOX A;  1SJ6 A;  2E7P A;  3IPZ A;  2C3N A;  1JLW A;  2MBT A;  2Z9S A;  4NAX A;  3ZIT A;  1V9W A;  4X4J A;  2B7K A;  4POM A;  1ZOF A;  4MA9 A;  3RHC A;  2C0E A;  4O32 A;  2BTO T;  3GTU A;  3HJP A;  4P3Y B;  2DJ2 A;  2LJR A;  2PUK C;  5HR1 A;  1G6W A;  3N5O A;  1M9A A;  3C8E A;  3IAS 2;  1I5G A;  2HLS A;  1X9M B;  1RQM A;  4WET A;  4BWS A;  4FYB A;  1FVJ A;  2V41 A;  5B8A A;  2IIY A;  3GL3 A;  3E0U A;  4ZL7 A;  2FGX A;  20GS A;  4K7I A;  3TGZ A;  1FG4 A;  2I1U A;  5ECN B;  2IME A;  2ZNM A;  1A23 A;  2R5G A;  3I6A A;  1XWA A;  3BBY A;  5D8I A;  2LUS A;  4JRR A;  3CQF A;  3ZML A;  5HFG A;  1SKW B;  1TRU A;  3IXR A;  4AJ7 A;  3F4T A;  6GSU A;  2QGV A;  2VIM A;  3M9K A;  3HVN A;  5AIX A;  5IOW A;  3D21 A;  8GSS A;  1O7U A;  2GSQ A;  1GSF A;  2L5O A;  5J41 A;  3J7Y b;  2DJ1 A;  3CXG A;  4O7H A;  2YNX A;  4ZB9 A;  4FQU A;  2J9H A;  1X9W B;  4I6X A;  4J56 E;  4POL A;  3C71 A;  5IM9 A;  2MMA A;  1ABA A;  1F9M A;  4KDX A;  5G31 A;  1MD4 A;  2DC5 A;  1M99 A;  4GTU A;  3IOS A;  3HD5 A;  5IO0 A;  4OFM A;  2C4J A;  2E2M A;  3C1R A;  4OFT A;  1NW2 A;  2KP2 A;  2H1D A;  3ME7 A;  3VWX A;  2YOI A;  4LMW A;  2NVL A;  10GS A;  4PQ1 A;  3LSZ A;  5KOW A;  3HY2 A;  3FKF A;  2VLU A;  2L4Q A;  4EDY A;  4I97 A;  2H75 A;  3A5W A;  3G7Y A;  2C0D A;  3J7Y k;  1S3R A;  4EIP A;  4EKZ A;  3MIX A;  5JWQ B;  2A4H A;  3UAR A;  1EV9 A;  1VF4 A;  5E59 A;  5ECP B;  1GSU A;  3CSI A;  2E2G A;  2L4C A;  2E0Q A;  2IPA A;  3M0F A;  1R7H A;  4MH3 A;  3GIX A;  3US3 A;  2NTO A;  1XWG A;  2V6K A;  5IMA A;  2L6C A;  4K7O A;  1SL1 B;  1VF2 A;  5JCG A;  2HT9 A;  4WBR D;  2GST A;  5GZZ B;  2H76 A;  4TVE A;  2F8F A;  2HSH A;  1GLP A;  5G30 A;  4YKG A;  1KTE A;  2VL2 A;  2YJ7 A;  4POK A;  2PVQ A;  3TRX A;  1XBS A;  4EIQ A;  4KAE A;  5IPG A;  2XBQ A;  1K0A A;  2VLV A;  4RQR A;  1JZO A;  4XHM A;  1PQN A;  4ZB8 A;  4WEY A;  4D73 B;  1WJK A;  2P5Q A;  1FHE A;  1K0D A;  2RUF A;  3BCI A;  1T4Y A;  1WWJ A;  3RDW A;  4ZBD A;  2H6X A;  2IFQ B;  5ELA A;  4L5L A;  5JWR B;  1ZCP A;  2H8L A;  1VF3 A;  1TXX A;  4HQS A;  3KP8 A;  3APS A;  3DXB A;  4IN0 A;  2YZU A;  1ZZY A;  1ZYN A;  4DSS A;  1ERW A;  6GST A;  2FUG 2;  2H30 A;  3A2V A;  5CRH A;  2HZE A;  5J9B A;  3PGT A;  1X5E A;  2RLI A;  2I81 A;  4KW6 A;  3FZA A;  2IMI A;  3I43 A;  18GS A;  2CVB A;  4MP4 A;  2WB9 A;  5ECL B;  2JZT A;  3ZRD A;  1S3D A;  3EYT A;  3CSH A;  5IMV A;  3TKQ A;  4PQI A;  1XZO A;  4HSC X;  4MMM A;  4AJ8 A;  1G0T A;  1SYR A;  9GSS A;  4F2I A;  3ZIV A;  2V1M A;  5HQP A;  4YH2 A;  5B7C A;  4MH2 A;  1USB A;  5D9X A;  5IIZ A;  1OKD A;  4ZL9 A;  2MMZ A;  2DKI A;  3KGK A;  1UC7 A;  3KMO A;  1YF0 A;  1Z6N A;  3FZ5 A;  1Z6M A;  2C3T A;  4LA1 A;  2CX3 A;  2UZ8 A;  1X0R A;  1LU4 A;  4TXO A;  1EP8 A;  4BWQ A;  1FVK A;  2B7J A;  2R0P A;  1YEX A;  3O6T A;  7GSS A;  1ERU A;  1GP1 A;  1OE7 A;  4ECB A;  2WJU A;  5H5Q A;  1GUH A;  3HYP A;  3UOM A;  1BYE A;  1PX6 A;  1GUM A;  1ZYQ B;  1IYH A;  2VUP A;  4K7N A;  2PU9 C;  2A2P A;  4DSR A;  5A4W A;  5ID2 A;  2FLS A;  2NBS A;  4RQX A;  3Q74 A;  3U6V A;  3CTG A;  1O73 A;  3TKR A;  5IMD A;  4QL9 A;  4A5P A;  2GZZ A;  3UJ1 A;  3IRA A;  4N11 A;  19GS A;  4MZB A;  2L57 A;  3IE3 A;  1U88 A;  3HJM A;  1OKT A;  4KF9 A;  4G0L A;  2PBJ A;  4K2X A;  1PRX A;  3M8N A;  1R4W A;  4WF5 A;  5GST A;  1JFU A;  2NPB A;  2OBI A;  2REM A;  3HZ8 A;  2KOK A;  3EUR A;  6GSS A;  22GS A;  4ACS A;  4OMV A;  1Z5Y E;  1HNA A;  5CRE A;  4BL7 A;  3VPT A;  3KP9 A;  1X9S B;  2MZC A;  2OAC A;  2H6Y A;  3SWL A;  6GSV A;  3QD9 A;  4OWY A;  3ZTL A;  3RBT A;  2M80 A;  2DJJ A;  2PN8 A;  3M1G A;  3TKS A;  1K0N A;  4MDC A;  1UA5 A;  4IBP A;  2LTK A;  1RW1 A;  4Q5Q A;  5D96 A;  4K6X A;  3PIN A;  1CQH A;  3PPU A;  2F8A A;  3KM6 A;  1SU9 A;  1GRX A;  4I8B A;  5GAP D;  4XTS A;  4G10 A;  4E8E A;  2JAD A;  1B4Q A;  4HU7 A;  4KE3 A;  1A0R P;  1OC9 A;  1K3L A;  3FZ4 A;  3Q6O A;  2KUC A;  4K1F A;  3FMW A;  3CYN A;  2VCV A;  3H93 A;  2J23 A;  4YQM A;  3DGQ A;  4ZL8 A;  5G2Z A;  3G9B A;  1VGL A;  3C73 A;  2DSA A;  3EU4 A;  2HSY A;  1TDI A;  4GSN A;  5LNK e;  3ME8 A;  1PGT A;  2OKA A;  2KLX A;  1HNC A;  4CDO A;  2WCI A;  3D6I A;  4KA0 A;  2DKH A;  2AHE A;  2R4V A;  3WGX A;  2GSR A;  2YWN A;  4POB A;  5DDL A;  4PXO A;  3GNJ A;  5ECM B;  4Z2R A;  1XPV A;  4GWR A;  5KOX A;  3FR3 A;  2DIZ A;  3NIV A;  1OVN A;  2K9F A;  2WUL A;  1W89 A;  4HU9 A;  5ECH B;  3DVX A;  3D5J A;  2YP6 A;  3ISO A;  4RI7 A;  5E4W A;  2EIQ A;  1GH2 A;  2RM6 A;  4LMV A;  4K8M A;  1E6B A;  4X43 A;  5EPF A;  2RII A;  4ZBB A;  2LRT A;  3UVH A;  3ZYW A;  1SEN A;  2VCW A;  1XXU A;  4GCI A;  3DRN A;  2BJX A;  4IHU A;  5DQS A;  3R3E A;  4MPF A;  3ERW A;  3H8Q A;  5HR2 A;  2YWI A;  5ABR A;  1T4Z A;  4Z2U A;  4TR4 A;  4E8H A;  2H66 A;  4KGI A;  1BG5 A;  4IGJ A;  3ZZX A;  4V2M A;  2O89 A;  1MDK A;  1K3Y A;  2OJL A;  3BOA A;  1C72 A;  4BVX A;  1JZR A;  2GVP A;  2LST A;  5DAL B;  4ZBA A;  2P0G A;  4O5R A;  2GT6 A;  3V1W A;  1TP9 A;  1V98 A;  3D4T A;  4EXJ A;  5IMF A;  2I9H A;  3H4K A;  3HJO A;  2IMK A;  2LNS A;  3WT2 A;  3FR9 A;  6GSY A;  3VWV A;  5G5E A;  1K0C A;  1M2D A;  2G0F A;  1GUL A;  2L6D A;  5JWO B;  3TDG A;  2B5Y A;  1F3A A;  4IW9 A;  2X8G A;  5H5R A;  2VL2 C;  2ZCT A;  1QK8 A;  4WR5 A;  4ISD A;  2GQL A;  5DAK A;  4PUR A;  1WMJ A;  4FYU A;  1UVZ A;  3IHG A;  3G7J A;  4TR1 A;  5ECS A;  3VI5 A;  2X49 A;  1M0U A;  4YQU A;  3WGD A;  4JZQ A;  1U6T A;  3L0H A;  3KCM A;  4OCF A;  4EUY A;  4DSS B;  4GRF A;  4IEL A;  2YV9 A;  3CSJ A;  4QL7 A;  4F0B A;  1QXH A;  5G5F A;  2FWE A;  4HJ2 A;  1S3C A;  2VCZ A;  4ZB6 A;  4OCE A;  1PL2 A;  1HD2 A;  3Q18 A;  5DCG A;  3TOU A;  2FHE A;  1THO A;  5EL8 A;  1PN9 A;  4EDZ A;  4QQ7 A;  2ALB A;  3TB2 A;  2H01 A;  3WYW A;  2X8C A;  1FW1 A;  2FCH A;  4O5U A;  3VLN A;  4K0N A;  1Q98 A;  2C8U A;  5D93 A;  3MDK A;  1V58 A;  1A0F A;  3BCK A;  4GXZ A;  5ELG A;  4L0W A;  2XC2 A;  1Q4J A;  3GH9 A;  2GZP A;  1A8L A;  1MD3 A;  3QFB C;  3GA4 A;  3BJ5 A;  2DJK A;  2LQQ A;  3DYR A;  4TXO B;  3ZRE A;  1T3B A;  1Z7P A;  3LW9 A;  2FWG A;  5CRD A;  2RUE A;  1WPI A;  4I2U A;  5JCU A;  4DVC A;  3LYK A;  4FIW A;  3DIE A;  2R0G A;  1QFN A;  1SJI A;  3TJJ A;  3QAV A;  2FWH A;  3F63 A;  3QAG A;  1XCC A;  2QC7 A;  3TRQ A;  4PNG A;  4Z7X A;  2EIO A;  3CTF A;  1QQ2 A;  4G0I A;  5ID2 B;  2FY6 A;  1SJZ A;  3GMF A;  3GFK A;  3HZ4 A;  4NMU A;  4Z2T A;  14GS A;  5CYY A;  3EWL A;  2VO4 A;  4GSS A;  1AQX A;  1YJ6 A;  2IWT A;  2GT5 A;  2WZ9 A;  3UBL A;  5KN2 A;  3APO A;  4XS6 A;  4G19 A;  4IKH A;  3GRX A;  3LXZ A;  6GSX A;  2PPT A;  4BA7 A;  3D22 A;  4MZC A;  2GGT A;  4BL7 B;  1R5A A;  17GS A;  2B5X A;  4OO5 A;  3QDN A;  3DKS A;  2AB6 A;  1TU7 A;  2FA8 A;  4O92 A;  5EY6 A;  3LXT A;  4IJI A;  3LWA A;  2TIR A;  1QUW A;  3D4M A;  1BED A;  1GTB A;  5F06 A;  4V2N A;  4TKY A;  1F37 A;  2H19 A;  2C1Y A;  2HRK A;  3C1S A;  5IQY A;  4JE1 A;  3KMN A;  4G9H A;  3CRU A; 
#chains in the Genus database with same CATH homology
 5INY A;  3EIN A;  1ZMA A;  4BVY A;  1PSQ A;  1S3A A;  4DSQ A;  1G7O A;  1SK1 A;  2JL4 A;  2JZR A;  4XRA A;  5DVB A;  1K0M A;  3TJB A;  3FK8 A;  2V32 A;  2QSI A;  3GH6 A;  3DML A;  3TKS C;  4KCE A;  2CVD A;  2A2S A;  2C0G A;  2AAW A;  2CQ9 A;  1TI3 A;  3EPT A;  16GS A;  2V6O A;  1AC1 A;  1PKW A;  4X0X A;  4EVM A;  1V2A A;  2CAQ A;  4OO4 A;  1BJX A;  1T8E B;  2CAI A;  2YAN A;  5CNW A;  2OAD A;  1T00 A;  3P7X A;  4FO5 A;  1O8W A;  1MDJ A;  3LOR A;  3P2A A;  2R2J A;  1FOH A;  4O5Q A;  2H71 A;  1E2Y A;  3KIJ A;  2OA7 A;  2GDR A;  5ECK B;  4F9Z A;  2VLT A;  3GYK A;  3UBK A;  3WGE A;  1ZYP A;  3VK9 A;  2M72 A;  3MNG A;  2MMN A;  3M9J A;  3R2Q A;  3WD6 A;  2HFD A;  4TRX A;  1EGR A;  4WF4 A;  2X64 A;  2O87 A;  1WOU A;  2QKE A;  1CQG A;  2C3Q A;  1SD8 A;  1NHY A;  3CRT A;  2CX4 A;  2O85 A;  3CMI A;  4JR4 A;  4JR6 A;  1OYJ A;  2FNO A;  5G1L A;  3VFI A;  3KH7 A;  1VRS D;  2VL9 A;  3QPM A;  3VWU A;  1AQW A;  3VI7 A;  1K3O A;  4GLT A;  3U5R E;  1VF1 A;  2VCX A;  1EP7 A;  3N9J A;  4JU5 A;  5IMZ A;  5AIV A;  3FZ9 A;  4IQ1 A;  2AJQ B;  2OBK A;  1FAA A;  5DQY A;  1GUK A;  3RHB A;  2LQO A;  1A24 A;  2WGR A;  2LV3 A;  3DEX A;  1AIU A;  5D9V A;  4PTS A;  3KTB A;  4LLR A;  4HUA A;  3FEU A;  4J57 E;  3IAM 2;  4OD7 A;  2DBC A;  5COH A;  4PNF A;  2F3M A;  3OR5 A;  3D0Z A;  2DML A;  3GTU B;  1YZX A;  2D2Z A;  2HNL A;  3VWW A;  2A2R A;  4MZW A;  3I69 A;  5DJM A;  2VD0 A;  3F4S A;  5A4V A;  5ECI B;  1Y6E A;  4KCA A;  2WRT A;  1J9B A;  1DUG A;  1F2E A;  4MJA A;  1EWX A;  2VAF A;  4MCU A;  2H74 A;  3KXO A;  3GN3 A;  2HI7 A;  2HRA A;  1BX9 A;  5DBQ A;  5BRT A;  1EEJ A;  4ID0 A;  3W8S A;  2H72 A;  4TR0 A;  3ZFL A;  3HA9 A;  3MWH A;  5HFK A;  3IR4 A;  1XWC A;  3IHQ A;  1PD2 1;  2GQM A;  1J0F A;  2H0I A;  4DEJ A;  4Q5F A;  3EE2 A;  3K8N A;  5DAK B;  4MPG A;  3MAK A;  5GSS A;  1GSY A;  4NHW A;  4N30 A;  3IK9 A;  1R26 A;  3WT1 A;  1DSB A;  3ZVJ A;  2DMM A;  3LGC A;  3EU3 A;  2DJ3 A;  1JZW A;  3GUR A;  3C7M A;  1M2B A;  2A4V A;  1A2L A;  3IC8 A;  1KEB A;  2ES7 A;  2CVK A;  2IMF A;  4EL1 A;  5D9T A;  2PGT A;  1F6M C;  2VL3 A;  3DWV A;  3EMP A;  3HXS A;  3HCZ A;  1ILO A;  1AW9 A;  2XPD A;  2OE1 A;  3TKP A;  5CRG A;  2PER A;  5C04 A;  1G6Y A;  2IJY A;  3O3T A;  3P90 A;  3PR8 A;  5J9C A;  5ECO B;  2RM5 A;  3FRC A;  2JSZ A;  4XS4 A;  5A5K A;  3EVI A;  3GHA A;  4HI7 A;  1YDK A;  4PUF C;  1GSQ A;  5G1K A;  2GS3 A;  1GTA A;  2I4A A;  11GS A;  4ICY A;  2AYT A;  4XS1 A;  2WFC A;  2LEG A;  2XBI A;  3GKX A;  4L8E A;  1B8X A;  1KBN A;  2LKU A;  2YV7 A;  3TRP A;  3F8U A;  3F3R A;  2GTU A;  1B48 A;  3E3E A;  3G7I A;  3HVS A;  4TOP A;  5FWG A;  1PX7 A;  4X1U A;  4MJB A;  1GTU A;  3DVW A;  3RAZ A;  3RPP A;  4AJ6 A;  4TR3 A;  3F9U A;  3MYD A;  5J4U A;  4EF0 A;  4IJ3 A;  1B4P A;  5ECQ B;  3L9U A;  1SKR B;  1TRV A;  4PX1 A;  4YAV A;  4GST A;  1EZK A;  1IYI A;  1F3B A;  3TJF A;  1XFL A;  2G2Q A;  1A2J A;  5ECR B;  4JED A;  4TXV A;  2JSY A;  2DJ0 A;  4MF7 A;  1M9B A;  3A2X A;  2N5B A;  1Z9H A;  2VD1 A;  3JCM L;  2ON7 A;  3KEB A;  2R3X A;  1GSD A;  5IO2 A;  2VM2 A;  2YCD A;  3ZLP A;  2K18 A;  2MBS A;  1ZGN A;  4ZIJ A;  3QAW A;  3F0I A;  1PN0 A;  3A2W A;  1GSE A;  1GWC A;  2X8H A;  2R37 A;  4HOJ A;  2HXK A;  4V1A g;  3L4N A;  2B1K A;  2R6K A;  4K9Z A;  2VCQ A;  4WXT A;  4CW9 A;  1SL0 B;  2FD3 A;  2HRN A;  4HZ4 A;  5B8B A;  3QMX A;  2KHP A;  2ON5 A;  1OAZ A;  2H1A A;  4BVY B;  3M3M A;  1B9X C;  4LL1 B;  2HZE B;  3W6G A;  5DCH A;  1WE0 A;  4K2D A;  2YZH A;  2LJK A;  3Q19 A;  1XW5 A;  1HQO A;  4MJC A;  1O85 A;  1YY7 A;  1WP0 A;  3TCO A;  3GKK A;  3VPQ A;  2YWM A;  3GX8 A;  2H1B A;  4L0U A;  2VM1 A;  1WIK A;  4CY8 A;  3FW2 A;  2EC4 A;  5HFI A;  1XW6 A;  5KN3 A;  3BD2 A;  2I3Y A;  4USS A;  5KN1 A;  2OE3 A;  3TUE A;  1LJR A;  3I9V 2;  2YN1 A;  1TW9 A;  2PMT A;  3A3T A;  1TTZ A;  4ILF A;  5C00 A;  4F0C A;  3IA1 A;  1AAZ A;  3GKN A;  2XPE A;  2N5A A;  4KND A;  1XIY A;  1ZL9 A;  4MAB A;  2QA2 A;  1Y25 A;  1YKC A;  3UIW A;  3F6F A;  1EV4 A;  2F9S A;  3RPN A;  1QMV A;  1DE1 A;  4RI6 A;  1ACV A;  2M46 A;  3TJG A;  4YKF A;  4NWY A;  4ECC A;  3LYP A;  4OFN A;  1OC8 A;  2XHF A;  3ZVJ D;  1I9D A;  1SL2 B;  3QFA C;  1JHB A;  5A4U A;  2EIR A;  4WBJ A;  2FWF A;  4CY6 A;  1AQV A;  4I5Q A;  3EMX A;  4RUV A;  4F03 A;  4IQA A;  3TOT A;  5EVO A;  1U87 A;  5D73 A;  5DAL A;  1HYU A;  2V2G A;  5LD0 A;  2B3S A;  4EO3 A;  4TN8 A;  1YQ1 A;  2CZ3 A;  1OE8 A;  2L5L A;  2B1L A;  1ML6 A;  4FYC A;  5JCW A;  3LEF A;  1GLQ A;  1TK8 B;  1Z7R A;  1AXD A;  3FR6 A;  3ZL5 A;  4F82 A;  3L78 A;  2GZY A;  1GNE A;  4HEA 2;  4ML1 A;  2K6V A;  1B9Y C;  4KH7 A;  3LQ7 A;  1FO5 A;  6GSW A;  2H70 A;  5GAN D;  5CP1 A;  1TI1 A;  2OE0 A;  3HVX A;  1TU8 A;  4PQH A;  3KH9 A;  5HR3 A;  3KZQ A;  1M2A A;  1G7E A;  1UN2 A;  4NPB A;  4N10 A;  4YAP A;  1AUC A;  4BPY A;  2DIY A;  4YQV A;  2NDO A;  1FB6 A;  4HZ2 A;  3ZMK A;  2MYG A;  2YPM A;  1A2M A;  2BMX A;  2HE3 A;  3LJR A;  3UL3 A;  4MK3 A;  4HS1 A;  4N0V A;  1NSW A;  5CAX A;  1TKD B;  5IMC A;  3L9V A;  1R5P A;  1THX A;  1FOV A;  1GTI A;  4V2L A;  2R0C A;  1OC9 B;  3UAP A;  2QA1 A;  1JZD A;  4N0Z A;  4JBB A;  1ON4 A;  3GSS A;  3GX0 A;  4NV2 A;  3UVT A;  2LS5 A;  1EEM A;  4V1A p;  4K5R A;  3GKM A;  1H4O A;  1TJD A;  4NHZ A;  2K8V A;  2CA8 A;  4HJM A;  2JZS A;  1H75 A;  3ERG A;  2LNT A;  1XVQ A;  2L59 A;  3KTL A;  1RK4 A;  1DE2 A;  1X5D A;  1GSS A;  3IBH A;  1XVW A;  4MF5 A;  3VUR A;  3GL5 A;  5CRW A;  1V57 A;  4EE0 A;  3FY7 A;  4PUA A;  3NZN A;  2HZF A;  2VCT A;  3ERF A;  2PWJ A;  2P31 A;  2YJH A;  4NXI A;  1PL1 A;  1BAY A;  3IDV A;  2CV4 A;  1W4V A;  2JU5 A;  4IS0 A;  1TOF A;  2GSS A;  3GUS A;  3DD3 A;  3EC3 A;  3MSZ A;  1GL8 A;  1XOB A;  13GS A;  4NV5 A;  3SBC A;  3O76 A;  3UMA A;  5AGY A;  1FB0 A;  4HDE A;  1K0O A;  5FT3 A;  4XS4 B;  1QGV A;  3QOU A;  4K0G A;  5AN1 A;  3F3Q A;  2CT6 A;  3LG6 A;  2N5F A;  2X4A A;  4I2T A;  4K5S A;  5FHI A;  3IV4 A;  4MJE A;  4IVF A;  3APQ A;  4ML6 A;  5H5S A;  4FH8 A;  4GQF A;  2MMO A;  5ENU A;  2HYX A;  1MDI A;  1XWB A;  2X99 A;  4LL4 B;  3F4R A;  1WRY A;  4KDU A;  5CO3 A;  3ZFB A;  3ED3 A;  4D73 A;  3HKR A;  3UEM A;  2K8S A;  3QR6 A;  3TJK A;  2GQK A;  4ZIL A;  2H1G A;  1TK0 B;  12GS A;  4BVX B;  2LRN A;  1NHO A;  1TRW A;  1YKA A;  1XOA A;  5B6N A;  2IFQ A;  2KP1 A;  2FA4 A;  4KB3 A;  1URM A;  1X5C A;  3KJY A;  3IK7 A;  1BQ7 A;  1SD9 A;  3ZIJ A;  2JAC A;  5B6M A;  3IC4 A;  2HSM A;  2LJA A;  2C0F A;  5F05 A;  4AF2 A;  5BMU A;  2H73 A;  1PMT A;  4Q5N A;  1SK0 A;  5HR0 A;  1TK5 B;  2ZUP A;  1PKZ A;  1ERV A;  3TKS E;  2WDU A;  1SYX A;  1M7T A;  4IP6 A;  2AUV A;  5F8B A;  3GST A;  1K0B A;  1N8J A;  4ECJ A;  1SKS B;  5F0G A;  3S9F A;  1ST9 A;  4MF6 A;  4ULX A;  4XIH A;  3E9J B;  2YWO A;  4GQC A;  2P5R A;  1U3I A;  4G2E A;  2H6Z A;  3NOF A;  2C80 A;  1DBY A;  4ZXG A;  1YF1 A;  3LFL A;  4KSO A;  3W8J A;  3CBU A;  3A5I A;  3F6D A;  1LBK A;  3KD0 A;  2AV4 A;  4XCS A;  2O8V B;  4TR1 B;  4WR4 A;  4KUN A;  4H86 A;  1MTC A;  4ECI A;  1O6J A;  5KEJ A;  5J5N A;  1J08 A;  1T1V A;  3H1N A;  4KDY A;  2F51 A;  2HRF A;  3AY8 A;  2VOC A;  3QCP A;  1KNG A;  1MEK A;  1O81 A;  1TRS A;  3FYG A;  1XWK A;  1N2A A;  2B5E A;  1EGO A;  2B6M A;  1O8X A;  1Z3E A;  4EC0 A;  5AIS A;  5L71 A;  2CZ2 A;  3HDC A;  2H0G A;  5F07 A;  2DLX A;  1A8Y A;  3H79 A;  2H0H A;  1PA3 A;  4PGT A;  1JLV A;  2O7K A;  4KX4 A;  3L9S A;  4GF0 A;  5KN0 A;  2GLR A;  2WS2 A;  3HHV A;  2IL3 A;  4HQZ A;  4TW5 A;  2IMD A;  4KSM A;  1EOG A;  3FHK A;  2LRC A;  4MLY A;  3HVV A;  1ERT A;  1EOH A;  4IP1 A;  4G0K A;  4MNN A;  1V40 A;  5IPH A;  1T7P B;  5DJL A;  4Q5R A;  4XRD A;  1YEP A;  4WKW A;  2TRX A;  3PH9 A;  5D9W A;  1NM3 A;  4CHS A;  4AGS A;  1U3A A;  1ZYE A;  1HNB A;  2TRC P;  5J3R A;  1SK2 A;  3GV1 A;  2IN3 A;  3P8W A;  2PVO C;  1XW9 A;  4J2F A;  4L5O A;  1OC3 A;  1GNW A;  5LCZ A;  5IOX A;  1SJ6 A;  2E7P A;  3IPZ A;  2C3N A;  1JLW A;  2MBT A;  2Z9S A;  4NAX A;  3ZIT A;  1V9W A;  4X4J A;  2B7K A;  4POM A;  1ZOF A;  4MA9 A;  3RHC A;  2C0E A;  4O32 A;  2BTO T;  3GTU A;  3HJP A;  4P3Y B;  2DJ2 A;  2LJR A;  2PUK C;  5HR1 A;  1G6W A;  3N5O A;  1M9A A;  3C8E A;  3IAS 2;  1I5G A;  2HLS A;  1X9M B;  1RQM A;  4WET A;  4BWS A;  4FYB A;  1FVJ A;  2V41 A;  5B8A A;  2IIY A;  3GL3 A;  3E0U A;  4ZL7 A;  2FGX A;  20GS A;  4K7I A;  3TGZ A;  1FG4 A;  2I1U A;  5ECN B;  2IME A;  2ZNM A;  1A23 A;  2R5G A;  3I6A A;  1XWA A;  3BBY A;  5D8I A;  2LUS A;  4JRR A;  3ZML A;  5HFG A;  1SKW B;  1TRU A;  3IXR A;  4AJ7 A;  3F4T A;  6GSU A;  2QGV A;  2VIM A;  3M9K A;  5AIX A;  5IOW A;  3D21 A;  8GSS A;  1O7U A;  2GSQ A;  1GSF A;  2L5O A;  5J41 A;  3J7Y b;  2DJ1 A;  3CXG A;  4O7H A;  2YNX A;  4ZB9 A;  4FQU A;  2J9H A;  1X9W B;  4I6X A;  4J56 E;  4POL A;  3C71 A;  5IM9 A;  2MMA A;  1ABA A;  1F9M A;  4KDX A;  5G31 A;  1MD4 A;  2DC5 A;  1M99 A;  4GTU A;  3IOS A;  3HD5 A;  5IO0 A;  4OFM A;  2C4J A;  2E2M A;  3C1R A;  4OFT A;  1NW2 A;  2KP2 A;  2H1D A;  3ME7 A;  3VWX A;  2YOI A;  4LMW A;  2NVL A;  10GS A;  4PQ1 A;  3LSZ A;  5KOW A;  3HY2 A;  3FKF A;  2VLU A;  2L4Q A;  4EDY A;  4I97 A;  2H75 A;  3A5W A;  3G7Y A;  2C0D A;  3J7Y k;  4EIP A;  4EKZ A;  3MIX A;  5JWQ B;  2A4H A;  3UAR A;  1EV9 A;  1VF4 A;  5E59 A;  5ECP B;  1GSU A;  3CSI A;  2E2G A;  2L4C A;  2E0Q A;  2IPA A;  3M0F A;  1R7H A;  4MH3 A;  3GIX A;  3US3 A;  2NTO A;  1XWG A;  2V6K A;  5IMA A;  2L6C A;  4K7O A;  1SL1 B;  1VF2 A;  5JCG A;  2HT9 A;  4WBR D;  2GST A;  5GZZ B;  2H76 A;  4TVE A;  2F8F A;  2HSH A;  1GLP A;  5G30 A;  4YKG A;  1KTE A;  2VL2 A;  2YJ7 A;  4POK A;  2PVQ A;  3TRX A;  1XBS A;  4EIQ A;  4KAE A;  5IPG A;  2XBQ A;  1K0A A;  2VLV A;  4RQR A;  1JZO A;  4XHM A;  1PQN A;  4ZB8 A;  4WEY A;  4D73 B;  1WJK A;  2P5Q A;  1FHE A;  1K0D A;  2RUF A;  3BCI A;  1T4Y A;  1WWJ A;  3RDW A;  4ZBD A;  2H6X A;  2IFQ B;  5ELA A;  4L5L A;  5JWR B;  1ZCP A;  2H8L A;  1VF3 A;  1TXX A;  4HQS A;  3KP8 A;  3APS A;  3DXB A;  4IN0 A;  2YZU A;  1ZZY A;  1ZYN A;  4DSS A;  1ERW A;  6GST A;  2FUG 2;  2H30 A;  3A2V A;  5CRH A;  2HZE A;  5J9B A;  3PGT A;  1X5E A;  2RLI A;  2I81 A;  4KW6 A;  3FZA A;  2IMI A;  3I43 A;  18GS A;  2CVB A;  4MP4 A;  2WB9 A;  5ECL B;  2JZT A;  3ZRD A;  1S3D A;  3EYT A;  3CSH A;  5IMV A;  3TKQ A;  4PQI A;  1XZO A;  4MMM A;  4AJ8 A;  1G0T A;  1SYR A;  9GSS A;  4F2I A;  3ZIV A;  2V1M A;  5HQP A;  4YH2 A;  5B7C A;  4MH2 A;  1USB A;  5D9X A;  5IIZ A;  1OKD A;  4ZL9 A;  2MMZ A;  2DKI A;  3KGK A;  1UC7 A;  3KMO A;  1YF0 A;  1Z6N A;  3FZ5 A;  1Z6M A;  2C3T A;  4LA1 A;  2CX3 A;  2UZ8 A;  1X0R A;  1LU4 A;  4TXO A;  1EP8 A;  4BWQ A;  1FVK A;  2B7J A;  2R0P A;  1YEX A;  3O6T A;  7GSS A;  1ERU A;  1GP1 A;  1OE7 A;  4ECB A;  2WJU A;  5H5Q A;  1GUH A;  3HYP A;  3UOM A;  1BYE A;  1PX6 A;  1GUM A;  1ZYQ B;  1IYH A;  2VUP A;  4K7N A;  2PU9 C;  2A2P A;  4DSR A;  5A4W A;  5ID2 A;  2FLS A;  2NBS A;  4RQX A;  3Q74 A;  3U6V A;  3CTG A;  1O73 A;  3TKR A;  5IMD A;  4QL9 A;  4A5P A;  2GZZ A;  3UJ1 A;  3IRA A;  4N11 A;  19GS A;  4MZB A;  2L57 A;  3IE3 A;  1U88 A;  3HJM A;  1OKT A;  4KF9 A;  4G0L A;  2PBJ A;  4K2X A;  1PRX A;  3M8N A;  1R4W A;  4WF5 A;  5GST A;  1JFU A;  2NPB A;  2OBI A;  2REM A;  3HZ8 A;  2KOK A;  3EUR A;  6GSS A;  22GS A;  4ACS A;  4OMV A;  1Z5Y E;  1HNA A;  5CRE A;  4BL7 A;  3VPT A;  3KP9 A;  1X9S B;  2MZC A;  2OAC A;  2H6Y A;  3SWL A;  6GSV A;  3QD9 A;  4OWY A;  3ZTL A;  3RBT A;  2M80 A;  2DJJ A;  2PN8 A;  3M1G A;  3TKS A;  1K0N A;  4MDC A;  1UA5 A;  4IBP A;  2LTK A;  1RW1 A;  4Q5Q A;  5D96 A;  4K6X A;  3PIN A;  1CQH A;  3PPU A;  2F8A A;  3KM6 A;  1SU9 A;  1GRX A;  4I8B A;  5GAP D;  4XTS A;  4G10 A;  4E8E A;  2JAD A;  1B4Q A;  4HU7 A;  4KE3 A;  1A0R P;  1OC9 A;  1K3L A;  3FZ4 A;  3Q6O A;  2KUC A;  4K1F A;  3FMW A;  3CYN A;  2VCV A;  3H93 A;  2J23 A;  4YQM A;  3DGQ A;  4ZL8 A;  5G2Z A;  3G9B A;  1VGL A;  3C73 A;  2DSA A;  3EU4 A;  2HSY A;  1TDI A;  4GSN A;  5LNK e;  3ME8 A;  1PGT A;  2OKA A;  2KLX A;  1HNC A;  4CDO A;  2WCI A;  3D6I A;  4KA0 A;  2DKH A;  2AHE A;  2R4V A;  3WGX A;  2GSR A;  2YWN A;  4POB A;  5DDL A;  4PXO A;  3GNJ A;  5ECM B;  4Z2R A;  1XPV A;  4GWR A;  5KOX A;  3FR3 A;  2DIZ A;  3NIV A;  1OVN A;  2K9F A;  2WUL A;  1W89 A;  4HU9 A;  5ECH B;  3DVX A;  3D5J A;  2YP6 A;  3ISO A;  4RI7 A;  5E4W A;  2EIQ A;  1GH2 A;  2RM6 A;  4LMV A;  4K8M A;  1E6B A;  4X43 A;  5EPF A;  2RII A;  4ZBB A;  2LRT A;  3UVH A;  3ZYW A;  1SEN A;  2VCW A;  1XXU A;  4GCI A;  3DRN A;  2BJX A;  4IHU A;  5DQS A;  3R3E A;  4MPF A;  3ERW A;  3H8Q A;  5HR2 A;  2YWI A;  5ABR A;  1T4Z A;  4Z2U A;  4TR4 A;  4E8H A;  2H66 A;  4KGI A;  1BG5 A;  4IGJ A;  3ZZX A;  4V2M A;  2O89 A;  1MDK A;  1K3Y A;  2OJL A;  3BOA A;  1C72 A;  4BVX A;  1JZR A;  2GVP A;  2LST A;  5DAL B;  4ZBA A;  2P0G A;  4O5R A;  2GT6 A;  3V1W A;  1TP9 A;  1V98 A;  3D4T A;  4EXJ A;  5IMF A;  2I9H A;  3H4K A;  3HJO A;  2IMK A;  2LNS A;  3WT2 A;  3FR9 A;  6GSY A;  3VWV A;  5G5E A;  1K0C A;  1M2D A;  2G0F A;  1GUL A;  2L6D A;  5JWO B;  3TDG A;  2B5Y A;  1F3A A;  4IW9 A;  2X8G A;  5H5R A;  2VL2 C;  2ZCT A;  1QK8 A;  4WR5 A;  4ISD A;  2GQL A;  5DAK A;  4PUR A;  1WMJ A;  4FYU A;  1UVZ A;  3IHG A;  3G7J A;  4TR1 A;  5ECS A;  3VI5 A;  2X49 A;  1M0U A;  4YQU A;  3WGD A;  4JZQ A;  1U6T A;  3L0H A;  3KCM A;  4OCF A;  4EUY A;  4DSS B;  4GRF A;  4IEL A;  2YV9 A;  3CSJ A;  4QL7 A;  4F0B A;  1QXH A;  5G5F A;  2FWE A;  4HJ2 A;  1S3C A;  2VCZ A;  4ZB6 A;  4OCE A;  1PL2 A;  1HD2 A;  3Q18 A;  5DCG A;  3TOU A;  2FHE A;  1THO A;  5EL8 A;  1PN9 A;  4EDZ A;  4QQ7 A;  2ALB A;  3TB2 A;  2H01 A;  3WYW A;  2X8C A;  1FW1 A;  2FCH A;  4O5U A;  3VLN A;  4K0N A;  1Q98 A;  2C8U A;  5D93 A;  3MDK A;  1V58 A;  1A0F A;  3BCK A;  4GXZ A;  5ELG A;  4L0W A;  2XC2 A;  1Q4J A;  3GH9 A;  2GZP A;  1A8L A;  1MD3 A;  3QFB C;  3GA4 A;  3BJ5 A;  2DJK A;  2LQQ A;  3DYR A;  4TXO B;  3ZRE A;  1T3B A;  1Z7P A;  3LW9 A;  2FWG A;  5CRD A;  2RUE A;  1WPI A;  4I2U A;  5JCU A;  4DVC A;  3LYK A;  4FIW A;  3DIE A;  2R0G A;  1QFN A;  1SJI A;  3TJJ A;  3QAV A;  2FWH A;  3F63 A;  3QAG A;  1XCC A;  2QC7 A;  3TRQ A;  4PNG A;  4Z7X A;  2EIO A;  3CTF A;  1QQ2 A;  4G0I A;  5ID2 B;  2FY6 A;  1SJZ A;  3GMF A;  3GFK A;  3HZ4 A;  4NMU A;  4Z2T A;  14GS A;  5CYY A;  3EWL A;  2VO4 A;  4GSS A;  1AQX A;  1YJ6 A;  2IWT A;  2GT5 A;  2WZ9 A;  3UBL A;  5KN2 A;  3APO A;  4XS6 A;  4G19 A;  4IKH A;  3GRX A;  3LXZ A;  6GSX A;  2PPT A;  4BA7 A;  3D22 A;  4MZC A;  2GGT A;  4BL7 B;  1R5A A;  17GS A;  2B5X A;  4OO5 A;  3QDN A;  3DKS A;  2AB6 A;  1TU7 A;  2FA8 A;  4O92 A;  5EY6 A;  3LXT A;  4IJI A;  3LWA A;  2TIR A;  1QUW A;  3D4M A;  1BED A;  1GTB A;  5F06 A;  4V2N A;  4TKY A;  1F37 A;  2H19 A;  2C1Y A;  2HRK A;  3C1S A;  5IQY A;  4JE1 A;  3KMN A;  4G9H A;  3CRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...