3HCZA

The crystal structure of a domain of possible thiol-disulfide isomerase from cytophaga hutchinsonii atcc 33406.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
147
structure length
147
Chain Sequence
NAPLLLGKKAPNLYMTDTTGTYRYLYDVQAKYTILFFWDSQCGHCQQETPKLYDWWLKNRAKGIQVYAANIERKDEEWLKFIRSKKIGGWLNVRDSKNHTDFKITYDIYATPVLYVLDKNKVIIAKRIGYENLDDFLVQYEKSLKTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Possible thiol-disulfide isomerase
publication title The crystal structure of a domain of possible thiol-disulfide isomerase from Cytophaga hutchinsonii ATCC 33406.
rcsb
source organism Cytophaga hutchinsonii
total genus 50
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hczA00
2BMXA 5G30A 1GL8A 1OE8A 4NWYA 1Q4JA 1Z3EA 1XWAA 1KTEA 1FHEA 1TK8B 2B6MA 2V2GA 1OAZA 3J7Yb 5IMFA 2BTOT 1GSEA 3IK9A 3D21A 3GKKA 3C1RA 4ULXA 4FYCA 4MPFA 1GSFA 5A4WA 3KD0A 3F6FA 1USBA 4MJCA 3KTLA 4ISDA 5CREA 3CMIA 4WR4A 1ACVA 1EOHA 2C0FA 1XIYA 1T00A 1ZGNA 3LEFA 2YOIA 2P0GA 2GZYA 3FYGA 5JWQB 1X5CA 3CBUA 4PGTA 3ZREA 2IMEA 2YV7A 4PX1A 4ILFA 2GQKA 2HYXA 3EURA 1IYHA 3VWWA 2VCVA 5J3RA 4FH8A 2C8UA 4L5OA 4EF0A 1XVWA 1PQNA 4MPGA 1DE1A 3GMFA 4HS1A 1O8XA 4KDXA 3DVXA 5HR1A 2F8FA 2CT6A 1TRVA 5H5RA 1PX6A 4V1Ap 3TKPA 1YJ6A 3LJRA 3GKXA 3IOSA 5IMZA 2VOCA 2EIOA 3K8NA 5D9TA 3LSZA 3CXGA 5A4VA 2IMDA 2H76A 2GSQA 5IO2A 3RBTA 2P31A 5G2ZA 1EWXA 3NZNA 3CRTA 3IR4A 3F3RA 4KUNA 5D93A 1UN2A 2H0GA 1XOAA 3KTBA 1TU7A 1K0DA 3GX8A 4J56E 3HDCA 2FWEA 3BJ5A 3CSIA 3G7JA 4KNDA 1K0OA 4JEDA 3UIWA 5IMCA 1OYJA 3WGEA 2CVDA 4I2TA 3ZFLA 3WYWA 2GVPA 1PA3A 4BL7A 5IM9A 4K9ZA 3HA9A 2GS3A 3DD3A 4NV5A 2OKAA 4KGIA 1SK0A 1O6JA 1TJDA 2H0HA 2H6XA 2HZEA 3C7MA 3NIVA 4XCSA 4N0ZA 1KBNA 1TRUA 1WPIA 2GT6A 4RI6A 5ID2A 3A2WA 1RW1A 2LV3A 3O3TA 3KGKA 4DVCA 3PH9A 1SKWB 4XIHA 4TR1A 4MZBA 1V9WA 3US3A 4TOPA 1PMTA 2E2GA 4HEA2 2JZTA 5CNWA 4J57E 4P3YB 4HJ2A 1TW9A 5DVBA 4TR0A 2BJXA 2YV9A 5CRGA 4ZL7A 1B48A 2TIRA 4BWSA 3FR9A 3KZQA 3LGCA 2HNLA 1M99A 4RQRA 3VPQA 5JCUA 2VL3A 1PKZA 1OC9A 4ECBA 3H8QA 9GSSA 5EVOA 1YEXA 1X0RA 2F51A 4MJBA 1U88A 4JZQA 1PN9A 3DEXA 1FG4A 1THOA 3P90A 1AQXA 3D6IA 3GSSA 4BVYA 2VCXA 3GV1A 5G1LA 1HNAA 1Z7RA 1UVZA 1EP8A 2FNOA 1B9YC 3EU3A 2C0EA 4EDZA 5IOXA 6GSTA 4K7IA 4MABA 1ERVA 5FHIA 3V1WA 3WGDA 1JZDA 3SBCA 2LQOA 2F8AA 3HD5A 2C0DA 3UMAA 3GN3A 1NM3A 1XW6A 1HNBA 3I43A 3HHVA 4XTSA 1V58A 3EVIA 4Q5NA 1QUWA 3JCML 2NVLA 1M2BA 2H74A 2KLXA 1SKSB 3VWXA 5F06A 2JU5A 3J7Yk 5D9WA 4N30A 5ECPB 3WT2A 2YPMA 4FYBA 3D22A 3LFLA 2RLIA 3IPZA 5ECNB 4WXTA 1DE2A 1BG5A 2RM6A 3ERWA 1H4OA 2AAWA 4IHUA 2K8SA 1ERTA 4BWQA 5ECLB 5GSTA 3LQ7A 3PR8A 3IRAA 3UAPA 5JCWA 2L59A 5DDLA 3DVWA 2L5LA 3LWAA 2CVKA 3DIEA 4GTUA 5H5QA 4IKHA 3KIJA 1SKRB 1GTBA 1JFUA 12GSA 3TKRA 2IMFA 3LYKA 5DALB 3F4SA 1ZCPA 3QD9A 5GSSA 1M0UA 1ZMAA 2L4QA 2L57A 2H1GA 2DC5A 2DSAA 5L71A 2DIZA 2G0FA 3TGZA 1Z9HA 3ZIJA 2DJKA 4OO4A 3KH7A 3QAVA 1F3AA 2OE0A 3MSZA 1SL1B 1IYIA 1YQ1A 1VF4A 4TXOB 20GSA 4ZL9A 1SJ6A 13GSA 3TCOA 2IPAA 3EMXA 2WRTA 4NHZA 5CRWA 1F2EA 4MZCA 3DMLA 4EO3A 2VCWA 3HJOA 2KOKA 2YP6A 3G7YA 5ECKB 8GSSA 1H75A 3ZFBA 1BJXA 1M9BA 1AIUA 2XPEA 2HRNA 3L78A 5ECOB 1GRXA 1W4VA 2QKEA 4GCIA 2K9FA 1C72A 1A2JA 1O81A 1XCCA 2KHPA 2QC7A 3TJBA 5G1KA 1BQ7A 2B1KA 1G7OA 5F8BA 3TKSE 2MBTA 4EE0A 1K3LA 1B4PA 1YKAA 5IMVA 4E8EA 3QPMA 4TR3A 1LJRA 4YAVA 4OWYA 4IP1A 2A4VA 1DBYA 2H70A 4MF7A 3UJ1A 3L9VA 5EY6A 1QXHA 3APQA 3D0ZA 1DSBA 4K6XA 5CO3A 3KMNA 4WBRD 4K2DA 3E9JB 3E0UA 2I81A 3CSJA 4LLRA 3F8UA 4J2FA 2TRCP 3EMPA 3F6DA 4GSTA 1F9MA 1G6YA 1V57A 2IN3A 5EL8A 4JBBA 2ZCTA 1BEDA 1XW5A 1Z7PA 2HRFA 5DQYA 1GNEA 3QAWA 4O7HA 3F4TA 2HSHA 4PXOA 4HI7A 5DJLA 2YANA 4ECIA 4N10A 4F82A 2GQMA 4YH2A 3KMOA 4ZXGA 1A24A 1MEKA 2HSYA 3IAS2 2LQQA 2G2QA 4WETA 1QMVA 2H72A 4AJ7A 5C00A 2E0QA 3ZITA 4NV2A 1XWGA 4NXIA 4EDYA 4PQHA 4LA1A 3OR5A 1YY7A 2NTOA 3IDVA 1E2YA 1WIKA 2KP1A 1A8LA 4HQZA 4MF5A 4IGJA 2DIYA 2B5YA 1JLVA 1PL1A 2H30A 5IIZA 1E6BA 1BX9A 2M80A 4PQ1A 1XWCA 2VL2C 2R6KA 4KSOA 1M7TA 5DJMA 2MMAA 4KW6A 2AUVA 4OFNA 1S3DA 4K8MA 5HFKA 4D73A 1I5GA 2JADA 4IELA 5LD0A 2PMTA 4V2LA 3EU4A 1YF0A 4DSSB 3O6TA 2WULA 4MDCA 4XRDA 4N11A 5B7CA 4GF0A 1RK4A 4IQAA 2IJYA 3FZ4A 2C1YA 1RQMA 3MAKA 3KXOA 3MWHA 1JHBA 1K3OA 2MMOA 1LBKA 4KCAA 2LRTA 3U5RE 4TN8A 2C3QA 1VGLA 5AN1A 3Q74A 4AF2A 3EYTA 1S3CA 3A2XA 3G9BA 3QCPA 4MLYA 1T4ZA 3GTUB 2C0GA 3HZ8A 4OFMA 2DMLA 3ZVJD 3HYPA 17GSA 4Q5RA 3N9JA 2AYTA 2PPTA 4IBPA 1T8EB 3S9FA 4KAEA 3HY2A 2B5EA 2YWMA 4HU9A 3GKMA 5COHA 4RUVA 5IPHA 1U6TA 3UEMA 2L6CA 2FWFA 1SYRA 5DAKA 3QFBC 3KH9A 2F9SA 4WBJA 2GQLA 5HFGA 2N5AA 2H73A 2PUKC 3ME7A 2J9HA 4GQCA 4LL4B 4Z7XA 5A5KA 2I4AA 2DMMA 1X9MB 3U6VA 3KJYA 4GSNA 1QQ2A 4F03A 1V40A 1EOGA 10GSA 5J9BA 3IE3A 3DGQA 1THXA 1R5AA 1CQHA 4O92A 3WT1A 2CZ3A 3DKSA 2ZUPA 5ECRB 3TOUA 5AIXA 3ZMLA 4GLTA 1AAZA 2IL3A 5IO0A 3RAZA 3Q6OA 2CV4A 5B8AA 3ME8A 1AXDA 4I2UA 5ECHB 1EZKA 1SYXA 2XHFA 2WGRA 2OJLA 1SK1A 2H6ZA 2H19A 5JWRB 4ZILA 4I8BA 4AJ6A 4ZBDA 3ZVJA 4EXJA 1ILOA 4YQUA 3ZTLA 4QL9A 1R7HA 4XHMA 3FHKA 1QK8A 1B4QA 4GSSA 1OKTA 1SJZA 2PWJA 2JSZA 3APOA 2CX3A 1XZOA 2REMA 3LYPA 4ACSA 3LXTA 3MDKA 2OBKA 2X8CA 5D9XA 5KN1A 4X1UA 3W6GA 2A2RA 1GTAA 3GFKA 1ST9A 3M1GA 1FO5A 4EC0A 1URMA 4FO5A 5ELAA 2DJ2A 1SU9A 2WS2A 2WB9A 2LNSA 1EV9A 4XS4B 4N0VA 2LEGA 4KH7A 1XW9A 3GL5A 1K0NA 2HLSA 5JCGA 4ZL8A 1V98A 1Z6MA 4I5QA 2VLUA 4NMUA 2GTUA 1PL2A 1TP9A 3PGTA 1VRSD 4PNFA 4MZWA 3APSA 1TK5B 1TU8A 4YAPA 4I97A 1PSQA 2OE1A 4TXVA 3FW2A 3RHCA 2JZRA 1ERWA 2H6YA 1OKDA 2V6OA 4GWRA 3M3MA 3TB2A 1A2LA 2PGTA 4KDUA 2PN8A 2MYGA 5KN3A 1T1VA 5HFIA 2P5QA 4FIWA 1NSWA 3R2QA 3TRXA 3KCMA 4CDOA 2CA8A 2NPBA 1OC3A 3L9SA 3M8NA 5AIVA 5IPGA 4ECJA 3FZ5A 1I9DA 1Y6EA 3TOTA 3IAM2 3RDWA 1WRYA 4NHWA 4NPBA 2H1BA 3TJJA 2ALBA 3D4TA 4K7NA 4TVEA 1VF2A 1GUMA 2R3XA 2M46A 3LG6A 1DUGA 4I6XA 5GAPD 1V2AA 3F9UA 2A2SA 6GSWA 5CAXA 2YZHA 1VF3A 3EWLA 3GYKA 5HQPA 1GP1A 2LS5A 4HDEA 1XPVA 4IVFA 1G0TA 3TJGA 2GSTA 2X8HA 1PD21 2H1AA 1Y25A 3QOUA 1U87A 2YNXA 2PVQA 4F2IA 3BCIA 4K0GA 2I9HA 3VK9A 6GSSA 3N5OA 2OADA 1OVNA 2MBSA 2VO4A 2KP2A 1AUCA 2VL2A 2N5FA 3TUEA 1XBSA 2AB6A 2IMIA 4KCEA 1HD2A 3GH6A 4ZB8A 1MDIA 1T4YA 1ZOFA 3WGXA 2ON5A 3UVHA 2LKUA 2LJRA 5ECSA 4TR4A 5IMAA 4JE1A 3TJFA 4O5RA 2GGTA 3QAGA 7GSSA 4V1Ag 4OD7A 5IOWA 2WJUA 1YEPA 1ZL9A 1F3BA 2OA7A 4XRAA 4Q5FA 4ML1A 4MJAA 5D73A 1GH2A 2E7PA 1EP7A 2QSIA 2P5RA 4MH3A 3I9V2 1FOVA 3FZ9A 2AV4A 5D8IA 2DJJA 5J4UA 1J9BA 3QMXA 3TDGA 3TJKA 4IQ1A 1TRWA 4NAXA 3IXRA 2XPDA 1NW2A 2K18A 3W8JA 2OE3A 4HOJA 5DCHA 1GSUA 2H01A 2H66A 4POLA 1EGOA 3UL3A 4XS6A 5EPFA 4G10A 2DLXA 1J08A 3P7XA 1X9WB 2CZ2A 1SD8A 2H71A 3HJPA 4CW9A 3SWLA 2LJAA 1YKCA 1GNWA 2FGXA 3G7IA 1A8YA 1G6WA 2XBQA 1O8WA 2O7KA 2YWNA 5KN0A 2GSRA 3M0FA 4MP4A 2PBJA 5F07A 4G2EA 2LTKA 3TRQA 3HCZA 3O76A 1SL2B 2EIQA 3HXSA 3C73A 2H8LA 3H79A 3RPNA 1ML6A 2B7KA 4V2NA 3ZYWA 3VFIA 3BCKA 4GRFA 3DYRA 1JLWA 2LJKA 4PQIA 2V6KA 4IJIA 3F3QA 1ON4A 2GLRA 2WCIA 1EGRA 3CTFA 6GSVA 2HXKA 5IMDA 19GSA 2B3SA 3KP8A 4IP6A 1G7EA 1PKWA 5KEJA 2L4CA 1PX7A 1TOFA 2FLSA 2FHEA 1Z5YE 6GSYA 1WMJA 2FA4A 3GL3A 2NDOA 2L6DA 4MCUA 1X5DA 3I69A 3IHQA 3H1NA 1BYEA 2VCZA 1SL0B 3FK8A 5KN2A 1WWJA 1U3IA 4EKZA 5AISA 3ZL5A 2I3YA 3EINA 2WFCA 2J23A 4IW9A 1SENA 1WE0A 5DQSA 2VLTA 5G5EA 2HZFA 2VD0A 1Z6NA 4GXZA 3IBHA 1R4WA 2X64A 1B9XC 4LL1B 4POKA 2I1UA 1GSDA 4BVXA 1TDIA 2FY6A 4ECCA 5INYA 1TI3A 3RHBA 3I6AA 2IMKA 1GLPA 3TKQA 4F0BA 4XS1A 4KB3A 4X0XA 2MMNA 4DEJA 2HI7A 3F63A 1MD4A 3CYNA 2VIMA 3TKSC 3GRXA 3IC4A 2CQ9A 3M9KA 1TRSA 3ZIVA 1ABAA 1SJIA 2LSTA 2WDUA 3BD2A 3BOAA 2B5XA 2DBCA 1SD9A 1R26A 2TRXA 4ML6A 1YDKA 2R2JA 1WJKA 2FA8A 1UC7A 2O87A 4EL1A 3UVTA 5ECIB 1NHYA 4ID0A 1NHOA 1GUHA 4POBA 2HT9A 5D9VA 5CP1A 1GUKA 3UBKA 2LUSA 4LMVA 1HYUA 3VWUA 1KEBA 2CAIA 1X5EA 3A3TA 1MTCA 1ERUA 3QR6A 2VM2A 3VWVA 5ELGA 4HU7A 3P8WA 22GSA 2V1MA 2YWOA 3FR3A 5DALA 1YF1A 5CRHA 2O89A 4MK3A 5C04A 4KX4A 2R4VA 5E4WA 4F0CA 3HKRA 1WOUA 2PERA 1S3AA 3GNJA 3GUSA 5ENUA 2FCHA 4HZ2A 5F05A 3DWVA 1M2AA 3VLNA 5G5FA 1AW9A 4PURA 5HR3A 4OFTA 5D96A 2OACA 4TXOA 4H86A 3WD6A 3GHAA 18GSA 5F0GA 3CRUA 2DJ0A 2CAQA 2IIYA 4HJMA 2V32A 4CHSA 4JU5A 4MMMA 3KP9A 3FY7A 3FKFA 4G19A 2VLVA 3DXBA 3HZ4A 4YQVA 4YQMA 1K0MA 2FWHA 2EC4A 4DSRA 2X99A 1B8XA 4E8HA 2H1DA 3MNGA 4WEYA 1PGTA 3ERGA 3KEBA 1UA5A 3UARA 2R37A 3CTGA 3ZZXA 5HR0A 2VUPA 16GSA 3IV4A 2GSSA 2M72A 2X8GA 1N8JA 2N5BA 1GWCA 1A0FA 2RUFA 3D4MA 2LRCA 2FWGA 4L8EA 1K0BA 1K3YA 5DCGA 1KNGA 2ON7A 1GSSA 1CQGA 4X43A 3C71A 2IFQB 2DJ3A 2JACA 3F0IA 5E59A 4V2MA 3GURA 4L0WA 1JZWA 2YZUA 3C8EA 4KA0A 4FYUA 5J41A 4AGSA 4TW5A 2MZCA 2K8VA 3IA1A 4OMVA 4TKYA 1U3AA 2D2ZA 5ECQB 2Z9SA 4WF4A 2H0IA 4KSMA 4BPYA 1ZZYA 6GSUA 3F4RA 4K1FA 2RIIA 2VD1A 2L5OA 1R5PA 1AQWA 1M2DA 1GULA 5B8BA 3VI7A 4QQ7A 5FWGA 4WKWA 6GSXA 4Q5QA 4HQSA 2RUEA 3L4NA 11GSA 1M9AA 4L5LA 2YCDA 2PVOC 3BBYA 2DJ1A 1SK2A 1LU4A 2XBIA 2GZZA 1TKDB 3VI5A 4O32A 2LNTA 1GTIA 4ZIJA 1TTZA 2V41A 3LXZA 1Q98A 1A0RP 2ZNMA 2H75A 3Q18A 4PNGA 1FVJA 2K6VA 2HE3A 3IK7A 3EC3A 1TXXA 1O73A 4D73B 1YZXA 1FB0A 1AC1A 4KDYA 3VURA 5B6NA 1FB6A 1TK0B 1MDJA 2B1LA 5A4UA 1F6MC 2ES7A 1AQVA 2EIRA 1JZRA 1ZYQB 1K0CA 4HUAA 4ZB6A 5J9CA 4POMA 1HQOA 4DSSA 5HR2A 1OE7A 3HVVA 2HFDA 2RM5A 1XVQA 3E3EA 1JZOA 2GZPA 3GKNA 4OCFA 3FRCA 2VAFA 1MDKA 1K0AA 3D5JA 1PRXA 3ZMKA 1HNCA 3GH9A 2AJQB 2NBSA 1QFNA 1ZYEA 4K0NA 5CRDA 1OC8A 3GTUA 3UOMA 2F3MA 4RQXA 1J0FA 4JR4A 4JRRA 4L0UA 2LRNA 4MF6A 4WR5A 3ISOA 2OBIA 3HVSA 3A5WA 3FZAA 2O85A 4AJ8A 5LNKe 1FAAA 2XC2A 5G31A 4KE3A 1XWKA 4WF5A 4ZB9A 5AGYA 2CX4A 5H5SA 1GSYA 2IWTA 1QGVA 3ED3A 3GSTA 5DAKB 2JSYA 4EUYA 4OO5A 3QDNA 4IS0A 5GZZB 2AHEA 3GA4A 3QFAC 3TKSA 4RI7A 2KUCA 4GQFA 1EV4A 5J5NA 3Q19A 2C80A 1FW1A 3ERFA 4QL7A 5CYYA 4OCEA 3CSHA 3C1SA 3LORA 3M9JA 4EVMA 5ABRA 1A23A 2WZ9A 4PUFC 2HZEB 1W89A 3ZRDA 1BAYA 2FUG2 1T7PB 2MMZA 1XXUA 5GAND 3UBLA 3H4KA 2GDRA 2QGVA 2YN1A 1XWBA 1O85A 4K7OA 3GX0A 1X9SB 1O7UA 2FD3A 1MD3A 1T3BA 5ID2B 1N2AA 1GSQA 3PINA 4IN0A 5FT3A 1A2MA 4MJEA 2C3NA 2GT5A 4PUAA 3A2VA 3EE2A 5JWOB 2PU9C 4TR1B 4MH2A 4TRXA 4G9HA 1XOBA 2YJ7A 2VCQA 3H93A 3HJMA 1EEJA 3ZLPA 4HZ4A 3W8SA 4JR6A 1XFLA 4IJ3A 1WP0A 3P2AA 5LCZA 5DBQA 3FR6A 1VF1A 2C3TA 3GIXA 3VPTA 2VL9A 2O8VB 1FVKA 2YWIA 3L9UA 4DSQA 1GLQA 3NOFA 1GTUA 2JZSA 4ZBAA 2R5GA 2IFQA 4ZBBA 4LMWA 1OC9B 4F9ZA 3AY8A 2JL4A 2YJHA 2B7JA 2VM1A 4MA9A 5ECMB 1F37A 5IQYA 3TRPA 3FEUA 14GSA 3KM6A 2C4JA 3DRNA 5B6MA 2VCTA 4XS4A 3HVXA 4BA7A 1TI1A 3RPPA 2CVBA 1EEMA 2E2MA 3L0HA
chains in the Genus database with same CATH superfamily
2BMXA 5G30A 1GL8A 1OE8A 4NWYA 1Q4JA 1Z3EA 3MYDA 1XWAA 1KTEA 1FHEA 1TK8B 2B6MA 2V2GA 1OAZA 3J7Yb 5IMFA 2BTOT 1GSEA 3IK9A 3D21A 3GKKA 3C1RA 4ULXA 4FYCA 4MPFA 1GSFA 5A4WA 3KD0A 3F6FA 1USBA 4MJCA 3KTLA 4ISDA 5CREA 3CMIA 4WR4A 1ACVA 1EOHA 2C0FA 1XIYA 1T00A 1ZGNA 3LEFA 2YOIA 2P0GA 2GZYA 5BMUA 3FYGA 5JWQB 1X5CA 3CBUA 4PGTA 3ZREA 2IMEA 2YV7A 4PX1A 4ILFA 2GQKA 2HYXA 3EURA 1IYHA 3VWWA 2VCVA 5J3RA 4FH8A 2C8UA 4L5OA 4EF0A 1XVWA 1PQNA 4MPGA 1DE1A 3GMFA 4HS1A 1O8XA 4KDXA 3DVXA 5HR1A 2F8FA 2CT6A 1TRVA 3IHGA 5H5RA 1PX6A 4V1Ap 3TKPA 1YJ6A 3LJRA 3GKXA 3IOSA 5IMZA 3LW9A 2VOCA 2EIOA 3K8NA 5D9TA 3LSZA 3CXGA 5A4VA 2IMDA 2H76A 2GSQA 5IO2A 3RBTA 2P31A 5G2ZA 1EWXA 3NZNA 3CRTA 3IR4A 3F3RA 4KUNA 5D93A 1UN2A 2H0GA 1XOAA 3KTBA 1TU7A 1K0DA 3GX8A 4J56E 3HDCA 2FWEA 3BJ5A 3CSIA 3G7JA 4KNDA 1K0OA 4JEDA 3UIWA 5IMCA 4K2XA 1OYJA 3WGEA 2CVDA 4I2TA 3ZFLA 3WYWA 2GVPA 1PA3A 4BL7A 5IM9A 4K9ZA 3HA9A 2GS3A 3DD3A 4NV5A 2OKAA 4KGIA 1SK0A 1O6JA 1TJDA 2H0HA 2H6XA 2HZEA 3C7MA 3NIVA 4XCSA 4N0ZA 1KBNA 1TRUA 1WPIA 2GT6A 4RI6A 5ID2A 3A2WA 1RW1A 2LV3A 3O3TA 3KGKA 4DVCA 3PH9A 1SKWB 4XIHA 4TR1A 4MZBA 1V9WA 3US3A 4TOPA 1PMTA 2E2GA 4HEA2 2JZTA 5CNWA 4J57E 4P3YB 4HJ2A 1TW9A 5DVBA 4YKGA 4TR0A 2BJXA 2YV9A 5CRGA 4ZL7A 1B48A 2TIRA 4BWSA 3FR9A 3KZQA 3LGCA 2HNLA 1M99A 4RQRA 3VPQA 5JCUA 2VL3A 1PKZA 1OC9A 4ECBA 3H8QA 9GSSA 5EVOA 1ZYPA 1YEXA 1X0RA 2F51A 4MJBA 1U88A 4JZQA 1PN9A 3DEXA 1FG4A 1THOA 3P90A 1AQXA 3D6IA 3GSSA 4BVYA 2VCXA 3GV1A 5G1LA 1HNAA 4EIQA 1Z7RA 1UVZA 1EP8A 2FNOA 1B9YC 3EU3A 2C0EA 4EDZA 5IOXA 6GSTA 4K7IA 4MABA 2HSMA 5BRTA 1ERVA 5FHIA 3V1WA 3WGDA 1JZDA 3SBCA 2LQOA 2F8AA 4BVXB 3HD5A 4K5RA 2C0DA 3UMAA 3GN3A 4CY8A 1NM3A 1XW6A 1HNBA 3I43A 3HHVA 4XTSA 1V58A 3EVIA 4Q5NA 1QUWA 3JCML 2NVLA 3PPUA 1M2BA 2H74A 2KLXA 1SKSB 3VWXA 5F06A 3EPTA 2JU5A 3J7Yk 5D9WA 4N30A 5ECPB 3WT2A 2YPMA 4FYBA 3D22A 3LFLA 2RLIA 3IPZA 5ECNB 4WXTA 1DE2A 1BG5A 2RM6A 3ERWA 1H4OA 2AAWA 4IHUA 2K8SA 1ERTA 4BWQA 5ECLB 5GSTA 3LQ7A 3PR8A 3IRAA 3UAPA 5JCWA 2L59A 5DDLA 1FOHA 3DVWA 2L5LA 3LWAA 2CVKA 3DIEA 4GTUA 5H5QA 4IKHA 3KIJA 1SKRB 1GTBA 1JFUA 12GSA 3TKRA 2IMFA 3LYKA 5DALB 3F4SA 1ZCPA 3QD9A 5GSSA 1M0UA 1ZMAA 2L4QA 2L57A 2H1GA 2DC5A 2DSAA 5L71A 2DIZA 2G0FA 3TGZA 1Z9HA 3ZIJA 2DJKA 4OO4A 3KH7A 3QAVA 1F3AA 1ZYNA 2OE0A 2HRAA 3MSZA 1SL1B 1IYIA 1YQ1A 1VF4A 4TXOB 20GSA 4ZL9A 1SJ6A 13GSA 3TCOA 2IPAA 3EMXA 2WRTA 4NHZA 5CRWA 1F2EA 4MZCA 3DMLA 4EO3A 2VCWA 3HJOA 2KOKA 2YP6A 3G7YA 5ECKB 8GSSA 1H75A 3ZFBA 1BJXA 1M9BA 1AIUA 2XPEA 2HRNA 3L78A 5ECOB 1GRXA 1W4VA 2QKEA 4GCIA 2K9FA 1C72A 1A2JA 1O81A 1XCCA 2KHPA 2QC7A 3TJBA 2A2PA 5G1KA 1BQ7A 2B1KA 1G7OA 5F8BA 3TKSE 2MBTA 4EE0A 1K3LA 3HVNA 1B4PA 1YKAA 5IMVA 4E8EA 3QPMA 4K5SA 4TR3A 1LJRA 4YAVA 4OWYA 4IP1A 2A4VA 1DBYA 2H70A 4MF7A 3UJ1A 3L9VA 4FQUA 5EY6A 1QXHA 3APQA 3D0ZA 1DSBA 4K6XA 5CO3A 3KMNA 4WBRD 4K2DA 3E9JB 3E0UA 2I81A 3CSJA 4LLRA 3F8UA 4J2FA 4YKFA 2TRCP 3EMPA 3F6DA 4GSTA 1F9MA 1G6YA 1V57A 2IN3A 5EL8A 4JBBA 2ZCTA 1BEDA 1XW5A 1Z7PA 2HRFA 5DQYA 1GNEA 3QAWA 4O7HA 3F4TA 2HSHA 4PXOA 3FMWA 4HI7A 5DJLA 2YANA 4ECIA 4N10A 4F82A 2GQMA 4YH2A 3KMOA 4USSA 4ZXGA 1A24A 1MEKA 2HSYA 3IAS2 2LQQA 2G2QA 4WETA 1QMVA 2H72A 4AJ7A 5C00A 2E0QA 3ZITA 4NV2A 1XWGA 4NXIA 4EDYA 4PQHA 4LA1A 3OR5A 1YY7A 2NTOA 3IDVA 1E2YA 1WIKA 2KP1A 1A8LA 4HQZA 4MF5A 1XG8A 4IGJA 2DIYA 2B5YA 2DKIA 1JLVA 1PL1A 2H30A 5IIZA 1E6BA 1BX9A 2M80A 4PQ1A 1XWCA 2VL2C 2R6KA 4KSOA 1M7TA 5DJMA 2MMAA 4KW6A 2AUVA 4OFNA 1S3DA 4K8MA 5HFKA 4D73A 1I5GA 2JADA 4IELA 5LD0A 2PMTA 4V2LA 3EU4A 1YF0A 4DSSB 3O6TA 2WULA 4MDCA 4XRDA 4N11A 5B7CA 4GF0A 1RK4A 4IQAA 2IJYA 3FZ4A 2C1YA 1RQMA 3MAKA 3KXOA 3MWHA 1JHBA 1K3OA 2MMOA 1LBKA 4KCAA 2LRTA 3U5RE 4TN8A 2C3QA 1VGLA 5AN1A 3Q74A 4AF2A 3EYTA 1S3CA 3A2XA 3G9BA 3QCPA 4MLYA 1T4ZA 3GTUB 2C0GA 3HZ8A 4OFMA 2DMLA 3ZVJD 3HYPA 17GSA 4Q5RA 3N9JA 2AYTA 2PPTA 4IBPA 1T8EB 3S9FA 4KAEA 3HY2A 2B5EA 2YWMA 4HU9A 3GKMA 5COHA 4RUVA 5IPHA 1U6TA 3UEMA 2L6CA 2FWFA 1SYRA 5DAKA 5KOXA 3QFBC 3KH9A 2F9SA 4WBJA 2GQLA 4ICYA 5HFGA 2N5AA 2H73A 2PUKC 3ME7A 2J9HA 4GQCA 4LL4B 4Z7XA 5A5KA 2I4AA 2DMMA 1X9MB 3U6VA 3KJYA 4GSNA 1QQ2A 4F03A 1V40A 1EOGA 10GSA 5J9BA 3IE3A 3DGQA 1THXA 1R5AA 1CQHA 4O92A 3WT1A 2CZ3A 3DKSA 2ZUPA 5ECRB 3TOUA 5AIXA 3ZMLA 4GLTA 1AAZA 2IL3A 5IO0A 3RAZA 3Q6OA 2CV4A 5B8AA 3ME8A 1AXDA 4I2UA 1EZKA 2XHFA 1SYXA 5ECHB 2WGRA 2OJLA 1SK1A 1M3JA 4CY6A 2H6ZA 2H19A 4EIPA 5JWRB 4ZILA 4I8BA 4AJ6A 4ZBDA 3ZVJA 4EXJA 1ILOA 4YQUA 3ZTLA 4QL9A 1R7HA 4XHMA 3FHKA 1QK8A 1B4QA 4GSSA 1OKTA 1SJZA 2PWJA 2JSZA 3APOA 2CX3A 1XZOA 2REMA 3LYPA 4ACSA 3LXTA 3MDKA 2OBKA 2X8CA 5D9XA 5KN1A 4X1UA 3W6GA 2A2RA 1GTAA 3GFKA 1ST9A 3M1GA 1FO5A 4EC0A 1URMA 4FO5A 5ELAA 2DJ2A 1SU9A 2WS2A 2WB9A 2LNSA 1EV9A 4XS4B 4N0VA 2A4HA 2LEGA 4KH7A 1XW9A 3GL5A 1K0NA 2HLSA 4BIKA 5JCGA 4ZL8A 1V98A 1Z6MA 4I5QA 2VLUA 4NMUA 2GTUA 1PL2A 1TP9A 3PGTA 1VRSD 4PNFA 4MZWA 3APSA 1TK5B 1TU8A 4YAPA 4I97A 3A5IA 1PSQA 2OE1A 4TXVA 3FW2A 3RHCA 2JZRA 1ERWA 2H6YA 1OKDA 2V6OA 4GWRA 3M3MA 3TB2A 1A2LA 2PGTA 4KDUA 2PN8A 2MYGA 5KN3A 1T1VA 5HFIA 2P5QA 4FIWA 1NSWA 3R2QA 3TRXA 3KCMA 4CDOA 2CA8A 2NPBA 1OC3A 5KOWA 3L9SA 3M8NA 5AIVA 5IPGA 4ECJA 3FZ5A 4Z2TA 1I9DA 1Y6EA 3TOTA 3IAM2 3RDWA 1WRYA 4NHWA 4NPBA 2H1BA 3TJJA 2ALBA 3D4TA 4K7NA 4TVEA 1VF2A 1GUMA 2R3XA 2M46A 3LG6A 1DUGA 4I6XA 5GAPD 1V2AA 3F9UA 2A2SA 6GSWA 5CAXA 2YZHA 1VF3A 3EWLA 3GYKA 5HQPA 1GP1A 2LS5A 4HDEA 1XPVA 4IVFA 1G0TA 3TJGA 2GSTA 2X8HA 1PD21 2H1AA 1Y25A 3QOUA 1U87A 2YNXA 2PVQA 4F2IA 3BCIA 4K0GA 2I9HA 3VK9A 6GSSA 3N5OA 2OADA 1OVNA 2MBSA 2VO4A 2KP2A 1AUCA 2VL2A 2N5FA 3TUEA 1XBSA 2AB6A 2IMIA 4KCEA 1HD2A 3GH6A 4ZB8A 1MDIA 1T4YA 1ZOFA 3WGXA 2ON5A 3UVHA 2LKUA 2LJRA 5ECSA 4TR4A 5IMAA 4JE1A 3TJFA 4O5RA 2GGTA 3QAGA 7GSSA 4V1Ag 4OD7A 4BL7B 5IOWA 2WJUA 1YEPA 1ZL9A 1F3BA 4HSCX 2OA7A 4XRAA 3CQFA 4A5PA 4Q5FA 4ML1A 4MJAA 5D73A 1GH2A 2E7PA 1EP7A 2QSIA 2P5RA 4MH3A 3I9V2 1FOVA 3FZ9A 2AV4A 5D8IA 2DJJA 5J4UA 1J9BA 3QMXA 3TDGA 3TJKA 4IQ1A 1TRWA 4NAXA 3IXRA 2XPDA 1NW2A 2K18A 3W8JA 2OE3A 4HOJA 5DCHA 1GSUA 2H01A 2H66A 4POLA 1EGOA 3UL3A 4XS6A 5EPFA 4G10A 2DLXA 1J08A 3P7XA 1X9WB 2CZ2A 1SD8A 2H71A 3HJPA 4CW9A 3SWLA 2LJAA 1YKCA 1GNWA 2FGXA 3G7IA 1A8YA 1G6WA 2XBQA 1O8WA 2O7KA 2YWNA 5KN0A 2GSRA 3M0FA 4MP4A 2PBJA 5F07A 4G2EA 2LTKA 3TRQA 3HCZA 3O76A 1SL2B 2EIQA 3HXSA 3C73A 2H8LA 3H79A 3RPNA 1ML6A 2B7KA 4V2NA 3ZYWA 3VFIA 3BCKA 4GRFA 3DYRA 1JLWA 2LJKA 4PQIA 2V6KA 4IJIA 3F3QA 1ON4A 2GLRA 2WCIA 1EGRA 3CTFA 6GSVA 2HXKA 5IMDA 19GSA 2B3SA 3KP8A 1PFOA 4IP6A 1G7EA 1PKWA 5KEJA 2L4CA 1PX7A 1TOFA 2FLSA 2FHEA 1Z5YE 6GSYA 4X4JA 1WMJA 2FA4A 3GL3A 2NDOA 2L6DA 4MCUA 1X5DA 3I69A 4BVYB 3IHQA 3H1NA 1BYEA 2VCZA 1SL0B 3FK8A 5KN2A 1WWJA 1U3IA 4EKZA 5AISA 2R0PA 3ZL5A 2I3YA 3EINA 2WFCA 2J23A 4IW9A 1SENA 1WE0A 4Z2UA 4PTSA 5DQSA 2VLTA 5G5EA 2HZFA 2VD0A 1Z6NA 4GXZA 3IBHA 1R4WA 2X64A 1B9XC 4LL1B 4POKA 2I1UA 1GSDA 4BVXA 1TDIA 2FY6A 4ECCA 5INYA 1TI3A 3RHBA 3I6AA 2IMKA 1GLPA 3TKQA 4F0BA 4XS1A 4KB3A 4X0XA 2MMNA 4DEJA 2HI7A 3F63A 1MD4A 3CYNA 2VIMA 4G0IA 2HRKA 3TKSC 3GRXA 3IC4A 2CQ9A 3M9KA 1TRSA 3ZIVA 1ABAA 1SJIA 2LSTA 2WDUA 3BD2A 3BOAA 2B5XA 2DBCA 1SD9A 1R26A 2TRXA 4ML6A 1YDKA 2R2JA 1WJKA 2FA8A 1UC7A 2O87A 4EL1A 3UVTA 5ECIB 1NHYA 4ID0A 1NHOA 1GUHA 4POBA 2HT9A 5D9VA 5CP1A 1GUKA 3UBKA 2LUSA 4LMVA 1HYUA 3VWUA 1KEBA 2CAIA 1X5EA 3A3TA 1MTCA 1ERUA 3QR6A 2VM2A 3VWVA 5ELGA 4HU7A 3P8WA 22GSA 2V1MA 2YWOA 3FR3A 5DALA 1YF1A 5CRHA 2O89A 4MK3A 5C04A 4KX4A 2R4VA 5E4WA 4F0CA 3HKRA 1WOUA 2PERA 1S3AA 3GNJA 3GUSA 5ENUA 2FCHA 4HZ2A 2UZ8A 5F05A 2QA1A 3DWVA 1M2AA 3VLNA 5G5FA 1AW9A 4PURA 5HR3A 4OFTA 5D96A 2OACA 4TXOA 3R3EA 4H86A 3WD6A 3GHAA 18GSA 5F0GA 3CRUA 2DJ0A 2CAQA 2IIYA 4HJMA 2V32A 4CHSA 4JU5A 4MMMA 3KP9A 3FY7A 4MNNA 3FKFA 4G19A 2VLVA 3DXBA 3HZ4A 4YQVA 4YQMA 1K0MA 2FWHA 2EC4A 4DSRA 2X99A 1B8XA 4E8HA 2H1DA 3MNGA 4WEYA 1PGTA 3ERGA 3KEBA 1UA5A 3UARA 2R37A 3CTGA 3ZZXA 5HR0A 2VUPA 16GSA 3IV4A 2GSSA 2M72A 2X8GA 1N8JA 1PN0A 2N5BA 1GWCA 1A0FA 2RUFA 3D4MA 2LRCA 2FWGA 4G0LA 4L8EA 1K0BA 1K3YA 2X49A 3IC8A 5DCGA 1KNGA 2ON7A 1GSSA 1CQGA 4X43A 3C71A 2IFQB 2DJ3A 2JACA 3F0IA 5E59A 4V2MA 3GURA 4L0WA 1JZWA 2YZUA 3C8EA 4KA0A 4FYUA 5J41A 4AGSA 4TW5A 2MZCA 1M3IA 2K8VA 3IA1A 4OMVA 4TKYA 1U3AA 2D2ZA 5ECQB 2Z9SA 4WF4A 2H0IA 4KSMA 4BPYA 1ZZYA 6GSUA 3F4RA 4K1FA 2RIIA 2VD1A 2L5OA 1R5PA 1AQWA 1M2DA 1GULA 5B8BA 3VI7A 4QQ7A 2DKHA 5FWGA 4WKWA 6GSXA 4Q5QA 4HQSA 2R0GA 2RUEA 3L4NA 11GSA 1M9AA 4L5LA 2YCDA 2PVOC 3BBYA 2DJ1A 1SK2A 1LU4A 2QA2A 2XBIA 2GZZA 1TKDB 3VI5A 4O32A 2LNTA 1GTIA 4ZIJA 1TTZA 2V41A 3LXZA 1Q98A 1A0RP 2ZNMA 2H75A 3Q18A 4PNGA 1FVJA 2K6VA 2HE3A 3IK7A 3EC3A 1TXXA 1O73A 4D73B 1YZXA 1FB0A 1AC1A 4KDYA 3VURA 5B6NA 1FB6A 1TK0B 1MDJA 2B1LA 4KF9A 5A4UA 1F6MC 2ES7A 1AQVA 2EIRA 1JZRA 1ZYQB 1K0CA 4HUAA 4O5QA 4ZB6A 5J9CA 4POMA 1HQOA 4DSSA 5HR2A 1OE7A 3HVVA 2HFDA 2RM5A 1XVQA 3E3EA 1JZOA 2GZPA 3GKNA 4OCFA 3FRCA 2VAFA 1MDKA 1K0AA 3D5JA 1PRXA 3ZMKA 1HNCA 3GH9A 2AJQB 2NBSA 1QFNA 1ZYEA 4K0NA 5CRDA 1OC8A 3GTUA 3UOMA 2F3MA 4RQXA 1J0FA 4JR4A 4JRRA 4L0UA 2LRNA 4MF6A 4WR5A 3ISOA 2OBIA 3HVSA 3A5WA 3FZAA 4Z2RA 2O85A 4AJ8A 5LNKe 1FAAA 2XC2A 5G31A 4KE3A 1XWKA 4WF5A 4ZB9A 5AGYA 2CX4A 5H5SA 1GSYA 2IWTA 1QGVA 3ED3A 3GSTA 5DAKB 2JSYA 4EUYA 4OO5A 3QDNA 4IS0A 5GZZB 2AHEA 3GA4A 3QFAC 3TKSA 4RI7A 2KUCA 4GQFA 1EV4A 5J5NA 3Q19A 2C80A 1FW1A 3MIXA 3ERFA 4QL7A 5CYYA 4OCEA 3CSHA 3C1SA 3LORA 3M9JA 4EVMA 5ABRA 1A23A 2WZ9A 4PUFC 2HZEB 1W89A 3ZRDA 1BAYA 2FUG2 1T7PB 2MMZA 1XXUA 5GAND 3UBLA 3H4KA 2GDRA 2QGVA 2YN1A 1XWBA 1O85A 4K7OA 3GX0A 1X9SB 1O7UA 2FD3A 1MD3A 1T3BA 5ID2B 4G0KA 1N2AA 1GSQA 3PINA 4IN0A 5FT3A 1A2MA 1S3RA 4MJEA 2C3NA 2GT5A 4PUAA 3A2VA 3EE2A 5JWOB 2PU9C 4TR1B 4MH2A 4TRXA 4G9HA 1XOBA 2YJ7A 2VCQA 3H93A 3HJMA 1EEJA 3ZLPA 4HZ4A 3W8SA 4JR6A 1XFLA 4IJ3A 1WP0A 3P2AA 5LCZA 5DBQA 3FR6A 1VF1A 2C3TA 3GIXA 3VPTA 2VL9A 2O8VB 1FVKA 2YWIA 3L9UA 4DSQA 1GLQA 3NOFA 1GTUA 2JZSA 4ZBAA 2R5GA 2X4AA 2IFQA 4ZBBA 4LMWA 1OC9B 4F9ZA 3AY8A 2JL4A 2YJHA 2B7JA 2VM1A 4MA9A 5ECMB 1F37A 5IQYA 3TRPA 3FEUA 14GSA 2R0CA 3KM6A 2C4JA 3DRNA 5B6MA 2VCTA 4XS4A 4O5UA 3HVXA 4BA7A 1TI1A 3RPPA 2CVBA 1EEMA 2E2MA 3L0HA
chains in the Genus database with same CATH topology
2BMXA 5G30A 1GL8A 1OE8A 4NWYA 1Q4JA 1Z3EA 3MYDA 1XWAA 1KTEA 1FHEA 1TK8B 2B6MA 2V2GA 1OAZA 3J7Yb 5IMFA 2BTOT 1GSEA 3IK9A 3D21A 3GKKA 3C1RA 4ULXA 4FYCA 4MPFA 1GSFA 5A4WA 3KD0A 3F6FA 1USBA 4MJCA 3KTLA 4ISDA 5CREA 3CMIA 4WR4A 1ACVA 1EOHA 2C0FA 1XIYA 1T00A 1ZGNA 3LEFA 2YOIA 2P0GA 2GZYA 5BMUA 3FYGA 5JWQB 1X5CA 3CBUA 4PGTA 3ZREA 2IMEA 2YV7A 4PX1A 4ILFA 2GQKA 2HYXA 3EURA 1IYHA 3VWWA 2VCVA 5J3RA 4FH8A 2C8UA 4L5OA 4EF0A 1XVWA 1PQNA 4MPGA 1DE1A 3GMFA 4HS1A 1O8XA 4KDXA 3DVXA 5HR1A 2F8FA 2CT6A 1TRVA 3IHGA 5H5RA 1PX6A 4V1Ap 3TKPA 1YJ6A 3LJRA 3GKXA 3IOSA 5IMZA 3LW9A 2VOCA 2EIOA 3K8NA 5D9TA 3LSZA 3CXGA 5A4VA 2IMDA 2H76A 2GSQA 5IO2A 3RBTA 2P31A 5G2ZA 1EWXA 3NZNA 3CRTA 3IR4A 3F3RA 4KUNA 5D93A 1UN2A 2H0GA 1XOAA 3KTBA 1TU7A 1K0DA 3GX8A 4J56E 3HDCA 2FWEA 3BJ5A 3CSIA 3G7JA 4KNDA 1K0OA 4JEDA 3UIWA 5IMCA 4K2XA 1OYJA 3WGEA 2CVDA 4I2TA 3ZFLA 3WYWA 2GVPA 1PA3A 4BL7A 5IM9A 4K9ZA 3HA9A 2GS3A 3DD3A 4NV5A 2OKAA 4KGIA 1SK0A 1O6JA 1TJDA 2H0HA 2H6XA 2HZEA 3C7MA 3NIVA 4XCSA 4N0ZA 1KBNA 1TRUA 1WPIA 2GT6A 4RI6A 5ID2A 3A2WA 1RW1A 2LV3A 3O3TA 3KGKA 4DVCA 3PH9A 1SKWB 4XIHA 4TR1A 4MZBA 1V9WA 3US3A 4TOPA 1PMTA 2E2GA 4HEA2 2JZTA 5CNWA 4J57E 4P3YB 4HJ2A 1TW9A 5DVBA 4YKGA 4TR0A 2BJXA 2YV9A 5CRGA 4ZL7A 1B48A 2TIRA 4BWSA 3FR9A 3KZQA 3LGCA 2HNLA 1M99A 4RQRA 3VPQA 5JCUA 2VL3A 1PKZA 1OC9A 4ECBA 3H8QA 9GSSA 5EVOA 1ZYPA 1YEXA 1X0RA 2F51A 4MJBA 1U88A 4JZQA 1PN9A 3DEXA 1FG4A 1THOA 3P90A 1AQXA 3D6IA 3GSSA 4BVYA 2VCXA 3GV1A 5G1LA 1HNAA 4EIQA 1Z7RA 1UVZA 1EP8A 2FNOA 1B9YC 3EU3A 2C0EA 4EDZA 5IOXA 6GSTA 4K7IA 4MABA 2HSMA 5BRTA 1ERVA 5FHIA 3V1WA 3WGDA 1JZDA 3SBCA 2LQOA 2F8AA 4BVXB 3HD5A 4K5RA 2C0DA 3UMAA 3GN3A 4CY8A 1NM3A 1XW6A 1HNBA 3I43A 3HHVA 4XTSA 1V58A 3EVIA 4Q5NA 1QUWA 3JCML 2NVLA 3PPUA 1M2BA 2H74A 2KLXA 1SKSB 3VWXA 5F06A 3EPTA 2JU5A 3J7Yk 5D9WA 4N30A 5ECPB 3WT2A 2YPMA 4FYBA 3D22A 3LFLA 2RLIA 3IPZA 5ECNB 4WXTA 1DE2A 1BG5A 2RM6A 3ERWA 1H4OA 2AAWA 4IHUA 2K8SA 1ERTA 4BWQA 5ECLB 5GSTA 3LQ7A 3PR8A 3IRAA 3UAPA 5JCWA 2L59A 5DDLA 1FOHA 3DVWA 2L5LA 3LWAA 2CVKA 3DIEA 4GTUA 5H5QA 4IKHA 3KIJA 1SKRB 1GTBA 1JFUA 12GSA 3TKRA 2IMFA 3LYKA 5DALB 3F4SA 1ZCPA 3QD9A 5GSSA 1M0UA 1ZMAA 2L4QA 2L57A 2H1GA 2DC5A 2DSAA 5L71A 2DIZA 2G0FA 3TGZA 1Z9HA 3ZIJA 2DJKA 4OO4A 3KH7A 3QAVA 1F3AA 1ZYNA 2OE0A 2HRAA 3MSZA 1SL1B 1IYIA 1YQ1A 1VF4A 4TXOB 20GSA 4ZL9A 1SJ6A 13GSA 3TCOA 2IPAA 3EMXA 2WRTA 4NHZA 5CRWA 1F2EA 4MZCA 3DMLA 4EO3A 2VCWA 3HJOA 2KOKA 2YP6A 3G7YA 5ECKB 8GSSA 1H75A 3ZFBA 1BJXA 1M9BA 1AIUA 2XPEA 2HRNA 3L78A 5ECOB 1GRXA 1W4VA 2QKEA 4GCIA 2K9FA 1C72A 1A2JA 1O81A 1XCCA 2KHPA 2QC7A 3TJBA 2A2PA 5G1KA 1BQ7A 2B1KA 1G7OA 5F8BA 3TKSE 2MBTA 4EE0A 1K3LA 1B4PA 1YKAA 5IMVA 4E8EA 3QPMA 4K5SA 4TR3A 1LJRA 4YAVA 4OWYA 4IP1A 2A4VA 1DBYA 2H70A 4MF7A 3UJ1A 3L9VA 4FQUA 5EY6A 1QXHA 3APQA 3D0ZA 1DSBA 4K6XA 5CO3A 3KMNA 4WBRD 4K2DA 3E9JB 3E0UA 2I81A 3CSJA 4LLRA 3F8UA 4J2FA 4YKFA 2TRCP 3EMPA 3F6DA 4GSTA 1F9MA 1G6YA 1V57A 2IN3A 5EL8A 4JBBA 2ZCTA 1BEDA 1XW5A 1Z7PA 2HRFA 5DQYA 1GNEA 3QAWA 4O7HA 3F4TA 2HSHA 4PXOA 3FMWA 4HI7A 5DJLA 2YANA 4ECIA 4N10A 4F82A 2GQMA 4YH2A 3KMOA 4USSA 4ZXGA 1A24A 1MEKA 2HSYA 3IAS2 2LQQA 2G2QA 4WETA 1QMVA 2H72A 4AJ7A 5C00A 2E0QA 3ZITA 4NV2A 1XWGA 4NXIA 4EDYA 4PQHA 4LA1A 3OR5A 1YY7A 2NTOA 3IDVA 1E2YA 1WIKA 2KP1A 1A8LA 4HQZA 4MF5A 4IGJA 2DIYA 2B5YA 2DKIA 1JLVA 1PL1A 2H30A 5IIZA 1E6BA 1BX9A 2M80A 4PQ1A 1XWCA 2VL2C 2R6KA 4KSOA 1M7TA 5DJMA 2MMAA 4KW6A 2AUVA 4OFNA 1S3DA 4K8MA 5HFKA 4D73A 1I5GA 2JADA 4IELA 5LD0A 2PMTA 4V2LA 3EU4A 1YF0A 4DSSB 3O6TA 2WULA 4MDCA 4XRDA 4N11A 5B7CA 4GF0A 1RK4A 4IQAA 2IJYA 3FZ4A 2C1YA 1RQMA 3MAKA 3KXOA 3MWHA 1JHBA 1K3OA 2MMOA 1LBKA 4KCAA 2LRTA 3U5RE 4TN8A 2C3QA 1VGLA 5AN1A 3Q74A 4AF2A 3EYTA 1S3CA 3A2XA 3G9BA 3QCPA 4MLYA 1T4ZA 3GTUB 2C0GA 3HZ8A 4OFMA 2DMLA 3ZVJD 3HYPA 17GSA 4Q5RA 3N9JA 2AYTA 2PPTA 4IBPA 1T8EB 3S9FA 4KAEA 3HY2A 2B5EA 2YWMA 4HU9A 3GKMA 5COHA 4RUVA 5IPHA 1U6TA 3UEMA 2L6CA 2FWFA 1SYRA 5DAKA 5KOXA 3QFBC 3KH9A 2F9SA 4WBJA 2GQLA 4ICYA 5HFGA 2N5AA 2H73A 2PUKC 3ME7A 2J9HA 4GQCA 4LL4B 4Z7XA 5A5KA 2I4AA 2DMMA 1X9MB 3U6VA 3KJYA 4GSNA 1QQ2A 4F03A 1V40A 1EOGA 10GSA 5J9BA 3IE3A 3DGQA 1THXA 1R5AA 1CQHA 4O92A 3WT1A 2CZ3A 3DKSA 2ZUPA 5ECRB 3TOUA 5AIXA 3ZMLA 4GLTA 1AAZA 2IL3A 5IO0A 3RAZA 3Q6OA 2CV4A 5B8AA 3ME8A 1AXDA 4I2UA 1EZKA 2XHFA 1SYXA 5ECHB 2WGRA 2OJLA 1SK1A 4CY6A 2H6ZA 2H19A 4EIPA 5JWRB 4ZILA 4I8BA 4AJ6A 4ZBDA 3ZVJA 4EXJA 1ILOA 4YQUA 3ZTLA 4QL9A 1R7HA 4XHMA 3FHKA 1QK8A 1B4QA 4GSSA 1OKTA 1SJZA 2PWJA 2JSZA 3APOA 2CX3A 1XZOA 2REMA 3LYPA 4ACSA 3LXTA 3MDKA 2OBKA 2X8CA 5D9XA 5KN1A 4X1UA 3W6GA 2A2RA 1GTAA 3GFKA 1ST9A 3M1GA 1FO5A 4EC0A 1URMA 4FO5A 5ELAA 2DJ2A 1SU9A 2WS2A 2WB9A 2LNSA 1EV9A 4XS4B 4N0VA 2A4HA 2LEGA 4KH7A 1XW9A 3GL5A 1K0NA 2HLSA 5JCGA 4ZL8A 1V98A 1Z6MA 4I5QA 2VLUA 4NMUA 2GTUA 1PL2A 1TP9A 3PGTA 1VRSD 4PNFA 4MZWA 3APSA 1TK5B 1TU8A 4YAPA 4I97A 3A5IA 1PSQA 2OE1A 4TXVA 3FW2A 3RHCA 2JZRA 1ERWA 2H6YA 1OKDA 2V6OA 4GWRA 3M3MA 3TB2A 1A2LA 2PGTA 4KDUA 2PN8A 2MYGA 5KN3A 1T1VA 5HFIA 2P5QA 4FIWA 1NSWA 3R2QA 3TRXA 3KCMA 4CDOA 2CA8A 2NPBA 1OC3A 5KOWA 3L9SA 3M8NA 5AIVA 5IPGA 4ECJA 3FZ5A 4Z2TA 1I9DA 1Y6EA 3TOTA 3IAM2 3RDWA 1WRYA 4NHWA 4NPBA 2H1BA 3TJJA 2ALBA 3D4TA 4K7NA 4TVEA 1VF2A 1GUMA 2R3XA 2M46A 3LG6A 1DUGA 4I6XA 5GAPD 1V2AA 3F9UA 2A2SA 6GSWA 5CAXA 2YZHA 1VF3A 3EWLA 3GYKA 5HQPA 1GP1A 2LS5A 4HDEA 1XPVA 4IVFA 1G0TA 3TJGA 2GSTA 2X8HA 1PD21 2H1AA 1Y25A 3QOUA 1U87A 2YNXA 2PVQA 4F2IA 3BCIA 4K0GA 2I9HA 3VK9A 6GSSA 3N5OA 2OADA 1OVNA 2MBSA 2VO4A 2KP2A 1AUCA 2VL2A 2N5FA 3TUEA 1XBSA 2AB6A 2IMIA 4KCEA 1HD2A 3GH6A 4ZB8A 1MDIA 1T4YA 1ZOFA 3WGXA 2ON5A 3UVHA 2LKUA 2LJRA 5ECSA 4TR4A 5IMAA 4JE1A 3TJFA 4O5RA 2GGTA 3QAGA 7GSSA 4V1Ag 4OD7A 4BL7B 5IOWA 2WJUA 1YEPA 1ZL9A 1F3BA 2OA7A 4XRAA 4A5PA 4Q5FA 4ML1A 4MJAA 5D73A 1GH2A 2E7PA 1EP7A 2QSIA 2P5RA 4MH3A 3I9V2 1FOVA 3FZ9A 2AV4A 5D8IA 2DJJA 5J4UA 1J9BA 3QMXA 3TDGA 3TJKA 4IQ1A 1TRWA 4NAXA 3IXRA 2XPDA 1NW2A 2K18A 3W8JA 2OE3A 4HOJA 5DCHA 1GSUA 2H01A 2H66A 4POLA 1EGOA 3UL3A 4XS6A 5EPFA 4G10A 2DLXA 1J08A 3P7XA 1X9WB 2CZ2A 1SD8A 2H71A 3HJPA 4CW9A 3SWLA 2LJAA 1YKCA 1GNWA 2FGXA 3G7IA 1A8YA 1G6WA 2XBQA 1O8WA 2O7KA 2YWNA 5KN0A 2GSRA 3M0FA 4MP4A 2PBJA 5F07A 4G2EA 2LTKA 3TRQA 3HCZA 3O76A 1SL2B 2EIQA 3HXSA 3C73A 2H8LA 3H79A 3RPNA 1ML6A 2B7KA 4V2NA 3ZYWA 3VFIA 3BCKA 4GRFA 3DYRA 1JLWA 2LJKA 4PQIA 2V6KA 4IJIA 3F3QA 1ON4A 2GLRA 2WCIA 1EGRA 3CTFA 6GSVA 2HXKA 5IMDA 19GSA 2B3SA 3KP8A 4IP6A 1G7EA 1PKWA 5KEJA 2L4CA 1PX7A 1TOFA 2FLSA 2FHEA 1Z5YE 6GSYA 4X4JA 1WMJA 2FA4A 3GL3A 2NDOA 2L6DA 4MCUA 1X5DA 3I69A 4BVYB 3IHQA 3H1NA 1BYEA 2VCZA 1SL0B 3FK8A 5KN2A 1WWJA 1U3IA 4EKZA 5AISA 2R0PA 3ZL5A 2I3YA 3EINA 2WFCA 2J23A 4IW9A 1SENA 1WE0A 4Z2UA 4PTSA 5DQSA 2VLTA 5G5EA 2HZFA 2VD0A 1Z6NA 4GXZA 3IBHA 1R4WA 2X64A 1B9XC 4LL1B 4POKA 2I1UA 1GSDA 4BVXA 1TDIA 2FY6A 4ECCA 5INYA 1TI3A 3RHBA 3I6AA 2IMKA 1GLPA 3TKQA 4F0BA 4XS1A 4KB3A 4X0XA 2MMNA 4DEJA 2HI7A 3F63A 1MD4A 3CYNA 2VIMA 4G0IA 2HRKA 3TKSC 3GRXA 3IC4A 2CQ9A 3M9KA 1TRSA 3ZIVA 1ABAA 1SJIA 2LSTA 2WDUA 3BD2A 3BOAA 2B5XA 2DBCA 1SD9A 1R26A 2TRXA 4ML6A 1YDKA 2R2JA 1WJKA 2FA8A 1UC7A 2O87A 4EL1A 3UVTA 5ECIB 1NHYA 4ID0A 1NHOA 1GUHA 4POBA 2HT9A 5D9VA 5CP1A 1GUKA 3UBKA 2LUSA 4LMVA 1HYUA 3VWUA 1KEBA 2CAIA 1X5EA 3A3TA 1MTCA 1ERUA 3QR6A 2VM2A 3VWVA 5ELGA 4HU7A 3P8WA 22GSA 2V1MA 2YWOA 3FR3A 5DALA 1YF1A 5CRHA 2O89A 4MK3A 5C04A 4KX4A 2R4VA 5E4WA 4F0CA 3HKRA 1WOUA 2PERA 1S3AA 3GNJA 3GUSA 5ENUA 2FCHA 4HZ2A 2UZ8A 5F05A 2QA1A 3DWVA 1M2AA 3VLNA 5G5FA 1AW9A 4PURA 5HR3A 4OFTA 5D96A 2OACA 4TXOA 3R3EA 4H86A 3WD6A 3GHAA 18GSA 5F0GA 3CRUA 2DJ0A 2CAQA 2IIYA 4HJMA 2V32A 4CHSA 4JU5A 4MMMA 3KP9A 3FY7A 4MNNA 3FKFA 4G19A 2VLVA 3DXBA 3HZ4A 4YQVA 4YQMA 1K0MA 2FWHA 2EC4A 4DSRA 2X99A 1B8XA 4E8HA 2H1DA 3MNGA 4WEYA 1PGTA 3ERGA 3KEBA 1UA5A 3UARA 2R37A 3CTGA 3ZZXA 5HR0A 2VUPA 16GSA 3IV4A 2GSSA 2M72A 2X8GA 1N8JA 1PN0A 2N5BA 1GWCA 1A0FA 2RUFA 3D4MA 2LRCA 2FWGA 4G0LA 4L8EA 1K0BA 1K3YA 2X49A 3IC8A 5DCGA 1KNGA 2ON7A 1GSSA 1CQGA 4X43A 3C71A 2IFQB 2DJ3A 2JACA 3F0IA 5E59A 4V2MA 3GURA 4L0WA 1JZWA 2YZUA 3C8EA 4KA0A 4FYUA 5J41A 4AGSA 4TW5A 2MZCA 2K8VA 3IA1A 4OMVA 4TKYA 1U3AA 2D2ZA 5ECQB 2Z9SA 4WF4A 2H0IA 4KSMA 4BPYA 1ZZYA 6GSUA 3F4RA 4K1FA 2RIIA 2VD1A 2L5OA 1R5PA 1AQWA 1M2DA 1GULA 5B8BA 3VI7A 4QQ7A 2DKHA 5FWGA 4WKWA 6GSXA 4Q5QA 4HQSA 2R0GA 2RUEA 3L4NA 11GSA 1M9AA 4L5LA 2YCDA 2PVOC 3BBYA 2DJ1A 1SK2A 1LU4A 2QA2A 2XBIA 2GZZA 1TKDB 3VI5A 4O32A 2LNTA 1GTIA 4ZIJA 1TTZA 2V41A 3LXZA 1Q98A 1A0RP 2ZNMA 2H75A 3Q18A 4PNGA 1FVJA 2K6VA 2HE3A 3IK7A 3EC3A 1TXXA 1O73A 4D73B 1YZXA 1FB0A 1AC1A 4KDYA 3VURA 5B6NA 1FB6A 1TK0B 1MDJA 2B1LA 4KF9A 5A4UA 1F6MC 2ES7A 1AQVA 2EIRA 1JZRA 1ZYQB 1K0CA 4HUAA 4O5QA 4ZB6A 5J9CA 4POMA 1HQOA 4DSSA 5HR2A 1OE7A 3HVVA 2HFDA 2RM5A 1XVQA 3E3EA 1JZOA 2GZPA 3GKNA 4OCFA 3FRCA 2VAFA 1MDKA 1K0AA 3D5JA 1PRXA 3ZMKA 1HNCA 3GH9A 2AJQB 2NBSA 1QFNA 1ZYEA 4K0NA 5CRDA 1OC8A 3GTUA 3UOMA 2F3MA 4RQXA 1J0FA 4JR4A 4JRRA 4L0UA 2LRNA 4MF6A 4WR5A 3ISOA 2OBIA 3HVSA 3A5WA 3FZAA 4Z2RA 2O85A 4AJ8A 5LNKe 1FAAA 2XC2A 5G31A 4KE3A 1XWKA 4WF5A 4ZB9A 5AGYA 2CX4A 5H5SA 1GSYA 2IWTA 1QGVA 3ED3A 3GSTA 5DAKB 2JSYA 4EUYA 4OO5A 3QDNA 4IS0A 5GZZB 2AHEA 3GA4A 3QFAC 3TKSA 4RI7A 2KUCA 4GQFA 1EV4A 5J5NA 3Q19A 2C80A 1FW1A 3MIXA 3ERFA 4QL7A 5CYYA 4OCEA 3CSHA 3C1SA 3LORA 3M9JA 4EVMA 5ABRA 1A23A 2WZ9A 4PUFC 2HZEB 1W89A 3ZRDA 1BAYA 2FUG2 1T7PB 2MMZA 1XXUA 5GAND 3UBLA 3H4KA 2GDRA 2QGVA 2YN1A 1XWBA 1O85A 4K7OA 3GX0A 1X9SB 1O7UA 2FD3A 1MD3A 1T3BA 5ID2B 4G0KA 1N2AA 1GSQA 3PINA 4IN0A 5FT3A 1A2MA 4MJEA 2C3NA 2GT5A 4PUAA 3A2VA 3EE2A 5JWOB 2PU9C 4TR1B 4MH2A 4TRXA 4G9HA 1XOBA 2YJ7A 2VCQA 3H93A 3HJMA 1EEJA 3ZLPA 4HZ4A 3W8SA 4JR6A 1XFLA 4IJ3A 1WP0A 3P2AA 5LCZA 5DBQA 3FR6A 1VF1A 2C3TA 3GIXA 3VPTA 2VL9A 2O8VB 1FVKA 2YWIA 3L9UA 4DSQA 1GLQA 3NOFA 1GTUA 2JZSA 4ZBAA 2R5GA 2X4AA 2IFQA 4ZBBA 4LMWA 1OC9B 4F9ZA 3AY8A 2JL4A 2YJHA 2B7JA 2VM1A 4MA9A 5ECMB 1F37A 5IQYA 3TRPA 3FEUA 14GSA 2R0CA 3KM6A 2C4JA 3DRNA 5B6MA 2VCTA 4XS4A 4O5UA 3HVXA 4BA7A 1TI1A 3RPPA 2CVBA 1EEMA 2E2MA 3L0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMX A;  5G30 A;  1GL8 A;  1OE8 A;  4NWY A;  1Q4J A;  1Z3E A;  1XWA A;  1KTE A;  1FHE A;  1TK8 B;  2B6M A;  2V2G A;  1OAZ A;  3J7Y b;  5IMF A;  2BTO T;  1GSE A;  3IK9 A;  3D21 A;  3GKK A;  3C1R A;  4ULX A;  4FYC A;  4MPF A;  1GSF A;  5A4W A;  3KD0 A;  3F6F A;  1USB A;  4MJC A;  3KTL A;  4ISD A;  5CRE A;  3CMI A;  4WR4 A;  1ACV A;  1EOH A;  2C0F A;  1XIY A;  1T00 A;  1ZGN A;  3LEF A;  2YOI A;  2P0G A;  2GZY A;  3FYG A;  5JWQ B;  1X5C A;  3CBU A;  4PGT A;  3ZRE A;  2IME A;  2YV7 A;  4PX1 A;  4ILF A;  2GQK A;  2HYX A;  3EUR A;  1IYH A;  3VWW A;  2VCV A;  5J3R A;  4FH8 A;  2C8U A;  4L5O A;  4EF0 A;  1XVW A;  1PQN A;  4MPG A;  1DE1 A;  3GMF A;  4HS1 A;  1O8X A;  4KDX A;  3DVX A;  5HR1 A;  2F8F A;  2CT6 A;  1TRV A;  5H5R A;  1PX6 A;  4V1A p;  3TKP A;  1YJ6 A;  3LJR A;  3GKX A;  3IOS A;  5IMZ A;  2VOC A;  2EIO A;  3K8N A;  5D9T A;  3LSZ A;  3CXG A;  5A4V A;  2IMD A;  2H76 A;  2GSQ A;  5IO2 A;  3RBT A;  2P31 A;  5G2Z A;  1EWX A;  3NZN A;  3CRT A;  3IR4 A;  3F3R A;  4KUN A;  5D93 A;  1UN2 A;  2H0G A;  1XOA A;  3KTB A;  1TU7 A;  1K0D A;  3GX8 A;  4J56 E;  3HDC A;  2FWE A;  3BJ5 A;  3CSI A;  3G7J A;  4KND A;  1K0O A;  4JED A;  3UIW A;  5IMC A;  1OYJ A;  3WGE A;  2CVD A;  4I2T A;  3ZFL A;  3WYW A;  2GVP A;  1PA3 A;  4BL7 A;  5IM9 A;  4K9Z A;  3HA9 A;  2GS3 A;  3DD3 A;  4NV5 A;  2OKA A;  4KGI A;  1SK0 A;  1O6J A;  1TJD A;  2H0H A;  2H6X A;  2HZE A;  3C7M A;  3NIV A;  4XCS A;  4N0Z A;  1KBN A;  1TRU A;  1WPI A;  2GT6 A;  4RI6 A;  5ID2 A;  3A2W A;  1RW1 A;  2LV3 A;  3O3T A;  3KGK A;  4DVC A;  3PH9 A;  1SKW B;  4XIH A;  4TR1 A;  4MZB A;  1V9W A;  3US3 A;  4TOP A;  1PMT A;  2E2G A;  4HEA 2;  2JZT A;  5CNW A;  4J57 E;  4P3Y B;  4HJ2 A;  1TW9 A;  5DVB A;  4TR0 A;  2BJX A;  2YV9 A;  5CRG A;  4ZL7 A;  1B48 A;  2TIR A;  4BWS A;  3FR9 A;  3KZQ A;  3LGC A;  2HNL A;  1M99 A;  4RQR A;  3VPQ A;  5JCU A;  2VL3 A;  1PKZ A;  1OC9 A;  4ECB A;  3H8Q A;  9GSS A;  5EVO A;  1YEX A;  1X0R A;  2F51 A;  4MJB A;  1U88 A;  4JZQ A;  1PN9 A;  3DEX A;  1FG4 A;  1THO A;  3P90 A;  1AQX A;  3D6I A;  3GSS A;  4BVY A;  2VCX A;  3GV1 A;  5G1L A;  1HNA A;  1Z7R A;  1UVZ A;  1EP8 A;  2FNO A;  1B9Y C;  3EU3 A;  2C0E A;  4EDZ A;  5IOX A;  6GST A;  4K7I A;  4MAB A;  1ERV A;  5FHI A;  3V1W A;  3WGD A;  1JZD A;  3SBC A;  2LQO A;  2F8A A;  3HD5 A;  2C0D A;  3UMA A;  3GN3 A;  1NM3 A;  1XW6 A;  1HNB A;  3I43 A;  3HHV A;  4XTS A;  1V58 A;  3EVI A;  4Q5N A;  1QUW A;  3JCM L;  2NVL A;  1M2B A;  2H74 A;  2KLX A;  1SKS B;  3VWX A;  5F06 A;  2JU5 A;  3J7Y k;  5D9W A;  4N30 A;  5ECP B;  3WT2 A;  2YPM A;  4FYB A;  3D22 A;  3LFL A;  2RLI A;  3IPZ A;  5ECN B;  4WXT A;  1DE2 A;  1BG5 A;  2RM6 A;  3ERW A;  1H4O A;  2AAW A;  4IHU A;  2K8S A;  1ERT A;  4BWQ A;  5ECL B;  5GST A;  3LQ7 A;  3PR8 A;  3IRA A;  3UAP A;  5JCW A;  2L59 A;  5DDL A;  3DVW A;  2L5L A;  3LWA A;  2CVK A;  3DIE A;  4GTU A;  5H5Q A;  4IKH A;  3KIJ A;  1SKR B;  1GTB A;  1JFU A;  12GS A;  3TKR A;  2IMF A;  3LYK A;  5DAL B;  3F4S A;  1ZCP A;  3QD9 A;  5GSS A;  1M0U A;  1ZMA A;  2L4Q A;  2L57 A;  2H1G A;  2DC5 A;  2DSA A;  5L71 A;  2DIZ A;  2G0F A;  3TGZ A;  1Z9H A;  3ZIJ A;  2DJK A;  4OO4 A;  3KH7 A;  3QAV A;  1F3A A;  2OE0 A;  3MSZ A;  1SL1 B;  1IYI A;  1YQ1 A;  1VF4 A;  4TXO B;  20GS A;  4ZL9 A;  1SJ6 A;  13GS A;  3TCO A;  2IPA A;  3EMX A;  2WRT A;  4NHZ A;  5CRW A;  1F2E A;  4MZC A;  3DML A;  4EO3 A;  2VCW A;  3HJO A;  2KOK A;  2YP6 A;  3G7Y A;  5ECK B;  8GSS A;  1H75 A;  3ZFB A;  1BJX A;  1M9B A;  1AIU A;  2XPE A;  2HRN A;  3L78 A;  5ECO B;  1GRX A;  1W4V A;  2QKE A;  4GCI A;  2K9F A;  1C72 A;  1A2J A;  1O81 A;  1XCC A;  2KHP A;  2QC7 A;  3TJB A;  5G1K A;  1BQ7 A;  2B1K A;  1G7O A;  5F8B A;  3TKS E;  2MBT A;  4EE0 A;  1K3L A;  1B4P A;  1YKA A;  5IMV A;  4E8E A;  3QPM A;  4TR3 A;  1LJR A;  4YAV A;  4OWY A;  4IP1 A;  2A4V A;  1DBY A;  2H70 A;  4MF7 A;  3UJ1 A;  3L9V A;  5EY6 A;  1QXH A;  3APQ A;  3D0Z A;  1DSB A;  4K6X A;  5CO3 A;  3KMN A;  4WBR D;  4K2D A;  3E9J B;  3E0U A;  2I81 A;  3CSJ A;  4LLR A;  3F8U A;  4J2F A;  2TRC P;  3EMP A;  3F6D A;  4GST A;  1F9M A;  1G6Y A;  1V57 A;  2IN3 A;  5EL8 A;  4JBB A;  2ZCT A;  1BED A;  1XW5 A;  1Z7P A;  2HRF A;  5DQY A;  1GNE A;  3QAW A;  4O7H A;  3F4T A;  2HSH A;  4PXO A;  4HI7 A;  5DJL A;  2YAN A;  4ECI A;  4N10 A;  4F82 A;  2GQM A;  4YH2 A;  3KMO A;  4ZXG A;  1A24 A;  1MEK A;  2HSY A;  3IAS 2;  2LQQ A;  2G2Q A;  4WET A;  1QMV A;  2H72 A;  4AJ7 A;  5C00 A;  2E0Q A;  3ZIT A;  4NV2 A;  1XWG A;  4NXI A;  4EDY A;  4PQH A;  4LA1 A;  3OR5 A;  1YY7 A;  2NTO A;  3IDV A;  1E2Y A;  1WIK A;  2KP1 A;  1A8L A;  4HQZ A;  4MF5 A;  4IGJ A;  2DIY A;  2B5Y A;  1JLV A;  1PL1 A;  2H30 A;  5IIZ A;  1E6B A;  1BX9 A;  2M80 A;  4PQ1 A;  1XWC A;  2VL2 C;  2R6K A;  4KSO A;  1M7T A;  5DJM A;  2MMA A;  4KW6 A;  2AUV A;  4OFN A;  1S3D A;  4K8M A;  5HFK A;  4D73 A;  1I5G A;  2JAD A;  4IEL A;  5LD0 A;  2PMT A;  4V2L A;  3EU4 A;  1YF0 A;  4DSS B;  3O6T A;  2WUL A;  4MDC A;  4XRD A;  4N11 A;  5B7C A;  4GF0 A;  1RK4 A;  4IQA A;  2IJY A;  3FZ4 A;  2C1Y A;  1RQM A;  3MAK A;  3KXO A;  3MWH A;  1JHB A;  1K3O A;  2MMO A;  1LBK A;  4KCA A;  2LRT A;  3U5R E;  4TN8 A;  2C3Q A;  1VGL A;  5AN1 A;  3Q74 A;  4AF2 A;  3EYT A;  1S3C A;  3A2X A;  3G9B A;  3QCP A;  4MLY A;  1T4Z A;  3GTU B;  2C0G A;  3HZ8 A;  4OFM A;  2DML A;  3ZVJ D;  3HYP A;  17GS A;  4Q5R A;  3N9J A;  2AYT A;  2PPT A;  4IBP A;  1T8E B;  3S9F A;  4KAE A;  3HY2 A;  2B5E A;  2YWM A;  4HU9 A;  3GKM A;  5COH A;  4RUV A;  5IPH A;  1U6T A;  3UEM A;  2L6C A;  2FWF A;  1SYR A;  5DAK A;  3QFB C;  3KH9 A;  2F9S A;  4WBJ A;  2GQL A;  5HFG A;  2N5A A;  2H73 A;  2PUK C;  3ME7 A;  2J9H A;  4GQC A;  4LL4 B;  4Z7X A;  5A5K A;  2I4A A;  2DMM A;  1X9M B;  3U6V A;  3KJY A;  4GSN A;  1QQ2 A;  4F03 A;  1V40 A;  1EOG A;  10GS A;  5J9B A;  3IE3 A;  3DGQ A;  1THX A;  1R5A A;  1CQH A;  4O92 A;  3WT1 A;  2CZ3 A;  3DKS A;  2ZUP A;  5ECR B;  3TOU A;  5AIX A;  3ZML A;  4GLT A;  1AAZ A;  2IL3 A;  5IO0 A;  3RAZ A;  3Q6O A;  2CV4 A;  5B8A A;  3ME8 A;  1AXD A;  4I2U A;  5ECH B;  1EZK A;  1SYX A;  2XHF A;  2WGR A;  2OJL A;  1SK1 A;  2H6Z A;  2H19 A;  5JWR B;  4ZIL A;  4I8B A;  4AJ6 A;  4ZBD A;  3ZVJ A;  4EXJ A;  1ILO A;  4YQU A;  3ZTL A;  4QL9 A;  1R7H A;  4XHM A;  3FHK A;  1QK8 A;  1B4Q A;  4GSS A;  1OKT A;  1SJZ A;  2PWJ A;  2JSZ A;  3APO A;  2CX3 A;  1XZO A;  2REM A;  3LYP A;  4ACS A;  3LXT A;  3MDK A;  2OBK A;  2X8C A;  5D9X A;  5KN1 A;  4X1U A;  3W6G A;  2A2R A;  1GTA A;  3GFK A;  1ST9 A;  3M1G A;  1FO5 A;  4EC0 A;  1URM A;  4FO5 A;  5ELA A;  2DJ2 A;  1SU9 A;  2WS2 A;  2WB9 A;  2LNS A;  1EV9 A;  4XS4 B;  4N0V A;  2LEG A;  4KH7 A;  1XW9 A;  3GL5 A;  1K0N A;  2HLS A;  5JCG A;  4ZL8 A;  1V98 A;  1Z6M A;  4I5Q A;  2VLU A;  4NMU A;  2GTU A;  1PL2 A;  1TP9 A;  3PGT A;  1VRS D;  4PNF A;  4MZW A;  3APS A;  1TK5 B;  1TU8 A;  4YAP A;  4I97 A;  1PSQ A;  2OE1 A;  4TXV A;  3FW2 A;  3RHC A;  2JZR A;  1ERW A;  2H6Y A;  1OKD A;  2V6O A;  4GWR A;  3M3M A;  3TB2 A;  1A2L A;  2PGT A;  4KDU A;  2PN8 A;  2MYG A;  5KN3 A;  1T1V A;  5HFI A;  2P5Q A;  4FIW A;  1NSW A;  3R2Q A;  3TRX A;  3KCM A;  4CDO A;  2CA8 A;  2NPB A;  1OC3 A;  3L9S A;  3M8N A;  5AIV A;  5IPG A;  4ECJ A;  3FZ5 A;  1I9D A;  1Y6E A;  3TOT A;  3IAM 2;  3RDW A;  1WRY A;  4NHW A;  4NPB A;  2H1B A;  3TJJ A;  2ALB A;  3D4T A;  4K7N A;  4TVE A;  1VF2 A;  1GUM A;  2R3X A;  2M46 A;  3LG6 A;  1DUG A;  4I6X A;  5GAP D;  1V2A A;  3F9U A;  2A2S A;  6GSW A;  5CAX A;  2YZH A;  1VF3 A;  3EWL A;  3GYK A;  5HQP A;  1GP1 A;  2LS5 A;  4HDE A;  1XPV A;  4IVF A;  1G0T A;  3TJG A;  2GST A;  2X8H A;  1PD2 1;  2H1A A;  1Y25 A;  3QOU A;  1U87 A;  2YNX A;  2PVQ A;  4F2I A;  3BCI A;  4K0G A;  2I9H A;  3VK9 A;  6GSS A;  3N5O A;  2OAD A;  1OVN A;  2MBS A;  2VO4 A;  2KP2 A;  1AUC A;  2VL2 A;  2N5F A;  3TUE A;  1XBS A;  2AB6 A;  2IMI A;  4KCE A;  1HD2 A;  3GH6 A;  4ZB8 A;  1MDI A;  1T4Y A;  1ZOF A;  3WGX A;  2ON5 A;  3UVH A;  2LKU A;  2LJR A;  5ECS A;  4TR4 A;  5IMA A;  4JE1 A;  3TJF A;  4O5R A;  2GGT A;  3QAG A;  7GSS A;  4V1A g;  4OD7 A;  5IOW A;  2WJU A;  1YEP A;  1ZL9 A;  1F3B A;  2OA7 A;  4XRA A;  4Q5F A;  4ML1 A;  4MJA A;  5D73 A;  1GH2 A;  2E7P A;  1EP7 A;  2QSI A;  2P5R A;  4MH3 A;  3I9V 2;  1FOV A;  3FZ9 A;  2AV4 A;  5D8I A;  2DJJ A;  5J4U A;  1J9B A;  3QMX A;  3TDG A;  3TJK A;  4IQ1 A;  1TRW A;  4NAX A;  3IXR A;  2XPD A;  1NW2 A;  2K18 A;  3W8J A;  2OE3 A;  4HOJ A;  5DCH A;  1GSU A;  2H01 A;  2H66 A;  4POL A;  1EGO A;  3UL3 A;  4XS6 A;  5EPF A;  4G10 A;  2DLX A;  1J08 A;  3P7X A;  1X9W B;  2CZ2 A;  1SD8 A;  2H71 A;  3HJP A;  4CW9 A;  3SWL A;  2LJA A;  1YKC A;  1GNW A;  2FGX A;  3G7I A;  1A8Y A;  1G6W A;  2XBQ A;  1O8W A;  2O7K A;  2YWN A;  5KN0 A;  2GSR A;  3M0F A;  4MP4 A;  2PBJ A;  5F07 A;  4G2E A;  2LTK A;  3TRQ A;  3HCZ A;  3O76 A;  1SL2 B;  2EIQ A;  3HXS A;  3C73 A;  2H8L A;  3H79 A;  3RPN A;  1ML6 A;  2B7K A;  4V2N A;  3ZYW A;  3VFI A;  3BCK A;  4GRF A;  3DYR A;  1JLW A;  2LJK A;  4PQI A;  2V6K A;  4IJI A;  3F3Q A;  1ON4 A;  2GLR A;  2WCI A;  1EGR A;  3CTF A;  6GSV A;  2HXK A;  5IMD A;  19GS A;  2B3S A;  3KP8 A;  4IP6 A;  1G7E A;  1PKW A;  5KEJ A;  2L4C A;  1PX7 A;  1TOF A;  2FLS A;  2FHE A;  1Z5Y E;  6GSY A;  1WMJ A;  2FA4 A;  3GL3 A;  2NDO A;  2L6D A;  4MCU A;  1X5D A;  3I69 A;  3IHQ A;  3H1N A;  1BYE A;  2VCZ A;  1SL0 B;  3FK8 A;  5KN2 A;  1WWJ A;  1U3I A;  4EKZ A;  5AIS A;  3ZL5 A;  2I3Y A;  3EIN A;  2WFC A;  2J23 A;  4IW9 A;  1SEN A;  1WE0 A;  5DQS A;  2VLT A;  5G5E A;  2HZF A;  2VD0 A;  1Z6N A;  4GXZ A;  3IBH A;  1R4W A;  2X64 A;  1B9X C;  4LL1 B;  4POK A;  2I1U A;  1GSD A;  4BVX A;  1TDI A;  2FY6 A;  4ECC A;  5INY A;  1TI3 A;  3RHB A;  3I6A A;  2IMK A;  1GLP A;  3TKQ A;  4F0B A;  4XS1 A;  4KB3 A;  4X0X A;  2MMN A;  4DEJ A;  2HI7 A;  3F63 A;  1MD4 A;  3CYN A;  2VIM A;  3TKS C;  3GRX A;  3IC4 A;  2CQ9 A;  3M9K A;  1TRS A;  3ZIV A;  1ABA A;  1SJI A;  2LST A;  2WDU A;  3BD2 A;  3BOA A;  2B5X A;  2DBC A;  1SD9 A;  1R26 A;  2TRX A;  4ML6 A;  1YDK A;  2R2J A;  1WJK A;  2FA8 A;  1UC7 A;  2O87 A;  4EL1 A;  3UVT A;  5ECI B;  1NHY A;  4ID0 A;  1NHO A;  1GUH A;  4POB A;  2HT9 A;  5D9V A;  5CP1 A;  1GUK A;  3UBK A;  2LUS A;  4LMV A;  1HYU A;  3VWU A;  1KEB A;  2CAI A;  1X5E A;  3A3T A;  1MTC A;  1ERU A;  3QR6 A;  2VM2 A;  3VWV A;  5ELG A;  4HU7 A;  3P8W A;  22GS A;  2V1M A;  2YWO A;  3FR3 A;  5DAL A;  1YF1 A;  5CRH A;  2O89 A;  4MK3 A;  5C04 A;  4KX4 A;  2R4V A;  5E4W A;  4F0C A;  3HKR A;  1WOU A;  2PER A;  1S3A A;  3GNJ A;  3GUS A;  5ENU A;  2FCH A;  4HZ2 A;  5F05 A;  3DWV A;  1M2A A;  3VLN A;  5G5F A;  1AW9 A;  4PUR A;  5HR3 A;  4OFT A;  5D96 A;  2OAC A;  4TXO A;  4H86 A;  3WD6 A;  3GHA A;  18GS A;  5F0G A;  3CRU A;  2DJ0 A;  2CAQ A;  2IIY A;  4HJM A;  2V32 A;  4CHS A;  4JU5 A;  4MMM A;  3KP9 A;  3FY7 A;  3FKF A;  4G19 A;  2VLV A;  3DXB A;  3HZ4 A;  4YQV A;  4YQM A;  1K0M A;  2FWH A;  2EC4 A;  4DSR A;  2X99 A;  1B8X A;  4E8H A;  2H1D A;  3MNG A;  4WEY A;  1PGT A;  3ERG A;  3KEB A;  1UA5 A;  3UAR A;  2R37 A;  3CTG A;  3ZZX A;  5HR0 A;  2VUP A;  16GS A;  3IV4 A;  2GSS A;  2M72 A;  2X8G A;  1N8J A;  2N5B A;  1GWC A;  1A0F A;  2RUF A;  3D4M A;  2LRC A;  2FWG A;  4L8E A;  1K0B A;  1K3Y A;  5DCG A;  1KNG A;  2ON7 A;  1GSS A;  1CQG A;  4X43 A;  3C71 A;  2IFQ B;  2DJ3 A;  2JAC A;  3F0I A;  5E59 A;  4V2M A;  3GUR A;  4L0W A;  1JZW A;  2YZU A;  3C8E A;  4KA0 A;  4FYU A;  5J41 A;  4AGS A;  4TW5 A;  2MZC A;  2K8V A;  3IA1 A;  4OMV A;  4TKY A;  1U3A A;  2D2Z A;  5ECQ B;  2Z9S A;  4WF4 A;  2H0I A;  4KSM A;  4BPY A;  1ZZY A;  6GSU A;  3F4R A;  4K1F A;  2RII A;  2VD1 A;  2L5O A;  1R5P A;  1AQW A;  1M2D A;  1GUL A;  5B8B A;  3VI7 A;  4QQ7 A;  5FWG A;  4WKW A;  6GSX A;  4Q5Q A;  4HQS A;  2RUE A;  3L4N A;  11GS A;  1M9A A;  4L5L A;  2YCD A;  2PVO C;  3BBY A;  2DJ1 A;  1SK2 A;  1LU4 A;  2XBI A;  2GZZ A;  1TKD B;  3VI5 A;  4O32 A;  2LNT A;  1GTI A;  4ZIJ A;  1TTZ A;  2V41 A;  3LXZ A;  1Q98 A;  1A0R P;  2ZNM A;  2H75 A;  3Q18 A;  4PNG A;  1FVJ A;  2K6V A;  2HE3 A;  3IK7 A;  3EC3 A;  1TXX A;  1O73 A;  4D73 B;  1YZX A;  1FB0 A;  1AC1 A;  4KDY A;  3VUR A;  5B6N A;  1FB6 A;  1TK0 B;  1MDJ A;  2B1L A;  5A4U A;  1F6M C;  2ES7 A;  1AQV A;  2EIR A;  1JZR A;  1ZYQ B;  1K0C A;  4HUA A;  4ZB6 A;  5J9C A;  4POM A;  1HQO A;  4DSS A;  5HR2 A;  1OE7 A;  3HVV A;  2HFD A;  2RM5 A;  1XVQ A;  3E3E A;  1JZO A;  2GZP A;  3GKN A;  4OCF A;  3FRC A;  2VAF A;  1MDK A;  1K0A A;  3D5J A;  1PRX A;  3ZMK A;  1HNC A;  3GH9 A;  2AJQ B;  2NBS A;  1QFN A;  1ZYE A;  4K0N A;  5CRD A;  1OC8 A;  3GTU A;  3UOM A;  2F3M A;  4RQX A;  1J0F A;  4JR4 A;  4JRR A;  4L0U A;  2LRN A;  4MF6 A;  4WR5 A;  3ISO A;  2OBI A;  3HVS A;  3A5W A;  3FZA A;  2O85 A;  4AJ8 A;  5LNK e;  1FAA A;  2XC2 A;  5G31 A;  4KE3 A;  1XWK A;  4WF5 A;  4ZB9 A;  5AGY A;  2CX4 A;  5H5S A;  1GSY A;  2IWT A;  1QGV A;  3ED3 A;  3GST A;  5DAK B;  2JSY A;  4EUY A;  4OO5 A;  3QDN A;  4IS0 A;  5GZZ B;  2AHE A;  3GA4 A;  3QFA C;  3TKS A;  4RI7 A;  2KUC A;  4GQF A;  1EV4 A;  5J5N A;  3Q19 A;  2C80 A;  1FW1 A;  3ERF A;  4QL7 A;  5CYY A;  4OCE A;  3CSH A;  3C1S A;  3LOR A;  3M9J A;  4EVM A;  5ABR A;  1A23 A;  2WZ9 A;  4PUF C;  2HZE B;  1W89 A;  3ZRD A;  1BAY A;  2FUG 2;  1T7P B;  2MMZ A;  1XXU A;  5GAN D;  3UBL A;  3H4K A;  2GDR A;  2QGV A;  2YN1 A;  1XWB A;  1O85 A;  4K7O A;  3GX0 A;  1X9S B;  1O7U A;  2FD3 A;  1MD3 A;  1T3B A;  5ID2 B;  1N2A A;  1GSQ A;  3PIN A;  4IN0 A;  5FT3 A;  1A2M A;  4MJE A;  2C3N A;  2GT5 A;  4PUA A;  3A2V A;  3EE2 A;  5JWO B;  2PU9 C;  4TR1 B;  4MH2 A;  4TRX A;  4G9H A;  1XOB A;  2YJ7 A;  2VCQ A;  3H93 A;  3HJM A;  1EEJ A;  3ZLP A;  4HZ4 A;  3W8S A;  4JR6 A;  1XFL A;  4IJ3 A;  1WP0 A;  3P2A A;  5LCZ A;  5DBQ A;  3FR6 A;  1VF1 A;  2C3T A;  3GIX A;  3VPT A;  2VL9 A;  2O8V B;  1FVK A;  2YWI A;  3L9U A;  4DSQ A;  1GLQ A;  3NOF A;  1GTU A;  2JZS A;  4ZBA A;  2R5G A;  2IFQ A;  4ZBB A;  4LMW A;  1OC9 B;  4F9Z A;  3AY8 A;  2JL4 A;  2YJH A;  2B7J A;  2VM1 A;  4MA9 A;  5ECM B;  1F37 A;  5IQY A;  3TRP A;  3FEU A;  14GS A;  3KM6 A;  2C4J A;  3DRN A;  5B6M A;  2VCT A;  4XS4 A;  3HVX A;  4BA7 A;  1TI1 A;  3RPP A;  2CVB A;  1EEM A;  2E2M A;  3L0H A; 
#chains in the Genus database with same CATH topology
 2BMX A;  5G30 A;  1GL8 A;  1OE8 A;  4NWY A;  1Q4J A;  1Z3E A;  3MYD A;  1XWA A;  1KTE A;  1FHE A;  1TK8 B;  2B6M A;  2V2G A;  1OAZ A;  3J7Y b;  5IMF A;  2BTO T;  1GSE A;  3IK9 A;  3D21 A;  3GKK A;  3C1R A;  4ULX A;  4FYC A;  4MPF A;  1GSF A;  5A4W A;  3KD0 A;  3F6F A;  1USB A;  4MJC A;  3KTL A;  4ISD A;  5CRE A;  3CMI A;  4WR4 A;  1ACV A;  1EOH A;  2C0F A;  1XIY A;  1T00 A;  1ZGN A;  3LEF A;  2YOI A;  2P0G A;  2GZY A;  5BMU A;  3FYG A;  5JWQ B;  1X5C A;  3CBU A;  4PGT A;  3ZRE A;  2IME A;  2YV7 A;  4PX1 A;  4ILF A;  2GQK A;  2HYX A;  3EUR A;  1IYH A;  3VWW A;  2VCV A;  5J3R A;  4FH8 A;  2C8U A;  4L5O A;  4EF0 A;  1XVW A;  1PQN A;  4MPG A;  1DE1 A;  3GMF A;  4HS1 A;  1O8X A;  4KDX A;  3DVX A;  5HR1 A;  2F8F A;  2CT6 A;  1TRV A;  3IHG A;  5H5R A;  1PX6 A;  4V1A p;  3TKP A;  1YJ6 A;  3LJR A;  3GKX A;  3IOS A;  5IMZ A;  3LW9 A;  2VOC A;  2EIO A;  3K8N A;  5D9T A;  3LSZ A;  3CXG A;  5A4V A;  2IMD A;  2H76 A;  2GSQ A;  5IO2 A;  3RBT A;  2P31 A;  5G2Z A;  1EWX A;  3NZN A;  3CRT A;  3IR4 A;  3F3R A;  4KUN A;  5D93 A;  1UN2 A;  2H0G A;  1XOA A;  3KTB A;  1TU7 A;  1K0D A;  3GX8 A;  4J56 E;  3HDC A;  2FWE A;  3BJ5 A;  3CSI A;  3G7J A;  4KND A;  1K0O A;  4JED A;  3UIW A;  5IMC A;  4K2X A;  1OYJ A;  3WGE A;  2CVD A;  4I2T A;  3ZFL A;  3WYW A;  2GVP A;  1PA3 A;  4BL7 A;  5IM9 A;  4K9Z A;  3HA9 A;  2GS3 A;  3DD3 A;  4NV5 A;  2OKA A;  4KGI A;  1SK0 A;  1O6J A;  1TJD A;  2H0H A;  2H6X A;  2HZE A;  3C7M A;  3NIV A;  4XCS A;  4N0Z A;  1KBN A;  1TRU A;  1WPI A;  2GT6 A;  4RI6 A;  5ID2 A;  3A2W A;  1RW1 A;  2LV3 A;  3O3T A;  3KGK A;  4DVC A;  3PH9 A;  1SKW B;  4XIH A;  4TR1 A;  4MZB A;  1V9W A;  3US3 A;  4TOP A;  1PMT A;  2E2G A;  4HEA 2;  2JZT A;  5CNW A;  4J57 E;  4P3Y B;  4HJ2 A;  1TW9 A;  5DVB A;  4YKG A;  4TR0 A;  2BJX A;  2YV9 A;  5CRG A;  4ZL7 A;  1B48 A;  2TIR A;  4BWS A;  3FR9 A;  3KZQ A;  3LGC A;  2HNL A;  1M99 A;  4RQR A;  3VPQ A;  5JCU A;  2VL3 A;  1PKZ A;  1OC9 A;  4ECB A;  3H8Q A;  9GSS A;  5EVO A;  1ZYP A;  1YEX A;  1X0R A;  2F51 A;  4MJB A;  1U88 A;  4JZQ A;  1PN9 A;  3DEX A;  1FG4 A;  1THO A;  3P90 A;  1AQX A;  3D6I A;  3GSS A;  4BVY A;  2VCX A;  3GV1 A;  5G1L A;  1HNA A;  4EIQ A;  1Z7R A;  1UVZ A;  1EP8 A;  2FNO A;  1B9Y C;  3EU3 A;  2C0E A;  4EDZ A;  5IOX A;  6GST A;  4K7I A;  4MAB A;  2HSM A;  5BRT A;  1ERV A;  5FHI A;  3V1W A;  3WGD A;  1JZD A;  3SBC A;  2LQO A;  2F8A A;  4BVX B;  3HD5 A;  4K5R A;  2C0D A;  3UMA A;  3GN3 A;  4CY8 A;  1NM3 A;  1XW6 A;  1HNB A;  3I43 A;  3HHV A;  4XTS A;  1V58 A;  3EVI A;  4Q5N A;  1QUW A;  3JCM L;  2NVL A;  3PPU A;  1M2B A;  2H74 A;  2KLX A;  1SKS B;  3VWX A;  5F06 A;  3EPT A;  2JU5 A;  3J7Y k;  5D9W A;  4N30 A;  5ECP B;  3WT2 A;  2YPM A;  4FYB A;  3D22 A;  3LFL A;  2RLI A;  3IPZ A;  5ECN B;  4WXT A;  1DE2 A;  1BG5 A;  2RM6 A;  3ERW A;  1H4O A;  2AAW A;  4IHU A;  2K8S A;  1ERT A;  4BWQ A;  5ECL B;  5GST A;  3LQ7 A;  3PR8 A;  3IRA A;  3UAP A;  5JCW A;  2L59 A;  5DDL A;  1FOH A;  3DVW A;  2L5L A;  3LWA A;  2CVK A;  3DIE A;  4GTU A;  5H5Q A;  4IKH A;  3KIJ A;  1SKR B;  1GTB A;  1JFU A;  12GS A;  3TKR A;  2IMF A;  3LYK A;  5DAL B;  3F4S A;  1ZCP A;  3QD9 A;  5GSS A;  1M0U A;  1ZMA A;  2L4Q A;  2L57 A;  2H1G A;  2DC5 A;  2DSA A;  5L71 A;  2DIZ A;  2G0F A;  3TGZ A;  1Z9H A;  3ZIJ A;  2DJK A;  4OO4 A;  3KH7 A;  3QAV A;  1F3A A;  1ZYN A;  2OE0 A;  2HRA A;  3MSZ A;  1SL1 B;  1IYI A;  1YQ1 A;  1VF4 A;  4TXO B;  20GS A;  4ZL9 A;  1SJ6 A;  13GS A;  3TCO A;  2IPA A;  3EMX A;  2WRT A;  4NHZ A;  5CRW A;  1F2E A;  4MZC A;  3DML A;  4EO3 A;  2VCW A;  3HJO A;  2KOK A;  2YP6 A;  3G7Y A;  5ECK B;  8GSS A;  1H75 A;  3ZFB A;  1BJX A;  1M9B A;  1AIU A;  2XPE A;  2HRN A;  3L78 A;  5ECO B;  1GRX A;  1W4V A;  2QKE A;  4GCI A;  2K9F A;  1C72 A;  1A2J A;  1O81 A;  1XCC A;  2KHP A;  2QC7 A;  3TJB A;  2A2P A;  5G1K A;  1BQ7 A;  2B1K A;  1G7O A;  5F8B A;  3TKS E;  2MBT A;  4EE0 A;  1K3L A;  3HVN A;  1B4P A;  1YKA A;  5IMV A;  4E8E A;  3QPM A;  4K5S A;  4TR3 A;  1LJR A;  4YAV A;  4OWY A;  4IP1 A;  2A4V A;  1DBY A;  2H70 A;  4MF7 A;  3UJ1 A;  3L9V A;  4FQU A;  5EY6 A;  1QXH A;  3APQ A;  3D0Z A;  1DSB A;  4K6X A;  5CO3 A;  3KMN A;  4WBR D;  4K2D A;  3E9J B;  3E0U A;  2I81 A;  3CSJ A;  4LLR A;  3F8U A;  4J2F A;  4YKF A;  2TRC P;  3EMP A;  3F6D A;  4GST A;  1F9M A;  1G6Y A;  1V57 A;  2IN3 A;  5EL8 A;  4JBB A;  2ZCT A;  1BED A;  1XW5 A;  1Z7P A;  2HRF A;  5DQY A;  1GNE A;  3QAW A;  4O7H A;  3F4T A;  2HSH A;  4PXO A;  3FMW A;  4HI7 A;  5DJL A;  2YAN A;  4ECI A;  4N10 A;  4F82 A;  2GQM A;  4YH2 A;  3KMO A;  4USS A;  4ZXG A;  1A24 A;  1MEK A;  2HSY A;  3IAS 2;  2LQQ A;  2G2Q A;  4WET A;  1QMV A;  2H72 A;  4AJ7 A;  5C00 A;  2E0Q A;  3ZIT A;  4NV2 A;  1XWG A;  4NXI A;  4EDY A;  4PQH A;  4LA1 A;  3OR5 A;  1YY7 A;  2NTO A;  3IDV A;  1E2Y A;  1WIK A;  2KP1 A;  1A8L A;  4HQZ A;  4MF5 A;  1XG8 A;  4IGJ A;  2DIY A;  2B5Y A;  2DKI A;  1JLV A;  1PL1 A;  2H30 A;  5IIZ A;  1E6B A;  1BX9 A;  2M80 A;  4PQ1 A;  1XWC A;  2VL2 C;  2R6K A;  4KSO A;  1M7T A;  5DJM A;  2MMA A;  4KW6 A;  2AUV A;  4OFN A;  1S3D A;  4K8M A;  5HFK A;  4D73 A;  1I5G A;  2JAD A;  4IEL A;  5LD0 A;  2PMT A;  4V2L A;  3EU4 A;  1YF0 A;  4DSS B;  3O6T A;  2WUL A;  4MDC A;  4XRD A;  4N11 A;  5B7C A;  4GF0 A;  1RK4 A;  4IQA A;  2IJY A;  3FZ4 A;  2C1Y A;  1RQM A;  3MAK A;  3KXO A;  3MWH A;  1JHB A;  1K3O A;  2MMO A;  1LBK A;  4KCA A;  2LRT A;  3U5R E;  4TN8 A;  2C3Q A;  1VGL A;  5AN1 A;  3Q74 A;  4AF2 A;  3EYT A;  1S3C A;  3A2X A;  3G9B A;  3QCP A;  4MLY A;  1T4Z A;  3GTU B;  2C0G A;  3HZ8 A;  4OFM A;  2DML A;  3ZVJ D;  3HYP A;  17GS A;  4Q5R A;  3N9J A;  2AYT A;  2PPT A;  4IBP A;  1T8E B;  3S9F A;  4KAE A;  3HY2 A;  2B5E A;  2YWM A;  4HU9 A;  3GKM A;  5COH A;  4RUV A;  5IPH A;  1U6T A;  3UEM A;  2L6C A;  2FWF A;  1SYR A;  5DAK A;  5KOX A;  3QFB C;  3KH9 A;  2F9S A;  4WBJ A;  2GQL A;  4ICY A;  5HFG A;  2N5A A;  2H73 A;  2PUK C;  3ME7 A;  2J9H A;  4GQC A;  4LL4 B;  4Z7X A;  5A5K A;  2I4A A;  2DMM A;  1X9M B;  3U6V A;  3KJY A;  4GSN A;  1QQ2 A;  4F03 A;  1V40 A;  1EOG A;  10GS A;  5J9B A;  3IE3 A;  3DGQ A;  1THX A;  1R5A A;  1CQH A;  4O92 A;  3WT1 A;  2CZ3 A;  3DKS A;  2ZUP A;  5ECR B;  3TOU A;  5AIX A;  3ZML A;  4GLT A;  1AAZ A;  2IL3 A;  5IO0 A;  3RAZ A;  3Q6O A;  2CV4 A;  5B8A A;  3ME8 A;  1AXD A;  4I2U A;  1EZK A;  2XHF A;  1SYX A;  5ECH B;  2WGR A;  2OJL A;  1SK1 A;  1M3J A;  4CY6 A;  2H6Z A;  2H19 A;  4EIP A;  5JWR B;  4ZIL A;  4I8B A;  4AJ6 A;  4ZBD A;  3ZVJ A;  4EXJ A;  1ILO A;  4YQU A;  3ZTL A;  4QL9 A;  1R7H A;  4XHM A;  3FHK A;  1QK8 A;  1B4Q A;  4GSS A;  1OKT A;  1SJZ A;  2PWJ A;  2JSZ A;  3APO A;  2CX3 A;  1XZO A;  2REM A;  3LYP A;  4ACS A;  3LXT A;  3MDK A;  2OBK A;  2X8C A;  5D9X A;  5KN1 A;  4X1U A;  3W6G A;  2A2R A;  1GTA A;  3GFK A;  1ST9 A;  3M1G A;  1FO5 A;  4EC0 A;  1URM A;  4FO5 A;  5ELA A;  2DJ2 A;  1SU9 A;  2WS2 A;  2WB9 A;  2LNS A;  1EV9 A;  4XS4 B;  4N0V A;  2A4H A;  2LEG A;  4KH7 A;  1XW9 A;  3GL5 A;  1K0N A;  2HLS A;  4BIK A;  5JCG A;  4ZL8 A;  1V98 A;  1Z6M A;  4I5Q A;  2VLU A;  4NMU A;  2GTU A;  1PL2 A;  1TP9 A;  3PGT A;  1VRS D;  4PNF A;  4MZW A;  3APS A;  1TK5 B;  1TU8 A;  4YAP A;  4I97 A;  3A5I A;  1PSQ A;  2OE1 A;  4TXV A;  3FW2 A;  3RHC A;  2JZR A;  1ERW A;  2H6Y A;  1OKD A;  2V6O A;  4GWR A;  3M3M A;  3TB2 A;  1A2L A;  2PGT A;  4KDU A;  2PN8 A;  2MYG A;  5KN3 A;  1T1V A;  5HFI A;  2P5Q A;  4FIW A;  1NSW A;  3R2Q A;  3TRX A;  3KCM A;  4CDO A;  2CA8 A;  2NPB A;  1OC3 A;  5KOW A;  3L9S A;  3M8N A;  5AIV A;  5IPG A;  4ECJ A;  3FZ5 A;  4Z2T A;  1I9D A;  1Y6E A;  3TOT A;  3IAM 2;  3RDW A;  1WRY A;  4NHW A;  4NPB A;  2H1B A;  3TJJ A;  2ALB A;  3D4T A;  4K7N A;  4TVE A;  1VF2 A;  1GUM A;  2R3X A;  2M46 A;  3LG6 A;  1DUG A;  4I6X A;  5GAP D;  1V2A A;  3F9U A;  2A2S A;  6GSW A;  5CAX A;  2YZH A;  1VF3 A;  3EWL A;  3GYK A;  5HQP A;  1GP1 A;  2LS5 A;  4HDE A;  1XPV A;  4IVF A;  1G0T A;  3TJG A;  2GST A;  2X8H A;  1PD2 1;  2H1A A;  1Y25 A;  3QOU A;  1U87 A;  2YNX A;  2PVQ A;  4F2I A;  3BCI A;  4K0G A;  2I9H A;  3VK9 A;  6GSS A;  3N5O A;  2OAD A;  1OVN A;  2MBS A;  2VO4 A;  2KP2 A;  1AUC A;  2VL2 A;  2N5F A;  3TUE A;  1XBS A;  2AB6 A;  2IMI A;  4KCE A;  1HD2 A;  3GH6 A;  4ZB8 A;  1MDI A;  1T4Y A;  1ZOF A;  3WGX A;  2ON5 A;  3UVH A;  2LKU A;  2LJR A;  5ECS A;  4TR4 A;  5IMA A;  4JE1 A;  3TJF A;  4O5R A;  2GGT A;  3QAG A;  7GSS A;  4V1A g;  4OD7 A;  4BL7 B;  5IOW A;  2WJU A;  1YEP A;  1ZL9 A;  1F3B A;  4HSC X;  2OA7 A;  4XRA A;  3CQF A;  4A5P A;  4Q5F A;  4ML1 A;  4MJA A;  5D73 A;  1GH2 A;  2E7P A;  1EP7 A;  2QSI A;  2P5R A;  4MH3 A;  3I9V 2;  1FOV A;  3FZ9 A;  2AV4 A;  5D8I A;  2DJJ A;  5J4U A;  1J9B A;  3QMX A;  3TDG A;  3TJK A;  4IQ1 A;  1TRW A;  4NAX A;  3IXR A;  2XPD A;  1NW2 A;  2K18 A;  3W8J A;  2OE3 A;  4HOJ A;  5DCH A;  1GSU A;  2H01 A;  2H66 A;  4POL A;  1EGO A;  3UL3 A;  4XS6 A;  5EPF A;  4G10 A;  2DLX A;  1J08 A;  3P7X A;  1X9W B;  2CZ2 A;  1SD8 A;  2H71 A;  3HJP A;  4CW9 A;  3SWL A;  2LJA A;  1YKC A;  1GNW A;  2FGX A;  3G7I A;  1A8Y A;  1G6W A;  2XBQ A;  1O8W A;  2O7K A;  2YWN A;  5KN0 A;  2GSR A;  3M0F A;  4MP4 A;  2PBJ A;  5F07 A;  4G2E A;  2LTK A;  3TRQ A;  3HCZ A;  3O76 A;  1SL2 B;  2EIQ A;  3HXS A;  3C73 A;  2H8L A;  3H79 A;  3RPN A;  1ML6 A;  2B7K A;  4V2N A;  3ZYW A;  3VFI A;  3BCK A;  4GRF A;  3DYR A;  1JLW A;  2LJK A;  4PQI A;  2V6K A;  4IJI A;  3F3Q A;  1ON4 A;  2GLR A;  2WCI A;  1EGR A;  3CTF A;  6GSV A;  2HXK A;  5IMD A;  19GS A;  2B3S A;  3KP8 A;  1PFO A;  4IP6 A;  1G7E A;  1PKW A;  5KEJ A;  2L4C A;  1PX7 A;  1TOF A;  2FLS A;  2FHE A;  1Z5Y E;  6GSY A;  4X4J A;  1WMJ A;  2FA4 A;  3GL3 A;  2NDO A;  2L6D A;  4MCU A;  1X5D A;  3I69 A;  4BVY B;  3IHQ A;  3H1N A;  1BYE A;  2VCZ A;  1SL0 B;  3FK8 A;  5KN2 A;  1WWJ A;  1U3I A;  4EKZ A;  5AIS A;  2R0P A;  3ZL5 A;  2I3Y A;  3EIN A;  2WFC A;  2J23 A;  4IW9 A;  1SEN A;  1WE0 A;  4Z2U A;  4PTS A;  5DQS A;  2VLT A;  5G5E A;  2HZF A;  2VD0 A;  1Z6N A;  4GXZ A;  3IBH A;  1R4W A;  2X64 A;  1B9X C;  4LL1 B;  4POK A;  2I1U A;  1GSD A;  4BVX A;  1TDI A;  2FY6 A;  4ECC A;  5INY A;  1TI3 A;  3RHB A;  3I6A A;  2IMK A;  1GLP A;  3TKQ A;  4F0B A;  4XS1 A;  4KB3 A;  4X0X A;  2MMN A;  4DEJ A;  2HI7 A;  3F63 A;  1MD4 A;  3CYN A;  2VIM A;  4G0I A;  2HRK A;  3TKS C;  3GRX A;  3IC4 A;  2CQ9 A;  3M9K A;  1TRS A;  3ZIV A;  1ABA A;  1SJI A;  2LST A;  2WDU A;  3BD2 A;  3BOA A;  2B5X A;  2DBC A;  1SD9 A;  1R26 A;  2TRX A;  4ML6 A;  1YDK A;  2R2J A;  1WJK A;  2FA8 A;  1UC7 A;  2O87 A;  4EL1 A;  3UVT A;  5ECI B;  1NHY A;  4ID0 A;  1NHO A;  1GUH A;  4POB A;  2HT9 A;  5D9V A;  5CP1 A;  1GUK A;  3UBK A;  2LUS A;  4LMV A;  1HYU A;  3VWU A;  1KEB A;  2CAI A;  1X5E A;  3A3T A;  1MTC A;  1ERU A;  3QR6 A;  2VM2 A;  3VWV A;  5ELG A;  4HU7 A;  3P8W A;  22GS A;  2V1M A;  2YWO A;  3FR3 A;  5DAL A;  1YF1 A;  5CRH A;  2O89 A;  4MK3 A;  5C04 A;  4KX4 A;  2R4V A;  5E4W A;  4F0C A;  3HKR A;  1WOU A;  2PER A;  1S3A A;  3GNJ A;  3GUS A;  5ENU A;  2FCH A;  4HZ2 A;  2UZ8 A;  5F05 A;  2QA1 A;  3DWV A;  1M2A A;  3VLN A;  5G5F A;  1AW9 A;  4PUR A;  5HR3 A;  4OFT A;  5D96 A;  2OAC A;  4TXO A;  3R3E A;  4H86 A;  3WD6 A;  3GHA A;  18GS A;  5F0G A;  3CRU A;  2DJ0 A;  2CAQ A;  2IIY A;  4HJM A;  2V32 A;  4CHS A;  4JU5 A;  4MMM A;  3KP9 A;  3FY7 A;  4MNN A;  3FKF A;  4G19 A;  2VLV A;  3DXB A;  3HZ4 A;  4YQV A;  4YQM A;  1K0M A;  2FWH A;  2EC4 A;  4DSR A;  2X99 A;  1B8X A;  4E8H A;  2H1D A;  3MNG A;  4WEY A;  1PGT A;  3ERG A;  3KEB A;  1UA5 A;  3UAR A;  2R37 A;  3CTG A;  3ZZX A;  5HR0 A;  2VUP A;  16GS A;  3IV4 A;  2GSS A;  2M72 A;  2X8G A;  1N8J A;  1PN0 A;  2N5B A;  1GWC A;  1A0F A;  2RUF A;  3D4M A;  2LRC A;  2FWG A;  4G0L A;  4L8E A;  1K0B A;  1K3Y A;  2X49 A;  3IC8 A;  5DCG A;  1KNG A;  2ON7 A;  1GSS A;  1CQG A;  4X43 A;  3C71 A;  2IFQ B;  2DJ3 A;  2JAC A;  3F0I A;  5E59 A;  4V2M A;  3GUR A;  4L0W A;  1JZW A;  2YZU A;  3C8E A;  4KA0 A;  4FYU A;  5J41 A;  4AGS A;  4TW5 A;  2MZC A;  1M3I A;  2K8V A;  3IA1 A;  4OMV A;  4TKY A;  1U3A A;  2D2Z A;  5ECQ B;  2Z9S A;  4WF4 A;  2H0I A;  4KSM A;  4BPY A;  1ZZY A;  6GSU A;  3F4R A;  4K1F A;  2RII A;  2VD1 A;  2L5O A;  1R5P A;  1AQW A;  1M2D A;  1GUL A;  5B8B A;  3VI7 A;  4QQ7 A;  2DKH A;  5FWG A;  4WKW A;  6GSX A;  4Q5Q A;  4HQS A;  2R0G A;  2RUE A;  3L4N A;  11GS A;  1M9A A;  4L5L A;  2YCD A;  2PVO C;  3BBY A;  2DJ1 A;  1SK2 A;  1LU4 A;  2QA2 A;  2XBI A;  2GZZ A;  1TKD B;  3VI5 A;  4O32 A;  2LNT A;  1GTI A;  4ZIJ A;  1TTZ A;  2V41 A;  3LXZ A;  1Q98 A;  1A0R P;  2ZNM A;  2H75 A;  3Q18 A;  4PNG A;  1FVJ A;  2K6V A;  2HE3 A;  3IK7 A;  3EC3 A;  1TXX A;  1O73 A;  4D73 B;  1YZX A;  1FB0 A;  1AC1 A;  4KDY A;  3VUR A;  5B6N A;  1FB6 A;  1TK0 B;  1MDJ A;  2B1L A;  4KF9 A;  5A4U A;  1F6M C;  2ES7 A;  1AQV A;  2EIR A;  1JZR A;  1ZYQ B;  1K0C A;  4HUA A;  4O5Q A;  4ZB6 A;  5J9C A;  4POM A;  1HQO A;  4DSS A;  5HR2 A;  1OE7 A;  3HVV A;  2HFD A;  2RM5 A;  1XVQ A;  3E3E A;  1JZO A;  2GZP A;  3GKN A;  4OCF A;  3FRC A;  2VAF A;  1MDK A;  1K0A A;  3D5J A;  1PRX A;  3ZMK A;  1HNC A;  3GH9 A;  2AJQ B;  2NBS A;  1QFN A;  1ZYE A;  4K0N A;  5CRD A;  1OC8 A;  3GTU A;  3UOM A;  2F3M A;  4RQX A;  1J0F A;  4JR4 A;  4JRR A;  4L0U A;  2LRN A;  4MF6 A;  4WR5 A;  3ISO A;  2OBI A;  3HVS A;  3A5W A;  3FZA A;  4Z2R A;  2O85 A;  4AJ8 A;  5LNK e;  1FAA A;  2XC2 A;  5G31 A;  4KE3 A;  1XWK A;  4WF5 A;  4ZB9 A;  5AGY A;  2CX4 A;  5H5S A;  1GSY A;  2IWT A;  1QGV A;  3ED3 A;  3GST A;  5DAK B;  2JSY A;  4EUY A;  4OO5 A;  3QDN A;  4IS0 A;  5GZZ B;  2AHE A;  3GA4 A;  3QFA C;  3TKS A;  4RI7 A;  2KUC A;  4GQF A;  1EV4 A;  5J5N A;  3Q19 A;  2C80 A;  1FW1 A;  3MIX A;  3ERF A;  4QL7 A;  5CYY A;  4OCE A;  3CSH A;  3C1S A;  3LOR A;  3M9J A;  4EVM A;  5ABR A;  1A23 A;  2WZ9 A;  4PUF C;  2HZE B;  1W89 A;  3ZRD A;  1BAY A;  2FUG 2;  1T7P B;  2MMZ A;  1XXU A;  5GAN D;  3UBL A;  3H4K A;  2GDR A;  2QGV A;  2YN1 A;  1XWB A;  1O85 A;  4K7O A;  3GX0 A;  1X9S B;  1O7U A;  2FD3 A;  1MD3 A;  1T3B A;  5ID2 B;  4G0K A;  1N2A A;  1GSQ A;  3PIN A;  4IN0 A;  5FT3 A;  1A2M A;  1S3R A;  4MJE A;  2C3N A;  2GT5 A;  4PUA A;  3A2V A;  3EE2 A;  5JWO B;  2PU9 C;  4TR1 B;  4MH2 A;  4TRX A;  4G9H A;  1XOB A;  2YJ7 A;  2VCQ A;  3H93 A;  3HJM A;  1EEJ A;  3ZLP A;  4HZ4 A;  3W8S A;  4JR6 A;  1XFL A;  4IJ3 A;  1WP0 A;  3P2A A;  5LCZ A;  5DBQ A;  3FR6 A;  1VF1 A;  2C3T A;  3GIX A;  3VPT A;  2VL9 A;  2O8V B;  1FVK A;  2YWI A;  3L9U A;  4DSQ A;  1GLQ A;  3NOF A;  1GTU A;  2JZS A;  4ZBA A;  2R5G A;  2X4A A;  2IFQ A;  4ZBB A;  4LMW A;  1OC9 B;  4F9Z A;  3AY8 A;  2JL4 A;  2YJH A;  2B7J A;  2VM1 A;  4MA9 A;  5ECM B;  1F37 A;  5IQY A;  3TRP A;  3FEU A;  14GS A;  2R0C A;  3KM6 A;  2C4J A;  3DRN A;  5B6M A;  2VCT A;  4XS4 A;  4O5U A;  3HVX A;  4BA7 A;  1TI1 A;  3RPP A;  2CVB A;  1EEM A;  2E2M A;  3L0H A; 
#chains in the Genus database with same CATH homology
 2BMX A;  5G30 A;  1GL8 A;  1OE8 A;  4NWY A;  1Q4J A;  1Z3E A;  3MYD A;  1XWA A;  1KTE A;  1FHE A;  1TK8 B;  2B6M A;  2V2G A;  1OAZ A;  3J7Y b;  5IMF A;  2BTO T;  1GSE A;  3IK9 A;  3D21 A;  3GKK A;  3C1R A;  4ULX A;  4FYC A;  4MPF A;  1GSF A;  5A4W A;  3KD0 A;  3F6F A;  1USB A;  4MJC A;  3KTL A;  4ISD A;  5CRE A;  3CMI A;  4WR4 A;  1ACV A;  1EOH A;  2C0F A;  1XIY A;  1T00 A;  1ZGN A;  3LEF A;  2YOI A;  2P0G A;  2GZY A;  5BMU A;  3FYG A;  5JWQ B;  1X5C A;  3CBU A;  4PGT A;  3ZRE A;  2IME A;  2YV7 A;  4PX1 A;  4ILF A;  2GQK A;  2HYX A;  3EUR A;  1IYH A;  3VWW A;  2VCV A;  5J3R A;  4FH8 A;  2C8U A;  4L5O A;  4EF0 A;  1XVW A;  1PQN A;  4MPG A;  1DE1 A;  3GMF A;  4HS1 A;  1O8X A;  4KDX A;  3DVX A;  5HR1 A;  2F8F A;  2CT6 A;  1TRV A;  3IHG A;  5H5R A;  1PX6 A;  4V1A p;  3TKP A;  1YJ6 A;  3LJR A;  3GKX A;  3IOS A;  5IMZ A;  3LW9 A;  2VOC A;  2EIO A;  3K8N A;  5D9T A;  3LSZ A;  3CXG A;  5A4V A;  2IMD A;  2H76 A;  2GSQ A;  5IO2 A;  3RBT A;  2P31 A;  5G2Z A;  1EWX A;  3NZN A;  3CRT A;  3IR4 A;  3F3R A;  4KUN A;  5D93 A;  1UN2 A;  2H0G A;  1XOA A;  3KTB A;  1TU7 A;  1K0D A;  3GX8 A;  4J56 E;  3HDC A;  2FWE A;  3BJ5 A;  3CSI A;  3G7J A;  4KND A;  1K0O A;  4JED A;  3UIW A;  5IMC A;  4K2X A;  1OYJ A;  3WGE A;  2CVD A;  4I2T A;  3ZFL A;  3WYW A;  2GVP A;  1PA3 A;  4BL7 A;  5IM9 A;  4K9Z A;  3HA9 A;  2GS3 A;  3DD3 A;  4NV5 A;  2OKA A;  4KGI A;  1SK0 A;  1O6J A;  1TJD A;  2H0H A;  2H6X A;  2HZE A;  3C7M A;  3NIV A;  4XCS A;  4N0Z A;  1KBN A;  1TRU A;  1WPI A;  2GT6 A;  4RI6 A;  5ID2 A;  3A2W A;  1RW1 A;  2LV3 A;  3O3T A;  3KGK A;  4DVC A;  3PH9 A;  1SKW B;  4XIH A;  4TR1 A;  4MZB A;  1V9W A;  3US3 A;  4TOP A;  1PMT A;  2E2G A;  4HEA 2;  2JZT A;  5CNW A;  4J57 E;  4P3Y B;  4HJ2 A;  1TW9 A;  5DVB A;  4YKG A;  4TR0 A;  2BJX A;  2YV9 A;  5CRG A;  4ZL7 A;  1B48 A;  2TIR A;  4BWS A;  3FR9 A;  3KZQ A;  3LGC A;  2HNL A;  1M99 A;  4RQR A;  3VPQ A;  5JCU A;  2VL3 A;  1PKZ A;  1OC9 A;  4ECB A;  3H8Q A;  9GSS A;  5EVO A;  1ZYP A;  1YEX A;  1X0R A;  2F51 A;  4MJB A;  1U88 A;  4JZQ A;  1PN9 A;  3DEX A;  1FG4 A;  1THO A;  3P90 A;  1AQX A;  3D6I A;  3GSS A;  4BVY A;  2VCX A;  3GV1 A;  5G1L A;  1HNA A;  4EIQ A;  1Z7R A;  1UVZ A;  1EP8 A;  2FNO A;  1B9Y C;  3EU3 A;  2C0E A;  4EDZ A;  5IOX A;  6GST A;  4K7I A;  4MAB A;  2HSM A;  5BRT A;  1ERV A;  5FHI A;  3V1W A;  3WGD A;  1JZD A;  3SBC A;  2LQO A;  2F8A A;  4BVX B;  3HD5 A;  4K5R A;  2C0D A;  3UMA A;  3GN3 A;  4CY8 A;  1NM3 A;  1XW6 A;  1HNB A;  3I43 A;  3HHV A;  4XTS A;  1V58 A;  3EVI A;  4Q5N A;  1QUW A;  3JCM L;  2NVL A;  3PPU A;  1M2B A;  2H74 A;  2KLX A;  1SKS B;  3VWX A;  5F06 A;  3EPT A;  2JU5 A;  3J7Y k;  5D9W A;  4N30 A;  5ECP B;  3WT2 A;  2YPM A;  4FYB A;  3D22 A;  3LFL A;  2RLI A;  3IPZ A;  5ECN B;  4WXT A;  1DE2 A;  1BG5 A;  2RM6 A;  3ERW A;  1H4O A;  2AAW A;  4IHU A;  2K8S A;  1ERT A;  4BWQ A;  5ECL B;  5GST A;  3LQ7 A;  3PR8 A;  3IRA A;  3UAP A;  5JCW A;  2L59 A;  5DDL A;  1FOH A;  3DVW A;  2L5L A;  3LWA A;  2CVK A;  3DIE A;  4GTU A;  5H5Q A;  4IKH A;  3KIJ A;  1SKR B;  1GTB A;  1JFU A;  12GS A;  3TKR A;  2IMF A;  3LYK A;  5DAL B;  3F4S A;  1ZCP A;  3QD9 A;  5GSS A;  1M0U A;  1ZMA A;  2L4Q A;  2L57 A;  2H1G A;  2DC5 A;  2DSA A;  5L71 A;  2DIZ A;  2G0F A;  3TGZ A;  1Z9H A;  3ZIJ A;  2DJK A;  4OO4 A;  3KH7 A;  3QAV A;  1F3A A;  1ZYN A;  2OE0 A;  2HRA A;  3MSZ A;  1SL1 B;  1IYI A;  1YQ1 A;  1VF4 A;  4TXO B;  20GS A;  4ZL9 A;  1SJ6 A;  13GS A;  3TCO A;  2IPA A;  3EMX A;  2WRT A;  4NHZ A;  5CRW A;  1F2E A;  4MZC A;  3DML A;  4EO3 A;  2VCW A;  3HJO A;  2KOK A;  2YP6 A;  3G7Y A;  5ECK B;  8GSS A;  1H75 A;  3ZFB A;  1BJX A;  1M9B A;  1AIU A;  2XPE A;  2HRN A;  3L78 A;  5ECO B;  1GRX A;  1W4V A;  2QKE A;  4GCI A;  2K9F A;  1C72 A;  1A2J A;  1O81 A;  1XCC A;  2KHP A;  2QC7 A;  3TJB A;  2A2P A;  5G1K A;  1BQ7 A;  2B1K A;  1G7O A;  5F8B A;  3TKS E;  2MBT A;  4EE0 A;  1K3L A;  1B4P A;  1YKA A;  5IMV A;  4E8E A;  3QPM A;  4K5S A;  4TR3 A;  1LJR A;  4YAV A;  4OWY A;  4IP1 A;  2A4V A;  1DBY A;  2H70 A;  4MF7 A;  3UJ1 A;  3L9V A;  4FQU A;  5EY6 A;  1QXH A;  3APQ A;  3D0Z A;  1DSB A;  4K6X A;  5CO3 A;  3KMN A;  4WBR D;  4K2D A;  3E9J B;  3E0U A;  2I81 A;  3CSJ A;  4LLR A;  3F8U A;  4J2F A;  4YKF A;  2TRC P;  3EMP A;  3F6D A;  4GST A;  1F9M A;  1G6Y A;  1V57 A;  2IN3 A;  5EL8 A;  4JBB A;  2ZCT A;  1BED A;  1XW5 A;  1Z7P A;  2HRF A;  5DQY A;  1GNE A;  3QAW A;  4O7H A;  3F4T A;  2HSH A;  4PXO A;  3FMW A;  4HI7 A;  5DJL A;  2YAN A;  4ECI A;  4N10 A;  4F82 A;  2GQM A;  4YH2 A;  3KMO A;  4USS A;  4ZXG A;  1A24 A;  1MEK A;  2HSY A;  3IAS 2;  2LQQ A;  2G2Q A;  4WET A;  1QMV A;  2H72 A;  4AJ7 A;  5C00 A;  2E0Q A;  3ZIT A;  4NV2 A;  1XWG A;  4NXI A;  4EDY A;  4PQH A;  4LA1 A;  3OR5 A;  1YY7 A;  2NTO A;  3IDV A;  1E2Y A;  1WIK A;  2KP1 A;  1A8L A;  4HQZ A;  4MF5 A;  4IGJ A;  2DIY A;  2B5Y A;  2DKI A;  1JLV A;  1PL1 A;  2H30 A;  5IIZ A;  1E6B A;  1BX9 A;  2M80 A;  4PQ1 A;  1XWC A;  2VL2 C;  2R6K A;  4KSO A;  1M7T A;  5DJM A;  2MMA A;  4KW6 A;  2AUV A;  4OFN A;  1S3D A;  4K8M A;  5HFK A;  4D73 A;  1I5G A;  2JAD A;  4IEL A;  5LD0 A;  2PMT A;  4V2L A;  3EU4 A;  1YF0 A;  4DSS B;  3O6T A;  2WUL A;  4MDC A;  4XRD A;  4N11 A;  5B7C A;  4GF0 A;  1RK4 A;  4IQA A;  2IJY A;  3FZ4 A;  2C1Y A;  1RQM A;  3MAK A;  3KXO A;  3MWH A;  1JHB A;  1K3O A;  2MMO A;  1LBK A;  4KCA A;  2LRT A;  3U5R E;  4TN8 A;  2C3Q A;  1VGL A;  5AN1 A;  3Q74 A;  4AF2 A;  3EYT A;  1S3C A;  3A2X A;  3G9B A;  3QCP A;  4MLY A;  1T4Z A;  3GTU B;  2C0G A;  3HZ8 A;  4OFM A;  2DML A;  3ZVJ D;  3HYP A;  17GS A;  4Q5R A;  3N9J A;  2AYT A;  2PPT A;  4IBP A;  1T8E B;  3S9F A;  4KAE A;  3HY2 A;  2B5E A;  2YWM A;  4HU9 A;  3GKM A;  5COH A;  4RUV A;  5IPH A;  1U6T A;  3UEM A;  2L6C A;  2FWF A;  1SYR A;  5DAK A;  5KOX A;  3QFB C;  3KH9 A;  2F9S A;  4WBJ A;  2GQL A;  4ICY A;  5HFG A;  2N5A A;  2H73 A;  2PUK C;  3ME7 A;  2J9H A;  4GQC A;  4LL4 B;  4Z7X A;  5A5K A;  2I4A A;  2DMM A;  1X9M B;  3U6V A;  3KJY A;  4GSN A;  1QQ2 A;  4F03 A;  1V40 A;  1EOG A;  10GS A;  5J9B A;  3IE3 A;  3DGQ A;  1THX A;  1R5A A;  1CQH A;  4O92 A;  3WT1 A;  2CZ3 A;  3DKS A;  2ZUP A;  5ECR B;  3TOU A;  5AIX A;  3ZML A;  4GLT A;  1AAZ A;  2IL3 A;  5IO0 A;  3RAZ A;  3Q6O A;  2CV4 A;  5B8A A;  3ME8 A;  1AXD A;  4I2U A;  1EZK A;  2XHF A;  1SYX A;  5ECH B;  2WGR A;  2OJL A;  1SK1 A;  4CY6 A;  2H6Z A;  2H19 A;  4EIP A;  5JWR B;  4ZIL A;  4I8B A;  4AJ6 A;  4ZBD A;  3ZVJ A;  4EXJ A;  1ILO A;  4YQU A;  3ZTL A;  4QL9 A;  1R7H A;  4XHM A;  3FHK A;  1QK8 A;  1B4Q A;  4GSS A;  1OKT A;  1SJZ A;  2PWJ A;  2JSZ A;  3APO A;  2CX3 A;  1XZO A;  2REM A;  3LYP A;  4ACS A;  3LXT A;  3MDK A;  2OBK A;  2X8C A;  5D9X A;  5KN1 A;  4X1U A;  3W6G A;  2A2R A;  1GTA A;  3GFK A;  1ST9 A;  3M1G A;  1FO5 A;  4EC0 A;  1URM A;  4FO5 A;  5ELA A;  2DJ2 A;  1SU9 A;  2WS2 A;  2WB9 A;  2LNS A;  1EV9 A;  4XS4 B;  4N0V A;  2A4H A;  2LEG A;  4KH7 A;  1XW9 A;  3GL5 A;  1K0N A;  2HLS A;  5JCG A;  4ZL8 A;  1V98 A;  1Z6M A;  4I5Q A;  2VLU A;  4NMU A;  2GTU A;  1PL2 A;  1TP9 A;  3PGT A;  1VRS D;  4PNF A;  4MZW A;  3APS A;  1TK5 B;  1TU8 A;  4YAP A;  4I97 A;  3A5I A;  1PSQ A;  2OE1 A;  4TXV A;  3FW2 A;  3RHC A;  2JZR A;  1ERW A;  2H6Y A;  1OKD A;  2V6O A;  4GWR A;  3M3M A;  3TB2 A;  1A2L A;  2PGT A;  4KDU A;  2PN8 A;  2MYG A;  5KN3 A;  1T1V A;  5HFI A;  2P5Q A;  4FIW A;  1NSW A;  3R2Q A;  3TRX A;  3KCM A;  4CDO A;  2CA8 A;  2NPB A;  1OC3 A;  5KOW A;  3L9S A;  3M8N A;  5AIV A;  5IPG A;  4ECJ A;  3FZ5 A;  4Z2T A;  1I9D A;  1Y6E A;  3TOT A;  3IAM 2;  3RDW A;  1WRY A;  4NHW A;  4NPB A;  2H1B A;  3TJJ A;  2ALB A;  3D4T A;  4K7N A;  4TVE A;  1VF2 A;  1GUM A;  2R3X A;  2M46 A;  3LG6 A;  1DUG A;  4I6X A;  5GAP D;  1V2A A;  3F9U A;  2A2S A;  6GSW A;  5CAX A;  2YZH A;  1VF3 A;  3EWL A;  3GYK A;  5HQP A;  1GP1 A;  2LS5 A;  4HDE A;  1XPV A;  4IVF A;  1G0T A;  3TJG A;  2GST A;  2X8H A;  1PD2 1;  2H1A A;  1Y25 A;  3QOU A;  1U87 A;  2YNX A;  2PVQ A;  4F2I A;  3BCI A;  4K0G A;  2I9H A;  3VK9 A;  6GSS A;  3N5O A;  2OAD A;  1OVN A;  2MBS A;  2VO4 A;  2KP2 A;  1AUC A;  2VL2 A;  2N5F A;  3TUE A;  1XBS A;  2AB6 A;  2IMI A;  4KCE A;  1HD2 A;  3GH6 A;  4ZB8 A;  1MDI A;  1T4Y A;  1ZOF A;  3WGX A;  2ON5 A;  3UVH A;  2LKU A;  2LJR A;  5ECS A;  4TR4 A;  5IMA A;  4JE1 A;  3TJF A;  4O5R A;  2GGT A;  3QAG A;  7GSS A;  4V1A g;  4OD7 A;  4BL7 B;  5IOW A;  2WJU A;  1YEP A;  1ZL9 A;  1F3B A;  2OA7 A;  4XRA A;  4A5P A;  4Q5F A;  4ML1 A;  4MJA A;  5D73 A;  1GH2 A;  2E7P A;  1EP7 A;  2QSI A;  2P5R A;  4MH3 A;  3I9V 2;  1FOV A;  3FZ9 A;  2AV4 A;  5D8I A;  2DJJ A;  5J4U A;  1J9B A;  3QMX A;  3TDG A;  3TJK A;  4IQ1 A;  1TRW A;  4NAX A;  3IXR A;  2XPD A;  1NW2 A;  2K18 A;  3W8J A;  2OE3 A;  4HOJ A;  5DCH A;  1GSU A;  2H01 A;  2H66 A;  4POL A;  1EGO A;  3UL3 A;  4XS6 A;  5EPF A;  4G10 A;  2DLX A;  1J08 A;  3P7X A;  1X9W B;  2CZ2 A;  1SD8 A;  2H71 A;  3HJP A;  4CW9 A;  3SWL A;  2LJA A;  1YKC A;  1GNW A;  2FGX A;  3G7I A;  1A8Y A;  1G6W A;  2XBQ A;  1O8W A;  2O7K A;  2YWN A;  5KN0 A;  2GSR A;  3M0F A;  4MP4 A;  2PBJ A;  5F07 A;  4G2E A;  2LTK A;  3TRQ A;  3HCZ A;  3O76 A;  1SL2 B;  2EIQ A;  3HXS A;  3C73 A;  2H8L A;  3H79 A;  3RPN A;  1ML6 A;  2B7K A;  4V2N A;  3ZYW A;  3VFI A;  3BCK A;  4GRF A;  3DYR A;  1JLW A;  2LJK A;  4PQI A;  2V6K A;  4IJI A;  3F3Q A;  1ON4 A;  2GLR A;  2WCI A;  1EGR A;  3CTF A;  6GSV A;  2HXK A;  5IMD A;  19GS A;  2B3S A;  3KP8 A;  4IP6 A;  1G7E A;  1PKW A;  5KEJ A;  2L4C A;  1PX7 A;  1TOF A;  2FLS A;  2FHE A;  1Z5Y E;  6GSY A;  4X4J A;  1WMJ A;  2FA4 A;  3GL3 A;  2NDO A;  2L6D A;  4MCU A;  1X5D A;  3I69 A;  4BVY B;  3IHQ A;  3H1N A;  1BYE A;  2VCZ A;  1SL0 B;  3FK8 A;  5KN2 A;  1WWJ A;  1U3I A;  4EKZ A;  5AIS A;  2R0P A;  3ZL5 A;  2I3Y A;  3EIN A;  2WFC A;  2J23 A;  4IW9 A;  1SEN A;  1WE0 A;  4Z2U A;  4PTS A;  5DQS A;  2VLT A;  5G5E A;  2HZF A;  2VD0 A;  1Z6N A;  4GXZ A;  3IBH A;  1R4W A;  2X64 A;  1B9X C;  4LL1 B;  4POK A;  2I1U A;  1GSD A;  4BVX A;  1TDI A;  2FY6 A;  4ECC A;  5INY A;  1TI3 A;  3RHB A;  3I6A A;  2IMK A;  1GLP A;  3TKQ A;  4F0B A;  4XS1 A;  4KB3 A;  4X0X A;  2MMN A;  4DEJ A;  2HI7 A;  3F63 A;  1MD4 A;  3CYN A;  2VIM A;  4G0I A;  2HRK A;  3TKS C;  3GRX A;  3IC4 A;  2CQ9 A;  3M9K A;  1TRS A;  3ZIV A;  1ABA A;  1SJI A;  2LST A;  2WDU A;  3BD2 A;  3BOA A;  2B5X A;  2DBC A;  1SD9 A;  1R26 A;  2TRX A;  4ML6 A;  1YDK A;  2R2J A;  1WJK A;  2FA8 A;  1UC7 A;  2O87 A;  4EL1 A;  3UVT A;  5ECI B;  1NHY A;  4ID0 A;  1NHO A;  1GUH A;  4POB A;  2HT9 A;  5D9V A;  5CP1 A;  1GUK A;  3UBK A;  2LUS A;  4LMV A;  1HYU A;  3VWU A;  1KEB A;  2CAI A;  1X5E A;  3A3T A;  1MTC A;  1ERU A;  3QR6 A;  2VM2 A;  3VWV A;  5ELG A;  4HU7 A;  3P8W A;  22GS A;  2V1M A;  2YWO A;  3FR3 A;  5DAL A;  1YF1 A;  5CRH A;  2O89 A;  4MK3 A;  5C04 A;  4KX4 A;  2R4V A;  5E4W A;  4F0C A;  3HKR A;  1WOU A;  2PER A;  1S3A A;  3GNJ A;  3GUS A;  5ENU A;  2FCH A;  4HZ2 A;  2UZ8 A;  5F05 A;  2QA1 A;  3DWV A;  1M2A A;  3VLN A;  5G5F A;  1AW9 A;  4PUR A;  5HR3 A;  4OFT A;  5D96 A;  2OAC A;  4TXO A;  3R3E A;  4H86 A;  3WD6 A;  3GHA A;  18GS A;  5F0G A;  3CRU A;  2DJ0 A;  2CAQ A;  2IIY A;  4HJM A;  2V32 A;  4CHS A;  4JU5 A;  4MMM A;  3KP9 A;  3FY7 A;  4MNN A;  3FKF A;  4G19 A;  2VLV A;  3DXB A;  3HZ4 A;  4YQV A;  4YQM A;  1K0M A;  2FWH A;  2EC4 A;  4DSR A;  2X99 A;  1B8X A;  4E8H A;  2H1D A;  3MNG A;  4WEY A;  1PGT A;  3ERG A;  3KEB A;  1UA5 A;  3UAR A;  2R37 A;  3CTG A;  3ZZX A;  5HR0 A;  2VUP A;  16GS A;  3IV4 A;  2GSS A;  2M72 A;  2X8G A;  1N8J A;  1PN0 A;  2N5B A;  1GWC A;  1A0F A;  2RUF A;  3D4M A;  2LRC A;  2FWG A;  4G0L A;  4L8E A;  1K0B A;  1K3Y A;  2X49 A;  3IC8 A;  5DCG A;  1KNG A;  2ON7 A;  1GSS A;  1CQG A;  4X43 A;  3C71 A;  2IFQ B;  2DJ3 A;  2JAC A;  3F0I A;  5E59 A;  4V2M A;  3GUR A;  4L0W A;  1JZW A;  2YZU A;  3C8E A;  4KA0 A;  4FYU A;  5J41 A;  4AGS A;  4TW5 A;  2MZC A;  2K8V A;  3IA1 A;  4OMV A;  4TKY A;  1U3A A;  2D2Z A;  5ECQ B;  2Z9S A;  4WF4 A;  2H0I A;  4KSM A;  4BPY A;  1ZZY A;  6GSU A;  3F4R A;  4K1F A;  2RII A;  2VD1 A;  2L5O A;  1R5P A;  1AQW A;  1M2D A;  1GUL A;  5B8B A;  3VI7 A;  4QQ7 A;  2DKH A;  5FWG A;  4WKW A;  6GSX A;  4Q5Q A;  4HQS A;  2R0G A;  2RUE A;  3L4N A;  11GS A;  1M9A A;  4L5L A;  2YCD A;  2PVO C;  3BBY A;  2DJ1 A;  1SK2 A;  1LU4 A;  2QA2 A;  2XBI A;  2GZZ A;  1TKD B;  3VI5 A;  4O32 A;  2LNT A;  1GTI A;  4ZIJ A;  1TTZ A;  2V41 A;  3LXZ A;  1Q98 A;  1A0R P;  2ZNM A;  2H75 A;  3Q18 A;  4PNG A;  1FVJ A;  2K6V A;  2HE3 A;  3IK7 A;  3EC3 A;  1TXX A;  1O73 A;  4D73 B;  1YZX A;  1FB0 A;  1AC1 A;  4KDY A;  3VUR A;  5B6N A;  1FB6 A;  1TK0 B;  1MDJ A;  2B1L A;  4KF9 A;  5A4U A;  1F6M C;  2ES7 A;  1AQV A;  2EIR A;  1JZR A;  1ZYQ B;  1K0C A;  4HUA A;  4O5Q A;  4ZB6 A;  5J9C A;  4POM A;  1HQO A;  4DSS A;  5HR2 A;  1OE7 A;  3HVV A;  2HFD A;  2RM5 A;  1XVQ A;  3E3E A;  1JZO A;  2GZP A;  3GKN A;  4OCF A;  3FRC A;  2VAF A;  1MDK A;  1K0A A;  3D5J A;  1PRX A;  3ZMK A;  1HNC A;  3GH9 A;  2AJQ B;  2NBS A;  1QFN A;  1ZYE A;  4K0N A;  5CRD A;  1OC8 A;  3GTU A;  3UOM A;  2F3M A;  4RQX A;  1J0F A;  4JR4 A;  4JRR A;  4L0U A;  2LRN A;  4MF6 A;  4WR5 A;  3ISO A;  2OBI A;  3HVS A;  3A5W A;  3FZA A;  4Z2R A;  2O85 A;  4AJ8 A;  5LNK e;  1FAA A;  2XC2 A;  5G31 A;  4KE3 A;  1XWK A;  4WF5 A;  4ZB9 A;  5AGY A;  2CX4 A;  5H5S A;  1GSY A;  2IWT A;  1QGV A;  3ED3 A;  3GST A;  5DAK B;  2JSY A;  4EUY A;  4OO5 A;  3QDN A;  4IS0 A;  5GZZ B;  2AHE A;  3GA4 A;  3QFA C;  3TKS A;  4RI7 A;  2KUC A;  4GQF A;  1EV4 A;  5J5N A;  3Q19 A;  2C80 A;  1FW1 A;  3MIX A;  3ERF A;  4QL7 A;  5CYY A;  4OCE A;  3CSH A;  3C1S A;  3LOR A;  3M9J A;  4EVM A;  5ABR A;  1A23 A;  2WZ9 A;  4PUF C;  2HZE B;  1W89 A;  3ZRD A;  1BAY A;  2FUG 2;  1T7P B;  2MMZ A;  1XXU A;  5GAN D;  3UBL A;  3H4K A;  2GDR A;  2QGV A;  2YN1 A;  1XWB A;  1O85 A;  4K7O A;  3GX0 A;  1X9S B;  1O7U A;  2FD3 A;  1MD3 A;  1T3B A;  5ID2 B;  4G0K A;  1N2A A;  1GSQ A;  3PIN A;  4IN0 A;  5FT3 A;  1A2M A;  4MJE A;  2C3N A;  2GT5 A;  4PUA A;  3A2V A;  3EE2 A;  5JWO B;  2PU9 C;  4TR1 B;  4MH2 A;  4TRX A;  4G9H A;  1XOB A;  2YJ7 A;  2VCQ A;  3H93 A;  3HJM A;  1EEJ A;  3ZLP A;  4HZ4 A;  3W8S A;  4JR6 A;  1XFL A;  4IJ3 A;  1WP0 A;  3P2A A;  5LCZ A;  5DBQ A;  3FR6 A;  1VF1 A;  2C3T A;  3GIX A;  3VPT A;  2VL9 A;  2O8V B;  1FVK A;  2YWI A;  3L9U A;  4DSQ A;  1GLQ A;  3NOF A;  1GTU A;  2JZS A;  4ZBA A;  2R5G A;  2X4A A;  2IFQ A;  4ZBB A;  4LMW A;  1OC9 B;  4F9Z A;  3AY8 A;  2JL4 A;  2YJH A;  2B7J A;  2VM1 A;  4MA9 A;  5ECM B;  1F37 A;  5IQY A;  3TRP A;  3FEU A;  14GS A;  2R0C A;  3KM6 A;  2C4J A;  3DRN A;  5B6M A;  2VCT A;  4XS4 A;  4O5U A;  3HVX A;  4BA7 A;  1TI1 A;  3RPP A;  2CVB A;  1EEM A;  2E2M A;  3L0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...