3HZ8A

Crystal structure of the oxidized t176v dsba1 mutant
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
192
structure length
192
Chain Sequence
PAGLVEGQNYTVLANPIPQQQAGKVEVLEFFGYFCPHCAHLEPVLSKHAKSFKDDMYLRTEHVVWQKEMLTLARLAAAVDMAAADSKDVANSHIFDAMVNQKIKLQNPEVLKKWLGEQTAFDGKKVLAAYESPESQARADKMQELTETFQIDGVPTVIVGGKYKVEFADWESGMNTIDLLADKVREEQKAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Biochemical and structural study of the homologues of the thiol-disulfide oxidoreductase DsbA in Neisseria meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis mc58
total genus 70
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hz8A00
2E7PA 4MP4A 4YH2A 2O85A 4EC0A 3G7YA 5DQYA 2C80A 1AC1A 5DAKB 4V1Ag 5DCGA 2EC4A 5JWOB 5CRHA 2V6OA 1PX6A 3IBHA 2CX4A 2LNTA 4MLYA 1TRVA 4V2MA 4AF2A 3C71A 3F63A 3QAGA 2CVBA 4XS4B 3QAWA 4MH2A 1JLWA 4FO5A 2DC5A 4ID0A 5CYYA 9GSSA 2IMEA 3TOUA 1K0OA 2C3TA 3PH9A 3O76A 1V40A 4JRRA 4FYUA 1VRSD 1TI1A 4MABA 4NXIA 1ERWA 3MWHA 1SU9A 1SJZA 2FLSA 4XIHA 4EE0A 1OKDA 4IJIA 2XBIA 2JU5A 3BJ5A 2G0FA 2KHPA 1B48A 1M2BA 1B4QA 1DE1A 5IIZA 5AIVA 3M9KA 4MA9A 3ZITA 4GWRA 3FRCA 4JR6A 3KZQA 1XCCA 4MJEA 2N5FA 1KNGA 4TVEA 3ME7A 4O92A 2MZCA 3K8NA 2GDRA 2LNSA 3ED3A 3FW2A 4FYBA 4HOJA 18GSA 2N5BA 1FHEA 3P90A 2V6KA 5A5KA 4NV5A 1T4YA 1URMA 2LEGA 3LFLA 4MZCA 2K9FA 3I43A 4J57E 3TRPA 5JWRB 3ZYWA 4FYCA 2HRNA 3L9SA 1O8XA 5LCZA 2V41A 1B9XC 2O89A 4CW9A 3VPTA 1HNCA 5IQYA 1ILOA 3IDVA 3D5JA 1EEMA 3GMFA 3FKFA 2PVQA 3EMPA 4BPYA 1XVWA 1TU7A 2IL3A 4K7IA 4G19A 3P2AA 2FCHA 1X9WB 1TTZA 2F9SA 3GX0A 4L5OA 4IJ3A 2K8SA 3QFAC 1UA5A 3HVXA 5IMAA 2DJ0A 3D0ZA 1WPIA 1YQ1A 5B8BA 1GTUA 5HR0A 2IFQB 3IC4A 2YNXA 1WOUA 2OA7A 3TB2A 2LQOA 3CBUA 1CQHA 3G7JA 2MBTA 3J7Yb 5ECPB 2LSTA 1Z6NA 3WGXA 1MEKA 1SKWB 1V98A 4ZIJA 2REMA 1GULA 1Q4JA 5CRGA 3VURA 3S9FA 3RPNA 1DUGA 3UBKA 1B9YC 1U6TA 3FZAA 1PX7A 2DMMA 1ZOFA 4OWYA 1PSQA 1GSQA 2GGTA 1THXA 3GTUB 1TXXA 4AJ6A 1O6JA 3CMIA 1HYUA 6GSUA 4LA1A 5CO3A 2YPMA 4N0ZA 6GSVA 4G9HA 3M8NA 4EDYA 1XWAA 2KOKA 3IAS2 5DJLA 2MYGA 2ZNMA 3L9VA 4K1FA 4LL1B 3TJJA 2H70A 3FR9A 4KA0A 5B7CA 3UIWA 3ZLPA 1Z3EA 2VL3A 5G5EA 1QFNA 4LLRA 4DSSA 2M80A 4MF5A 1Z7PA 1K0NA 4HJ2A 3I6AA 3VWXA 5A4WA 4WKWA 1GUKA 1YZXA 3TRQA 5HFKA 3DMLA 2VCVA 5KN1A 1U88A 3KP8A 2XPDA 3DD3A 1YY7A 2VOCA 2YWNA 4YQMA 2CX3A 2GT5A 3LSZA 3TJBA 1WP0A 5G1KA 3UJ1A 3MAKA 1GLQA 4I5QA 4POLA 2VLVA 3GSSA 2WGRA 4NPBA 2VM2A 2NDOA 1WWJA 2NPBA 1WRYA 4I8BA 4Q5FA 3TGZA 1UC7A 5DDLA 1GLPA 4K8MA 3KMOA 3GUSA 4NAXA 2DJ3A 3ZIVA 1XW5A 1VF3A 2C0EA 1FAAA 3U5RE 2LQQA 4WBRD 1WE0A 2VCQA 3DXBA 5J3RA 1K0MA 4D73B 10GSA 1V9WA 1C72A 3IPZA 2CAQA 1TRWA 3LYPA 2BMXA 4L0UA 3WD6A 3PINA 2DLXA 4J2FA 2FWHA 2PVOC 4TOPA 1FOVA 2O8VB 3DRNA 1G0TA 4ZBBA 2XHFA 1TI3A 2VL2C 5JWQB 4F2IA 3GH6A 4MH3A 3TJKA 3EMXA 2RIIA 3IV4A 3EC3A 1Y6EA 5IMCA 3Q74A 2WJUA 3EVIA 5JCUA 4HUAA 3GL5A 4WBJA 4BWQA 5CRDA 1U3IA 3QDNA 3RAZA 1LU4A 5GSSA 2IJYA 2X8HA 1OC8A 1MDIA 2XC2A 3GN3A 1HD2A 2J9HA 2F8AA 4EUYA 1T4ZA 5ECNB 2PWJA 2PMTA 6GSWA 2PU9C 5GAND 3CSJA 4EKZA 1EP8A 3W8JA 5J4UA 3HZ4A 1W89A 1XWCA 1B4PA 2GSQA 2X8GA 5FWGA 1S3DA 3TKPA 3W6GA 4ZL8A 2I1UA 5B8AA 4MCUA 6GSTA 3M0FA 2FA8A 2JZRA 5D9VA 3VI7A 5F05A 5D73A 1F3AA 1XW9A 1A0RP 2YOIA 2K18A 1DE2A 4K7OA 1U3AA 2GQMA 4Q5NA 3LYKA 1JFUA 2GQKA 4JEDA 3ZVJD 5ID2A 3APOA 16GSA 2JSZA 4ECCA 3BBYA 3GHAA 2QC7A 2H6XA 2FUG2 4K2DA 1R7HA 4IVFA 4EF0A 3F3QA 1OAZA 2H76A 4O7HA 1X5EA 4YQVA 3GRXA 2I81A 2KP1A 5H5RA 1AQWA 1PD21 3FK8A 1PL2A 4YAVA 2H01A 1GRXA 5DJMA 1FB0A 4OCFA 1MDKA 3HZ8A 4EL1A 4IQ1A 3DWVA 1PGTA 1JZRA 3ZMLA 2F51A 1T7PB 2MMOA 3KTBA 4ACSA 2EIRA 5H5QA 1GSYA 1ERTA 3QFBC 2E2GA 2DIYA 2P31A 1PN9A 5GAPD 1BAYA 2L5OA 3Q6OA 1AUCA 1GL8A 5HR1A 2B7JA 2GLRA 4I6XA 1V57A 4TR1A 3GNJA 1ZL9A 2HT9A 3D4MA 1O7UA 3GKKA 4E8EA 3C73A 3E3EA 1PKZA 1H75A 2CZ3A 3M3MA 1K0BA 4K9ZA 4LMVA 2OADA 1BEDA 3CRTA 4MJAA 4K6XA 1ZMAA 3UVHA 3KCMA 4HQZA 1Z7RA 3D6IA 6GSYA 1X9MB 4KE3A 5LNKe 3EU4A 3ERWA 2VAFA 2YCDA 4LL4B 3KP9A 4XTSA 1SL0B 1FB6A 4EVMA 2A2SA 3TKRA 3F3RA 2IMKA 2C4JA 3HXSA 2E2MA 3KGKA 3AY8A 2H1GA 3UEMA 5F06A 1K0AA 5ENUA 4POBA 1M7TA 1TK5B 4QQ7A 2GSRA 3H4KA 1TU8A 2GSSA 3ME8A 4PURA 4ZB9A 3CSHA 5COHA 2OJLA 1U87A 5A4UA 1K0DA 3PR8A 2LJAA 5ECMB 3LXTA 3GL3A 4JR4A 2AJQB 3HDCA 1TK0B 4O32A 4HI7A 1OE7A 1YKAA 1XZOA 2P5RA 1I9DA 4IHUA 3GKNA 2VD0A 1Q98A 1IYIA 1O81A 5C00A 3BCIA 3ZL5A 1TP9A 2L4QA 2WRTA 4OCEA 5J9BA 4F03A 3QMXA 2OE0A 4ZL7A 2VCXA 5D8IA 2C3NA 4HQSA 3J7Yk 4KX4A 2OACA 3EU3A 2GS3A 2H1BA 2OE1A 2LTKA 1OC9A 3FY7A 2ON5A 2OBKA 4HDEA 1FVJA 2R5GA 4IN0A 3RPPA 2HZEA 1GSEA 1AQXA 5B6NA 1JLVA 1G6YA 2B5EA 4IW9A 3N5OA 1XXUA 1F9MA 2MMAA 4OO4A 5ECHB 4GTUA 3LORA 4ZB8A 3P8WA 2LS5A 5IO0A 3ZVJA 3UARA 4HJMA 5KN3A 2V32A 2FWGA 2YV9A 2L5LA 2R4VA 4Q5RA 1E2YA 3KTLA 3LXZA 4YAPA 4JBBA 1Z9HA 2CAIA 4IP1A 1YJ6A 2GVPA 2KP2A 1QUWA 4X0XA 1BYEA 1V58A 3ZIJA 4TR4A 3HVVA 4QL7A 3G7IA 1A0FA 1SENA 2P5QA 3QR6A 3I9V2 2GT6A 1TRUA 3DVXA 4RUVA 3H79A 4XS1A 2LRNA 2N5AA 1NW2A 3F6FA 3VK9A 3KMNA 1A2MA 3DEXA 3H1NA 4P3YB 5LD0A 1ML6A 1SK2A 5FT3A 5EL8A 4BA7A 5DCHA 4BVXA 2WCIA 2CA8A 5D9WA 5ECKB 5G2ZA 2HNLA 4JE1A 1FG4A 1THOA 2FD3A 3C8EA 1SD8A 4PX1A 2JSYA 4PNGA 4DEJA 3UMAA 1XOAA 1VF1A 2R3XA 5D93A 2VCZA 3ZREA 1N2AA 2I4AA 1KEBA 4MMMA 4IELA 5DAKA 2R2JA 3F0IA 3FEUA 5INYA 2JADA 1WMJA 2X64A 4MDCA 2VIMA 4GQFA 2VCWA 3DIEA 2E0QA 1O73A 3GURA 2TIRA 1TW9A 4XS4A 4F82A 4MJBA 1N8JA 3LG6A 2B3SA 3BOAA 5AN1A 2H30A 1UVZA 1T1VA 2H19A 4GSTA 2FHEA 1NSWA 5G30A 3KD0A 5F07A 2NVLA 4OMVA 3TJFA 1SYRA 4KSOA 4I2UA 4BWSA 5G5FA 3VWUA 1SL1B 4NMUA 2YWIA 3GKMA 1M9AA 3KM6A 1PA3A 2LRTA 4LMWA 2WB9A 2F3MA 2AHEA 3TDGA 3UAPA 8GSSA 4KB3A 1SJ6A 3NOFA 3IA1A 4I97A 2GQLA 4F0CA 1USBA 3IK9A 2LJKA 1OE8A 3NZNA 2VL2A 1FVKA 2CQ9A 3E9JB 2BTOT 3CRUA 1JZWA 1YEPA 5CP1A 5JCGA 4JZQA 5KN2A 2LKUA 1GTAA 3EE2A 1RK4A 1TKDB 1ZZYA 2YN1A 3E0UA 4KW6A 5AGYA 3FHKA 4ECBA 2EIQA 1F6MC 4PGTA 4IS0A 3O3TA 4MZWA 3MDKA 2ES7A 1Z6MA 3SWLA 5EVOA 2JZSA 2YJHA 1W4VA 3P7XA 2H6YA 4N11A 1PQNA 2WFCA 2YZHA 1RQMA 2GZYA 2D2ZA 3KH9A 4WF5A 1YEXA 1ERVA 1G7OA 2H75A 4V2NA 2VD1A 1T3BA 4OFMA 3CSIA 2ZUPA 1GNEA 1M99A 1DSBA 1GTBA 2HI7A 4KDXA 2PERA 2RLIA 3W8SA 4N10A 3IOSA 1K3OA 2C0GA 3ERFA 4L0WA 1QMVA 4F9ZA 5AISA 2CVKA 2VO4A 4WR4A 2K8VA 2HZFA 4XRAA 3GV1A 5IOWA 3D21A 3EINA 3HCZA 1WIKA 1EWXA 4PQ1A 4OFTA 1X0RA 1XWGA 5J9CA 4DSRA 1XPVA 4TR0A 2C8UA 2TRCP 1A8LA 2HZEB 2F8FA 1OKTA 2P0GA 3HY2A 2B1KA 4H86A 1XW6A 3HYPA 1GSSA 4PXOA 5IPHA 3F4RA 3HA9A 1ZYQB 3GKXA 4WEYA 4NHWA 2YZUA 3HJMA 1SL2B 1R5PA 2HSHA 4POMA 2Z9SA 3QD9A 3M9JA 2HFDA 2KLXA 4KCEA 4GLTA 3WT1A 5KEJA 1FW1A 2YWMA 3IK7A 4IQAA 2GSTA 4JU5A 4NV2A 1ZCPA 3RHBA 3V1WA 3MNGA 4K0GA 3IHQA 1NM3A 1LBKA 4GRFA 4ZB6A 1BQ7A 4MJCA 4DSQA 3HD5A 4OO5A 3UVTA 2MMNA 2AAWA 14GSA 4FIWA 2RM6A 4HS1A 2DJ2A 3QPMA 5G1LA 2AV4A 2C1YA 5A4VA 1GTIA 3TKSC 1X9SB 4X1UA 3I69A 1QGVA 3VI5A 2B5XA 3DYRA 3ZMKA 1Z5YE 2IPAA 2IMDA 3U6VA 2H66A 4MZBA 4V1Ap 1OC3A 3KEBA 3L78A 5CREA 2EIOA 5HR2A 3WGDA 1DBYA 2VCTA 20GSA 2R37A 2R6KA 4XCSA 4ECJA 1F37A 2PPTA 3FR6A 4FH8A 5HR3A 1A2LA 2WULA 1O85A 3VWVA 3ZFLA 5EPFA 3LQ7A 2FY6A 3FZ4A 2YP6A 5IM9A 1I5GA 3F8UA 2WS2A 1X5CA 3N9JA 4DSSB 3UL3A 3HJOA 1JZOA 3L4NA 2XBQA 4KDYA 5IPGA 1G6WA 4WXTA 2FWEA 4GSSA 4NHZA 4ML6A 19GSA 3US3A 4IKHA 2B5YA 3A2WA 2PBJA 3F6DA 1J9BA 3C7MA 3TRXA 3HKRA 1T00A 3NIVA 3KXOA 1F3BA 3L0HA 3QCPA 3HHVA 3GH9A 2DMLA 4XRDA 1PRXA 2AYTA 4KNDA 2LUSA 4IGJA 3WT2A 2M72A 4D73A 3GSTA 3QAVA 2VL9A 4E8HA 2I3YA 4PUAA 1J0FA 1YF0A 5AIXA 2JACA 3ISOA 1T8EB 5J5NA 5ECQB 2LRCA 4K7NA 1VF2A 1OYJA 4XS6A 1NHOA 5L71A 5EY6A 1E6BA 4IBPA 2H0HA 2C0FA 2PN8A 1SD9A 2WDUA 4GXZA 5GZZB 2FGXA 4OD7A 3F9UA 3H8QA 4KAEA 5J41A 1ZYEA 1AW9A 1KTEA 2DIZA 2HYXA 3IE3A 2IIYA 2RM5A 5G31A 4HZ4A 1SK0A 1O8WA 3EYTA 2H0GA 1KBNA 4F0BA 4NWYA 2H0IA 2XPEA 2OKAA 4ZBDA 5D9TA 2G2QA 4TN8A 4PQHA 4ZILA 2H6ZA 2GZZA 4XHMA 3FR3A 2X8CA 5ABRA 3G9BA 3UBLA 1ABAA 1JZDA 2YWOA 2MMZA 5HQPA 4KSMA 5F8BA 4N0VA 3LEFA 4EDZA 4O5RA 2B7KA 2OBIA 2H8LA 1J08A 3OR5A 5DVBA 4EXJA 3R2QA 4GF0A 1TJDA 2RUFA 3H93A 5D9XA 2FWFA 3CYNA 13GSA 4TXOA 4QL9A 3VFIA 4KUNA 5ECIB 1GNWA 5IMFA 5GSTA 3FZ5A 4GSNA 4X43A 3GFKA 2IMFA 1GUMA 5E59A 5FHIA 3A3TA 5DALA 2LV3A 2H1AA 2IMIA 4TR3A 3TKQA 1H4OA 4KDUA 2DJ1A 1QQ2A 1XBSA 4WF4A 5CRWA 2NBSA 1XOBA 4J56E 3LJRA 1MTCA 3PGTA 3F4TA 1TRSA 5ELAA 5IO2A 5ID2B 2NTOA 3HVSA 4BVYA 2H73A 4MK3A 1GUHA 2JZTA 1PL1A 1XVQA 1IYHA 1M2DA 3C1RA 3FYGA 1ACVA 3M1GA 2CT6A 3GX8A 3IXRA 3BD2A 4AJ7A 3APQA 4I2TA 5IMDA 3KH7A 3TCOA 3IRAA 2PGTA 1TK8B 11GSA 3TKSE 3VLNA 1XFLA 1QK8A 2HSYA 2L6DA 4K0NA 2L4CA 5B6MA 3MSZA 1YDKA 3Q18A 2K6VA 4RQXA 1K3LA 3JCML 1OVNA 2BJXA 1K3YA 4TW5A 2H72A 3L9UA 1R26A 2ALBA 5C04A 2YANA 4HZ2A 1A2JA 1PMTA 1EGRA 1YF1A 1K0CA 2JL4A 3HJPA 1M0UA 1RW1A 3TOTA 5ELGA 5IMZA 4Z7XA 4TR1B 4L5LA 4RI7A 3FZ9A 1XWKA 1XWBA 4KCAA 1S3CA 1TOFA 1GSDA 1ON4A 2PUKC 5ECRB 4MPFA 2CZ2A 3A2XA 4ULXA 3WGEA 5ECLB 2RUEA 2MBSA 3D22A 5F0GA 3RBTA 2WZ9A 5HFGA 4ECIA 4RQRA 2B6MA 1BG5A 1EEJA 5H5SA 5DQSA 2X99A 3ERGA 3IAM2 4N30A 1X5DA 5CNWA 1EZKA 1V2AA 4KH7A 6GSXA 1GSUA 4L8EA 1UN2A 1BJXA 3TUEA 4RI6A 3LWAA 5KN0A 5ECOB 1ST9A 4AJ8A 3GYKA 2YV7A 3ZRDA 2QGVA 4PUFC 2VLUA 2IN3A 1A24A 3GIXA 2HXKA 2H1DA 2HLSA 4AGSA 1TDIA 1SJIA 4BL7A 2IWTA 2KUCA 4ZXGA 22GSA 4GCIA 2ON7A 3RDWA 3A5WA 3QOUA 4G2EA 3SBCA 4PNFA 4ML1A 1GP1A 2L59A 3F4SA 2HRFA 3A2VA 3D4TA 4PQIA 1A8YA 3UOMA 4WR5A 4EO3A 1A23A 3LGCA 1B8XA 2AUVA 4HU7A 2QSIA 2GZPA 3VPQA 1BX9A 2L6CA 4ISDA 2M46A 2AB6A 1SKSB 4TXVA 1AAZA 1YKCA 5CAXA 1EV9A 3KIJA 1Y25A 6GSSA 3ZFBA 3VWWA 2DBCA 1HNAA 1G7EA 2V1MA 4ZL9A 3DVWA 1VGLA 2VLTA 4DVCA 2FNOA 2CV4A 1NHYA 17GSA 1MD3A 2OE3A 4GQCA 1S3AA 1CQGA 5IOXA 2QKEA 3CXGA 1OC9B 2LJRA 5ECSA 2ZCTA 4HEA2 5D96A 3GA4A 3IR4A 5E4WA 2IFQA 2J23A 1SYXA 1EGOA 2H74A 1GSFA 3EURA 4POKA 3CTFA 2VM1A 1GH2A 1GWCA 3ZTLA 4HU9A 2HE3A 4TRXA 4IP6A 1WJKA 4TXOB 3TJGA 4ZBAA 7GSSA 12GSA 1FO5A 2FA4A 4MF7A 2O7KA 1MDJA 2CVDA 5DALB 1R4WA 3DGQA 1MD4A 1JHBA 1M2AA 2GTUA 3CTGA 2DJJA 1XIYA 2VUPA 3O6TA 1HQOA 3EWLA 3BCKA 1ERUA 3TKSA 2DSAA 3C1SA 1AXDA 1SK1A 1AIUA 4KGIA 1AQVA 4G10A 2B1LA 3GTUA 4YQUA 1QXHA 1LJRA 4OFNA 1EOHA 2H71A 1M9BA 2DJKA 3APSA 3Q19A 2L57A 2O87A 1PKWA 4CDOA 2A4VA 2YJ7A 4MPGA 1R5AA 3RHCA 5DBQA 1F2EA 2C0DA 2A2RA 2V2GA 3ZZXA 1EP7A 4TKYA 2TRXA 1VF4A 3DKSA 3KJYA 5JCWA 4MF6A 3WYWA 1EV4A 4CHSA 2I9HA 4WETA 1HNBA 4V2LA 5HFIA 1ZGNA 4Q5QA 1EOGA 4ILFA 5IMVA 2C3QA 1SKRB
chains in the Genus database with same CATH superfamily
2E7PA 4MP4A 4YH2A 4O5QA 2O85A 4EC0A 3G7YA 5DQYA 2C80A 1AC1A 5BRTA 5DAKB 4V1Ag 5DCGA 2EC4A 5JWOB 5CRHA 2V6OA 1PX6A 3IBHA 2CX4A 2LNTA 4MLYA 1XG8A 1TRVA 4V2MA 4AF2A 3C71A 3F63A 3QAGA 2CVBA 4XS4B 3QAWA 4MH2A 1JLWA 4FO5A 2DC5A 4X4JA 4ID0A 5CYYA 9GSSA 2IMEA 3TOUA 1K0OA 2C3TA 3PH9A 3O76A 1V40A 4JRRA 4FYUA 1VRSD 1TI1A 4MABA 4NXIA 1ERWA 3MWHA 1SU9A 4HSCX 1SJZA 2FLSA 4XIHA 4EE0A 1OKDA 4IJIA 2XBIA 2JU5A 3BJ5A 2G0FA 2KHPA 1B48A 1M2BA 1B4QA 1DE1A 5IIZA 5AIVA 3M9KA 4MA9A 3ZITA 4GWRA 3FRCA 4JR6A 3KZQA 1XCCA 4MJEA 2N5FA 1KNGA 4TVEA 3ME7A 4O92A 2MZCA 3K8NA 2GDRA 2LNSA 3ED3A 3FW2A 4FYBA 4HOJA 18GSA 2N5BA 1FHEA 3P90A 2V6KA 5A5KA 4NV5A 1T4YA 1URMA 2LEGA 3LFLA 4MZCA 2K9FA 3I43A 4J57E 3TRPA 5JWRB 4K5SA 3ZYWA 4FYCA 2HRNA 3L9SA 1O8XA 5LCZA 2V41A 1B9XC 2O89A 4CW9A 3VPTA 1HNCA 5IQYA 1ILOA 3IDVA 3D5JA 1EEMA 3GMFA 3FKFA 2PVQA 4Z2RA 3EMPA 4BPYA 1XVWA 1TU7A 2IL3A 4K7IA 4G19A 3P2AA 2FCHA 1X9WB 1TTZA 2F9SA 3GX0A 4L5OA 4CY6A 4IJ3A 2K8SA 3QFAC 2X49A 1UA5A 3HVXA 5IMAA 2DJ0A 3D0ZA 1WPIA 1YQ1A 5B8BA 1GTUA 5HR0A 2IFQB 3IC4A 2YNXA 1WOUA 2OA7A 3TB2A 2LQOA 3CBUA 1CQHA 3G7JA 2MBTA 3J7Yb 5ECPB 2LSTA 1Z6NA 3WGXA 1MEKA 1SKWB 1V98A 4ZIJA 2REMA 1FOHA 1GULA 1Q4JA 5CRGA 3VURA 3S9FA 3RPNA 1DUGA 3UBKA 4ICYA 1B9YC 2A4HA 1U6TA 3FZAA 1PX7A 2DMMA 1ZOFA 4OWYA 1PSQA 1GSQA 2GGTA 1THXA 3GTUB 1TXXA 4AJ6A 1O6JA 3CMIA 1HYUA 6GSUA 4LA1A 5CO3A 2YPMA 4N0ZA 6GSVA 4G9HA 3M8NA 4EDYA 1XWAA 2KOKA 3IAS2 5DJLA 2MYGA 2ZNMA 3L9VA 4K1FA 4LL1B 3TJJA 2H70A 3FR9A 4KA0A 5B7CA 3UIWA 3ZLPA 1Z3EA 2VL3A 5G5EA 1QFNA 4LLRA 4DSSA 2M80A 4MF5A 1Z7PA 1K0NA 4HJ2A 3I6AA 3VWXA 5A4WA 4WKWA 1GUKA 1YZXA 3TRQA 5HFKA 3MIXA 3DMLA 2VCVA 5KN1A 1U88A 5KOXA 3KP8A 2XPDA 3DD3A 1YY7A 2VOCA 2YWNA 4YQMA 2CX3A 2GT5A 3LSZA 3TJBA 1WP0A 5G1KA 1ZYNA 3UJ1A 3MAKA 1GLQA 4I5QA 4POLA 2VLVA 3GSSA 2WGRA 4NPBA 2VM2A 2NDOA 1WWJA 2NPBA 1WRYA 4I8BA 4Q5FA 3TGZA 1UC7A 5DDLA 1GLPA 4K8MA 3KMOA 3GUSA 4NAXA 2DJ3A 3ZIVA 1XW5A 1VF3A 2C0EA 1FAAA 3U5RE 4G0LA 2LQQA 4WBRD 1WE0A 2VCQA 3DXBA 5J3RA 1K0MA 4D73B 10GSA 1V9WA 1C72A 3IPZA 2CAQA 1TRWA 3LYPA 2BMXA 4L0UA 3WD6A 3PINA 2DLXA 4J2FA 2FWHA 2PVOC 4TOPA 1FOVA 2O8VB 3DRNA 1G0TA 4ZBBA 2XHFA 1TI3A 4K5RA 2VL2C 5JWQB 4F2IA 3GH6A 4MH3A 3TJKA 2DKHA 3EMXA 2RIIA 3IV4A 3EC3A 1Y6EA 5IMCA 3Q74A 2WJUA 3EVIA 5JCUA 4HUAA 3GL5A 4WBJA 4BWQA 5KOWA 5CRDA 1U3IA 3QDNA 3RAZA 1LU4A 2QA1A 5GSSA 2IJYA 2X8HA 1OC8A 1MDIA 2XC2A 3GN3A 1HD2A 2J9HA 2F8AA 4EUYA 1T4ZA 5ECNB 2PWJA 2PMTA 6GSWA 2PU9C 5GAND 3CSJA 4EKZA 1EP8A 3W8JA 5J4UA 3HZ4A 1W89A 1XWCA 1B4PA 2GSQA 2X8GA 2HRAA 5FWGA 1S3DA 3TKPA 3W6GA 4ZL8A 2I1UA 5B8AA 4MCUA 6GSTA 3M0FA 2FA8A 2JZRA 5D9VA 3VI7A 5F05A 5D73A 1F3AA 1XW9A 1A0RP 2YOIA 2K18A 1DE2A 4K7OA 1U3AA 2GQMA 4CY8A 4Q5NA 3IC8A 3LYKA 1JFUA 2GQKA 4JEDA 3ZVJD 5ID2A 3APOA 16GSA 2JSZA 4ECCA 4BIKA 3BBYA 3GHAA 2QC7A 4G0KA 2H6XA 2FUG2 4K2DA 1R7HA 4IVFA 4EF0A 3F3QA 1OAZA 2H76A 4O7HA 1X5EA 4YQVA 3GRXA 2I81A 2KP1A 5H5RA 1AQWA 1PD21 3FK8A 1PL2A 4YAVA 2H01A 1GRXA 5DJMA 1FB0A 4OCFA 1MDKA 3HZ8A 4EL1A 4IQ1A 3DWVA 1PGTA 1JZRA 3ZMLA 2F51A 1T7PB 2MMOA 3KTBA 4ACSA 2EIRA 5H5QA 1GSYA 1ERTA 3QFBC 2E2GA 2DIYA 2P31A 1PN9A 5GAPD 1BAYA 2L5OA 3Q6OA 1AUCA 1GL8A 5HR1A 2B7JA 2R0PA 2GLRA 4I6XA 1V57A 4TR1A 3GNJA 1ZL9A 2HT9A 3D4MA 2HRKA 1O7UA 3GKKA 4E8EA 3C73A 3E3EA 1PKZA 1H75A 2CZ3A 3M3MA 1K0BA 4K9ZA 3LW9A 4LMVA 2OADA 1BEDA 3CRTA 4MJAA 4K6XA 4EIPA 1ZMAA 3UVHA 3KCMA 2X4AA 4HQZA 1Z7RA 3D6IA 6GSYA 1X9MB 4KE3A 5LNKe 3EU4A 3ERWA 4G0IA 2VAFA 2YCDA 4LL4B 3KP9A 4XTSA 1SL0B 1FB6A 4EVMA 2A2SA 3TKRA 3F3RA 2IMKA 2C4JA 3HXSA 2E2MA 4Z2UA 3KGKA 3AY8A 2H1GA 3UEMA 5F06A 1K0AA 5ENUA 4POBA 1M7TA 1TK5B 4QQ7A 2GSRA 3H4KA 1TU8A 2GSSA 3ME8A 4PURA 4ZB9A 3CSHA 5COHA 2OJLA 1U87A 5A4UA 1K0DA 3PR8A 2LJAA 5ECMB 3LXTA 3GL3A 4JR4A 2AJQB 3HDCA 1TK0B 4O32A 4HI7A 1OE7A 4BL7B 1YKAA 1XZOA 2P5RA 1I9DA 4IHUA 3GKNA 2VD0A 1Q98A 1IYIA 1O81A 5C00A 3BCIA 3ZL5A 1TP9A 2L4QA 2WRTA 4OCEA 5J9BA 4F03A 3QMXA 2OE0A 4ZL7A 2VCXA 5D8IA 2C3NA 4HQSA 3J7Yk 4KX4A 2OACA 3EU3A 2GS3A 2H1BA 2OE1A 2LTKA 1OC9A 3FY7A 2ON5A 2OBKA 4HDEA 1FVJA 2R5GA 4IN0A 3RPPA 2HZEA 1GSEA 1AQXA 5B6NA 1JLVA 1G6YA 2B5EA 1PFOA 4IW9A 3N5OA 1XXUA 1F9MA 2MMAA 4OO4A 5ECHB 4GTUA 3LORA 4ZB8A 3P8WA 2LS5A 5IO0A 3ZVJA 3UARA 4HJMA 5KN3A 2V32A 2FWGA 2YV9A 2L5LA 2R4VA 4Q5RA 1E2YA 1PN0A 3KTLA 3LXZA 4YAPA 4JBBA 1Z9HA 2CAIA 4IP1A 1YJ6A 2GVPA 2KP2A 1QUWA 4X0XA 1BYEA 1V58A 3ZIJA 4TR4A 3HVVA 4QL7A 3G7IA 1A0FA 1SENA 2P5QA 3QR6A 3I9V2 2GT6A 1S3RA 1TRUA 3DVXA 4RUVA 3H79A 4XS1A 2LRNA 2N5AA 1NW2A 3F6FA 3VK9A 3KMNA 1A2MA 3DEXA 3H1NA 4P3YB 5LD0A 1ML6A 1SK2A 5FT3A 5EL8A 4BA7A 5DCHA 4BVXA 2WCIA 2CA8A 5D9WA 5ECKB 5G2ZA 2HNLA 4JE1A 1FG4A 1THOA 2FD3A 3C8EA 1SD8A 4PX1A 2JSYA 4PNGA 4DEJA 3UMAA 1XOAA 1VF1A 2R3XA 5D93A 2VCZA 3ZREA 1N2AA 2I4AA 1KEBA 4MMMA 4IELA 5DAKA 2R2JA 3F0IA 3FEUA 5INYA 2JADA 1WMJA 2X64A 4MDCA 2VIMA 4FQUA 4GQFA 2VCWA 3DIEA 2E0QA 1O73A 3GURA 2TIRA 1TW9A 4XS4A 4F82A 4MJBA 1N8JA 3LG6A 2B3SA 3BOAA 5AN1A 2H30A 1UVZA 1T1VA 2H19A 4GSTA 2FHEA 1NSWA 5G30A 3KD0A 5F07A 2NVLA 4OMVA 3TJFA 1SYRA 4KSOA 4I2UA 4BWSA 5G5FA 3VWUA 1SL1B 4NMUA 2YWIA 3GKMA 1M9AA 3KM6A 1PA3A 2LRTA 4LMWA 2WB9A 2F3MA 2AHEA 3TDGA 3UAPA 8GSSA 4KB3A 1SJ6A 3NOFA 3IA1A 4I97A 2GQLA 4F0CA 1USBA 4EIQA 3IK9A 2LJKA 1OE8A 3NZNA 2VL2A 1FVKA 2CQ9A 3E9JB 2BTOT 3CRUA 1JZWA 1YEPA 5CP1A 5JCGA 4JZQA 5KN2A 2LKUA 1GTAA 3EE2A 2QA2A 1RK4A 1TKDB 1ZZYA 2YN1A 3E0UA 4KW6A 5AGYA 3FHKA 4ECBA 2EIQA 4K2XA 1F6MC 4PGTA 4IS0A 3O3TA 4MZWA 3MDKA 2ES7A 1Z6MA 3SWLA 5EVOA 2JZSA 2YJHA 1W4VA 3P7XA 2H6YA 4N11A 1PQNA 2WFCA 3FMWA 2YZHA 1RQMA 2GZYA 2D2ZA 1ZYPA 3KH9A 4WF5A 1YEXA 1ERVA 1G7OA 2H75A 4V2NA 2VD1A 1T3BA 4OFMA 3CSIA 2ZUPA 1GNEA 1M99A 1DSBA 1GTBA 2HI7A 4KDXA 2PERA 3MYDA 2RLIA 3W8SA 4N10A 3IOSA 1K3OA 2C0GA 3ERFA 4L0WA 1QMVA 4F9ZA 5AISA 2CVKA 2VO4A 4WR4A 2K8VA 2HZFA 4XRAA 3GV1A 5IOWA 3D21A 3EINA 3HCZA 1WIKA 1EWXA 4PQ1A 4OFTA 1X0RA 1XWGA 5J9CA 4DSRA 1XPVA 4TR0A 2C8UA 2TRCP 1A8LA 2HZEB 2F8FA 1OKTA 2P0GA 3HY2A 2B1KA 4YKFA 4H86A 1XW6A 3HYPA 1GSSA 4PXOA 5IPHA 3PPUA 3F4RA 2HSMA 3HA9A 1ZYQB 3GKXA 4WEYA 4NHWA 2YZUA 3HJMA 1SL2B 1R5PA 2HSHA 4POMA 2Z9SA 3QD9A 3M9JA 2HFDA 2KLXA 4KCEA 4GLTA 3WT1A 5KEJA 1FW1A 2YWMA 3IK7A 4IQAA 2GSTA 4JU5A 4NV2A 1ZCPA 3RHBA 3V1WA 3MNGA 4K0GA 3IHQA 1NM3A 1LBKA 4GRFA 4ZB6A 1BQ7A 4MJCA 4DSQA 3HD5A 4OO5A 4PTSA 3UVTA 2MMNA 2AAWA 14GSA 4FIWA 2RM6A 4HS1A 2DJ2A 3QPMA 5G1LA 2AV4A 2C1YA 5A4VA 1GTIA 3TKSC 1X9SB 4X1UA 3I69A 1QGVA 3VI5A 2B5XA 3DYRA 3ZMKA 1Z5YE 2IPAA 2IMDA 3U6VA 2H66A 4MZBA 4V1Ap 1OC3A 3KEBA 3L78A 5CREA 2EIOA 5HR2A 3WGDA 1DBYA 2VCTA 20GSA 2R37A 2R6KA 4XCSA 4USSA 4ECJA 1F37A 2PPTA 3FR6A 4FH8A 5HR3A 1A2LA 2WULA 1O85A 3VWVA 3ZFLA 5EPFA 3LQ7A 2FY6A 3FZ4A 2YP6A 5IM9A 1I5GA 3F8UA 2WS2A 1X5CA 3N9JA 4DSSB 3UL3A 3HJOA 1JZOA 3L4NA 2XBQA 4KDYA 5IPGA 1G6WA 4WXTA 2FWEA 4GSSA 4NHZA 4ML6A 19GSA 3US3A 3R3EA 4IKHA 2B5YA 3A2WA 2PBJA 3F6DA 1J9BA 3C7MA 3TRXA 3HKRA 1T00A 3NIVA 3KXOA 1F3BA 3L0HA 3QCPA 3HHVA 3GH9A 2DMLA 3CQFA 4XRDA 1PRXA 2AYTA 4KNDA 2LUSA 4IGJA 3WT2A 2M72A 4D73A 3GSTA 3QAVA 2VL9A 4E8HA 2I3YA 4PUAA 1J0FA 1YF0A 5AIXA 2JACA 3ISOA 3A5IA 1T8EB 5J5NA 5ECQB 2LRCA 4K7NA 1VF2A 1OYJA 4XS6A 1NHOA 5L71A 5EY6A 1E6BA 4IBPA 2H0HA 2C0FA 2PN8A 1SD9A 2WDUA 4GXZA 5GZZB 2FGXA 4OD7A 2A2PA 3F9UA 3H8QA 4KAEA 5J41A 1ZYEA 1AW9A 1KTEA 2DIZA 2HYXA 3IE3A 2IIYA 1M3JA 2RM5A 5G31A 4HZ4A 1SK0A 1O8WA 3EYTA 2H0GA 1KBNA 4F0BA 4NWYA 2H0IA 2XPEA 2OKAA 4ZBDA 5D9TA 2R0GA 2G2QA 4TN8A 4PQHA 4ZILA 2H6ZA 2GZZA 4XHMA 3FR3A 2X8CA 5ABRA 3G9BA 3UBLA 1ABAA 1JZDA 2YWOA 2MMZA 5HQPA 4KSMA 5F8BA 4N0VA 3LEFA 4EDZA 4O5RA 2B7KA 2OBIA 2H8LA 1J08A 3OR5A 5DVBA 4EXJA 3R2QA 4GF0A 1TJDA 2RUFA 4MNNA 3H93A 5D9XA 2FWFA 3CYNA 13GSA 4TXOA 4QL9A 3VFIA 4KUNA 5ECIB 1GNWA 5IMFA 5GSTA 3FZ5A 4GSNA 4X43A 3GFKA 2IMFA 1GUMA 5E59A 5FHIA 3A3TA 5DALA 2LV3A 2H1AA 2IMIA 4TR3A 3TKQA 3EPTA 1H4OA 4KDUA 2DJ1A 1QQ2A 1XBSA 4WF4A 5CRWA 2NBSA 1XOBA 4J56E 3LJRA 1MTCA 3PGTA 3F4TA 1TRSA 5ELAA 5IO2A 5ID2B 2NTOA 3HVSA 4BVYA 2H73A 4MK3A 3HVNA 1GUHA 2JZTA 1PL1A 1XVQA 1IYHA 1M2DA 3C1RA 3FYGA 1ACVA 3M1GA 2CT6A 3GX8A 3IXRA 3BD2A 4AJ7A 3APQA 4I2TA 5IMDA 3KH7A 3TCOA 3IRAA 2PGTA 1TK8B 11GSA 3TKSE 3VLNA 1XFLA 1QK8A 2HSYA 2L6DA 4K0NA 2L4CA 2R0CA 5B6MA 3MSZA 1YDKA 3Q18A 2K6VA 4RQXA 1K3LA 3JCML 1OVNA 2BJXA 1K3YA 4TW5A 2H72A 3L9UA 1R26A 2ALBA 5C04A 2YANA 4HZ2A 1A2JA 1PMTA 1EGRA 1YF1A 1K0CA 2JL4A 3HJPA 1M0UA 1RW1A 3TOTA 5ELGA 5IMZA 4Z7XA 4TR1B 4L5LA 4RI7A 3FZ9A 1XWKA 1XWBA 4KCAA 1S3CA 1TOFA 1GSDA 1ON4A 2PUKC 5ECRB 4MPFA 2CZ2A 3A2XA 4ULXA 3WGEA 5ECLB 2RUEA 2MBSA 3D22A 5F0GA 3RBTA 4KF9A 2WZ9A 5HFGA 4ECIA 4RQRA 2B6MA 1BG5A 1EEJA 5H5SA 5DQSA 2X99A 3ERGA 3IAM2 4N30A 1X5DA 5CNWA 1EZKA 1V2AA 4KH7A 6GSXA 1GSUA 4L8EA 1UN2A 4A5PA 1BJXA 3TUEA 4RI6A 3LWAA 5KN0A 5ECOB 1M3IA 1ST9A 4AJ8A 3GYKA 2YV7A 3ZRDA 2QGVA 4PUFC 2VLUA 4O5UA 2IN3A 1A24A 3GIXA 2HXKA 2H1DA 3IHGA 2HLSA 4AGSA 1TDIA 1SJIA 4BL7A 2IWTA 2KUCA 4ZXGA 22GSA 4GCIA 2ON7A 3RDWA 3A5WA 3QOUA 4G2EA 3SBCA 4PNFA 4ML1A 1GP1A 2L59A 3F4SA 2HRFA 3A2VA 3D4TA 4PQIA 1A8YA 3UOMA 4WR5A 4EO3A 1A23A 3LGCA 1B8XA 2AUVA 4HU7A 2QSIA 2GZPA 3VPQA 1BX9A 2L6CA 4ISDA 2M46A 2AB6A 1SKSB 4TXVA 1AAZA 1YKCA 5CAXA 1EV9A 3KIJA 1Y25A 6GSSA 3ZFBA 4Z2TA 3VWWA 2DBCA 1HNAA 1G7EA 2V1MA 4ZL9A 2UZ8A 3DVWA 1VGLA 2VLTA 4DVCA 2FNOA 2CV4A 1NHYA 17GSA 1MD3A 2OE3A 4GQCA 1S3AA 1CQGA 5IOXA 2QKEA 3CXGA 1OC9B 2LJRA 5ECSA 2DKIA 2ZCTA 4HEA2 5D96A 3GA4A 3IR4A 5E4WA 2IFQA 2J23A 1SYXA 1EGOA 2H74A 1GSFA 3EURA 4POKA 3CTFA 2VM1A 1GH2A 1GWCA 3ZTLA 4HU9A 2HE3A 4TRXA 4IP6A 1WJKA 4TXOB 3TJGA 4ZBAA 7GSSA 12GSA 1FO5A 2FA4A 4MF7A 2O7KA 1MDJA 2CVDA 5DALB 1R4WA 3DGQA 1MD4A 1JHBA 1M2AA 2GTUA 3CTGA 2DJJA 1XIYA 2VUPA 3O6TA 1HQOA 3EWLA 3BCKA 4YKGA 1ERUA 3TKSA 5BMUA 2DSAA 3C1SA 1AXDA 1SK1A 1AIUA 4KGIA 1AQVA 4G10A 2B1LA 3GTUA 4YQUA 1QXHA 1LJRA 4OFNA 1EOHA 4BVYB 2H71A 1M9BA 2DJKA 3APSA 3Q19A 2L57A 2O87A 1PKWA 4CDOA 2A4VA 2YJ7A 4MPGA 1R5AA 3RHCA 5DBQA 1F2EA 2C0DA 2A2RA 2V2GA 3ZZXA 1EP7A 4TKYA 2TRXA 1VF4A 3DKSA 3KJYA 5JCWA 4MF6A 4BVXB 3WYWA 1EV4A 4CHSA 2I9HA 4WETA 1HNBA 4V2LA 5HFIA 1ZGNA 4Q5QA 1EOGA 4ILFA 5IMVA 2C3QA 1SKRB
chains in the Genus database with same CATH topology
2E7PA 4MP4A 4YH2A 4O5QA 2O85A 4EC0A 3G7YA 5DQYA 2C80A 1AC1A 5BRTA 5DAKB 4V1Ag 5DCGA 2EC4A 5JWOB 5CRHA 2V6OA 1PX6A 3IBHA 2CX4A 2LNTA 4MLYA 1TRVA 4V2MA 4AF2A 3C71A 3F63A 3QAGA 2CVBA 4XS4B 3QAWA 4MH2A 1JLWA 4FO5A 2DC5A 4X4JA 4ID0A 5CYYA 9GSSA 2IMEA 3TOUA 1K0OA 2C3TA 3PH9A 3O76A 1V40A 4JRRA 4FYUA 1VRSD 1TI1A 4MABA 4NXIA 1ERWA 3MWHA 1SU9A 1SJZA 2FLSA 4XIHA 4EE0A 1OKDA 4IJIA 2XBIA 2JU5A 3BJ5A 2G0FA 2KHPA 1B48A 1M2BA 1B4QA 1DE1A 5IIZA 5AIVA 3M9KA 4MA9A 3ZITA 4GWRA 3FRCA 4JR6A 3KZQA 1XCCA 4MJEA 2N5FA 1KNGA 4TVEA 3ME7A 4O92A 2MZCA 3K8NA 2GDRA 2LNSA 3ED3A 3FW2A 4FYBA 4HOJA 18GSA 2N5BA 1FHEA 3P90A 2V6KA 5A5KA 4NV5A 1T4YA 1URMA 2LEGA 3LFLA 4MZCA 2K9FA 3I43A 4J57E 3TRPA 5JWRB 4K5SA 3ZYWA 4FYCA 2HRNA 3L9SA 1O8XA 5LCZA 2V41A 1B9XC 2O89A 4CW9A 3VPTA 1HNCA 5IQYA 1ILOA 3IDVA 3D5JA 1EEMA 3GMFA 3FKFA 2PVQA 4Z2RA 3EMPA 4BPYA 1XVWA 1TU7A 2IL3A 4K7IA 4G19A 3P2AA 2FCHA 1X9WB 1TTZA 2F9SA 3GX0A 4L5OA 4CY6A 4IJ3A 2K8SA 3QFAC 2X49A 1UA5A 3HVXA 5IMAA 2DJ0A 3D0ZA 1WPIA 1YQ1A 5B8BA 1GTUA 5HR0A 2IFQB 3IC4A 2YNXA 1WOUA 2OA7A 3TB2A 2LQOA 3CBUA 1CQHA 3G7JA 2MBTA 3J7Yb 5ECPB 2LSTA 1Z6NA 3WGXA 1MEKA 1SKWB 1V98A 4ZIJA 2REMA 1FOHA 1GULA 1Q4JA 5CRGA 3VURA 3S9FA 3RPNA 1DUGA 3UBKA 4ICYA 1B9YC 2A4HA 1U6TA 3FZAA 1PX7A 2DMMA 1ZOFA 4OWYA 1PSQA 1GSQA 2GGTA 1THXA 3GTUB 1TXXA 4AJ6A 1O6JA 3CMIA 1HYUA 6GSUA 4LA1A 5CO3A 2YPMA 4N0ZA 6GSVA 4G9HA 3M8NA 4EDYA 1XWAA 2KOKA 3IAS2 5DJLA 2MYGA 2ZNMA 3L9VA 4K1FA 4LL1B 3TJJA 2H70A 3FR9A 4KA0A 5B7CA 3UIWA 3ZLPA 1Z3EA 2VL3A 5G5EA 1QFNA 4LLRA 4DSSA 2M80A 4MF5A 1Z7PA 1K0NA 4HJ2A 3I6AA 3VWXA 5A4WA 4WKWA 1GUKA 1YZXA 3TRQA 5HFKA 3MIXA 3DMLA 2VCVA 5KN1A 1U88A 5KOXA 3KP8A 2XPDA 3DD3A 1YY7A 2VOCA 2YWNA 4YQMA 2CX3A 2GT5A 3LSZA 3TJBA 1WP0A 5G1KA 1ZYNA 3UJ1A 3MAKA 1GLQA 4I5QA 4POLA 2VLVA 3GSSA 2WGRA 4NPBA 2VM2A 2NDOA 1WWJA 2NPBA 1WRYA 4I8BA 4Q5FA 3TGZA 1UC7A 5DDLA 1GLPA 4K8MA 3KMOA 3GUSA 4NAXA 2DJ3A 3ZIVA 1XW5A 1VF3A 2C0EA 1FAAA 3U5RE 4G0LA 2LQQA 4WBRD 1WE0A 2VCQA 3DXBA 5J3RA 1K0MA 4D73B 10GSA 1V9WA 1C72A 3IPZA 2CAQA 1TRWA 3LYPA 2BMXA 4L0UA 3WD6A 3PINA 2DLXA 4J2FA 2FWHA 2PVOC 4TOPA 1FOVA 2O8VB 3DRNA 1G0TA 4ZBBA 2XHFA 1TI3A 4K5RA 2VL2C 5JWQB 4F2IA 3GH6A 4MH3A 3TJKA 2DKHA 3EMXA 2RIIA 3IV4A 3EC3A 1Y6EA 5IMCA 3Q74A 2WJUA 3EVIA 5JCUA 4HUAA 3GL5A 4WBJA 4BWQA 5KOWA 5CRDA 1U3IA 3QDNA 3RAZA 1LU4A 2QA1A 5GSSA 2IJYA 2X8HA 1OC8A 1MDIA 2XC2A 3GN3A 1HD2A 2J9HA 2F8AA 4EUYA 1T4ZA 5ECNB 2PWJA 2PMTA 6GSWA 2PU9C 5GAND 3CSJA 4EKZA 1EP8A 3W8JA 5J4UA 3HZ4A 1W89A 1XWCA 1B4PA 2GSQA 2X8GA 2HRAA 5FWGA 1S3DA 3TKPA 3W6GA 4ZL8A 2I1UA 5B8AA 4MCUA 6GSTA 3M0FA 2FA8A 2JZRA 5D9VA 3VI7A 5F05A 5D73A 1F3AA 1XW9A 1A0RP 2YOIA 2K18A 1DE2A 4K7OA 1U3AA 2GQMA 4CY8A 4Q5NA 3IC8A 3LYKA 1JFUA 2GQKA 4JEDA 3ZVJD 5ID2A 3APOA 16GSA 2JSZA 4ECCA 3BBYA 3GHAA 2QC7A 4G0KA 2H6XA 2FUG2 4K2DA 1R7HA 4IVFA 4EF0A 3F3QA 1OAZA 2H76A 4O7HA 1X5EA 4YQVA 3GRXA 2I81A 2KP1A 5H5RA 1AQWA 1PD21 3FK8A 1PL2A 4YAVA 2H01A 1GRXA 5DJMA 1FB0A 4OCFA 1MDKA 3HZ8A 4EL1A 4IQ1A 3DWVA 1PGTA 1JZRA 3ZMLA 2F51A 1T7PB 2MMOA 3KTBA 4ACSA 2EIRA 5H5QA 1GSYA 1ERTA 3QFBC 2E2GA 2DIYA 2P31A 1PN9A 5GAPD 1BAYA 2L5OA 3Q6OA 1AUCA 1GL8A 5HR1A 2B7JA 2R0PA 2GLRA 4I6XA 1V57A 4TR1A 3GNJA 1ZL9A 2HT9A 3D4MA 2HRKA 1O7UA 3GKKA 4E8EA 3C73A 3E3EA 1PKZA 1H75A 2CZ3A 3M3MA 1K0BA 4K9ZA 3LW9A 4LMVA 2OADA 1BEDA 3CRTA 4MJAA 4K6XA 4EIPA 1ZMAA 3UVHA 3KCMA 2X4AA 4HQZA 1Z7RA 3D6IA 6GSYA 1X9MB 4KE3A 5LNKe 3EU4A 3ERWA 4G0IA 2VAFA 2YCDA 4LL4B 3KP9A 4XTSA 1SL0B 1FB6A 4EVMA 2A2SA 3TKRA 3F3RA 2IMKA 2C4JA 3HXSA 2E2MA 4Z2UA 3KGKA 3AY8A 2H1GA 3UEMA 5F06A 1K0AA 5ENUA 4POBA 1M7TA 1TK5B 4QQ7A 2GSRA 3H4KA 1TU8A 2GSSA 3ME8A 4PURA 4ZB9A 3CSHA 5COHA 2OJLA 1U87A 5A4UA 1K0DA 3PR8A 2LJAA 5ECMB 3LXTA 3GL3A 4JR4A 2AJQB 3HDCA 1TK0B 4O32A 4HI7A 1OE7A 4BL7B 1YKAA 1XZOA 2P5RA 1I9DA 4IHUA 3GKNA 2VD0A 1Q98A 1IYIA 1O81A 5C00A 3BCIA 3ZL5A 1TP9A 2L4QA 2WRTA 4OCEA 5J9BA 4F03A 3QMXA 2OE0A 4ZL7A 2VCXA 5D8IA 2C3NA 4HQSA 3J7Yk 4KX4A 2OACA 3EU3A 2GS3A 2H1BA 2OE1A 2LTKA 1OC9A 3FY7A 2ON5A 2OBKA 4HDEA 1FVJA 2R5GA 4IN0A 3RPPA 2HZEA 1GSEA 1AQXA 5B6NA 1JLVA 1G6YA 2B5EA 4IW9A 3N5OA 1XXUA 1F9MA 2MMAA 4OO4A 5ECHB 4GTUA 3LORA 4ZB8A 3P8WA 2LS5A 5IO0A 3ZVJA 3UARA 4HJMA 5KN3A 2V32A 2FWGA 2YV9A 2L5LA 2R4VA 4Q5RA 1E2YA 1PN0A 3KTLA 3LXZA 4YAPA 4JBBA 1Z9HA 2CAIA 4IP1A 1YJ6A 2GVPA 2KP2A 1QUWA 4X0XA 1BYEA 1V58A 3ZIJA 4TR4A 3HVVA 4QL7A 3G7IA 1A0FA 1SENA 2P5QA 3QR6A 3I9V2 2GT6A 1TRUA 3DVXA 4RUVA 3H79A 4XS1A 2LRNA 2N5AA 1NW2A 3F6FA 3VK9A 3KMNA 1A2MA 3DEXA 3H1NA 4P3YB 5LD0A 1ML6A 1SK2A 5FT3A 5EL8A 4BA7A 5DCHA 4BVXA 2WCIA 2CA8A 5D9WA 5ECKB 5G2ZA 2HNLA 4JE1A 1FG4A 1THOA 2FD3A 3C8EA 1SD8A 4PX1A 2JSYA 4PNGA 4DEJA 3UMAA 1XOAA 1VF1A 2R3XA 5D93A 2VCZA 3ZREA 1N2AA 2I4AA 1KEBA 4MMMA 4IELA 5DAKA 2R2JA 3F0IA 3FEUA 5INYA 2JADA 1WMJA 2X64A 4MDCA 2VIMA 4FQUA 4GQFA 2VCWA 3DIEA 2E0QA 1O73A 3GURA 2TIRA 1TW9A 4XS4A 4F82A 4MJBA 1N8JA 3LG6A 2B3SA 3BOAA 5AN1A 2H30A 1UVZA 1T1VA 2H19A 4GSTA 2FHEA 1NSWA 5G30A 3KD0A 5F07A 2NVLA 4OMVA 3TJFA 1SYRA 4KSOA 4I2UA 4BWSA 5G5FA 3VWUA 1SL1B 4NMUA 2YWIA 3GKMA 1M9AA 3KM6A 1PA3A 2LRTA 4LMWA 2WB9A 2F3MA 2AHEA 3TDGA 3UAPA 8GSSA 4KB3A 1SJ6A 3NOFA 3IA1A 4I97A 2GQLA 4F0CA 1USBA 4EIQA 3IK9A 2LJKA 1OE8A 3NZNA 2VL2A 1FVKA 2CQ9A 3E9JB 2BTOT 3CRUA 1JZWA 1YEPA 5CP1A 5JCGA 4JZQA 5KN2A 2LKUA 1GTAA 3EE2A 2QA2A 1RK4A 1TKDB 1ZZYA 2YN1A 3E0UA 4KW6A 5AGYA 3FHKA 4ECBA 2EIQA 4K2XA 1F6MC 4PGTA 4IS0A 3O3TA 4MZWA 3MDKA 2ES7A 1Z6MA 3SWLA 5EVOA 2JZSA 2YJHA 1W4VA 3P7XA 2H6YA 4N11A 1PQNA 2WFCA 3FMWA 2YZHA 1RQMA 2GZYA 2D2ZA 1ZYPA 3KH9A 4WF5A 1YEXA 1ERVA 1G7OA 2H75A 4V2NA 2VD1A 1T3BA 4OFMA 3CSIA 2ZUPA 1GNEA 1M99A 1DSBA 1GTBA 2HI7A 4KDXA 2PERA 3MYDA 2RLIA 3W8SA 4N10A 3IOSA 1K3OA 2C0GA 3ERFA 4L0WA 1QMVA 4F9ZA 5AISA 2CVKA 2VO4A 4WR4A 2K8VA 2HZFA 4XRAA 3GV1A 5IOWA 3D21A 3EINA 3HCZA 1WIKA 1EWXA 4PQ1A 4OFTA 1X0RA 1XWGA 5J9CA 4DSRA 1XPVA 4TR0A 2C8UA 2TRCP 1A8LA 2HZEB 2F8FA 1OKTA 2P0GA 3HY2A 2B1KA 4YKFA 4H86A 1XW6A 3HYPA 1GSSA 4PXOA 5IPHA 3PPUA 3F4RA 2HSMA 3HA9A 1ZYQB 3GKXA 4WEYA 4NHWA 2YZUA 3HJMA 1SL2B 1R5PA 2HSHA 4POMA 2Z9SA 3QD9A 3M9JA 2HFDA 2KLXA 4KCEA 4GLTA 3WT1A 5KEJA 1FW1A 2YWMA 3IK7A 4IQAA 2GSTA 4JU5A 4NV2A 1ZCPA 3RHBA 3V1WA 3MNGA 4K0GA 3IHQA 1NM3A 1LBKA 4GRFA 4ZB6A 1BQ7A 4MJCA 4DSQA 3HD5A 4OO5A 4PTSA 3UVTA 2MMNA 2AAWA 14GSA 4FIWA 2RM6A 4HS1A 2DJ2A 3QPMA 5G1LA 2AV4A 2C1YA 5A4VA 1GTIA 3TKSC 1X9SB 4X1UA 3I69A 1QGVA 3VI5A 2B5XA 3DYRA 3ZMKA 1Z5YE 2IPAA 2IMDA 3U6VA 2H66A 4MZBA 4V1Ap 1OC3A 3KEBA 3L78A 5CREA 2EIOA 5HR2A 3WGDA 1DBYA 2VCTA 20GSA 2R37A 2R6KA 4XCSA 4USSA 4ECJA 1F37A 2PPTA 3FR6A 4FH8A 5HR3A 1A2LA 2WULA 1O85A 3VWVA 3ZFLA 5EPFA 3LQ7A 2FY6A 3FZ4A 2YP6A 5IM9A 1I5GA 3F8UA 2WS2A 1X5CA 3N9JA 4DSSB 3UL3A 3HJOA 1JZOA 3L4NA 2XBQA 4KDYA 5IPGA 1G6WA 4WXTA 2FWEA 4GSSA 4NHZA 4ML6A 19GSA 3US3A 3R3EA 4IKHA 2B5YA 3A2WA 2PBJA 3F6DA 1J9BA 3C7MA 3TRXA 3HKRA 1T00A 3NIVA 3KXOA 1F3BA 3L0HA 3QCPA 3HHVA 3GH9A 2DMLA 4XRDA 1PRXA 2AYTA 4KNDA 2LUSA 4IGJA 3WT2A 2M72A 4D73A 3GSTA 3QAVA 2VL9A 4E8HA 2I3YA 4PUAA 1J0FA 1YF0A 5AIXA 2JACA 3ISOA 3A5IA 1T8EB 5J5NA 5ECQB 2LRCA 4K7NA 1VF2A 1OYJA 4XS6A 1NHOA 5L71A 5EY6A 1E6BA 4IBPA 2H0HA 2C0FA 2PN8A 1SD9A 2WDUA 4GXZA 5GZZB 2FGXA 4OD7A 2A2PA 3F9UA 3H8QA 4KAEA 5J41A 1ZYEA 1AW9A 1KTEA 2DIZA 2HYXA 3IE3A 2IIYA 2RM5A 5G31A 4HZ4A 1SK0A 1O8WA 3EYTA 2H0GA 1KBNA 4F0BA 4NWYA 2H0IA 2XPEA 2OKAA 4ZBDA 5D9TA 2R0GA 2G2QA 4TN8A 4PQHA 4ZILA 2H6ZA 2GZZA 4XHMA 3FR3A 2X8CA 5ABRA 3G9BA 3UBLA 1ABAA 1JZDA 2YWOA 2MMZA 5HQPA 4KSMA 5F8BA 4N0VA 3LEFA 4EDZA 4O5RA 2B7KA 2OBIA 2H8LA 1J08A 3OR5A 5DVBA 4EXJA 3R2QA 4GF0A 1TJDA 2RUFA 4MNNA 3H93A 5D9XA 2FWFA 3CYNA 13GSA 4TXOA 4QL9A 3VFIA 4KUNA 5ECIB 1GNWA 5IMFA 5GSTA 3FZ5A 4GSNA 4X43A 3GFKA 2IMFA 1GUMA 5E59A 5FHIA 3A3TA 5DALA 2LV3A 2H1AA 2IMIA 4TR3A 3TKQA 3EPTA 1H4OA 4KDUA 2DJ1A 1QQ2A 1XBSA 4WF4A 5CRWA 2NBSA 1XOBA 4J56E 3LJRA 1MTCA 3PGTA 3F4TA 1TRSA 5ELAA 5IO2A 5ID2B 2NTOA 3HVSA 4BVYA 2H73A 4MK3A 1GUHA 2JZTA 1PL1A 1XVQA 1IYHA 1M2DA 3C1RA 3FYGA 1ACVA 3M1GA 2CT6A 3GX8A 3IXRA 3BD2A 4AJ7A 3APQA 4I2TA 5IMDA 3KH7A 3TCOA 3IRAA 2PGTA 1TK8B 11GSA 3TKSE 3VLNA 1XFLA 1QK8A 2HSYA 2L6DA 4K0NA 2L4CA 2R0CA 5B6MA 3MSZA 1YDKA 3Q18A 2K6VA 4RQXA 1K3LA 3JCML 1OVNA 2BJXA 1K3YA 4TW5A 2H72A 3L9UA 1R26A 2ALBA 5C04A 2YANA 4HZ2A 1A2JA 1PMTA 1EGRA 1YF1A 1K0CA 2JL4A 3HJPA 1M0UA 1RW1A 3TOTA 5ELGA 5IMZA 4Z7XA 4TR1B 4L5LA 4RI7A 3FZ9A 1XWKA 1XWBA 4KCAA 1S3CA 1TOFA 1GSDA 1ON4A 2PUKC 5ECRB 4MPFA 2CZ2A 3A2XA 4ULXA 3WGEA 5ECLB 2RUEA 2MBSA 3D22A 5F0GA 3RBTA 4KF9A 2WZ9A 5HFGA 4ECIA 4RQRA 2B6MA 1BG5A 1EEJA 5H5SA 5DQSA 2X99A 3ERGA 3IAM2 4N30A 1X5DA 5CNWA 1EZKA 1V2AA 4KH7A 6GSXA 1GSUA 4L8EA 1UN2A 4A5PA 1BJXA 3TUEA 4RI6A 3LWAA 5KN0A 5ECOB 1ST9A 4AJ8A 3GYKA 2YV7A 3ZRDA 2QGVA 4PUFC 2VLUA 4O5UA 2IN3A 1A24A 3GIXA 2HXKA 2H1DA 3IHGA 2HLSA 4AGSA 1TDIA 1SJIA 4BL7A 2IWTA 2KUCA 4ZXGA 22GSA 4GCIA 2ON7A 3RDWA 3A5WA 3QOUA 4G2EA 3SBCA 4PNFA 4ML1A 1GP1A 2L59A 3F4SA 2HRFA 3A2VA 3D4TA 4PQIA 1A8YA 3UOMA 4WR5A 4EO3A 1A23A 3LGCA 1B8XA 2AUVA 4HU7A 2QSIA 2GZPA 3VPQA 1BX9A 2L6CA 4ISDA 2M46A 2AB6A 1SKSB 4TXVA 1AAZA 1YKCA 5CAXA 1EV9A 3KIJA 1Y25A 6GSSA 3ZFBA 4Z2TA 3VWWA 2DBCA 1HNAA 1G7EA 2V1MA 4ZL9A 2UZ8A 3DVWA 1VGLA 2VLTA 4DVCA 2FNOA 2CV4A 1NHYA 17GSA 1MD3A 2OE3A 4GQCA 1S3AA 1CQGA 5IOXA 2QKEA 3CXGA 1OC9B 2LJRA 5ECSA 2DKIA 2ZCTA 4HEA2 5D96A 3GA4A 3IR4A 5E4WA 2IFQA 2J23A 1SYXA 1EGOA 2H74A 1GSFA 3EURA 4POKA 3CTFA 2VM1A 1GH2A 1GWCA 3ZTLA 4HU9A 2HE3A 4TRXA 4IP6A 1WJKA 4TXOB 3TJGA 4ZBAA 7GSSA 12GSA 1FO5A 2FA4A 4MF7A 2O7KA 1MDJA 2CVDA 5DALB 1R4WA 3DGQA 1MD4A 1JHBA 1M2AA 2GTUA 3CTGA 2DJJA 1XIYA 2VUPA 3O6TA 1HQOA 3EWLA 3BCKA 4YKGA 1ERUA 3TKSA 5BMUA 2DSAA 3C1SA 1AXDA 1SK1A 1AIUA 4KGIA 1AQVA 4G10A 2B1LA 3GTUA 4YQUA 1QXHA 1LJRA 4OFNA 1EOHA 4BVYB 2H71A 1M9BA 2DJKA 3APSA 3Q19A 2L57A 2O87A 1PKWA 4CDOA 2A4VA 2YJ7A 4MPGA 1R5AA 3RHCA 5DBQA 1F2EA 2C0DA 2A2RA 2V2GA 3ZZXA 1EP7A 4TKYA 2TRXA 1VF4A 3DKSA 3KJYA 5JCWA 4MF6A 4BVXB 3WYWA 1EV4A 4CHSA 2I9HA 4WETA 1HNBA 4V2LA 5HFIA 1ZGNA 4Q5QA 1EOGA 4ILFA 5IMVA 2C3QA 1SKRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E7P A;  4MP4 A;  4YH2 A;  2O85 A;  4EC0 A;  3G7Y A;  5DQY A;  2C80 A;  1AC1 A;  5DAK B;  4V1A g;  5DCG A;  2EC4 A;  5JWO B;  5CRH A;  2V6O A;  1PX6 A;  3IBH A;  2CX4 A;  2LNT A;  4MLY A;  1TRV A;  4V2M A;  4AF2 A;  3C71 A;  3F63 A;  3QAG A;  2CVB A;  4XS4 B;  3QAW A;  4MH2 A;  1JLW A;  4FO5 A;  2DC5 A;  4ID0 A;  5CYY A;  9GSS A;  2IME A;  3TOU A;  1K0O A;  2C3T A;  3PH9 A;  3O76 A;  1V40 A;  4JRR A;  4FYU A;  1VRS D;  1TI1 A;  4MAB A;  4NXI A;  1ERW A;  3MWH A;  1SU9 A;  1SJZ A;  2FLS A;  4XIH A;  4EE0 A;  1OKD A;  4IJI A;  2XBI A;  2JU5 A;  3BJ5 A;  2G0F A;  2KHP A;  1B48 A;  1M2B A;  1B4Q A;  1DE1 A;  5IIZ A;  5AIV A;  3M9K A;  4MA9 A;  3ZIT A;  4GWR A;  3FRC A;  4JR6 A;  3KZQ A;  1XCC A;  4MJE A;  2N5F A;  1KNG A;  4TVE A;  3ME7 A;  4O92 A;  2MZC A;  3K8N A;  2GDR A;  2LNS A;  3ED3 A;  3FW2 A;  4FYB A;  4HOJ A;  18GS A;  2N5B A;  1FHE A;  3P90 A;  2V6K A;  5A5K A;  4NV5 A;  1T4Y A;  1URM A;  2LEG A;  3LFL A;  4MZC A;  2K9F A;  3I43 A;  4J57 E;  3TRP A;  5JWR B;  3ZYW A;  4FYC A;  2HRN A;  3L9S A;  1O8X A;  5LCZ A;  2V41 A;  1B9X C;  2O89 A;  4CW9 A;  3VPT A;  1HNC A;  5IQY A;  1ILO A;  3IDV A;  3D5J A;  1EEM A;  3GMF A;  3FKF A;  2PVQ A;  3EMP A;  4BPY A;  1XVW A;  1TU7 A;  2IL3 A;  4K7I A;  4G19 A;  3P2A A;  2FCH A;  1X9W B;  1TTZ A;  2F9S A;  3GX0 A;  4L5O A;  4IJ3 A;  2K8S A;  3QFA C;  1UA5 A;  3HVX A;  5IMA A;  2DJ0 A;  3D0Z A;  1WPI A;  1YQ1 A;  5B8B A;  1GTU A;  5HR0 A;  2IFQ B;  3IC4 A;  2YNX A;  1WOU A;  2OA7 A;  3TB2 A;  2LQO A;  3CBU A;  1CQH A;  3G7J A;  2MBT A;  3J7Y b;  5ECP B;  2LST A;  1Z6N A;  3WGX A;  1MEK A;  1SKW B;  1V98 A;  4ZIJ A;  2REM A;  1GUL A;  1Q4J A;  5CRG A;  3VUR A;  3S9F A;  3RPN A;  1DUG A;  3UBK A;  1B9Y C;  1U6T A;  3FZA A;  1PX7 A;  2DMM A;  1ZOF A;  4OWY A;  1PSQ A;  1GSQ A;  2GGT A;  1THX A;  3GTU B;  1TXX A;  4AJ6 A;  1O6J A;  3CMI A;  1HYU A;  6GSU A;  4LA1 A;  5CO3 A;  2YPM A;  4N0Z A;  6GSV A;  4G9H A;  3M8N A;  4EDY A;  1XWA A;  2KOK A;  3IAS 2;  5DJL A;  2MYG A;  2ZNM A;  3L9V A;  4K1F A;  4LL1 B;  3TJJ A;  2H70 A;  3FR9 A;  4KA0 A;  5B7C A;  3UIW A;  3ZLP A;  1Z3E A;  2VL3 A;  5G5E A;  1QFN A;  4LLR A;  4DSS A;  2M80 A;  4MF5 A;  1Z7P A;  1K0N A;  4HJ2 A;  3I6A A;  3VWX A;  5A4W A;  4WKW A;  1GUK A;  1YZX A;  3TRQ A;  5HFK A;  3DML A;  2VCV A;  5KN1 A;  1U88 A;  3KP8 A;  2XPD A;  3DD3 A;  1YY7 A;  2VOC A;  2YWN A;  4YQM A;  2CX3 A;  2GT5 A;  3LSZ A;  3TJB A;  1WP0 A;  5G1K A;  3UJ1 A;  3MAK A;  1GLQ A;  4I5Q A;  4POL A;  2VLV A;  3GSS A;  2WGR A;  4NPB A;  2VM2 A;  2NDO A;  1WWJ A;  2NPB A;  1WRY A;  4I8B A;  4Q5F A;  3TGZ A;  1UC7 A;  5DDL A;  1GLP A;  4K8M A;  3KMO A;  3GUS A;  4NAX A;  2DJ3 A;  3ZIV A;  1XW5 A;  1VF3 A;  2C0E A;  1FAA A;  3U5R E;  2LQQ A;  4WBR D;  1WE0 A;  2VCQ A;  3DXB A;  5J3R A;  1K0M A;  4D73 B;  10GS A;  1V9W A;  1C72 A;  3IPZ A;  2CAQ A;  1TRW A;  3LYP A;  2BMX A;  4L0U A;  3WD6 A;  3PIN A;  2DLX A;  4J2F A;  2FWH A;  2PVO C;  4TOP A;  1FOV A;  2O8V B;  3DRN A;  1G0T A;  4ZBB A;  2XHF A;  1TI3 A;  2VL2 C;  5JWQ B;  4F2I A;  3GH6 A;  4MH3 A;  3TJK A;  3EMX A;  2RII A;  3IV4 A;  3EC3 A;  1Y6E A;  5IMC A;  3Q74 A;  2WJU A;  3EVI A;  5JCU A;  4HUA A;  3GL5 A;  4WBJ A;  4BWQ A;  5CRD A;  1U3I A;  3QDN A;  3RAZ A;  1LU4 A;  5GSS A;  2IJY A;  2X8H A;  1OC8 A;  1MDI A;  2XC2 A;  3GN3 A;  1HD2 A;  2J9H A;  2F8A A;  4EUY A;  1T4Z A;  5ECN B;  2PWJ A;  2PMT A;  6GSW A;  2PU9 C;  5GAN D;  3CSJ A;  4EKZ A;  1EP8 A;  3W8J A;  5J4U A;  3HZ4 A;  1W89 A;  1XWC A;  1B4P A;  2GSQ A;  2X8G A;  5FWG A;  1S3D A;  3TKP A;  3W6G A;  4ZL8 A;  2I1U A;  5B8A A;  4MCU A;  6GST A;  3M0F A;  2FA8 A;  2JZR A;  5D9V A;  3VI7 A;  5F05 A;  5D73 A;  1F3A A;  1XW9 A;  1A0R P;  2YOI A;  2K18 A;  1DE2 A;  4K7O A;  1U3A A;  2GQM A;  4Q5N A;  3LYK A;  1JFU A;  2GQK A;  4JED A;  3ZVJ D;  5ID2 A;  3APO A;  16GS A;  2JSZ A;  4ECC A;  3BBY A;  3GHA A;  2QC7 A;  2H6X A;  2FUG 2;  4K2D A;  1R7H A;  4IVF A;  4EF0 A;  3F3Q A;  1OAZ A;  2H76 A;  4O7H A;  1X5E A;  4YQV A;  3GRX A;  2I81 A;  2KP1 A;  5H5R A;  1AQW A;  1PD2 1;  3FK8 A;  1PL2 A;  4YAV A;  2H01 A;  1GRX A;  5DJM A;  1FB0 A;  4OCF A;  1MDK A;  3HZ8 A;  4EL1 A;  4IQ1 A;  3DWV A;  1PGT A;  1JZR A;  3ZML A;  2F51 A;  1T7P B;  2MMO A;  3KTB A;  4ACS A;  2EIR A;  5H5Q A;  1GSY A;  1ERT A;  3QFB C;  2E2G A;  2DIY A;  2P31 A;  1PN9 A;  5GAP D;  1BAY A;  2L5O A;  3Q6O A;  1AUC A;  1GL8 A;  5HR1 A;  2B7J A;  2GLR A;  4I6X A;  1V57 A;  4TR1 A;  3GNJ A;  1ZL9 A;  2HT9 A;  3D4M A;  1O7U A;  3GKK A;  4E8E A;  3C73 A;  3E3E A;  1PKZ A;  1H75 A;  2CZ3 A;  3M3M A;  1K0B A;  4K9Z A;  4LMV A;  2OAD A;  1BED A;  3CRT A;  4MJA A;  4K6X A;  1ZMA A;  3UVH A;  3KCM A;  4HQZ A;  1Z7R A;  3D6I A;  6GSY A;  1X9M B;  4KE3 A;  5LNK e;  3EU4 A;  3ERW A;  2VAF A;  2YCD A;  4LL4 B;  3KP9 A;  4XTS A;  1SL0 B;  1FB6 A;  4EVM A;  2A2S A;  3TKR A;  3F3R A;  2IMK A;  2C4J A;  3HXS A;  2E2M A;  3KGK A;  3AY8 A;  2H1G A;  3UEM A;  5F06 A;  1K0A A;  5ENU A;  4POB A;  1M7T A;  1TK5 B;  4QQ7 A;  2GSR A;  3H4K A;  1TU8 A;  2GSS A;  3ME8 A;  4PUR A;  4ZB9 A;  3CSH A;  5COH A;  2OJL A;  1U87 A;  5A4U A;  1K0D A;  3PR8 A;  2LJA A;  5ECM B;  3LXT A;  3GL3 A;  4JR4 A;  2AJQ B;  3HDC A;  1TK0 B;  4O32 A;  4HI7 A;  1OE7 A;  1YKA A;  1XZO A;  2P5R A;  1I9D A;  4IHU A;  3GKN A;  2VD0 A;  1Q98 A;  1IYI A;  1O81 A;  5C00 A;  3BCI A;  3ZL5 A;  1TP9 A;  2L4Q A;  2WRT A;  4OCE A;  5J9B A;  4F03 A;  3QMX A;  2OE0 A;  4ZL7 A;  2VCX A;  5D8I A;  2C3N A;  4HQS A;  3J7Y k;  4KX4 A;  2OAC A;  3EU3 A;  2GS3 A;  2H1B A;  2OE1 A;  2LTK A;  1OC9 A;  3FY7 A;  2ON5 A;  2OBK A;  4HDE A;  1FVJ A;  2R5G A;  4IN0 A;  3RPP A;  2HZE A;  1GSE A;  1AQX A;  5B6N A;  1JLV A;  1G6Y A;  2B5E A;  4IW9 A;  3N5O A;  1XXU A;  1F9M A;  2MMA A;  4OO4 A;  5ECH B;  4GTU A;  3LOR A;  4ZB8 A;  3P8W A;  2LS5 A;  5IO0 A;  3ZVJ A;  3UAR A;  4HJM A;  5KN3 A;  2V32 A;  2FWG A;  2YV9 A;  2L5L A;  2R4V A;  4Q5R A;  1E2Y A;  3KTL A;  3LXZ A;  4YAP A;  4JBB A;  1Z9H A;  2CAI A;  4IP1 A;  1YJ6 A;  2GVP A;  2KP2 A;  1QUW A;  4X0X A;  1BYE A;  1V58 A;  3ZIJ A;  4TR4 A;  3HVV A;  4QL7 A;  3G7I A;  1A0F A;  1SEN A;  2P5Q A;  3QR6 A;  3I9V 2;  2GT6 A;  1TRU A;  3DVX A;  4RUV A;  3H79 A;  4XS1 A;  2LRN A;  2N5A A;  1NW2 A;  3F6F A;  3VK9 A;  3KMN A;  1A2M A;  3DEX A;  3H1N A;  4P3Y B;  5LD0 A;  1ML6 A;  1SK2 A;  5FT3 A;  5EL8 A;  4BA7 A;  5DCH A;  4BVX A;  2WCI A;  2CA8 A;  5D9W A;  5ECK B;  5G2Z A;  2HNL A;  4JE1 A;  1FG4 A;  1THO A;  2FD3 A;  3C8E A;  1SD8 A;  4PX1 A;  2JSY A;  4PNG A;  4DEJ A;  3UMA A;  1XOA A;  1VF1 A;  2R3X A;  5D93 A;  2VCZ A;  3ZRE A;  1N2A A;  2I4A A;  1KEB A;  4MMM A;  4IEL A;  5DAK A;  2R2J A;  3F0I A;  3FEU A;  5INY A;  2JAD A;  1WMJ A;  2X64 A;  4MDC A;  2VIM A;  4GQF A;  2VCW A;  3DIE A;  2E0Q A;  1O73 A;  3GUR A;  2TIR A;  1TW9 A;  4XS4 A;  4F82 A;  4MJB A;  1N8J A;  3LG6 A;  2B3S A;  3BOA A;  5AN1 A;  2H30 A;  1UVZ A;  1T1V A;  2H19 A;  4GST A;  2FHE A;  1NSW A;  5G30 A;  3KD0 A;  5F07 A;  2NVL A;  4OMV A;  3TJF A;  1SYR A;  4KSO A;  4I2U A;  4BWS A;  5G5F A;  3VWU A;  1SL1 B;  4NMU A;  2YWI A;  3GKM A;  1M9A A;  3KM6 A;  1PA3 A;  2LRT A;  4LMW A;  2WB9 A;  2F3M A;  2AHE A;  3TDG A;  3UAP A;  8GSS A;  4KB3 A;  1SJ6 A;  3NOF A;  3IA1 A;  4I97 A;  2GQL A;  4F0C A;  1USB A;  3IK9 A;  2LJK A;  1OE8 A;  3NZN A;  2VL2 A;  1FVK A;  2CQ9 A;  3E9J B;  2BTO T;  3CRU A;  1JZW A;  1YEP A;  5CP1 A;  5JCG A;  4JZQ A;  5KN2 A;  2LKU A;  1GTA A;  3EE2 A;  1RK4 A;  1TKD B;  1ZZY A;  2YN1 A;  3E0U A;  4KW6 A;  5AGY A;  3FHK A;  4ECB A;  2EIQ A;  1F6M C;  4PGT A;  4IS0 A;  3O3T A;  4MZW A;  3MDK A;  2ES7 A;  1Z6M A;  3SWL A;  5EVO A;  2JZS A;  2YJH A;  1W4V A;  3P7X A;  2H6Y A;  4N11 A;  1PQN A;  2WFC A;  2YZH A;  1RQM A;  2GZY A;  2D2Z A;  3KH9 A;  4WF5 A;  1YEX A;  1ERV A;  1G7O A;  2H75 A;  4V2N A;  2VD1 A;  1T3B A;  4OFM A;  3CSI A;  2ZUP A;  1GNE A;  1M99 A;  1DSB A;  1GTB A;  2HI7 A;  4KDX A;  2PER A;  2RLI A;  3W8S A;  4N10 A;  3IOS A;  1K3O A;  2C0G A;  3ERF A;  4L0W A;  1QMV A;  4F9Z A;  5AIS A;  2CVK A;  2VO4 A;  4WR4 A;  2K8V A;  2HZF A;  4XRA A;  3GV1 A;  5IOW A;  3D21 A;  3EIN A;  3HCZ A;  1WIK A;  1EWX A;  4PQ1 A;  4OFT A;  1X0R A;  1XWG A;  5J9C A;  4DSR A;  1XPV A;  4TR0 A;  2C8U A;  2TRC P;  1A8L A;  2HZE B;  2F8F A;  1OKT A;  2P0G A;  3HY2 A;  2B1K A;  4H86 A;  1XW6 A;  3HYP A;  1GSS A;  4PXO A;  5IPH A;  3F4R A;  3HA9 A;  1ZYQ B;  3GKX A;  4WEY A;  4NHW A;  2YZU A;  3HJM A;  1SL2 B;  1R5P A;  2HSH A;  4POM A;  2Z9S A;  3QD9 A;  3M9J A;  2HFD A;  2KLX A;  4KCE A;  4GLT A;  3WT1 A;  5KEJ A;  1FW1 A;  2YWM A;  3IK7 A;  4IQA A;  2GST A;  4JU5 A;  4NV2 A;  1ZCP A;  3RHB A;  3V1W A;  3MNG A;  4K0G A;  3IHQ A;  1NM3 A;  1LBK A;  4GRF A;  4ZB6 A;  1BQ7 A;  4MJC A;  4DSQ A;  3HD5 A;  4OO5 A;  3UVT A;  2MMN A;  2AAW A;  14GS A;  4FIW A;  2RM6 A;  4HS1 A;  2DJ2 A;  3QPM A;  5G1L A;  2AV4 A;  2C1Y A;  5A4V A;  1GTI A;  3TKS C;  1X9S B;  4X1U A;  3I69 A;  1QGV A;  3VI5 A;  2B5X A;  3DYR A;  3ZMK A;  1Z5Y E;  2IPA A;  2IMD A;  3U6V A;  2H66 A;  4MZB A;  4V1A p;  1OC3 A;  3KEB A;  3L78 A;  5CRE A;  2EIO A;  5HR2 A;  3WGD A;  1DBY A;  2VCT A;  20GS A;  2R37 A;  2R6K A;  4XCS A;  4ECJ A;  1F37 A;  2PPT A;  3FR6 A;  4FH8 A;  5HR3 A;  1A2L A;  2WUL A;  1O85 A;  3VWV A;  3ZFL A;  5EPF A;  3LQ7 A;  2FY6 A;  3FZ4 A;  2YP6 A;  5IM9 A;  1I5G A;  3F8U A;  2WS2 A;  1X5C A;  3N9J A;  4DSS B;  3UL3 A;  3HJO A;  1JZO A;  3L4N A;  2XBQ A;  4KDY A;  5IPG A;  1G6W A;  4WXT A;  2FWE A;  4GSS A;  4NHZ A;  4ML6 A;  19GS A;  3US3 A;  4IKH A;  2B5Y A;  3A2W A;  2PBJ A;  3F6D A;  1J9B A;  3C7M A;  3TRX A;  3HKR A;  1T00 A;  3NIV A;  3KXO A;  1F3B A;  3L0H A;  3QCP A;  3HHV A;  3GH9 A;  2DML A;  4XRD A;  1PRX A;  2AYT A;  4KND A;  2LUS A;  4IGJ A;  3WT2 A;  2M72 A;  4D73 A;  3GST A;  3QAV A;  2VL9 A;  4E8H A;  2I3Y A;  4PUA A;  1J0F A;  1YF0 A;  5AIX A;  2JAC A;  3ISO A;  1T8E B;  5J5N A;  5ECQ B;  2LRC A;  4K7N A;  1VF2 A;  1OYJ A;  4XS6 A;  1NHO A;  5L71 A;  5EY6 A;  1E6B A;  4IBP A;  2H0H A;  2C0F A;  2PN8 A;  1SD9 A;  2WDU A;  4GXZ A;  5GZZ B;  2FGX A;  4OD7 A;  3F9U A;  3H8Q A;  4KAE A;  5J41 A;  1ZYE A;  1AW9 A;  1KTE A;  2DIZ A;  2HYX A;  3IE3 A;  2IIY A;  2RM5 A;  5G31 A;  4HZ4 A;  1SK0 A;  1O8W A;  3EYT A;  2H0G A;  1KBN A;  4F0B A;  4NWY A;  2H0I A;  2XPE A;  2OKA A;  4ZBD A;  5D9T A;  2G2Q A;  4TN8 A;  4PQH A;  4ZIL A;  2H6Z A;  2GZZ A;  4XHM A;  3FR3 A;  2X8C A;  5ABR A;  3G9B A;  3UBL A;  1ABA A;  1JZD A;  2YWO A;  2MMZ A;  5HQP A;  4KSM A;  5F8B A;  4N0V A;  3LEF A;  4EDZ A;  4O5R A;  2B7K A;  2OBI A;  2H8L A;  1J08 A;  3OR5 A;  5DVB A;  4EXJ A;  3R2Q A;  4GF0 A;  1TJD A;  2RUF A;  3H93 A;  5D9X A;  2FWF A;  3CYN A;  13GS A;  4TXO A;  4QL9 A;  3VFI A;  4KUN A;  5ECI B;  1GNW A;  5IMF A;  5GST A;  3FZ5 A;  4GSN A;  4X43 A;  3GFK A;  2IMF A;  1GUM A;  5E59 A;  5FHI A;  3A3T A;  5DAL A;  2LV3 A;  2H1A A;  2IMI A;  4TR3 A;  3TKQ A;  1H4O A;  4KDU A;  2DJ1 A;  1QQ2 A;  1XBS A;  4WF4 A;  5CRW A;  2NBS A;  1XOB A;  4J56 E;  3LJR A;  1MTC A;  3PGT A;  3F4T A;  1TRS A;  5ELA A;  5IO2 A;  5ID2 B;  2NTO A;  3HVS A;  4BVY A;  2H73 A;  4MK3 A;  1GUH A;  2JZT A;  1PL1 A;  1XVQ A;  1IYH A;  1M2D A;  3C1R A;  3FYG A;  1ACV A;  3M1G A;  2CT6 A;  3GX8 A;  3IXR A;  3BD2 A;  4AJ7 A;  3APQ A;  4I2T A;  5IMD A;  3KH7 A;  3TCO A;  3IRA A;  2PGT A;  1TK8 B;  11GS A;  3TKS E;  3VLN A;  1XFL A;  1QK8 A;  2HSY A;  2L6D A;  4K0N A;  2L4C A;  5B6M A;  3MSZ A;  1YDK A;  3Q18 A;  2K6V A;  4RQX A;  1K3L A;  3JCM L;  1OVN A;  2BJX A;  1K3Y A;  4TW5 A;  2H72 A;  3L9U A;  1R26 A;  2ALB A;  5C04 A;  2YAN A;  4HZ2 A;  1A2J A;  1PMT A;  1EGR A;  1YF1 A;  1K0C A;  2JL4 A;  3HJP A;  1M0U A;  1RW1 A;  3TOT A;  5ELG A;  5IMZ A;  4Z7X A;  4TR1 B;  4L5L A;  4RI7 A;  3FZ9 A;  1XWK A;  1XWB A;  4KCA A;  1S3C A;  1TOF A;  1GSD A;  1ON4 A;  2PUK C;  5ECR B;  4MPF A;  2CZ2 A;  3A2X A;  4ULX A;  3WGE A;  5ECL B;  2RUE A;  2MBS A;  3D22 A;  5F0G A;  3RBT A;  2WZ9 A;  5HFG A;  4ECI A;  4RQR A;  2B6M A;  1BG5 A;  1EEJ A;  5H5S A;  5DQS A;  2X99 A;  3ERG A;  3IAM 2;  4N30 A;  1X5D A;  5CNW A;  1EZK A;  1V2A A;  4KH7 A;  6GSX A;  1GSU A;  4L8E A;  1UN2 A;  1BJX A;  3TUE A;  4RI6 A;  3LWA A;  5KN0 A;  5ECO B;  1ST9 A;  4AJ8 A;  3GYK A;  2YV7 A;  3ZRD A;  2QGV A;  4PUF C;  2VLU A;  2IN3 A;  1A24 A;  3GIX A;  2HXK A;  2H1D A;  2HLS A;  4AGS A;  1TDI A;  1SJI A;  4BL7 A;  2IWT A;  2KUC A;  4ZXG A;  22GS A;  4GCI A;  2ON7 A;  3RDW A;  3A5W A;  3QOU A;  4G2E A;  3SBC A;  4PNF A;  4ML1 A;  1GP1 A;  2L59 A;  3F4S A;  2HRF A;  3A2V A;  3D4T A;  4PQI A;  1A8Y A;  3UOM A;  4WR5 A;  4EO3 A;  1A23 A;  3LGC A;  1B8X A;  2AUV A;  4HU7 A;  2QSI A;  2GZP A;  3VPQ A;  1BX9 A;  2L6C A;  4ISD A;  2M46 A;  2AB6 A;  1SKS B;  4TXV A;  1AAZ A;  1YKC A;  5CAX A;  1EV9 A;  3KIJ A;  1Y25 A;  6GSS A;  3ZFB A;  3VWW A;  2DBC A;  1HNA A;  1G7E A;  2V1M A;  4ZL9 A;  3DVW A;  1VGL A;  2VLT A;  4DVC A;  2FNO A;  2CV4 A;  1NHY A;  17GS A;  1MD3 A;  2OE3 A;  4GQC A;  1S3A A;  1CQG A;  5IOX A;  2QKE A;  3CXG A;  1OC9 B;  2LJR A;  5ECS A;  2ZCT A;  4HEA 2;  5D96 A;  3GA4 A;  3IR4 A;  5E4W A;  2IFQ A;  2J23 A;  1SYX A;  1EGO A;  2H74 A;  1GSF A;  3EUR A;  4POK A;  3CTF A;  2VM1 A;  1GH2 A;  1GWC A;  3ZTL A;  4HU9 A;  2HE3 A;  4TRX A;  4IP6 A;  1WJK A;  4TXO B;  3TJG A;  4ZBA A;  7GSS A;  12GS A;  1FO5 A;  2FA4 A;  4MF7 A;  2O7K A;  1MDJ A;  2CVD A;  5DAL B;  1R4W A;  3DGQ A;  1MD4 A;  1JHB A;  1M2A A;  2GTU A;  3CTG A;  2DJJ A;  1XIY A;  2VUP A;  3O6T A;  1HQO A;  3EWL A;  3BCK A;  1ERU A;  3TKS A;  2DSA A;  3C1S A;  1AXD A;  1SK1 A;  1AIU A;  4KGI A;  1AQV A;  4G10 A;  2B1L A;  3GTU A;  4YQU A;  1QXH A;  1LJR A;  4OFN A;  1EOH A;  2H71 A;  1M9B A;  2DJK A;  3APS A;  3Q19 A;  2L57 A;  2O87 A;  1PKW A;  4CDO A;  2A4V A;  2YJ7 A;  4MPG A;  1R5A A;  3RHC A;  5DBQ A;  1F2E A;  2C0D A;  2A2R A;  2V2G A;  3ZZX A;  1EP7 A;  4TKY A;  2TRX A;  1VF4 A;  3DKS A;  3KJY A;  5JCW A;  4MF6 A;  3WYW A;  1EV4 A;  4CHS A;  2I9H A;  4WET A;  1HNB A;  4V2L A;  5HFI A;  1ZGN A;  4Q5Q A;  1EOG A;  4ILF A;  5IMV A;  2C3Q A;  1SKR B; 
#chains in the Genus database with same CATH topology
 2E7P A;  4MP4 A;  4YH2 A;  4O5Q A;  2O85 A;  4EC0 A;  3G7Y A;  5DQY A;  2C80 A;  1AC1 A;  5BRT A;  5DAK B;  4V1A g;  5DCG A;  2EC4 A;  5JWO B;  5CRH A;  2V6O A;  1PX6 A;  3IBH A;  2CX4 A;  2LNT A;  4MLY A;  1XG8 A;  1TRV A;  4V2M A;  4AF2 A;  3C71 A;  3F63 A;  3QAG A;  2CVB A;  4XS4 B;  3QAW A;  4MH2 A;  1JLW A;  4FO5 A;  2DC5 A;  4X4J A;  4ID0 A;  5CYY A;  9GSS A;  2IME A;  3TOU A;  1K0O A;  2C3T A;  3PH9 A;  3O76 A;  1V40 A;  4JRR A;  4FYU A;  1VRS D;  1TI1 A;  4MAB A;  4NXI A;  1ERW A;  3MWH A;  1SU9 A;  4HSC X;  1SJZ A;  2FLS A;  4XIH A;  4EE0 A;  1OKD A;  4IJI A;  2XBI A;  2JU5 A;  3BJ5 A;  2G0F A;  2KHP A;  1B48 A;  1M2B A;  1B4Q A;  1DE1 A;  5IIZ A;  5AIV A;  3M9K A;  4MA9 A;  3ZIT A;  4GWR A;  3FRC A;  4JR6 A;  3KZQ A;  1XCC A;  4MJE A;  2N5F A;  1KNG A;  4TVE A;  3ME7 A;  4O92 A;  2MZC A;  3K8N A;  2GDR A;  2LNS A;  3ED3 A;  3FW2 A;  4FYB A;  4HOJ A;  18GS A;  2N5B A;  1FHE A;  3P90 A;  2V6K A;  5A5K A;  4NV5 A;  1T4Y A;  1URM A;  2LEG A;  3LFL A;  4MZC A;  2K9F A;  3I43 A;  4J57 E;  3TRP A;  5JWR B;  4K5S A;  3ZYW A;  4FYC A;  2HRN A;  3L9S A;  1O8X A;  5LCZ A;  2V41 A;  1B9X C;  2O89 A;  4CW9 A;  3VPT A;  1HNC A;  5IQY A;  1ILO A;  3IDV A;  3D5J A;  1EEM A;  3GMF A;  3FKF A;  2PVQ A;  4Z2R A;  3EMP A;  4BPY A;  1XVW A;  1TU7 A;  2IL3 A;  4K7I A;  4G19 A;  3P2A A;  2FCH A;  1X9W B;  1TTZ A;  2F9S A;  3GX0 A;  4L5O A;  4CY6 A;  4IJ3 A;  2K8S A;  3QFA C;  2X49 A;  1UA5 A;  3HVX A;  5IMA A;  2DJ0 A;  3D0Z A;  1WPI A;  1YQ1 A;  5B8B A;  1GTU A;  5HR0 A;  2IFQ B;  3IC4 A;  2YNX A;  1WOU A;  2OA7 A;  3TB2 A;  2LQO A;  3CBU A;  1CQH A;  3G7J A;  2MBT A;  3J7Y b;  5ECP B;  2LST A;  1Z6N A;  3WGX A;  1MEK A;  1SKW B;  1V98 A;  4ZIJ A;  2REM A;  1FOH A;  1GUL A;  1Q4J A;  5CRG A;  3VUR A;  3S9F A;  3RPN A;  1DUG A;  3UBK A;  4ICY A;  1B9Y C;  2A4H A;  1U6T A;  3FZA A;  1PX7 A;  2DMM A;  1ZOF A;  4OWY A;  1PSQ A;  1GSQ A;  2GGT A;  1THX A;  3GTU B;  1TXX A;  4AJ6 A;  1O6J A;  3CMI A;  1HYU A;  6GSU A;  4LA1 A;  5CO3 A;  2YPM A;  4N0Z A;  6GSV A;  4G9H A;  3M8N A;  4EDY A;  1XWA A;  2KOK A;  3IAS 2;  5DJL A;  2MYG A;  2ZNM A;  3L9V A;  4K1F A;  4LL1 B;  3TJJ A;  2H70 A;  3FR9 A;  4KA0 A;  5B7C A;  3UIW A;  3ZLP A;  1Z3E A;  2VL3 A;  5G5E A;  1QFN A;  4LLR A;  4DSS A;  2M80 A;  4MF5 A;  1Z7P A;  1K0N A;  4HJ2 A;  3I6A A;  3VWX A;  5A4W A;  4WKW A;  1GUK A;  1YZX A;  3TRQ A;  5HFK A;  3MIX A;  3DML A;  2VCV A;  5KN1 A;  1U88 A;  5KOX A;  3KP8 A;  2XPD A;  3DD3 A;  1YY7 A;  2VOC A;  2YWN A;  4YQM A;  2CX3 A;  2GT5 A;  3LSZ A;  3TJB A;  1WP0 A;  5G1K A;  1ZYN A;  3UJ1 A;  3MAK A;  1GLQ A;  4I5Q A;  4POL A;  2VLV A;  3GSS A;  2WGR A;  4NPB A;  2VM2 A;  2NDO A;  1WWJ A;  2NPB A;  1WRY A;  4I8B A;  4Q5F A;  3TGZ A;  1UC7 A;  5DDL A;  1GLP A;  4K8M A;  3KMO A;  3GUS A;  4NAX A;  2DJ3 A;  3ZIV A;  1XW5 A;  1VF3 A;  2C0E A;  1FAA A;  3U5R E;  4G0L A;  2LQQ A;  4WBR D;  1WE0 A;  2VCQ A;  3DXB A;  5J3R A;  1K0M A;  4D73 B;  10GS A;  1V9W A;  1C72 A;  3IPZ A;  2CAQ A;  1TRW A;  3LYP A;  2BMX A;  4L0U A;  3WD6 A;  3PIN A;  2DLX A;  4J2F A;  2FWH A;  2PVO C;  4TOP A;  1FOV A;  2O8V B;  3DRN A;  1G0T A;  4ZBB A;  2XHF A;  1TI3 A;  4K5R A;  2VL2 C;  5JWQ B;  4F2I A;  3GH6 A;  4MH3 A;  3TJK A;  2DKH A;  3EMX A;  2RII A;  3IV4 A;  3EC3 A;  1Y6E A;  5IMC A;  3Q74 A;  2WJU A;  3EVI A;  5JCU A;  4HUA A;  3GL5 A;  4WBJ A;  4BWQ A;  5KOW A;  5CRD A;  1U3I A;  3QDN A;  3RAZ A;  1LU4 A;  2QA1 A;  5GSS A;  2IJY A;  2X8H A;  1OC8 A;  1MDI A;  2XC2 A;  3GN3 A;  1HD2 A;  2J9H A;  2F8A A;  4EUY A;  1T4Z A;  5ECN B;  2PWJ A;  2PMT A;  6GSW A;  2PU9 C;  5GAN D;  3CSJ A;  4EKZ A;  1EP8 A;  3W8J A;  5J4U A;  3HZ4 A;  1W89 A;  1XWC A;  1B4P A;  2GSQ A;  2X8G A;  2HRA A;  5FWG A;  1S3D A;  3TKP A;  3W6G A;  4ZL8 A;  2I1U A;  5B8A A;  4MCU A;  6GST A;  3M0F A;  2FA8 A;  2JZR A;  5D9V A;  3VI7 A;  5F05 A;  5D73 A;  1F3A A;  1XW9 A;  1A0R P;  2YOI A;  2K18 A;  1DE2 A;  4K7O A;  1U3A A;  2GQM A;  4CY8 A;  4Q5N A;  3IC8 A;  3LYK A;  1JFU A;  2GQK A;  4JED A;  3ZVJ D;  5ID2 A;  3APO A;  16GS A;  2JSZ A;  4ECC A;  4BIK A;  3BBY A;  3GHA A;  2QC7 A;  4G0K A;  2H6X A;  2FUG 2;  4K2D A;  1R7H A;  4IVF A;  4EF0 A;  3F3Q A;  1OAZ A;  2H76 A;  4O7H A;  1X5E A;  4YQV A;  3GRX A;  2I81 A;  2KP1 A;  5H5R A;  1AQW A;  1PD2 1;  3FK8 A;  1PL2 A;  4YAV A;  2H01 A;  1GRX A;  5DJM A;  1FB0 A;  4OCF A;  1MDK A;  3HZ8 A;  4EL1 A;  4IQ1 A;  3DWV A;  1PGT A;  1JZR A;  3ZML A;  2F51 A;  1T7P B;  2MMO A;  3KTB A;  4ACS A;  2EIR A;  5H5Q A;  1GSY A;  1ERT A;  3QFB C;  2E2G A;  2DIY A;  2P31 A;  1PN9 A;  5GAP D;  1BAY A;  2L5O A;  3Q6O A;  1AUC A;  1GL8 A;  5HR1 A;  2B7J A;  2R0P A;  2GLR A;  4I6X A;  1V57 A;  4TR1 A;  3GNJ A;  1ZL9 A;  2HT9 A;  3D4M A;  2HRK A;  1O7U A;  3GKK A;  4E8E A;  3C73 A;  3E3E A;  1PKZ A;  1H75 A;  2CZ3 A;  3M3M A;  1K0B A;  4K9Z A;  3LW9 A;  4LMV A;  2OAD A;  1BED A;  3CRT A;  4MJA A;  4K6X A;  4EIP A;  1ZMA A;  3UVH A;  3KCM A;  2X4A A;  4HQZ A;  1Z7R A;  3D6I A;  6GSY A;  1X9M B;  4KE3 A;  5LNK e;  3EU4 A;  3ERW A;  4G0I A;  2VAF A;  2YCD A;  4LL4 B;  3KP9 A;  4XTS A;  1SL0 B;  1FB6 A;  4EVM A;  2A2S A;  3TKR A;  3F3R A;  2IMK A;  2C4J A;  3HXS A;  2E2M A;  4Z2U A;  3KGK A;  3AY8 A;  2H1G A;  3UEM A;  5F06 A;  1K0A A;  5ENU A;  4POB A;  1M7T A;  1TK5 B;  4QQ7 A;  2GSR A;  3H4K A;  1TU8 A;  2GSS A;  3ME8 A;  4PUR A;  4ZB9 A;  3CSH A;  5COH A;  2OJL A;  1U87 A;  5A4U A;  1K0D A;  3PR8 A;  2LJA A;  5ECM B;  3LXT A;  3GL3 A;  4JR4 A;  2AJQ B;  3HDC A;  1TK0 B;  4O32 A;  4HI7 A;  1OE7 A;  4BL7 B;  1YKA A;  1XZO A;  2P5R A;  1I9D A;  4IHU A;  3GKN A;  2VD0 A;  1Q98 A;  1IYI A;  1O81 A;  5C00 A;  3BCI A;  3ZL5 A;  1TP9 A;  2L4Q A;  2WRT A;  4OCE A;  5J9B A;  4F03 A;  3QMX A;  2OE0 A;  4ZL7 A;  2VCX A;  5D8I A;  2C3N A;  4HQS A;  3J7Y k;  4KX4 A;  2OAC A;  3EU3 A;  2GS3 A;  2H1B A;  2OE1 A;  2LTK A;  1OC9 A;  3FY7 A;  2ON5 A;  2OBK A;  4HDE A;  1FVJ A;  2R5G A;  4IN0 A;  3RPP A;  2HZE A;  1GSE A;  1AQX A;  5B6N A;  1JLV A;  1G6Y A;  2B5E A;  1PFO A;  4IW9 A;  3N5O A;  1XXU A;  1F9M A;  2MMA A;  4OO4 A;  5ECH B;  4GTU A;  3LOR A;  4ZB8 A;  3P8W A;  2LS5 A;  5IO0 A;  3ZVJ A;  3UAR A;  4HJM A;  5KN3 A;  2V32 A;  2FWG A;  2YV9 A;  2L5L A;  2R4V A;  4Q5R A;  1E2Y A;  1PN0 A;  3KTL A;  3LXZ A;  4YAP A;  4JBB A;  1Z9H A;  2CAI A;  4IP1 A;  1YJ6 A;  2GVP A;  2KP2 A;  1QUW A;  4X0X A;  1BYE A;  1V58 A;  3ZIJ A;  4TR4 A;  3HVV A;  4QL7 A;  3G7I A;  1A0F A;  1SEN A;  2P5Q A;  3QR6 A;  3I9V 2;  2GT6 A;  1S3R A;  1TRU A;  3DVX A;  4RUV A;  3H79 A;  4XS1 A;  2LRN A;  2N5A A;  1NW2 A;  3F6F A;  3VK9 A;  3KMN A;  1A2M A;  3DEX A;  3H1N A;  4P3Y B;  5LD0 A;  1ML6 A;  1SK2 A;  5FT3 A;  5EL8 A;  4BA7 A;  5DCH A;  4BVX A;  2WCI A;  2CA8 A;  5D9W A;  5ECK B;  5G2Z A;  2HNL A;  4JE1 A;  1FG4 A;  1THO A;  2FD3 A;  3C8E A;  1SD8 A;  4PX1 A;  2JSY A;  4PNG A;  4DEJ A;  3UMA A;  1XOA A;  1VF1 A;  2R3X A;  5D93 A;  2VCZ A;  3ZRE A;  1N2A A;  2I4A A;  1KEB A;  4MMM A;  4IEL A;  5DAK A;  2R2J A;  3F0I A;  3FEU A;  5INY A;  2JAD A;  1WMJ A;  2X64 A;  4MDC A;  2VIM A;  4FQU A;  4GQF A;  2VCW A;  3DIE A;  2E0Q A;  1O73 A;  3GUR A;  2TIR A;  1TW9 A;  4XS4 A;  4F82 A;  4MJB A;  1N8J A;  3LG6 A;  2B3S A;  3BOA A;  5AN1 A;  2H30 A;  1UVZ A;  1T1V A;  2H19 A;  4GST A;  2FHE A;  1NSW A;  5G30 A;  3KD0 A;  5F07 A;  2NVL A;  4OMV A;  3TJF A;  1SYR A;  4KSO A;  4I2U A;  4BWS A;  5G5F A;  3VWU A;  1SL1 B;  4NMU A;  2YWI A;  3GKM A;  1M9A A;  3KM6 A;  1PA3 A;  2LRT A;  4LMW A;  2WB9 A;  2F3M A;  2AHE A;  3TDG A;  3UAP A;  8GSS A;  4KB3 A;  1SJ6 A;  3NOF A;  3IA1 A;  4I97 A;  2GQL A;  4F0C A;  1USB A;  4EIQ A;  3IK9 A;  2LJK A;  1OE8 A;  3NZN A;  2VL2 A;  1FVK A;  2CQ9 A;  3E9J B;  2BTO T;  3CRU A;  1JZW A;  1YEP A;  5CP1 A;  5JCG A;  4JZQ A;  5KN2 A;  2LKU A;  1GTA A;  3EE2 A;  2QA2 A;  1RK4 A;  1TKD B;  1ZZY A;  2YN1 A;  3E0U A;  4KW6 A;  5AGY A;  3FHK A;  4ECB A;  2EIQ A;  4K2X A;  1F6M C;  4PGT A;  4IS0 A;  3O3T A;  4MZW A;  3MDK A;  2ES7 A;  1Z6M A;  3SWL A;  5EVO A;  2JZS A;  2YJH A;  1W4V A;  3P7X A;  2H6Y A;  4N11 A;  1PQN A;  2WFC A;  3FMW A;  2YZH A;  1RQM A;  2GZY A;  2D2Z A;  1ZYP A;  3KH9 A;  4WF5 A;  1YEX A;  1ERV A;  1G7O A;  2H75 A;  4V2N A;  2VD1 A;  1T3B A;  4OFM A;  3CSI A;  2ZUP A;  1GNE A;  1M99 A;  1DSB A;  1GTB A;  2HI7 A;  4KDX A;  2PER A;  3MYD A;  2RLI A;  3W8S A;  4N10 A;  3IOS A;  1K3O A;  2C0G A;  3ERF A;  4L0W A;  1QMV A;  4F9Z A;  5AIS A;  2CVK A;  2VO4 A;  4WR4 A;  2K8V A;  2HZF A;  4XRA A;  3GV1 A;  5IOW A;  3D21 A;  3EIN A;  3HCZ A;  1WIK A;  1EWX A;  4PQ1 A;  4OFT A;  1X0R A;  1XWG A;  5J9C A;  4DSR A;  1XPV A;  4TR0 A;  2C8U A;  2TRC P;  1A8L A;  2HZE B;  2F8F A;  1OKT A;  2P0G A;  3HY2 A;  2B1K A;  4YKF A;  4H86 A;  1XW6 A;  3HYP A;  1GSS A;  4PXO A;  5IPH A;  3PPU A;  3F4R A;  2HSM A;  3HA9 A;  1ZYQ B;  3GKX A;  4WEY A;  4NHW A;  2YZU A;  3HJM A;  1SL2 B;  1R5P A;  2HSH A;  4POM A;  2Z9S A;  3QD9 A;  3M9J A;  2HFD A;  2KLX A;  4KCE A;  4GLT A;  3WT1 A;  5KEJ A;  1FW1 A;  2YWM A;  3IK7 A;  4IQA A;  2GST A;  4JU5 A;  4NV2 A;  1ZCP A;  3RHB A;  3V1W A;  3MNG A;  4K0G A;  3IHQ A;  1NM3 A;  1LBK A;  4GRF A;  4ZB6 A;  1BQ7 A;  4MJC A;  4DSQ A;  3HD5 A;  4OO5 A;  4PTS A;  3UVT A;  2MMN A;  2AAW A;  14GS A;  4FIW A;  2RM6 A;  4HS1 A;  2DJ2 A;  3QPM A;  5G1L A;  2AV4 A;  2C1Y A;  5A4V A;  1GTI A;  3TKS C;  1X9S B;  4X1U A;  3I69 A;  1QGV A;  3VI5 A;  2B5X A;  3DYR A;  3ZMK A;  1Z5Y E;  2IPA A;  2IMD A;  3U6V A;  2H66 A;  4MZB A;  4V1A p;  1OC3 A;  3KEB A;  3L78 A;  5CRE A;  2EIO A;  5HR2 A;  3WGD A;  1DBY A;  2VCT A;  20GS A;  2R37 A;  2R6K A;  4XCS A;  4USS A;  4ECJ A;  1F37 A;  2PPT A;  3FR6 A;  4FH8 A;  5HR3 A;  1A2L A;  2WUL A;  1O85 A;  3VWV A;  3ZFL A;  5EPF A;  3LQ7 A;  2FY6 A;  3FZ4 A;  2YP6 A;  5IM9 A;  1I5G A;  3F8U A;  2WS2 A;  1X5C A;  3N9J A;  4DSS B;  3UL3 A;  3HJO A;  1JZO A;  3L4N A;  2XBQ A;  4KDY A;  5IPG A;  1G6W A;  4WXT A;  2FWE A;  4GSS A;  4NHZ A;  4ML6 A;  19GS A;  3US3 A;  3R3E A;  4IKH A;  2B5Y A;  3A2W A;  2PBJ A;  3F6D A;  1J9B A;  3C7M A;  3TRX A;  3HKR A;  1T00 A;  3NIV A;  3KXO A;  1F3B A;  3L0H A;  3QCP A;  3HHV A;  3GH9 A;  2DML A;  3CQF A;  4XRD A;  1PRX A;  2AYT A;  4KND A;  2LUS A;  4IGJ A;  3WT2 A;  2M72 A;  4D73 A;  3GST A;  3QAV A;  2VL9 A;  4E8H A;  2I3Y A;  4PUA A;  1J0F A;  1YF0 A;  5AIX A;  2JAC A;  3ISO A;  3A5I A;  1T8E B;  5J5N A;  5ECQ B;  2LRC A;  4K7N A;  1VF2 A;  1OYJ A;  4XS6 A;  1NHO A;  5L71 A;  5EY6 A;  1E6B A;  4IBP A;  2H0H A;  2C0F A;  2PN8 A;  1SD9 A;  2WDU A;  4GXZ A;  5GZZ B;  2FGX A;  4OD7 A;  2A2P A;  3F9U A;  3H8Q A;  4KAE A;  5J41 A;  1ZYE A;  1AW9 A;  1KTE A;  2DIZ A;  2HYX A;  3IE3 A;  2IIY A;  1M3J A;  2RM5 A;  5G31 A;  4HZ4 A;  1SK0 A;  1O8W A;  3EYT A;  2H0G A;  1KBN A;  4F0B A;  4NWY A;  2H0I A;  2XPE A;  2OKA A;  4ZBD A;  5D9T A;  2R0G A;  2G2Q A;  4TN8 A;  4PQH A;  4ZIL A;  2H6Z A;  2GZZ A;  4XHM A;  3FR3 A;  2X8C A;  5ABR A;  3G9B A;  3UBL A;  1ABA A;  1JZD A;  2YWO A;  2MMZ A;  5HQP A;  4KSM A;  5F8B A;  4N0V A;  3LEF A;  4EDZ A;  4O5R A;  2B7K A;  2OBI A;  2H8L A;  1J08 A;  3OR5 A;  5DVB A;  4EXJ A;  3R2Q A;  4GF0 A;  1TJD A;  2RUF A;  4MNN A;  3H93 A;  5D9X A;  2FWF A;  3CYN A;  13GS A;  4TXO A;  4QL9 A;  3VFI A;  4KUN A;  5ECI B;  1GNW A;  5IMF A;  5GST A;  3FZ5 A;  4GSN A;  4X43 A;  3GFK A;  2IMF A;  1GUM A;  5E59 A;  5FHI A;  3A3T A;  5DAL A;  2LV3 A;  2H1A A;  2IMI A;  4TR3 A;  3TKQ A;  3EPT A;  1H4O A;  4KDU A;  2DJ1 A;  1QQ2 A;  1XBS A;  4WF4 A;  5CRW A;  2NBS A;  1XOB A;  4J56 E;  3LJR A;  1MTC A;  3PGT A;  3F4T A;  1TRS A;  5ELA A;  5IO2 A;  5ID2 B;  2NTO A;  3HVS A;  4BVY A;  2H73 A;  4MK3 A;  3HVN A;  1GUH A;  2JZT A;  1PL1 A;  1XVQ A;  1IYH A;  1M2D A;  3C1R A;  3FYG A;  1ACV A;  3M1G A;  2CT6 A;  3GX8 A;  3IXR A;  3BD2 A;  4AJ7 A;  3APQ A;  4I2T A;  5IMD A;  3KH7 A;  3TCO A;  3IRA A;  2PGT A;  1TK8 B;  11GS A;  3TKS E;  3VLN A;  1XFL A;  1QK8 A;  2HSY A;  2L6D A;  4K0N A;  2L4C A;  2R0C A;  5B6M A;  3MSZ A;  1YDK A;  3Q18 A;  2K6V A;  4RQX A;  1K3L A;  3JCM L;  1OVN A;  2BJX A;  1K3Y A;  4TW5 A;  2H72 A;  3L9U A;  1R26 A;  2ALB A;  5C04 A;  2YAN A;  4HZ2 A;  1A2J A;  1PMT A;  1EGR A;  1YF1 A;  1K0C A;  2JL4 A;  3HJP A;  1M0U A;  1RW1 A;  3TOT A;  5ELG A;  5IMZ A;  4Z7X A;  4TR1 B;  4L5L A;  4RI7 A;  3FZ9 A;  1XWK A;  1XWB A;  4KCA A;  1S3C A;  1TOF A;  1GSD A;  1ON4 A;  2PUK C;  5ECR B;  4MPF A;  2CZ2 A;  3A2X A;  4ULX A;  3WGE A;  5ECL B;  2RUE A;  2MBS A;  3D22 A;  5F0G A;  3RBT A;  4KF9 A;  2WZ9 A;  5HFG A;  4ECI A;  4RQR A;  2B6M A;  1BG5 A;  1EEJ A;  5H5S A;  5DQS A;  2X99 A;  3ERG A;  3IAM 2;  4N30 A;  1X5D A;  5CNW A;  1EZK A;  1V2A A;  4KH7 A;  6GSX A;  1GSU A;  4L8E A;  1UN2 A;  4A5P A;  1BJX A;  3TUE A;  4RI6 A;  3LWA A;  5KN0 A;  5ECO B;  1M3I A;  1ST9 A;  4AJ8 A;  3GYK A;  2YV7 A;  3ZRD A;  2QGV A;  4PUF C;  2VLU A;  4O5U A;  2IN3 A;  1A24 A;  3GIX A;  2HXK A;  2H1D A;  3IHG A;  2HLS A;  4AGS A;  1TDI A;  1SJI A;  4BL7 A;  2IWT A;  2KUC A;  4ZXG A;  22GS A;  4GCI A;  2ON7 A;  3RDW A;  3A5W A;  3QOU A;  4G2E A;  3SBC A;  4PNF A;  4ML1 A;  1GP1 A;  2L59 A;  3F4S A;  2HRF A;  3A2V A;  3D4T A;  4PQI A;  1A8Y A;  3UOM A;  4WR5 A;  4EO3 A;  1A23 A;  3LGC A;  1B8X A;  2AUV A;  4HU7 A;  2QSI A;  2GZP A;  3VPQ A;  1BX9 A;  2L6C A;  4ISD A;  2M46 A;  2AB6 A;  1SKS B;  4TXV A;  1AAZ A;  1YKC A;  5CAX A;  1EV9 A;  3KIJ A;  1Y25 A;  6GSS A;  3ZFB A;  4Z2T A;  3VWW A;  2DBC A;  1HNA A;  1G7E A;  2V1M A;  4ZL9 A;  2UZ8 A;  3DVW A;  1VGL A;  2VLT A;  4DVC A;  2FNO A;  2CV4 A;  1NHY A;  17GS A;  1MD3 A;  2OE3 A;  4GQC A;  1S3A A;  1CQG A;  5IOX A;  2QKE A;  3CXG A;  1OC9 B;  2LJR A;  5ECS A;  2DKI A;  2ZCT A;  4HEA 2;  5D96 A;  3GA4 A;  3IR4 A;  5E4W A;  2IFQ A;  2J23 A;  1SYX A;  1EGO A;  2H74 A;  1GSF A;  3EUR A;  4POK A;  3CTF A;  2VM1 A;  1GH2 A;  1GWC A;  3ZTL A;  4HU9 A;  2HE3 A;  4TRX A;  4IP6 A;  1WJK A;  4TXO B;  3TJG A;  4ZBA A;  7GSS A;  12GS A;  1FO5 A;  2FA4 A;  4MF7 A;  2O7K A;  1MDJ A;  2CVD A;  5DAL B;  1R4W A;  3DGQ A;  1MD4 A;  1JHB A;  1M2A A;  2GTU A;  3CTG A;  2DJJ A;  1XIY A;  2VUP A;  3O6T A;  1HQO A;  3EWL A;  3BCK A;  4YKG A;  1ERU A;  3TKS A;  5BMU A;  2DSA A;  3C1S A;  1AXD A;  1SK1 A;  1AIU A;  4KGI A;  1AQV A;  4G10 A;  2B1L A;  3GTU A;  4YQU A;  1QXH A;  1LJR A;  4OFN A;  1EOH A;  4BVY B;  2H71 A;  1M9B A;  2DJK A;  3APS A;  3Q19 A;  2L57 A;  2O87 A;  1PKW A;  4CDO A;  2A4V A;  2YJ7 A;  4MPG A;  1R5A A;  3RHC A;  5DBQ A;  1F2E A;  2C0D A;  2A2R A;  2V2G A;  3ZZX A;  1EP7 A;  4TKY A;  2TRX A;  1VF4 A;  3DKS A;  3KJY A;  5JCW A;  4MF6 A;  4BVX B;  3WYW A;  1EV4 A;  4CHS A;  2I9H A;  4WET A;  1HNB A;  4V2L A;  5HFI A;  1ZGN A;  4Q5Q A;  1EOG A;  4ILF A;  5IMV A;  2C3Q A;  1SKR B; 
#chains in the Genus database with same CATH homology
 2E7P A;  4MP4 A;  4YH2 A;  4O5Q A;  2O85 A;  4EC0 A;  3G7Y A;  5DQY A;  2C80 A;  1AC1 A;  5BRT A;  5DAK B;  4V1A g;  5DCG A;  2EC4 A;  5JWO B;  5CRH A;  2V6O A;  1PX6 A;  3IBH A;  2CX4 A;  2LNT A;  4MLY A;  1TRV A;  4V2M A;  4AF2 A;  3C71 A;  3F63 A;  3QAG A;  2CVB A;  4XS4 B;  3QAW A;  4MH2 A;  1JLW A;  4FO5 A;  2DC5 A;  4X4J A;  4ID0 A;  5CYY A;  9GSS A;  2IME A;  3TOU A;  1K0O A;  2C3T A;  3PH9 A;  3O76 A;  1V40 A;  4JRR A;  4FYU A;  1VRS D;  1TI1 A;  4MAB A;  4NXI A;  1ERW A;  3MWH A;  1SU9 A;  1SJZ A;  2FLS A;  4XIH A;  4EE0 A;  1OKD A;  4IJI A;  2XBI A;  2JU5 A;  3BJ5 A;  2G0F A;  2KHP A;  1B48 A;  1M2B A;  1B4Q A;  1DE1 A;  5IIZ A;  5AIV A;  3M9K A;  4MA9 A;  3ZIT A;  4GWR A;  3FRC A;  4JR6 A;  3KZQ A;  1XCC A;  4MJE A;  2N5F A;  1KNG A;  4TVE A;  3ME7 A;  4O92 A;  2MZC A;  3K8N A;  2GDR A;  2LNS A;  3ED3 A;  3FW2 A;  4FYB A;  4HOJ A;  18GS A;  2N5B A;  1FHE A;  3P90 A;  2V6K A;  5A5K A;  4NV5 A;  1T4Y A;  1URM A;  2LEG A;  3LFL A;  4MZC A;  2K9F A;  3I43 A;  4J57 E;  3TRP A;  5JWR B;  4K5S A;  3ZYW A;  4FYC A;  2HRN A;  3L9S A;  1O8X A;  5LCZ A;  2V41 A;  1B9X C;  2O89 A;  4CW9 A;  3VPT A;  1HNC A;  5IQY A;  1ILO A;  3IDV A;  3D5J A;  1EEM A;  3GMF A;  3FKF A;  2PVQ A;  4Z2R A;  3EMP A;  4BPY A;  1XVW A;  1TU7 A;  2IL3 A;  4K7I A;  4G19 A;  3P2A A;  2FCH A;  1X9W B;  1TTZ A;  2F9S A;  3GX0 A;  4L5O A;  4CY6 A;  4IJ3 A;  2K8S A;  3QFA C;  2X49 A;  1UA5 A;  3HVX A;  5IMA A;  2DJ0 A;  3D0Z A;  1WPI A;  1YQ1 A;  5B8B A;  1GTU A;  5HR0 A;  2IFQ B;  3IC4 A;  2YNX A;  1WOU A;  2OA7 A;  3TB2 A;  2LQO A;  3CBU A;  1CQH A;  3G7J A;  2MBT A;  3J7Y b;  5ECP B;  2LST A;  1Z6N A;  3WGX A;  1MEK A;  1SKW B;  1V98 A;  4ZIJ A;  2REM A;  1FOH A;  1GUL A;  1Q4J A;  5CRG A;  3VUR A;  3S9F A;  3RPN A;  1DUG A;  3UBK A;  4ICY A;  1B9Y C;  2A4H A;  1U6T A;  3FZA A;  1PX7 A;  2DMM A;  1ZOF A;  4OWY A;  1PSQ A;  1GSQ A;  2GGT A;  1THX A;  3GTU B;  1TXX A;  4AJ6 A;  1O6J A;  3CMI A;  1HYU A;  6GSU A;  4LA1 A;  5CO3 A;  2YPM A;  4N0Z A;  6GSV A;  4G9H A;  3M8N A;  4EDY A;  1XWA A;  2KOK A;  3IAS 2;  5DJL A;  2MYG A;  2ZNM A;  3L9V A;  4K1F A;  4LL1 B;  3TJJ A;  2H70 A;  3FR9 A;  4KA0 A;  5B7C A;  3UIW A;  3ZLP A;  1Z3E A;  2VL3 A;  5G5E A;  1QFN A;  4LLR A;  4DSS A;  2M80 A;  4MF5 A;  1Z7P A;  1K0N A;  4HJ2 A;  3I6A A;  3VWX A;  5A4W A;  4WKW A;  1GUK A;  1YZX A;  3TRQ A;  5HFK A;  3MIX A;  3DML A;  2VCV A;  5KN1 A;  1U88 A;  5KOX A;  3KP8 A;  2XPD A;  3DD3 A;  1YY7 A;  2VOC A;  2YWN A;  4YQM A;  2CX3 A;  2GT5 A;  3LSZ A;  3TJB A;  1WP0 A;  5G1K A;  1ZYN A;  3UJ1 A;  3MAK A;  1GLQ A;  4I5Q A;  4POL A;  2VLV A;  3GSS A;  2WGR A;  4NPB A;  2VM2 A;  2NDO A;  1WWJ A;  2NPB A;  1WRY A;  4I8B A;  4Q5F A;  3TGZ A;  1UC7 A;  5DDL A;  1GLP A;  4K8M A;  3KMO A;  3GUS A;  4NAX A;  2DJ3 A;  3ZIV A;  1XW5 A;  1VF3 A;  2C0E A;  1FAA A;  3U5R E;  4G0L A;  2LQQ A;  4WBR D;  1WE0 A;  2VCQ A;  3DXB A;  5J3R A;  1K0M A;  4D73 B;  10GS A;  1V9W A;  1C72 A;  3IPZ A;  2CAQ A;  1TRW A;  3LYP A;  2BMX A;  4L0U A;  3WD6 A;  3PIN A;  2DLX A;  4J2F A;  2FWH A;  2PVO C;  4TOP A;  1FOV A;  2O8V B;  3DRN A;  1G0T A;  4ZBB A;  2XHF A;  1TI3 A;  4K5R A;  2VL2 C;  5JWQ B;  4F2I A;  3GH6 A;  4MH3 A;  3TJK A;  2DKH A;  3EMX A;  2RII A;  3IV4 A;  3EC3 A;  1Y6E A;  5IMC A;  3Q74 A;  2WJU A;  3EVI A;  5JCU A;  4HUA A;  3GL5 A;  4WBJ A;  4BWQ A;  5KOW A;  5CRD A;  1U3I A;  3QDN A;  3RAZ A;  1LU4 A;  2QA1 A;  5GSS A;  2IJY A;  2X8H A;  1OC8 A;  1MDI A;  2XC2 A;  3GN3 A;  1HD2 A;  2J9H A;  2F8A A;  4EUY A;  1T4Z A;  5ECN B;  2PWJ A;  2PMT A;  6GSW A;  2PU9 C;  5GAN D;  3CSJ A;  4EKZ A;  1EP8 A;  3W8J A;  5J4U A;  3HZ4 A;  1W89 A;  1XWC A;  1B4P A;  2GSQ A;  2X8G A;  2HRA A;  5FWG A;  1S3D A;  3TKP A;  3W6G A;  4ZL8 A;  2I1U A;  5B8A A;  4MCU A;  6GST A;  3M0F A;  2FA8 A;  2JZR A;  5D9V A;  3VI7 A;  5F05 A;  5D73 A;  1F3A A;  1XW9 A;  1A0R P;  2YOI A;  2K18 A;  1DE2 A;  4K7O A;  1U3A A;  2GQM A;  4CY8 A;  4Q5N A;  3IC8 A;  3LYK A;  1JFU A;  2GQK A;  4JED A;  3ZVJ D;  5ID2 A;  3APO A;  16GS A;  2JSZ A;  4ECC A;  3BBY A;  3GHA A;  2QC7 A;  4G0K A;  2H6X A;  2FUG 2;  4K2D A;  1R7H A;  4IVF A;  4EF0 A;  3F3Q A;  1OAZ A;  2H76 A;  4O7H A;  1X5E A;  4YQV A;  3GRX A;  2I81 A;  2KP1 A;  5H5R A;  1AQW A;  1PD2 1;  3FK8 A;  1PL2 A;  4YAV A;  2H01 A;  1GRX A;  5DJM A;  1FB0 A;  4OCF A;  1MDK A;  3HZ8 A;  4EL1 A;  4IQ1 A;  3DWV A;  1PGT A;  1JZR A;  3ZML A;  2F51 A;  1T7P B;  2MMO A;  3KTB A;  4ACS A;  2EIR A;  5H5Q A;  1GSY A;  1ERT A;  3QFB C;  2E2G A;  2DIY A;  2P31 A;  1PN9 A;  5GAP D;  1BAY A;  2L5O A;  3Q6O A;  1AUC A;  1GL8 A;  5HR1 A;  2B7J A;  2R0P A;  2GLR A;  4I6X A;  1V57 A;  4TR1 A;  3GNJ A;  1ZL9 A;  2HT9 A;  3D4M A;  2HRK A;  1O7U A;  3GKK A;  4E8E A;  3C73 A;  3E3E A;  1PKZ A;  1H75 A;  2CZ3 A;  3M3M A;  1K0B A;  4K9Z A;  3LW9 A;  4LMV A;  2OAD A;  1BED A;  3CRT A;  4MJA A;  4K6X A;  4EIP A;  1ZMA A;  3UVH A;  3KCM A;  2X4A A;  4HQZ A;  1Z7R A;  3D6I A;  6GSY A;  1X9M B;  4KE3 A;  5LNK e;  3EU4 A;  3ERW A;  4G0I A;  2VAF A;  2YCD A;  4LL4 B;  3KP9 A;  4XTS A;  1SL0 B;  1FB6 A;  4EVM A;  2A2S A;  3TKR A;  3F3R A;  2IMK A;  2C4J A;  3HXS A;  2E2M A;  4Z2U A;  3KGK A;  3AY8 A;  2H1G A;  3UEM A;  5F06 A;  1K0A A;  5ENU A;  4POB A;  1M7T A;  1TK5 B;  4QQ7 A;  2GSR A;  3H4K A;  1TU8 A;  2GSS A;  3ME8 A;  4PUR A;  4ZB9 A;  3CSH A;  5COH A;  2OJL A;  1U87 A;  5A4U A;  1K0D A;  3PR8 A;  2LJA A;  5ECM B;  3LXT A;  3GL3 A;  4JR4 A;  2AJQ B;  3HDC A;  1TK0 B;  4O32 A;  4HI7 A;  1OE7 A;  4BL7 B;  1YKA A;  1XZO A;  2P5R A;  1I9D A;  4IHU A;  3GKN A;  2VD0 A;  1Q98 A;  1IYI A;  1O81 A;  5C00 A;  3BCI A;  3ZL5 A;  1TP9 A;  2L4Q A;  2WRT A;  4OCE A;  5J9B A;  4F03 A;  3QMX A;  2OE0 A;  4ZL7 A;  2VCX A;  5D8I A;  2C3N A;  4HQS A;  3J7Y k;  4KX4 A;  2OAC A;  3EU3 A;  2GS3 A;  2H1B A;  2OE1 A;  2LTK A;  1OC9 A;  3FY7 A;  2ON5 A;  2OBK A;  4HDE A;  1FVJ A;  2R5G A;  4IN0 A;  3RPP A;  2HZE A;  1GSE A;  1AQX A;  5B6N A;  1JLV A;  1G6Y A;  2B5E A;  4IW9 A;  3N5O A;  1XXU A;  1F9M A;  2MMA A;  4OO4 A;  5ECH B;  4GTU A;  3LOR A;  4ZB8 A;  3P8W A;  2LS5 A;  5IO0 A;  3ZVJ A;  3UAR A;  4HJM A;  5KN3 A;  2V32 A;  2FWG A;  2YV9 A;  2L5L A;  2R4V A;  4Q5R A;  1E2Y A;  1PN0 A;  3KTL A;  3LXZ A;  4YAP A;  4JBB A;  1Z9H A;  2CAI A;  4IP1 A;  1YJ6 A;  2GVP A;  2KP2 A;  1QUW A;  4X0X A;  1BYE A;  1V58 A;  3ZIJ A;  4TR4 A;  3HVV A;  4QL7 A;  3G7I A;  1A0F A;  1SEN A;  2P5Q A;  3QR6 A;  3I9V 2;  2GT6 A;  1TRU A;  3DVX A;  4RUV A;  3H79 A;  4XS1 A;  2LRN A;  2N5A A;  1NW2 A;  3F6F A;  3VK9 A;  3KMN A;  1A2M A;  3DEX A;  3H1N A;  4P3Y B;  5LD0 A;  1ML6 A;  1SK2 A;  5FT3 A;  5EL8 A;  4BA7 A;  5DCH A;  4BVX A;  2WCI A;  2CA8 A;  5D9W A;  5ECK B;  5G2Z A;  2HNL A;  4JE1 A;  1FG4 A;  1THO A;  2FD3 A;  3C8E A;  1SD8 A;  4PX1 A;  2JSY A;  4PNG A;  4DEJ A;  3UMA A;  1XOA A;  1VF1 A;  2R3X A;  5D93 A;  2VCZ A;  3ZRE A;  1N2A A;  2I4A A;  1KEB A;  4MMM A;  4IEL A;  5DAK A;  2R2J A;  3F0I A;  3FEU A;  5INY A;  2JAD A;  1WMJ A;  2X64 A;  4MDC A;  2VIM A;  4FQU A;  4GQF A;  2VCW A;  3DIE A;  2E0Q A;  1O73 A;  3GUR A;  2TIR A;  1TW9 A;  4XS4 A;  4F82 A;  4MJB A;  1N8J A;  3LG6 A;  2B3S A;  3BOA A;  5AN1 A;  2H30 A;  1UVZ A;  1T1V A;  2H19 A;  4GST A;  2FHE A;  1NSW A;  5G30 A;  3KD0 A;  5F07 A;  2NVL A;  4OMV A;  3TJF A;  1SYR A;  4KSO A;  4I2U A;  4BWS A;  5G5F A;  3VWU A;  1SL1 B;  4NMU A;  2YWI A;  3GKM A;  1M9A A;  3KM6 A;  1PA3 A;  2LRT A;  4LMW A;  2WB9 A;  2F3M A;  2AHE A;  3TDG A;  3UAP A;  8GSS A;  4KB3 A;  1SJ6 A;  3NOF A;  3IA1 A;  4I97 A;  2GQL A;  4F0C A;  1USB A;  4EIQ A;  3IK9 A;  2LJK A;  1OE8 A;  3NZN A;  2VL2 A;  1FVK A;  2CQ9 A;  3E9J B;  2BTO T;  3CRU A;  1JZW A;  1YEP A;  5CP1 A;  5JCG A;  4JZQ A;  5KN2 A;  2LKU A;  1GTA A;  3EE2 A;  2QA2 A;  1RK4 A;  1TKD B;  1ZZY A;  2YN1 A;  3E0U A;  4KW6 A;  5AGY A;  3FHK A;  4ECB A;  2EIQ A;  4K2X A;  1F6M C;  4PGT A;  4IS0 A;  3O3T A;  4MZW A;  3MDK A;  2ES7 A;  1Z6M A;  3SWL A;  5EVO A;  2JZS A;  2YJH A;  1W4V A;  3P7X A;  2H6Y A;  4N11 A;  1PQN A;  2WFC A;  3FMW A;  2YZH A;  1RQM A;  2GZY A;  2D2Z A;  1ZYP A;  3KH9 A;  4WF5 A;  1YEX A;  1ERV A;  1G7O A;  2H75 A;  4V2N A;  2VD1 A;  1T3B A;  4OFM A;  3CSI A;  2ZUP A;  1GNE A;  1M99 A;  1DSB A;  1GTB A;  2HI7 A;  4KDX A;  2PER A;  3MYD A;  2RLI A;  3W8S A;  4N10 A;  3IOS A;  1K3O A;  2C0G A;  3ERF A;  4L0W A;  1QMV A;  4F9Z A;  5AIS A;  2CVK A;  2VO4 A;  4WR4 A;  2K8V A;  2HZF A;  4XRA A;  3GV1 A;  5IOW A;  3D21 A;  3EIN A;  3HCZ A;  1WIK A;  1EWX A;  4PQ1 A;  4OFT A;  1X0R A;  1XWG A;  5J9C A;  4DSR A;  1XPV A;  4TR0 A;  2C8U A;  2TRC P;  1A8L A;  2HZE B;  2F8F A;  1OKT A;  2P0G A;  3HY2 A;  2B1K A;  4YKF A;  4H86 A;  1XW6 A;  3HYP A;  1GSS A;  4PXO A;  5IPH A;  3PPU A;  3F4R A;  2HSM A;  3HA9 A;  1ZYQ B;  3GKX A;  4WEY A;  4NHW A;  2YZU A;  3HJM A;  1SL2 B;  1R5P A;  2HSH A;  4POM A;  2Z9S A;  3QD9 A;  3M9J A;  2HFD A;  2KLX A;  4KCE A;  4GLT A;  3WT1 A;  5KEJ A;  1FW1 A;  2YWM A;  3IK7 A;  4IQA A;  2GST A;  4JU5 A;  4NV2 A;  1ZCP A;  3RHB A;  3V1W A;  3MNG A;  4K0G A;  3IHQ A;  1NM3 A;  1LBK A;  4GRF A;  4ZB6 A;  1BQ7 A;  4MJC A;  4DSQ A;  3HD5 A;  4OO5 A;  4PTS A;  3UVT A;  2MMN A;  2AAW A;  14GS A;  4FIW A;  2RM6 A;  4HS1 A;  2DJ2 A;  3QPM A;  5G1L A;  2AV4 A;  2C1Y A;  5A4V A;  1GTI A;  3TKS C;  1X9S B;  4X1U A;  3I69 A;  1QGV A;  3VI5 A;  2B5X A;  3DYR A;  3ZMK A;  1Z5Y E;  2IPA A;  2IMD A;  3U6V A;  2H66 A;  4MZB A;  4V1A p;  1OC3 A;  3KEB A;  3L78 A;  5CRE A;  2EIO A;  5HR2 A;  3WGD A;  1DBY A;  2VCT A;  20GS A;  2R37 A;  2R6K A;  4XCS A;  4USS A;  4ECJ A;  1F37 A;  2PPT A;  3FR6 A;  4FH8 A;  5HR3 A;  1A2L A;  2WUL A;  1O85 A;  3VWV A;  3ZFL A;  5EPF A;  3LQ7 A;  2FY6 A;  3FZ4 A;  2YP6 A;  5IM9 A;  1I5G A;  3F8U A;  2WS2 A;  1X5C A;  3N9J A;  4DSS B;  3UL3 A;  3HJO A;  1JZO A;  3L4N A;  2XBQ A;  4KDY A;  5IPG A;  1G6W A;  4WXT A;  2FWE A;  4GSS A;  4NHZ A;  4ML6 A;  19GS A;  3US3 A;  3R3E A;  4IKH A;  2B5Y A;  3A2W A;  2PBJ A;  3F6D A;  1J9B A;  3C7M A;  3TRX A;  3HKR A;  1T00 A;  3NIV A;  3KXO A;  1F3B A;  3L0H A;  3QCP A;  3HHV A;  3GH9 A;  2DML A;  4XRD A;  1PRX A;  2AYT A;  4KND A;  2LUS A;  4IGJ A;  3WT2 A;  2M72 A;  4D73 A;  3GST A;  3QAV A;  2VL9 A;  4E8H A;  2I3Y A;  4PUA A;  1J0F A;  1YF0 A;  5AIX A;  2JAC A;  3ISO A;  3A5I A;  1T8E B;  5J5N A;  5ECQ B;  2LRC A;  4K7N A;  1VF2 A;  1OYJ A;  4XS6 A;  1NHO A;  5L71 A;  5EY6 A;  1E6B A;  4IBP A;  2H0H A;  2C0F A;  2PN8 A;  1SD9 A;  2WDU A;  4GXZ A;  5GZZ B;  2FGX A;  4OD7 A;  2A2P A;  3F9U A;  3H8Q A;  4KAE A;  5J41 A;  1ZYE A;  1AW9 A;  1KTE A;  2DIZ A;  2HYX A;  3IE3 A;  2IIY A;  2RM5 A;  5G31 A;  4HZ4 A;  1SK0 A;  1O8W A;  3EYT A;  2H0G A;  1KBN A;  4F0B A;  4NWY A;  2H0I A;  2XPE A;  2OKA A;  4ZBD A;  5D9T A;  2R0G A;  2G2Q A;  4TN8 A;  4PQH A;  4ZIL A;  2H6Z A;  2GZZ A;  4XHM A;  3FR3 A;  2X8C A;  5ABR A;  3G9B A;  3UBL A;  1ABA A;  1JZD A;  2YWO A;  2MMZ A;  5HQP A;  4KSM A;  5F8B A;  4N0V A;  3LEF A;  4EDZ A;  4O5R A;  2B7K A;  2OBI A;  2H8L A;  1J08 A;  3OR5 A;  5DVB A;  4EXJ A;  3R2Q A;  4GF0 A;  1TJD A;  2RUF A;  4MNN A;  3H93 A;  5D9X A;  2FWF A;  3CYN A;  13GS A;  4TXO A;  4QL9 A;  3VFI A;  4KUN A;  5ECI B;  1GNW A;  5IMF A;  5GST A;  3FZ5 A;  4GSN A;  4X43 A;  3GFK A;  2IMF A;  1GUM A;  5E59 A;  5FHI A;  3A3T A;  5DAL A;  2LV3 A;  2H1A A;  2IMI A;  4TR3 A;  3TKQ A;  3EPT A;  1H4O A;  4KDU A;  2DJ1 A;  1QQ2 A;  1XBS A;  4WF4 A;  5CRW A;  2NBS A;  1XOB A;  4J56 E;  3LJR A;  1MTC A;  3PGT A;  3F4T A;  1TRS A;  5ELA A;  5IO2 A;  5ID2 B;  2NTO A;  3HVS A;  4BVY A;  2H73 A;  4MK3 A;  1GUH A;  2JZT A;  1PL1 A;  1XVQ A;  1IYH A;  1M2D A;  3C1R A;  3FYG A;  1ACV A;  3M1G A;  2CT6 A;  3GX8 A;  3IXR A;  3BD2 A;  4AJ7 A;  3APQ A;  4I2T A;  5IMD A;  3KH7 A;  3TCO A;  3IRA A;  2PGT A;  1TK8 B;  11GS A;  3TKS E;  3VLN A;  1XFL A;  1QK8 A;  2HSY A;  2L6D A;  4K0N A;  2L4C A;  2R0C A;  5B6M A;  3MSZ A;  1YDK A;  3Q18 A;  2K6V A;  4RQX A;  1K3L A;  3JCM L;  1OVN A;  2BJX A;  1K3Y A;  4TW5 A;  2H72 A;  3L9U A;  1R26 A;  2ALB A;  5C04 A;  2YAN A;  4HZ2 A;  1A2J A;  1PMT A;  1EGR A;  1YF1 A;  1K0C A;  2JL4 A;  3HJP A;  1M0U A;  1RW1 A;  3TOT A;  5ELG A;  5IMZ A;  4Z7X A;  4TR1 B;  4L5L A;  4RI7 A;  3FZ9 A;  1XWK A;  1XWB A;  4KCA A;  1S3C A;  1TOF A;  1GSD A;  1ON4 A;  2PUK C;  5ECR B;  4MPF A;  2CZ2 A;  3A2X A;  4ULX A;  3WGE A;  5ECL B;  2RUE A;  2MBS A;  3D22 A;  5F0G A;  3RBT A;  4KF9 A;  2WZ9 A;  5HFG A;  4ECI A;  4RQR A;  2B6M A;  1BG5 A;  1EEJ A;  5H5S A;  5DQS A;  2X99 A;  3ERG A;  3IAM 2;  4N30 A;  1X5D A;  5CNW A;  1EZK A;  1V2A A;  4KH7 A;  6GSX A;  1GSU A;  4L8E A;  1UN2 A;  4A5P A;  1BJX A;  3TUE A;  4RI6 A;  3LWA A;  5KN0 A;  5ECO B;  1ST9 A;  4AJ8 A;  3GYK A;  2YV7 A;  3ZRD A;  2QGV A;  4PUF C;  2VLU A;  4O5U A;  2IN3 A;  1A24 A;  3GIX A;  2HXK A;  2H1D A;  3IHG A;  2HLS A;  4AGS A;  1TDI A;  1SJI A;  4BL7 A;  2IWT A;  2KUC A;  4ZXG A;  22GS A;  4GCI A;  2ON7 A;  3RDW A;  3A5W A;  3QOU A;  4G2E A;  3SBC A;  4PNF A;  4ML1 A;  1GP1 A;  2L59 A;  3F4S A;  2HRF A;  3A2V A;  3D4T A;  4PQI A;  1A8Y A;  3UOM A;  4WR5 A;  4EO3 A;  1A23 A;  3LGC A;  1B8X A;  2AUV A;  4HU7 A;  2QSI A;  2GZP A;  3VPQ A;  1BX9 A;  2L6C A;  4ISD A;  2M46 A;  2AB6 A;  1SKS B;  4TXV A;  1AAZ A;  1YKC A;  5CAX A;  1EV9 A;  3KIJ A;  1Y25 A;  6GSS A;  3ZFB A;  4Z2T A;  3VWW A;  2DBC A;  1HNA A;  1G7E A;  2V1M A;  4ZL9 A;  2UZ8 A;  3DVW A;  1VGL A;  2VLT A;  4DVC A;  2FNO A;  2CV4 A;  1NHY A;  17GS A;  1MD3 A;  2OE3 A;  4GQC A;  1S3A A;  1CQG A;  5IOX A;  2QKE A;  3CXG A;  1OC9 B;  2LJR A;  5ECS A;  2DKI A;  2ZCT A;  4HEA 2;  5D96 A;  3GA4 A;  3IR4 A;  5E4W A;  2IFQ A;  2J23 A;  1SYX A;  1EGO A;  2H74 A;  1GSF A;  3EUR A;  4POK A;  3CTF A;  2VM1 A;  1GH2 A;  1GWC A;  3ZTL A;  4HU9 A;  2HE3 A;  4TRX A;  4IP6 A;  1WJK A;  4TXO B;  3TJG A;  4ZBA A;  7GSS A;  12GS A;  1FO5 A;  2FA4 A;  4MF7 A;  2O7K A;  1MDJ A;  2CVD A;  5DAL B;  1R4W A;  3DGQ A;  1MD4 A;  1JHB A;  1M2A A;  2GTU A;  3CTG A;  2DJJ A;  1XIY A;  2VUP A;  3O6T A;  1HQO A;  3EWL A;  3BCK A;  4YKG A;  1ERU A;  3TKS A;  5BMU A;  2DSA A;  3C1S A;  1AXD A;  1SK1 A;  1AIU A;  4KGI A;  1AQV A;  4G10 A;  2B1L A;  3GTU A;  4YQU A;  1QXH A;  1LJR A;  4OFN A;  1EOH A;  4BVY B;  2H71 A;  1M9B A;  2DJK A;  3APS A;  3Q19 A;  2L57 A;  2O87 A;  1PKW A;  4CDO A;  2A4V A;  2YJ7 A;  4MPG A;  1R5A A;  3RHC A;  5DBQ A;  1F2E A;  2C0D A;  2A2R A;  2V2G A;  3ZZX A;  1EP7 A;  4TKY A;  2TRX A;  1VF4 A;  3DKS A;  3KJY A;  5JCW A;  4MF6 A;  4BVX B;  3WYW A;  1EV4 A;  4CHS A;  2I9H A;  4WET A;  1HNB A;  4V2L A;  5HFI A;  1ZGN A;  4Q5Q A;  1EOG A;  4ILF A;  5IMV A;  2C3Q A;  1SKR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...