2B7JA

Crystal structure of yeast sco1 with copper bound
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
172
structure length
158
Chain Sequence
b'GKPSLGGPFHLEDMYGNEFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNTLSSKYGITLQPLFITCDPARDSPAVLKEYLSDFHPSILGLTGTFDEVKNACKKYRVYVDHSIFFYLMDPEGQFVDALGRNYDEKTGVDKIVEHVKSYVPAEQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCO1 protein
publication title Crystal structure of yeast Sco1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal binding protein
total genus 46
structure length 158
sequence length 172
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2b7jA00
5ECKB 5G1LA 1XWKA 4HEA2 1W4VA 2H71A 4EDZA 3ERFA 5JWRB 3I9V2 3LGCA 2OA7A 2GS3A 1TXXA 3EU4A 2VAFA 3LJRA 5FWGA 5B8AA 3G7YA 1JZWA 1SD9A 3VURA 2IMDA 2LQOA 1TW9A 1TKDB 4O32A 3FRCA 2YOIA 4G19A 1ERTA 2I9HA 5L71A 1QK8A 4QL7A 1K0MA 4JEDA 1ZYQB 4YQMA 4BWSA 3KIJA 4Q5FA 3KXOA 2KHPA 3E0UA 4MJBA 4MZBA 4V1Ag 5CNWA 3QAWA 2YWOA 4GCIA 2JZSA 2GSQA 4OFMA 3ZVJD 1X0RA 4N10A 2MMAA 4TR3A 2B6MA 2ZCTA 2VIMA 3L4NA 2I4AA 4XRAA 3VK9A 1F3BA 1BG5A 3D21A 2IWTA 3HZ8A 4EUYA 3EC3A 4ILFA 1FO5A 3H79A 4HU9A 3ZRDA 4POLA 1SU9A 4ZL8A 2PWJA 2EC4A 2HFDA 2RM5A 5IM9A 3BJ5A 1B9XC 1SJ6A 4OWYA 2VCTA 1HD2A 4GF0A 2CVDA 2IMKA 5LD0A 1U3IA 1XZOA 2VCWA 5GAPD 3PINA 4KGIA 3QOUA 1WMJA 3GUSA 3WT2A 4K9ZA 1V9WA 5IO2A 5DAKB 4G2EA 4PNGA 4ECCA 2NTOA 3WGDA 4HQSA 1T8EB 5J41A 4XS4B 4J2FA 1V57A 2AV4A 2ES7A 4TXOA 3IE3A 2AYTA 3F4TA 4OFTA 1AXDA 5DVBA 2NDOA 2L5LA 2GTUA 1FAAA 2LJAA 4K8MA 4JR6A 1YKAA 2LNSA 5E59A 1LBKA 3TDGA 5CRWA 4KUNA 3QDNA 1PRXA 2WDUA 2VCZA 4DEJA 3VWXA 1TK5B 2GDRA 2C0GA 3KH7A 2YV7A 1T7PB 1A0FA 1O81A 4GSTA 2WS2A 5EPFA 2FNOA 2JSYA 3HJOA 2A4VA 1TI1A 2VL3A 5G5EA 2LRCA 5HFIA 5DDLA 2A2SA 4I97A 3LEFA 2QGVA 1AC1A 3DVWA 3ZL5A 4ZXGA 3GKNA 3FEUA 5H5QA 3LFLA 1F2EA 5LCZA 2VL2C 2CX4A 2R37A 3LXZA 3L78A 2FD3A 4NV5A 3PGTA 1M99A 2AAWA 2MMOA 1V40A 2F3MA 4JZQA 1NHOA 1SL1B 3HXSA 2F9SA 2H8LA 1V98A 2L5OA 13GSA 1G6WA 5F8BA 3UARA 4MMMA 3I69A 5A5KA 2K9FA 3HY2A 2FUG2 1A2JA 3LYKA 3HYPA 1U88A 1HYUA 1GULA 1Q98A 2B5XA 2HI7A 4N0VA 2E0QA 2QSIA 3BBYA 2IMEA 1VF4A 3KMNA 3F6DA 1T00A 2I81A 4EE0A 2FY6A 1XWAA 5CRHA 5IMVA 2V1MA 1J08A 2MBSA 4ZILA 3Q6OA 5FT3A 4E8EA 2C0DA 4PNFA 5G5FA 1ZYEA 1GTBA 1X5DA 2X64A 1PL1A 4PXOA 4WKWA 2C80A 1OC3A 3GNJA 4AGSA 5IOWA 2CZ2A 1QUWA 5ECPB 2O89A 2GZYA 4L5OA 1OE8A 3LWAA 2OBIA 4HS1A 5E4WA 5G30A 3SBCA 1S3AA 2H0HA 1FG4A 3ZIVA 4HU7A 2R6KA 3E9JB 2R4VA 4MH2A 1TK0B 1OKTA 4K7OA 4EXJA 2TRXA 1M9BA 9GSSA 1XOBA 1A23A 4WETA 3MWHA 4H86A 1KEBA 2GSTA 1OKDA 2F8FA 1THOA 5C04A 2RUFA 4TR1B 3RPNA 3TKSA 2IFQA 3CRUA 1M2AA 4MABA 2HNLA 2H6YA 3CSHA 4IW9A 5HFGA 3AY8A 5CRGA 4MK3A 1K0OA 3LSZA 5ECLB 1USBA 5D9XA 3J7Yb 1FB0A 1YZXA 3ZITA 3ERGA 3KM6A 3M0FA 4CDOA 3CMIA 4FH8A 2L6CA 3A5WA 4RI7A 1OE7A 2IPAA 4F9ZA 4TOPA 1X9SB 1K3YA 3LQ7A 4OCEA 4IS0A 4GXZA 2HE3A 3FHKA 1TJDA 2YN1A 4KNDA 1BQ7A 3N9JA 4FYCA 3D4MA 1QQ2A 4PURA 4FIWA 3HVSA 4OO4A 3BOAA 1XW5A 4ECBA 4N30A 5HR0A 1H4OA 3ZVJA 2RM6A 1EGOA 4IHUA 3VI7A 5IPHA 2VLVA 3VFIA 4EL1A 4IP6A 1EOGA 1B4QA 3TJKA 3W8JA 2E7PA 2LS5A 3W8SA 3O6TA 3H1NA 3HCZA 5IO0A 1XBSA 2ON7A 3M9KA 1J0FA 3EMPA 4KDYA 1Z7RA 3LYPA 2K8SA 3WD6A 4OFNA 3GSSA 3FZ5A 2CAQA 5DCHA 4IN0A 2H0IA 4LLRA 4IQAA 1YY7A 2EIRA 1VRSD 2GZZA 3C8EA 5JCWA 4FYUA 4PX1A 3F4RA 4TN8A 1O8WA 4I2TA 6GSSA 1AW9A 1OAZA 4L0WA 1OC9B 4MJAA 4K2DA 3EYTA 3IOSA 3HVXA 3QFAC 4ML1A 5IMAA 4WF4A 2YJ7A 3KH9A 4L0UA 3QMXA 1DSBA 4BWQA 4ZL7A 2Z9SA 2GSRA 4FYBA 3IRAA 5GSTA 4HI7A 1XOAA 5ID2A 2HZEA 1URMA 1R5AA 3ME8A 5F0GA 1K0AA 4O5RA 2HZEB 1UN2A 2YWNA 2G2QA 1SD8A 4D73A 2N5FA 2I3YA 4AJ6A 4KDUA 2VD1A 2H6XA 3D6IA 4DSSB 3IV4A 3CSIA 4MF6A 2WRTA 2D2ZA 5DALB 3IC4A 3DXBA 5EL8A 5DJMA 3Q18A 3P7XA 4MPFA 2JL4A 2R5GA 3ZZXA 1BX9A 10GSA 3DIEA 2IMIA 2GQKA 4WR5A 1WIKA 2IIYA 4WR4A 1BYEA 4WBRD 4TRXA 4V2LA 1N2AA 4ZB6A 6GSWA 1AQVA 2REMA 1X5CA 2K18A 2C0EA 12GSA 5IMCA 5JCGA 5D9VA 2FWGA 3APSA 5A4WA 1RW1A 2VLUA 5F07A 1ERWA 3TOUA 5J3RA 3IDVA 1A0RP 4HQZA 4RQRA 1T3BA 1R7HA 5KN1A 4F03A 2V41A 3E3EA 2J9HA 3TKPA 3KD0A 1GUKA 5ELGA 2H1DA 4YAVA 4MF7A 3L9UA 3DYRA 2IMFA 1KBNA 4NAXA 3UVTA 2VM2A 3TJJA 5JWOB 4LMWA 2TRCP 3KEBA 3GSTA 4FO5A 1FVKA 5HR2A 4KX4A 3JCML 3HA9A 3GA4A 6GSYA 4F2IA 1XVWA 14GSA 1GUHA 3MNGA 2WCIA 3N5OA 3GV1A 5ECIB 2FCHA 4K7IA 2VL9A 4ISDA 2H76A 3P2AA 1ZL9A 4KSOA 2BJXA 3IK7A 2CVKA 1A24A 1YKCA 3MSZA 1XW9A 4MPGA 2RUEA 1JLVA 2C1YA 3CXGA 3GTUB 2DMLA 5EY6A 1O7UA 2NVLA 5IMDA 2B7JA 5HR1A 3P8WA 5AIVA 5KN2A 4DSQA 4G10A 1SK2A 1SK0A 5J4UA 1ZGNA 3Q74A 2DLXA 2O85A 2ZUPA 5ECOB 2OE3A 1TK8B 5ECSA 4WBJA 4ZB8A 1XIYA 2PVQA 1MDJA 2LEGA 5DAKA 1TU8A 1UC7A 1JHBA 1HQOA 1VF1A 4XCSA 1GSUA 2FA8A 4XS4A 1A8YA 1G7OA 1J9BA 2DJ0A 1DUGA 3HZ4A 5IPGA 2N5AA 5D9WA 1O8XA 2VL2A 2ALBA 1DBYA 2OJLA 3G7JA 1QMVA 1GLPA 4IELA 2MYGA 4XS1A 2GZPA 1PQNA 4ZIJA 5INYA 2N5BA 1S3DA 1M7TA 2XPDA 1PGTA 3LXTA 3APOA 4K0NA 2FLSA 3HD5A 3US3A 2C3NA 1HNBA 4E8HA 4X43A 4YH2A 2PMTA 1ML6A 3EWLA 2H66A 3CRTA 3HJMA 3KP8A 4MA9A 3HDCA 4Q5NA 5B6NA 2QC7A 1MD3A 1Y25A 2H72A 2XBQA 1IYHA 2VM1A 4KSMA 3FR6A 4GQCA 1EZKA 5HFKA 1ILOA 2LSTA 3UOMA 2VCVA 3MAKA 4PQ1A 3TGZA 2H70A 1O85A 3PH9A 3F63A 2RIIA 3M3MA 2O8VB 5JWQB 1QFNA 4RI6A 4X0XA 4WF5A 2FWEA 4DVCA 2VCQA 4CW9A 2H74A 2YPMA 2GT5A 1GWCA 2OKAA 4ACSA 2H1AA 16GSA 1EP7A 3TJBA 4BPYA 2YZHA 1YDKA 2X99A 4YAPA 3FKFA 1CQGA 4IQ1A 3GHAA 5A4VA 2WB9A 3K8NA 3ERWA 4OO5A 3FZ4A 4KAEA 1TRWA 2L59A 5CO3A 2PN8A 2YP6A 3ZMKA 3C71A 3RHCA 2BMXA 3VPQA 1I5GA 5HR3A 1ON4A 3H93A 4G9HA 3GX8A 2CQ9A 5GSSA 3IR4A 2CX3A 2F8AA 3GIXA 2V6KA 2DC5A 4IP1A 3TJFA 2PU9C 4EKZA 3KZQA 7GSSA 1Z3EA 5DQSA 4V2MA 4JRRA 3SWLA 4ZL9A 4TR4A 4I8BA 5C00A 4MJCA 2H01A 1OC8A 3ZMLA 4XS6A 3EURA 4P3YB 4K6XA 5FHIA 4NMUA 5AISA 4TR1A 4EC0A 4BVYA 2GGTA 1EWXA 5J5NA 2I1UA 1VF2A 3F3QA 1EEMA 4LL4B 5F06A 4HOJA 2LJKA 4KDXA 5ECRB 2LKUA 3IPZA 3BCIA 3ZTLA 4WXTA 3F3RA 2GQLA 3HHVA 1Z6NA 1ZOFA 3NZNA 1GTIA 4KCEA 4MH3A 2HT9A 3ZYWA 1PKWA 1ABAA 1TOFA 1GSSA 2YJHA 5D8IA 6GSUA 2J23A 3G7IA 4IKHA 1M2BA 3CBUA 3ZFBA 1G6YA 1VGLA 1FOVA 2V32A 4NV2A 4PQIA 4MLYA 1W89A 3FW2A 4HJMA 3IA1A 1JFUA 1AQXA 5B6MA 3QD9A 3WGEA 2R3XA 1K0CA 2E2GA 5H5RA 3GYKA 1B9YC 3EU3A 2K8VA 1ACVA 1A8LA 1T4ZA 3F6FA 4AJ7A 1Z5YE 1WPIA 1SKRB 2FWFA 2YWMA 1EV4A 1GNEA 2P0GA 4AF2A 4X1UA 1ST9A 1V58A 5ENUA 5JCUA 5ECHB 2DIZA 4BVXA 4TKYA 3TKRA 4HZ4A 4KE3A 1R26A 1XVQA 3FYGA 3D22A 2B3SA 4EDYA 1SYRA 1NW2A 3KP9A 3ME7A 3ZLPA 4TXVA 4L5LA 1PL2A 2PUKC 1OC9A 2H73A 3RBTA 1IYIA 3GURA 1F6MC 2C3QA 2FWHA 3CTGA 1MTCA 5ECMB 5CREA 3UL3A 3DWVA 3IBHA 5IIZA 3QFBC 5IQYA 2HSHA 5B8BA 3TCOA 5KEJA 1MDIA 1PN9A 4GLTA 4EVMA 1U87A 1TDIA 2B5YA 2HZFA 2C8UA 1BEDA 3GH9A 2HSYA 3HJPA 1SENA 3VI5A 2GLRA 1K3OA 1TRVA 1X5EA 1WP0A 3I6AA 5ECQB 2H0GA 5A4UA 4F82A 2DMMA 3O76A 5B7CA 3ZFLA 3M8NA 4DSSA 5CYYA 3FZAA 5DJLA 2HRFA 5IOXA 5DALA 1BAYA 1F3AA 3GL5A 1TTZA 1TU7A 2PGTA 2H30A 3KJYA 4MZCA 5AIXA 2V2GA 1YEPA 5GAND 3UAPA 2B1LA 5DBQA 1EEJA 4NXIA 4PUFC 1PX6A 4NHZA 1UA5A 2XPEA 3IXRA 2DJ2A 8GSSA 2CT6A 1PD21 5HQPA 1C72A 3GN3A 3VPTA 1K0BA 3IK9A 4NHWA 2VD0A 3CSJA 1WOUA 5COHA 3TUEA 4F0BA 1G0TA 4POMA 1MEKA 4EF0A 3RAZA 5G1KA 1EOHA 3F0IA 3GKMA 3F4SA 1GSDA 1LJRA 20GSA 2ZNMA 3WT1A 2XBIA 3UJ1A 4KH7A 3FK8A 3A2VA 2L4QA 1HNAA 2H19A 2MZCA 1AAZA 4Q5RA 1O6JA 3TRXA 18GSA 4NPBA 4KB3A 3UBLA 3CTFA 4HJ2A 3FZ9A 3EE2A 3PR8A 3UVHA 1THXA 4K1FA 3FR9A 2L6DA 2PVOC 2H1GA 3A3TA 5CAXA 2G0FA 1O73A 1B4PA 2VOCA 3EVIA 3L9VA 2AB6A 1PSQA 2K6VA 4GWRA 5F05A 2IN3A 4JR4A 2AHEA 2RLIA 5D9TA 5AGYA 1YEXA 4IBPA 3Q19A 2MBTA 3ZIJA 3D5JA 4KW6A 3FY7A 1F37A 2CZ3A 1GL8A 3WGXA 5ABRA 1GTAA 3GTUA 3I43A 4MP4A 1EV9A 1SK1A 5CP1A 1DE1A 2IJYA 4BL7A 5AN1A 1T1VA 1T4YA 4MF5A 3DRNA 3OR5A 2DJ3A 2B7KA 1SL0B 2CA8A 1YF1A 2XC2A 6GSVA 2AUVA 4OD7A 3G9BA 3H8QA 4ZBBA 3TJGA 4OMVA 2YNXA 1FW1A 4I6XA 2IL3A 3EINA 2H6ZA 4V2NA 4GTUA 4ZBAA 4RUVA 3L9SA 4F0CA 3L0HA 3GMFA 1Z6MA 2M46A 4ZBDA 4HDEA 2YZUA 4LA1A 5H5SA 5J9CA 1ZZYA 3C7MA 3V1WA 4YQUA 2VO4A 2GT6A 1HNCA 1MD4A 4LL1B 2M80A 1U3AA 4MJEA 5CRDA 4N11A 1GH2A 2KP1A 2ON5A 2WFCA 4PUAA 1KNGA 1GSQA 1V2AA 4IVFA 2WULA 4TXOB 5ELAA 4TW5A 1PX7A 1GP1A 3U6VA 1NSWA 4BA7A 1ZMAA 2H75A 3F9UA 3IAM2 1WE0A 3ISOA 1EGRA 4TR0A 3GH6A 1XXUA 3FR3A 3TOTA 2PPTA 2PERA 2PBJA 4AJ8A 3P90A 1RK4A 1ERUA 2YANA 2KLXA 2O87A 2WGRA 5KN0A 4QQ7A 1WJKA 3UIWA 2EIOA 2O7KA 5GZZB 2MMZA 2MMNA 3KCMA 4V1Ap 1A2LA 3GKKA 3NIVA 4XTSA 1N8JA 3WYWA 1AQWA 1K0NA 4MCUA 4ULXA 3O3TA 4JBBA 1GUMA 4NWYA 4IJ3A 1AUCA 1R4WA 2LQQA 1KTEA 4GSSA 2CV4A 6GSXA 1LU4A 3QAVA 4MZWA 2XHFA 2JSZA 3VWVA 5KN3A 5IMZA 2C4JA 2EIQA 4J56E 3TRPA 4ID0A 2OE0A 3DEXA 6GSTA 2KUCA 2YCDA 4KA0A 2NBSA 1Y6EA 1XW6A 1FB6A 3U5RE 2CVBA 1MDKA 1R5PA 2P5QA 4J57E 4QL9A 2M72A 4CHSA 2JZTA 4Z7XA 4ML6A 4O7HA 1XFLA 5LNKe 2YWIA 2LUSA 1RQMA 4K0GA 2DBCA 2FHEA 3BD2A 4EO3A 4GQFA 4KCAA 3KTBA 2VUPA 3W6GA 3QR6A 4TVEA 1NM3A 3D0ZA 3TKQA 5D93A 1YJ6A 4HZ2A 2DSAA 1GSEA 3GX0A 1PMTA 1JZDA 1SJIA 2LJRA 1G7EA 3KGKA 2DJ1A 5D96A 5G2ZA 4Q5QA 3RPPA 1H75A 4JU5A 1VF3A 1JZRA 1X9MB 2JZRA 3NOFA 1TI3A 3M9JA 3F8UA 2BTOT 3VWUA 2IFQB 3DGQA 1OVNA 3DMLA 2HRNA 2C0FA 2DIYA 3BCKA 3RHBA 1B48A 3TKSE 3GFKA 4HUAA 2FGXA 4K7NA 2NPBA 2GVPA 3VLNA 1A2MA 1F9MA 1QGVA 5D73A 3QCPA 1Z9HA 2VCXA 1SL2B 2JACA 3H4KA 5DCGA 3GKXA 1WWJA 1Q4JA 4N0ZA 3QAGA 3IAS2 2E2MA 3GRXA 2HLSA 3ZREA 4YQVA 2HXKA 4I2UA 11GSA 4XRDA 2JU5A 3APQA 3C1RA 2C3TA 1CQHA 1XPVA 3RDWA 3TKSC 1BJXA 2X8HA 2FA4A 17GSA 3HKRA 5EVOA 4LMVA 1M2DA 1GNWA 4POBA 3TB2A 1GLQA 2V6OA 4I5QA 1XWGA 4JE1A 4PGTA 4O92A 1GSYA 1M0UA 1ZCPA 2KP2A 2TIRA 3C73A 3A2XA 2GQMA 2CAIA 1TP9A 5DQYA 3R2QA 1WRYA 3UMAA 3DVXA 2GSSA 1I9DA 3ED3A 1NHYA 3A2WA 5J9BA 2L4CA 2LTKA 4L8EA 1YQ1A 1E6BA 1X9WB 1SJZA 2X8CA 4IJIA 2LRNA 3QPMA 2LNTA 1XWCA 3DKSA 3UBKA 2OE1A 2DJJA 3C1SA 1PKZA 1SYXA 5IMFA 1EP8A 3UEMA 2DJKA 1S3CA 5ID2B 1TRUA 1B8XA 2AJQB 3DD3A 2B1KA 2KOKA 1PA3A 4DSRA 2L57A 3KTLA 2QKEA 2P5RA 2VLTA 3KMOA 2B5EA 3GL3A 3LORA 1JLWA 4D73B 2LV3A 4OCFA 1UVZA 1FHEA 3LG6A 4GSNA 1JZOA 1SKWB 4XHMA 2P31A 1DE2A 4POKA 1Z7PA 4GRFA 4MDCA 3J7Yk 2WZ9A 4RQXA 2OACA 1GSFA 1OYJA 22GSA 3M1GA 1FVJA 3IHQA 3TRQA 2H1BA 4WEYA 4IGJA 1GTUA 1U6TA 5ECNB 3CYNA 2R2JA 1XWBA 2A2RA 19GSA 1M9AA 2JADA 4XIHA 2F51A 1ERVA 2HYXA 2YV9A 2X8GA 4ZB9A 3MDKA 3D4TA 1GRXA 2OADA 2OBKA 2WJUA 1TRSA 2LRTA 1K0DA 4ECJA 4PQHA 3S9FA 4ECIA 3VWWA 1K3LA 1SKSB 1XCCA 1YF0A 3HVVA 1E2YA 3EMXA 5G31A 1AIUA 1QXHA
chains in the Genus database with same CATH superfamily
5ECKB 5G1LA 1XWKA 4HEA2 1W4VA 2H71A 4EDZA 3ERFA 5JWRB 3I9V2 3LGCA 3IHGA 2OA7A 2GS3A 1TXXA 3EU4A 2VAFA 3LJRA 5FWGA 5B8AA 3G7YA 1JZWA 1SD9A 3VURA 2IMDA 2LQOA 1TW9A 1TKDB 4O32A 3FRCA 2YOIA 4G19A 1ERTA 2I9HA 5L71A 1QK8A 4QL7A 1K0MA 3MYDA 4JEDA 1ZYQB 4YQMA 4BWSA 3KIJA 4Q5FA 3KXOA 2KHPA 3E0UA 4MJBA 4MZBA 4V1Ag 5CNWA 3QAWA 2YWOA 4GCIA 2JZSA 2GSQA 4OFMA 3ZVJD 1X0RA 4N10A 2MMAA 4KF9A 4TR3A 2B6MA 2ZCTA 2VIMA 3L4NA 2I4AA 4XRAA 3VK9A 4PTSA 1F3BA 1BG5A 3D21A 2IWTA 3A5IA 3HZ8A 4EUYA 3EC3A 4ILFA 1FO5A 3H79A 4HU9A 3ZRDA 4POLA 1SU9A 4ZL8A 2PWJA 2EC4A 2HFDA 1FOHA 2RM5A 5IM9A 3BJ5A 1B9XC 1SJ6A 4OWYA 2VCTA 1HD2A 4GF0A 2CVDA 2IMKA 5LD0A 1U3IA 1XZOA 2VCWA 5GAPD 3PINA 4KGIA 3QOUA 1WMJA 3GUSA 3WT2A 4K9ZA 1V9WA 5IO2A 5DAKB 4G2EA 4PNGA 2R0CA 4ECCA 2NTOA 3WGDA 4HQSA 1T8EB 5J41A 4XS4B 4J2FA 1V57A 2AV4A 2ES7A 4TXOA 3IE3A 2AYTA 3F4TA 4OFTA 1AXDA 5DVBA 2NDOA 2L5LA 2GTUA 1FAAA 2LJAA 4K8MA 4JR6A 1YKAA 2LNSA 5E59A 1LBKA 3TDGA 5CRWA 4KUNA 3QDNA 1PRXA 2WDUA 5BRTA 2VCZA 4DEJA 4X4JA 3VWXA 1TK5B 2GDRA 2C0GA 3KH7A 4YKFA 4A5PA 2YV7A 1T7PB 1A0FA 1O81A 4GSTA 2WS2A 5EPFA 2FNOA 2JSYA 3HJOA 2A4VA 1TI1A 2VL3A 5G5EA 2LRCA 5HFIA 5DDLA 2A2SA 4I97A 3LEFA 2QGVA 1AC1A 3DVWA 3ZL5A 4ZXGA 3GKNA 3FEUA 5H5QA 3LFLA 1F2EA 5LCZA 2VL2C 2CX4A 2R37A 2R0GA 3LXZA 3L78A 2FD3A 4NV5A 3PGTA 2R0PA 1M99A 2AAWA 2MMOA 1V40A 2F3MA 4JZQA 1NHOA 1SL1B 3HXSA 2F9SA 2H8LA 1V98A 2L5OA 13GSA 1G6WA 5F8BA 3UARA 4HSCX 4MMMA 4EIPA 3I69A 5A5KA 2K9FA 3HY2A 2FUG2 1A2JA 3LYKA 3HYPA 1U88A 1HYUA 1GULA 4CY6A 1Q98A 2B5XA 2HI7A 4N0VA 2E0QA 2QSIA 3BBYA 2IMEA 1VF4A 3KMNA 3F6DA 1T00A 2I81A 4EE0A 2FY6A 1XWAA 5CRHA 5IMVA 2V1MA 1J08A 2MBSA 4ZILA 3Q6OA 5FT3A 4E8EA 2C0DA 4PNFA 5G5FA 1ZYEA 1GTBA 1X5DA 2X64A 1PL1A 4PXOA 4WKWA 2C80A 1OC3A 3GNJA 3LW9A 4AGSA 5IOWA 2CZ2A 1QUWA 5ECPB 2O89A 2GZYA 4L5OA 1OE8A 3LWAA 2OBIA 4HS1A 5E4WA 5G30A 3SBCA 1S3AA 2H0HA 1FG4A 3ZIVA 4HU7A 2R6KA 3E9JB 2R4VA 4MH2A 1TK0B 1OKTA 4K7OA 4EXJA 2TRXA 1M9BA 9GSSA 1XOBA 1A23A 4WETA 3MWHA 4H86A 1KEBA 3R3EA 2GSTA 1OKDA 2F8FA 1THOA 5C04A 2RUFA 4TR1B 3RPNA 3TKSA 2IFQA 3CRUA 1M2AA 4MABA 2HNLA 2H6YA 3CSHA 4IW9A 5HFGA 3AY8A 4FQUA 5CRGA 4MK3A 1K0OA 3LSZA 5ECLB 1USBA 5D9XA 3J7Yb 1FB0A 1YZXA 3ZITA 3ERGA 3KM6A 3M0FA 4CDOA 3CMIA 4FH8A 3HVNA 2L6CA 3A5WA 4RI7A 1OE7A 2IPAA 4F9ZA 3FMWA 4TOPA 1X9SB 1K3YA 3LQ7A 4OCEA 4IS0A 4GXZA 2HE3A 3FHKA 1TJDA 2YN1A 4KNDA 1BQ7A 3N9JA 4FYCA 3D4MA 1QQ2A 4PURA 4FIWA 3HVSA 4OO4A 3BOAA 1XW5A 4ECBA 4N30A 5HR0A 1H4OA 3ZVJA 2RM6A 1EGOA 4IHUA 3VI7A 5IPHA 2VLVA 3VFIA 4EL1A 4IP6A 1EOGA 1B4QA 3TJKA 3W8JA 2E7PA 2LS5A 3W8SA 3O6TA 3H1NA 3HCZA 5IO0A 1XBSA 2ON7A 3M9KA 1J0FA 3EMPA 4KDYA 1Z7RA 3LYPA 2A4HA 2K8SA 3WD6A 4OFNA 3GSSA 3FZ5A 2CAQA 5DCHA 4IN0A 2H0IA 4LLRA 4IQAA 1YY7A 2EIRA 1VRSD 4BVXB 2GZZA 3C8EA 5JCWA 4FYUA 4PX1A 3F4RA 4CY8A 4TN8A 1O8WA 4I2TA 6GSSA 1AW9A 1OAZA 4L0WA 1OC9B 4MJAA 4K2DA 3EYTA 3IOSA 3HVXA 3QFAC 4ML1A 5IMAA 4WF4A 2YJ7A 3KH9A 4L0UA 3QMXA 1DSBA 4BWQA 4ZL7A 2Z9SA 2GSRA 4FYBA 4O5UA 3IRAA 5GSTA 4HI7A 1XOAA 5ID2A 2HZEA 1URMA 1R5AA 3ME8A 5F0GA 1K0AA 4O5RA 2HZEB 4Z2RA 1UN2A 2YWNA 2G2QA 1SD8A 4D73A 2N5FA 2I3YA 4AJ6A 4KDUA 2VD1A 2H6XA 3D6IA 4DSSB 3IV4A 3CSIA 4MF6A 2WRTA 2D2ZA 5DALB 3IC4A 3DXBA 5EL8A 5DJMA 3Q18A 3P7XA 4MPFA 2JL4A 2R5GA 3ZZXA 1BX9A 10GSA 3DIEA 2IMIA 2GQKA 4WR5A 1WIKA 2IIYA 4WR4A 1BYEA 4WBRD 4TRXA 4V2LA 1N2AA 4ZB6A 6GSWA 1AQVA 2REMA 1X5CA 2K18A 2C0EA 12GSA 5IMCA 5JCGA 5D9VA 2FWGA 1M3JA 3APSA 5A4WA 1RW1A 2VLUA 5F07A 1ERWA 3TOUA 5J3RA 3IDVA 1A0RP 4HQZA 3PPUA 4RQRA 1T3BA 1R7HA 5KN1A 4F03A 2V41A 3E3EA 2J9HA 3TKPA 3KD0A 1GUKA 5ELGA 2H1DA 4YAVA 4MF7A 3L9UA 3DYRA 2IMFA 1KBNA 4NAXA 3UVTA 2VM2A 3TJJA 5JWOB 4LMWA 2TRCP 3KEBA 3GSTA 4FO5A 1FVKA 5HR2A 4KX4A 3JCML 3HA9A 3GA4A 6GSYA 4F2IA 1XVWA 14GSA 1GUHA 3MNGA 2WCIA 3N5OA 3GV1A 5ECIB 2FCHA 4K7IA 2VL9A 4ISDA 2H76A 3P2AA 1ZL9A 4KSOA 2BJXA 3IK7A 2CVKA 1A24A 1YKCA 3MSZA 1XW9A 4MPGA 2RUEA 1JLVA 2C1YA 3CXGA 3GTUB 2DMLA 5EY6A 1O7UA 2NVLA 4BL7B 5IMDA 2B7JA 5HR1A 3P8WA 5AIVA 5KN2A 2HRKA 4DSQA 4G10A 1SK2A 1SK0A 5J4UA 1ZGNA 3Q74A 2DLXA 3MIXA 2O85A 2ZUPA 5ECOB 2OE3A 1TK8B 5ECSA 4WBJA 4ZB8A 1XIYA 2PVQA 1MDJA 2LEGA 5DAKA 1TU8A 1UC7A 1ZYPA 1JHBA 1HQOA 1VF1A 4XCSA 1GSUA 2FA8A 4XS4A 1A8YA 1G7OA 1J9BA 2DJ0A 1DUGA 3HZ4A 5IPGA 2N5AA 5D9WA 1O8XA 2VL2A 2ALBA 1DBYA 2OJLA 3G7JA 1QMVA 1GLPA 4IELA 2MYGA 4G0LA 4XS1A 2GZPA 1PQNA 4ZIJA 5INYA 2N5BA 1S3DA 1M7TA 2XPDA 1PGTA 3LXTA 3APOA 4K0NA 2FLSA 3HD5A 3US3A 2C3NA 1HNBA 4E8HA 4X43A 4YH2A 2PMTA 1ML6A 3EWLA 2H66A 3CRTA 3HJMA 3KP8A 4MA9A 3HDCA 4Q5NA 2HSMA 2QC7A 5B6NA 1MD3A 1Y25A 2H72A 2XBQA 1IYHA 2VM1A 5BMUA 4KSMA 3FR6A 4GQCA 1EZKA 5HFKA 1ILOA 2LSTA 3UOMA 2VCVA 3MAKA 4PQ1A 3TGZA 2H70A 2DKIA 1O85A 3PH9A 3F63A 2RIIA 3M3MA 2O8VB 5JWQB 1QFNA 4RI6A 4X0XA 4WF5A 2FWEA 4DVCA 2VCQA 4CW9A 2H74A 2YPMA 2GT5A 1GWCA 2OKAA 4ACSA 2H1AA 16GSA 1EP7A 3TJBA 4BPYA 2YZHA 1YDKA 2X99A 4YAPA 3FKFA 1CQGA 4IQ1A 3GHAA 5A4VA 2WB9A 3K8NA 3ERWA 4BIKA 4OO5A 3FZ4A 4KAEA 2A2PA 2DKHA 1TRWA 2L59A 4O5QA 5CO3A 2PN8A 2X4AA 2YP6A 3ZMKA 3C71A 3RHCA 2BMXA 3VPQA 1I5GA 5HR3A 1ON4A 3H93A 4G9HA 3GX8A 2CQ9A 5GSSA 3IR4A 2CX3A 2F8AA 2UZ8A 3GIXA 2V6KA 2DC5A 4IP1A 1XG8A 3TJFA 2PU9C 4EKZA 3KZQA 7GSSA 1Z3EA 5DQSA 4V2MA 4JRRA 3SWLA 4ZL9A 4TR4A 4I8BA 5C00A 4MJCA 2H01A 1OC8A 3ZMLA 4XS6A 3EURA 4P3YB 4K6XA 5FHIA 4NMUA 5AISA 4TR1A 4EC0A 4BVYA 2GGTA 1EWXA 5J5NA 2I1UA 1VF2A 3F3QA 1EEMA 4LL4B 4BVYB 4HOJA 5F06A 2LJKA 4KDXA 5ECRB 2LKUA 3IPZA 3BCIA 3ZTLA 4WXTA 3F3RA 2GQLA 3HHVA 1Z6NA 1ZOFA 3NZNA 1GTIA 4KCEA 4MH3A 2HT9A 3ZYWA 1PKWA 1ABAA 1TOFA 1GSSA 2YJHA 5D8IA 6GSUA 2J23A 3G7IA 4IKHA 1M2BA 3CBUA 3ZFBA 1G6YA 1VGLA 4G0KA 1FOVA 2V32A 4NV2A 4PQIA 4MLYA 1W89A 3FW2A 4HJMA 4YKGA 3IA1A 1JFUA 4ICYA 1AQXA 5B6MA 3QD9A 3WGEA 2R3XA 1K0CA 2E2GA 5H5RA 3GYKA 1B9YC 3EU3A 2K8VA 1ACVA 1A8LA 1T4ZA 3F6FA 4AJ7A 1Z5YE 1WPIA 1SKRB 2FWFA 2YWMA 1EV4A 1GNEA 2P0GA 4AF2A 4X1UA 1ST9A 1V58A 5ENUA 5JCUA 5ECHB 2DIZA 4BVXA 4TKYA 3TKRA 4HZ4A 4KE3A 1R26A 1XVQA 3FYGA 3D22A 2B3SA 4EDYA 1SYRA 1ZYNA 1NW2A 3KP9A 3ME7A 3ZLPA 4TXVA 4L5LA 1PL2A 2PUKC 1OC9A 2H73A 3RBTA 1IYIA 3GURA 1F6MC 2C3QA 2FWHA 3CTGA 1MTCA 5ECMB 5CREA 3UL3A 3DWVA 3IBHA 5IIZA 3QFBC 5IQYA 2HSHA 5B8BA 3TCOA 5KEJA 1MDIA 1PN9A 4GLTA 4EVMA 1U87A 1TDIA 2HRAA 2B5YA 2HZFA 2C8UA 1BEDA 3GH9A 2HSYA 3HJPA 1SENA 3VI5A 4Z2TA 2GLRA 1K3OA 1TRVA 1X5EA 1WP0A 3I6AA 5ECQB 2H0GA 5A4UA 4F82A 2DMMA 3O76A 5B7CA 3ZFLA 3M8NA 1PFOA 4DSSA 5CYYA 3FZAA 5DJLA 2HRFA 5IOXA 5DALA 1BAYA 1F3AA 3GL5A 1TTZA 1TU7A 2PGTA 2H30A 3KJYA 4MZCA 5AIXA 2V2GA 1YEPA 5GAND 3UAPA 2B1LA 5DBQA 1EEJA 4NXIA 4PUFC 1PX6A 4NHZA 1UA5A 2XPEA 3IXRA 2DJ2A 8GSSA 2CT6A 1PD21 5HQPA 1C72A 3GN3A 3VPTA 3IC8A 1K0BA 3IK9A 4NHWA 2VD0A 3CSJA 1WOUA 5COHA 3TUEA 4F0BA 1G0TA 4POMA 1MEKA 4EF0A 3RAZA 5G1KA 1EOHA 3F0IA 3GKMA 3F4SA 1GSDA 1LJRA 20GSA 2ZNMA 3WT1A 2XBIA 3UJ1A 4KH7A 3FK8A 3A2VA 2L4QA 1HNAA 2H19A 2MZCA 1AAZA 4K2XA 4Q5RA 1O6JA 3TRXA 18GSA 4NPBA 4KB3A 3UBLA 3CTFA 4HJ2A 3FZ9A 3EE2A 3PR8A 3UVHA 1THXA 4K1FA 3FR9A 2L6DA 2PVOC 2H1GA 3A3TA 5CAXA 2G0FA 1O73A 1B4PA 2VOCA 3EVIA 3L9VA 2AB6A 1PSQA 2K6VA 4GWRA 5F05A 2IN3A 4JR4A 2AHEA 2RLIA 4G0IA 5D9TA 5AGYA 1YEXA 4IBPA 3Q19A 2MBTA 3ZIJA 3D5JA 4KW6A 3FY7A 1F37A 2CZ3A 1GL8A 3WGXA 5ABRA 1GTAA 3GTUA 3I43A 4MP4A 1EV9A 1SK1A 5CP1A 1DE1A 1S3RA 2IJYA 4BL7A 5AN1A 1T1VA 1T4YA 4MF5A 3DRNA 3OR5A 2DJ3A 2B7KA 1SL0B 2CA8A 1YF1A 2XC2A 6GSVA 2AUVA 4OD7A 3G9BA 3H8QA 4ZBBA 3TJGA 4OMVA 2YNXA 1FW1A 4I6XA 2IL3A 3EINA 2H6ZA 4V2NA 4GTUA 4ZBAA 4RUVA 3L9SA 4F0CA 3L0HA 4K5SA 3GMFA 1Z6MA 2M46A 4ZBDA 4HDEA 2YZUA 4LA1A 5H5SA 3CQFA 1PN0A 5J9CA 1ZZYA 3C7MA 3V1WA 4YQUA 2VO4A 2GT6A 1HNCA 1MD4A 4LL1B 2M80A 1U3AA 4MJEA 5CRDA 4N11A 1GH2A 2KP1A 2ON5A 2WFCA 4PUAA 1KNGA 1GSQA 1V2AA 4IVFA 2WULA 4TXOB 5ELAA 4TW5A 1PX7A 1GP1A 3U6VA 1NSWA 4K5RA 4BA7A 1ZMAA 2H75A 3F9UA 3IAM2 1WE0A 3ISOA 1EGRA 4TR0A 3GH6A 1XXUA 3FR3A 3TOTA 2PPTA 2PERA 2PBJA 4AJ8A 3P90A 1RK4A 1ERUA 2YANA 2KLXA 2O87A 2WGRA 5KN0A 4QQ7A 1WJKA 3UIWA 2EIOA 2O7KA 5GZZB 2MMZA 2MMNA 3KCMA 4USSA 4V1Ap 1A2LA 3GKKA 3NIVA 4XTSA 1N8JA 3WYWA 1AQWA 1K0NA 4MCUA 4ULXA 3O3TA 4JBBA 1GUMA 4NWYA 4IJ3A 1AUCA 1R4WA 2LQQA 1KTEA 4GSSA 2CV4A 6GSXA 1LU4A 3QAVA 4MZWA 2XHFA 2JSZA 3VWVA 5KN3A 5IMZA 2C4JA 2QA2A 2EIQA 4J56E 3TRPA 4ID0A 2OE0A 3DEXA 6GSTA 2KUCA 2YCDA 4KA0A 2NBSA 1Y6EA 1XW6A 1FB6A 3U5RE 2CVBA 1MDKA 1R5PA 2P5QA 4J57E 4QL9A 2M72A 4CHSA 2JZTA 4Z7XA 4ML6A 4O7HA 1XFLA 5LNKe 2YWIA 2LUSA 1RQMA 4K0GA 2DBCA 2FHEA 3BD2A 4EO3A 4GQFA 4KCAA 3KTBA 2VUPA 3W6GA 3QR6A 4TVEA 1NM3A 3D0ZA 3TKQA 5D93A 1YJ6A 4HZ2A 2DSAA 1GSEA 3GX0A 1PMTA 1JZDA 1SJIA 2LJRA 1G7EA 3KGKA 2DJ1A 5D96A 5G2ZA 4Q5QA 3RPPA 1H75A 4JU5A 1VF3A 1JZRA 1X9MB 2JZRA 3NOFA 1TI3A 3M9JA 3F8UA 2BTOT 3VWUA 2QA1A 2IFQB 3DGQA 1OVNA 3DMLA 2HRNA 2C0FA 2DIYA 3BCKA 3RHBA 1B48A 3TKSE 3GFKA 4HUAA 2FGXA 4K7NA 2NPBA 2GVPA 3VLNA 1A2MA 1F9MA 1QGVA 5D73A 3QCPA 1Z9HA 2VCXA 1SL2B 2JACA 3H4KA 5DCGA 3GKXA 1WWJA 1Q4JA 4N0ZA 3QAGA 3IAS2 4MNNA 2E2MA 3GRXA 2HLSA 3ZREA 4YQVA 2HXKA 4I2UA 11GSA 4XRDA 2JU5A 3APQA 3C1RA 2C3TA 1CQHA 1XPVA 3RDWA 3TKSC 1BJXA 3EPTA 2X8HA 2FA4A 17GSA 3HKRA 5EVOA 4LMVA 1M2DA 1GNWA 4POBA 3TB2A 1GLQA 2V6OA 4I5QA 1XWGA 4JE1A 4PGTA 4O92A 1GSYA 1M0UA 1ZCPA 2KP2A 2TIRA 3C73A 3A2XA 2GQMA 2CAIA 1TP9A 1M3IA 5DQYA 3R2QA 1WRYA 3UMAA 3DVXA 2GSSA 1I9DA 2X49A 3ED3A 1NHYA 3A2WA 5J9BA 2L4CA 2LTKA 4L8EA 1YQ1A 1E6BA 1X9WB 1SJZA 2X8CA 4IJIA 5KOWA 2LRNA 3QPMA 2LNTA 1XWCA 3DKSA 3UBKA 2OE1A 2DJJA 3C1SA 1PKZA 1SYXA 4EIQA 5IMFA 1EP8A 3UEMA 2DJKA 1S3CA 5ID2B 1TRUA 1B8XA 2AJQB 3DD3A 2B1KA 2KOKA 1PA3A 4DSRA 2L57A 3KTLA 2QKEA 2P5RA 2VLTA 3KMOA 2B5EA 3GL3A 5KOXA 3LORA 1JLWA 4D73B 2LV3A 4OCFA 1UVZA 1FHEA 3LG6A 4GSNA 1JZOA 1SKWB 4XHMA 2P31A 1DE2A 4POKA 1Z7PA 4GRFA 4MDCA 3J7Yk 2WZ9A 4RQXA 2OACA 1GSFA 1OYJA 22GSA 3M1GA 1FVJA 3IHQA 3TRQA 2H1BA 4WEYA 4IGJA 1GTUA 1U6TA 5ECNB 3CYNA 2R2JA 1XWBA 2A2RA 19GSA 1M9AA 2JADA 4XIHA 2F51A 1ERVA 2HYXA 2YV9A 2X8GA 4ZB9A 3MDKA 3D4TA 1GRXA 2OADA 2OBKA 2WJUA 1TRSA 2LRTA 1K0DA 4ECJA 4PQHA 4Z2UA 3S9FA 4ECIA 3VWWA 1K3LA 1SKSB 1XCCA 1YF0A 3HVVA 1E2YA 3EMXA 5G31A 1AIUA 1QXHA
chains in the Genus database with same CATH topology
5ECKB 5G1LA 1XWKA 4HEA2 1W4VA 2H71A 4EDZA 3ERFA 5JWRB 3I9V2 3LGCA 3IHGA 2OA7A 2GS3A 1TXXA 3EU4A 2VAFA 3LJRA 5FWGA 5B8AA 3G7YA 1JZWA 1SD9A 3VURA 2IMDA 2LQOA 1TW9A 1TKDB 4O32A 3FRCA 2YOIA 4G19A 1ERTA 2I9HA 5L71A 1QK8A 4QL7A 1K0MA 3MYDA 4JEDA 1ZYQB 4YQMA 4BWSA 3KIJA 4Q5FA 3KXOA 2KHPA 3E0UA 4MJBA 4MZBA 4V1Ag 5CNWA 3QAWA 2YWOA 4GCIA 2JZSA 2GSQA 4OFMA 3ZVJD 1X0RA 4N10A 2MMAA 4KF9A 4TR3A 2B6MA 2ZCTA 2VIMA 3L4NA 2I4AA 4XRAA 3VK9A 4PTSA 1F3BA 1BG5A 3D21A 2IWTA 3A5IA 3HZ8A 4EUYA 3EC3A 4ILFA 1FO5A 3H79A 4HU9A 3ZRDA 4POLA 1SU9A 4ZL8A 2PWJA 2EC4A 2HFDA 1FOHA 2RM5A 5IM9A 3BJ5A 1B9XC 1SJ6A 4OWYA 2VCTA 1HD2A 4GF0A 2CVDA 2IMKA 5LD0A 1U3IA 1XZOA 2VCWA 5GAPD 3PINA 4KGIA 3QOUA 1WMJA 3GUSA 3WT2A 4K9ZA 1V9WA 5IO2A 5DAKB 4G2EA 4PNGA 2R0CA 4ECCA 2NTOA 3WGDA 4HQSA 1T8EB 5J41A 4XS4B 4J2FA 1V57A 2AV4A 2ES7A 4TXOA 3IE3A 2AYTA 3F4TA 4OFTA 1AXDA 5DVBA 2NDOA 2L5LA 2GTUA 1FAAA 2LJAA 4K8MA 4JR6A 1YKAA 2LNSA 5E59A 1LBKA 3TDGA 5CRWA 4KUNA 3QDNA 1PRXA 2WDUA 5BRTA 2VCZA 4DEJA 4X4JA 3VWXA 1TK5B 2GDRA 2C0GA 3KH7A 4YKFA 4A5PA 2YV7A 1T7PB 1A0FA 1O81A 4GSTA 2WS2A 5EPFA 2FNOA 2JSYA 3HJOA 2A4VA 1TI1A 2VL3A 5G5EA 2LRCA 5HFIA 5DDLA 2A2SA 4I97A 3LEFA 2QGVA 1AC1A 3DVWA 3ZL5A 4ZXGA 3GKNA 3FEUA 5H5QA 3LFLA 1F2EA 5LCZA 2VL2C 2CX4A 2R37A 2R0GA 3LXZA 3L78A 2FD3A 4NV5A 3PGTA 2R0PA 1M99A 2AAWA 2MMOA 1V40A 2F3MA 4JZQA 1NHOA 1SL1B 3HXSA 2F9SA 2H8LA 1V98A 2L5OA 13GSA 1G6WA 5F8BA 3UARA 4MMMA 4EIPA 3I69A 5A5KA 2K9FA 3HY2A 2FUG2 1A2JA 3LYKA 3HYPA 1U88A 1HYUA 1GULA 4CY6A 1Q98A 2B5XA 2HI7A 4N0VA 2E0QA 2QSIA 3BBYA 2IMEA 1VF4A 3KMNA 3F6DA 1T00A 2I81A 4EE0A 2FY6A 1XWAA 5CRHA 5IMVA 2V1MA 1J08A 2MBSA 4ZILA 3Q6OA 5FT3A 4E8EA 2C0DA 4PNFA 5G5FA 1ZYEA 1GTBA 1X5DA 2X64A 1PL1A 4PXOA 4WKWA 2C80A 1OC3A 3GNJA 3LW9A 4AGSA 5IOWA 2CZ2A 1QUWA 5ECPB 2O89A 2GZYA 4L5OA 1OE8A 3LWAA 2OBIA 4HS1A 5E4WA 5G30A 3SBCA 1S3AA 2H0HA 1FG4A 3ZIVA 4HU7A 2R6KA 3E9JB 2R4VA 4MH2A 1TK0B 1OKTA 4K7OA 4EXJA 2TRXA 1M9BA 9GSSA 1XOBA 1A23A 4WETA 3MWHA 4H86A 1KEBA 3R3EA 2GSTA 1OKDA 2F8FA 1THOA 5C04A 2RUFA 4TR1B 3RPNA 3TKSA 2IFQA 3CRUA 1M2AA 4MABA 2HNLA 2H6YA 3CSHA 4IW9A 5HFGA 3AY8A 4FQUA 5CRGA 4MK3A 1K0OA 3LSZA 5ECLB 1USBA 5D9XA 3J7Yb 1FB0A 1YZXA 3ZITA 3ERGA 3KM6A 3M0FA 4CDOA 3CMIA 4FH8A 2L6CA 3A5WA 4RI7A 1OE7A 2IPAA 4F9ZA 3FMWA 4TOPA 1X9SB 1K3YA 3LQ7A 4OCEA 4IS0A 4GXZA 2HE3A 3FHKA 1TJDA 2YN1A 4KNDA 1BQ7A 3N9JA 4FYCA 3D4MA 1QQ2A 4PURA 4FIWA 3HVSA 4OO4A 3BOAA 1XW5A 4ECBA 4N30A 5HR0A 1H4OA 3ZVJA 2RM6A 1EGOA 4IHUA 3VI7A 5IPHA 2VLVA 3VFIA 4EL1A 4IP6A 1EOGA 1B4QA 3TJKA 3W8JA 2E7PA 2LS5A 3W8SA 3O6TA 3H1NA 3HCZA 5IO0A 1XBSA 2ON7A 3M9KA 1J0FA 3EMPA 4KDYA 1Z7RA 3LYPA 2A4HA 2K8SA 3WD6A 4OFNA 3GSSA 3FZ5A 2CAQA 5DCHA 4IN0A 2H0IA 4LLRA 4IQAA 1YY7A 2EIRA 1VRSD 4BVXB 2GZZA 3C8EA 5JCWA 4FYUA 4PX1A 3F4RA 4CY8A 4TN8A 1O8WA 4I2TA 6GSSA 1AW9A 1OAZA 4L0WA 1OC9B 4MJAA 4K2DA 3EYTA 3IOSA 3HVXA 3QFAC 4ML1A 5IMAA 4WF4A 2YJ7A 3KH9A 4L0UA 3QMXA 1DSBA 4BWQA 4ZL7A 2Z9SA 2GSRA 4FYBA 4O5UA 3IRAA 5GSTA 4HI7A 1XOAA 5ID2A 2HZEA 1URMA 1R5AA 3ME8A 5F0GA 1K0AA 4O5RA 2HZEB 4Z2RA 1UN2A 2YWNA 2G2QA 1SD8A 4D73A 2N5FA 2I3YA 4AJ6A 4KDUA 2VD1A 2H6XA 3D6IA 4DSSB 3IV4A 3CSIA 4MF6A 2WRTA 2D2ZA 5DALB 3IC4A 3DXBA 5EL8A 5DJMA 3Q18A 3P7XA 4MPFA 2JL4A 2R5GA 3ZZXA 1BX9A 10GSA 3DIEA 2IMIA 2GQKA 4WR5A 1WIKA 2IIYA 4WR4A 1BYEA 4WBRD 4TRXA 4V2LA 1N2AA 4ZB6A 6GSWA 1AQVA 2REMA 1X5CA 2K18A 2C0EA 12GSA 5IMCA 5JCGA 5D9VA 2FWGA 3APSA 5A4WA 1RW1A 2VLUA 5F07A 1ERWA 3TOUA 5J3RA 3IDVA 1A0RP 4HQZA 3PPUA 4RQRA 1T3BA 1R7HA 5KN1A 4F03A 2V41A 3E3EA 2J9HA 3TKPA 3KD0A 1GUKA 5ELGA 2H1DA 4YAVA 4MF7A 3L9UA 3DYRA 2IMFA 1KBNA 4NAXA 3UVTA 2VM2A 3TJJA 5JWOB 4LMWA 2TRCP 3KEBA 3GSTA 4FO5A 1FVKA 5HR2A 4KX4A 3JCML 3HA9A 3GA4A 6GSYA 4F2IA 1XVWA 14GSA 1GUHA 3MNGA 2WCIA 3N5OA 3GV1A 5ECIB 2FCHA 4K7IA 2VL9A 4ISDA 2H76A 3P2AA 1ZL9A 4KSOA 2BJXA 3IK7A 2CVKA 1A24A 1YKCA 3MSZA 1XW9A 4MPGA 2RUEA 1JLVA 2C1YA 3CXGA 3GTUB 2DMLA 5EY6A 1O7UA 2NVLA 4BL7B 5IMDA 2B7JA 5HR1A 3P8WA 5AIVA 5KN2A 2HRKA 4DSQA 4G10A 1SK2A 1SK0A 5J4UA 1ZGNA 3Q74A 2DLXA 3MIXA 2O85A 2ZUPA 5ECOB 2OE3A 1TK8B 5ECSA 4WBJA 4ZB8A 1XIYA 2PVQA 1MDJA 2LEGA 5DAKA 1TU8A 1UC7A 1ZYPA 1JHBA 1HQOA 1VF1A 4XCSA 1GSUA 2FA8A 4XS4A 1A8YA 1G7OA 1J9BA 2DJ0A 1DUGA 3HZ4A 5IPGA 2N5AA 5D9WA 1O8XA 2VL2A 2ALBA 1DBYA 2OJLA 3G7JA 1QMVA 1GLPA 4IELA 2MYGA 4G0LA 4XS1A 2GZPA 1PQNA 4ZIJA 5INYA 2N5BA 1S3DA 1M7TA 2XPDA 1PGTA 3LXTA 3APOA 4K0NA 2FLSA 3HD5A 3US3A 2C3NA 1HNBA 4E8HA 4X43A 4YH2A 2PMTA 1ML6A 3EWLA 2H66A 3CRTA 3HJMA 3KP8A 4MA9A 3HDCA 4Q5NA 2HSMA 2QC7A 5B6NA 1MD3A 1Y25A 2H72A 2XBQA 1IYHA 2VM1A 5BMUA 4KSMA 3FR6A 4GQCA 1EZKA 5HFKA 1ILOA 2LSTA 3UOMA 2VCVA 3MAKA 4PQ1A 3TGZA 2H70A 2DKIA 1O85A 3PH9A 3F63A 2RIIA 3M3MA 2O8VB 5JWQB 1QFNA 4RI6A 4X0XA 4WF5A 2FWEA 4DVCA 2VCQA 4CW9A 2H74A 2YPMA 2GT5A 1GWCA 2OKAA 4ACSA 2H1AA 16GSA 1EP7A 3TJBA 4BPYA 2YZHA 1YDKA 2X99A 4YAPA 3FKFA 1CQGA 4IQ1A 3GHAA 5A4VA 2WB9A 3K8NA 3ERWA 4OO5A 3FZ4A 4KAEA 2A2PA 2DKHA 1TRWA 2L59A 4O5QA 5CO3A 2PN8A 2X4AA 2YP6A 3ZMKA 3C71A 3RHCA 2BMXA 3VPQA 1I5GA 5HR3A 1ON4A 3H93A 4G9HA 3GX8A 2CQ9A 5GSSA 3IR4A 2CX3A 2F8AA 2UZ8A 3GIXA 2V6KA 2DC5A 4IP1A 3TJFA 2PU9C 4EKZA 3KZQA 7GSSA 1Z3EA 5DQSA 4V2MA 4JRRA 3SWLA 4ZL9A 4TR4A 4I8BA 5C00A 4MJCA 2H01A 1OC8A 3ZMLA 4XS6A 3EURA 4P3YB 4K6XA 5FHIA 4NMUA 5AISA 4TR1A 4EC0A 4BVYA 2GGTA 1EWXA 5J5NA 2I1UA 1VF2A 3F3QA 1EEMA 4LL4B 4BVYB 4HOJA 5F06A 2LJKA 4KDXA 5ECRB 2LKUA 3IPZA 3BCIA 3ZTLA 4WXTA 3F3RA 2GQLA 3HHVA 1Z6NA 1ZOFA 3NZNA 1GTIA 4KCEA 4MH3A 2HT9A 3ZYWA 1PKWA 1ABAA 1TOFA 1GSSA 2YJHA 5D8IA 6GSUA 2J23A 3G7IA 4IKHA 1M2BA 3CBUA 3ZFBA 1G6YA 1VGLA 4G0KA 1FOVA 2V32A 4NV2A 4PQIA 4MLYA 1W89A 3FW2A 4HJMA 4YKGA 3IA1A 1JFUA 4ICYA 1AQXA 5B6MA 3QD9A 3WGEA 2R3XA 1K0CA 2E2GA 5H5RA 3GYKA 1B9YC 3EU3A 2K8VA 1ACVA 1A8LA 1T4ZA 3F6FA 4AJ7A 1Z5YE 1WPIA 1SKRB 2FWFA 2YWMA 1EV4A 1GNEA 2P0GA 4AF2A 4X1UA 1ST9A 1V58A 5ENUA 5JCUA 5ECHB 2DIZA 4BVXA 4TKYA 3TKRA 4HZ4A 4KE3A 1R26A 1XVQA 3FYGA 3D22A 2B3SA 4EDYA 1SYRA 1ZYNA 1NW2A 3KP9A 3ME7A 3ZLPA 4TXVA 4L5LA 1PL2A 2PUKC 1OC9A 2H73A 3RBTA 1IYIA 3GURA 1F6MC 2C3QA 2FWHA 3CTGA 1MTCA 5ECMB 5CREA 3UL3A 3DWVA 3IBHA 5IIZA 3QFBC 5IQYA 2HSHA 5B8BA 3TCOA 5KEJA 1MDIA 1PN9A 4GLTA 4EVMA 1U87A 1TDIA 2HRAA 2B5YA 2HZFA 2C8UA 1BEDA 3GH9A 2HSYA 3HJPA 1SENA 3VI5A 4Z2TA 2GLRA 1K3OA 1TRVA 1X5EA 1WP0A 3I6AA 5ECQB 2H0GA 5A4UA 4F82A 2DMMA 3O76A 5B7CA 3ZFLA 3M8NA 4DSSA 5CYYA 3FZAA 5DJLA 2HRFA 5IOXA 5DALA 1BAYA 1F3AA 3GL5A 1TTZA 1TU7A 2PGTA 2H30A 3KJYA 4MZCA 5AIXA 2V2GA 1YEPA 5GAND 3UAPA 2B1LA 5DBQA 1EEJA 4NXIA 4PUFC 1PX6A 4NHZA 1UA5A 2XPEA 3IXRA 2DJ2A 8GSSA 2CT6A 1PD21 5HQPA 1C72A 3GN3A 3VPTA 3IC8A 1K0BA 3IK9A 4NHWA 2VD0A 3CSJA 1WOUA 5COHA 3TUEA 4F0BA 1G0TA 4POMA 1MEKA 4EF0A 3RAZA 5G1KA 1EOHA 3F0IA 3GKMA 3F4SA 1GSDA 1LJRA 20GSA 2ZNMA 3WT1A 2XBIA 3UJ1A 4KH7A 3FK8A 3A2VA 2L4QA 1HNAA 2H19A 2MZCA 1AAZA 4K2XA 4Q5RA 1O6JA 3TRXA 18GSA 4NPBA 4KB3A 3UBLA 3CTFA 4HJ2A 3FZ9A 3EE2A 3PR8A 3UVHA 1THXA 4K1FA 3FR9A 2L6DA 2PVOC 2H1GA 3A3TA 5CAXA 2G0FA 1O73A 1B4PA 2VOCA 3EVIA 3L9VA 2AB6A 1PSQA 2K6VA 4GWRA 5F05A 2IN3A 4JR4A 2AHEA 2RLIA 4G0IA 5D9TA 5AGYA 1YEXA 4IBPA 3Q19A 2MBTA 3ZIJA 3D5JA 4KW6A 3FY7A 1F37A 2CZ3A 1GL8A 3WGXA 5ABRA 1GTAA 3GTUA 3I43A 4MP4A 1EV9A 1SK1A 5CP1A 1DE1A 2IJYA 4BL7A 5AN1A 1T1VA 1T4YA 4MF5A 3DRNA 3OR5A 2DJ3A 2B7KA 1SL0B 2CA8A 1YF1A 2XC2A 6GSVA 2AUVA 4OD7A 3G9BA 3H8QA 4ZBBA 3TJGA 4OMVA 2YNXA 1FW1A 4I6XA 2IL3A 3EINA 2H6ZA 4V2NA 4GTUA 4ZBAA 4RUVA 3L9SA 4F0CA 3L0HA 4K5SA 3GMFA 1Z6MA 2M46A 4ZBDA 4HDEA 2YZUA 4LA1A 5H5SA 1PN0A 5J9CA 1ZZYA 3C7MA 3V1WA 4YQUA 2VO4A 2GT6A 1HNCA 1MD4A 4LL1B 2M80A 1U3AA 4MJEA 5CRDA 4N11A 1GH2A 2KP1A 2ON5A 2WFCA 4PUAA 1KNGA 1GSQA 1V2AA 4IVFA 2WULA 4TXOB 5ELAA 4TW5A 1PX7A 1GP1A 3U6VA 1NSWA 4K5RA 4BA7A 1ZMAA 2H75A 3F9UA 3IAM2 1WE0A 3ISOA 1EGRA 4TR0A 3GH6A 1XXUA 3FR3A 3TOTA 2PPTA 2PERA 2PBJA 4AJ8A 3P90A 1RK4A 1ERUA 2YANA 2KLXA 2O87A 2WGRA 5KN0A 4QQ7A 1WJKA 3UIWA 2EIOA 2O7KA 5GZZB 2MMZA 2MMNA 3KCMA 4USSA 4V1Ap 1A2LA 3GKKA 3NIVA 4XTSA 1N8JA 3WYWA 1AQWA 1K0NA 4MCUA 4ULXA 3O3TA 4JBBA 1GUMA 4NWYA 4IJ3A 1AUCA 1R4WA 2LQQA 1KTEA 4GSSA 2CV4A 6GSXA 1LU4A 3QAVA 4MZWA 2XHFA 2JSZA 3VWVA 5KN3A 5IMZA 2C4JA 2QA2A 2EIQA 4J56E 3TRPA 4ID0A 2OE0A 3DEXA 6GSTA 2KUCA 2YCDA 4KA0A 2NBSA 1Y6EA 1XW6A 1FB6A 3U5RE 2CVBA 1MDKA 1R5PA 2P5QA 4J57E 4QL9A 2M72A 4CHSA 2JZTA 4Z7XA 4ML6A 4O7HA 1XFLA 5LNKe 2YWIA 2LUSA 1RQMA 4K0GA 2DBCA 2FHEA 3BD2A 4EO3A 4GQFA 4KCAA 3KTBA 2VUPA 3W6GA 3QR6A 4TVEA 1NM3A 3D0ZA 3TKQA 5D93A 1YJ6A 4HZ2A 2DSAA 1GSEA 3GX0A 1PMTA 1JZDA 1SJIA 2LJRA 1G7EA 3KGKA 2DJ1A 5D96A 5G2ZA 4Q5QA 3RPPA 1H75A 4JU5A 1VF3A 1JZRA 1X9MB 2JZRA 3NOFA 1TI3A 3M9JA 3F8UA 2BTOT 3VWUA 2QA1A 2IFQB 3DGQA 1OVNA 3DMLA 2HRNA 2C0FA 2DIYA 3BCKA 3RHBA 1B48A 3TKSE 3GFKA 4HUAA 2FGXA 4K7NA 2NPBA 2GVPA 3VLNA 1A2MA 1F9MA 1QGVA 5D73A 3QCPA 1Z9HA 2VCXA 1SL2B 2JACA 3H4KA 5DCGA 3GKXA 1WWJA 1Q4JA 4N0ZA 3QAGA 3IAS2 4MNNA 2E2MA 3GRXA 2HLSA 3ZREA 4YQVA 2HXKA 4I2UA 11GSA 4XRDA 2JU5A 3APQA 3C1RA 2C3TA 1CQHA 1XPVA 3RDWA 3TKSC 1BJXA 3EPTA 2X8HA 2FA4A 17GSA 3HKRA 5EVOA 4LMVA 1M2DA 1GNWA 4POBA 3TB2A 1GLQA 2V6OA 4I5QA 1XWGA 4JE1A 4PGTA 4O92A 1GSYA 1M0UA 1ZCPA 2KP2A 2TIRA 3C73A 3A2XA 2GQMA 2CAIA 1TP9A 5DQYA 3R2QA 1WRYA 3UMAA 3DVXA 2GSSA 1I9DA 2X49A 3ED3A 1NHYA 3A2WA 5J9BA 2L4CA 2LTKA 4L8EA 1YQ1A 1E6BA 1X9WB 1SJZA 2X8CA 4IJIA 5KOWA 2LRNA 3QPMA 2LNTA 1XWCA 3DKSA 3UBKA 2OE1A 2DJJA 3C1SA 1PKZA 1SYXA 4EIQA 5IMFA 1EP8A 3UEMA 2DJKA 1S3CA 5ID2B 1TRUA 1B8XA 2AJQB 3DD3A 2B1KA 2KOKA 1PA3A 4DSRA 2L57A 3KTLA 2QKEA 2P5RA 2VLTA 3KMOA 2B5EA 3GL3A 5KOXA 3LORA 1JLWA 4D73B 2LV3A 4OCFA 1UVZA 1FHEA 3LG6A 4GSNA 1JZOA 1SKWB 4XHMA 2P31A 1DE2A 4POKA 1Z7PA 4GRFA 4MDCA 3J7Yk 2WZ9A 4RQXA 2OACA 1GSFA 1OYJA 22GSA 3M1GA 1FVJA 3IHQA 3TRQA 2H1BA 4WEYA 4IGJA 1GTUA 1U6TA 5ECNB 3CYNA 2R2JA 1XWBA 2A2RA 19GSA 1M9AA 2JADA 4XIHA 2F51A 1ERVA 2HYXA 2YV9A 2X8GA 4ZB9A 3MDKA 3D4TA 1GRXA 2OADA 2OBKA 2WJUA 1TRSA 2LRTA 1K0DA 4ECJA 4PQHA 4Z2UA 3S9FA 4ECIA 3VWWA 1K3LA 1SKSB 1XCCA 1YF0A 3HVVA 1E2YA 3EMXA 5G31A 1AIUA 1QXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECK B;  5G1L A;  1XWK A;  4HEA 2;  1W4V A;  2H71 A;  4EDZ A;  3ERF A;  5JWR B;  3I9V 2;  3LGC A;  2OA7 A;  2GS3 A;  1TXX A;  3EU4 A;  2VAF A;  3LJR A;  5FWG A;  5B8A A;  3G7Y A;  1JZW A;  1SD9 A;  3VUR A;  2IMD A;  2LQO A;  1TW9 A;  1TKD B;  4O32 A;  3FRC A;  2YOI A;  4G19 A;  1ERT A;  2I9H A;  5L71 A;  1QK8 A;  4QL7 A;  1K0M A;  4JED A;  1ZYQ B;  4YQM A;  4BWS A;  3KIJ A;  4Q5F A;  3KXO A;  2KHP A;  3E0U A;  4MJB A;  4MZB A;  4V1A g;  5CNW A;  3QAW A;  2YWO A;  4GCI A;  2JZS A;  2GSQ A;  4OFM A;  3ZVJ D;  1X0R A;  4N10 A;  2MMA A;  4TR3 A;  2B6M A;  2ZCT A;  2VIM A;  3L4N A;  2I4A A;  4XRA A;  3VK9 A;  1F3B A;  1BG5 A;  3D21 A;  2IWT A;  3HZ8 A;  4EUY A;  3EC3 A;  4ILF A;  1FO5 A;  3H79 A;  4HU9 A;  3ZRD A;  4POL A;  1SU9 A;  4ZL8 A;  2PWJ A;  2EC4 A;  2HFD A;  2RM5 A;  5IM9 A;  3BJ5 A;  1B9X C;  1SJ6 A;  4OWY A;  2VCT A;  1HD2 A;  4GF0 A;  2CVD A;  2IMK A;  5LD0 A;  1U3I A;  1XZO A;  2VCW A;  5GAP D;  3PIN A;  4KGI A;  3QOU A;  1WMJ A;  3GUS A;  3WT2 A;  4K9Z A;  1V9W A;  5IO2 A;  5DAK B;  4G2E A;  4PNG A;  4ECC A;  2NTO A;  3WGD A;  4HQS A;  1T8E B;  5J41 A;  4XS4 B;  4J2F A;  1V57 A;  2AV4 A;  2ES7 A;  4TXO A;  3IE3 A;  2AYT A;  3F4T A;  4OFT A;  1AXD A;  5DVB A;  2NDO A;  2L5L A;  2GTU A;  1FAA A;  2LJA A;  4K8M A;  4JR6 A;  1YKA A;  2LNS A;  5E59 A;  1LBK A;  3TDG A;  5CRW A;  4KUN A;  3QDN A;  1PRX A;  2WDU A;  2VCZ A;  4DEJ A;  3VWX A;  1TK5 B;  2GDR A;  2C0G A;  3KH7 A;  2YV7 A;  1T7P B;  1A0F A;  1O81 A;  4GST A;  2WS2 A;  5EPF A;  2FNO A;  2JSY A;  3HJO A;  2A4V A;  1TI1 A;  2VL3 A;  5G5E A;  2LRC A;  5HFI A;  5DDL A;  2A2S A;  4I97 A;  3LEF A;  2QGV A;  1AC1 A;  3DVW A;  3ZL5 A;  4ZXG A;  3GKN A;  3FEU A;  5H5Q A;  3LFL A;  1F2E A;  5LCZ A;  2VL2 C;  2CX4 A;  2R37 A;  3LXZ A;  3L78 A;  2FD3 A;  4NV5 A;  3PGT A;  1M99 A;  2AAW A;  2MMO A;  1V40 A;  2F3M A;  4JZQ A;  1NHO A;  1SL1 B;  3HXS A;  2F9S A;  2H8L A;  1V98 A;  2L5O A;  13GS A;  1G6W A;  5F8B A;  3UAR A;  4MMM A;  3I69 A;  5A5K A;  2K9F A;  3HY2 A;  2FUG 2;  1A2J A;  3LYK A;  3HYP A;  1U88 A;  1HYU A;  1GUL A;  1Q98 A;  2B5X A;  2HI7 A;  4N0V A;  2E0Q A;  2QSI A;  3BBY A;  2IME A;  1VF4 A;  3KMN A;  3F6D A;  1T00 A;  2I81 A;  4EE0 A;  2FY6 A;  1XWA A;  5CRH A;  5IMV A;  2V1M A;  1J08 A;  2MBS A;  4ZIL A;  3Q6O A;  5FT3 A;  4E8E A;  2C0D A;  4PNF A;  5G5F A;  1ZYE A;  1GTB A;  1X5D A;  2X64 A;  1PL1 A;  4PXO A;  4WKW A;  2C80 A;  1OC3 A;  3GNJ A;  4AGS A;  5IOW A;  2CZ2 A;  1QUW A;  5ECP B;  2O89 A;  2GZY A;  4L5O A;  1OE8 A;  3LWA A;  2OBI A;  4HS1 A;  5E4W A;  5G30 A;  3SBC A;  1S3A A;  2H0H A;  1FG4 A;  3ZIV A;  4HU7 A;  2R6K A;  3E9J B;  2R4V A;  4MH2 A;  1TK0 B;  1OKT A;  4K7O A;  4EXJ A;  2TRX A;  1M9B A;  9GSS A;  1XOB A;  1A23 A;  4WET A;  3MWH A;  4H86 A;  1KEB A;  2GST A;  1OKD A;  2F8F A;  1THO A;  5C04 A;  2RUF A;  4TR1 B;  3RPN A;  3TKS A;  2IFQ A;  3CRU A;  1M2A A;  4MAB A;  2HNL A;  2H6Y A;  3CSH A;  4IW9 A;  5HFG A;  3AY8 A;  5CRG A;  4MK3 A;  1K0O A;  3LSZ A;  5ECL B;  1USB A;  5D9X A;  3J7Y b;  1FB0 A;  1YZX A;  3ZIT A;  3ERG A;  3KM6 A;  3M0F A;  4CDO A;  3CMI A;  4FH8 A;  2L6C A;  3A5W A;  4RI7 A;  1OE7 A;  2IPA A;  4F9Z A;  4TOP A;  1X9S B;  1K3Y A;  3LQ7 A;  4OCE A;  4IS0 A;  4GXZ A;  2HE3 A;  3FHK A;  1TJD A;  2YN1 A;  4KND A;  1BQ7 A;  3N9J A;  4FYC A;  3D4M A;  1QQ2 A;  4PUR A;  4FIW A;  3HVS A;  4OO4 A;  3BOA A;  1XW5 A;  4ECB A;  4N30 A;  5HR0 A;  1H4O A;  3ZVJ A;  2RM6 A;  1EGO A;  4IHU A;  3VI7 A;  5IPH A;  2VLV A;  3VFI A;  4EL1 A;  4IP6 A;  1EOG A;  1B4Q A;  3TJK A;  3W8J A;  2E7P A;  2LS5 A;  3W8S A;  3O6T A;  3H1N A;  3HCZ A;  5IO0 A;  1XBS A;  2ON7 A;  3M9K A;  1J0F A;  3EMP A;  4KDY A;  1Z7R A;  3LYP A;  2K8S A;  3WD6 A;  4OFN A;  3GSS A;  3FZ5 A;  2CAQ A;  5DCH A;  4IN0 A;  2H0I A;  4LLR A;  4IQA A;  1YY7 A;  2EIR A;  1VRS D;  2GZZ A;  3C8E A;  5JCW A;  4FYU A;  4PX1 A;  3F4R A;  4TN8 A;  1O8W A;  4I2T A;  6GSS A;  1AW9 A;  1OAZ A;  4L0W A;  1OC9 B;  4MJA A;  4K2D A;  3EYT A;  3IOS A;  3HVX A;  3QFA C;  4ML1 A;  5IMA A;  4WF4 A;  2YJ7 A;  3KH9 A;  4L0U A;  3QMX A;  1DSB A;  4BWQ A;  4ZL7 A;  2Z9S A;  2GSR A;  4FYB A;  3IRA A;  5GST A;  4HI7 A;  1XOA A;  5ID2 A;  2HZE A;  1URM A;  1R5A A;  3ME8 A;  5F0G A;  1K0A A;  4O5R A;  2HZE B;  1UN2 A;  2YWN A;  2G2Q A;  1SD8 A;  4D73 A;  2N5F A;  2I3Y A;  4AJ6 A;  4KDU A;  2VD1 A;  2H6X A;  3D6I A;  4DSS B;  3IV4 A;  3CSI A;  4MF6 A;  2WRT A;  2D2Z A;  5DAL B;  3IC4 A;  3DXB A;  5EL8 A;  5DJM A;  3Q18 A;  3P7X A;  4MPF A;  2JL4 A;  2R5G A;  3ZZX A;  1BX9 A;  10GS A;  3DIE A;  2IMI A;  2GQK A;  4WR5 A;  1WIK A;  2IIY A;  4WR4 A;  1BYE A;  4WBR D;  4TRX A;  4V2L A;  1N2A A;  4ZB6 A;  6GSW A;  1AQV A;  2REM A;  1X5C A;  2K18 A;  2C0E A;  12GS A;  5IMC A;  5JCG A;  5D9V A;  2FWG A;  3APS A;  5A4W A;  1RW1 A;  2VLU A;  5F07 A;  1ERW A;  3TOU A;  5J3R A;  3IDV A;  1A0R P;  4HQZ A;  4RQR A;  1T3B A;  1R7H A;  5KN1 A;  4F03 A;  2V41 A;  3E3E A;  2J9H A;  3TKP A;  3KD0 A;  1GUK A;  5ELG A;  2H1D A;  4YAV A;  4MF7 A;  3L9U A;  3DYR A;  2IMF A;  1KBN A;  4NAX A;  3UVT A;  2VM2 A;  3TJJ A;  5JWO B;  4LMW A;  2TRC P;  3KEB A;  3GST A;  4FO5 A;  1FVK A;  5HR2 A;  4KX4 A;  3JCM L;  3HA9 A;  3GA4 A;  6GSY A;  4F2I A;  1XVW A;  14GS A;  1GUH A;  3MNG A;  2WCI A;  3N5O A;  3GV1 A;  5ECI B;  2FCH A;  4K7I A;  2VL9 A;  4ISD A;  2H76 A;  3P2A A;  1ZL9 A;  4KSO A;  2BJX A;  3IK7 A;  2CVK A;  1A24 A;  1YKC A;  3MSZ A;  1XW9 A;  4MPG A;  2RUE A;  1JLV A;  2C1Y A;  3CXG A;  3GTU B;  2DML A;  5EY6 A;  1O7U A;  2NVL A;  5IMD A;  2B7J A;  5HR1 A;  3P8W A;  5AIV A;  5KN2 A;  4DSQ A;  4G10 A;  1SK2 A;  1SK0 A;  5J4U A;  1ZGN A;  3Q74 A;  2DLX A;  2O85 A;  2ZUP A;  5ECO B;  2OE3 A;  1TK8 B;  5ECS A;  4WBJ A;  4ZB8 A;  1XIY A;  2PVQ A;  1MDJ A;  2LEG A;  5DAK A;  1TU8 A;  1UC7 A;  1JHB A;  1HQO A;  1VF1 A;  4XCS A;  1GSU A;  2FA8 A;  4XS4 A;  1A8Y A;  1G7O A;  1J9B A;  2DJ0 A;  1DUG A;  3HZ4 A;  5IPG A;  2N5A A;  5D9W A;  1O8X A;  2VL2 A;  2ALB A;  1DBY A;  2OJL A;  3G7J A;  1QMV A;  1GLP A;  4IEL A;  2MYG A;  4XS1 A;  2GZP A;  1PQN A;  4ZIJ A;  5INY A;  2N5B A;  1S3D A;  1M7T A;  2XPD A;  1PGT A;  3LXT A;  3APO A;  4K0N A;  2FLS A;  3HD5 A;  3US3 A;  2C3N A;  1HNB A;  4E8H A;  4X43 A;  4YH2 A;  2PMT A;  1ML6 A;  3EWL A;  2H66 A;  3CRT A;  3HJM A;  3KP8 A;  4MA9 A;  3HDC A;  4Q5N A;  5B6N A;  2QC7 A;  1MD3 A;  1Y25 A;  2H72 A;  2XBQ A;  1IYH A;  2VM1 A;  4KSM A;  3FR6 A;  4GQC A;  1EZK A;  5HFK A;  1ILO A;  2LST A;  3UOM A;  2VCV A;  3MAK A;  4PQ1 A;  3TGZ A;  2H70 A;  1O85 A;  3PH9 A;  3F63 A;  2RII A;  3M3M A;  2O8V B;  5JWQ B;  1QFN A;  4RI6 A;  4X0X A;  4WF5 A;  2FWE A;  4DVC A;  2VCQ A;  4CW9 A;  2H74 A;  2YPM A;  2GT5 A;  1GWC A;  2OKA A;  4ACS A;  2H1A A;  16GS A;  1EP7 A;  3TJB A;  4BPY A;  2YZH A;  1YDK A;  2X99 A;  4YAP A;  3FKF A;  1CQG A;  4IQ1 A;  3GHA A;  5A4V A;  2WB9 A;  3K8N A;  3ERW A;  4OO5 A;  3FZ4 A;  4KAE A;  1TRW A;  2L59 A;  5CO3 A;  2PN8 A;  2YP6 A;  3ZMK A;  3C71 A;  3RHC A;  2BMX A;  3VPQ A;  1I5G A;  5HR3 A;  1ON4 A;  3H93 A;  4G9H A;  3GX8 A;  2CQ9 A;  5GSS A;  3IR4 A;  2CX3 A;  2F8A A;  3GIX A;  2V6K A;  2DC5 A;  4IP1 A;  3TJF A;  2PU9 C;  4EKZ A;  3KZQ A;  7GSS A;  1Z3E A;  5DQS A;  4V2M A;  4JRR A;  3SWL A;  4ZL9 A;  4TR4 A;  4I8B A;  5C00 A;  4MJC A;  2H01 A;  1OC8 A;  3ZML A;  4XS6 A;  3EUR A;  4P3Y B;  4K6X A;  5FHI A;  4NMU A;  5AIS A;  4TR1 A;  4EC0 A;  4BVY A;  2GGT A;  1EWX A;  5J5N A;  2I1U A;  1VF2 A;  3F3Q A;  1EEM A;  4LL4 B;  5F06 A;  4HOJ A;  2LJK A;  4KDX A;  5ECR B;  2LKU A;  3IPZ A;  3BCI A;  3ZTL A;  4WXT A;  3F3R A;  2GQL A;  3HHV A;  1Z6N A;  1ZOF A;  3NZN A;  1GTI A;  4KCE A;  4MH3 A;  2HT9 A;  3ZYW A;  1PKW A;  1ABA A;  1TOF A;  1GSS A;  2YJH A;  5D8I A;  6GSU A;  2J23 A;  3G7I A;  4IKH A;  1M2B A;  3CBU A;  3ZFB A;  1G6Y A;  1VGL A;  1FOV A;  2V32 A;  4NV2 A;  4PQI A;  4MLY A;  1W89 A;  3FW2 A;  4HJM A;  3IA1 A;  1JFU A;  1AQX A;  5B6M A;  3QD9 A;  3WGE A;  2R3X A;  1K0C A;  2E2G A;  5H5R A;  3GYK A;  1B9Y C;  3EU3 A;  2K8V A;  1ACV A;  1A8L A;  1T4Z A;  3F6F A;  4AJ7 A;  1Z5Y E;  1WPI A;  1SKR B;  2FWF A;  2YWM A;  1EV4 A;  1GNE A;  2P0G A;  4AF2 A;  4X1U A;  1ST9 A;  1V58 A;  5ENU A;  5JCU A;  5ECH B;  2DIZ A;  4BVX A;  4TKY A;  3TKR A;  4HZ4 A;  4KE3 A;  1R26 A;  1XVQ A;  3FYG A;  3D22 A;  2B3S A;  4EDY A;  1SYR A;  1NW2 A;  3KP9 A;  3ME7 A;  3ZLP A;  4TXV A;  4L5L A;  1PL2 A;  2PUK C;  1OC9 A;  2H73 A;  3RBT A;  1IYI A;  3GUR A;  1F6M C;  2C3Q A;  2FWH A;  3CTG A;  1MTC A;  5ECM B;  5CRE A;  3UL3 A;  3DWV A;  3IBH A;  5IIZ A;  3QFB C;  5IQY A;  2HSH A;  5B8B A;  3TCO A;  5KEJ A;  1MDI A;  1PN9 A;  4GLT A;  4EVM A;  1U87 A;  1TDI A;  2B5Y A;  2HZF A;  2C8U A;  1BED A;  3GH9 A;  2HSY A;  3HJP A;  1SEN A;  3VI5 A;  2GLR A;  1K3O A;  1TRV A;  1X5E A;  1WP0 A;  3I6A A;  5ECQ B;  2H0G A;  5A4U A;  4F82 A;  2DMM A;  3O76 A;  5B7C A;  3ZFL A;  3M8N A;  4DSS A;  5CYY A;  3FZA A;  5DJL A;  2HRF A;  5IOX A;  5DAL A;  1BAY A;  1F3A A;  3GL5 A;  1TTZ A;  1TU7 A;  2PGT A;  2H30 A;  3KJY A;  4MZC A;  5AIX A;  2V2G A;  1YEP A;  5GAN D;  3UAP A;  2B1L A;  5DBQ A;  1EEJ A;  4NXI A;  4PUF C;  1PX6 A;  4NHZ A;  1UA5 A;  2XPE A;  3IXR A;  2DJ2 A;  8GSS A;  2CT6 A;  1PD2 1;  5HQP A;  1C72 A;  3GN3 A;  3VPT A;  1K0B A;  3IK9 A;  4NHW A;  2VD0 A;  3CSJ A;  1WOU A;  5COH A;  3TUE A;  4F0B A;  1G0T A;  4POM A;  1MEK A;  4EF0 A;  3RAZ A;  5G1K A;  1EOH A;  3F0I A;  3GKM A;  3F4S A;  1GSD A;  1LJR A;  20GS A;  2ZNM A;  3WT1 A;  2XBI A;  3UJ1 A;  4KH7 A;  3FK8 A;  3A2V A;  2L4Q A;  1HNA A;  2H19 A;  2MZC A;  1AAZ A;  4Q5R A;  1O6J A;  3TRX A;  18GS A;  4NPB A;  4KB3 A;  3UBL A;  3CTF A;  4HJ2 A;  3FZ9 A;  3EE2 A;  3PR8 A;  3UVH A;  1THX A;  4K1F A;  3FR9 A;  2L6D A;  2PVO C;  2H1G A;  3A3T A;  5CAX A;  2G0F A;  1O73 A;  1B4P A;  2VOC A;  3EVI A;  3L9V A;  2AB6 A;  1PSQ A;  2K6V A;  4GWR A;  5F05 A;  2IN3 A;  4JR4 A;  2AHE A;  2RLI A;  5D9T A;  5AGY A;  1YEX A;  4IBP A;  3Q19 A;  2MBT A;  3ZIJ A;  3D5J A;  4KW6 A;  3FY7 A;  1F37 A;  2CZ3 A;  1GL8 A;  3WGX A;  5ABR A;  1GTA A;  3GTU A;  3I43 A;  4MP4 A;  1EV9 A;  1SK1 A;  5CP1 A;  1DE1 A;  2IJY A;  4BL7 A;  5AN1 A;  1T1V A;  1T4Y A;  4MF5 A;  3DRN A;  3OR5 A;  2DJ3 A;  2B7K A;  1SL0 B;  2CA8 A;  1YF1 A;  2XC2 A;  6GSV A;  2AUV A;  4OD7 A;  3G9B A;  3H8Q A;  4ZBB A;  3TJG A;  4OMV A;  2YNX A;  1FW1 A;  4I6X A;  2IL3 A;  3EIN A;  2H6Z A;  4V2N A;  4GTU A;  4ZBA A;  4RUV A;  3L9S A;  4F0C A;  3L0H A;  3GMF A;  1Z6M A;  2M46 A;  4ZBD A;  4HDE A;  2YZU A;  4LA1 A;  5H5S A;  5J9C A;  1ZZY A;  3C7M A;  3V1W A;  4YQU A;  2VO4 A;  2GT6 A;  1HNC A;  1MD4 A;  4LL1 B;  2M80 A;  1U3A A;  4MJE A;  5CRD A;  4N11 A;  1GH2 A;  2KP1 A;  2ON5 A;  2WFC A;  4PUA A;  1KNG A;  1GSQ A;  1V2A A;  4IVF A;  2WUL A;  4TXO B;  5ELA A;  4TW5 A;  1PX7 A;  1GP1 A;  3U6V A;  1NSW A;  4BA7 A;  1ZMA A;  2H75 A;  3F9U A;  3IAM 2;  1WE0 A;  3ISO A;  1EGR A;  4TR0 A;  3GH6 A;  1XXU A;  3FR3 A;  3TOT A;  2PPT A;  2PER A;  2PBJ A;  4AJ8 A;  3P90 A;  1RK4 A;  1ERU A;  2YAN A;  2KLX A;  2O87 A;  2WGR A;  5KN0 A;  4QQ7 A;  1WJK A;  3UIW A;  2EIO A;  2O7K A;  5GZZ B;  2MMZ A;  2MMN A;  3KCM A;  4V1A p;  1A2L A;  3GKK A;  3NIV A;  4XTS A;  1N8J A;  3WYW A;  1AQW A;  1K0N A;  4MCU A;  4ULX A;  3O3T A;  4JBB A;  1GUM A;  4NWY A;  4IJ3 A;  1AUC A;  1R4W A;  2LQQ A;  1KTE A;  4GSS A;  2CV4 A;  6GSX A;  1LU4 A;  3QAV A;  4MZW A;  2XHF A;  2JSZ A;  3VWV A;  5KN3 A;  5IMZ A;  2C4J A;  2EIQ A;  4J56 E;  3TRP A;  4ID0 A;  2OE0 A;  3DEX A;  6GST A;  2KUC A;  2YCD A;  4KA0 A;  2NBS A;  1Y6E A;  1XW6 A;  1FB6 A;  3U5R E;  2CVB A;  1MDK A;  1R5P A;  2P5Q A;  4J57 E;  4QL9 A;  2M72 A;  4CHS A;  2JZT A;  4Z7X A;  4ML6 A;  4O7H A;  1XFL A;  5LNK e;  2YWI A;  2LUS A;  1RQM A;  4K0G A;  2DBC A;  2FHE A;  3BD2 A;  4EO3 A;  4GQF A;  4KCA A;  3KTB A;  2VUP A;  3W6G A;  3QR6 A;  4TVE A;  1NM3 A;  3D0Z A;  3TKQ A;  5D93 A;  1YJ6 A;  4HZ2 A;  2DSA A;  1GSE A;  3GX0 A;  1PMT A;  1JZD A;  1SJI A;  2LJR A;  1G7E A;  3KGK A;  2DJ1 A;  5D96 A;  5G2Z A;  4Q5Q A;  3RPP A;  1H75 A;  4JU5 A;  1VF3 A;  1JZR A;  1X9M B;  2JZR A;  3NOF A;  1TI3 A;  3M9J A;  3F8U A;  2BTO T;  3VWU A;  2IFQ B;  3DGQ A;  1OVN A;  3DML A;  2HRN A;  2C0F A;  2DIY A;  3BCK A;  3RHB A;  1B48 A;  3TKS E;  3GFK A;  4HUA A;  2FGX A;  4K7N A;  2NPB A;  2GVP A;  3VLN A;  1A2M A;  1F9M A;  1QGV A;  5D73 A;  3QCP A;  1Z9H A;  2VCX A;  1SL2 B;  2JAC A;  3H4K A;  5DCG A;  3GKX A;  1WWJ A;  1Q4J A;  4N0Z A;  3QAG A;  3IAS 2;  2E2M A;  3GRX A;  2HLS A;  3ZRE A;  4YQV A;  2HXK A;  4I2U A;  11GS A;  4XRD A;  2JU5 A;  3APQ A;  3C1R A;  2C3T A;  1CQH A;  1XPV A;  3RDW A;  3TKS C;  1BJX A;  2X8H A;  2FA4 A;  17GS A;  3HKR A;  5EVO A;  4LMV A;  1M2D A;  1GNW A;  4POB A;  3TB2 A;  1GLQ A;  2V6O A;  4I5Q A;  1XWG A;  4JE1 A;  4PGT A;  4O92 A;  1GSY A;  1M0U A;  1ZCP A;  2KP2 A;  2TIR A;  3C73 A;  3A2X A;  2GQM A;  2CAI A;  1TP9 A;  5DQY A;  3R2Q A;  1WRY A;  3UMA A;  3DVX A;  2GSS A;  1I9D A;  3ED3 A;  1NHY A;  3A2W A;  5J9B A;  2L4C A;  2LTK A;  4L8E A;  1YQ1 A;  1E6B A;  1X9W B;  1SJZ A;  2X8C A;  4IJI A;  2LRN A;  3QPM A;  2LNT A;  1XWC A;  3DKS A;  3UBK A;  2OE1 A;  2DJJ A;  3C1S A;  1PKZ A;  1SYX A;  5IMF A;  1EP8 A;  3UEM A;  2DJK A;  1S3C A;  5ID2 B;  1TRU A;  1B8X A;  2AJQ B;  3DD3 A;  2B1K A;  2KOK A;  1PA3 A;  4DSR A;  2L57 A;  3KTL A;  2QKE A;  2P5R A;  2VLT A;  3KMO A;  2B5E A;  3GL3 A;  3LOR A;  1JLW A;  4D73 B;  2LV3 A;  4OCF A;  1UVZ A;  1FHE A;  3LG6 A;  4GSN A;  1JZO A;  1SKW B;  4XHM A;  2P31 A;  1DE2 A;  4POK A;  1Z7P A;  4GRF A;  4MDC A;  3J7Y k;  2WZ9 A;  4RQX A;  2OAC A;  1GSF A;  1OYJ A;  22GS A;  3M1G A;  1FVJ A;  3IHQ A;  3TRQ A;  2H1B A;  4WEY A;  4IGJ A;  1GTU A;  1U6T A;  5ECN B;  3CYN A;  2R2J A;  1XWB A;  2A2R A;  19GS A;  1M9A A;  2JAD A;  4XIH A;  2F51 A;  1ERV A;  2HYX A;  2YV9 A;  2X8G A;  4ZB9 A;  3MDK A;  3D4T A;  1GRX A;  2OAD A;  2OBK A;  2WJU A;  1TRS A;  2LRT A;  1K0D A;  4ECJ A;  4PQH A;  3S9F A;  4ECI A;  3VWW A;  1K3L A;  1SKS B;  1XCC A;  1YF0 A;  3HVV A;  1E2Y A;  3EMX A;  5G31 A;  1AIU A;  1QXH A; 
#chains in the Genus database with same CATH topology
 5ECK B;  5G1L A;  1XWK A;  4HEA 2;  1W4V A;  2H71 A;  4EDZ A;  3ERF A;  5JWR B;  3I9V 2;  3LGC A;  3IHG A;  2OA7 A;  2GS3 A;  1TXX A;  3EU4 A;  2VAF A;  3LJR A;  5FWG A;  5B8A A;  3G7Y A;  1JZW A;  1SD9 A;  3VUR A;  2IMD A;  2LQO A;  1TW9 A;  1TKD B;  4O32 A;  3FRC A;  2YOI A;  4G19 A;  1ERT A;  2I9H A;  5L71 A;  1QK8 A;  4QL7 A;  1K0M A;  3MYD A;  4JED A;  1ZYQ B;  4YQM A;  4BWS A;  3KIJ A;  4Q5F A;  3KXO A;  2KHP A;  3E0U A;  4MJB A;  4MZB A;  4V1A g;  5CNW A;  3QAW A;  2YWO A;  4GCI A;  2JZS A;  2GSQ A;  4OFM A;  3ZVJ D;  1X0R A;  4N10 A;  2MMA A;  4KF9 A;  4TR3 A;  2B6M A;  2ZCT A;  2VIM A;  3L4N A;  2I4A A;  4XRA A;  3VK9 A;  4PTS A;  1F3B A;  1BG5 A;  3D21 A;  2IWT A;  3A5I A;  3HZ8 A;  4EUY A;  3EC3 A;  4ILF A;  1FO5 A;  3H79 A;  4HU9 A;  3ZRD A;  4POL A;  1SU9 A;  4ZL8 A;  2PWJ A;  2EC4 A;  2HFD A;  1FOH A;  2RM5 A;  5IM9 A;  3BJ5 A;  1B9X C;  1SJ6 A;  4OWY A;  2VCT A;  1HD2 A;  4GF0 A;  2CVD A;  2IMK A;  5LD0 A;  1U3I A;  1XZO A;  2VCW A;  5GAP D;  3PIN A;  4KGI A;  3QOU A;  1WMJ A;  3GUS A;  3WT2 A;  4K9Z A;  1V9W A;  5IO2 A;  5DAK B;  4G2E A;  4PNG A;  2R0C A;  4ECC A;  2NTO A;  3WGD A;  4HQS A;  1T8E B;  5J41 A;  4XS4 B;  4J2F A;  1V57 A;  2AV4 A;  2ES7 A;  4TXO A;  3IE3 A;  2AYT A;  3F4T A;  4OFT A;  1AXD A;  5DVB A;  2NDO A;  2L5L A;  2GTU A;  1FAA A;  2LJA A;  4K8M A;  4JR6 A;  1YKA A;  2LNS A;  5E59 A;  1LBK A;  3TDG A;  5CRW A;  4KUN A;  3QDN A;  1PRX A;  2WDU A;  5BRT A;  2VCZ A;  4DEJ A;  4X4J A;  3VWX A;  1TK5 B;  2GDR A;  2C0G A;  3KH7 A;  4YKF A;  4A5P A;  2YV7 A;  1T7P B;  1A0F A;  1O81 A;  4GST A;  2WS2 A;  5EPF A;  2FNO A;  2JSY A;  3HJO A;  2A4V A;  1TI1 A;  2VL3 A;  5G5E A;  2LRC A;  5HFI A;  5DDL A;  2A2S A;  4I97 A;  3LEF A;  2QGV A;  1AC1 A;  3DVW A;  3ZL5 A;  4ZXG A;  3GKN A;  3FEU A;  5H5Q A;  3LFL A;  1F2E A;  5LCZ A;  2VL2 C;  2CX4 A;  2R37 A;  2R0G A;  3LXZ A;  3L78 A;  2FD3 A;  4NV5 A;  3PGT A;  2R0P A;  1M99 A;  2AAW A;  2MMO A;  1V40 A;  2F3M A;  4JZQ A;  1NHO A;  1SL1 B;  3HXS A;  2F9S A;  2H8L A;  1V98 A;  2L5O A;  13GS A;  1G6W A;  5F8B A;  3UAR A;  4HSC X;  4MMM A;  4EIP A;  3I69 A;  5A5K A;  2K9F A;  3HY2 A;  2FUG 2;  1A2J A;  3LYK A;  3HYP A;  1U88 A;  1HYU A;  1GUL A;  4CY6 A;  1Q98 A;  2B5X A;  2HI7 A;  4N0V A;  2E0Q A;  2QSI A;  3BBY A;  2IME A;  1VF4 A;  3KMN A;  3F6D A;  1T00 A;  2I81 A;  4EE0 A;  2FY6 A;  1XWA A;  5CRH A;  5IMV A;  2V1M A;  1J08 A;  2MBS A;  4ZIL A;  3Q6O A;  5FT3 A;  4E8E A;  2C0D A;  4PNF A;  5G5F A;  1ZYE A;  1GTB A;  1X5D A;  2X64 A;  1PL1 A;  4PXO A;  4WKW A;  2C80 A;  1OC3 A;  3GNJ A;  3LW9 A;  4AGS A;  5IOW A;  2CZ2 A;  1QUW A;  5ECP B;  2O89 A;  2GZY A;  4L5O A;  1OE8 A;  3LWA A;  2OBI A;  4HS1 A;  5E4W A;  5G30 A;  3SBC A;  1S3A A;  2H0H A;  1FG4 A;  3ZIV A;  4HU7 A;  2R6K A;  3E9J B;  2R4V A;  4MH2 A;  1TK0 B;  1OKT A;  4K7O A;  4EXJ A;  2TRX A;  1M9B A;  9GSS A;  1XOB A;  1A23 A;  4WET A;  3MWH A;  4H86 A;  1KEB A;  3R3E A;  2GST A;  1OKD A;  2F8F A;  1THO A;  5C04 A;  2RUF A;  4TR1 B;  3RPN A;  3TKS A;  2IFQ A;  3CRU A;  1M2A A;  4MAB A;  2HNL A;  2H6Y A;  3CSH A;  4IW9 A;  5HFG A;  3AY8 A;  4FQU A;  5CRG A;  4MK3 A;  1K0O A;  3LSZ A;  5ECL B;  1USB A;  5D9X A;  3J7Y b;  1FB0 A;  1YZX A;  3ZIT A;  3ERG A;  3KM6 A;  3M0F A;  4CDO A;  3CMI A;  4FH8 A;  3HVN A;  2L6C A;  3A5W A;  4RI7 A;  1OE7 A;  2IPA A;  4F9Z A;  3FMW A;  4TOP A;  1X9S B;  1K3Y A;  3LQ7 A;  4OCE A;  4IS0 A;  4GXZ A;  2HE3 A;  3FHK A;  1TJD A;  2YN1 A;  4KND A;  1BQ7 A;  3N9J A;  4FYC A;  3D4M A;  1QQ2 A;  4PUR A;  4FIW A;  3HVS A;  4OO4 A;  3BOA A;  1XW5 A;  4ECB A;  4N30 A;  5HR0 A;  1H4O A;  3ZVJ A;  2RM6 A;  1EGO A;  4IHU A;  3VI7 A;  5IPH A;  2VLV A;  3VFI A;  4EL1 A;  4IP6 A;  1EOG A;  1B4Q A;  3TJK A;  3W8J A;  2E7P A;  2LS5 A;  3W8S A;  3O6T A;  3H1N A;  3HCZ A;  5IO0 A;  1XBS A;  2ON7 A;  3M9K A;  1J0F A;  3EMP A;  4KDY A;  1Z7R A;  3LYP A;  2A4H A;  2K8S A;  3WD6 A;  4OFN A;  3GSS A;  3FZ5 A;  2CAQ A;  5DCH A;  4IN0 A;  2H0I A;  4LLR A;  4IQA A;  1YY7 A;  2EIR A;  1VRS D;  4BVX B;  2GZZ A;  3C8E A;  5JCW A;  4FYU A;  4PX1 A;  3F4R A;  4CY8 A;  4TN8 A;  1O8W A;  4I2T A;  6GSS A;  1AW9 A;  1OAZ A;  4L0W A;  1OC9 B;  4MJA A;  4K2D A;  3EYT A;  3IOS A;  3HVX A;  3QFA C;  4ML1 A;  5IMA A;  4WF4 A;  2YJ7 A;  3KH9 A;  4L0U A;  3QMX A;  1DSB A;  4BWQ A;  4ZL7 A;  2Z9S A;  2GSR A;  4FYB A;  4O5U A;  3IRA A;  5GST A;  4HI7 A;  1XOA A;  5ID2 A;  2HZE A;  1URM A;  1R5A A;  3ME8 A;  5F0G A;  1K0A A;  4O5R A;  2HZE B;  4Z2R A;  1UN2 A;  2YWN A;  2G2Q A;  1SD8 A;  4D73 A;  2N5F A;  2I3Y A;  4AJ6 A;  4KDU A;  2VD1 A;  2H6X A;  3D6I A;  4DSS B;  3IV4 A;  3CSI A;  4MF6 A;  2WRT A;  2D2Z A;  5DAL B;  3IC4 A;  3DXB A;  5EL8 A;  5DJM A;  3Q18 A;  3P7X A;  4MPF A;  2JL4 A;  2R5G A;  3ZZX A;  1BX9 A;  10GS A;  3DIE A;  2IMI A;  2GQK A;  4WR5 A;  1WIK A;  2IIY A;  4WR4 A;  1BYE A;  4WBR D;  4TRX A;  4V2L A;  1N2A A;  4ZB6 A;  6GSW A;  1AQV A;  2REM A;  1X5C A;  2K18 A;  2C0E A;  12GS A;  5IMC A;  5JCG A;  5D9V A;  2FWG A;  1M3J A;  3APS A;  5A4W A;  1RW1 A;  2VLU A;  5F07 A;  1ERW A;  3TOU A;  5J3R A;  3IDV A;  1A0R P;  4HQZ A;  3PPU A;  4RQR A;  1T3B A;  1R7H A;  5KN1 A;  4F03 A;  2V41 A;  3E3E A;  2J9H A;  3TKP A;  3KD0 A;  1GUK A;  5ELG A;  2H1D A;  4YAV A;  4MF7 A;  3L9U A;  3DYR A;  2IMF A;  1KBN A;  4NAX A;  3UVT A;  2VM2 A;  3TJJ A;  5JWO B;  4LMW A;  2TRC P;  3KEB A;  3GST A;  4FO5 A;  1FVK A;  5HR2 A;  4KX4 A;  3JCM L;  3HA9 A;  3GA4 A;  6GSY A;  4F2I A;  1XVW A;  14GS A;  1GUH A;  3MNG A;  2WCI A;  3N5O A;  3GV1 A;  5ECI B;  2FCH A;  4K7I A;  2VL9 A;  4ISD A;  2H76 A;  3P2A A;  1ZL9 A;  4KSO A;  2BJX A;  3IK7 A;  2CVK A;  1A24 A;  1YKC A;  3MSZ A;  1XW9 A;  4MPG A;  2RUE A;  1JLV A;  2C1Y A;  3CXG A;  3GTU B;  2DML A;  5EY6 A;  1O7U A;  2NVL A;  4BL7 B;  5IMD A;  2B7J A;  5HR1 A;  3P8W A;  5AIV A;  5KN2 A;  2HRK A;  4DSQ A;  4G10 A;  1SK2 A;  1SK0 A;  5J4U A;  1ZGN A;  3Q74 A;  2DLX A;  3MIX A;  2O85 A;  2ZUP A;  5ECO B;  2OE3 A;  1TK8 B;  5ECS A;  4WBJ A;  4ZB8 A;  1XIY A;  2PVQ A;  1MDJ A;  2LEG A;  5DAK A;  1TU8 A;  1UC7 A;  1ZYP A;  1JHB A;  1HQO A;  1VF1 A;  4XCS A;  1GSU A;  2FA8 A;  4XS4 A;  1A8Y A;  1G7O A;  1J9B A;  2DJ0 A;  1DUG A;  3HZ4 A;  5IPG A;  2N5A A;  5D9W A;  1O8X A;  2VL2 A;  2ALB A;  1DBY A;  2OJL A;  3G7J A;  1QMV A;  1GLP A;  4IEL A;  2MYG A;  4G0L A;  4XS1 A;  2GZP A;  1PQN A;  4ZIJ A;  5INY A;  2N5B A;  1S3D A;  1M7T A;  2XPD A;  1PGT A;  3LXT A;  3APO A;  4K0N A;  2FLS A;  3HD5 A;  3US3 A;  2C3N A;  1HNB A;  4E8H A;  4X43 A;  4YH2 A;  2PMT A;  1ML6 A;  3EWL A;  2H66 A;  3CRT A;  3HJM A;  3KP8 A;  4MA9 A;  3HDC A;  4Q5N A;  2HSM A;  2QC7 A;  5B6N A;  1MD3 A;  1Y25 A;  2H72 A;  2XBQ A;  1IYH A;  2VM1 A;  5BMU A;  4KSM A;  3FR6 A;  4GQC A;  1EZK A;  5HFK A;  1ILO A;  2LST A;  3UOM A;  2VCV A;  3MAK A;  4PQ1 A;  3TGZ A;  2H70 A;  2DKI A;  1O85 A;  3PH9 A;  3F63 A;  2RII A;  3M3M A;  2O8V B;  5JWQ B;  1QFN A;  4RI6 A;  4X0X A;  4WF5 A;  2FWE A;  4DVC A;  2VCQ A;  4CW9 A;  2H74 A;  2YPM A;  2GT5 A;  1GWC A;  2OKA A;  4ACS A;  2H1A A;  16GS A;  1EP7 A;  3TJB A;  4BPY A;  2YZH A;  1YDK A;  2X99 A;  4YAP A;  3FKF A;  1CQG A;  4IQ1 A;  3GHA A;  5A4V A;  2WB9 A;  3K8N A;  3ERW A;  4BIK A;  4OO5 A;  3FZ4 A;  4KAE A;  2A2P A;  2DKH A;  1TRW A;  2L59 A;  4O5Q A;  5CO3 A;  2PN8 A;  2X4A A;  2YP6 A;  3ZMK A;  3C71 A;  3RHC A;  2BMX A;  3VPQ A;  1I5G A;  5HR3 A;  1ON4 A;  3H93 A;  4G9H A;  3GX8 A;  2CQ9 A;  5GSS A;  3IR4 A;  2CX3 A;  2F8A A;  2UZ8 A;  3GIX A;  2V6K A;  2DC5 A;  4IP1 A;  1XG8 A;  3TJF A;  2PU9 C;  4EKZ A;  3KZQ A;  7GSS A;  1Z3E A;  5DQS A;  4V2M A;  4JRR A;  3SWL A;  4ZL9 A;  4TR4 A;  4I8B A;  5C00 A;  4MJC A;  2H01 A;  1OC8 A;  3ZML A;  4XS6 A;  3EUR A;  4P3Y B;  4K6X A;  5FHI A;  4NMU A;  5AIS A;  4TR1 A;  4EC0 A;  4BVY A;  2GGT A;  1EWX A;  5J5N A;  2I1U A;  1VF2 A;  3F3Q A;  1EEM A;  4LL4 B;  4BVY B;  4HOJ A;  5F06 A;  2LJK A;  4KDX A;  5ECR B;  2LKU A;  3IPZ A;  3BCI A;  3ZTL A;  4WXT A;  3F3R A;  2GQL A;  3HHV A;  1Z6N A;  1ZOF A;  3NZN A;  1GTI A;  4KCE A;  4MH3 A;  2HT9 A;  3ZYW A;  1PKW A;  1ABA A;  1TOF A;  1GSS A;  2YJH A;  5D8I A;  6GSU A;  2J23 A;  3G7I A;  4IKH A;  1M2B A;  3CBU A;  3ZFB A;  1G6Y A;  1VGL A;  4G0K A;  1FOV A;  2V32 A;  4NV2 A;  4PQI A;  4MLY A;  1W89 A;  3FW2 A;  4HJM A;  4YKG A;  3IA1 A;  1JFU A;  4ICY A;  1AQX A;  5B6M A;  3QD9 A;  3WGE A;  2R3X A;  1K0C A;  2E2G A;  5H5R A;  3GYK A;  1B9Y C;  3EU3 A;  2K8V A;  1ACV A;  1A8L A;  1T4Z A;  3F6F A;  4AJ7 A;  1Z5Y E;  1WPI A;  1SKR B;  2FWF A;  2YWM A;  1EV4 A;  1GNE A;  2P0G A;  4AF2 A;  4X1U A;  1ST9 A;  1V58 A;  5ENU A;  5JCU A;  5ECH B;  2DIZ A;  4BVX A;  4TKY A;  3TKR A;  4HZ4 A;  4KE3 A;  1R26 A;  1XVQ A;  3FYG A;  3D22 A;  2B3S A;  4EDY A;  1SYR A;  1ZYN A;  1NW2 A;  3KP9 A;  3ME7 A;  3ZLP A;  4TXV A;  4L5L A;  1PL2 A;  2PUK C;  1OC9 A;  2H73 A;  3RBT A;  1IYI A;  3GUR A;  1F6M C;  2C3Q A;  2FWH A;  3CTG A;  1MTC A;  5ECM B;  5CRE A;  3UL3 A;  3DWV A;  3IBH A;  5IIZ A;  3QFB C;  5IQY A;  2HSH A;  5B8B A;  3TCO A;  5KEJ A;  1MDI A;  1PN9 A;  4GLT A;  4EVM A;  1U87 A;  1TDI A;  2HRA A;  2B5Y A;  2HZF A;  2C8U A;  1BED A;  3GH9 A;  2HSY A;  3HJP A;  1SEN A;  3VI5 A;  4Z2T A;  2GLR A;  1K3O A;  1TRV A;  1X5E A;  1WP0 A;  3I6A A;  5ECQ B;  2H0G A;  5A4U A;  4F82 A;  2DMM A;  3O76 A;  5B7C A;  3ZFL A;  3M8N A;  1PFO A;  4DSS A;  5CYY A;  3FZA A;  5DJL A;  2HRF A;  5IOX A;  5DAL A;  1BAY A;  1F3A A;  3GL5 A;  1TTZ A;  1TU7 A;  2PGT A;  2H30 A;  3KJY A;  4MZC A;  5AIX A;  2V2G A;  1YEP A;  5GAN D;  3UAP A;  2B1L A;  5DBQ A;  1EEJ A;  4NXI A;  4PUF C;  1PX6 A;  4NHZ A;  1UA5 A;  2XPE A;  3IXR A;  2DJ2 A;  8GSS A;  2CT6 A;  1PD2 1;  5HQP A;  1C72 A;  3GN3 A;  3VPT A;  3IC8 A;  1K0B A;  3IK9 A;  4NHW A;  2VD0 A;  3CSJ A;  1WOU A;  5COH A;  3TUE A;  4F0B A;  1G0T A;  4POM A;  1MEK A;  4EF0 A;  3RAZ A;  5G1K A;  1EOH A;  3F0I A;  3GKM A;  3F4S A;  1GSD A;  1LJR A;  20GS A;  2ZNM A;  3WT1 A;  2XBI A;  3UJ1 A;  4KH7 A;  3FK8 A;  3A2V A;  2L4Q A;  1HNA A;  2H19 A;  2MZC A;  1AAZ A;  4K2X A;  4Q5R A;  1O6J A;  3TRX A;  18GS A;  4NPB A;  4KB3 A;  3UBL A;  3CTF A;  4HJ2 A;  3FZ9 A;  3EE2 A;  3PR8 A;  3UVH A;  1THX A;  4K1F A;  3FR9 A;  2L6D A;  2PVO C;  2H1G A;  3A3T A;  5CAX A;  2G0F A;  1O73 A;  1B4P A;  2VOC A;  3EVI A;  3L9V A;  2AB6 A;  1PSQ A;  2K6V A;  4GWR A;  5F05 A;  2IN3 A;  4JR4 A;  2AHE A;  2RLI A;  4G0I A;  5D9T A;  5AGY A;  1YEX A;  4IBP A;  3Q19 A;  2MBT A;  3ZIJ A;  3D5J A;  4KW6 A;  3FY7 A;  1F37 A;  2CZ3 A;  1GL8 A;  3WGX A;  5ABR A;  1GTA A;  3GTU A;  3I43 A;  4MP4 A;  1EV9 A;  1SK1 A;  5CP1 A;  1DE1 A;  1S3R A;  2IJY A;  4BL7 A;  5AN1 A;  1T1V A;  1T4Y A;  4MF5 A;  3DRN A;  3OR5 A;  2DJ3 A;  2B7K A;  1SL0 B;  2CA8 A;  1YF1 A;  2XC2 A;  6GSV A;  2AUV A;  4OD7 A;  3G9B A;  3H8Q A;  4ZBB A;  3TJG A;  4OMV A;  2YNX A;  1FW1 A;  4I6X A;  2IL3 A;  3EIN A;  2H6Z A;  4V2N A;  4GTU A;  4ZBA A;  4RUV A;  3L9S A;  4F0C A;  3L0H A;  4K5S A;  3GMF A;  1Z6M A;  2M46 A;  4ZBD A;  4HDE A;  2YZU A;  4LA1 A;  5H5S A;  3CQF A;  1PN0 A;  5J9C A;  1ZZY A;  3C7M A;  3V1W A;  4YQU A;  2VO4 A;  2GT6 A;  1HNC A;  1MD4 A;  4LL1 B;  2M80 A;  1U3A A;  4MJE A;  5CRD A;  4N11 A;  1GH2 A;  2KP1 A;  2ON5 A;  2WFC A;  4PUA A;  1KNG A;  1GSQ A;  1V2A A;  4IVF A;  2WUL A;  4TXO B;  5ELA A;  4TW5 A;  1PX7 A;  1GP1 A;  3U6V A;  1NSW A;  4K5R A;  4BA7 A;  1ZMA A;  2H75 A;  3F9U A;  3IAM 2;  1WE0 A;  3ISO A;  1EGR A;  4TR0 A;  3GH6 A;  1XXU A;  3FR3 A;  3TOT A;  2PPT A;  2PER A;  2PBJ A;  4AJ8 A;  3P90 A;  1RK4 A;  1ERU A;  2YAN A;  2KLX A;  2O87 A;  2WGR A;  5KN0 A;  4QQ7 A;  1WJK A;  3UIW A;  2EIO A;  2O7K A;  5GZZ B;  2MMZ A;  2MMN A;  3KCM A;  4USS A;  4V1A p;  1A2L A;  3GKK A;  3NIV A;  4XTS A;  1N8J A;  3WYW A;  1AQW A;  1K0N A;  4MCU A;  4ULX A;  3O3T A;  4JBB A;  1GUM A;  4NWY A;  4IJ3 A;  1AUC A;  1R4W A;  2LQQ A;  1KTE A;  4GSS A;  2CV4 A;  6GSX A;  1LU4 A;  3QAV A;  4MZW A;  2XHF A;  2JSZ A;  3VWV A;  5KN3 A;  5IMZ A;  2C4J A;  2QA2 A;  2EIQ A;  4J56 E;  3TRP A;  4ID0 A;  2OE0 A;  3DEX A;  6GST A;  2KUC A;  2YCD A;  4KA0 A;  2NBS A;  1Y6E A;  1XW6 A;  1FB6 A;  3U5R E;  2CVB A;  1MDK A;  1R5P A;  2P5Q A;  4J57 E;  4QL9 A;  2M72 A;  4CHS A;  2JZT A;  4Z7X A;  4ML6 A;  4O7H A;  1XFL A;  5LNK e;  2YWI A;  2LUS A;  1RQM A;  4K0G A;  2DBC A;  2FHE A;  3BD2 A;  4EO3 A;  4GQF A;  4KCA A;  3KTB A;  2VUP A;  3W6G A;  3QR6 A;  4TVE A;  1NM3 A;  3D0Z A;  3TKQ A;  5D93 A;  1YJ6 A;  4HZ2 A;  2DSA A;  1GSE A;  3GX0 A;  1PMT A;  1JZD A;  1SJI A;  2LJR A;  1G7E A;  3KGK A;  2DJ1 A;  5D96 A;  5G2Z A;  4Q5Q A;  3RPP A;  1H75 A;  4JU5 A;  1VF3 A;  1JZR A;  1X9M B;  2JZR A;  3NOF A;  1TI3 A;  3M9J A;  3F8U A;  2BTO T;  3VWU A;  2QA1 A;  2IFQ B;  3DGQ A;  1OVN A;  3DML A;  2HRN A;  2C0F A;  2DIY A;  3BCK A;  3RHB A;  1B48 A;  3TKS E;  3GFK A;  4HUA A;  2FGX A;  4K7N A;  2NPB A;  2GVP A;  3VLN A;  1A2M A;  1F9M A;  1QGV A;  5D73 A;  3QCP A;  1Z9H A;  2VCX A;  1SL2 B;  2JAC A;  3H4K A;  5DCG A;  3GKX A;  1WWJ A;  1Q4J A;  4N0Z A;  3QAG A;  3IAS 2;  4MNN A;  2E2M A;  3GRX A;  2HLS A;  3ZRE A;  4YQV A;  2HXK A;  4I2U A;  11GS A;  4XRD A;  2JU5 A;  3APQ A;  3C1R A;  2C3T A;  1CQH A;  1XPV A;  3RDW A;  3TKS C;  1BJX A;  3EPT A;  2X8H A;  2FA4 A;  17GS A;  3HKR A;  5EVO A;  4LMV A;  1M2D A;  1GNW A;  4POB A;  3TB2 A;  1GLQ A;  2V6O A;  4I5Q A;  1XWG A;  4JE1 A;  4PGT A;  4O92 A;  1GSY A;  1M0U A;  1ZCP A;  2KP2 A;  2TIR A;  3C73 A;  3A2X A;  2GQM A;  2CAI A;  1TP9 A;  1M3I A;  5DQY A;  3R2Q A;  1WRY A;  3UMA A;  3DVX A;  2GSS A;  1I9D A;  2X49 A;  3ED3 A;  1NHY A;  3A2W A;  5J9B A;  2L4C A;  2LTK A;  4L8E A;  1YQ1 A;  1E6B A;  1X9W B;  1SJZ A;  2X8C A;  4IJI A;  5KOW A;  2LRN A;  3QPM A;  2LNT A;  1XWC A;  3DKS A;  3UBK A;  2OE1 A;  2DJJ A;  3C1S A;  1PKZ A;  1SYX A;  4EIQ A;  5IMF A;  1EP8 A;  3UEM A;  2DJK A;  1S3C A;  5ID2 B;  1TRU A;  1B8X A;  2AJQ B;  3DD3 A;  2B1K A;  2KOK A;  1PA3 A;  4DSR A;  2L57 A;  3KTL A;  2QKE A;  2P5R A;  2VLT A;  3KMO A;  2B5E A;  3GL3 A;  5KOX A;  3LOR A;  1JLW A;  4D73 B;  2LV3 A;  4OCF A;  1UVZ A;  1FHE A;  3LG6 A;  4GSN A;  1JZO A;  1SKW B;  4XHM A;  2P31 A;  1DE2 A;  4POK A;  1Z7P A;  4GRF A;  4MDC A;  3J7Y k;  2WZ9 A;  4RQX A;  2OAC A;  1GSF A;  1OYJ A;  22GS A;  3M1G A;  1FVJ A;  3IHQ A;  3TRQ A;  2H1B A;  4WEY A;  4IGJ A;  1GTU A;  1U6T A;  5ECN B;  3CYN A;  2R2J A;  1XWB A;  2A2R A;  19GS A;  1M9A A;  2JAD A;  4XIH A;  2F51 A;  1ERV A;  2HYX A;  2YV9 A;  2X8G A;  4ZB9 A;  3MDK A;  3D4T A;  1GRX A;  2OAD A;  2OBK A;  2WJU A;  1TRS A;  2LRT A;  1K0D A;  4ECJ A;  4PQH A;  4Z2U A;  3S9F A;  4ECI A;  3VWW A;  1K3L A;  1SKS B;  1XCC A;  1YF0 A;  3HVV A;  1E2Y A;  3EMX A;  5G31 A;  1AIU A;  1QXH A; 
#chains in the Genus database with same CATH homology
 5ECK B;  5G1L A;  1XWK A;  4HEA 2;  1W4V A;  2H71 A;  4EDZ A;  3ERF A;  5JWR B;  3I9V 2;  3LGC A;  3IHG A;  2OA7 A;  2GS3 A;  1TXX A;  3EU4 A;  2VAF A;  3LJR A;  5FWG A;  5B8A A;  3G7Y A;  1JZW A;  1SD9 A;  3VUR A;  2IMD A;  2LQO A;  1TW9 A;  1TKD B;  4O32 A;  3FRC A;  2YOI A;  4G19 A;  1ERT A;  2I9H A;  5L71 A;  1QK8 A;  4QL7 A;  1K0M A;  3MYD A;  4JED A;  1ZYQ B;  4YQM A;  4BWS A;  3KIJ A;  4Q5F A;  3KXO A;  2KHP A;  3E0U A;  4MJB A;  4MZB A;  4V1A g;  5CNW A;  3QAW A;  2YWO A;  4GCI A;  2JZS A;  2GSQ A;  4OFM A;  3ZVJ D;  1X0R A;  4N10 A;  2MMA A;  4KF9 A;  4TR3 A;  2B6M A;  2ZCT A;  2VIM A;  3L4N A;  2I4A A;  4XRA A;  3VK9 A;  4PTS A;  1F3B A;  1BG5 A;  3D21 A;  2IWT A;  3A5I A;  3HZ8 A;  4EUY A;  3EC3 A;  4ILF A;  1FO5 A;  3H79 A;  4HU9 A;  3ZRD A;  4POL A;  1SU9 A;  4ZL8 A;  2PWJ A;  2EC4 A;  2HFD A;  1FOH A;  2RM5 A;  5IM9 A;  3BJ5 A;  1B9X C;  1SJ6 A;  4OWY A;  2VCT A;  1HD2 A;  4GF0 A;  2CVD A;  2IMK A;  5LD0 A;  1U3I A;  1XZO A;  2VCW A;  5GAP D;  3PIN A;  4KGI A;  3QOU A;  1WMJ A;  3GUS A;  3WT2 A;  4K9Z A;  1V9W A;  5IO2 A;  5DAK B;  4G2E A;  4PNG A;  2R0C A;  4ECC A;  2NTO A;  3WGD A;  4HQS A;  1T8E B;  5J41 A;  4XS4 B;  4J2F A;  1V57 A;  2AV4 A;  2ES7 A;  4TXO A;  3IE3 A;  2AYT A;  3F4T A;  4OFT A;  1AXD A;  5DVB A;  2NDO A;  2L5L A;  2GTU A;  1FAA A;  2LJA A;  4K8M A;  4JR6 A;  1YKA A;  2LNS A;  5E59 A;  1LBK A;  3TDG A;  5CRW A;  4KUN A;  3QDN A;  1PRX A;  2WDU A;  5BRT A;  2VCZ A;  4DEJ A;  4X4J A;  3VWX A;  1TK5 B;  2GDR A;  2C0G A;  3KH7 A;  4YKF A;  4A5P A;  2YV7 A;  1T7P B;  1A0F A;  1O81 A;  4GST A;  2WS2 A;  5EPF A;  2FNO A;  2JSY A;  3HJO A;  2A4V A;  1TI1 A;  2VL3 A;  5G5E A;  2LRC A;  5HFI A;  5DDL A;  2A2S A;  4I97 A;  3LEF A;  2QGV A;  1AC1 A;  3DVW A;  3ZL5 A;  4ZXG A;  3GKN A;  3FEU A;  5H5Q A;  3LFL A;  1F2E A;  5LCZ A;  2VL2 C;  2CX4 A;  2R37 A;  2R0G A;  3LXZ A;  3L78 A;  2FD3 A;  4NV5 A;  3PGT A;  2R0P A;  1M99 A;  2AAW A;  2MMO A;  1V40 A;  2F3M A;  4JZQ A;  1NHO A;  1SL1 B;  3HXS A;  2F9S A;  2H8L A;  1V98 A;  2L5O A;  13GS A;  1G6W A;  5F8B A;  3UAR A;  4MMM A;  4EIP A;  3I69 A;  5A5K A;  2K9F A;  3HY2 A;  2FUG 2;  1A2J A;  3LYK A;  3HYP A;  1U88 A;  1HYU A;  1GUL A;  4CY6 A;  1Q98 A;  2B5X A;  2HI7 A;  4N0V A;  2E0Q A;  2QSI A;  3BBY A;  2IME A;  1VF4 A;  3KMN A;  3F6D A;  1T00 A;  2I81 A;  4EE0 A;  2FY6 A;  1XWA A;  5CRH A;  5IMV A;  2V1M A;  1J08 A;  2MBS A;  4ZIL A;  3Q6O A;  5FT3 A;  4E8E A;  2C0D A;  4PNF A;  5G5F A;  1ZYE A;  1GTB A;  1X5D A;  2X64 A;  1PL1 A;  4PXO A;  4WKW A;  2C80 A;  1OC3 A;  3GNJ A;  3LW9 A;  4AGS A;  5IOW A;  2CZ2 A;  1QUW A;  5ECP B;  2O89 A;  2GZY A;  4L5O A;  1OE8 A;  3LWA A;  2OBI A;  4HS1 A;  5E4W A;  5G30 A;  3SBC A;  1S3A A;  2H0H A;  1FG4 A;  3ZIV A;  4HU7 A;  2R6K A;  3E9J B;  2R4V A;  4MH2 A;  1TK0 B;  1OKT A;  4K7O A;  4EXJ A;  2TRX A;  1M9B A;  9GSS A;  1XOB A;  1A23 A;  4WET A;  3MWH A;  4H86 A;  1KEB A;  3R3E A;  2GST A;  1OKD A;  2F8F A;  1THO A;  5C04 A;  2RUF A;  4TR1 B;  3RPN A;  3TKS A;  2IFQ A;  3CRU A;  1M2A A;  4MAB A;  2HNL A;  2H6Y A;  3CSH A;  4IW9 A;  5HFG A;  3AY8 A;  4FQU A;  5CRG A;  4MK3 A;  1K0O A;  3LSZ A;  5ECL B;  1USB A;  5D9X A;  3J7Y b;  1FB0 A;  1YZX A;  3ZIT A;  3ERG A;  3KM6 A;  3M0F A;  4CDO A;  3CMI A;  4FH8 A;  2L6C A;  3A5W A;  4RI7 A;  1OE7 A;  2IPA A;  4F9Z A;  3FMW A;  4TOP A;  1X9S B;  1K3Y A;  3LQ7 A;  4OCE A;  4IS0 A;  4GXZ A;  2HE3 A;  3FHK A;  1TJD A;  2YN1 A;  4KND A;  1BQ7 A;  3N9J A;  4FYC A;  3D4M A;  1QQ2 A;  4PUR A;  4FIW A;  3HVS A;  4OO4 A;  3BOA A;  1XW5 A;  4ECB A;  4N30 A;  5HR0 A;  1H4O A;  3ZVJ A;  2RM6 A;  1EGO A;  4IHU A;  3VI7 A;  5IPH A;  2VLV A;  3VFI A;  4EL1 A;  4IP6 A;  1EOG A;  1B4Q A;  3TJK A;  3W8J A;  2E7P A;  2LS5 A;  3W8S A;  3O6T A;  3H1N A;  3HCZ A;  5IO0 A;  1XBS A;  2ON7 A;  3M9K A;  1J0F A;  3EMP A;  4KDY A;  1Z7R A;  3LYP A;  2A4H A;  2K8S A;  3WD6 A;  4OFN A;  3GSS A;  3FZ5 A;  2CAQ A;  5DCH A;  4IN0 A;  2H0I A;  4LLR A;  4IQA A;  1YY7 A;  2EIR A;  1VRS D;  4BVX B;  2GZZ A;  3C8E A;  5JCW A;  4FYU A;  4PX1 A;  3F4R A;  4CY8 A;  4TN8 A;  1O8W A;  4I2T A;  6GSS A;  1AW9 A;  1OAZ A;  4L0W A;  1OC9 B;  4MJA A;  4K2D A;  3EYT A;  3IOS A;  3HVX A;  3QFA C;  4ML1 A;  5IMA A;  4WF4 A;  2YJ7 A;  3KH9 A;  4L0U A;  3QMX A;  1DSB A;  4BWQ A;  4ZL7 A;  2Z9S A;  2GSR A;  4FYB A;  4O5U A;  3IRA A;  5GST A;  4HI7 A;  1XOA A;  5ID2 A;  2HZE A;  1URM A;  1R5A A;  3ME8 A;  5F0G A;  1K0A A;  4O5R A;  2HZE B;  4Z2R A;  1UN2 A;  2YWN A;  2G2Q A;  1SD8 A;  4D73 A;  2N5F A;  2I3Y A;  4AJ6 A;  4KDU A;  2VD1 A;  2H6X A;  3D6I A;  4DSS B;  3IV4 A;  3CSI A;  4MF6 A;  2WRT A;  2D2Z A;  5DAL B;  3IC4 A;  3DXB A;  5EL8 A;  5DJM A;  3Q18 A;  3P7X A;  4MPF A;  2JL4 A;  2R5G A;  3ZZX A;  1BX9 A;  10GS A;  3DIE A;  2IMI A;  2GQK A;  4WR5 A;  1WIK A;  2IIY A;  4WR4 A;  1BYE A;  4WBR D;  4TRX A;  4V2L A;  1N2A A;  4ZB6 A;  6GSW A;  1AQV A;  2REM A;  1X5C A;  2K18 A;  2C0E A;  12GS A;  5IMC A;  5JCG A;  5D9V A;  2FWG A;  3APS A;  5A4W A;  1RW1 A;  2VLU A;  5F07 A;  1ERW A;  3TOU A;  5J3R A;  3IDV A;  1A0R P;  4HQZ A;  3PPU A;  4RQR A;  1T3B A;  1R7H A;  5KN1 A;  4F03 A;  2V41 A;  3E3E A;  2J9H A;  3TKP A;  3KD0 A;  1GUK A;  5ELG A;  2H1D A;  4YAV A;  4MF7 A;  3L9U A;  3DYR A;  2IMF A;  1KBN A;  4NAX A;  3UVT A;  2VM2 A;  3TJJ A;  5JWO B;  4LMW A;  2TRC P;  3KEB A;  3GST A;  4FO5 A;  1FVK A;  5HR2 A;  4KX4 A;  3JCM L;  3HA9 A;  3GA4 A;  6GSY A;  4F2I A;  1XVW A;  14GS A;  1GUH A;  3MNG A;  2WCI A;  3N5O A;  3GV1 A;  5ECI B;  2FCH A;  4K7I A;  2VL9 A;  4ISD A;  2H76 A;  3P2A A;  1ZL9 A;  4KSO A;  2BJX A;  3IK7 A;  2CVK A;  1A24 A;  1YKC A;  3MSZ A;  1XW9 A;  4MPG A;  2RUE A;  1JLV A;  2C1Y A;  3CXG A;  3GTU B;  2DML A;  5EY6 A;  1O7U A;  2NVL A;  4BL7 B;  5IMD A;  2B7J A;  5HR1 A;  3P8W A;  5AIV A;  5KN2 A;  2HRK A;  4DSQ A;  4G10 A;  1SK2 A;  1SK0 A;  5J4U A;  1ZGN A;  3Q74 A;  2DLX A;  3MIX A;  2O85 A;  2ZUP A;  5ECO B;  2OE3 A;  1TK8 B;  5ECS A;  4WBJ A;  4ZB8 A;  1XIY A;  2PVQ A;  1MDJ A;  2LEG A;  5DAK A;  1TU8 A;  1UC7 A;  1ZYP A;  1JHB A;  1HQO A;  1VF1 A;  4XCS A;  1GSU A;  2FA8 A;  4XS4 A;  1A8Y A;  1G7O A;  1J9B A;  2DJ0 A;  1DUG A;  3HZ4 A;  5IPG A;  2N5A A;  5D9W A;  1O8X A;  2VL2 A;  2ALB A;  1DBY A;  2OJL A;  3G7J A;  1QMV A;  1GLP A;  4IEL A;  2MYG A;  4G0L A;  4XS1 A;  2GZP A;  1PQN A;  4ZIJ A;  5INY A;  2N5B A;  1S3D A;  1M7T A;  2XPD A;  1PGT A;  3LXT A;  3APO A;  4K0N A;  2FLS A;  3HD5 A;  3US3 A;  2C3N A;  1HNB A;  4E8H A;  4X43 A;  4YH2 A;  2PMT A;  1ML6 A;  3EWL A;  2H66 A;  3CRT A;  3HJM A;  3KP8 A;  4MA9 A;  3HDC A;  4Q5N A;  2HSM A;  2QC7 A;  5B6N A;  1MD3 A;  1Y25 A;  2H72 A;  2XBQ A;  1IYH A;  2VM1 A;  5BMU A;  4KSM A;  3FR6 A;  4GQC A;  1EZK A;  5HFK A;  1ILO A;  2LST A;  3UOM A;  2VCV A;  3MAK A;  4PQ1 A;  3TGZ A;  2H70 A;  2DKI A;  1O85 A;  3PH9 A;  3F63 A;  2RII A;  3M3M A;  2O8V B;  5JWQ B;  1QFN A;  4RI6 A;  4X0X A;  4WF5 A;  2FWE A;  4DVC A;  2VCQ A;  4CW9 A;  2H74 A;  2YPM A;  2GT5 A;  1GWC A;  2OKA A;  4ACS A;  2H1A A;  16GS A;  1EP7 A;  3TJB A;  4BPY A;  2YZH A;  1YDK A;  2X99 A;  4YAP A;  3FKF A;  1CQG A;  4IQ1 A;  3GHA A;  5A4V A;  2WB9 A;  3K8N A;  3ERW A;  4OO5 A;  3FZ4 A;  4KAE A;  2A2P A;  2DKH A;  1TRW A;  2L59 A;  4O5Q A;  5CO3 A;  2PN8 A;  2X4A A;  2YP6 A;  3ZMK A;  3C71 A;  3RHC A;  2BMX A;  3VPQ A;  1I5G A;  5HR3 A;  1ON4 A;  3H93 A;  4G9H A;  3GX8 A;  2CQ9 A;  5GSS A;  3IR4 A;  2CX3 A;  2F8A A;  2UZ8 A;  3GIX A;  2V6K A;  2DC5 A;  4IP1 A;  3TJF A;  2PU9 C;  4EKZ A;  3KZQ A;  7GSS A;  1Z3E A;  5DQS A;  4V2M A;  4JRR A;  3SWL A;  4ZL9 A;  4TR4 A;  4I8B A;  5C00 A;  4MJC A;  2H01 A;  1OC8 A;  3ZML A;  4XS6 A;  3EUR A;  4P3Y B;  4K6X A;  5FHI A;  4NMU A;  5AIS A;  4TR1 A;  4EC0 A;  4BVY A;  2GGT A;  1EWX A;  5J5N A;  2I1U A;  1VF2 A;  3F3Q A;  1EEM A;  4LL4 B;  4BVY B;  4HOJ A;  5F06 A;  2LJK A;  4KDX A;  5ECR B;  2LKU A;  3IPZ A;  3BCI A;  3ZTL A;  4WXT A;  3F3R A;  2GQL A;  3HHV A;  1Z6N A;  1ZOF A;  3NZN A;  1GTI A;  4KCE A;  4MH3 A;  2HT9 A;  3ZYW A;  1PKW A;  1ABA A;  1TOF A;  1GSS A;  2YJH A;  5D8I A;  6GSU A;  2J23 A;  3G7I A;  4IKH A;  1M2B A;  3CBU A;  3ZFB A;  1G6Y A;  1VGL A;  4G0K A;  1FOV A;  2V32 A;  4NV2 A;  4PQI A;  4MLY A;  1W89 A;  3FW2 A;  4HJM A;  4YKG A;  3IA1 A;  1JFU A;  4ICY A;  1AQX A;  5B6M A;  3QD9 A;  3WGE A;  2R3X A;  1K0C A;  2E2G A;  5H5R A;  3GYK A;  1B9Y C;  3EU3 A;  2K8V A;  1ACV A;  1A8L A;  1T4Z A;  3F6F A;  4AJ7 A;  1Z5Y E;  1WPI A;  1SKR B;  2FWF A;  2YWM A;  1EV4 A;  1GNE A;  2P0G A;  4AF2 A;  4X1U A;  1ST9 A;  1V58 A;  5ENU A;  5JCU A;  5ECH B;  2DIZ A;  4BVX A;  4TKY A;  3TKR A;  4HZ4 A;  4KE3 A;  1R26 A;  1XVQ A;  3FYG A;  3D22 A;  2B3S A;  4EDY A;  1SYR A;  1ZYN A;  1NW2 A;  3KP9 A;  3ME7 A;  3ZLP A;  4TXV A;  4L5L A;  1PL2 A;  2PUK C;  1OC9 A;  2H73 A;  3RBT A;  1IYI A;  3GUR A;  1F6M C;  2C3Q A;  2FWH A;  3CTG A;  1MTC A;  5ECM B;  5CRE A;  3UL3 A;  3DWV A;  3IBH A;  5IIZ A;  3QFB C;  5IQY A;  2HSH A;  5B8B A;  3TCO A;  5KEJ A;  1MDI A;  1PN9 A;  4GLT A;  4EVM A;  1U87 A;  1TDI A;  2HRA A;  2B5Y A;  2HZF A;  2C8U A;  1BED A;  3GH9 A;  2HSY A;  3HJP A;  1SEN A;  3VI5 A;  4Z2T A;  2GLR A;  1K3O A;  1TRV A;  1X5E A;  1WP0 A;  3I6A A;  5ECQ B;  2H0G A;  5A4U A;  4F82 A;  2DMM A;  3O76 A;  5B7C A;  3ZFL A;  3M8N A;  4DSS A;  5CYY A;  3FZA A;  5DJL A;  2HRF A;  5IOX A;  5DAL A;  1BAY A;  1F3A A;  3GL5 A;  1TTZ A;  1TU7 A;  2PGT A;  2H30 A;  3KJY A;  4MZC A;  5AIX A;  2V2G A;  1YEP A;  5GAN D;  3UAP A;  2B1L A;  5DBQ A;  1EEJ A;  4NXI A;  4PUF C;  1PX6 A;  4NHZ A;  1UA5 A;  2XPE A;  3IXR A;  2DJ2 A;  8GSS A;  2CT6 A;  1PD2 1;  5HQP A;  1C72 A;  3GN3 A;  3VPT A;  3IC8 A;  1K0B A;  3IK9 A;  4NHW A;  2VD0 A;  3CSJ A;  1WOU A;  5COH A;  3TUE A;  4F0B A;  1G0T A;  4POM A;  1MEK A;  4EF0 A;  3RAZ A;  5G1K A;  1EOH A;  3F0I A;  3GKM A;  3F4S A;  1GSD A;  1LJR A;  20GS A;  2ZNM A;  3WT1 A;  2XBI A;  3UJ1 A;  4KH7 A;  3FK8 A;  3A2V A;  2L4Q A;  1HNA A;  2H19 A;  2MZC A;  1AAZ A;  4K2X A;  4Q5R A;  1O6J A;  3TRX A;  18GS A;  4NPB A;  4KB3 A;  3UBL A;  3CTF A;  4HJ2 A;  3FZ9 A;  3EE2 A;  3PR8 A;  3UVH A;  1THX A;  4K1F A;  3FR9 A;  2L6D A;  2PVO C;  2H1G A;  3A3T A;  5CAX A;  2G0F A;  1O73 A;  1B4P A;  2VOC A;  3EVI A;  3L9V A;  2AB6 A;  1PSQ A;  2K6V A;  4GWR A;  5F05 A;  2IN3 A;  4JR4 A;  2AHE A;  2RLI A;  4G0I A;  5D9T A;  5AGY A;  1YEX A;  4IBP A;  3Q19 A;  2MBT A;  3ZIJ A;  3D5J A;  4KW6 A;  3FY7 A;  1F37 A;  2CZ3 A;  1GL8 A;  3WGX A;  5ABR A;  1GTA A;  3GTU A;  3I43 A;  4MP4 A;  1EV9 A;  1SK1 A;  5CP1 A;  1DE1 A;  2IJY A;  4BL7 A;  5AN1 A;  1T1V A;  1T4Y A;  4MF5 A;  3DRN A;  3OR5 A;  2DJ3 A;  2B7K A;  1SL0 B;  2CA8 A;  1YF1 A;  2XC2 A;  6GSV A;  2AUV A;  4OD7 A;  3G9B A;  3H8Q A;  4ZBB A;  3TJG A;  4OMV A;  2YNX A;  1FW1 A;  4I6X A;  2IL3 A;  3EIN A;  2H6Z A;  4V2N A;  4GTU A;  4ZBA A;  4RUV A;  3L9S A;  4F0C A;  3L0H A;  4K5S A;  3GMF A;  1Z6M A;  2M46 A;  4ZBD A;  4HDE A;  2YZU A;  4LA1 A;  5H5S A;  1PN0 A;  5J9C A;  1ZZY A;  3C7M A;  3V1W A;  4YQU A;  2VO4 A;  2GT6 A;  1HNC A;  1MD4 A;  4LL1 B;  2M80 A;  1U3A A;  4MJE A;  5CRD A;  4N11 A;  1GH2 A;  2KP1 A;  2ON5 A;  2WFC A;  4PUA A;  1KNG A;  1GSQ A;  1V2A A;  4IVF A;  2WUL A;  4TXO B;  5ELA A;  4TW5 A;  1PX7 A;  1GP1 A;  3U6V A;  1NSW A;  4K5R A;  4BA7 A;  1ZMA A;  2H75 A;  3F9U A;  3IAM 2;  1WE0 A;  3ISO A;  1EGR A;  4TR0 A;  3GH6 A;  1XXU A;  3FR3 A;  3TOT A;  2PPT A;  2PER A;  2PBJ A;  4AJ8 A;  3P90 A;  1RK4 A;  1ERU A;  2YAN A;  2KLX A;  2O87 A;  2WGR A;  5KN0 A;  4QQ7 A;  1WJK A;  3UIW A;  2EIO A;  2O7K A;  5GZZ B;  2MMZ A;  2MMN A;  3KCM A;  4USS A;  4V1A p;  1A2L A;  3GKK A;  3NIV A;  4XTS A;  1N8J A;  3WYW A;  1AQW A;  1K0N A;  4MCU A;  4ULX A;  3O3T A;  4JBB A;  1GUM A;  4NWY A;  4IJ3 A;  1AUC A;  1R4W A;  2LQQ A;  1KTE A;  4GSS A;  2CV4 A;  6GSX A;  1LU4 A;  3QAV A;  4MZW A;  2XHF A;  2JSZ A;  3VWV A;  5KN3 A;  5IMZ A;  2C4J A;  2QA2 A;  2EIQ A;  4J56 E;  3TRP A;  4ID0 A;  2OE0 A;  3DEX A;  6GST A;  2KUC A;  2YCD A;  4KA0 A;  2NBS A;  1Y6E A;  1XW6 A;  1FB6 A;  3U5R E;  2CVB A;  1MDK A;  1R5P A;  2P5Q A;  4J57 E;  4QL9 A;  2M72 A;  4CHS A;  2JZT A;  4Z7X A;  4ML6 A;  4O7H A;  1XFL A;  5LNK e;  2YWI A;  2LUS A;  1RQM A;  4K0G A;  2DBC A;  2FHE A;  3BD2 A;  4EO3 A;  4GQF A;  4KCA A;  3KTB A;  2VUP A;  3W6G A;  3QR6 A;  4TVE A;  1NM3 A;  3D0Z A;  3TKQ A;  5D93 A;  1YJ6 A;  4HZ2 A;  2DSA A;  1GSE A;  3GX0 A;  1PMT A;  1JZD A;  1SJI A;  2LJR A;  1G7E A;  3KGK A;  2DJ1 A;  5D96 A;  5G2Z A;  4Q5Q A;  3RPP A;  1H75 A;  4JU5 A;  1VF3 A;  1JZR A;  1X9M B;  2JZR A;  3NOF A;  1TI3 A;  3M9J A;  3F8U A;  2BTO T;  3VWU A;  2QA1 A;  2IFQ B;  3DGQ A;  1OVN A;  3DML A;  2HRN A;  2C0F A;  2DIY A;  3BCK A;  3RHB A;  1B48 A;  3TKS E;  3GFK A;  4HUA A;  2FGX A;  4K7N A;  2NPB A;  2GVP A;  3VLN A;  1A2M A;  1F9M A;  1QGV A;  5D73 A;  3QCP A;  1Z9H A;  2VCX A;  1SL2 B;  2JAC A;  3H4K A;  5DCG A;  3GKX A;  1WWJ A;  1Q4J A;  4N0Z A;  3QAG A;  3IAS 2;  4MNN A;  2E2M A;  3GRX A;  2HLS A;  3ZRE A;  4YQV A;  2HXK A;  4I2U A;  11GS A;  4XRD A;  2JU5 A;  3APQ A;  3C1R A;  2C3T A;  1CQH A;  1XPV A;  3RDW A;  3TKS C;  1BJX A;  3EPT A;  2X8H A;  2FA4 A;  17GS A;  3HKR A;  5EVO A;  4LMV A;  1M2D A;  1GNW A;  4POB A;  3TB2 A;  1GLQ A;  2V6O A;  4I5Q A;  1XWG A;  4JE1 A;  4PGT A;  4O92 A;  1GSY A;  1M0U A;  1ZCP A;  2KP2 A;  2TIR A;  3C73 A;  3A2X A;  2GQM A;  2CAI A;  1TP9 A;  5DQY A;  3R2Q A;  1WRY A;  3UMA A;  3DVX A;  2GSS A;  1I9D A;  2X49 A;  3ED3 A;  1NHY A;  3A2W A;  5J9B A;  2L4C A;  2LTK A;  4L8E A;  1YQ1 A;  1E6B A;  1X9W B;  1SJZ A;  2X8C A;  4IJI A;  5KOW A;  2LRN A;  3QPM A;  2LNT A;  1XWC A;  3DKS A;  3UBK A;  2OE1 A;  2DJJ A;  3C1S A;  1PKZ A;  1SYX A;  4EIQ A;  5IMF A;  1EP8 A;  3UEM A;  2DJK A;  1S3C A;  5ID2 B;  1TRU A;  1B8X A;  2AJQ B;  3DD3 A;  2B1K A;  2KOK A;  1PA3 A;  4DSR A;  2L57 A;  3KTL A;  2QKE A;  2P5R A;  2VLT A;  3KMO A;  2B5E A;  3GL3 A;  5KOX A;  3LOR A;  1JLW A;  4D73 B;  2LV3 A;  4OCF A;  1UVZ A;  1FHE A;  3LG6 A;  4GSN A;  1JZO A;  1SKW B;  4XHM A;  2P31 A;  1DE2 A;  4POK A;  1Z7P A;  4GRF A;  4MDC A;  3J7Y k;  2WZ9 A;  4RQX A;  2OAC A;  1GSF A;  1OYJ A;  22GS A;  3M1G A;  1FVJ A;  3IHQ A;  3TRQ A;  2H1B A;  4WEY A;  4IGJ A;  1GTU A;  1U6T A;  5ECN B;  3CYN A;  2R2J A;  1XWB A;  2A2R A;  19GS A;  1M9A A;  2JAD A;  4XIH A;  2F51 A;  1ERV A;  2HYX A;  2YV9 A;  2X8G A;  4ZB9 A;  3MDK A;  3D4T A;  1GRX A;  2OAD A;  2OBK A;  2WJU A;  1TRS A;  2LRT A;  1K0D A;  4ECJ A;  4PQH A;  4Z2U A;  3S9F A;  4ECI A;  3VWW A;  1K3L A;  1SKS B;  1XCC A;  1YF0 A;  3HVV A;  1E2Y A;  3EMX A;  5G31 A;  1AIU A;  1QXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...