2RIIA

Crystal structure of human peroxiredoxin i in complex with sulfiredoxin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
184
structure length
184
Chain Sequence
SGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNSQVIGASVDSHFEHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPGSDTIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase complex
molecule keywords Peroxiredoxin-1
publication title Structure of the sulphiredoxin-peroxiredoxin complex reveals an essential repair embrace.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2007-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2riiA00
3RHCA 1GRXA 1Q98A 2LV3A 3GN3A 1K3OA 2TIRA 4GTUA 3IAM2 3D4MA 3G9BA 1OKTA 3PINA 4LMVA 4JE1A 2H6ZA 4K2DA 2CAIA 1B9XC 3GH9A 5GSSA 3GL5A 1LBKA 4J57E 1UC7A 4GCIA 2FCHA 2VCWA 2HT9A 1O73A 1H4OA 2H6XA 4EXJA 2LQOA 4PQHA 4MK3A 9GSSA 4QL9A 5IPGA 1FVJA 3FR6A 4KSOA 2VLUA 4POBA 1K0DA 3LJRA 1EV9A 2VM2A 2ALBA 3GURA 1M9BA 4MZBA 3QAVA 1Y25A 2AAWA 1BX9A 2IWTA 4PGTA 2H76A 4HJMA 4NAXA 5DJMA 5ECRB 2NTOA 4JEDA 1YY7A 2VIMA 4HI7A 3C8EA 1EGRA 1MEKA 4JU5A 4MP4A 1EEMA 1PRXA 2VL2A 2DSAA 3C1SA 2LEGA 3H79A 4JR6A 2H8LA 4FYUA 5ECNB 1BG5A 1TI1A 2IFQB 3LQ7A 2H1BA 1ABAA 4POKA 5FHIA 1FB6A 1M99A 3LORA 1V2AA 3P7XA 2GT5A 1XW5A 2LQQA 4ILFA 5J41A 5DAKB 5J9CA 2LTKA 5JCGA 3F3RA 1ZL9A 2DJ3A 4TRXA 4JZQA 2GLRA 4CHSA 1EP7A 1GUMA 1OAZA 5CRHA 4L5OA 2VLVA 4EUYA 1A8YA 3F6FA 1B9YC 4ZL9A 3DVXA 4GWRA 1WPIA 1AXDA 2GQLA 5DCHA 2CX4A 3NOFA 1T8EB 2B1LA 2LJAA 3I43A 2F9SA 4O32A 1S3DA 3VI7A 5E59A 1EV4A 4OD7A 3KH9A 3A2XA 1XWBA 3IK7A 4PUAA 1YEPA 2D2ZA 4YAVA 4PQ1A 2CQ9A 3GL3A 4DSSB 1SD9A 1TKDB 2FWFA 2GS3A 1TJDA 1NM3A 3HZ8A 2FD3A 3EINA 2JU5A 1FHEA 2YNXA 3IA1A 5ECLB 2HFDA 2WB9A 3W6GA 2HSYA 4ZIJA 4KA0A 3OR5A 4ML1A 2P5RA 3FHKA 3MSZA 4GSTA 1SL0B 2WGRA 4IP6A 3TRPA 4LL4B 2K8SA 2GZYA 1V40A 3AY8A 3F3QA 2JZSA 2DJ2A 4MZWA 4BWSA 2FNOA 2H66A 4AJ8A 3LGCA 1ACVA 5DBQA 3GKMA 2IMFA 1OKDA 3F63A 2L6CA 3LFLA 3VLNA 4PX1A 3ZFBA 1OYJA 2CVKA 3ME7A 1SK1A 1LU4A 4V2MA 1AQWA 1V98A 1FB0A 1M2AA 4KUNA 4WR5A 4MPGA 1GSFA 1OC8A 2HXKA 3LWAA 2VOCA 1HD2A 1UN2A 4KGIA 5A4VA 1PL2A 1DE2A 5C04A 2JL4A 1IYHA 3EVIA 1JHBA 1QGVA 2JSYA 3IOSA 2B7JA 2R37A 3P8WA 5J3RA 4KAEA 3D6IA 4POMA 3RHBA 1KEBA 1A0FA 3BBYA 3FZ9A 5ID2B 3O6TA 4IJIA 2BJXA 4BVXA 2H71A 2MMOA 4HJ2A 4JRRA 4F0CA 1ZYQB 1XBSA 5D9WA 1YEXA 2L59A 2O87A 2WZ9A 1TI3A 2WFCA 1GSUA 4XS4B 3HJOA 5GSTA 5INYA 2X64A 2KLXA 13GSA 2DIZA 2M72A 1I9DA 2HLSA 5KN0A 1F2EA 1QFNA 2GZPA 2JZRA 3EYTA 4HZ2A 4IELA 3SBCA 2V6OA 2R2JA 4E8HA 1GNEA 3M9KA 5ELGA 4GRFA 3GMFA 3D4TA 1M9AA 1SENA 3QD9A 3ZVJA 2HYXA 10GSA 2FA8A 5AIXA 1MD4A 1SJIA 5G31A 2HZFA 1QK8A 4TR0A 4YH2A 2MZCA 2H72A 5DALA 3EURA 16GSA 2EIQA 4ACSA 3ME8A 3KP9A 5AN1A 3QAGA 2WCIA 3TOUA 1A2LA 1ERTA 3ZL5A 4O92A 12GSA 1O81A 4HUAA 3S9FA 1WWJA 3NZNA 2RLIA 4ZL7A 3WGDA 1FVKA 4O7HA 4XS1A 1LJRA 3ZMLA 4KCAA 2YP6A 2DJ0A 4YQUA 1U6TA 1VRSD 3H4KA 5JCWA 2MBSA 1FO5A 2R5GA 3IHQA 2IIYA 1PKWA 1Z7RA 1OC3A 3DEXA 1UVZA 2OE0A 1AW9A 2HI7A 1WRYA 3VWVA 1QMVA 5IOXA 2HSHA 1XXUA 2L4CA 4N0ZA 1SK0A 2YPMA 2FWEA 1Z9HA 2XHFA 3GKKA 5B6NA 4ISDA 2Z9SA 1BAYA 1SJZA 1QUWA 1C72A 4EE0A 14GSA 2I1UA 1K0CA 3CTGA 2R6KA 3GV1A 5CAXA 2HNLA 1V58A 1T7PB 5FT3A 1EEJA 3L78A 4MABA 1TK8B 2B5YA 4K0NA 1K0NA 2ON5A 2YN1A 1GSSA 3IK9A 1IYIA 4GF0A 1Z6MA 5ECHB 2O85A 3BCIA 1GP1A 3DD3A 2ZCTA 1A8LA 2K9FA 1TP9A 7GSSA 3F0IA 1THOA 4HOJA 3GKXA 1Y6EA 3VWUA 4F03A 3RAZA 2DC5A 3O76A 4TR3A 1EP8A 4EL1A 2P0GA 5CRWA 5HR0A 2GSQA 17GSA 4RI7A 2FHEA 1A2JA 2DLXA 3FY7A 4POLA 1O85A 5IM9A 3ZRDA 5AGYA 3QFAC 2FGXA 4K7OA 4GQCA 2V32A 2TRCP 4OWYA 1WE0A 3K8NA 3ZZXA 3H93A 4KDUA 5DQSA 1SK2A 1XIYA 5IPHA 4OO5A 2HZEA 5CNWA 3LG6A 2XPDA 3CBUA 3D5JA 3DVWA 4L0UA 2GSTA 5DQYA 3DIEA 3MAKA 1XW6A 4MF7A 4K6XA 4JR4A 1YJ6A 2JADA 5B7CA 4HEA2 3PGTA 6GSVA 5JWQB 4KNDA 4D73A 5IO0A 5FWGA 1XW9A 2LNTA 2FWGA 1GSYA 4V1Ap 4EVMA 5DVBA 3UAPA 4K7IA 2M46A 1RQMA 3D0ZA 1TRWA 1XVWA 2CX3A 1PSQA 1YKAA 3IRAA 1YF1A 2NPBA 2V41A 2NDOA 2KHPA 1EGOA 3HZ4A 1VGLA 2K8VA 4IQ1A 2P31A 5AIVA 3ZYWA 1WJKA 3EC3A 4HQSA 5F8BA 2V1MA 4EKZA 3UJ1A 1AQXA 2J23A 4MJCA 1Z3EA 2GZZA 3TJBA 4Q5FA 4X0XA 1XWAA 1X5DA 2OACA 2OJLA 3LSZA 1PN9A 4V2NA 2PMTA 3UL3A 2L5LA 3LYPA 1JZOA 1SKWB 2H70A 3KP8A 2B5XA 4L5LA 3BCKA 3FR9A 4MH3A 3KIJA 5IMFA 2L6DA 1GSEA 1PKZA 5CP1A 1XWKA 2PVQA 3M1GA 1F9MA 5IIZA 2PBJA 4NV5A 3GSTA 3TUEA 5GAPD 3EMPA 5J9BA 1DE1A 4F82A 3NIVA 1J0FA 4EF0A 5D8IA 2GVPA 1R5PA 2OE1A 1U3IA 4Q5NA 1AAZA 4MLYA 3L9SA 2EC4A 4EDZA 5H5RA 3EE2A 1PA3A 1J08A 4KDXA 4FO5A 3U6VA 1W4VA 3ZITA 2N5AA 2CZ3A 4WF4A 1XCCA 1V57A 4ECJA 5D9VA 4PNFA 1FAAA 4TR1A 2P5QA 2C3TA 4J56E 3VI5A 5ECSA 1MTCA 3A2WA 1VF3A 4GSSA 4G2EA 2H0IA 2RUFA 4NHZA 4OFMA 4IJ3A 2X8HA 1YQ1A 1ERUA 1AIUA 3GTUA 1SU9A 4K8MA 4Q5RA 2RIIA 3VPTA 2TRXA 5COHA 3TKQA 2JACA 2RM6A 4FYBA 2H73A 3ZIJA 4TXOA 2CV4A 4DVCA 5HFIA 4ZBAA 5LD0A 2WDUA 1RW1A 2YWNA 2BMXA 5ECIB 4V1Ag 2AUVA 2HRNA 1R5AA 4WBRD 5ECOB 4MPFA 1TK5B 2YV9A 4NMUA 1AQVA 1O8XA 4ML6A 3A3TA 3RDWA 4YAPA 4G9HA 4J2FA 2H1DA 3C73A 4KW6A 1B4PA 2MMAA 3I6AA 1GH2A 3EU3A 4ZBBA 4ZILA 3HHVA 4TKYA 1DUGA 3FR3A 4F0BA 2LRCA 2GQMA 5KN1A 1X5CA 4TR4A 3CSHA 4IN0A 3GX8A 4BVYA 4K0GA 2DJ1A 2GQKA 1XOAA 1ZMAA 5B8BA 3ERWA 3QMXA 3F8UA 2H75A 1F6MC 5IQYA 2WULA 1TOFA 4WKWA 2YJ7A 2CAQA 4KH7A 1NW2A 1GULA 4AF2A 2FA4A 3CMIA 4XRAA 1TTZA 1YF0A 3N9JA 5ECQB 1QXHA 4P3YB 3IR4A 4N11A 2VCZA 2IMDA 1DSBA 4MF5A 4XHMA 3FK8A 5B8AA 3ZTLA 2GTUA 2XBIA 4LLRA 4XIHA 1S3CA 5ECMB 3BOAA 5F06A 2B6MA 4HU9A 3TJJA 5JWRB 1ON4A 3EWLA 1VF1A 2OBKA 3KEBA 3HVVA 5D96A 1X5EA 5H5SA 3DYRA 5DCGA 5IMZA 1K3LA 1NHYA 5F0GA 1R7HA 1XWCA 3G7JA 3C7MA 5JCUA 1O8WA 5IMVA 1URMA 2AB6A 2AV4A 4MA9A 3UOMA 4IGJA 4ZB9A 5ENUA 1F3AA 1M2DA 1KBNA 3C1RA 2ON7A 2J9HA 4O5RA 5IMCA 3GA4A 3R2QA 3UIWA 1R4WA 2ZUPA 2VCVA 2B1KA 2IMIA 3FW2A 3IAS2 6GSXA 3CRUA 1JZDA 4F9ZA 3WT1A 1YZXA 3C71A 2OBIA 4MMMA 1ZCPA 3CYNA 4AGSA 2AYTA 1ZOFA 1PX6A 5AISA 1O7UA 5IMDA 2YZHA 1G6YA 4IQAA 4YQMA 3M0FA 5F05A 1Z7PA 1T1VA 2H0HA 5G2ZA 3UARA 4LMWA 1G7EA 2X8GA 1ST9A 1N2AA 1N8JA 1A23A 3M3MA 3F6DA 4DEJA 2EIOA 2PGTA 1TU7A 4MJAA 3QFBC 4K1FA 5CO3A 2LS5A 1M7TA 2IMEA 4WF5A 1HNCA 3WD6A 1OE7A 1G7OA 4WXTA 4GXZA 1OC9A 1V9WA 3TB2A 4GLTA 2B7KA 3VWWA 3J7Yk 2H1AA 4KCEA 1PL1A 4WETA 4MH2A 2C1YA 2PN8A 3CRTA 4I2UA 2IJYA 1GTUA 4HZ4A 4OCEA 4ZBDA 2V6KA 2PERA 2YANA 1Z5YE 2YZUA 5CRGA 2WJUA 20GSA 3HVSA 2A2RA 3KD0A 3FRCA 5DDLA 3FKFA 5DALB 2DBCA 3RPPA 3GUSA 2C0GA 3D21A 3KMOA 5GZZB 2H01A 2MMNA 2VL2C 3GH6A 3ZMKA 1GWCA 2KOKA 2YWIA 3EU4A 3TJKA 4CW9A 4HDEA 4G10A 4HU7A 4EC0A 4I5QA 8GSSA 1T00A 2K18A 3FZ5A 2VAFA 1TU8A 3Q19A 4EO3A 1KTEA 2PU9C 2HRFA 4XRDA 5KN3A 4F2IA 3DGQA 4PURA 3HXSA 1X9SB 4MCUA 3ZFLA 2XC2A 3UVHA 5EL8A 1XZOA 3BJ5A 3G7YA 2VD1A 3D22A 3W8JA 2C3NA 2IN3A 2E2GA 3UBLA 1MDJA 3IBHA 1XOBA 3GIXA 4DSQA 4MF6A 1WOUA 3F4TA 2VUPA 1MDIA 4TXVA 3IDVA 4L8EA 2EIRA 3WYWA 3ISOA 3IE3A 1G0TA 3KTBA 1X0RA 1GUHA 5ELAA 4IHUA 3APOA 3VPQA 3TRXA 3HA9A 3GSSA 5E4WA 2E0QA 4ID0A 4DSRA 2DIYA 3LXZA 5G1LA 1JLWA 3L4NA 2A4VA 4RQRA 1VF2A 1NSWA 3GYKA 3KH7A 4LL1B 1A24A 1SJ6A 2YWMA 3KGKA 2IFQA 3ZVJD 1MD3A 1U3AA 3VWXA 4OCFA 5KN2A 4I97A 3I9V2 4XS6A 4N30A 4PUFC 2GGTA 2PPTA 2ES7A 3M9JA 1RK4A 5LNKe 4K9ZA 1TW9A 2DMMA 3FEUA 1MDKA 5DAKA 2NBSA 2QC7A 5IOWA 5EPFA 3HDCA 2PWJA 4X1UA 6GSWA 3LYKA 5GAND 1CQHA 3TDGA 6GSUA 3CSIA 2E2MA 2LNSA 4HS1A 1ERVA 3GFKA 4PQIA 1GUKA 3HJMA 3DMLA 3BD2A 1HYUA 2AJQB 5C00A 1OVNA 3LXTA 2GT6A 1QQ2A 3DRNA 1BQ7A 4RUVA 4ZB6A 2OADA 3KM6A 3UMAA 2HZEB 1HNAA 5F07A 3HY2A 2O7KA 1FOVA 2G2QA 5CYYA 3L9VA 1B8XA 5ABRA 2CVDA 3TCOA 4KDYA 2O8VB 4OO4A 2L5OA 2YWOA 4BWQA 5CRDA 4D73B 4XTSA 3TKSE 1J9BA 1TRVA 3HCZA 2CVBA 4DSSA 1WMJA 2CT6A 5DJLA 2C4JA 3UVTA 1GNWA 2MBTA 2OKAA 4BL7A 3V1WA 3M8NA 4IKHA 1GTAA 2WS2A 2BTOT 5CREA 3KXOA 4V2LA 2X99A 3Q74A 1B4QA 2VM1A 4NHWA 2A2SA 2VD0A 3O3TA 3HYPA 1ZGNA 4OFNA 1F37A 3HD5A 3IPZA 4QL7A 3P2AA 1BJXA 3P90A 4NWYA 2E7PA 1PMTA 3TRQA 1EWXA 1W89A 3QCPA 3MDKA 5B6MA 2YOIA 1SD8A 2LJRA 3Q6OA 2JZTA 1GSDA 2VCXA 2H74A 3TKSC 3GHAA 4PXOA 5H5QA 4BPYA 22GSA 2KP2A 4AJ7A 2R4VA 3QR6A 2F51A 2PUKC 3LEFA 2H1GA 3N5OA 2IPAA 4ECBA 1OE8A 3Q18A 3KJYA 1THXA 1ZYEA 2FY6A 5G5FA 4ULXA 2F3MA 1S3AA 4MZCA 4KX4A 3F4SA 4XCSA 5HR1A 2YCDA 2RM5A 4ZB8A 3UBKA 2OA7A 4IW9A 1ZZYA 2H6YA 4NPBA 3QPMA 4GQFA 2JSZA 3TJGA 2B3SA 3DKSA 6GSSA 2I4AA 2LSTA 3KMNA 2N5FA 5ID2A 1M0UA 2PVOC 5HR2A 1A0RP 5D9XA 1KNGA 3MWHA 3TKPA 2FUG2 1WIKA 2C80A 3L0HA 2CA8A 1JZWA 4TR1B 1E6BA 4L0WA 1JFUA 3E9JB 3FYGA 4NV2A 5ECKB 4I8BA 2G0FA 4XS4A 2KP1A 2QKEA 1FG4A 3UEMA 4GSNA 3GTUB 3QDNA 2GSRA 1SYXA 1SKSB 1T3BA 1TRSA 2M80A 4TOPA 18GSA 3PR8A 4TXOB 2N5BA 2K6VA 2ZNMA 1T4ZA 3HKRA 4YQVA 2AHEA 2VL3A 2FLSA 3G7IA 3IV4A 5G1KA 4HQZA 1X9WB 4FIWA 3E3EA 1NHOA 5A4UA 1PX7A 3WGXA 1EOGA 1K0OA 1TDIA 3HJPA 2F8FA 1K0BA 4G19A 3PH9A 1EZKA 4ZL8A 3QOUA 1Z6NA 3A5WA 6GSYA 2R3XA 3RBTA 3F4RA 5HFGA 1A2MA 4IP1A 4PNGA 4H86A 5L71A 2DJKA 2I81A 1HNBA 1WP0A 2MYGA 2V2GA 1K3YA 3CSJA 5J5NA 2L57A 1R26A 4AJ6A 4I2TA 1X9MB 3KTLA 1XPVA 1Q4JA 4EDYA 4JBBA 3I69A 3KZQA 4ECIA 3U5RE 1O6JA 1U88A 1YDKA 3TKSA 1GL8A 3SWLA 3IXRA 3DWVA 3F9UA 1JZRA 5HR3A 1AUCA 4OFTA 2VO4A 3WGEA 3MNGA 5KEJA 2REMA 1E2YA 5IO2A 4N10A 3L9UA 2YV7A 2C0EA 3ZIVA 4TN8A 1U87A 5G30A 1GTBA 2I9HA 1TXXA 2NVLA 5EVOA 3J7Yb 4IBPA 5D73A 2MMZA 1TK0B 1GLQA 4RI6A 2L4QA 2RUEA 1ERWA 2XBQA 3GNJA 2FWHA 4OMVA 1UA5A 2I3YA 2DJJA 1AC1A 1GTIA 3H8QA 1SL1B 3US3A 1B48A 3VURA 3VK9A 4WEYA 4Z7XA 4ZXGA 4KB3A 5A5KA 4MJEA 4MDCA 2H30A 5HFKA 2HE3A 2LKUA 3FZ4A 2B5EA 3HVXA 4I6XA 3ZREA 1XVQA 1BEDA 3QAWA 4KSMA 2VCTA 1GSQA 3KCMA 1JLVA 4E8EA 2O89A 2CZ2A 4QQ7A 1FW1A 1SKRB 1HQOA 3APQA 1BYEA 5A4WA 3GX0A 5JWOB 4TW5A 1K0MA 1G6WA 4KE3A 5EY6A 2VL9A 4BA7A 5LCZA 2C0FA 2C8UA 3CTFA 3IC4A 2LJKA 3FZAA 3TGZA 3DXBA 1K0AA 1XFLA 3H1NA 1GLPA 3W8SA 2YJHA 1PQNA 1T4YA 4LA1A 3APSA 2VLTA 3ED3A 4NXIA 4FH8A 2C0DA 4Q5QA 4N0VA 3ERFA 2LRTA 5J4UA 2XPEA 1I5GA 2IL3A 2KUCA 3JCML 3TOTA 5HQPA 4TVEA 4WR4A 1VF4A 2DMLA 2X8CA 6GSTA 2H0GA 3A2VA 1SYRA 1SL2B 5G5EA 11GSA 1XWGA 2LRNA 1M2BA 3TKRA 4IS0A 3VFIA 4WBJA 1ILOA 1OC9B 2F8AA 2GSSA 1H75A 1YKCA 3ERGA 2IMKA 5D93A 4CDOA 3E0UA 1TRUA 4MJBA 4X43A 1F3BA 5IMAA 1ML6A 1EOHA 4IVFA 4RQXA 4K7NA 3GRXA 4ECCA 3WT2A 19GSA 1CQGA 1PGTA 2QGVA 1USBA 2QSIA 2WRTA 3TJFA 1DBYA 5ECPB 3CXGA 3ZLPA 3GKNA 4FYCA 2GDRA 5D9TA 2VCQA 2LUSA 3RPNA 2H19A 3EMXA 2C3QA 2OE3A 1PD21
chains in the Genus database with same CATH superfamily
3RHCA 1GRXA 1Q98A 2LV3A 3GN3A 1K3OA 2TIRA 4GTUA 3IAM2 3D4MA 3G9BA 1OKTA 3PINA 4LMVA 4JE1A 2H6ZA 4K2DA 2CAIA 1B9XC 3GH9A 5GSSA 3GL5A 1LBKA 4J57E 1UC7A 4GCIA 2FCHA 2VCWA 3IC8A 2HT9A 1O73A 1H4OA 2H6XA 4EXJA 2LQOA 4PQHA 4MK3A 9GSSA 4QL9A 5IPGA 1FVJA 3FR6A 4KSOA 2VLUA 4POBA 1K0DA 3LJRA 1EV9A 2VM2A 2ALBA 3GURA 1M9BA 4MZBA 3QAVA 1Y25A 2AAWA 1BX9A 2IWTA 4PGTA 1FOHA 2H76A 4HJMA 4NAXA 5DJMA 5ECRB 2NTOA 4JEDA 1YY7A 2VIMA 4HI7A 3C8EA 1EGRA 1MEKA 4JU5A 4MP4A 1EEMA 1PRXA 2VL2A 2DSAA 3C1SA 2LEGA 3H79A 4JR6A 2H8LA 4FYUA 5ECNB 1BG5A 1TI1A 2IFQB 3LQ7A 2H1BA 1ABAA 4POKA 5FHIA 1FB6A 1M99A 3LORA 1V2AA 3P7XA 2GT5A 1XW5A 2LQQA 2UZ8A 4ILFA 5J41A 5DAKB 5J9CA 2LTKA 5JCGA 3F3RA 1ZL9A 2HSMA 2DJ3A 4TRXA 4JZQA 2GLRA 4CHSA 1EP7A 1GUMA 1OAZA 5CRHA 4L5OA 2VLVA 4EUYA 1A8YA 3F6FA 1B9YC 4ZL9A 3DVXA 4GWRA 1WPIA 1AXDA 2GQLA 5DCHA 2CX4A 3NOFA 1T8EB 2B1LA 2LJAA 3EPTA 3I43A 2F9SA 4O32A 1S3DA 3VI7A 5E59A 1EV4A 4OD7A 3KH9A 3A2XA 1XWBA 3IK7A 4PUAA 1YEPA 2D2ZA 4YAVA 4PQ1A 2CQ9A 3GL3A 4DSSB 1SD9A 1TKDB 2FWFA 2QA1A 2GS3A 4BL7B 1TJDA 2A4HA 1NM3A 3HZ8A 2FD3A 3EINA 2JU5A 1FHEA 2YNXA 3IA1A 5ECLB 2HFDA 2WB9A 3W6GA 2HSYA 4ZIJA 4KA0A 3OR5A 4ML1A 2P5RA 3FHKA 1PFOA 3MSZA 4GSTA 1SL0B 2WGRA 4IP6A 3TRPA 4LL4B 2K8SA 2GZYA 1V40A 3AY8A 3F3QA 2JZSA 2DJ2A 4MZWA 4BWSA 2FNOA 2H66A 4AJ8A 3LGCA 1ACVA 5DBQA 3GKMA 2IMFA 1OKDA 3F63A 2L6CA 3LFLA 3VLNA 4PX1A 3ZFBA 1OYJA 4BIKA 2CVKA 3ME7A 1SK1A 1LU4A 4V2MA 1AQWA 1V98A 1FB0A 1M2AA 4KUNA 4WR5A 4MPGA 1GSFA 1OC8A 2HXKA 3LWAA 2VOCA 1HD2A 1UN2A 4KGIA 5A4VA 1PL2A 1DE2A 4EIQA 4ICYA 5C04A 2JL4A 1IYHA 3EVIA 1JHBA 1QGVA 2JSYA 3IOSA 2B7JA 2R37A 3P8WA 5J3RA 4KAEA 3D6IA 4POMA 3RHBA 1KEBA 1A0FA 3BBYA 3FZ9A 5ID2B 4YKGA 3O6TA 4IJIA 2BJXA 4BVXA 2H71A 2MMOA 4HJ2A 4JRRA 4F0CA 1ZYQB 1XBSA 5D9WA 1YEXA 2L59A 2O87A 2WZ9A 4G0KA 1TI3A 2WFCA 1GSUA 4XS4B 3HJOA 5GSTA 5INYA 2X64A 2KLXA 13GSA 2DIZA 2M72A 1I9DA 2HLSA 5KN0A 1F2EA 1QFNA 2GZPA 2JZRA 3EYTA 4HZ2A 4IELA 3SBCA 2V6OA 3FMWA 2R2JA 2HRKA 4E8HA 1GNEA 3M9KA 5ELGA 4GRFA 3GMFA 3D4TA 1M9AA 1SENA 3QD9A 3ZVJA 2HYXA 10GSA 2FA8A 5AIXA 1MD4A 1SJIA 5G31A 4YKFA 2HZFA 1QK8A 4TR0A 4YH2A 2MZCA 2H72A 5DALA 3EURA 16GSA 2EIQA 4ACSA 3ME8A 3KP9A 5AN1A 3QAGA 2WCIA 3TOUA 1A2LA 1ERTA 3ZL5A 4O92A 12GSA 1O81A 4HUAA 3S9FA 1WWJA 3NZNA 2RLIA 4ZL7A 3WGDA 1FVKA 4O7HA 4XS1A 1LJRA 3ZMLA 4KCAA 2YP6A 2DJ0A 4YQUA 1U6TA 1VRSD 3H4KA 5JCWA 2MBSA 1FO5A 2R5GA 3IHQA 2IIYA 1PKWA 1Z7RA 4G0LA 1OC3A 3DEXA 1UVZA 2OE0A 1AW9A 2HI7A 1WRYA 3VWVA 1QMVA 5IOXA 2HSHA 1XXUA 2L4CA 4N0ZA 1SK0A 2YPMA 2FWEA 1Z9HA 2XHFA 3GKKA 5B6NA 4ISDA 2Z9SA 1BAYA 1SJZA 1QUWA 1C72A 4EE0A 14GSA 2I1UA 1K0CA 3CTGA 2R6KA 3GV1A 5CAXA 2HNLA 1V58A 1T7PB 5FT3A 3A5IA 1EEJA 3L78A 4MABA 1TK8B 1M3JA 2B5YA 4K0NA 1K0NA 2ON5A 2YN1A 1GSSA 3IK9A 1IYIA 4GF0A 1Z6MA 5ECHB 2O85A 3BCIA 1GP1A 3DD3A 2ZCTA 1A8LA 2K9FA 1TP9A 7GSSA 3F0IA 1THOA 4HOJA 3GKXA 1Y6EA 3VWUA 4F03A 3RAZA 2DC5A 3O76A 4TR3A 1EP8A 4EL1A 2P0GA 5CRWA 5HR0A 2GSQA 17GSA 4RI7A 2FHEA 1A2JA 2DLXA 3FY7A 4POLA 1O85A 5IM9A 3ZRDA 5AGYA 3QFAC 2FGXA 4K7OA 4GQCA 2V32A 2TRCP 4OWYA 1WE0A 3K8NA 3ZZXA 3H93A 4KDUA 5DQSA 1SK2A 1XIYA 5IPHA 4OO5A 2HZEA 5CNWA 3LG6A 2XPDA 3CBUA 3D5JA 3DVWA 4G0IA 4L0UA 2GSTA 5DQYA 3DIEA 3MAKA 1XW6A 4MF7A 4K6XA 4JR4A 1YJ6A 2JADA 5B7CA 4HEA2 3PGTA 6GSVA 5JWQB 4KNDA 4D73A 5IO0A 5FWGA 1XW9A 2LNTA 4K5RA 2FWGA 1GSYA 4V1Ap 4EVMA 5DVBA 3UAPA 4K7IA 2M46A 1RQMA 3D0ZA 2X49A 1TRWA 1XVWA 2CX3A 1PSQA 1YKAA 3IRAA 1YF1A 2NPBA 2V41A 2NDOA 2KHPA 1EGOA 3HZ4A 1VGLA 2K8VA 4IQ1A 2P31A 5AIVA 3ZYWA 1WJKA 3EC3A 4HQSA 5F8BA 2V1MA 4EKZA 3UJ1A 1AQXA 2J23A 4MJCA 1Z3EA 2GZZA 3TJBA 4Q5FA 4X0XA 1XWAA 1X5DA 2OACA 2OJLA 3LSZA 1PN9A 4V2NA 4CY8A 2PMTA 3UL3A 2L5LA 3LYPA 1JZOA 1SKWB 4K5SA 2H70A 3KP8A 2B5XA 4L5LA 3BCKA 3FR9A 4MH3A 3IHGA 3KIJA 5IMFA 4Z2UA 2L6DA 1GSEA 1PKZA 5CP1A 1XWKA 2PVQA 3M1GA 1F9MA 5IIZA 2PBJA 4NV5A 3GSTA 3TUEA 5GAPD 3EMPA 5J9BA 1DE1A 4F82A 3NIVA 1J0FA 4EF0A 5D8IA 2GVPA 1R5PA 2OE1A 1U3IA 4Q5NA 1AAZA 5KOXA 4MLYA 3L9SA 2EC4A 4EDZA 5H5RA 3EE2A 1PA3A 1J08A 4KDXA 2R0CA 4FO5A 3U6VA 1W4VA 3ZITA 2N5AA 4Z2TA 2CZ3A 4WF4A 1XCCA 1V57A 4ECJA 5D9VA 4PNFA 1FAAA 4TR1A 2P5QA 2C3TA 4J56E 3VI5A 5ECSA 1MTCA 3A2WA 1VF3A 4GSSA 4G2EA 2H0IA 2RUFA 4NHZA 2R0PA 4OFMA 4IJ3A 2X8HA 1YQ1A 1ERUA 1AIUA 3GTUA 1SU9A 4K8MA 4Q5RA 2RIIA 3VPTA 2TRXA 5COHA 3TKQA 2JACA 2RM6A 4FYBA 2H73A 3ZIJA 4TXOA 2CV4A 4DVCA 5HFIA 4ZBAA 5LD0A 2WDUA 1RW1A 2YWNA 2BMXA 5ECIB 4USSA 4V1Ag 2AUVA 2HRNA 4EIPA 1R5AA 4WBRD 5ECOB 4MPFA 1TK5B 2YV9A 4NMUA 1AQVA 1O8XA 4ML6A 3A3TA 3RDWA 4YAPA 4G9HA 4J2FA 2H1DA 3C73A 4KW6A 1B4PA 2MMAA 3I6AA 1GH2A 3EU3A 4ZBBA 4ZILA 3HHVA 4TKYA 1DUGA 3FR3A 4F0BA 2LRCA 2GQMA 5KN1A 1X5CA 4TR4A 3CSHA 4IN0A 3GX8A 4BVYA 4K0GA 2DJ1A 2GQKA 1XOAA 1ZMAA 5B8BA 3ERWA 3QMXA 3F8UA 2H75A 1F6MC 5IQYA 2WULA 1TOFA 4WKWA 2YJ7A 2CAQA 4KH7A 1NW2A 1GULA 4AF2A 2FA4A 3CMIA 4XRAA 1TTZA 1YF0A 3N9JA 5ECQB 1QXHA 4P3YB 3IR4A 4N11A 2VCZA 2IMDA 4MNNA 1DSBA 4MF5A 4XHMA 3FK8A 5B8AA 3ZTLA 2DKHA 2GTUA 2XBIA 4LLRA 4XIHA 1S3CA 3HVNA 5ECMB 3BOAA 5F06A 2B6MA 4HU9A 4Z2RA 3TJJA 5JWRB 1ON4A 3EWLA 1VF1A 2OBKA 3KEBA 3HVVA 5D96A 1X5EA 5H5SA 3DYRA 5DCGA 4K2XA 5IMZA 1K3LA 5KOWA 1NHYA 5F0GA 1R7HA 1XWCA 3G7JA 3C7MA 5JCUA 1O8WA 5IMVA 1URMA 2AB6A 2AV4A 4MA9A 3UOMA 4IGJA 1XG8A 1M3IA 4ZB9A 5ENUA 1F3AA 1M2DA 1KBNA 3C1RA 2ON7A 2J9HA 4O5RA 5IMCA 3GA4A 3R2QA 3UIWA 1R4WA 2ZUPA 3MYDA 2VCVA 2B1KA 2IMIA 3FW2A 3IAS2 6GSXA 3CRUA 1JZDA 4F9ZA 3WT1A 1YZXA 3C71A 2OBIA 4MMMA 1ZCPA 3CYNA 4AGSA 2AYTA 1ZOFA 1PX6A 5AISA 1O7UA 5IMDA 2YZHA 1G6YA 4IQAA 4YQMA 3M0FA 5F05A 1Z7PA 4BVXB 1T1VA 2H0HA 5G2ZA 3UARA 4LMWA 1G7EA 2X8GA 1ST9A 1N2AA 1N8JA 1A23A 3M3MA 3F6DA 4DEJA 2EIOA 2PGTA 1TU7A 4MJAA 3QFBC 1S3RA 4K1FA 5CO3A 2LS5A 1M7TA 2IMEA 4WF5A 1HNCA 3WD6A 1OE7A 1G7OA 2R0GA 4WXTA 4GXZA 1OC9A 1V9WA 3TB2A 4GLTA 2B7KA 3VWWA 3J7Yk 2H1AA 3R3EA 4KCEA 1PL1A 4WETA 4MH2A 2C1YA 2PN8A 3CRTA 4I2UA 2IJYA 1GTUA 4HZ4A 4OCEA 4ZBDA 2V6KA 2X4AA 2PERA 2YANA 1Z5YE 2YZUA 5CRGA 2WJUA 20GSA 3HVSA 2A2RA 3KD0A 3FRCA 5DDLA 3FKFA 5DALB 2DBCA 3RPPA 3GUSA 2C0GA 3D21A 3KMOA 5GZZB 2H01A 2MMNA 2VL2C 3GH6A 3ZMKA 1GWCA 2KOKA 2YWIA 3EU4A 3TJKA 4CW9A 4HDEA 4G10A 4HU7A 4EC0A 4I5QA 8GSSA 1T00A 2K18A 3FZ5A 2VAFA 1TU8A 3Q19A 4EO3A 1KTEA 2PU9C 2HRFA 4XRDA 5KN3A 4F2IA 3DGQA 4PURA 3HXSA 1X9SB 4MCUA 3ZFLA 2XC2A 3UVHA 1PN0A 5EL8A 1XZOA 3BJ5A 3G7YA 2VD1A 3D22A 3W8JA 2C3NA 2IN3A 2E2GA 3UBLA 1MDJA 3IBHA 1XOBA 3GIXA 4DSQA 4MF6A 1WOUA 3F4TA 2VUPA 1MDIA 4TXVA 3IDVA 4L8EA 2EIRA 3WYWA 3ISOA 3IE3A 1G0TA 3KTBA 1X0RA 1GUHA 5ELAA 4IHUA 3APOA 3VPQA 3TRXA 3HA9A 3GSSA 5E4WA 2E0QA 4ID0A 4DSRA 2DIYA 3LXZA 5G1LA 1JLWA 3L4NA 2A4VA 4RQRA 1VF2A 1ZYPA 1NSWA 3GYKA 3KH7A 4LL1B 1A24A 1SJ6A 2YWMA 3KGKA 2IFQA 3ZVJD 1MD3A 1U3AA 3VWXA 4OCFA 5KN2A 4I97A 3I9V2 4XS6A 4N30A 4PUFC 2GGTA 2PPTA 2ES7A 3M9JA 1RK4A 5LNKe 4K9ZA 1TW9A 2DMMA 3FEUA 1MDKA 5DAKA 2NBSA 2QC7A 5IOWA 5EPFA 3HDCA 2PWJA 4X1UA 6GSWA 3LYKA 5GAND 1CQHA 3TDGA 6GSUA 3CSIA 2E2MA 2LNSA 4HS1A 1ERVA 3GFKA 4PQIA 1GUKA 3HJMA 3DMLA 3BD2A 1HYUA 2AJQB 5C00A 1OVNA 3LXTA 2GT6A 1QQ2A 3DRNA 1BQ7A 4RUVA 4ZB6A 2OADA 3KM6A 3UMAA 2HZEB 1HNAA 5F07A 3HY2A 2O7KA 1FOVA 2G2QA 4PTSA 5CYYA 3L9VA 1B8XA 5ABRA 2CVDA 3TCOA 4KDYA 2O8VB 4OO4A 2L5OA 2YWOA 4BWQA 5CRDA 4D73B 4XTSA 3TKSE 1J9BA 1TRVA 3HCZA 2CVBA 4DSSA 1WMJA 2CT6A 5DJLA 2C4JA 3UVTA 1GNWA 4O5UA 2MBTA 2OKAA 4A5PA 4BL7A 3V1WA 3M8NA 4IKHA 1GTAA 2WS2A 2BTOT 5CREA 3KXOA 4V2LA 2X99A 3Q74A 1B4QA 2VM1A 4NHWA 2A2SA 2VD0A 3O3TA 3HYPA 1ZGNA 2QA2A 4OFNA 1F37A 3HD5A 3IPZA 4QL7A 3P2AA 1BJXA 3P90A 4NWYA 2E7PA 1PMTA 3TRQA 1EWXA 1W89A 3QCPA 3MDKA 5B6MA 2YOIA 4HSCX 1SD8A 2LJRA 3Q6OA 2JZTA 1GSDA 2VCXA 2H74A 3TKSC 3GHAA 4PXOA 3MIXA 5H5QA 4BPYA 22GSA 2KP2A 4AJ7A 3PPUA 2R4VA 3QR6A 2F51A 2PUKC 3LEFA 2H1GA 3N5OA 2IPAA 4ECBA 2A2PA 1OE8A 3Q18A 3KJYA 1THXA 1ZYEA 4FQUA 2FY6A 5G5FA 4ULXA 2F3MA 1S3AA 4MZCA 4KX4A 3F4SA 4XCSA 5HR1A 2YCDA 2RM5A 4ZB8A 3UBKA 2OA7A 4IW9A 5BMUA 1ZZYA 2H6YA 4NPBA 3QPMA 4GQFA 2JSZA 2DKIA 3TJGA 2B3SA 3DKSA 6GSSA 2I4AA 2LSTA 3KMNA 2N5FA 5ID2A 1M0UA 2PVOC 5HR2A 1A0RP 5D9XA 1KNGA 3MWHA 3TKPA 2FUG2 1WIKA 2C80A 3L0HA 2CA8A 1JZWA 2HRAA 1E6BA 4L0WA 4TR1B 1JFUA 3E9JB 3FYGA 4NV2A 5ECKB 4I8BA 2G0FA 4XS4A 2KP1A 4X4JA 2QKEA 1FG4A 3UEMA 4GSNA 3GTUB 3QDNA 2GSRA 1SYXA 1SKSB 1T3BA 1TRSA 2M80A 4TOPA 18GSA 3PR8A 4TXOB 2N5BA 2K6VA 2ZNMA 1T4ZA 3HKRA 4YQVA 2AHEA 2VL3A 2FLSA 3G7IA 3IV4A 5G1KA 4HQZA 1X9WB 4FIWA 3E3EA 1NHOA 5A4UA 1PX7A 3WGXA 1EOGA 1K0OA 1TDIA 3HJPA 2F8FA 1K0BA 4G19A 3PH9A 1EZKA 4ZL8A 3QOUA 1Z6NA 3A5WA 6GSYA 2R3XA 3RBTA 3F4RA 5HFGA 1A2MA 4IP1A 4PNGA 4H86A 5L71A 2DJKA 2I81A 1HNBA 1WP0A 2MYGA 2V2GA 1K3YA 4BVYB 3CSJA 5J5NA 2L57A 1R26A 4AJ6A 4I2TA 1X9MB 3KTLA 1XPVA 1Q4JA 4EDYA 4KF9A 4JBBA 3I69A 3KZQA 4ECIA 3U5RE 1O6JA 1U88A 1YDKA 3TKSA 1GL8A 3SWLA 3IXRA 3DWVA 3F9UA 1JZRA 5HR3A 1AUCA 4OFTA 2VO4A 3WGEA 3MNGA 5KEJA 2REMA 1E2YA 5IO2A 4N10A 3L9UA 2YV7A 2C0EA 1ZYNA 3ZIVA 4TN8A 1U87A 5G30A 1GTBA 2I9HA 1TXXA 2NVLA 5EVOA 3J7Yb 4IBPA 5D73A 2MMZA 1TK0B 1GLQA 4RI6A 2L4QA 2RUEA 1ERWA 2XBQA 3GNJA 2FWHA 4OMVA 1UA5A 2I3YA 2DJJA 1AC1A 1GTIA 3CQFA 3H8QA 1SL1B 3US3A 1B48A 3VURA 3VK9A 4WEYA 4Z7XA 4ZXGA 4KB3A 5A5KA 4MJEA 3LW9A 4MDCA 2H30A 5HFKA 2HE3A 2LKUA 3FZ4A 2B5EA 3HVXA 4I6XA 3ZREA 1XVQA 1BEDA 3QAWA 4KSMA 2VCTA 1GSQA 3KCMA 1JLVA 4E8EA 2O89A 2CZ2A 4QQ7A 1FW1A 1SKRB 1HQOA 3APQA 1BYEA 5A4WA 3GX0A 5JWOB 4TW5A 1K0MA 1G6WA 4KE3A 5EY6A 2VL9A 4BA7A 4CY6A 5LCZA 2C0FA 2C8UA 3CTFA 3IC4A 2LJKA 3FZAA 3TGZA 3DXBA 1K0AA 1XFLA 3H1NA 1GLPA 3W8SA 2YJHA 1PQNA 1T4YA 4LA1A 3APSA 2VLTA 3ED3A 4NXIA 4FH8A 2C0DA 4Q5QA 4N0VA 3ERFA 2LRTA 5J4UA 2XPEA 1I5GA 2IL3A 2KUCA 3JCML 3TOTA 5HQPA 4TVEA 4WR4A 1VF4A 2DMLA 2X8CA 6GSTA 2H0GA 3A2VA 1SYRA 1SL2B 5G5EA 11GSA 1XWGA 2LRNA 1M2BA 3TKRA 4IS0A 3VFIA 4WBJA 1ILOA 1OC9B 4O5QA 2F8AA 2GSSA 1H75A 1YKCA 3ERGA 2IMKA 5D93A 4CDOA 3E0UA 1TRUA 4MJBA 4X43A 1F3BA 5IMAA 1ML6A 1EOHA 4IVFA 4RQXA 4K7NA 3GRXA 4ECCA 3WT2A 19GSA 1CQGA 1PGTA 2QGVA 1USBA 2QSIA 2WRTA 3TJFA 1DBYA 5ECPB 3CXGA 3ZLPA 5BRTA 3GKNA 4FYCA 2GDRA 5D9TA 2VCQA 2LUSA 3RPNA 2H19A 3EMXA 2C3QA 2OE3A 1PD21
chains in the Genus database with same CATH topology
3RHCA 1GRXA 1Q98A 2LV3A 3GN3A 1K3OA 2TIRA 4GTUA 3IAM2 3D4MA 3G9BA 1OKTA 3PINA 4LMVA 4JE1A 2H6ZA 4K2DA 2CAIA 1B9XC 3GH9A 5GSSA 3GL5A 1LBKA 4J57E 1UC7A 4GCIA 2FCHA 2VCWA 3IC8A 2HT9A 1O73A 1H4OA 2H6XA 4EXJA 2LQOA 4PQHA 4MK3A 9GSSA 4QL9A 5IPGA 1FVJA 3FR6A 4KSOA 2VLUA 4POBA 1K0DA 3LJRA 1EV9A 2VM2A 2ALBA 3GURA 1M9BA 4MZBA 3QAVA 1Y25A 2AAWA 1BX9A 2IWTA 4PGTA 1FOHA 2H76A 4HJMA 4NAXA 5DJMA 5ECRB 2NTOA 4JEDA 1YY7A 2VIMA 4HI7A 3C8EA 1EGRA 1MEKA 4JU5A 4MP4A 1EEMA 1PRXA 2VL2A 2DSAA 3C1SA 2LEGA 3H79A 4JR6A 2H8LA 4FYUA 5ECNB 1BG5A 1TI1A 2IFQB 3LQ7A 2H1BA 1ABAA 4POKA 5FHIA 1FB6A 1M99A 3LORA 1V2AA 3P7XA 2GT5A 1XW5A 2LQQA 2UZ8A 4ILFA 5J41A 5DAKB 5J9CA 2LTKA 5JCGA 3F3RA 1ZL9A 2HSMA 2DJ3A 4TRXA 4JZQA 2GLRA 4CHSA 1EP7A 1GUMA 1OAZA 5CRHA 4L5OA 2VLVA 4EUYA 1A8YA 3F6FA 1B9YC 4ZL9A 3DVXA 4GWRA 1WPIA 1AXDA 2GQLA 5DCHA 2CX4A 3NOFA 1T8EB 2B1LA 2LJAA 3EPTA 3I43A 2F9SA 4O32A 1S3DA 3VI7A 5E59A 1EV4A 4OD7A 3KH9A 3A2XA 1XWBA 3IK7A 4PUAA 1YEPA 2D2ZA 4YAVA 4PQ1A 2CQ9A 3GL3A 4DSSB 1SD9A 1TKDB 2FWFA 2QA1A 2GS3A 4BL7B 1TJDA 2A4HA 1NM3A 3HZ8A 2FD3A 3EINA 2JU5A 1FHEA 2YNXA 3IA1A 5ECLB 2HFDA 2WB9A 3W6GA 2HSYA 4ZIJA 4KA0A 3OR5A 4ML1A 2P5RA 3FHKA 3MSZA 4GSTA 1SL0B 2WGRA 4IP6A 3TRPA 4LL4B 2K8SA 2GZYA 1V40A 3AY8A 3F3QA 2JZSA 2DJ2A 4MZWA 4BWSA 2FNOA 2H66A 4AJ8A 3LGCA 1ACVA 5DBQA 3GKMA 2IMFA 1OKDA 3F63A 2L6CA 3LFLA 3VLNA 4PX1A 3ZFBA 1OYJA 2CVKA 3ME7A 1SK1A 1LU4A 4V2MA 1AQWA 1V98A 1FB0A 1M2AA 4KUNA 4WR5A 4MPGA 1GSFA 1OC8A 2HXKA 3LWAA 2VOCA 1HD2A 1UN2A 4KGIA 5A4VA 1PL2A 1DE2A 4EIQA 4ICYA 5C04A 2JL4A 1IYHA 3EVIA 1JHBA 1QGVA 2JSYA 3IOSA 2B7JA 2R37A 3P8WA 5J3RA 4KAEA 3D6IA 4POMA 3RHBA 1KEBA 1A0FA 3BBYA 3FZ9A 5ID2B 4YKGA 3O6TA 4IJIA 2BJXA 4BVXA 2H71A 2MMOA 4HJ2A 4JRRA 4F0CA 1ZYQB 1XBSA 5D9WA 1YEXA 2L59A 2O87A 2WZ9A 4G0KA 1TI3A 2WFCA 1GSUA 4XS4B 3HJOA 5GSTA 5INYA 2X64A 2KLXA 13GSA 2DIZA 2M72A 1I9DA 2HLSA 5KN0A 1F2EA 1QFNA 2GZPA 2JZRA 3EYTA 4HZ2A 4IELA 3SBCA 2V6OA 3FMWA 2R2JA 2HRKA 4E8HA 1GNEA 3M9KA 5ELGA 4GRFA 3GMFA 3D4TA 1M9AA 1SENA 3QD9A 3ZVJA 2HYXA 10GSA 2FA8A 5AIXA 1MD4A 1SJIA 5G31A 4YKFA 2HZFA 1QK8A 4TR0A 4YH2A 2MZCA 2H72A 5DALA 3EURA 16GSA 2EIQA 4ACSA 3ME8A 3KP9A 5AN1A 3QAGA 2WCIA 3TOUA 1A2LA 1ERTA 3ZL5A 4O92A 12GSA 1O81A 4HUAA 3S9FA 1WWJA 3NZNA 2RLIA 4ZL7A 3WGDA 1FVKA 4O7HA 4XS1A 1LJRA 3ZMLA 4KCAA 2YP6A 2DJ0A 4YQUA 1U6TA 1VRSD 3H4KA 5JCWA 2MBSA 1FO5A 2R5GA 3IHQA 2IIYA 1PKWA 1Z7RA 4G0LA 1OC3A 3DEXA 1UVZA 2OE0A 1AW9A 2HI7A 1WRYA 3VWVA 1QMVA 5IOXA 2HSHA 1XXUA 2L4CA 4N0ZA 1SK0A 2YPMA 2FWEA 1Z9HA 2XHFA 3GKKA 5B6NA 4ISDA 2Z9SA 1BAYA 1SJZA 1QUWA 1C72A 4EE0A 14GSA 2I1UA 1K0CA 3CTGA 2R6KA 3GV1A 5CAXA 2HNLA 1V58A 1T7PB 5FT3A 3A5IA 1EEJA 3L78A 4MABA 1TK8B 2B5YA 4K0NA 1K0NA 2ON5A 2YN1A 1GSSA 3IK9A 1IYIA 4GF0A 1Z6MA 5ECHB 2O85A 3BCIA 1GP1A 3DD3A 2ZCTA 1A8LA 2K9FA 1TP9A 7GSSA 3F0IA 1THOA 4HOJA 3GKXA 1Y6EA 3VWUA 4F03A 3RAZA 2DC5A 3O76A 4TR3A 1EP8A 4EL1A 2P0GA 5CRWA 5HR0A 2GSQA 17GSA 4RI7A 2FHEA 1A2JA 2DLXA 3FY7A 4POLA 1O85A 5IM9A 3ZRDA 5AGYA 3QFAC 2FGXA 4K7OA 4GQCA 2V32A 2TRCP 4OWYA 1WE0A 3K8NA 3ZZXA 3H93A 4KDUA 5DQSA 1SK2A 1XIYA 5IPHA 4OO5A 2HZEA 5CNWA 3LG6A 2XPDA 3CBUA 3D5JA 3DVWA 4G0IA 4L0UA 2GSTA 5DQYA 3DIEA 3MAKA 1XW6A 4MF7A 4K6XA 4JR4A 1YJ6A 2JADA 5B7CA 4HEA2 3PGTA 6GSVA 5JWQB 4KNDA 4D73A 5IO0A 5FWGA 1XW9A 2LNTA 4K5RA 2FWGA 1GSYA 4V1Ap 4EVMA 5DVBA 3UAPA 4K7IA 2M46A 1RQMA 3D0ZA 2X49A 1TRWA 1XVWA 2CX3A 1PSQA 1YKAA 3IRAA 1YF1A 2NPBA 2V41A 2NDOA 2KHPA 1EGOA 3HZ4A 1VGLA 2K8VA 4IQ1A 2P31A 5AIVA 3ZYWA 1WJKA 3EC3A 4HQSA 5F8BA 2V1MA 4EKZA 3UJ1A 1AQXA 2J23A 4MJCA 1Z3EA 2GZZA 3TJBA 4Q5FA 4X0XA 1XWAA 1X5DA 2OACA 2OJLA 3LSZA 1PN9A 4V2NA 4CY8A 2PMTA 3UL3A 2L5LA 3LYPA 1JZOA 1SKWB 4K5SA 2H70A 3KP8A 2B5XA 4L5LA 3BCKA 3FR9A 4MH3A 3IHGA 3KIJA 5IMFA 4Z2UA 2L6DA 1GSEA 1PKZA 5CP1A 1XWKA 2PVQA 3M1GA 1F9MA 5IIZA 2PBJA 4NV5A 3GSTA 3TUEA 5GAPD 3EMPA 5J9BA 1DE1A 4F82A 3NIVA 1J0FA 4EF0A 5D8IA 2GVPA 1R5PA 2OE1A 1U3IA 4Q5NA 1AAZA 5KOXA 4MLYA 3L9SA 2EC4A 4EDZA 5H5RA 3EE2A 1PA3A 1J08A 4KDXA 2R0CA 4FO5A 3U6VA 1W4VA 3ZITA 2N5AA 4Z2TA 2CZ3A 4WF4A 1XCCA 1V57A 4ECJA 5D9VA 4PNFA 1FAAA 4TR1A 2P5QA 2C3TA 4J56E 3VI5A 5ECSA 1MTCA 3A2WA 1VF3A 4GSSA 4G2EA 2H0IA 2RUFA 4NHZA 2R0PA 4OFMA 4IJ3A 2X8HA 1YQ1A 1ERUA 1AIUA 3GTUA 1SU9A 4K8MA 4Q5RA 2RIIA 3VPTA 2TRXA 5COHA 3TKQA 2JACA 2RM6A 4FYBA 2H73A 3ZIJA 4TXOA 2CV4A 4DVCA 5HFIA 4ZBAA 5LD0A 2WDUA 1RW1A 2YWNA 2BMXA 5ECIB 4USSA 4V1Ag 2AUVA 2HRNA 4EIPA 1R5AA 4WBRD 5ECOB 4MPFA 1TK5B 2YV9A 4NMUA 1AQVA 1O8XA 4ML6A 3A3TA 3RDWA 4YAPA 4G9HA 4J2FA 2H1DA 3C73A 4KW6A 1B4PA 2MMAA 3I6AA 1GH2A 3EU3A 4ZBBA 4ZILA 3HHVA 4TKYA 1DUGA 3FR3A 4F0BA 2LRCA 2GQMA 5KN1A 1X5CA 4TR4A 3CSHA 4IN0A 3GX8A 4BVYA 4K0GA 2DJ1A 2GQKA 1XOAA 1ZMAA 5B8BA 3ERWA 3QMXA 3F8UA 2H75A 1F6MC 5IQYA 2WULA 1TOFA 4WKWA 2YJ7A 2CAQA 4KH7A 1NW2A 1GULA 4AF2A 2FA4A 3CMIA 4XRAA 1TTZA 1YF0A 3N9JA 5ECQB 1QXHA 4P3YB 3IR4A 4N11A 2VCZA 2IMDA 4MNNA 1DSBA 4MF5A 4XHMA 3FK8A 5B8AA 3ZTLA 2DKHA 2GTUA 2XBIA 4LLRA 4XIHA 1S3CA 5ECMB 3BOAA 5F06A 2B6MA 4HU9A 4Z2RA 3TJJA 5JWRB 1ON4A 3EWLA 1VF1A 2OBKA 3KEBA 3HVVA 5D96A 1X5EA 5H5SA 3DYRA 5DCGA 4K2XA 5IMZA 1K3LA 5KOWA 1NHYA 5F0GA 1R7HA 1XWCA 3G7JA 3C7MA 5JCUA 1O8WA 5IMVA 1URMA 2AB6A 2AV4A 4MA9A 3UOMA 4IGJA 4ZB9A 5ENUA 1F3AA 1M2DA 1KBNA 3C1RA 2ON7A 2J9HA 4O5RA 5IMCA 3GA4A 3R2QA 3UIWA 1R4WA 2ZUPA 3MYDA 2VCVA 2B1KA 2IMIA 3FW2A 3IAS2 6GSXA 3CRUA 1JZDA 4F9ZA 3WT1A 1YZXA 3C71A 2OBIA 4MMMA 1ZCPA 3CYNA 4AGSA 2AYTA 1ZOFA 1PX6A 5AISA 1O7UA 5IMDA 2YZHA 1G6YA 4IQAA 4YQMA 3M0FA 5F05A 1Z7PA 4BVXB 1T1VA 2H0HA 5G2ZA 3UARA 4LMWA 1G7EA 2X8GA 1ST9A 1N2AA 1N8JA 1A23A 3M3MA 3F6DA 4DEJA 2EIOA 2PGTA 1TU7A 4MJAA 3QFBC 4K1FA 5CO3A 2LS5A 1M7TA 2IMEA 4WF5A 1HNCA 3WD6A 1OE7A 1G7OA 2R0GA 4WXTA 4GXZA 1OC9A 1V9WA 3TB2A 4GLTA 2B7KA 3VWWA 3J7Yk 2H1AA 3R3EA 4KCEA 1PL1A 4WETA 4MH2A 2C1YA 2PN8A 3CRTA 4I2UA 2IJYA 1GTUA 4HZ4A 4OCEA 4ZBDA 2V6KA 2X4AA 2PERA 2YANA 1Z5YE 2YZUA 5CRGA 2WJUA 20GSA 3HVSA 2A2RA 3KD0A 3FRCA 5DDLA 3FKFA 5DALB 2DBCA 3RPPA 3GUSA 2C0GA 3D21A 3KMOA 5GZZB 2H01A 2MMNA 2VL2C 3GH6A 3ZMKA 1GWCA 2KOKA 2YWIA 3EU4A 3TJKA 4CW9A 4HDEA 4G10A 4HU7A 4EC0A 4I5QA 8GSSA 1T00A 2K18A 3FZ5A 2VAFA 1TU8A 3Q19A 4EO3A 1KTEA 2PU9C 2HRFA 4XRDA 5KN3A 4F2IA 3DGQA 4PURA 3HXSA 1X9SB 4MCUA 3ZFLA 2XC2A 3UVHA 1PN0A 5EL8A 1XZOA 3BJ5A 3G7YA 2VD1A 3D22A 3W8JA 2C3NA 2IN3A 2E2GA 3UBLA 1MDJA 3IBHA 1XOBA 3GIXA 4DSQA 4MF6A 1WOUA 3F4TA 2VUPA 1MDIA 4TXVA 3IDVA 4L8EA 2EIRA 3WYWA 3ISOA 3IE3A 1G0TA 3KTBA 1X0RA 1GUHA 5ELAA 4IHUA 3APOA 3VPQA 3TRXA 3HA9A 3GSSA 5E4WA 2E0QA 4ID0A 4DSRA 2DIYA 3LXZA 5G1LA 1JLWA 3L4NA 2A4VA 4RQRA 1VF2A 1ZYPA 1NSWA 3GYKA 3KH7A 4LL1B 1A24A 1SJ6A 2YWMA 3KGKA 2IFQA 3ZVJD 1MD3A 1U3AA 3VWXA 4OCFA 5KN2A 4I97A 3I9V2 4XS6A 4N30A 4PUFC 2GGTA 2PPTA 2ES7A 3M9JA 1RK4A 5LNKe 4K9ZA 1TW9A 2DMMA 3FEUA 1MDKA 5DAKA 2NBSA 2QC7A 5IOWA 5EPFA 3HDCA 2PWJA 4X1UA 6GSWA 3LYKA 5GAND 1CQHA 3TDGA 6GSUA 3CSIA 2E2MA 2LNSA 4HS1A 1ERVA 3GFKA 4PQIA 1GUKA 3HJMA 3DMLA 3BD2A 1HYUA 2AJQB 5C00A 1OVNA 3LXTA 2GT6A 1QQ2A 3DRNA 1BQ7A 4RUVA 4ZB6A 2OADA 3KM6A 3UMAA 2HZEB 1HNAA 5F07A 3HY2A 2O7KA 1FOVA 2G2QA 4PTSA 5CYYA 3L9VA 1B8XA 5ABRA 2CVDA 3TCOA 4KDYA 2O8VB 4OO4A 2L5OA 2YWOA 4BWQA 5CRDA 4D73B 4XTSA 3TKSE 1J9BA 1TRVA 3HCZA 2CVBA 4DSSA 1WMJA 2CT6A 5DJLA 2C4JA 3UVTA 1GNWA 4O5UA 2MBTA 2OKAA 4A5PA 4BL7A 3V1WA 3M8NA 4IKHA 1GTAA 2WS2A 2BTOT 5CREA 3KXOA 4V2LA 2X99A 3Q74A 1B4QA 2VM1A 4NHWA 2A2SA 2VD0A 3O3TA 3HYPA 1ZGNA 2QA2A 4OFNA 1F37A 3HD5A 3IPZA 4QL7A 3P2AA 1BJXA 3P90A 4NWYA 2E7PA 1PMTA 3TRQA 1EWXA 1W89A 3QCPA 3MDKA 5B6MA 2YOIA 1SD8A 2LJRA 3Q6OA 2JZTA 1GSDA 2VCXA 2H74A 3TKSC 3GHAA 4PXOA 3MIXA 5H5QA 4BPYA 22GSA 2KP2A 4AJ7A 3PPUA 2R4VA 3QR6A 2F51A 2PUKC 3LEFA 2H1GA 3N5OA 2IPAA 4ECBA 2A2PA 1OE8A 3Q18A 3KJYA 1THXA 1ZYEA 4FQUA 2FY6A 5G5FA 4ULXA 2F3MA 1S3AA 4MZCA 4KX4A 3F4SA 4XCSA 5HR1A 2YCDA 2RM5A 4ZB8A 3UBKA 2OA7A 4IW9A 5BMUA 1ZZYA 2H6YA 4NPBA 3QPMA 4GQFA 2JSZA 2DKIA 3TJGA 2B3SA 3DKSA 6GSSA 2I4AA 2LSTA 3KMNA 2N5FA 5ID2A 1M0UA 2PVOC 5HR2A 1A0RP 5D9XA 1KNGA 3MWHA 3TKPA 2FUG2 1WIKA 2C80A 3L0HA 2CA8A 1JZWA 2HRAA 1E6BA 4L0WA 4TR1B 1JFUA 3E9JB 3FYGA 4NV2A 5ECKB 4I8BA 2G0FA 4XS4A 2KP1A 4X4JA 2QKEA 1FG4A 3UEMA 4GSNA 3GTUB 3QDNA 2GSRA 1SYXA 1SKSB 1T3BA 1TRSA 2M80A 4TOPA 18GSA 3PR8A 4TXOB 2N5BA 2K6VA 2ZNMA 1T4ZA 3HKRA 4YQVA 2AHEA 2VL3A 2FLSA 3G7IA 3IV4A 5G1KA 4HQZA 1X9WB 4FIWA 3E3EA 1NHOA 5A4UA 1PX7A 3WGXA 1EOGA 1K0OA 1TDIA 3HJPA 2F8FA 1K0BA 4G19A 3PH9A 1EZKA 4ZL8A 3QOUA 1Z6NA 3A5WA 6GSYA 2R3XA 3RBTA 3F4RA 5HFGA 1A2MA 4IP1A 4PNGA 4H86A 5L71A 2DJKA 2I81A 1HNBA 1WP0A 2MYGA 2V2GA 1K3YA 4BVYB 3CSJA 5J5NA 2L57A 1R26A 4AJ6A 4I2TA 1X9MB 3KTLA 1XPVA 1Q4JA 4EDYA 4KF9A 4JBBA 3I69A 3KZQA 4ECIA 3U5RE 1O6JA 1U88A 1YDKA 3TKSA 1GL8A 3SWLA 3IXRA 3DWVA 3F9UA 1JZRA 5HR3A 1AUCA 4OFTA 2VO4A 3WGEA 3MNGA 5KEJA 2REMA 1E2YA 5IO2A 4N10A 3L9UA 2YV7A 2C0EA 1ZYNA 3ZIVA 4TN8A 1U87A 5G30A 1GTBA 2I9HA 1TXXA 2NVLA 5EVOA 3J7Yb 4IBPA 5D73A 2MMZA 1TK0B 1GLQA 4RI6A 2L4QA 2RUEA 1ERWA 2XBQA 3GNJA 2FWHA 4OMVA 1UA5A 2I3YA 2DJJA 1AC1A 1GTIA 3H8QA 1SL1B 3US3A 1B48A 3VURA 3VK9A 4WEYA 4Z7XA 4ZXGA 4KB3A 5A5KA 4MJEA 3LW9A 4MDCA 2H30A 5HFKA 2HE3A 2LKUA 3FZ4A 2B5EA 3HVXA 4I6XA 3ZREA 1XVQA 1BEDA 3QAWA 4KSMA 2VCTA 1GSQA 3KCMA 1JLVA 4E8EA 2O89A 2CZ2A 4QQ7A 1FW1A 1SKRB 1HQOA 3APQA 1BYEA 5A4WA 3GX0A 5JWOB 4TW5A 1K0MA 1G6WA 4KE3A 5EY6A 2VL9A 4BA7A 4CY6A 5LCZA 2C0FA 2C8UA 3CTFA 3IC4A 2LJKA 3FZAA 3TGZA 3DXBA 1K0AA 1XFLA 3H1NA 1GLPA 3W8SA 2YJHA 1PQNA 1T4YA 4LA1A 3APSA 2VLTA 3ED3A 4NXIA 4FH8A 2C0DA 4Q5QA 4N0VA 3ERFA 2LRTA 5J4UA 2XPEA 1I5GA 2IL3A 2KUCA 3JCML 3TOTA 5HQPA 4TVEA 4WR4A 1VF4A 2DMLA 2X8CA 6GSTA 2H0GA 3A2VA 1SYRA 1SL2B 5G5EA 11GSA 1XWGA 2LRNA 1M2BA 3TKRA 4IS0A 3VFIA 4WBJA 1ILOA 1OC9B 4O5QA 2F8AA 2GSSA 1H75A 1YKCA 3ERGA 2IMKA 5D93A 4CDOA 3E0UA 1TRUA 4MJBA 4X43A 1F3BA 5IMAA 1ML6A 1EOHA 4IVFA 4RQXA 4K7NA 3GRXA 4ECCA 3WT2A 19GSA 1CQGA 1PGTA 2QGVA 1USBA 2QSIA 2WRTA 3TJFA 1DBYA 5ECPB 3CXGA 3ZLPA 5BRTA 3GKNA 4FYCA 2GDRA 5D9TA 2VCQA 2LUSA 3RPNA 2H19A 3EMXA 2C3QA 2OE3A 1PD21
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RHC A;  1GRX A;  1Q98 A;  2LV3 A;  3GN3 A;  1K3O A;  2TIR A;  4GTU A;  3IAM 2;  3D4M A;  3G9B A;  1OKT A;  3PIN A;  4LMV A;  4JE1 A;  2H6Z A;  4K2D A;  2CAI A;  1B9X C;  3GH9 A;  5GSS A;  3GL5 A;  1LBK A;  4J57 E;  1UC7 A;  4GCI A;  2FCH A;  2VCW A;  2HT9 A;  1O73 A;  1H4O A;  2H6X A;  4EXJ A;  2LQO A;  4PQH A;  4MK3 A;  9GSS A;  4QL9 A;  5IPG A;  1FVJ A;  3FR6 A;  4KSO A;  2VLU A;  4POB A;  1K0D A;  3LJR A;  1EV9 A;  2VM2 A;  2ALB A;  3GUR A;  1M9B A;  4MZB A;  3QAV A;  1Y25 A;  2AAW A;  1BX9 A;  2IWT A;  4PGT A;  2H76 A;  4HJM A;  4NAX A;  5DJM A;  5ECR B;  2NTO A;  4JED A;  1YY7 A;  2VIM A;  4HI7 A;  3C8E A;  1EGR A;  1MEK A;  4JU5 A;  4MP4 A;  1EEM A;  1PRX A;  2VL2 A;  2DSA A;  3C1S A;  2LEG A;  3H79 A;  4JR6 A;  2H8L A;  4FYU A;  5ECN B;  1BG5 A;  1TI1 A;  2IFQ B;  3LQ7 A;  2H1B A;  1ABA A;  4POK A;  5FHI A;  1FB6 A;  1M99 A;  3LOR A;  1V2A A;  3P7X A;  2GT5 A;  1XW5 A;  2LQQ A;  4ILF A;  5J41 A;  5DAK B;  5J9C A;  2LTK A;  5JCG A;  3F3R A;  1ZL9 A;  2DJ3 A;  4TRX A;  4JZQ A;  2GLR A;  4CHS A;  1EP7 A;  1GUM A;  1OAZ A;  5CRH A;  4L5O A;  2VLV A;  4EUY A;  1A8Y A;  3F6F A;  1B9Y C;  4ZL9 A;  3DVX A;  4GWR A;  1WPI A;  1AXD A;  2GQL A;  5DCH A;  2CX4 A;  3NOF A;  1T8E B;  2B1L A;  2LJA A;  3I43 A;  2F9S A;  4O32 A;  1S3D A;  3VI7 A;  5E59 A;  1EV4 A;  4OD7 A;  3KH9 A;  3A2X A;  1XWB A;  3IK7 A;  4PUA A;  1YEP A;  2D2Z A;  4YAV A;  4PQ1 A;  2CQ9 A;  3GL3 A;  4DSS B;  1SD9 A;  1TKD B;  2FWF A;  2GS3 A;  1TJD A;  1NM3 A;  3HZ8 A;  2FD3 A;  3EIN A;  2JU5 A;  1FHE A;  2YNX A;  3IA1 A;  5ECL B;  2HFD A;  2WB9 A;  3W6G A;  2HSY A;  4ZIJ A;  4KA0 A;  3OR5 A;  4ML1 A;  2P5R A;  3FHK A;  3MSZ A;  4GST A;  1SL0 B;  2WGR A;  4IP6 A;  3TRP A;  4LL4 B;  2K8S A;  2GZY A;  1V40 A;  3AY8 A;  3F3Q A;  2JZS A;  2DJ2 A;  4MZW A;  4BWS A;  2FNO A;  2H66 A;  4AJ8 A;  3LGC A;  1ACV A;  5DBQ A;  3GKM A;  2IMF A;  1OKD A;  3F63 A;  2L6C A;  3LFL A;  3VLN A;  4PX1 A;  3ZFB A;  1OYJ A;  2CVK A;  3ME7 A;  1SK1 A;  1LU4 A;  4V2M A;  1AQW A;  1V98 A;  1FB0 A;  1M2A A;  4KUN A;  4WR5 A;  4MPG A;  1GSF A;  1OC8 A;  2HXK A;  3LWA A;  2VOC A;  1HD2 A;  1UN2 A;  4KGI A;  5A4V A;  1PL2 A;  1DE2 A;  5C04 A;  2JL4 A;  1IYH A;  3EVI A;  1JHB A;  1QGV A;  2JSY A;  3IOS A;  2B7J A;  2R37 A;  3P8W A;  5J3R A;  4KAE A;  3D6I A;  4POM A;  3RHB A;  1KEB A;  1A0F A;  3BBY A;  3FZ9 A;  5ID2 B;  3O6T A;  4IJI A;  2BJX A;  4BVX A;  2H71 A;  2MMO A;  4HJ2 A;  4JRR A;  4F0C A;  1ZYQ B;  1XBS A;  5D9W A;  1YEX A;  2L59 A;  2O87 A;  2WZ9 A;  1TI3 A;  2WFC A;  1GSU A;  4XS4 B;  3HJO A;  5GST A;  5INY A;  2X64 A;  2KLX A;  13GS A;  2DIZ A;  2M72 A;  1I9D A;  2HLS A;  5KN0 A;  1F2E A;  1QFN A;  2GZP A;  2JZR A;  3EYT A;  4HZ2 A;  4IEL A;  3SBC A;  2V6O A;  2R2J A;  4E8H A;  1GNE A;  3M9K A;  5ELG A;  4GRF A;  3GMF A;  3D4T A;  1M9A A;  1SEN A;  3QD9 A;  3ZVJ A;  2HYX A;  10GS A;  2FA8 A;  5AIX A;  1MD4 A;  1SJI A;  5G31 A;  2HZF A;  1QK8 A;  4TR0 A;  4YH2 A;  2MZC A;  2H72 A;  5DAL A;  3EUR A;  16GS A;  2EIQ A;  4ACS A;  3ME8 A;  3KP9 A;  5AN1 A;  3QAG A;  2WCI A;  3TOU A;  1A2L A;  1ERT A;  3ZL5 A;  4O92 A;  12GS A;  1O81 A;  4HUA A;  3S9F A;  1WWJ A;  3NZN A;  2RLI A;  4ZL7 A;  3WGD A;  1FVK A;  4O7H A;  4XS1 A;  1LJR A;  3ZML A;  4KCA A;  2YP6 A;  2DJ0 A;  4YQU A;  1U6T A;  1VRS D;  3H4K A;  5JCW A;  2MBS A;  1FO5 A;  2R5G A;  3IHQ A;  2IIY A;  1PKW A;  1Z7R A;  1OC3 A;  3DEX A;  1UVZ A;  2OE0 A;  1AW9 A;  2HI7 A;  1WRY A;  3VWV A;  1QMV A;  5IOX A;  2HSH A;  1XXU A;  2L4C A;  4N0Z A;  1SK0 A;  2YPM A;  2FWE A;  1Z9H A;  2XHF A;  3GKK A;  5B6N A;  4ISD A;  2Z9S A;  1BAY A;  1SJZ A;  1QUW A;  1C72 A;  4EE0 A;  14GS A;  2I1U A;  1K0C A;  3CTG A;  2R6K A;  3GV1 A;  5CAX A;  2HNL A;  1V58 A;  1T7P B;  5FT3 A;  1EEJ A;  3L78 A;  4MAB A;  1TK8 B;  2B5Y A;  4K0N A;  1K0N A;  2ON5 A;  2YN1 A;  1GSS A;  3IK9 A;  1IYI A;  4GF0 A;  1Z6M A;  5ECH B;  2O85 A;  3BCI A;  1GP1 A;  3DD3 A;  2ZCT A;  1A8L A;  2K9F A;  1TP9 A;  7GSS A;  3F0I A;  1THO A;  4HOJ A;  3GKX A;  1Y6E A;  3VWU A;  4F03 A;  3RAZ A;  2DC5 A;  3O76 A;  4TR3 A;  1EP8 A;  4EL1 A;  2P0G A;  5CRW A;  5HR0 A;  2GSQ A;  17GS A;  4RI7 A;  2FHE A;  1A2J A;  2DLX A;  3FY7 A;  4POL A;  1O85 A;  5IM9 A;  3ZRD A;  5AGY A;  3QFA C;  2FGX A;  4K7O A;  4GQC A;  2V32 A;  2TRC P;  4OWY A;  1WE0 A;  3K8N A;  3ZZX A;  3H93 A;  4KDU A;  5DQS A;  1SK2 A;  1XIY A;  5IPH A;  4OO5 A;  2HZE A;  5CNW A;  3LG6 A;  2XPD A;  3CBU A;  3D5J A;  3DVW A;  4L0U A;  2GST A;  5DQY A;  3DIE A;  3MAK A;  1XW6 A;  4MF7 A;  4K6X A;  4JR4 A;  1YJ6 A;  2JAD A;  5B7C A;  4HEA 2;  3PGT A;  6GSV A;  5JWQ B;  4KND A;  4D73 A;  5IO0 A;  5FWG A;  1XW9 A;  2LNT A;  2FWG A;  1GSY A;  4V1A p;  4EVM A;  5DVB A;  3UAP A;  4K7I A;  2M46 A;  1RQM A;  3D0Z A;  1TRW A;  1XVW A;  2CX3 A;  1PSQ A;  1YKA A;  3IRA A;  1YF1 A;  2NPB A;  2V41 A;  2NDO A;  2KHP A;  1EGO A;  3HZ4 A;  1VGL A;  2K8V A;  4IQ1 A;  2P31 A;  5AIV A;  3ZYW A;  1WJK A;  3EC3 A;  4HQS A;  5F8B A;  2V1M A;  4EKZ A;  3UJ1 A;  1AQX A;  2J23 A;  4MJC A;  1Z3E A;  2GZZ A;  3TJB A;  4Q5F A;  4X0X A;  1XWA A;  1X5D A;  2OAC A;  2OJL A;  3LSZ A;  1PN9 A;  4V2N A;  2PMT A;  3UL3 A;  2L5L A;  3LYP A;  1JZO A;  1SKW B;  2H70 A;  3KP8 A;  2B5X A;  4L5L A;  3BCK A;  3FR9 A;  4MH3 A;  3KIJ A;  5IMF A;  2L6D A;  1GSE A;  1PKZ A;  5CP1 A;  1XWK A;  2PVQ A;  3M1G A;  1F9M A;  5IIZ A;  2PBJ A;  4NV5 A;  3GST A;  3TUE A;  5GAP D;  3EMP A;  5J9B A;  1DE1 A;  4F82 A;  3NIV A;  1J0F A;  4EF0 A;  5D8I A;  2GVP A;  1R5P A;  2OE1 A;  1U3I A;  4Q5N A;  1AAZ A;  4MLY A;  3L9S A;  2EC4 A;  4EDZ A;  5H5R A;  3EE2 A;  1PA3 A;  1J08 A;  4KDX A;  4FO5 A;  3U6V A;  1W4V A;  3ZIT A;  2N5A A;  2CZ3 A;  4WF4 A;  1XCC A;  1V57 A;  4ECJ A;  5D9V A;  4PNF A;  1FAA A;  4TR1 A;  2P5Q A;  2C3T A;  4J56 E;  3VI5 A;  5ECS A;  1MTC A;  3A2W A;  1VF3 A;  4GSS A;  4G2E A;  2H0I A;  2RUF A;  4NHZ A;  4OFM A;  4IJ3 A;  2X8H A;  1YQ1 A;  1ERU A;  1AIU A;  3GTU A;  1SU9 A;  4K8M A;  4Q5R A;  2RII A;  3VPT A;  2TRX A;  5COH A;  3TKQ A;  2JAC A;  2RM6 A;  4FYB A;  2H73 A;  3ZIJ A;  4TXO A;  2CV4 A;  4DVC A;  5HFI A;  4ZBA A;  5LD0 A;  2WDU A;  1RW1 A;  2YWN A;  2BMX A;  5ECI B;  4V1A g;  2AUV A;  2HRN A;  1R5A A;  4WBR D;  5ECO B;  4MPF A;  1TK5 B;  2YV9 A;  4NMU A;  1AQV A;  1O8X A;  4ML6 A;  3A3T A;  3RDW A;  4YAP A;  4G9H A;  4J2F A;  2H1D A;  3C73 A;  4KW6 A;  1B4P A;  2MMA A;  3I6A A;  1GH2 A;  3EU3 A;  4ZBB A;  4ZIL A;  3HHV A;  4TKY A;  1DUG A;  3FR3 A;  4F0B A;  2LRC A;  2GQM A;  5KN1 A;  1X5C A;  4TR4 A;  3CSH A;  4IN0 A;  3GX8 A;  4BVY A;  4K0G A;  2DJ1 A;  2GQK A;  1XOA A;  1ZMA A;  5B8B A;  3ERW A;  3QMX A;  3F8U A;  2H75 A;  1F6M C;  5IQY A;  2WUL A;  1TOF A;  4WKW A;  2YJ7 A;  2CAQ A;  4KH7 A;  1NW2 A;  1GUL A;  4AF2 A;  2FA4 A;  3CMI A;  4XRA A;  1TTZ A;  1YF0 A;  3N9J A;  5ECQ B;  1QXH A;  4P3Y B;  3IR4 A;  4N11 A;  2VCZ A;  2IMD A;  1DSB A;  4MF5 A;  4XHM A;  3FK8 A;  5B8A A;  3ZTL A;  2GTU A;  2XBI A;  4LLR A;  4XIH A;  1S3C A;  5ECM B;  3BOA A;  5F06 A;  2B6M A;  4HU9 A;  3TJJ A;  5JWR B;  1ON4 A;  3EWL A;  1VF1 A;  2OBK A;  3KEB A;  3HVV A;  5D96 A;  1X5E A;  5H5S A;  3DYR A;  5DCG A;  5IMZ A;  1K3L A;  1NHY A;  5F0G A;  1R7H A;  1XWC A;  3G7J A;  3C7M A;  5JCU A;  1O8W A;  5IMV A;  1URM A;  2AB6 A;  2AV4 A;  4MA9 A;  3UOM A;  4IGJ A;  4ZB9 A;  5ENU A;  1F3A A;  1M2D A;  1KBN A;  3C1R A;  2ON7 A;  2J9H A;  4O5R A;  5IMC A;  3GA4 A;  3R2Q A;  3UIW A;  1R4W A;  2ZUP A;  2VCV A;  2B1K A;  2IMI A;  3FW2 A;  3IAS 2;  6GSX A;  3CRU A;  1JZD A;  4F9Z A;  3WT1 A;  1YZX A;  3C71 A;  2OBI A;  4MMM A;  1ZCP A;  3CYN A;  4AGS A;  2AYT A;  1ZOF A;  1PX6 A;  5AIS A;  1O7U A;  5IMD A;  2YZH A;  1G6Y A;  4IQA A;  4YQM A;  3M0F A;  5F05 A;  1Z7P A;  1T1V A;  2H0H A;  5G2Z A;  3UAR A;  4LMW A;  1G7E A;  2X8G A;  1ST9 A;  1N2A A;  1N8J A;  1A23 A;  3M3M A;  3F6D A;  4DEJ A;  2EIO A;  2PGT A;  1TU7 A;  4MJA A;  3QFB C;  4K1F A;  5CO3 A;  2LS5 A;  1M7T A;  2IME A;  4WF5 A;  1HNC A;  3WD6 A;  1OE7 A;  1G7O A;  4WXT A;  4GXZ A;  1OC9 A;  1V9W A;  3TB2 A;  4GLT A;  2B7K A;  3VWW A;  3J7Y k;  2H1A A;  4KCE A;  1PL1 A;  4WET A;  4MH2 A;  2C1Y A;  2PN8 A;  3CRT A;  4I2U A;  2IJY A;  1GTU A;  4HZ4 A;  4OCE A;  4ZBD A;  2V6K A;  2PER A;  2YAN A;  1Z5Y E;  2YZU A;  5CRG A;  2WJU A;  20GS A;  3HVS A;  2A2R A;  3KD0 A;  3FRC A;  5DDL A;  3FKF A;  5DAL B;  2DBC A;  3RPP A;  3GUS A;  2C0G A;  3D21 A;  3KMO A;  5GZZ B;  2H01 A;  2MMN A;  2VL2 C;  3GH6 A;  3ZMK A;  1GWC A;  2KOK A;  2YWI A;  3EU4 A;  3TJK A;  4CW9 A;  4HDE A;  4G10 A;  4HU7 A;  4EC0 A;  4I5Q A;  8GSS A;  1T00 A;  2K18 A;  3FZ5 A;  2VAF A;  1TU8 A;  3Q19 A;  4EO3 A;  1KTE A;  2PU9 C;  2HRF A;  4XRD A;  5KN3 A;  4F2I A;  3DGQ A;  4PUR A;  3HXS A;  1X9S B;  4MCU A;  3ZFL A;  2XC2 A;  3UVH A;  5EL8 A;  1XZO A;  3BJ5 A;  3G7Y A;  2VD1 A;  3D22 A;  3W8J A;  2C3N A;  2IN3 A;  2E2G A;  3UBL A;  1MDJ A;  3IBH A;  1XOB A;  3GIX A;  4DSQ A;  4MF6 A;  1WOU A;  3F4T A;  2VUP A;  1MDI A;  4TXV A;  3IDV A;  4L8E A;  2EIR A;  3WYW A;  3ISO A;  3IE3 A;  1G0T A;  3KTB A;  1X0R A;  1GUH A;  5ELA A;  4IHU A;  3APO A;  3VPQ A;  3TRX A;  3HA9 A;  3GSS A;  5E4W A;  2E0Q A;  4ID0 A;  4DSR A;  2DIY A;  3LXZ A;  5G1L A;  1JLW A;  3L4N A;  2A4V A;  4RQR A;  1VF2 A;  1NSW A;  3GYK A;  3KH7 A;  4LL1 B;  1A24 A;  1SJ6 A;  2YWM A;  3KGK A;  2IFQ A;  3ZVJ D;  1MD3 A;  1U3A A;  3VWX A;  4OCF A;  5KN2 A;  4I97 A;  3I9V 2;  4XS6 A;  4N30 A;  4PUF C;  2GGT A;  2PPT A;  2ES7 A;  3M9J A;  1RK4 A;  5LNK e;  4K9Z A;  1TW9 A;  2DMM A;  3FEU A;  1MDK A;  5DAK A;  2NBS A;  2QC7 A;  5IOW A;  5EPF A;  3HDC A;  2PWJ A;  4X1U A;  6GSW A;  3LYK A;  5GAN D;  1CQH A;  3TDG A;  6GSU A;  3CSI A;  2E2M A;  2LNS A;  4HS1 A;  1ERV A;  3GFK A;  4PQI A;  1GUK A;  3HJM A;  3DML A;  3BD2 A;  1HYU A;  2AJQ B;  5C00 A;  1OVN A;  3LXT A;  2GT6 A;  1QQ2 A;  3DRN A;  1BQ7 A;  4RUV A;  4ZB6 A;  2OAD A;  3KM6 A;  3UMA A;  2HZE B;  1HNA A;  5F07 A;  3HY2 A;  2O7K A;  1FOV A;  2G2Q A;  5CYY A;  3L9V A;  1B8X A;  5ABR A;  2CVD A;  3TCO A;  4KDY A;  2O8V B;  4OO4 A;  2L5O A;  2YWO A;  4BWQ A;  5CRD A;  4D73 B;  4XTS A;  3TKS E;  1J9B A;  1TRV A;  3HCZ A;  2CVB A;  4DSS A;  1WMJ A;  2CT6 A;  5DJL A;  2C4J A;  3UVT A;  1GNW A;  2MBT A;  2OKA A;  4BL7 A;  3V1W A;  3M8N A;  4IKH A;  1GTA A;  2WS2 A;  2BTO T;  5CRE A;  3KXO A;  4V2L A;  2X99 A;  3Q74 A;  1B4Q A;  2VM1 A;  4NHW A;  2A2S A;  2VD0 A;  3O3T A;  3HYP A;  1ZGN A;  4OFN A;  1F37 A;  3HD5 A;  3IPZ A;  4QL7 A;  3P2A A;  1BJX A;  3P90 A;  4NWY A;  2E7P A;  1PMT A;  3TRQ A;  1EWX A;  1W89 A;  3QCP A;  3MDK A;  5B6M A;  2YOI A;  1SD8 A;  2LJR A;  3Q6O A;  2JZT A;  1GSD A;  2VCX A;  2H74 A;  3TKS C;  3GHA A;  4PXO A;  5H5Q A;  4BPY A;  22GS A;  2KP2 A;  4AJ7 A;  2R4V A;  3QR6 A;  2F51 A;  2PUK C;  3LEF A;  2H1G A;  3N5O A;  2IPA A;  4ECB A;  1OE8 A;  3Q18 A;  3KJY A;  1THX A;  1ZYE A;  2FY6 A;  5G5F A;  4ULX A;  2F3M A;  1S3A A;  4MZC A;  4KX4 A;  3F4S A;  4XCS A;  5HR1 A;  2YCD A;  2RM5 A;  4ZB8 A;  3UBK A;  2OA7 A;  4IW9 A;  1ZZY A;  2H6Y A;  4NPB A;  3QPM A;  4GQF A;  2JSZ A;  3TJG A;  2B3S A;  3DKS A;  6GSS A;  2I4A A;  2LST A;  3KMN A;  2N5F A;  5ID2 A;  1M0U A;  2PVO C;  5HR2 A;  1A0R P;  5D9X A;  1KNG A;  3MWH A;  3TKP A;  2FUG 2;  1WIK A;  2C80 A;  3L0H A;  2CA8 A;  1JZW A;  4TR1 B;  1E6B A;  4L0W A;  1JFU A;  3E9J B;  3FYG A;  4NV2 A;  5ECK B;  4I8B A;  2G0F A;  4XS4 A;  2KP1 A;  2QKE A;  1FG4 A;  3UEM A;  4GSN A;  3GTU B;  3QDN A;  2GSR A;  1SYX A;  1SKS B;  1T3B A;  1TRS A;  2M80 A;  4TOP A;  18GS A;  3PR8 A;  4TXO B;  2N5B A;  2K6V A;  2ZNM A;  1T4Z A;  3HKR A;  4YQV A;  2AHE A;  2VL3 A;  2FLS A;  3G7I A;  3IV4 A;  5G1K A;  4HQZ A;  1X9W B;  4FIW A;  3E3E A;  1NHO A;  5A4U A;  1PX7 A;  3WGX A;  1EOG A;  1K0O A;  1TDI A;  3HJP A;  2F8F A;  1K0B A;  4G19 A;  3PH9 A;  1EZK A;  4ZL8 A;  3QOU A;  1Z6N A;  3A5W A;  6GSY A;  2R3X A;  3RBT A;  3F4R A;  5HFG A;  1A2M A;  4IP1 A;  4PNG A;  4H86 A;  5L71 A;  2DJK A;  2I81 A;  1HNB A;  1WP0 A;  2MYG A;  2V2G A;  1K3Y A;  3CSJ A;  5J5N A;  2L57 A;  1R26 A;  4AJ6 A;  4I2T A;  1X9M B;  3KTL A;  1XPV A;  1Q4J A;  4EDY A;  4JBB A;  3I69 A;  3KZQ A;  4ECI A;  3U5R E;  1O6J A;  1U88 A;  1YDK A;  3TKS A;  1GL8 A;  3SWL A;  3IXR A;  3DWV A;  3F9U A;  1JZR A;  5HR3 A;  1AUC A;  4OFT A;  2VO4 A;  3WGE A;  3MNG A;  5KEJ A;  2REM A;  1E2Y A;  5IO2 A;  4N10 A;  3L9U A;  2YV7 A;  2C0E A;  3ZIV A;  4TN8 A;  1U87 A;  5G30 A;  1GTB A;  2I9H A;  1TXX A;  2NVL A;  5EVO A;  3J7Y b;  4IBP A;  5D73 A;  2MMZ A;  1TK0 B;  1GLQ A;  4RI6 A;  2L4Q A;  2RUE A;  1ERW A;  2XBQ A;  3GNJ A;  2FWH A;  4OMV A;  1UA5 A;  2I3Y A;  2DJJ A;  1AC1 A;  1GTI A;  3H8Q A;  1SL1 B;  3US3 A;  1B48 A;  3VUR A;  3VK9 A;  4WEY A;  4Z7X A;  4ZXG A;  4KB3 A;  5A5K A;  4MJE A;  4MDC A;  2H30 A;  5HFK A;  2HE3 A;  2LKU A;  3FZ4 A;  2B5E A;  3HVX A;  4I6X A;  3ZRE A;  1XVQ A;  1BED A;  3QAW A;  4KSM A;  2VCT A;  1GSQ A;  3KCM A;  1JLV A;  4E8E A;  2O89 A;  2CZ2 A;  4QQ7 A;  1FW1 A;  1SKR B;  1HQO A;  3APQ A;  1BYE A;  5A4W A;  3GX0 A;  5JWO B;  4TW5 A;  1K0M A;  1G6W A;  4KE3 A;  5EY6 A;  2VL9 A;  4BA7 A;  5LCZ A;  2C0F A;  2C8U A;  3CTF A;  3IC4 A;  2LJK A;  3FZA A;  3TGZ A;  3DXB A;  1K0A A;  1XFL A;  3H1N A;  1GLP A;  3W8S A;  2YJH A;  1PQN A;  1T4Y A;  4LA1 A;  3APS A;  2VLT A;  3ED3 A;  4NXI A;  4FH8 A;  2C0D A;  4Q5Q A;  4N0V A;  3ERF A;  2LRT A;  5J4U A;  2XPE A;  1I5G A;  2IL3 A;  2KUC A;  3JCM L;  3TOT A;  5HQP A;  4TVE A;  4WR4 A;  1VF4 A;  2DML A;  2X8C A;  6GST A;  2H0G A;  3A2V A;  1SYR A;  1SL2 B;  5G5E A;  11GS A;  1XWG A;  2LRN A;  1M2B A;  3TKR A;  4IS0 A;  3VFI A;  4WBJ A;  1ILO A;  1OC9 B;  2F8A A;  2GSS A;  1H75 A;  1YKC A;  3ERG A;  2IMK A;  5D93 A;  4CDO A;  3E0U A;  1TRU A;  4MJB A;  4X43 A;  1F3B A;  5IMA A;  1ML6 A;  1EOH A;  4IVF A;  4RQX A;  4K7N A;  3GRX A;  4ECC A;  3WT2 A;  19GS A;  1CQG A;  1PGT A;  2QGV A;  1USB A;  2QSI A;  2WRT A;  3TJF A;  1DBY A;  5ECP B;  3CXG A;  3ZLP A;  3GKN A;  4FYC A;  2GDR A;  5D9T A;  2VCQ A;  2LUS A;  3RPN A;  2H19 A;  3EMX A;  2C3Q A;  2OE3 A;  1PD2 1; 
#chains in the Genus database with same CATH topology
 3RHC A;  1GRX A;  1Q98 A;  2LV3 A;  3GN3 A;  1K3O A;  2TIR A;  4GTU A;  3IAM 2;  3D4M A;  3G9B A;  1OKT A;  3PIN A;  4LMV A;  4JE1 A;  2H6Z A;  4K2D A;  2CAI A;  1B9X C;  3GH9 A;  5GSS A;  3GL5 A;  1LBK A;  4J57 E;  1UC7 A;  4GCI A;  2FCH A;  2VCW A;  3IC8 A;  2HT9 A;  1O73 A;  1H4O A;  2H6X A;  4EXJ A;  2LQO A;  4PQH A;  4MK3 A;  9GSS A;  4QL9 A;  5IPG A;  1FVJ A;  3FR6 A;  4KSO A;  2VLU A;  4POB A;  1K0D A;  3LJR A;  1EV9 A;  2VM2 A;  2ALB A;  3GUR A;  1M9B A;  4MZB A;  3QAV A;  1Y25 A;  2AAW A;  1BX9 A;  2IWT A;  4PGT A;  1FOH A;  2H76 A;  4HJM A;  4NAX A;  5DJM A;  5ECR B;  2NTO A;  4JED A;  1YY7 A;  2VIM A;  4HI7 A;  3C8E A;  1EGR A;  1MEK A;  4JU5 A;  4MP4 A;  1EEM A;  1PRX A;  2VL2 A;  2DSA A;  3C1S A;  2LEG A;  3H79 A;  4JR6 A;  2H8L A;  4FYU A;  5ECN B;  1BG5 A;  1TI1 A;  2IFQ B;  3LQ7 A;  2H1B A;  1ABA A;  4POK A;  5FHI A;  1FB6 A;  1M99 A;  3LOR A;  1V2A A;  3P7X A;  2GT5 A;  1XW5 A;  2LQQ A;  2UZ8 A;  4ILF A;  5J41 A;  5DAK B;  5J9C A;  2LTK A;  5JCG A;  3F3R A;  1ZL9 A;  2HSM A;  2DJ3 A;  4TRX A;  4JZQ A;  2GLR A;  4CHS A;  1EP7 A;  1GUM A;  1OAZ A;  5CRH A;  4L5O A;  2VLV A;  4EUY A;  1A8Y A;  3F6F A;  1B9Y C;  4ZL9 A;  3DVX A;  4GWR A;  1WPI A;  1AXD A;  2GQL A;  5DCH A;  2CX4 A;  3NOF A;  1T8E B;  2B1L A;  2LJA A;  3EPT A;  3I43 A;  2F9S A;  4O32 A;  1S3D A;  3VI7 A;  5E59 A;  1EV4 A;  4OD7 A;  3KH9 A;  3A2X A;  1XWB A;  3IK7 A;  4PUA A;  1YEP A;  2D2Z A;  4YAV A;  4PQ1 A;  2CQ9 A;  3GL3 A;  4DSS B;  1SD9 A;  1TKD B;  2FWF A;  2QA1 A;  2GS3 A;  4BL7 B;  1TJD A;  2A4H A;  1NM3 A;  3HZ8 A;  2FD3 A;  3EIN A;  2JU5 A;  1FHE A;  2YNX A;  3IA1 A;  5ECL B;  2HFD A;  2WB9 A;  3W6G A;  2HSY A;  4ZIJ A;  4KA0 A;  3OR5 A;  4ML1 A;  2P5R A;  3FHK A;  1PFO A;  3MSZ A;  4GST A;  1SL0 B;  2WGR A;  4IP6 A;  3TRP A;  4LL4 B;  2K8S A;  2GZY A;  1V40 A;  3AY8 A;  3F3Q A;  2JZS A;  2DJ2 A;  4MZW A;  4BWS A;  2FNO A;  2H66 A;  4AJ8 A;  3LGC A;  1ACV A;  5DBQ A;  3GKM A;  2IMF A;  1OKD A;  3F63 A;  2L6C A;  3LFL A;  3VLN A;  4PX1 A;  3ZFB A;  1OYJ A;  4BIK A;  2CVK A;  3ME7 A;  1SK1 A;  1LU4 A;  4V2M A;  1AQW A;  1V98 A;  1FB0 A;  1M2A A;  4KUN A;  4WR5 A;  4MPG A;  1GSF A;  1OC8 A;  2HXK A;  3LWA A;  2VOC A;  1HD2 A;  1UN2 A;  4KGI A;  5A4V A;  1PL2 A;  1DE2 A;  4EIQ A;  4ICY A;  5C04 A;  2JL4 A;  1IYH A;  3EVI A;  1JHB A;  1QGV A;  2JSY A;  3IOS A;  2B7J A;  2R37 A;  3P8W A;  5J3R A;  4KAE A;  3D6I A;  4POM A;  3RHB A;  1KEB A;  1A0F A;  3BBY A;  3FZ9 A;  5ID2 B;  4YKG A;  3O6T A;  4IJI A;  2BJX A;  4BVX A;  2H71 A;  2MMO A;  4HJ2 A;  4JRR A;  4F0C A;  1ZYQ B;  1XBS A;  5D9W A;  1YEX A;  2L59 A;  2O87 A;  2WZ9 A;  4G0K A;  1TI3 A;  2WFC A;  1GSU A;  4XS4 B;  3HJO A;  5GST A;  5INY A;  2X64 A;  2KLX A;  13GS A;  2DIZ A;  2M72 A;  1I9D A;  2HLS A;  5KN0 A;  1F2E A;  1QFN A;  2GZP A;  2JZR A;  3EYT A;  4HZ2 A;  4IEL A;  3SBC A;  2V6O A;  3FMW A;  2R2J A;  2HRK A;  4E8H A;  1GNE A;  3M9K A;  5ELG A;  4GRF A;  3GMF A;  3D4T A;  1M9A A;  1SEN A;  3QD9 A;  3ZVJ A;  2HYX A;  10GS A;  2FA8 A;  5AIX A;  1MD4 A;  1SJI A;  5G31 A;  4YKF A;  2HZF A;  1QK8 A;  4TR0 A;  4YH2 A;  2MZC A;  2H72 A;  5DAL A;  3EUR A;  16GS A;  2EIQ A;  4ACS A;  3ME8 A;  3KP9 A;  5AN1 A;  3QAG A;  2WCI A;  3TOU A;  1A2L A;  1ERT A;  3ZL5 A;  4O92 A;  12GS A;  1O81 A;  4HUA A;  3S9F A;  1WWJ A;  3NZN A;  2RLI A;  4ZL7 A;  3WGD A;  1FVK A;  4O7H A;  4XS1 A;  1LJR A;  3ZML A;  4KCA A;  2YP6 A;  2DJ0 A;  4YQU A;  1U6T A;  1VRS D;  3H4K A;  5JCW A;  2MBS A;  1FO5 A;  2R5G A;  3IHQ A;  2IIY A;  1PKW A;  1Z7R A;  4G0L A;  1OC3 A;  3DEX A;  1UVZ A;  2OE0 A;  1AW9 A;  2HI7 A;  1WRY A;  3VWV A;  1QMV A;  5IOX A;  2HSH A;  1XXU A;  2L4C A;  4N0Z A;  1SK0 A;  2YPM A;  2FWE A;  1Z9H A;  2XHF A;  3GKK A;  5B6N A;  4ISD A;  2Z9S A;  1BAY A;  1SJZ A;  1QUW A;  1C72 A;  4EE0 A;  14GS A;  2I1U A;  1K0C A;  3CTG A;  2R6K A;  3GV1 A;  5CAX A;  2HNL A;  1V58 A;  1T7P B;  5FT3 A;  3A5I A;  1EEJ A;  3L78 A;  4MAB A;  1TK8 B;  1M3J A;  2B5Y A;  4K0N A;  1K0N A;  2ON5 A;  2YN1 A;  1GSS A;  3IK9 A;  1IYI A;  4GF0 A;  1Z6M A;  5ECH B;  2O85 A;  3BCI A;  1GP1 A;  3DD3 A;  2ZCT A;  1A8L A;  2K9F A;  1TP9 A;  7GSS A;  3F0I A;  1THO A;  4HOJ A;  3GKX A;  1Y6E A;  3VWU A;  4F03 A;  3RAZ A;  2DC5 A;  3O76 A;  4TR3 A;  1EP8 A;  4EL1 A;  2P0G A;  5CRW A;  5HR0 A;  2GSQ A;  17GS A;  4RI7 A;  2FHE A;  1A2J A;  2DLX A;  3FY7 A;  4POL A;  1O85 A;  5IM9 A;  3ZRD A;  5AGY A;  3QFA C;  2FGX A;  4K7O A;  4GQC A;  2V32 A;  2TRC P;  4OWY A;  1WE0 A;  3K8N A;  3ZZX A;  3H93 A;  4KDU A;  5DQS A;  1SK2 A;  1XIY A;  5IPH A;  4OO5 A;  2HZE A;  5CNW A;  3LG6 A;  2XPD A;  3CBU A;  3D5J A;  3DVW A;  4G0I A;  4L0U A;  2GST A;  5DQY A;  3DIE A;  3MAK A;  1XW6 A;  4MF7 A;  4K6X A;  4JR4 A;  1YJ6 A;  2JAD A;  5B7C A;  4HEA 2;  3PGT A;  6GSV A;  5JWQ B;  4KND A;  4D73 A;  5IO0 A;  5FWG A;  1XW9 A;  2LNT A;  4K5R A;  2FWG A;  1GSY A;  4V1A p;  4EVM A;  5DVB A;  3UAP A;  4K7I A;  2M46 A;  1RQM A;  3D0Z A;  2X49 A;  1TRW A;  1XVW A;  2CX3 A;  1PSQ A;  1YKA A;  3IRA A;  1YF1 A;  2NPB A;  2V41 A;  2NDO A;  2KHP A;  1EGO A;  3HZ4 A;  1VGL A;  2K8V A;  4IQ1 A;  2P31 A;  5AIV A;  3ZYW A;  1WJK A;  3EC3 A;  4HQS A;  5F8B A;  2V1M A;  4EKZ A;  3UJ1 A;  1AQX A;  2J23 A;  4MJC A;  1Z3E A;  2GZZ A;  3TJB A;  4Q5F A;  4X0X A;  1XWA A;  1X5D A;  2OAC A;  2OJL A;  3LSZ A;  1PN9 A;  4V2N A;  4CY8 A;  2PMT A;  3UL3 A;  2L5L A;  3LYP A;  1JZO A;  1SKW B;  4K5S A;  2H70 A;  3KP8 A;  2B5X A;  4L5L A;  3BCK A;  3FR9 A;  4MH3 A;  3IHG A;  3KIJ A;  5IMF A;  4Z2U A;  2L6D A;  1GSE A;  1PKZ A;  5CP1 A;  1XWK A;  2PVQ A;  3M1G A;  1F9M A;  5IIZ A;  2PBJ A;  4NV5 A;  3GST A;  3TUE A;  5GAP D;  3EMP A;  5J9B A;  1DE1 A;  4F82 A;  3NIV A;  1J0F A;  4EF0 A;  5D8I A;  2GVP A;  1R5P A;  2OE1 A;  1U3I A;  4Q5N A;  1AAZ A;  5KOX A;  4MLY A;  3L9S A;  2EC4 A;  4EDZ A;  5H5R A;  3EE2 A;  1PA3 A;  1J08 A;  4KDX A;  2R0C A;  4FO5 A;  3U6V A;  1W4V A;  3ZIT A;  2N5A A;  4Z2T A;  2CZ3 A;  4WF4 A;  1XCC A;  1V57 A;  4ECJ A;  5D9V A;  4PNF A;  1FAA A;  4TR1 A;  2P5Q A;  2C3T A;  4J56 E;  3VI5 A;  5ECS A;  1MTC A;  3A2W A;  1VF3 A;  4GSS A;  4G2E A;  2H0I A;  2RUF A;  4NHZ A;  2R0P A;  4OFM A;  4IJ3 A;  2X8H A;  1YQ1 A;  1ERU A;  1AIU A;  3GTU A;  1SU9 A;  4K8M A;  4Q5R A;  2RII A;  3VPT A;  2TRX A;  5COH A;  3TKQ A;  2JAC A;  2RM6 A;  4FYB A;  2H73 A;  3ZIJ A;  4TXO A;  2CV4 A;  4DVC A;  5HFI A;  4ZBA A;  5LD0 A;  2WDU A;  1RW1 A;  2YWN A;  2BMX A;  5ECI B;  4USS A;  4V1A g;  2AUV A;  2HRN A;  4EIP A;  1R5A A;  4WBR D;  5ECO B;  4MPF A;  1TK5 B;  2YV9 A;  4NMU A;  1AQV A;  1O8X A;  4ML6 A;  3A3T A;  3RDW A;  4YAP A;  4G9H A;  4J2F A;  2H1D A;  3C73 A;  4KW6 A;  1B4P A;  2MMA A;  3I6A A;  1GH2 A;  3EU3 A;  4ZBB A;  4ZIL A;  3HHV A;  4TKY A;  1DUG A;  3FR3 A;  4F0B A;  2LRC A;  2GQM A;  5KN1 A;  1X5C A;  4TR4 A;  3CSH A;  4IN0 A;  3GX8 A;  4BVY A;  4K0G A;  2DJ1 A;  2GQK A;  1XOA A;  1ZMA A;  5B8B A;  3ERW A;  3QMX A;  3F8U A;  2H75 A;  1F6M C;  5IQY A;  2WUL A;  1TOF A;  4WKW A;  2YJ7 A;  2CAQ A;  4KH7 A;  1NW2 A;  1GUL A;  4AF2 A;  2FA4 A;  3CMI A;  4XRA A;  1TTZ A;  1YF0 A;  3N9J A;  5ECQ B;  1QXH A;  4P3Y B;  3IR4 A;  4N11 A;  2VCZ A;  2IMD A;  4MNN A;  1DSB A;  4MF5 A;  4XHM A;  3FK8 A;  5B8A A;  3ZTL A;  2DKH A;  2GTU A;  2XBI A;  4LLR A;  4XIH A;  1S3C A;  3HVN A;  5ECM B;  3BOA A;  5F06 A;  2B6M A;  4HU9 A;  4Z2R A;  3TJJ A;  5JWR B;  1ON4 A;  3EWL A;  1VF1 A;  2OBK A;  3KEB A;  3HVV A;  5D96 A;  1X5E A;  5H5S A;  3DYR A;  5DCG A;  4K2X A;  5IMZ A;  1K3L A;  5KOW A;  1NHY A;  5F0G A;  1R7H A;  1XWC A;  3G7J A;  3C7M A;  5JCU A;  1O8W A;  5IMV A;  1URM A;  2AB6 A;  2AV4 A;  4MA9 A;  3UOM A;  4IGJ A;  1XG8 A;  1M3I A;  4ZB9 A;  5ENU A;  1F3A A;  1M2D A;  1KBN A;  3C1R A;  2ON7 A;  2J9H A;  4O5R A;  5IMC A;  3GA4 A;  3R2Q A;  3UIW A;  1R4W A;  2ZUP A;  3MYD A;  2VCV A;  2B1K A;  2IMI A;  3FW2 A;  3IAS 2;  6GSX A;  3CRU A;  1JZD A;  4F9Z A;  3WT1 A;  1YZX A;  3C71 A;  2OBI A;  4MMM A;  1ZCP A;  3CYN A;  4AGS A;  2AYT A;  1ZOF A;  1PX6 A;  5AIS A;  1O7U A;  5IMD A;  2YZH A;  1G6Y A;  4IQA A;  4YQM A;  3M0F A;  5F05 A;  1Z7P A;  4BVX B;  1T1V A;  2H0H A;  5G2Z A;  3UAR A;  4LMW A;  1G7E A;  2X8G A;  1ST9 A;  1N2A A;  1N8J A;  1A23 A;  3M3M A;  3F6D A;  4DEJ A;  2EIO A;  2PGT A;  1TU7 A;  4MJA A;  3QFB C;  1S3R A;  4K1F A;  5CO3 A;  2LS5 A;  1M7T A;  2IME A;  4WF5 A;  1HNC A;  3WD6 A;  1OE7 A;  1G7O A;  2R0G A;  4WXT A;  4GXZ A;  1OC9 A;  1V9W A;  3TB2 A;  4GLT A;  2B7K A;  3VWW A;  3J7Y k;  2H1A A;  3R3E A;  4KCE A;  1PL1 A;  4WET A;  4MH2 A;  2C1Y A;  2PN8 A;  3CRT A;  4I2U A;  2IJY A;  1GTU A;  4HZ4 A;  4OCE A;  4ZBD A;  2V6K A;  2X4A A;  2PER A;  2YAN A;  1Z5Y E;  2YZU A;  5CRG A;  2WJU A;  20GS A;  3HVS A;  2A2R A;  3KD0 A;  3FRC A;  5DDL A;  3FKF A;  5DAL B;  2DBC A;  3RPP A;  3GUS A;  2C0G A;  3D21 A;  3KMO A;  5GZZ B;  2H01 A;  2MMN A;  2VL2 C;  3GH6 A;  3ZMK A;  1GWC A;  2KOK A;  2YWI A;  3EU4 A;  3TJK A;  4CW9 A;  4HDE A;  4G10 A;  4HU7 A;  4EC0 A;  4I5Q A;  8GSS A;  1T00 A;  2K18 A;  3FZ5 A;  2VAF A;  1TU8 A;  3Q19 A;  4EO3 A;  1KTE A;  2PU9 C;  2HRF A;  4XRD A;  5KN3 A;  4F2I A;  3DGQ A;  4PUR A;  3HXS A;  1X9S B;  4MCU A;  3ZFL A;  2XC2 A;  3UVH A;  1PN0 A;  5EL8 A;  1XZO A;  3BJ5 A;  3G7Y A;  2VD1 A;  3D22 A;  3W8J A;  2C3N A;  2IN3 A;  2E2G A;  3UBL A;  1MDJ A;  3IBH A;  1XOB A;  3GIX A;  4DSQ A;  4MF6 A;  1WOU A;  3F4T A;  2VUP A;  1MDI A;  4TXV A;  3IDV A;  4L8E A;  2EIR A;  3WYW A;  3ISO A;  3IE3 A;  1G0T A;  3KTB A;  1X0R A;  1GUH A;  5ELA A;  4IHU A;  3APO A;  3VPQ A;  3TRX A;  3HA9 A;  3GSS A;  5E4W A;  2E0Q A;  4ID0 A;  4DSR A;  2DIY A;  3LXZ A;  5G1L A;  1JLW A;  3L4N A;  2A4V A;  4RQR A;  1VF2 A;  1ZYP A;  1NSW A;  3GYK A;  3KH7 A;  4LL1 B;  1A24 A;  1SJ6 A;  2YWM A;  3KGK A;  2IFQ A;  3ZVJ D;  1MD3 A;  1U3A A;  3VWX A;  4OCF A;  5KN2 A;  4I97 A;  3I9V 2;  4XS6 A;  4N30 A;  4PUF C;  2GGT A;  2PPT A;  2ES7 A;  3M9J A;  1RK4 A;  5LNK e;  4K9Z A;  1TW9 A;  2DMM A;  3FEU A;  1MDK A;  5DAK A;  2NBS A;  2QC7 A;  5IOW A;  5EPF A;  3HDC A;  2PWJ A;  4X1U A;  6GSW A;  3LYK A;  5GAN D;  1CQH A;  3TDG A;  6GSU A;  3CSI A;  2E2M A;  2LNS A;  4HS1 A;  1ERV A;  3GFK A;  4PQI A;  1GUK A;  3HJM A;  3DML A;  3BD2 A;  1HYU A;  2AJQ B;  5C00 A;  1OVN A;  3LXT A;  2GT6 A;  1QQ2 A;  3DRN A;  1BQ7 A;  4RUV A;  4ZB6 A;  2OAD A;  3KM6 A;  3UMA A;  2HZE B;  1HNA A;  5F07 A;  3HY2 A;  2O7K A;  1FOV A;  2G2Q A;  4PTS A;  5CYY A;  3L9V A;  1B8X A;  5ABR A;  2CVD A;  3TCO A;  4KDY A;  2O8V B;  4OO4 A;  2L5O A;  2YWO A;  4BWQ A;  5CRD A;  4D73 B;  4XTS A;  3TKS E;  1J9B A;  1TRV A;  3HCZ A;  2CVB A;  4DSS A;  1WMJ A;  2CT6 A;  5DJL A;  2C4J A;  3UVT A;  1GNW A;  4O5U A;  2MBT A;  2OKA A;  4A5P A;  4BL7 A;  3V1W A;  3M8N A;  4IKH A;  1GTA A;  2WS2 A;  2BTO T;  5CRE A;  3KXO A;  4V2L A;  2X99 A;  3Q74 A;  1B4Q A;  2VM1 A;  4NHW A;  2A2S A;  2VD0 A;  3O3T A;  3HYP A;  1ZGN A;  2QA2 A;  4OFN A;  1F37 A;  3HD5 A;  3IPZ A;  4QL7 A;  3P2A A;  1BJX A;  3P90 A;  4NWY A;  2E7P A;  1PMT A;  3TRQ A;  1EWX A;  1W89 A;  3QCP A;  3MDK A;  5B6M A;  2YOI A;  4HSC X;  1SD8 A;  2LJR A;  3Q6O A;  2JZT A;  1GSD A;  2VCX A;  2H74 A;  3TKS C;  3GHA A;  4PXO A;  3MIX A;  5H5Q A;  4BPY A;  22GS A;  2KP2 A;  4AJ7 A;  3PPU A;  2R4V A;  3QR6 A;  2F51 A;  2PUK C;  3LEF A;  2H1G A;  3N5O A;  2IPA A;  4ECB A;  2A2P A;  1OE8 A;  3Q18 A;  3KJY A;  1THX A;  1ZYE A;  4FQU A;  2FY6 A;  5G5F A;  4ULX A;  2F3M A;  1S3A A;  4MZC A;  4KX4 A;  3F4S A;  4XCS A;  5HR1 A;  2YCD A;  2RM5 A;  4ZB8 A;  3UBK A;  2OA7 A;  4IW9 A;  5BMU A;  1ZZY A;  2H6Y A;  4NPB A;  3QPM A;  4GQF A;  2JSZ A;  2DKI A;  3TJG A;  2B3S A;  3DKS A;  6GSS A;  2I4A A;  2LST A;  3KMN A;  2N5F A;  5ID2 A;  1M0U A;  2PVO C;  5HR2 A;  1A0R P;  5D9X A;  1KNG A;  3MWH A;  3TKP A;  2FUG 2;  1WIK A;  2C80 A;  3L0H A;  2CA8 A;  1JZW A;  2HRA A;  1E6B A;  4L0W A;  4TR1 B;  1JFU A;  3E9J B;  3FYG A;  4NV2 A;  5ECK B;  4I8B A;  2G0F A;  4XS4 A;  2KP1 A;  4X4J A;  2QKE A;  1FG4 A;  3UEM A;  4GSN A;  3GTU B;  3QDN A;  2GSR A;  1SYX A;  1SKS B;  1T3B A;  1TRS A;  2M80 A;  4TOP A;  18GS A;  3PR8 A;  4TXO B;  2N5B A;  2K6V A;  2ZNM A;  1T4Z A;  3HKR A;  4YQV A;  2AHE A;  2VL3 A;  2FLS A;  3G7I A;  3IV4 A;  5G1K A;  4HQZ A;  1X9W B;  4FIW A;  3E3E A;  1NHO A;  5A4U A;  1PX7 A;  3WGX A;  1EOG A;  1K0O A;  1TDI A;  3HJP A;  2F8F A;  1K0B A;  4G19 A;  3PH9 A;  1EZK A;  4ZL8 A;  3QOU A;  1Z6N A;  3A5W A;  6GSY A;  2R3X A;  3RBT A;  3F4R A;  5HFG A;  1A2M A;  4IP1 A;  4PNG A;  4H86 A;  5L71 A;  2DJK A;  2I81 A;  1HNB A;  1WP0 A;  2MYG A;  2V2G A;  1K3Y A;  4BVY B;  3CSJ A;  5J5N A;  2L57 A;  1R26 A;  4AJ6 A;  4I2T A;  1X9M B;  3KTL A;  1XPV A;  1Q4J A;  4EDY A;  4KF9 A;  4JBB A;  3I69 A;  3KZQ A;  4ECI A;  3U5R E;  1O6J A;  1U88 A;  1YDK A;  3TKS A;  1GL8 A;  3SWL A;  3IXR A;  3DWV A;  3F9U A;  1JZR A;  5HR3 A;  1AUC A;  4OFT A;  2VO4 A;  3WGE A;  3MNG A;  5KEJ A;  2REM A;  1E2Y A;  5IO2 A;  4N10 A;  3L9U A;  2YV7 A;  2C0E A;  1ZYN A;  3ZIV A;  4TN8 A;  1U87 A;  5G30 A;  1GTB A;  2I9H A;  1TXX A;  2NVL A;  5EVO A;  3J7Y b;  4IBP A;  5D73 A;  2MMZ A;  1TK0 B;  1GLQ A;  4RI6 A;  2L4Q A;  2RUE A;  1ERW A;  2XBQ A;  3GNJ A;  2FWH A;  4OMV A;  1UA5 A;  2I3Y A;  2DJJ A;  1AC1 A;  1GTI A;  3CQF A;  3H8Q A;  1SL1 B;  3US3 A;  1B48 A;  3VUR A;  3VK9 A;  4WEY A;  4Z7X A;  4ZXG A;  4KB3 A;  5A5K A;  4MJE A;  3LW9 A;  4MDC A;  2H30 A;  5HFK A;  2HE3 A;  2LKU A;  3FZ4 A;  2B5E A;  3HVX A;  4I6X A;  3ZRE A;  1XVQ A;  1BED A;  3QAW A;  4KSM A;  2VCT A;  1GSQ A;  3KCM A;  1JLV A;  4E8E A;  2O89 A;  2CZ2 A;  4QQ7 A;  1FW1 A;  1SKR B;  1HQO A;  3APQ A;  1BYE A;  5A4W A;  3GX0 A;  5JWO B;  4TW5 A;  1K0M A;  1G6W A;  4KE3 A;  5EY6 A;  2VL9 A;  4BA7 A;  4CY6 A;  5LCZ A;  2C0F A;  2C8U A;  3CTF A;  3IC4 A;  2LJK A;  3FZA A;  3TGZ A;  3DXB A;  1K0A A;  1XFL A;  3H1N A;  1GLP A;  3W8S A;  2YJH A;  1PQN A;  1T4Y A;  4LA1 A;  3APS A;  2VLT A;  3ED3 A;  4NXI A;  4FH8 A;  2C0D A;  4Q5Q A;  4N0V A;  3ERF A;  2LRT A;  5J4U A;  2XPE A;  1I5G A;  2IL3 A;  2KUC A;  3JCM L;  3TOT A;  5HQP A;  4TVE A;  4WR4 A;  1VF4 A;  2DML A;  2X8C A;  6GST A;  2H0G A;  3A2V A;  1SYR A;  1SL2 B;  5G5E A;  11GS A;  1XWG A;  2LRN A;  1M2B A;  3TKR A;  4IS0 A;  3VFI A;  4WBJ A;  1ILO A;  1OC9 B;  4O5Q A;  2F8A A;  2GSS A;  1H75 A;  1YKC A;  3ERG A;  2IMK A;  5D93 A;  4CDO A;  3E0U A;  1TRU A;  4MJB A;  4X43 A;  1F3B A;  5IMA A;  1ML6 A;  1EOH A;  4IVF A;  4RQX A;  4K7N A;  3GRX A;  4ECC A;  3WT2 A;  19GS A;  1CQG A;  1PGT A;  2QGV A;  1USB A;  2QSI A;  2WRT A;  3TJF A;  1DBY A;  5ECP B;  3CXG A;  3ZLP A;  5BRT A;  3GKN A;  4FYC A;  2GDR A;  5D9T A;  2VCQ A;  2LUS A;  3RPN A;  2H19 A;  3EMX A;  2C3Q A;  2OE3 A;  1PD2 1; 
#chains in the Genus database with same CATH homology
 3RHC A;  1GRX A;  1Q98 A;  2LV3 A;  3GN3 A;  1K3O A;  2TIR A;  4GTU A;  3IAM 2;  3D4M A;  3G9B A;  1OKT A;  3PIN A;  4LMV A;  4JE1 A;  2H6Z A;  4K2D A;  2CAI A;  1B9X C;  3GH9 A;  5GSS A;  3GL5 A;  1LBK A;  4J57 E;  1UC7 A;  4GCI A;  2FCH A;  2VCW A;  3IC8 A;  2HT9 A;  1O73 A;  1H4O A;  2H6X A;  4EXJ A;  2LQO A;  4PQH A;  4MK3 A;  9GSS A;  4QL9 A;  5IPG A;  1FVJ A;  3FR6 A;  4KSO A;  2VLU A;  4POB A;  1K0D A;  3LJR A;  1EV9 A;  2VM2 A;  2ALB A;  3GUR A;  1M9B A;  4MZB A;  3QAV A;  1Y25 A;  2AAW A;  1BX9 A;  2IWT A;  4PGT A;  1FOH A;  2H76 A;  4HJM A;  4NAX A;  5DJM A;  5ECR B;  2NTO A;  4JED A;  1YY7 A;  2VIM A;  4HI7 A;  3C8E A;  1EGR A;  1MEK A;  4JU5 A;  4MP4 A;  1EEM A;  1PRX A;  2VL2 A;  2DSA A;  3C1S A;  2LEG A;  3H79 A;  4JR6 A;  2H8L A;  4FYU A;  5ECN B;  1BG5 A;  1TI1 A;  2IFQ B;  3LQ7 A;  2H1B A;  1ABA A;  4POK A;  5FHI A;  1FB6 A;  1M99 A;  3LOR A;  1V2A A;  3P7X A;  2GT5 A;  1XW5 A;  2LQQ A;  2UZ8 A;  4ILF A;  5J41 A;  5DAK B;  5J9C A;  2LTK A;  5JCG A;  3F3R A;  1ZL9 A;  2HSM A;  2DJ3 A;  4TRX A;  4JZQ A;  2GLR A;  4CHS A;  1EP7 A;  1GUM A;  1OAZ A;  5CRH A;  4L5O A;  2VLV A;  4EUY A;  1A8Y A;  3F6F A;  1B9Y C;  4ZL9 A;  3DVX A;  4GWR A;  1WPI A;  1AXD A;  2GQL A;  5DCH A;  2CX4 A;  3NOF A;  1T8E B;  2B1L A;  2LJA A;  3EPT A;  3I43 A;  2F9S A;  4O32 A;  1S3D A;  3VI7 A;  5E59 A;  1EV4 A;  4OD7 A;  3KH9 A;  3A2X A;  1XWB A;  3IK7 A;  4PUA A;  1YEP A;  2D2Z A;  4YAV A;  4PQ1 A;  2CQ9 A;  3GL3 A;  4DSS B;  1SD9 A;  1TKD B;  2FWF A;  2QA1 A;  2GS3 A;  4BL7 B;  1TJD A;  2A4H A;  1NM3 A;  3HZ8 A;  2FD3 A;  3EIN A;  2JU5 A;  1FHE A;  2YNX A;  3IA1 A;  5ECL B;  2HFD A;  2WB9 A;  3W6G A;  2HSY A;  4ZIJ A;  4KA0 A;  3OR5 A;  4ML1 A;  2P5R A;  3FHK A;  3MSZ A;  4GST A;  1SL0 B;  2WGR A;  4IP6 A;  3TRP A;  4LL4 B;  2K8S A;  2GZY A;  1V40 A;  3AY8 A;  3F3Q A;  2JZS A;  2DJ2 A;  4MZW A;  4BWS A;  2FNO A;  2H66 A;  4AJ8 A;  3LGC A;  1ACV A;  5DBQ A;  3GKM A;  2IMF A;  1OKD A;  3F63 A;  2L6C A;  3LFL A;  3VLN A;  4PX1 A;  3ZFB A;  1OYJ A;  2CVK A;  3ME7 A;  1SK1 A;  1LU4 A;  4V2M A;  1AQW A;  1V98 A;  1FB0 A;  1M2A A;  4KUN A;  4WR5 A;  4MPG A;  1GSF A;  1OC8 A;  2HXK A;  3LWA A;  2VOC A;  1HD2 A;  1UN2 A;  4KGI A;  5A4V A;  1PL2 A;  1DE2 A;  4EIQ A;  4ICY A;  5C04 A;  2JL4 A;  1IYH A;  3EVI A;  1JHB A;  1QGV A;  2JSY A;  3IOS A;  2B7J A;  2R37 A;  3P8W A;  5J3R A;  4KAE A;  3D6I A;  4POM A;  3RHB A;  1KEB A;  1A0F A;  3BBY A;  3FZ9 A;  5ID2 B;  4YKG A;  3O6T A;  4IJI A;  2BJX A;  4BVX A;  2H71 A;  2MMO A;  4HJ2 A;  4JRR A;  4F0C A;  1ZYQ B;  1XBS A;  5D9W A;  1YEX A;  2L59 A;  2O87 A;  2WZ9 A;  4G0K A;  1TI3 A;  2WFC A;  1GSU A;  4XS4 B;  3HJO A;  5GST A;  5INY A;  2X64 A;  2KLX A;  13GS A;  2DIZ A;  2M72 A;  1I9D A;  2HLS A;  5KN0 A;  1F2E A;  1QFN A;  2GZP A;  2JZR A;  3EYT A;  4HZ2 A;  4IEL A;  3SBC A;  2V6O A;  3FMW A;  2R2J A;  2HRK A;  4E8H A;  1GNE A;  3M9K A;  5ELG A;  4GRF A;  3GMF A;  3D4T A;  1M9A A;  1SEN A;  3QD9 A;  3ZVJ A;  2HYX A;  10GS A;  2FA8 A;  5AIX A;  1MD4 A;  1SJI A;  5G31 A;  4YKF A;  2HZF A;  1QK8 A;  4TR0 A;  4YH2 A;  2MZC A;  2H72 A;  5DAL A;  3EUR A;  16GS A;  2EIQ A;  4ACS A;  3ME8 A;  3KP9 A;  5AN1 A;  3QAG A;  2WCI A;  3TOU A;  1A2L A;  1ERT A;  3ZL5 A;  4O92 A;  12GS A;  1O81 A;  4HUA A;  3S9F A;  1WWJ A;  3NZN A;  2RLI A;  4ZL7 A;  3WGD A;  1FVK A;  4O7H A;  4XS1 A;  1LJR A;  3ZML A;  4KCA A;  2YP6 A;  2DJ0 A;  4YQU A;  1U6T A;  1VRS D;  3H4K A;  5JCW A;  2MBS A;  1FO5 A;  2R5G A;  3IHQ A;  2IIY A;  1PKW A;  1Z7R A;  4G0L A;  1OC3 A;  3DEX A;  1UVZ A;  2OE0 A;  1AW9 A;  2HI7 A;  1WRY A;  3VWV A;  1QMV A;  5IOX A;  2HSH A;  1XXU A;  2L4C A;  4N0Z A;  1SK0 A;  2YPM A;  2FWE A;  1Z9H A;  2XHF A;  3GKK A;  5B6N A;  4ISD A;  2Z9S A;  1BAY A;  1SJZ A;  1QUW A;  1C72 A;  4EE0 A;  14GS A;  2I1U A;  1K0C A;  3CTG A;  2R6K A;  3GV1 A;  5CAX A;  2HNL A;  1V58 A;  1T7P B;  5FT3 A;  3A5I A;  1EEJ A;  3L78 A;  4MAB A;  1TK8 B;  2B5Y A;  4K0N A;  1K0N A;  2ON5 A;  2YN1 A;  1GSS A;  3IK9 A;  1IYI A;  4GF0 A;  1Z6M A;  5ECH B;  2O85 A;  3BCI A;  1GP1 A;  3DD3 A;  2ZCT A;  1A8L A;  2K9F A;  1TP9 A;  7GSS A;  3F0I A;  1THO A;  4HOJ A;  3GKX A;  1Y6E A;  3VWU A;  4F03 A;  3RAZ A;  2DC5 A;  3O76 A;  4TR3 A;  1EP8 A;  4EL1 A;  2P0G A;  5CRW A;  5HR0 A;  2GSQ A;  17GS A;  4RI7 A;  2FHE A;  1A2J A;  2DLX A;  3FY7 A;  4POL A;  1O85 A;  5IM9 A;  3ZRD A;  5AGY A;  3QFA C;  2FGX A;  4K7O A;  4GQC A;  2V32 A;  2TRC P;  4OWY A;  1WE0 A;  3K8N A;  3ZZX A;  3H93 A;  4KDU A;  5DQS A;  1SK2 A;  1XIY A;  5IPH A;  4OO5 A;  2HZE A;  5CNW A;  3LG6 A;  2XPD A;  3CBU A;  3D5J A;  3DVW A;  4G0I A;  4L0U A;  2GST A;  5DQY A;  3DIE A;  3MAK A;  1XW6 A;  4MF7 A;  4K6X A;  4JR4 A;  1YJ6 A;  2JAD A;  5B7C A;  4HEA 2;  3PGT A;  6GSV A;  5JWQ B;  4KND A;  4D73 A;  5IO0 A;  5FWG A;  1XW9 A;  2LNT A;  4K5R A;  2FWG A;  1GSY A;  4V1A p;  4EVM A;  5DVB A;  3UAP A;  4K7I A;  2M46 A;  1RQM A;  3D0Z A;  2X49 A;  1TRW A;  1XVW A;  2CX3 A;  1PSQ A;  1YKA A;  3IRA A;  1YF1 A;  2NPB A;  2V41 A;  2NDO A;  2KHP A;  1EGO A;  3HZ4 A;  1VGL A;  2K8V A;  4IQ1 A;  2P31 A;  5AIV A;  3ZYW A;  1WJK A;  3EC3 A;  4HQS A;  5F8B A;  2V1M A;  4EKZ A;  3UJ1 A;  1AQX A;  2J23 A;  4MJC A;  1Z3E A;  2GZZ A;  3TJB A;  4Q5F A;  4X0X A;  1XWA A;  1X5D A;  2OAC A;  2OJL A;  3LSZ A;  1PN9 A;  4V2N A;  4CY8 A;  2PMT A;  3UL3 A;  2L5L A;  3LYP A;  1JZO A;  1SKW B;  4K5S A;  2H70 A;  3KP8 A;  2B5X A;  4L5L A;  3BCK A;  3FR9 A;  4MH3 A;  3IHG A;  3KIJ A;  5IMF A;  4Z2U A;  2L6D A;  1GSE A;  1PKZ A;  5CP1 A;  1XWK A;  2PVQ A;  3M1G A;  1F9M A;  5IIZ A;  2PBJ A;  4NV5 A;  3GST A;  3TUE A;  5GAP D;  3EMP A;  5J9B A;  1DE1 A;  4F82 A;  3NIV A;  1J0F A;  4EF0 A;  5D8I A;  2GVP A;  1R5P A;  2OE1 A;  1U3I A;  4Q5N A;  1AAZ A;  5KOX A;  4MLY A;  3L9S A;  2EC4 A;  4EDZ A;  5H5R A;  3EE2 A;  1PA3 A;  1J08 A;  4KDX A;  2R0C A;  4FO5 A;  3U6V A;  1W4V A;  3ZIT A;  2N5A A;  4Z2T A;  2CZ3 A;  4WF4 A;  1XCC A;  1V57 A;  4ECJ A;  5D9V A;  4PNF A;  1FAA A;  4TR1 A;  2P5Q A;  2C3T A;  4J56 E;  3VI5 A;  5ECS A;  1MTC A;  3A2W A;  1VF3 A;  4GSS A;  4G2E A;  2H0I A;  2RUF A;  4NHZ A;  2R0P A;  4OFM A;  4IJ3 A;  2X8H A;  1YQ1 A;  1ERU A;  1AIU A;  3GTU A;  1SU9 A;  4K8M A;  4Q5R A;  2RII A;  3VPT A;  2TRX A;  5COH A;  3TKQ A;  2JAC A;  2RM6 A;  4FYB A;  2H73 A;  3ZIJ A;  4TXO A;  2CV4 A;  4DVC A;  5HFI A;  4ZBA A;  5LD0 A;  2WDU A;  1RW1 A;  2YWN A;  2BMX A;  5ECI B;  4USS A;  4V1A g;  2AUV A;  2HRN A;  4EIP A;  1R5A A;  4WBR D;  5ECO B;  4MPF A;  1TK5 B;  2YV9 A;  4NMU A;  1AQV A;  1O8X A;  4ML6 A;  3A3T A;  3RDW A;  4YAP A;  4G9H A;  4J2F A;  2H1D A;  3C73 A;  4KW6 A;  1B4P A;  2MMA A;  3I6A A;  1GH2 A;  3EU3 A;  4ZBB A;  4ZIL A;  3HHV A;  4TKY A;  1DUG A;  3FR3 A;  4F0B A;  2LRC A;  2GQM A;  5KN1 A;  1X5C A;  4TR4 A;  3CSH A;  4IN0 A;  3GX8 A;  4BVY A;  4K0G A;  2DJ1 A;  2GQK A;  1XOA A;  1ZMA A;  5B8B A;  3ERW A;  3QMX A;  3F8U A;  2H75 A;  1F6M C;  5IQY A;  2WUL A;  1TOF A;  4WKW A;  2YJ7 A;  2CAQ A;  4KH7 A;  1NW2 A;  1GUL A;  4AF2 A;  2FA4 A;  3CMI A;  4XRA A;  1TTZ A;  1YF0 A;  3N9J A;  5ECQ B;  1QXH A;  4P3Y B;  3IR4 A;  4N11 A;  2VCZ A;  2IMD A;  4MNN A;  1DSB A;  4MF5 A;  4XHM A;  3FK8 A;  5B8A A;  3ZTL A;  2DKH A;  2GTU A;  2XBI A;  4LLR A;  4XIH A;  1S3C A;  5ECM B;  3BOA A;  5F06 A;  2B6M A;  4HU9 A;  4Z2R A;  3TJJ A;  5JWR B;  1ON4 A;  3EWL A;  1VF1 A;  2OBK A;  3KEB A;  3HVV A;  5D96 A;  1X5E A;  5H5S A;  3DYR A;  5DCG A;  4K2X A;  5IMZ A;  1K3L A;  5KOW A;  1NHY A;  5F0G A;  1R7H A;  1XWC A;  3G7J A;  3C7M A;  5JCU A;  1O8W A;  5IMV A;  1URM A;  2AB6 A;  2AV4 A;  4MA9 A;  3UOM A;  4IGJ A;  4ZB9 A;  5ENU A;  1F3A A;  1M2D A;  1KBN A;  3C1R A;  2ON7 A;  2J9H A;  4O5R A;  5IMC A;  3GA4 A;  3R2Q A;  3UIW A;  1R4W A;  2ZUP A;  3MYD A;  2VCV A;  2B1K A;  2IMI A;  3FW2 A;  3IAS 2;  6GSX A;  3CRU A;  1JZD A;  4F9Z A;  3WT1 A;  1YZX A;  3C71 A;  2OBI A;  4MMM A;  1ZCP A;  3CYN A;  4AGS A;  2AYT A;  1ZOF A;  1PX6 A;  5AIS A;  1O7U A;  5IMD A;  2YZH A;  1G6Y A;  4IQA A;  4YQM A;  3M0F A;  5F05 A;  1Z7P A;  4BVX B;  1T1V A;  2H0H A;  5G2Z A;  3UAR A;  4LMW A;  1G7E A;  2X8G A;  1ST9 A;  1N2A A;  1N8J A;  1A23 A;  3M3M A;  3F6D A;  4DEJ A;  2EIO A;  2PGT A;  1TU7 A;  4MJA A;  3QFB C;  4K1F A;  5CO3 A;  2LS5 A;  1M7T A;  2IME A;  4WF5 A;  1HNC A;  3WD6 A;  1OE7 A;  1G7O A;  2R0G A;  4WXT A;  4GXZ A;  1OC9 A;  1V9W A;  3TB2 A;  4GLT A;  2B7K A;  3VWW A;  3J7Y k;  2H1A A;  3R3E A;  4KCE A;  1PL1 A;  4WET A;  4MH2 A;  2C1Y A;  2PN8 A;  3CRT A;  4I2U A;  2IJY A;  1GTU A;  4HZ4 A;  4OCE A;  4ZBD A;  2V6K A;  2X4A A;  2PER A;  2YAN A;  1Z5Y E;  2YZU A;  5CRG A;  2WJU A;  20GS A;  3HVS A;  2A2R A;  3KD0 A;  3FRC A;  5DDL A;  3FKF A;  5DAL B;  2DBC A;  3RPP A;  3GUS A;  2C0G A;  3D21 A;  3KMO A;  5GZZ B;  2H01 A;  2MMN A;  2VL2 C;  3GH6 A;  3ZMK A;  1GWC A;  2KOK A;  2YWI A;  3EU4 A;  3TJK A;  4CW9 A;  4HDE A;  4G10 A;  4HU7 A;  4EC0 A;  4I5Q A;  8GSS A;  1T00 A;  2K18 A;  3FZ5 A;  2VAF A;  1TU8 A;  3Q19 A;  4EO3 A;  1KTE A;  2PU9 C;  2HRF A;  4XRD A;  5KN3 A;  4F2I A;  3DGQ A;  4PUR A;  3HXS A;  1X9S B;  4MCU A;  3ZFL A;  2XC2 A;  3UVH A;  1PN0 A;  5EL8 A;  1XZO A;  3BJ5 A;  3G7Y A;  2VD1 A;  3D22 A;  3W8J A;  2C3N A;  2IN3 A;  2E2G A;  3UBL A;  1MDJ A;  3IBH A;  1XOB A;  3GIX A;  4DSQ A;  4MF6 A;  1WOU A;  3F4T A;  2VUP A;  1MDI A;  4TXV A;  3IDV A;  4L8E A;  2EIR A;  3WYW A;  3ISO A;  3IE3 A;  1G0T A;  3KTB A;  1X0R A;  1GUH A;  5ELA A;  4IHU A;  3APO A;  3VPQ A;  3TRX A;  3HA9 A;  3GSS A;  5E4W A;  2E0Q A;  4ID0 A;  4DSR A;  2DIY A;  3LXZ A;  5G1L A;  1JLW A;  3L4N A;  2A4V A;  4RQR A;  1VF2 A;  1ZYP A;  1NSW A;  3GYK A;  3KH7 A;  4LL1 B;  1A24 A;  1SJ6 A;  2YWM A;  3KGK A;  2IFQ A;  3ZVJ D;  1MD3 A;  1U3A A;  3VWX A;  4OCF A;  5KN2 A;  4I97 A;  3I9V 2;  4XS6 A;  4N30 A;  4PUF C;  2GGT A;  2PPT A;  2ES7 A;  3M9J A;  1RK4 A;  5LNK e;  4K9Z A;  1TW9 A;  2DMM A;  3FEU A;  1MDK A;  5DAK A;  2NBS A;  2QC7 A;  5IOW A;  5EPF A;  3HDC A;  2PWJ A;  4X1U A;  6GSW A;  3LYK A;  5GAN D;  1CQH A;  3TDG A;  6GSU A;  3CSI A;  2E2M A;  2LNS A;  4HS1 A;  1ERV A;  3GFK A;  4PQI A;  1GUK A;  3HJM A;  3DML A;  3BD2 A;  1HYU A;  2AJQ B;  5C00 A;  1OVN A;  3LXT A;  2GT6 A;  1QQ2 A;  3DRN A;  1BQ7 A;  4RUV A;  4ZB6 A;  2OAD A;  3KM6 A;  3UMA A;  2HZE B;  1HNA A;  5F07 A;  3HY2 A;  2O7K A;  1FOV A;  2G2Q A;  4PTS A;  5CYY A;  3L9V A;  1B8X A;  5ABR A;  2CVD A;  3TCO A;  4KDY A;  2O8V B;  4OO4 A;  2L5O A;  2YWO A;  4BWQ A;  5CRD A;  4D73 B;  4XTS A;  3TKS E;  1J9B A;  1TRV A;  3HCZ A;  2CVB A;  4DSS A;  1WMJ A;  2CT6 A;  5DJL A;  2C4J A;  3UVT A;  1GNW A;  4O5U A;  2MBT A;  2OKA A;  4A5P A;  4BL7 A;  3V1W A;  3M8N A;  4IKH A;  1GTA A;  2WS2 A;  2BTO T;  5CRE A;  3KXO A;  4V2L A;  2X99 A;  3Q74 A;  1B4Q A;  2VM1 A;  4NHW A;  2A2S A;  2VD0 A;  3O3T A;  3HYP A;  1ZGN A;  2QA2 A;  4OFN A;  1F37 A;  3HD5 A;  3IPZ A;  4QL7 A;  3P2A A;  1BJX A;  3P90 A;  4NWY A;  2E7P A;  1PMT A;  3TRQ A;  1EWX A;  1W89 A;  3QCP A;  3MDK A;  5B6M A;  2YOI A;  1SD8 A;  2LJR A;  3Q6O A;  2JZT A;  1GSD A;  2VCX A;  2H74 A;  3TKS C;  3GHA A;  4PXO A;  3MIX A;  5H5Q A;  4BPY A;  22GS A;  2KP2 A;  4AJ7 A;  3PPU A;  2R4V A;  3QR6 A;  2F51 A;  2PUK C;  3LEF A;  2H1G A;  3N5O A;  2IPA A;  4ECB A;  2A2P A;  1OE8 A;  3Q18 A;  3KJY A;  1THX A;  1ZYE A;  4FQU A;  2FY6 A;  5G5F A;  4ULX A;  2F3M A;  1S3A A;  4MZC A;  4KX4 A;  3F4S A;  4XCS A;  5HR1 A;  2YCD A;  2RM5 A;  4ZB8 A;  3UBK A;  2OA7 A;  4IW9 A;  5BMU A;  1ZZY A;  2H6Y A;  4NPB A;  3QPM A;  4GQF A;  2JSZ A;  2DKI A;  3TJG A;  2B3S A;  3DKS A;  6GSS A;  2I4A A;  2LST A;  3KMN A;  2N5F A;  5ID2 A;  1M0U A;  2PVO C;  5HR2 A;  1A0R P;  5D9X A;  1KNG A;  3MWH A;  3TKP A;  2FUG 2;  1WIK A;  2C80 A;  3L0H A;  2CA8 A;  1JZW A;  2HRA A;  1E6B A;  4L0W A;  4TR1 B;  1JFU A;  3E9J B;  3FYG A;  4NV2 A;  5ECK B;  4I8B A;  2G0F A;  4XS4 A;  2KP1 A;  4X4J A;  2QKE A;  1FG4 A;  3UEM A;  4GSN A;  3GTU B;  3QDN A;  2GSR A;  1SYX A;  1SKS B;  1T3B A;  1TRS A;  2M80 A;  4TOP A;  18GS A;  3PR8 A;  4TXO B;  2N5B A;  2K6V A;  2ZNM A;  1T4Z A;  3HKR A;  4YQV A;  2AHE A;  2VL3 A;  2FLS A;  3G7I A;  3IV4 A;  5G1K A;  4HQZ A;  1X9W B;  4FIW A;  3E3E A;  1NHO A;  5A4U A;  1PX7 A;  3WGX A;  1EOG A;  1K0O A;  1TDI A;  3HJP A;  2F8F A;  1K0B A;  4G19 A;  3PH9 A;  1EZK A;  4ZL8 A;  3QOU A;  1Z6N A;  3A5W A;  6GSY A;  2R3X A;  3RBT A;  3F4R A;  5HFG A;  1A2M A;  4IP1 A;  4PNG A;  4H86 A;  5L71 A;  2DJK A;  2I81 A;  1HNB A;  1WP0 A;  2MYG A;  2V2G A;  1K3Y A;  4BVY B;  3CSJ A;  5J5N A;  2L57 A;  1R26 A;  4AJ6 A;  4I2T A;  1X9M B;  3KTL A;  1XPV A;  1Q4J A;  4EDY A;  4KF9 A;  4JBB A;  3I69 A;  3KZQ A;  4ECI A;  3U5R E;  1O6J A;  1U88 A;  1YDK A;  3TKS A;  1GL8 A;  3SWL A;  3IXR A;  3DWV A;  3F9U A;  1JZR A;  5HR3 A;  1AUC A;  4OFT A;  2VO4 A;  3WGE A;  3MNG A;  5KEJ A;  2REM A;  1E2Y A;  5IO2 A;  4N10 A;  3L9U A;  2YV7 A;  2C0E A;  1ZYN A;  3ZIV A;  4TN8 A;  1U87 A;  5G30 A;  1GTB A;  2I9H A;  1TXX A;  2NVL A;  5EVO A;  3J7Y b;  4IBP A;  5D73 A;  2MMZ A;  1TK0 B;  1GLQ A;  4RI6 A;  2L4Q A;  2RUE A;  1ERW A;  2XBQ A;  3GNJ A;  2FWH A;  4OMV A;  1UA5 A;  2I3Y A;  2DJJ A;  1AC1 A;  1GTI A;  3H8Q A;  1SL1 B;  3US3 A;  1B48 A;  3VUR A;  3VK9 A;  4WEY A;  4Z7X A;  4ZXG A;  4KB3 A;  5A5K A;  4MJE A;  3LW9 A;  4MDC A;  2H30 A;  5HFK A;  2HE3 A;  2LKU A;  3FZ4 A;  2B5E A;  3HVX A;  4I6X A;  3ZRE A;  1XVQ A;  1BED A;  3QAW A;  4KSM A;  2VCT A;  1GSQ A;  3KCM A;  1JLV A;  4E8E A;  2O89 A;  2CZ2 A;  4QQ7 A;  1FW1 A;  1SKR B;  1HQO A;  3APQ A;  1BYE A;  5A4W A;  3GX0 A;  5JWO B;  4TW5 A;  1K0M A;  1G6W A;  4KE3 A;  5EY6 A;  2VL9 A;  4BA7 A;  4CY6 A;  5LCZ A;  2C0F A;  2C8U A;  3CTF A;  3IC4 A;  2LJK A;  3FZA A;  3TGZ A;  3DXB A;  1K0A A;  1XFL A;  3H1N A;  1GLP A;  3W8S A;  2YJH A;  1PQN A;  1T4Y A;  4LA1 A;  3APS A;  2VLT A;  3ED3 A;  4NXI A;  4FH8 A;  2C0D A;  4Q5Q A;  4N0V A;  3ERF A;  2LRT A;  5J4U A;  2XPE A;  1I5G A;  2IL3 A;  2KUC A;  3JCM L;  3TOT A;  5HQP A;  4TVE A;  4WR4 A;  1VF4 A;  2DML A;  2X8C A;  6GST A;  2H0G A;  3A2V A;  1SYR A;  1SL2 B;  5G5E A;  11GS A;  1XWG A;  2LRN A;  1M2B A;  3TKR A;  4IS0 A;  3VFI A;  4WBJ A;  1ILO A;  1OC9 B;  4O5Q A;  2F8A A;  2GSS A;  1H75 A;  1YKC A;  3ERG A;  2IMK A;  5D93 A;  4CDO A;  3E0U A;  1TRU A;  4MJB A;  4X43 A;  1F3B A;  5IMA A;  1ML6 A;  1EOH A;  4IVF A;  4RQX A;  4K7N A;  3GRX A;  4ECC A;  3WT2 A;  19GS A;  1CQG A;  1PGT A;  2QGV A;  1USB A;  2QSI A;  2WRT A;  3TJF A;  1DBY A;  5ECP B;  3CXG A;  3ZLP A;  5BRT A;  3GKN A;  4FYC A;  2GDR A;  5D9T A;  2VCQ A;  2LUS A;  3RPN A;  2H19 A;  3EMX A;  2C3Q A;  2OE3 A;  1PD2 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...