3UIWA

Zebrafish grx2 (apo)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
110
structure length
110
Chain Sequence
PGLSSSACGQFVQDIVSSNCVVIFSKTTCPYCKMAKGVFNEIGATYKVVELDEHNDGRRLQETLAELTGARTVPRVFINGQCIGGGSDTKQLHQQGKLLPLIEQCRPCCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin 2
publication title A New Mode of Iron-sulfur Cluster Coordination in Glutaredoxins is Crucial for Axonogenesis
rcsb
source organism Danio rerio
total genus 31
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3uiwA00
3QR6A 2V32A 4ZL8A 3GTUA 3UEMA 1A8LA 2REMA 2F8AA 4D73B 2FWFA 3CRTA 4PGTA 4ZB6A 1A23A 2LUSA 5B7CA 3FK8A 3TKSC 2IN3A 1ON4A 19GSA 3TOUA 17GSA 2H6YA 1VF3A 4NHWA 5EPFA 2YWMA 4G10A 4ISDA 3FKFA 4DSQA 1Y25A 3GV1A 2X64A 2B1KA 4BVYA 2YZUA 3G7JA 1TK0B 2HT9A 2JL4A 4ECBA 2KP2A 1PKWA 4GQFA 1OKDA 2H1AA 3QOUA 5B6NA 2E7PA 2KUCA 1T8EB 1GSQA 1XWGA 5IMFA 1KNGA 3UOMA 4KAEA 3FR6A 5IO2A 1XWCA 4K1FA 5DBQA 2YWOA 6GSTA 3L9UA 3HZ8A 4Q5RA 1Z7PA 1SL0B 4OFNA 3G7IA 1FVKA 5IOWA 4TR1B 4TN8A 2X99A 5F07A 4F82A 2OJLA 3MNGA 3GUSA 5ECHB 3FZAA 4GSSA 1R7HA 4IBPA 3BCKA 5JCUA 1FG4A 1FAAA 4HI7A 1XXUA 4IQAA 1V2AA 1BQ7A 2CX4A 2LRNA 1NHYA 1OE8A 4N0VA 4AGSA 4KSOA 4XIHA 2IMEA 2PVOC 2E2GA 4HJMA 4I8BA 4MCUA 4ID0A 4KCAA 5J4UA 4G19A 1K3YA 1PX7A 3CTGA 1ST9A 4POBA 3FZ9A 2HSHA 3EC3A 4KA0A 6GSUA 1PN9A 3CXGA 2B7KA 3TJJA 2MMAA 1QK8A 4PQIA 4PQHA 1GSYA 3ZITA 1EGOA 3TUEA 2PUKC 1LBKA 5CRDA 3HY2A 1FOVA 1M9AA 3UBLA 3IA1A 4MZWA 4YH2A 3S9FA 1A2LA 2P5QA 2G2QA 2EIRA 3TJKA 2FHEA 2K8SA 3W8SA 4D73A 4K7NA 2V6KA 3E0UA 2FLSA 4GWRA 2D2ZA 4J57E 3TGZA 1YJ6A 4V1Ap 2YJHA 2IPAA 1W4VA 5ENUA 3SBCA 1QGVA 3NZNA 5AIXA 4N0ZA 2XC2A 3ZZXA 5H5QA 4HQZA 5D9XA 4ZL9A 2C0FA 3KGKA 1OVNA 2HXKA 3IXRA 3DYRA 4MH3A 5ECNB 4XTSA 2OE1A 4V1Ag 2HFDA 2PMTA 3TRPA 1FHEA 1XVQA 1XOAA 3TKPA 2H73A 4MF6A 4TW5A 4NXIA 5A4WA 1M2DA 2X8HA 2N5AA 4LL4B 5ID2B 5CAXA 2R5GA 1OYJA 2GGTA 2B1LA 1SK2A 5LD0A 3LYPA 3F9UA 4MJAA 4OFMA 2H8LA 4Q5NA 1U3AA 5J3RA 2VM1A 3KIJA 2LRCA 5DCHA 1TI1A 6GSVA 3H93A 5G30A 2O7KA 5LNKe 3WGXA 1JZDA 5AISA 1LU4A 4TR1A 5D9VA 5ECMB 3FHKA 3E3EA 2JADA 3FR9A 4ZB9A 4EUYA 1GLQA 1AUCA 1USBA 4IQ1A 3BD2A 3ERWA 4HZ2A 3EVIA 3C8EA 1HD2A 4QQ7A 5CRHA 1OAZA 1B48A 4GCIA 2LJRA 3C73A 1THXA 4EDZA 3MWHA 2VL3A 5JCWA 3RHBA 3BJ5A 3RHCA 1BJXA 1J9BA 3D4MA 4ECJA 4O5RA 1J08A 5D73A 4MK3A 3BOAA 3LWAA 4FYUA 1K0BA 2HNLA 3ME8A 3DVWA 5D8IA 3LXTA 4L0UA 5H5RA 3VWWA 1SKWB 1PD21 4POMA 3NOFA 1XW5A 3APOA 1ERWA 4KNDA 1U87A 1X0RA 1K3OA 2J9HA 4X1UA 5DALB 4XS6A 4QL9A 2AHEA 4HS1A 2JACA 4NWYA 4DSSA 3H79A 2CAQA 1ERVA 5HFGA 5IPGA 4J2FA 4TR3A 3WT2A 3DGQA 1G7OA 2H0GA 2RIIA 3VWVA 2M46A 4HU7A 5H5SA 2X8CA 3IV4A 3IRAA 2MMZA 2IL3A 2WCIA 2F3MA 3EYTA 4EXJA 4FO5A 4EVMA 3TB2A 4GSNA 2B5XA 3GTUB 4FYCA 3LSZA 3DWVA 3KZQA 1T4ZA 1Z6NA 1PKZA 5ID2A 2VCWA 3TKRA 3HDCA 5J9BA 1G6WA 3GN3A 2F9SA 5FWGA 2C0DA 2H1BA 1XFLA 3UVHA 5KN0A 5IQYA 2HSYA 5DDLA 4P3YB 1YY7A 2VAFA 2IMFA 2A2RA 4KDYA 3M3MA 2GT6A 3DRNA 4PX1A 2BTOT 1NSWA 3Q18A 2CZ2A 1Z7RA 3EE2A 4XRDA 5ECSA 4MH2A 3ZMKA 3GYKA 4TR4A 1WIKA 3GX8A 2CZ3A 2E0QA 1LJRA 2HZFA 2O85A 4K7OA 1VF4A 5GAND 5HR0A 1FO5A 1WP0A 3C7MA 3WYWA 4IHUA 3OR5A 3GIXA 3Q6OA 4X43A 3AY8A 2YN1A 2GQKA 1F2EA 4GLTA 3PR8A 2H1DA 4BVXA 2YWIA 3F4SA 3RAZA 3JCML 1V57A 2WS2A 1HYUA 1ZOFA 2OACA 3VLNA 3F3QA 3ZVJD 1F3AA 2N5BA 1X5CA 1NM3A 2GSRA 3APSA 5DALA 3EMPA 3HKRA 3DXBA 3M9JA 1SJIA 5IMAA 3C1RA 1PX6A 5IM9A 1TP9A 4EE0A 4V2NA 2HRNA 2K8VA 1OE7A 4JRRA 2GZZA 4AF2A 4GXZA 2H1GA 5J5NA 1VF2A 2B5YA 16GSA 5CYYA 1ACVA 4RQRA 4PUFC 4LLRA 4HDEA 2YV9A 4ZBBA 4HZ4A 1MD4A 1JZRA 1BYEA 1TDIA 3KTBA 4AJ6A 4L8EA 2H71A 1U6TA 2JZTA 4QL7A 4WETA 2I4AA 4KH7A 3EMXA 1ML6A 2PWJA 5D96A 1R26A 5B8AA 5D9TA 3QFBC 3P2AA 3GURA 4BWQA 3VPTA 3QDNA 3KM6A 1S3CA 3TKSE 1WJKA 4PNGA 1URMA 2HZEB 1A24A 3A2WA 3UMAA 2C3TA 2GQMA 2GS3A 1AW9A 2KLXA 2L6CA 4F0CA 1TOFA 2MBTA 4MF5A 1Z5YE 1R4WA 2BMXA 5A5KA 1N2AA 1SU9A 13GSA 2FGXA 3ZTLA 3GH9A 5CP1A 1PL1A 2VO4A 2K9FA 2A4VA 1S3AA 4WKWA 1RQMA 1K0OA 3VPQA 3HJOA 5KN2A 1AAZA 3UJ1A 3D5JA 4PNFA 2R2JA 1O85A 4TOPA 3P8WA 4YAVA 1EGRA 3CSHA 1EOGA 1TI3A 4WR5A 2F51A 5COHA 4LL1B 1G0TA 3HD5A 1Z9HA 2O87A 1FW1A 1O6JA 3PH9A 3UIWA 5IO0A 8GSSA 1T00A 1O7UA 1WE0A 1UN2A 2FA4A 3CMIA 4FH8A 2TIRA 5JCGA 3GFKA 3ZYWA 1H4OA 4GTUA 4BPYA 5ECRB 3MDKA 1O81A 4GRFA 11GSA 2KOKA 2KP1A 2AUVA 1ILOA 1YQ1A 3GKXA 1GUHA 2L4CA 4OD7A 4NV5A 1TK5B 2CVDA 5IMDA 4IP6A 2VCQA 4MJBA 1MD3A 4ZBDA 1Z6MA 2GZYA 4FYBA 4KW6A 4ZIJA 1PQNA 1OC9B 2YWNA 5DJLA 5G1KA 1YEPA 2RM5A 3D6IA 3CSJA 12GSA 3QFAC 3ZREA 4EL1A 4X0XA 2V41A 5ECKB 5ECIB 2VUPA 4CW9A 2XHFA 2RUFA 2IWTA 2LS5A 4JBBA 3LORA 2H6ZA 1F37A 5DCGA 1QQ2A 1GLPA 3F6FA 1AIUA 1M99A 3GSTA 5G2ZA 4O7HA 4ZL7A 2MBSA 1GP1A 2WFCA 4FIWA 4DSSB 1V9WA 3LFLA 4N30A 5A4UA 3HXSA 3RPNA 4WXTA 1YKAA 3A5WA 4MPGA 2DMLA 3K8NA 1EP8A 3M1GA 2IMIA 2MMNA 2H19A 3ZIVA 1EWXA 2HZEA 3QCPA 5DVBA 3TOTA 3N5OA 3MAKA 4RUVA 3WGEA 5FHIA 3ZVJA 4CDOA 2VCVA 4EDYA 2K18A 3I6AA 20GSA 4YQVA 3BBYA 1XZOA 4Q5QA 1PSQA 2FWEA 2GQLA 5AIVA 1WWJA 5J9CA 2H76A 1PGTA 1BG5A 2GSSA 2KHPA 5J41A 5CO3A 3M8NA 3TJGA 2ES7A 1TTZA 3QD9A 4MDCA 4LMVA 1YZXA 5CRGA 2NPBA 3IBHA 1MTCA 1TK8B 1TKDB 3CYNA 2B3SA 1AC1A 5ELAA 3D0ZA 14GSA 4JR6A 2DJJA 4I5QA 2BJXA 3HYPA 1IYHA 1FB0A 3KP9A 4HQSA 1X9MB 3GA4A 2R4VA 1ZZYA 1DBYA 5A4VA 2CT6A 3D22A 1M9BA 3BCIA 2GDRA 1TJDA 2MZCA 3GMFA 4MZCA 1Q98A 2I9HA 2YV7A 1UVZA 3IAS2 1OC9A 2I3YA 3HZ4A 2C4JA 1GH2A 4KB3A 5GZZB 2VLTA 3QAVA 2LRTA 4OWYA 1HNCA 3IC4A 2AV4A 4KUNA 2V2GA 4V2MA 2CV4A 1A0FA 2MYGA 5HR2A 1NW2A 1F3BA 2LQOA 3CTFA 2GT5A 3LGCA 3G7YA 4PQ1A 1TXXA 3KJYA 2LNTA 4KCEA 10GSA 5IIZA 5F06A 3WGDA 1JZWA 1W89A 5D9WA 3U5RE 3I9V2 4ZB8A 3MSZA 4BWSA 2JU5A 2C8UA 2C0EA 4OMVA 9GSSA 3LG6A 4ML6A 2VCTA 4WBRD 1KEBA 3US3A 1SK1A 1JHBA 1I9DA 2CA8A 2R37A 1RW1A 2V1MA 2QSIA 4IN0A 3GRXA 3KP8A 4Z7XA 1FB6A 2H30A 2H0IA 3QAGA 1SENA 2O8VB 2FNOA 3UBKA 1EP7A 4ACSA 2V6OA 3DMLA 3UVTA 5IMZA 4KGIA 2R6KA 1GL8A 1GNWA 3IOSA 3VWUA 1YEXA 2LV3A 4EO3A 5EL8A 2LJAA 4MP4A 5GSTA 1GSEA 3CRUA 3WT1A 5EY6A 3HHVA 4MPFA 3F3RA 2HRFA 1AQWA 2XPEA 1E6BA 2FWGA 1V98A 3ERFA 1GSUA 2YJ7A 1TRVA 1HQOA 1SJ6A 2CX3A 3KH9A 3DEXA 4XHMA 4N11A 1SYRA 2JSYA 1SL1B 2CAIA 4WF5A 3KTLA 2C1YA 3DD3A 1PL2A 4OCEA 1XVWA 3F4TA 2GVPA 3HJPA 1GULA 2JZRA 3EU3A 3HCZA 4WEYA 2CVKA 2DJKA 1GSSA 4JU5A 3HVVA 3WD6A 3PINA 5HFIA 4TXOB 1ERTA 3IAM2 2PVQA 5DAKB 4RI7A 4F03A 1B9YC 2IFQB 4BA7A 2XBIA 1K0MA 1OC3A 4MF7A 2TRXA 5L71A 5JWOB 4NMUA 4ZILA 4PXOA 2GZPA 2I1UA 1WMJA 2PERA 1GRXA 2Z9SA 3L9VA 3U6VA 4F2IA 22GSA 3TJBA 1AQVA 4AJ7A 2DBCA 2FA8A 3UAPA 3FZ4A 1ABAA 1AXDA 3GSSA 4E8EA 4NPBA 1CQHA 3J7Yk 2H0HA 4N10A 1X5DA 1A2MA 2H72A 3M9KA 5CNWA 2NTOA 4I6XA 3KH7A 3UL3A 2H6XA 5HFKA 3N9JA 4O32A 2H01A 4ZBAA 1ZGNA 1X5EA 1X9SB 1DUGA 1ERUA 5CRWA 5E4WA 4TKYA 5ECLB 5ABRA 1TU8A 1K0AA 5DQSA 3H8QA 2YZHA 3IR4A 3KMOA 4KDUA 1SKRB 3IE3A 5KN3A 2ZCTA 1T1VA 2ALBA 2HYXA 5CREA 1WRYA 1HNBA 2L59A 5HQPA 3FEUA 1K0CA 2IMKA 5IMVA 4PUAA 3TRQA 3F63A 4HEA2 4WR4A 1MDIA 2IJYA 5DQYA 1DE1A 2L57A 2P31A 4HU9A 5C00A 3GNJA 1V40A 5G5EA 4H86A 4V2LA 2B7JA 1R5AA 2CVBA 2YNXA 3W6GA 2C3QA 2CQ9A 2VLVA 4F9ZA 1BAYA 4ML1A 3EURA 3C71A 2L6DA 2EIQA 2WDUA 2VIMA 5GSSA 2PU9C 1TW9A 2AJQB 3W8JA 3J7Yb 6GSWA 4JE1A 4J56E 7GSSA 1K0DA 1O8XA 3O6TA 1J0FA 1OC8A 4I2TA 1ZL9A 1O8WA 3E9JB 1ZYEA 1E2YA 3QMXA 5KN1A 3KCMA 1XWKA 2FY6A 4TXOA 2VD0A 1EV9A 5DAKA 5ELGA 2IFQA 3VI5A 1T4YA 5B6MA 3I43A 3ME7A 5HR1A 2M72A 2GTUA 2C80A 1WOUA 3O3TA 1DSBA 1GTIA 4BL7A 3HJMA 3A3TA 4MLYA 1H75A 3TCOA 3PGTA 1XWAA 3V1WA 3A2XA 1MEKA 5F05A 2YANA 2QKEA 2DJ3A 5F8BA 3GHAA 4K9ZA 4G9HA 2YOIA 3GX0A 4WF4A 3ERGA 2B6MA 3G9BA 3Q74A 3KD0A 3R2QA 1G6YA 1B4PA 2ON7A 1XCCA 1SK0A 3QPMA 3ZFLA 3EWLA 2PN8A 3VFIA 1MDJA 1TRSA 1GSFA 1QUWA 2E2MA 2G0FA 4HJ2A 2WGRA 1U88A 2DLXA 1M2AA 3FRCA 3NIVA 2LTKA 3IPZA 1JFUA 2HE3A 4YAPA 2WJUA 2IIYA 2P0GA 4IS0A 5AGYA 2OA7A 1T7PB 2WZ9A 5IPHA 2N5FA 4G2EA 5JWRB 1F6MC 1MDKA 1SJZA 1YDKA 1M2BA 1Y6EA 3F8UA 1XBSA 1T3BA 1Z3EA 1O73A 5IMCA 4OCFA 3GL3A 1G7EA 1XWBA 3VK9A 4L5LA 2DC5A 1GSDA 4RI6A 1GTBA 2LQQA 2RUEA 3CBUA 4XS4B 2RM6A 1DE2A 3TJFA 3TKQA 5GAPD 1TRUA 2WULA 5FT3A 2HI7A 1FVJA 2FD3A 3Q19A 4NAXA 5E59A 1BEDA 1JZOA 4IJIA 4OO5A 3D4TA 2PGTA 2EC4A 4NHZA 2A2SA 2L4QA 2GSTA 2VL9A 4O92A 2JZSA 2VL2A 2FUG2 4DEJA 1B9XC 4HUAA 5EVOA 1I5GA 2FCHA 1A8YA 6GSXA 4ZXGA 2YCDA 4L5OA 1IYIA 4K0GA 1F9MA 1B8XA 4ECCA 4KSMA 1EOHA 3ZL5A 3RBTA 3F4RA 3H1NA 3M0FA 5ECQB 3HA9A 2DSAA 2DJ0A 4GF0A 3FR3A 1JLVA 4XRAA 2OKAA 1SKSB 18GSA 1TRWA 4IP1A 4F0BA 4TR0A 3DKSA 1N8JA 3I69A 4TXVA 4YQUA 1VGLA 2YP6A 3CSIA 1XIYA 6GSSA 4K2DA 1OKTA 2H75A 2VCZA 1S3DA 3A2VA 2C3NA 4ILFA 5G1LA 2ON5A 4KDXA 1M0UA 3APQA 4XCSA 3IK9A 3LJRA 3DIEA 5C04A 2J23A 2OE0A 2F8FA 3ZIJA 1B4QA 2FWHA 2AYTA 3ZFBA 3LEFA 5G31A 4LA1A 1EZKA 2PPTA 2NDOA 3KMNA 2O89A 2H74A 2H66A 2B5EA 2WB9A 1SL2B 5INYA 1EV4A 4K6XA 1AQXA 2X8GA 2AAWA 3P7XA 4RQXA 1Q4JA 4MZBA 1QMVA 4DSRA 3GH6A 1GNEA 3RDWA 3ED3A 6GSYA 1SD9A 1THOA 3FW2A 4POKA 3VWXA 4EF0A 3P90A 1V58A 3HVXA 1EEMA 1YKCA 1ZYQB 3HVSA 3H4KA 3L9SA 3IHQA 3LYKA 1U3IA 3TKSA 1R5PA 1M7TA 4XS4A 1K3LA 5IOXA 2YPMA 1UC7A 2OE3A 4KX4A 2NBSA 3LQ7A 1PA3A 4TRXA 3TDGA 1GTAA 3VURA 1ZCPA 4NV2A 3IDVA 1SD8A 2OBKA 3ZRDA 2OADA 1BX9A 1GWCA 2VM2A 1GUMA 1HNAA 1A0RP 2PBJA 4I97A 5DJMA 4ULXA 4Q5FA 3ZMLA 2EIOA 1NHOA 4K8MA 2GSQA 2VCXA 1VRSD 4XS1A 1A2JA 3GKNA 4GQCA 2K6VA 2IMDA 4K0NA 4MJCA 2GLRA 2DJ2A 4PURA 4POLA 2NVLA 2ZUPA 5B8BA 4K7IA 1UA5A 4YQMA 1X9WB 2DMMA 2HLSA 2QGVA 4IW9A 4EC0A 2JSZA 3C1SA 4IJ3A 4DVCA 3SWLA 1XW6A 3FZ5A 2M80A 3DVXA 1GTUA 2QC7A 4MJEA 1KBNA 4TVEA 4ECIA 1SYXA 1CQGA 3GKMA 1EEJA 2VL2C 2LJKA 4JZQA 1KTEA 1YF0A 4IGJA 5LCZA 3LXZA 3ZLPA 2ZNMA 1QFNA 4I2UA 3EU4A 4E8HA 3QAWA 2DJ1A 2R3XA 4AJ8A 1XPVA 2L5LA 1QXHA 3D21A 2P5RA 1JLWA 2LSTA 1GUKA 5G5FA 2L5OA 4GSTA 4JR4A 2XBQA 4KE3A 5AN1A 5KEJA 1XW9A 3EINA 2VD1A 3L0HA 2RLIA 4CHSA 2OBIA 4IELA 2VLUA 4LMWA 4IVFA 3L78A 4WBJA 4MMMA 3VI7A 1TU7A 1PRXA 4L0WA 2DIYA 3O76A 5ECPB 1PMTA 1XOBA 4EKZA 4MABA 2WRTA 3L4NA 2AB6A 2TRCP 3UARA 1WPIA 5F0GA 5D93A 3KXOA 2XPDA 3FYGA 4OO4A 3GKKA 2MMOA 1VF1A 2LEGA 1C72A 3F6DA 2I81A 2C0GA 2VOCA 4JEDA 3F0IA 4MA9A 1ZMAA 2H70A 3GL5A 4HOJA 3TRXA 1K0NA 2LNSA 3FY7A 5JWQB 3IK7A 1YF1A 4IKHA 4OFTA 5HR3A 2LKUA 2DIZA 5ECOB 3KEBA 1RK4A 3ISOA 3RPPA
chains in the Genus database with same CATH superfamily
3QR6A 2V32A 4ZL8A 3GTUA 3UEMA 4MNNA 1A8LA 2REMA 2F8AA 4D73B 2FWFA 3CRTA 4PGTA 4ZB6A 1A23A 4KF9A 2LUSA 5B7CA 3FK8A 3TKSC 2IN3A 1ON4A 19GSA 3TOUA 17GSA 2H6YA 1VF3A 4NHWA 5EPFA 2YWMA 4G10A 4ISDA 3FKFA 4DSQA 1Y25A 3GV1A 2X64A 2B1KA 4BVYA 4K2XA 2YZUA 3G7JA 3IHGA 1TK0B 2HT9A 2JL4A 4ECBA 2KP2A 1PKWA 4GQFA 1OKDA 2H1AA 3QOUA 5B6NA 2E7PA 2KUCA 1T8EB 1GSQA 1XWGA 5IMFA 1KNGA 3UOMA 4KAEA 3FR6A 5IO2A 1XWCA 4K1FA 5DBQA 2YWOA 6GSTA 3L9UA 3HZ8A 4Q5RA 4K5RA 1Z7PA 1SL0B 4OFNA 3G7IA 1FVKA 5IOWA 4TR1B 4TN8A 2X99A 2R0CA 5F07A 4F82A 2OJLA 3MNGA 3GUSA 5ECHB 3FZAA 4GSSA 1R7HA 4IBPA 3BCKA 5JCUA 1FG4A 1FAAA 4HI7A 1XXUA 4IQAA 1V2AA 1BQ7A 2CX4A 2LRNA 1NHYA 1OE8A 4N0VA 4AGSA 4KSOA 4XIHA 2X4AA 2IMEA 2PVOC 2E2GA 4HJMA 4I8BA 4MCUA 4ID0A 4KCAA 5J4UA 4G19A 1K3YA 1PX7A 3CTGA 1ST9A 4POBA 3FZ9A 2HSHA 3EC3A 4KA0A 6GSUA 1PN9A 3CXGA 2B7KA 3TJJA 2MMAA 1QK8A 4PQIA 4PQHA 1GSYA 4HSCX 3ZITA 3TUEA 1EGOA 2PUKC 1LBKA 5CRDA 3HY2A 1FOVA 1M9AA 3UBLA 3IA1A 4MZWA 4YH2A 3S9FA 1A2LA 2P5QA 2G2QA 2EIRA 3TJKA 2FHEA 2K8SA 3W8SA 4D73A 4PTSA 4K7NA 2V6KA 3E0UA 2FLSA 4GWRA 2D2ZA 4J57E 3TGZA 1YJ6A 4V1Ap 2YJHA 2IPAA 1W4VA 5ENUA 3SBCA 1QGVA 3NZNA 5AIXA 4N0ZA 2XC2A 4G0KA 3ZZXA 5H5QA 4HQZA 5D9XA 4ZL9A 2C0FA 3KGKA 1OVNA 2HXKA 3IXRA 3DYRA 4MH3A 5ECNB 4XTSA 2OE1A 4V1Ag 2HFDA 2PMTA 3TRPA 1FHEA 1XVQA 1XOAA 3TKPA 2H73A 4MF6A 4TW5A 4NXIA 5A4WA 1M2DA 2X8HA 2N5AA 4LL4B 5ID2B 2HRAA 5CAXA 2R5GA 1OYJA 2GGTA 2B1LA 1SK2A 5LD0A 3LYPA 3F9UA 4MJAA 4OFMA 2H8LA 4Q5NA 1U3AA 5J3RA 2VM1A 3KIJA 2LRCA 5DCHA 1TI1A 6GSVA 3H93A 4FQUA 5G30A 2O7KA 5LNKe 3WGXA 1JZDA 5AISA 1LU4A 4TR1A 5D9VA 5ECMB 3FHKA 3E3EA 2JADA 3FR9A 4ZB9A 4EUYA 1GLQA 1AUCA 1USBA 4IQ1A 3BD2A 3ERWA 4HZ2A 3EVIA 3C8EA 1HD2A 4QQ7A 5CRHA 1OAZA 1B48A 4GCIA 2LJRA 3C73A 1THXA 4EDZA 3MWHA 2VL3A 5JCWA 3RHBA 3BJ5A 3RHCA 1BJXA 2A2PA 1J9BA 3D4MA 4ECJA 4O5RA 1J08A 5D73A 4MK3A 3BOAA 3LWAA 2A4HA 4FYUA 4EIPA 1K0BA 2HNLA 3ME8A 3DVWA 5D8IA 3LXTA 4L0UA 5H5RA 3VWWA 1SKWB 1PD21 4POMA 4BVXB 3NOFA 1XW5A 3APOA 1ERWA 4KNDA 1U87A 1X0RA 1K3OA 2J9HA 4X1UA 5DALB 4XS6A 4QL9A 2AHEA 2HRKA 4HS1A 2JACA 4NWYA 4DSSA 3H79A 2CAQA 1ERVA 5HFGA 5IPGA 4J2FA 4TR3A 3WT2A 3DGQA 1G7OA 2H0GA 2RIIA 4O5QA 3VWVA 2M46A 4HU7A 5H5SA 2X8CA 3IV4A 3IRAA 2MMZA 2IL3A 2WCIA 2F3MA 3EYTA 4EXJA 4FO5A 4EVMA 3TB2A 4GSNA 2B5XA 3GTUB 4FYCA 3LSZA 3DWVA 3KZQA 1T4ZA 1Z6NA 1PKZA 5ID2A 2VCWA 3TKRA 3HDCA 5J9BA 1G6WA 3GN3A 2F9SA 5FWGA 2C0DA 2H1BA 1XFLA 3UVHA 5KN0A 5IQYA 2HSYA 5DDLA 4P3YB 1YY7A 2VAFA 2IMFA 2A2RA 4KDYA 3M3MA 2GT6A 4CY6A 3DRNA 4PX1A 2BTOT 1NSWA 3Q18A 2CZ2A 1Z7RA 3EE2A 4XRDA 5ECSA 4MH2A 3ZMKA 3GYKA 4TR4A 1WIKA 3GX8A 2CZ3A 2E0QA 1LJRA 2HZFA 2O85A 4K7OA 1VF4A 5GAND 5HR0A 1FO5A 1WP0A 3C7MA 3WYWA 4IHUA 3OR5A 3GIXA 3Q6OA 4X43A 3AY8A 2YN1A 2GQKA 1F2EA 4GLTA 3PR8A 2H1DA 4BVXA 2YWIA 3F4SA 3RAZA 3JCML 1V57A 2WS2A 1HYUA 1ZOFA 2OACA 3VLNA 3F3QA 3ZVJD 1F3AA 1M3JA 2N5BA 1X5CA 1NM3A 2GSRA 3APSA 5DALA 3EMPA 3HKRA 3DXBA 3M9JA 1SJIA 5IMAA 3C1RA 1PX6A 5IM9A 1TP9A 4EE0A 4V2NA 2HRNA 2K8VA 1OE7A 4JRRA 2GZZA 4AF2A 4GXZA 2H1GA 5J5NA 1VF2A 2B5YA 16GSA 5CYYA 1ACVA 4RQRA 4PUFC 4LLRA 4HDEA 2YV9A 4ZBBA 4HZ4A 1MD4A 1JZRA 1BYEA 1TDIA 3KTBA 4AJ6A 4L8EA 2H71A 1U6TA 2JZTA 4QL7A 4WETA 2I4AA 3CQFA 3EMXA 4KH7A 1ML6A 2PWJA 4A5PA 5D96A 1R26A 5B8AA 5D9TA 3QFBC 3P2AA 3GURA 4BWQA 3VPTA 3QDNA 3KM6A 1S3CA 3R3EA 3TKSE 1WJKA 2QA1A 4PNGA 1URMA 2HZEB 1A24A 3A2WA 3UMAA 2C3TA 2GQMA 2GS3A 1AW9A 2KLXA 2L6CA 4F0CA 1TOFA 2MBTA 4MF5A 1Z5YE 1R4WA 2BMXA 5A5KA 1N2AA 1SU9A 13GSA 2FGXA 3ZTLA 3GH9A 5CP1A 1PL1A 2VO4A 2K9FA 2A4VA 1S3AA 4WKWA 4K5SA 1RQMA 1K0OA 3VPQA 3HJOA 5KN2A 1AAZA 3UJ1A 3D5JA 4PNFA 2R2JA 1O85A 4TOPA 3P8WA 4YAVA 1EGRA 3CSHA 1EOGA 1TI3A 4WR5A 2F51A 5COHA 1M3IA 4LL1B 1G0TA 3HD5A 1Z9HA 2O87A 1FW1A 1O6JA 3PH9A 3UIWA 5IO0A 8GSSA 1T00A 1O7UA 1WE0A 1UN2A 2FA4A 3CMIA 4FH8A 2TIRA 5JCGA 3GFKA 3ZYWA 1H4OA 4GTUA 4BPYA 5ECRB 3MDKA 1O81A 4GRFA 11GSA 2KOKA 2KP1A 2AUVA 1ILOA 1YQ1A 3GKXA 1GUHA 2L4CA 4OD7A 4NV5A 1TK5B 2CVDA 5IMDA 4IP6A 2VCQA 4MJBA 1MD3A 4ZBDA 1Z6MA 2GZYA 4FYBA 4KW6A 4ZIJA 1PQNA 1OC9B 4BIKA 2YWNA 5DJLA 4CY8A 5G1KA 1YEPA 2RM5A 3D6IA 3CSJA 12GSA 3QFAC 3ZREA 4EL1A 4X0XA 2V41A 5ECKB 5ECIB 2VUPA 4CW9A 2XHFA 2RUFA 5KOXA 2IWTA 2LS5A 4JBBA 3LORA 2H6ZA 1F37A 5DCGA 1QQ2A 1GLPA 3F6FA 1AIUA 1M99A 3GSTA 5G2ZA 4O7HA 4ZL7A 2MBSA 1GP1A 2WFCA 4FIWA 4DSSB 1V9WA 3LFLA 4N30A 5A4UA 3HXSA 3RPNA 4WXTA 1YKAA 3A5WA 4MPGA 2DMLA 5KOWA 3K8NA 1EP8A 3M1GA 2IMIA 2MMNA 2DKHA 2H19A 3ZIVA 1EWXA 2HZEA 3QCPA 5DVBA 3TOTA 3FMWA 3N5OA 3MAKA 4RUVA 3WGEA 5FHIA 3ZVJA 4O5UA 4CDOA 2VCVA 4EDYA 2K18A 3I6AA 20GSA 4YQVA 3BBYA 1XZOA 4Q5QA 1PSQA 2FWEA 2GQLA 2QA2A 5AIVA 1WWJA 5J9CA 2H76A 1PGTA 1BG5A 2GSSA 2KHPA 5J41A 5CO3A 3M8NA 3TJGA 2ES7A 1TTZA 3QD9A 4MDCA 4LMVA 1YZXA 5CRGA 2NPBA 3IBHA 1MTCA 1TK8B 1TKDB 3CYNA 2B3SA 1AC1A 5ELAA 3D0ZA 14GSA 4JR6A 2DJJA 4I5QA 2BJXA 3HYPA 1IYHA 1FB0A 3KP9A 4HQSA 1X9MB 3GA4A 2R4VA 1ZZYA 4YKGA 1DBYA 5A4VA 2CT6A 3D22A 1M9BA 3BCIA 2GDRA 2UZ8A 1TJDA 2MZCA 3GMFA 4MZCA 1Q98A 2I9HA 2YV7A 1UVZA 3IAS2 1OC9A 2I3YA 3HZ4A 2C4JA 3LW9A 1GH2A 4KB3A 5GZZB 2VLTA 3QAVA 2LRTA 4OWYA 1HNCA 3IC4A 2AV4A 4KUNA 2V2GA 4V2MA 2CV4A 1A0FA 2MYGA 5HR2A 1NW2A 1F3BA 2LQOA 3CTFA 2GT5A 3LGCA 3G7YA 4PQ1A 1TXXA 3KJYA 2LNTA 4KCEA 1ZYPA 10GSA 5IIZA 5F06A 3WGDA 1JZWA 1W89A 5D9WA 3U5RE 3I9V2 4ZB8A 3MSZA 4BWSA 2JU5A 2C8UA 2C0EA 4OMVA 9GSSA 3LG6A 4ML6A 2VCTA 4WBRD 3A5IA 1KEBA 3US3A 1SK1A 1JHBA 1I9DA 2CA8A 2R37A 1RW1A 2V1MA 2QSIA 4IN0A 3GRXA 3KP8A 4Z7XA 1FB6A 2H30A 2H0IA 3QAGA 1SENA 1PFOA 2O8VB 2FNOA 3UBKA 1EP7A 4ACSA 2V6OA 3DMLA 3UVTA 5IMZA 4KGIA 1ZYNA 2R6KA 1GL8A 1GNWA 3IOSA 3VWUA 1YEXA 2LV3A 4EO3A 5EL8A 2LJAA 4MP4A 5GSTA 1GSEA 3CRUA 3WT1A 5EY6A 3HHVA 4MPFA 3F3RA 2HRFA 1AQWA 2XPEA 1E6BA 2FWGA 1V98A 3ERFA 1GSUA 2YJ7A 1TRVA 1HQOA 1SJ6A 2CX3A 3KH9A 3DEXA 4XHMA 1PN0A 4N11A 1SYRA 2JSYA 1SL1B 2CAIA 4WF5A 3KTLA 2C1YA 3DD3A 1PL2A 4OCEA 1XVWA 3F4TA 2GVPA 3HJPA 1GULA 2JZRA 3EU3A 3HCZA 4WEYA 2CVKA 2DJKA 1GSSA 4JU5A 4EIQA 3HVVA 3WD6A 3PINA 5HFIA 4TXOB 1ERTA 3IAM2 2PVQA 5DAKB 4RI7A 4F03A 1B9YC 2IFQB 4BA7A 2XBIA 1K0MA 1OC3A 4MF7A 2TRXA 5L71A 5JWOB 4NMUA 4ZILA 1S3RA 4PXOA 2GZPA 2I1UA 1WMJA 2PERA 1GRXA 2Z9SA 3L9VA 3U6VA 4F2IA 22GSA 3PPUA 3TJBA 1AQVA 4AJ7A 2DBCA 2FA8A 3UAPA 3FZ4A 1ABAA 1AXDA 3GSSA 4E8EA 4NPBA 1CQHA 3J7Yk 4ICYA 2H0HA 4N10A 1X5DA 1A2MA 2H72A 3M9KA 5CNWA 2NTOA 4I6XA 3KH7A 3UL3A 2H6XA 5HFKA 3N9JA 2R0GA 4O32A 2H01A 4ZBAA 1ZGNA 1X5EA 1X9SB 1DUGA 1ERUA 5CRWA 5E4WA 4TKYA 5ECLB 5ABRA 1TU8A 1K0AA 5DQSA 3H8QA 2YZHA 3IR4A 3KMOA 4KDUA 1SKRB 3IE3A 5KN3A 2ZCTA 1T1VA 2ALBA 3IC8A 2HYXA 5CREA 1WRYA 1HNBA 2L59A 5HQPA 3FEUA 1K0CA 2IMKA 5IMVA 4PUAA 3TRQA 3F63A 4HEA2 4WR4A 1MDIA 2IJYA 5DQYA 1DE1A 2L57A 4Z2TA 2P31A 4HU9A 5C00A 3GNJA 1V40A 5G5EA 3EPTA 4H86A 4V2LA 2B7JA 1R5AA 2CVBA 2YNXA 3W6GA 2C3QA 2CQ9A 2VLVA 4F9ZA 1BAYA 4ML1A 4USSA 3EURA 3C71A 2L6DA 2EIQA 2WDUA 2VIMA 5GSSA 2PU9C 1TW9A 2AJQB 3W8JA 3J7Yb 6GSWA 4JE1A 4J56E 7GSSA 1K0DA 1O8XA 3O6TA 1J0FA 1OC8A 4I2TA 1ZL9A 1O8WA 3E9JB 1ZYEA 1E2YA 3QMXA 2R0PA 5KN1A 3KCMA 1XWKA 2FY6A 4TXOA 2VD0A 1EV9A 5DAKA 5ELGA 2IFQA 3VI5A 1T4YA 5B6MA 3I43A 3ME7A 5HR1A 2M72A 2GTUA 2C80A 1WOUA 3O3TA 5BRTA 1DSBA 1GTIA 4BL7A 3HJMA 3A3TA 4MLYA 1H75A 3TCOA 3PGTA 1XWAA 3V1WA 3A2XA 1MEKA 5F05A 2YANA 2QKEA 2DJ3A 5F8BA 3GHAA 4K9ZA 4G9HA 2YOIA 3GX0A 4WF4A 3ERGA 2B6MA 3G9BA 3Q74A 3KD0A 3R2QA 1G6YA 1B4PA 2HSMA 2ON7A 1XCCA 1SK0A 3QPMA 3ZFLA 3EWLA 2PN8A 3VFIA 1MDJA 1TRSA 1GSFA 1QUWA 2E2MA 2G0FA 4HJ2A 2WGRA 1U88A 2DLXA 1M2AA 3FRCA 3NIVA 2LTKA 3IPZA 1JFUA 2HE3A 4YAPA 2WJUA 2IIYA 2P0GA 4IS0A 4X4JA 5AGYA 2OA7A 1T7PB 2WZ9A 5IPHA 2N5FA 4G2EA 5JWRB 1F6MC 1MDKA 1SJZA 1YDKA 1M2BA 1Y6EA 3F8UA 1XG8A 1XBSA 1T3BA 1Z3EA 1O73A 5IMCA 4OCFA 3GL3A 1G7EA 1XWBA 3VK9A 4L5LA 2DC5A 1GSDA 4RI6A 1GTBA 2LQQA 2RUEA 3CBUA 4XS4B 2RM6A 1DE2A 3TJFA 3TKQA 5GAPD 1TRUA 2WULA 5FT3A 2HI7A 1FVJA 2FD3A 3Q19A 4NAXA 5E59A 1BEDA 1JZOA 4IJIA 4OO5A 3D4TA 2PGTA 2EC4A 4NHZA 2A2SA 2L4QA 2GSTA 2VL9A 4O92A 2JZSA 2VL2A 2FUG2 4DEJA 1B9XC 4HUAA 5EVOA 1I5GA 2FCHA 1A8YA 6GSXA 4ZXGA 2YCDA 4L5OA 1IYIA 4G0LA 4K0GA 1F9MA 1B8XA 4ECCA 4KSMA 1EOHA 3ZL5A 3RBTA 3F4RA 3H1NA 3M0FA 5ECQB 3HA9A 2DSAA 5BMUA 4YKFA 3HVNA 2DJ0A 4GF0A 3FR3A 1JLVA 4XRAA 2OKAA 1SKSB 18GSA 1TRWA 4IP1A 4F0BA 4TR0A 3DKSA 1N8JA 3I69A 4TXVA 4YQUA 1VGLA 2YP6A 3CSIA 1XIYA 3MYDA 6GSSA 4K2DA 1OKTA 2H75A 2VCZA 1S3DA 3A2VA 2C3NA 4ILFA 4Z2UA 5G1LA 2ON5A 3MIXA 4KDXA 1M0UA 3APQA 4XCSA 3IK9A 3LJRA 3DIEA 5C04A 2J23A 2OE0A 2F8FA 3ZIJA 1B4QA 2FWHA 2AYTA 3ZFBA 3LEFA 5G31A 4LA1A 1EZKA 2PPTA 2NDOA 3KMNA 2O89A 2H74A 2H66A 2B5EA 2WB9A 1SL2B 5INYA 1EV4A 4K6XA 1AQXA 2X8GA 2AAWA 3P7XA 4RQXA 1Q4JA 4MZBA 1QMVA 4DSRA 3GH6A 1GNEA 3RDWA 4G0IA 3ED3A 6GSYA 1SD9A 1THOA 3FW2A 4POKA 3VWXA 4EF0A 3P90A 1V58A 3HVXA 1EEMA 1YKCA 1ZYQB 3HVSA 3H4KA 3L9SA 1FOHA 3IHQA 3LYKA 1U3IA 3TKSA 1R5PA 1M7TA 4XS4A 1K3LA 5IOXA 2YPMA 1UC7A 2OE3A 4KX4A 2NBSA 3LQ7A 1PA3A 4TRXA 3TDGA 1GTAA 3VURA 1ZCPA 4NV2A 3IDVA 1SD8A 2OBKA 3ZRDA 2OADA 1BX9A 1GWCA 2VM2A 1GUMA 1HNAA 1A0RP 2PBJA 4I97A 5DJMA 4ULXA 4Q5FA 3ZMLA 2EIOA 1NHOA 4K8MA 2GSQA 2VCXA 1VRSD 4XS1A 1A2JA 3GKNA 4GQCA 2K6VA 2IMDA 4K0NA 4MJCA 2GLRA 2DJ2A 4PURA 4POLA 2NVLA 2ZUPA 5B8BA 4K7IA 1UA5A 4YQMA 1X9WB 2DMMA 2HLSA 2QGVA 4IW9A 4EC0A 4BVYB 2JSZA 3C1SA 4IJ3A 4DVCA 3SWLA 1XW6A 3FZ5A 2M80A 3DVXA 1GTUA 2QC7A 4MJEA 1KBNA 4TVEA 4ECIA 1SYXA 1CQGA 3GKMA 1EEJA 2VL2C 2LJKA 4JZQA 1KTEA 1YF0A 4IGJA 5LCZA 3LXZA 3ZLPA 2ZNMA 1QFNA 4I2UA 3EU4A 4BL7B 4E8HA 3QAWA 2DJ1A 2R3XA 4AJ8A 1XPVA 4Z2RA 2L5LA 1QXHA 3D21A 2P5RA 1JLWA 2LSTA 1GUKA 5G5FA 2L5OA 4GSTA 4JR4A 2XBQA 4KE3A 5AN1A 5KEJA 1XW9A 3EINA 2VD1A 3L0HA 2DKIA 2RLIA 4CHSA 2OBIA 4IELA 2VLUA 4LMWA 4IVFA 3L78A 4WBJA 4MMMA 3VI7A 1TU7A 1PRXA 4L0WA 2DIYA 3O76A 5ECPB 1PMTA 1XOBA 4EKZA 4MABA 2WRTA 2X49A 3L4NA 2AB6A 2TRCP 3UARA 1WPIA 5F0GA 3KXOA 2XPDA 3FYGA 4OO4A 5D93A 3GKKA 2MMOA 1VF1A 2LEGA 1C72A 3F6DA 2I81A 2C0GA 2VOCA 4JEDA 3F0IA 4MA9A 1ZMAA 2H70A 3GL5A 4HOJA 3TRXA 1K0NA 2LNSA 3FY7A 5JWQB 3IK7A 1YF1A 4IKHA 4OFTA 5HR3A 2LKUA 2DIZA 5ECOB 3KEBA 1RK4A 3ISOA 3RPPA
chains in the Genus database with same CATH topology
3QR6A 2V32A 4ZL8A 3GTUA 3UEMA 4MNNA 1A8LA 2REMA 2F8AA 4D73B 2FWFA 3CRTA 4PGTA 4ZB6A 1A23A 4KF9A 2LUSA 5B7CA 3FK8A 3TKSC 2IN3A 1ON4A 19GSA 3TOUA 17GSA 2H6YA 1VF3A 4NHWA 5EPFA 2YWMA 4G10A 4ISDA 3FKFA 4DSQA 1Y25A 3GV1A 2X64A 2B1KA 4BVYA 4K2XA 2YZUA 3G7JA 3IHGA 1TK0B 2HT9A 2JL4A 4ECBA 2KP2A 1PKWA 4GQFA 1OKDA 2H1AA 3QOUA 5B6NA 2E7PA 2KUCA 1T8EB 1GSQA 1XWGA 5IMFA 1KNGA 3UOMA 4KAEA 3FR6A 5IO2A 1XWCA 4K1FA 5DBQA 2YWOA 6GSTA 3L9UA 3HZ8A 4Q5RA 4K5RA 1Z7PA 1SL0B 4OFNA 3G7IA 1FVKA 5IOWA 4TR1B 4TN8A 2X99A 2R0CA 5F07A 4F82A 2OJLA 3MNGA 3GUSA 5ECHB 3FZAA 4GSSA 1R7HA 4IBPA 3BCKA 5JCUA 1FG4A 1FAAA 4HI7A 1XXUA 4IQAA 1V2AA 1BQ7A 2CX4A 2LRNA 1NHYA 1OE8A 4N0VA 4AGSA 4KSOA 4XIHA 2X4AA 2IMEA 2PVOC 2E2GA 4HJMA 4I8BA 4MCUA 4ID0A 4KCAA 5J4UA 4G19A 1K3YA 1PX7A 3CTGA 1ST9A 4POBA 3FZ9A 2HSHA 3EC3A 4KA0A 6GSUA 1PN9A 3CXGA 2B7KA 3TJJA 2MMAA 1QK8A 4PQIA 4PQHA 1GSYA 3ZITA 1EGOA 3TUEA 2PUKC 1LBKA 5CRDA 3HY2A 1FOVA 1M9AA 3UBLA 3IA1A 4MZWA 4YH2A 3S9FA 1A2LA 2P5QA 2G2QA 2EIRA 3TJKA 2FHEA 2K8SA 3W8SA 4D73A 4PTSA 4K7NA 2V6KA 3E0UA 2FLSA 4GWRA 2D2ZA 4J57E 3TGZA 1YJ6A 4V1Ap 2YJHA 2IPAA 1W4VA 5ENUA 3SBCA 1QGVA 3NZNA 5AIXA 4N0ZA 2XC2A 4G0KA 3ZZXA 5H5QA 4HQZA 5D9XA 4ZL9A 2C0FA 3KGKA 1OVNA 2HXKA 3IXRA 3DYRA 4MH3A 5ECNB 4XTSA 2OE1A 4V1Ag 2HFDA 2PMTA 3TRPA 1FHEA 1XVQA 1XOAA 3TKPA 2H73A 4MF6A 4TW5A 4NXIA 5A4WA 1M2DA 2X8HA 2N5AA 4LL4B 5ID2B 2HRAA 5CAXA 2R5GA 1OYJA 2GGTA 2B1LA 1SK2A 5LD0A 3LYPA 3F9UA 4MJAA 4OFMA 2H8LA 4Q5NA 1U3AA 5J3RA 2VM1A 3KIJA 2LRCA 5DCHA 1TI1A 6GSVA 3H93A 4FQUA 5G30A 2O7KA 5LNKe 3WGXA 1JZDA 5AISA 1LU4A 4TR1A 5D9VA 5ECMB 3FHKA 3E3EA 2JADA 3FR9A 4ZB9A 4EUYA 1GLQA 1AUCA 1USBA 4IQ1A 3BD2A 3ERWA 4HZ2A 3EVIA 3C8EA 1HD2A 4QQ7A 5CRHA 1OAZA 1B48A 4GCIA 2LJRA 3C73A 1THXA 4EDZA 3MWHA 2VL3A 5JCWA 3RHBA 3BJ5A 3RHCA 1BJXA 2A2PA 1J9BA 3D4MA 4ECJA 4O5RA 1J08A 5D73A 4MK3A 3BOAA 3LWAA 2A4HA 4FYUA 4EIPA 1K0BA 2HNLA 3ME8A 3DVWA 5D8IA 3LXTA 4L0UA 5H5RA 3VWWA 1SKWB 1PD21 4POMA 4BVXB 3NOFA 1XW5A 3APOA 1ERWA 4KNDA 1U87A 1X0RA 1K3OA 2J9HA 4X1UA 5DALB 4XS6A 4QL9A 2AHEA 2HRKA 4HS1A 2JACA 4NWYA 4DSSA 3H79A 2CAQA 1ERVA 5HFGA 5IPGA 4J2FA 4TR3A 3WT2A 3DGQA 1G7OA 2H0GA 2RIIA 4O5QA 3VWVA 2M46A 4HU7A 5H5SA 2X8CA 3IV4A 3IRAA 2MMZA 2IL3A 2WCIA 2F3MA 3EYTA 4EXJA 4FO5A 4EVMA 3TB2A 4GSNA 2B5XA 3GTUB 4FYCA 3LSZA 3DWVA 3KZQA 1T4ZA 1Z6NA 1PKZA 5ID2A 2VCWA 3TKRA 3HDCA 5J9BA 1G6WA 3GN3A 2F9SA 5FWGA 2C0DA 2H1BA 1XFLA 3UVHA 5KN0A 5IQYA 2HSYA 5DDLA 4P3YB 1YY7A 2VAFA 2IMFA 2A2RA 4KDYA 3M3MA 2GT6A 4CY6A 3DRNA 4PX1A 2BTOT 1NSWA 3Q18A 2CZ2A 1Z7RA 3EE2A 4XRDA 5ECSA 4MH2A 3ZMKA 3GYKA 4TR4A 1WIKA 3GX8A 2CZ3A 2E0QA 1LJRA 2HZFA 2O85A 4K7OA 1VF4A 5GAND 5HR0A 1FO5A 1WP0A 3C7MA 3WYWA 4IHUA 3OR5A 3GIXA 3Q6OA 4X43A 3AY8A 2YN1A 2GQKA 1F2EA 4GLTA 3PR8A 2H1DA 4BVXA 2YWIA 3F4SA 3RAZA 3JCML 1V57A 2WS2A 1HYUA 1ZOFA 2OACA 3VLNA 3F3QA 3ZVJD 1F3AA 2N5BA 1X5CA 1NM3A 2GSRA 3APSA 5DALA 3EMPA 3HKRA 3DXBA 3M9JA 1SJIA 5IMAA 3C1RA 1PX6A 5IM9A 1TP9A 4EE0A 4V2NA 2HRNA 2K8VA 1OE7A 4JRRA 2GZZA 4AF2A 4GXZA 2H1GA 5J5NA 1VF2A 2B5YA 16GSA 5CYYA 1ACVA 4RQRA 4PUFC 4LLRA 4HDEA 2YV9A 4ZBBA 4HZ4A 1MD4A 1JZRA 1BYEA 1TDIA 3KTBA 4AJ6A 4L8EA 2H71A 1U6TA 2JZTA 4QL7A 4WETA 2I4AA 4KH7A 3EMXA 1ML6A 2PWJA 4A5PA 5D96A 1R26A 5B8AA 5D9TA 3QFBC 3P2AA 3GURA 4BWQA 3VPTA 3QDNA 3KM6A 1S3CA 3R3EA 3TKSE 1WJKA 2QA1A 4PNGA 1URMA 2HZEB 1A24A 3A2WA 3UMAA 2C3TA 2GQMA 2GS3A 1AW9A 2KLXA 2L6CA 4F0CA 1TOFA 2MBTA 4MF5A 1Z5YE 1R4WA 2BMXA 5A5KA 1N2AA 1SU9A 13GSA 2FGXA 3ZTLA 3GH9A 5CP1A 1PL1A 2VO4A 2K9FA 2A4VA 1S3AA 4WKWA 4K5SA 1RQMA 1K0OA 3VPQA 3HJOA 5KN2A 1AAZA 3UJ1A 3D5JA 4PNFA 2R2JA 1O85A 4TOPA 3P8WA 4YAVA 1EGRA 3CSHA 1EOGA 1TI3A 4WR5A 2F51A 5COHA 4LL1B 1G0TA 3HD5A 1Z9HA 2O87A 1FW1A 1O6JA 3PH9A 3UIWA 5IO0A 8GSSA 1T00A 1O7UA 1WE0A 1UN2A 2FA4A 3CMIA 4FH8A 2TIRA 5JCGA 3GFKA 3ZYWA 1H4OA 4GTUA 4BPYA 5ECRB 3MDKA 1O81A 4GRFA 11GSA 2KOKA 2KP1A 2AUVA 1ILOA 1YQ1A 3GKXA 1GUHA 2L4CA 4OD7A 4NV5A 1TK5B 2CVDA 5IMDA 4IP6A 2VCQA 4MJBA 1MD3A 4ZBDA 1Z6MA 2GZYA 4FYBA 4KW6A 4ZIJA 1PQNA 1OC9B 2YWNA 5DJLA 4CY8A 5G1KA 1YEPA 2RM5A 3D6IA 3CSJA 12GSA 3QFAC 3ZREA 4EL1A 4X0XA 2V41A 5ECKB 5ECIB 2VUPA 4CW9A 2XHFA 2RUFA 5KOXA 2IWTA 2LS5A 4JBBA 3LORA 2H6ZA 1F37A 5DCGA 1QQ2A 1GLPA 3F6FA 1AIUA 1M99A 3GSTA 5G2ZA 4O7HA 4ZL7A 2MBSA 1GP1A 2WFCA 4FIWA 4DSSB 1V9WA 3LFLA 4N30A 5A4UA 3HXSA 3RPNA 4WXTA 1YKAA 3A5WA 4MPGA 2DMLA 5KOWA 3K8NA 1EP8A 3M1GA 2IMIA 2MMNA 2DKHA 2H19A 3ZIVA 1EWXA 2HZEA 3QCPA 5DVBA 3TOTA 3FMWA 3N5OA 3MAKA 4RUVA 3WGEA 5FHIA 3ZVJA 4O5UA 4CDOA 2VCVA 4EDYA 2K18A 3I6AA 20GSA 4YQVA 3BBYA 1XZOA 4Q5QA 1PSQA 2FWEA 2GQLA 2QA2A 5AIVA 1WWJA 5J9CA 2H76A 1PGTA 1BG5A 2GSSA 2KHPA 5J41A 5CO3A 3M8NA 3TJGA 2ES7A 1TTZA 3QD9A 4MDCA 4LMVA 1YZXA 5CRGA 2NPBA 3IBHA 1MTCA 1TK8B 1TKDB 3CYNA 2B3SA 1AC1A 5ELAA 3D0ZA 14GSA 4JR6A 2DJJA 4I5QA 2BJXA 3HYPA 1IYHA 1FB0A 3KP9A 4HQSA 1X9MB 3GA4A 2R4VA 1ZZYA 4YKGA 1DBYA 5A4VA 2CT6A 3D22A 1M9BA 3BCIA 2GDRA 2UZ8A 1TJDA 2MZCA 3GMFA 4MZCA 1Q98A 2I9HA 2YV7A 1UVZA 3IAS2 1OC9A 2I3YA 3HZ4A 2C4JA 3LW9A 1GH2A 4KB3A 5GZZB 2VLTA 3QAVA 2LRTA 4OWYA 1HNCA 3IC4A 2AV4A 4KUNA 2V2GA 4V2MA 2CV4A 1A0FA 2MYGA 5HR2A 1NW2A 1F3BA 2LQOA 3CTFA 2GT5A 3LGCA 3G7YA 4PQ1A 1TXXA 3KJYA 2LNTA 4KCEA 1ZYPA 10GSA 5IIZA 5F06A 3WGDA 1JZWA 1W89A 5D9WA 3U5RE 3I9V2 4ZB8A 3MSZA 4BWSA 2JU5A 2C8UA 2C0EA 4OMVA 9GSSA 3LG6A 4ML6A 2VCTA 4WBRD 3A5IA 1KEBA 3US3A 1SK1A 1JHBA 1I9DA 2CA8A 2R37A 1RW1A 2V1MA 2QSIA 4IN0A 3GRXA 3KP8A 4Z7XA 1FB6A 2H30A 2H0IA 3QAGA 1SENA 2O8VB 2FNOA 3UBKA 1EP7A 4ACSA 2V6OA 3DMLA 3UVTA 5IMZA 4KGIA 1ZYNA 2R6KA 1GL8A 1GNWA 3IOSA 3VWUA 1YEXA 2LV3A 4EO3A 5EL8A 2LJAA 4MP4A 5GSTA 1GSEA 3CRUA 3WT1A 5EY6A 3HHVA 4MPFA 3F3RA 2HRFA 1AQWA 2XPEA 1E6BA 2FWGA 1V98A 3ERFA 1GSUA 2YJ7A 1TRVA 1HQOA 1SJ6A 2CX3A 3KH9A 3DEXA 4XHMA 1PN0A 4N11A 1SYRA 2JSYA 1SL1B 2CAIA 4WF5A 3KTLA 2C1YA 3DD3A 1PL2A 4OCEA 1XVWA 3F4TA 2GVPA 3HJPA 1GULA 2JZRA 3EU3A 3HCZA 4WEYA 2CVKA 2DJKA 1GSSA 4JU5A 4EIQA 3HVVA 3WD6A 3PINA 5HFIA 4TXOB 1ERTA 3IAM2 2PVQA 5DAKB 4RI7A 4F03A 1B9YC 2IFQB 4BA7A 2XBIA 1K0MA 1OC3A 4MF7A 2TRXA 5L71A 5JWOB 4NMUA 4ZILA 4PXOA 2GZPA 2I1UA 1WMJA 2PERA 1GRXA 2Z9SA 3L9VA 3U6VA 4F2IA 22GSA 3PPUA 3TJBA 1AQVA 4AJ7A 2DBCA 2FA8A 3UAPA 3FZ4A 1ABAA 1AXDA 3GSSA 4E8EA 4NPBA 1CQHA 3J7Yk 4ICYA 2H0HA 4N10A 1X5DA 1A2MA 2H72A 3M9KA 5CNWA 2NTOA 4I6XA 3KH7A 3UL3A 2H6XA 5HFKA 3N9JA 2R0GA 4O32A 2H01A 4ZBAA 1ZGNA 1X5EA 1X9SB 1DUGA 1ERUA 5CRWA 5E4WA 4TKYA 5ECLB 5ABRA 1TU8A 1K0AA 5DQSA 3H8QA 2YZHA 3IR4A 3KMOA 4KDUA 1SKRB 3IE3A 5KN3A 2ZCTA 1T1VA 2ALBA 3IC8A 2HYXA 5CREA 1WRYA 1HNBA 2L59A 5HQPA 3FEUA 1K0CA 2IMKA 5IMVA 4PUAA 3TRQA 3F63A 4HEA2 4WR4A 1MDIA 2IJYA 5DQYA 1DE1A 2L57A 4Z2TA 2P31A 4HU9A 5C00A 3GNJA 1V40A 5G5EA 3EPTA 4H86A 4V2LA 2B7JA 1R5AA 2CVBA 2YNXA 3W6GA 2C3QA 2CQ9A 2VLVA 4F9ZA 1BAYA 4ML1A 4USSA 3EURA 3C71A 2L6DA 2EIQA 2WDUA 2VIMA 5GSSA 2PU9C 1TW9A 2AJQB 3W8JA 3J7Yb 6GSWA 4JE1A 4J56E 7GSSA 1K0DA 1O8XA 3O6TA 1J0FA 1OC8A 4I2TA 1ZL9A 1O8WA 3E9JB 1ZYEA 1E2YA 3QMXA 2R0PA 5KN1A 3KCMA 1XWKA 2FY6A 4TXOA 2VD0A 1EV9A 5DAKA 5ELGA 2IFQA 3VI5A 1T4YA 5B6MA 3I43A 3ME7A 5HR1A 2M72A 2GTUA 2C80A 1WOUA 3O3TA 5BRTA 1DSBA 1GTIA 4BL7A 3HJMA 3A3TA 4MLYA 1H75A 3TCOA 3PGTA 1XWAA 3V1WA 3A2XA 1MEKA 5F05A 2YANA 2QKEA 2DJ3A 5F8BA 3GHAA 4K9ZA 4G9HA 2YOIA 3GX0A 4WF4A 3ERGA 2B6MA 3G9BA 3Q74A 3KD0A 3R2QA 1G6YA 1B4PA 2HSMA 2ON7A 1XCCA 1SK0A 3QPMA 3ZFLA 3EWLA 2PN8A 3VFIA 1MDJA 1TRSA 1GSFA 1QUWA 2E2MA 2G0FA 4HJ2A 2WGRA 1U88A 2DLXA 1M2AA 3FRCA 3NIVA 2LTKA 3IPZA 1JFUA 2HE3A 4YAPA 2WJUA 2IIYA 2P0GA 4IS0A 4X4JA 5AGYA 2OA7A 1T7PB 2WZ9A 5IPHA 2N5FA 4G2EA 5JWRB 1F6MC 1MDKA 1SJZA 1YDKA 1M2BA 1Y6EA 3F8UA 1XBSA 1T3BA 1Z3EA 1O73A 5IMCA 4OCFA 3GL3A 1G7EA 1XWBA 3VK9A 4L5LA 2DC5A 1GSDA 4RI6A 1GTBA 2LQQA 2RUEA 3CBUA 4XS4B 2RM6A 1DE2A 3TJFA 3TKQA 5GAPD 1TRUA 2WULA 5FT3A 2HI7A 1FVJA 2FD3A 3Q19A 4NAXA 5E59A 1BEDA 1JZOA 4IJIA 4OO5A 3D4TA 2PGTA 2EC4A 4NHZA 2A2SA 2L4QA 2GSTA 2VL9A 4O92A 2JZSA 2VL2A 2FUG2 4DEJA 1B9XC 4HUAA 5EVOA 1I5GA 2FCHA 1A8YA 6GSXA 4ZXGA 2YCDA 4L5OA 1IYIA 4G0LA 4K0GA 1F9MA 1B8XA 4ECCA 4KSMA 1EOHA 3ZL5A 3RBTA 3F4RA 3H1NA 3M0FA 5ECQB 3HA9A 2DSAA 5BMUA 4YKFA 2DJ0A 4GF0A 3FR3A 1JLVA 4XRAA 2OKAA 1SKSB 18GSA 1TRWA 4IP1A 4F0BA 4TR0A 3DKSA 1N8JA 3I69A 4TXVA 4YQUA 1VGLA 2YP6A 3CSIA 1XIYA 3MYDA 6GSSA 4K2DA 1OKTA 2H75A 2VCZA 1S3DA 3A2VA 2C3NA 4ILFA 4Z2UA 5G1LA 2ON5A 3MIXA 4KDXA 1M0UA 3APQA 4XCSA 3IK9A 3LJRA 3DIEA 5C04A 2J23A 2OE0A 2F8FA 3ZIJA 1B4QA 2FWHA 2AYTA 3ZFBA 3LEFA 5G31A 4LA1A 1EZKA 2PPTA 2NDOA 3KMNA 2O89A 2H74A 2H66A 2B5EA 2WB9A 1SL2B 5INYA 1EV4A 4K6XA 1AQXA 2X8GA 2AAWA 3P7XA 4RQXA 1Q4JA 4MZBA 1QMVA 4DSRA 3GH6A 1GNEA 3RDWA 4G0IA 3ED3A 6GSYA 1SD9A 1THOA 3FW2A 4POKA 3VWXA 4EF0A 3P90A 1V58A 3HVXA 1EEMA 1YKCA 1ZYQB 3HVSA 3H4KA 3L9SA 1FOHA 3IHQA 3LYKA 1U3IA 3TKSA 1R5PA 1M7TA 4XS4A 1K3LA 5IOXA 2YPMA 1UC7A 2OE3A 4KX4A 2NBSA 3LQ7A 1PA3A 4TRXA 3TDGA 1GTAA 3VURA 1ZCPA 4NV2A 3IDVA 1SD8A 2OBKA 3ZRDA 2OADA 1BX9A 1GWCA 2VM2A 1GUMA 1HNAA 1A0RP 2PBJA 4I97A 5DJMA 4ULXA 4Q5FA 3ZMLA 2EIOA 1NHOA 4K8MA 2GSQA 2VCXA 1VRSD 4XS1A 1A2JA 3GKNA 4GQCA 2K6VA 2IMDA 4K0NA 4MJCA 2GLRA 2DJ2A 4PURA 4POLA 2NVLA 2ZUPA 5B8BA 4K7IA 1UA5A 4YQMA 1X9WB 2DMMA 2HLSA 2QGVA 4IW9A 4EC0A 4BVYB 2JSZA 3C1SA 4IJ3A 4DVCA 3SWLA 1XW6A 3FZ5A 2M80A 3DVXA 1GTUA 2QC7A 4MJEA 1KBNA 4TVEA 4ECIA 1SYXA 1CQGA 3GKMA 1EEJA 2VL2C 2LJKA 4JZQA 1KTEA 1YF0A 4IGJA 5LCZA 3LXZA 3ZLPA 2ZNMA 1QFNA 4I2UA 3EU4A 4BL7B 4E8HA 3QAWA 2DJ1A 2R3XA 4AJ8A 1XPVA 4Z2RA 2L5LA 1QXHA 3D21A 2P5RA 1JLWA 2LSTA 1GUKA 5G5FA 2L5OA 4GSTA 4JR4A 2XBQA 4KE3A 5AN1A 5KEJA 1XW9A 3EINA 2VD1A 3L0HA 2DKIA 2RLIA 4CHSA 2OBIA 4IELA 2VLUA 4LMWA 4IVFA 3L78A 4WBJA 4MMMA 3VI7A 1TU7A 1PRXA 4L0WA 2DIYA 3O76A 5ECPB 1PMTA 1XOBA 4EKZA 4MABA 2WRTA 2X49A 3L4NA 2AB6A 2TRCP 3UARA 1WPIA 5F0GA 3KXOA 2XPDA 3FYGA 4OO4A 5D93A 3GKKA 2MMOA 1VF1A 2LEGA 1C72A 3F6DA 2I81A 2C0GA 2VOCA 4JEDA 3F0IA 4MA9A 1ZMAA 2H70A 3GL5A 4HOJA 3TRXA 1K0NA 2LNSA 3FY7A 5JWQB 3IK7A 1YF1A 4IKHA 4OFTA 5HR3A 2LKUA 2DIZA 5ECOB 3KEBA 1RK4A 3ISOA 3RPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QR6 A;  2V32 A;  4ZL8 A;  3GTU A;  3UEM A;  1A8L A;  2REM A;  2F8A A;  4D73 B;  2FWF A;  3CRT A;  4PGT A;  4ZB6 A;  1A23 A;  2LUS A;  5B7C A;  3FK8 A;  3TKS C;  2IN3 A;  1ON4 A;  19GS A;  3TOU A;  17GS A;  2H6Y A;  1VF3 A;  4NHW A;  5EPF A;  2YWM A;  4G10 A;  4ISD A;  3FKF A;  4DSQ A;  1Y25 A;  3GV1 A;  2X64 A;  2B1K A;  4BVY A;  2YZU A;  3G7J A;  1TK0 B;  2HT9 A;  2JL4 A;  4ECB A;  2KP2 A;  1PKW A;  4GQF A;  1OKD A;  2H1A A;  3QOU A;  5B6N A;  2E7P A;  2KUC A;  1T8E B;  1GSQ A;  1XWG A;  5IMF A;  1KNG A;  3UOM A;  4KAE A;  3FR6 A;  5IO2 A;  1XWC A;  4K1F A;  5DBQ A;  2YWO A;  6GST A;  3L9U A;  3HZ8 A;  4Q5R A;  1Z7P A;  1SL0 B;  4OFN A;  3G7I A;  1FVK A;  5IOW A;  4TR1 B;  4TN8 A;  2X99 A;  5F07 A;  4F82 A;  2OJL A;  3MNG A;  3GUS A;  5ECH B;  3FZA A;  4GSS A;  1R7H A;  4IBP A;  3BCK A;  5JCU A;  1FG4 A;  1FAA A;  4HI7 A;  1XXU A;  4IQA A;  1V2A A;  1BQ7 A;  2CX4 A;  2LRN A;  1NHY A;  1OE8 A;  4N0V A;  4AGS A;  4KSO A;  4XIH A;  2IME A;  2PVO C;  2E2G A;  4HJM A;  4I8B A;  4MCU A;  4ID0 A;  4KCA A;  5J4U A;  4G19 A;  1K3Y A;  1PX7 A;  3CTG A;  1ST9 A;  4POB A;  3FZ9 A;  2HSH A;  3EC3 A;  4KA0 A;  6GSU A;  1PN9 A;  3CXG A;  2B7K A;  3TJJ A;  2MMA A;  1QK8 A;  4PQI A;  4PQH A;  1GSY A;  3ZIT A;  1EGO A;  3TUE A;  2PUK C;  1LBK A;  5CRD A;  3HY2 A;  1FOV A;  1M9A A;  3UBL A;  3IA1 A;  4MZW A;  4YH2 A;  3S9F A;  1A2L A;  2P5Q A;  2G2Q A;  2EIR A;  3TJK A;  2FHE A;  2K8S A;  3W8S A;  4D73 A;  4K7N A;  2V6K A;  3E0U A;  2FLS A;  4GWR A;  2D2Z A;  4J57 E;  3TGZ A;  1YJ6 A;  4V1A p;  2YJH A;  2IPA A;  1W4V A;  5ENU A;  3SBC A;  1QGV A;  3NZN A;  5AIX A;  4N0Z A;  2XC2 A;  3ZZX A;  5H5Q A;  4HQZ A;  5D9X A;  4ZL9 A;  2C0F A;  3KGK A;  1OVN A;  2HXK A;  3IXR A;  3DYR A;  4MH3 A;  5ECN B;  4XTS A;  2OE1 A;  4V1A g;  2HFD A;  2PMT A;  3TRP A;  1FHE A;  1XVQ A;  1XOA A;  3TKP A;  2H73 A;  4MF6 A;  4TW5 A;  4NXI A;  5A4W A;  1M2D A;  2X8H A;  2N5A A;  4LL4 B;  5ID2 B;  5CAX A;  2R5G A;  1OYJ A;  2GGT A;  2B1L A;  1SK2 A;  5LD0 A;  3LYP A;  3F9U A;  4MJA A;  4OFM A;  2H8L A;  4Q5N A;  1U3A A;  5J3R A;  2VM1 A;  3KIJ A;  2LRC A;  5DCH A;  1TI1 A;  6GSV A;  3H93 A;  5G30 A;  2O7K A;  5LNK e;  3WGX A;  1JZD A;  5AIS A;  1LU4 A;  4TR1 A;  5D9V A;  5ECM B;  3FHK A;  3E3E A;  2JAD A;  3FR9 A;  4ZB9 A;  4EUY A;  1GLQ A;  1AUC A;  1USB A;  4IQ1 A;  3BD2 A;  3ERW A;  4HZ2 A;  3EVI A;  3C8E A;  1HD2 A;  4QQ7 A;  5CRH A;  1OAZ A;  1B48 A;  4GCI A;  2LJR A;  3C73 A;  1THX A;  4EDZ A;  3MWH A;  2VL3 A;  5JCW A;  3RHB A;  3BJ5 A;  3RHC A;  1BJX A;  1J9B A;  3D4M A;  4ECJ A;  4O5R A;  1J08 A;  5D73 A;  4MK3 A;  3BOA A;  3LWA A;  4FYU A;  1K0B A;  2HNL A;  3ME8 A;  3DVW A;  5D8I A;  3LXT A;  4L0U A;  5H5R A;  3VWW A;  1SKW B;  1PD2 1;  4POM A;  3NOF A;  1XW5 A;  3APO A;  1ERW A;  4KND A;  1U87 A;  1X0R A;  1K3O A;  2J9H A;  4X1U A;  5DAL B;  4XS6 A;  4QL9 A;  2AHE A;  4HS1 A;  2JAC A;  4NWY A;  4DSS A;  3H79 A;  2CAQ A;  1ERV A;  5HFG A;  5IPG A;  4J2F A;  4TR3 A;  3WT2 A;  3DGQ A;  1G7O A;  2H0G A;  2RII A;  3VWV A;  2M46 A;  4HU7 A;  5H5S A;  2X8C A;  3IV4 A;  3IRA A;  2MMZ A;  2IL3 A;  2WCI A;  2F3M A;  3EYT A;  4EXJ A;  4FO5 A;  4EVM A;  3TB2 A;  4GSN A;  2B5X A;  3GTU B;  4FYC A;  3LSZ A;  3DWV A;  3KZQ A;  1T4Z A;  1Z6N A;  1PKZ A;  5ID2 A;  2VCW A;  3TKR A;  3HDC A;  5J9B A;  1G6W A;  3GN3 A;  2F9S A;  5FWG A;  2C0D A;  2H1B A;  1XFL A;  3UVH A;  5KN0 A;  5IQY A;  2HSY A;  5DDL A;  4P3Y B;  1YY7 A;  2VAF A;  2IMF A;  2A2R A;  4KDY A;  3M3M A;  2GT6 A;  3DRN A;  4PX1 A;  2BTO T;  1NSW A;  3Q18 A;  2CZ2 A;  1Z7R A;  3EE2 A;  4XRD A;  5ECS A;  4MH2 A;  3ZMK A;  3GYK A;  4TR4 A;  1WIK A;  3GX8 A;  2CZ3 A;  2E0Q A;  1LJR A;  2HZF A;  2O85 A;  4K7O A;  1VF4 A;  5GAN D;  5HR0 A;  1FO5 A;  1WP0 A;  3C7M A;  3WYW A;  4IHU A;  3OR5 A;  3GIX A;  3Q6O A;  4X43 A;  3AY8 A;  2YN1 A;  2GQK A;  1F2E A;  4GLT A;  3PR8 A;  2H1D A;  4BVX A;  2YWI A;  3F4S A;  3RAZ A;  3JCM L;  1V57 A;  2WS2 A;  1HYU A;  1ZOF A;  2OAC A;  3VLN A;  3F3Q A;  3ZVJ D;  1F3A A;  2N5B A;  1X5C A;  1NM3 A;  2GSR A;  3APS A;  5DAL A;  3EMP A;  3HKR A;  3DXB A;  3M9J A;  1SJI A;  5IMA A;  3C1R A;  1PX6 A;  5IM9 A;  1TP9 A;  4EE0 A;  4V2N A;  2HRN A;  2K8V A;  1OE7 A;  4JRR A;  2GZZ A;  4AF2 A;  4GXZ A;  2H1G A;  5J5N A;  1VF2 A;  2B5Y A;  16GS A;  5CYY A;  1ACV A;  4RQR A;  4PUF C;  4LLR A;  4HDE A;  2YV9 A;  4ZBB A;  4HZ4 A;  1MD4 A;  1JZR A;  1BYE A;  1TDI A;  3KTB A;  4AJ6 A;  4L8E A;  2H71 A;  1U6T A;  2JZT A;  4QL7 A;  4WET A;  2I4A A;  4KH7 A;  3EMX A;  1ML6 A;  2PWJ A;  5D96 A;  1R26 A;  5B8A A;  5D9T A;  3QFB C;  3P2A A;  3GUR A;  4BWQ A;  3VPT A;  3QDN A;  3KM6 A;  1S3C A;  3TKS E;  1WJK A;  4PNG A;  1URM A;  2HZE B;  1A24 A;  3A2W A;  3UMA A;  2C3T A;  2GQM A;  2GS3 A;  1AW9 A;  2KLX A;  2L6C A;  4F0C A;  1TOF A;  2MBT A;  4MF5 A;  1Z5Y E;  1R4W A;  2BMX A;  5A5K A;  1N2A A;  1SU9 A;  13GS A;  2FGX A;  3ZTL A;  3GH9 A;  5CP1 A;  1PL1 A;  2VO4 A;  2K9F A;  2A4V A;  1S3A A;  4WKW A;  1RQM A;  1K0O A;  3VPQ A;  3HJO A;  5KN2 A;  1AAZ A;  3UJ1 A;  3D5J A;  4PNF A;  2R2J A;  1O85 A;  4TOP A;  3P8W A;  4YAV A;  1EGR A;  3CSH A;  1EOG A;  1TI3 A;  4WR5 A;  2F51 A;  5COH A;  4LL1 B;  1G0T A;  3HD5 A;  1Z9H A;  2O87 A;  1FW1 A;  1O6J A;  3PH9 A;  3UIW A;  5IO0 A;  8GSS A;  1T00 A;  1O7U A;  1WE0 A;  1UN2 A;  2FA4 A;  3CMI A;  4FH8 A;  2TIR A;  5JCG A;  3GFK A;  3ZYW A;  1H4O A;  4GTU A;  4BPY A;  5ECR B;  3MDK A;  1O81 A;  4GRF A;  11GS A;  2KOK A;  2KP1 A;  2AUV A;  1ILO A;  1YQ1 A;  3GKX A;  1GUH A;  2L4C A;  4OD7 A;  4NV5 A;  1TK5 B;  2CVD A;  5IMD A;  4IP6 A;  2VCQ A;  4MJB A;  1MD3 A;  4ZBD A;  1Z6M A;  2GZY A;  4FYB A;  4KW6 A;  4ZIJ A;  1PQN A;  1OC9 B;  2YWN A;  5DJL A;  5G1K A;  1YEP A;  2RM5 A;  3D6I A;  3CSJ A;  12GS A;  3QFA C;  3ZRE A;  4EL1 A;  4X0X A;  2V41 A;  5ECK B;  5ECI B;  2VUP A;  4CW9 A;  2XHF A;  2RUF A;  2IWT A;  2LS5 A;  4JBB A;  3LOR A;  2H6Z A;  1F37 A;  5DCG A;  1QQ2 A;  1GLP A;  3F6F A;  1AIU A;  1M99 A;  3GST A;  5G2Z A;  4O7H A;  4ZL7 A;  2MBS A;  1GP1 A;  2WFC A;  4FIW A;  4DSS B;  1V9W A;  3LFL A;  4N30 A;  5A4U A;  3HXS A;  3RPN A;  4WXT A;  1YKA A;  3A5W A;  4MPG A;  2DML A;  3K8N A;  1EP8 A;  3M1G A;  2IMI A;  2MMN A;  2H19 A;  3ZIV A;  1EWX A;  2HZE A;  3QCP A;  5DVB A;  3TOT A;  3N5O A;  3MAK A;  4RUV A;  3WGE A;  5FHI A;  3ZVJ A;  4CDO A;  2VCV A;  4EDY A;  2K18 A;  3I6A A;  20GS A;  4YQV A;  3BBY A;  1XZO A;  4Q5Q A;  1PSQ A;  2FWE A;  2GQL A;  5AIV A;  1WWJ A;  5J9C A;  2H76 A;  1PGT A;  1BG5 A;  2GSS A;  2KHP A;  5J41 A;  5CO3 A;  3M8N A;  3TJG A;  2ES7 A;  1TTZ A;  3QD9 A;  4MDC A;  4LMV A;  1YZX A;  5CRG A;  2NPB A;  3IBH A;  1MTC A;  1TK8 B;  1TKD B;  3CYN A;  2B3S A;  1AC1 A;  5ELA A;  3D0Z A;  14GS A;  4JR6 A;  2DJJ A;  4I5Q A;  2BJX A;  3HYP A;  1IYH A;  1FB0 A;  3KP9 A;  4HQS A;  1X9M B;  3GA4 A;  2R4V A;  1ZZY A;  1DBY A;  5A4V A;  2CT6 A;  3D22 A;  1M9B A;  3BCI A;  2GDR A;  1TJD A;  2MZC A;  3GMF A;  4MZC A;  1Q98 A;  2I9H A;  2YV7 A;  1UVZ A;  3IAS 2;  1OC9 A;  2I3Y A;  3HZ4 A;  2C4J A;  1GH2 A;  4KB3 A;  5GZZ B;  2VLT A;  3QAV A;  2LRT A;  4OWY A;  1HNC A;  3IC4 A;  2AV4 A;  4KUN A;  2V2G A;  4V2M A;  2CV4 A;  1A0F A;  2MYG A;  5HR2 A;  1NW2 A;  1F3B A;  2LQO A;  3CTF A;  2GT5 A;  3LGC A;  3G7Y A;  4PQ1 A;  1TXX A;  3KJY A;  2LNT A;  4KCE A;  10GS A;  5IIZ A;  5F06 A;  3WGD A;  1JZW A;  1W89 A;  5D9W A;  3U5R E;  3I9V 2;  4ZB8 A;  3MSZ A;  4BWS A;  2JU5 A;  2C8U A;  2C0E A;  4OMV A;  9GSS A;  3LG6 A;  4ML6 A;  2VCT A;  4WBR D;  1KEB A;  3US3 A;  1SK1 A;  1JHB A;  1I9D A;  2CA8 A;  2R37 A;  1RW1 A;  2V1M A;  2QSI A;  4IN0 A;  3GRX A;  3KP8 A;  4Z7X A;  1FB6 A;  2H30 A;  2H0I A;  3QAG A;  1SEN A;  2O8V B;  2FNO A;  3UBK A;  1EP7 A;  4ACS A;  2V6O A;  3DML A;  3UVT A;  5IMZ A;  4KGI A;  2R6K A;  1GL8 A;  1GNW A;  3IOS A;  3VWU A;  1YEX A;  2LV3 A;  4EO3 A;  5EL8 A;  2LJA A;  4MP4 A;  5GST A;  1GSE A;  3CRU A;  3WT1 A;  5EY6 A;  3HHV A;  4MPF A;  3F3R A;  2HRF A;  1AQW A;  2XPE A;  1E6B A;  2FWG A;  1V98 A;  3ERF A;  1GSU A;  2YJ7 A;  1TRV A;  1HQO A;  1SJ6 A;  2CX3 A;  3KH9 A;  3DEX A;  4XHM A;  4N11 A;  1SYR A;  2JSY A;  1SL1 B;  2CAI A;  4WF5 A;  3KTL A;  2C1Y A;  3DD3 A;  1PL2 A;  4OCE A;  1XVW A;  3F4T A;  2GVP A;  3HJP A;  1GUL A;  2JZR A;  3EU3 A;  3HCZ A;  4WEY A;  2CVK A;  2DJK A;  1GSS A;  4JU5 A;  3HVV A;  3WD6 A;  3PIN A;  5HFI A;  4TXO B;  1ERT A;  3IAM 2;  2PVQ A;  5DAK B;  4RI7 A;  4F03 A;  1B9Y C;  2IFQ B;  4BA7 A;  2XBI A;  1K0M A;  1OC3 A;  4MF7 A;  2TRX A;  5L71 A;  5JWO B;  4NMU A;  4ZIL A;  4PXO A;  2GZP A;  2I1U A;  1WMJ A;  2PER A;  1GRX A;  2Z9S A;  3L9V A;  3U6V A;  4F2I A;  22GS A;  3TJB A;  1AQV A;  4AJ7 A;  2DBC A;  2FA8 A;  3UAP A;  3FZ4 A;  1ABA A;  1AXD A;  3GSS A;  4E8E A;  4NPB A;  1CQH A;  3J7Y k;  2H0H A;  4N10 A;  1X5D A;  1A2M A;  2H72 A;  3M9K A;  5CNW A;  2NTO A;  4I6X A;  3KH7 A;  3UL3 A;  2H6X A;  5HFK A;  3N9J A;  4O32 A;  2H01 A;  4ZBA A;  1ZGN A;  1X5E A;  1X9S B;  1DUG A;  1ERU A;  5CRW A;  5E4W A;  4TKY A;  5ECL B;  5ABR A;  1TU8 A;  1K0A A;  5DQS A;  3H8Q A;  2YZH A;  3IR4 A;  3KMO A;  4KDU A;  1SKR B;  3IE3 A;  5KN3 A;  2ZCT A;  1T1V A;  2ALB A;  2HYX A;  5CRE A;  1WRY A;  1HNB A;  2L59 A;  5HQP A;  3FEU A;  1K0C A;  2IMK A;  5IMV A;  4PUA A;  3TRQ A;  3F63 A;  4HEA 2;  4WR4 A;  1MDI A;  2IJY A;  5DQY A;  1DE1 A;  2L57 A;  2P31 A;  4HU9 A;  5C00 A;  3GNJ A;  1V40 A;  5G5E A;  4H86 A;  4V2L A;  2B7J A;  1R5A A;  2CVB A;  2YNX A;  3W6G A;  2C3Q A;  2CQ9 A;  2VLV A;  4F9Z A;  1BAY A;  4ML1 A;  3EUR A;  3C71 A;  2L6D A;  2EIQ A;  2WDU A;  2VIM A;  5GSS A;  2PU9 C;  1TW9 A;  2AJQ B;  3W8J A;  3J7Y b;  6GSW A;  4JE1 A;  4J56 E;  7GSS A;  1K0D A;  1O8X A;  3O6T A;  1J0F A;  1OC8 A;  4I2T A;  1ZL9 A;  1O8W A;  3E9J B;  1ZYE A;  1E2Y A;  3QMX A;  5KN1 A;  3KCM A;  1XWK A;  2FY6 A;  4TXO A;  2VD0 A;  1EV9 A;  5DAK A;  5ELG A;  2IFQ A;  3VI5 A;  1T4Y A;  5B6M A;  3I43 A;  3ME7 A;  5HR1 A;  2M72 A;  2GTU A;  2C80 A;  1WOU A;  3O3T A;  1DSB A;  1GTI A;  4BL7 A;  3HJM A;  3A3T A;  4MLY A;  1H75 A;  3TCO A;  3PGT A;  1XWA A;  3V1W A;  3A2X A;  1MEK A;  5F05 A;  2YAN A;  2QKE A;  2DJ3 A;  5F8B A;  3GHA A;  4K9Z A;  4G9H A;  2YOI A;  3GX0 A;  4WF4 A;  3ERG A;  2B6M A;  3G9B A;  3Q74 A;  3KD0 A;  3R2Q A;  1G6Y A;  1B4P A;  2ON7 A;  1XCC A;  1SK0 A;  3QPM A;  3ZFL A;  3EWL A;  2PN8 A;  3VFI A;  1MDJ A;  1TRS A;  1GSF A;  1QUW A;  2E2M A;  2G0F A;  4HJ2 A;  2WGR A;  1U88 A;  2DLX A;  1M2A A;  3FRC A;  3NIV A;  2LTK A;  3IPZ A;  1JFU A;  2HE3 A;  4YAP A;  2WJU A;  2IIY A;  2P0G A;  4IS0 A;  5AGY A;  2OA7 A;  1T7P B;  2WZ9 A;  5IPH A;  2N5F A;  4G2E A;  5JWR B;  1F6M C;  1MDK A;  1SJZ A;  1YDK A;  1M2B A;  1Y6E A;  3F8U A;  1XBS A;  1T3B A;  1Z3E A;  1O73 A;  5IMC A;  4OCF A;  3GL3 A;  1G7E A;  1XWB A;  3VK9 A;  4L5L A;  2DC5 A;  1GSD A;  4RI6 A;  1GTB A;  2LQQ A;  2RUE A;  3CBU A;  4XS4 B;  2RM6 A;  1DE2 A;  3TJF A;  3TKQ A;  5GAP D;  1TRU A;  2WUL A;  5FT3 A;  2HI7 A;  1FVJ A;  2FD3 A;  3Q19 A;  4NAX A;  5E59 A;  1BED A;  1JZO A;  4IJI A;  4OO5 A;  3D4T A;  2PGT A;  2EC4 A;  4NHZ A;  2A2S A;  2L4Q A;  2GST A;  2VL9 A;  4O92 A;  2JZS A;  2VL2 A;  2FUG 2;  4DEJ A;  1B9X C;  4HUA A;  5EVO A;  1I5G A;  2FCH A;  1A8Y A;  6GSX A;  4ZXG A;  2YCD A;  4L5O A;  1IYI A;  4K0G A;  1F9M A;  1B8X A;  4ECC A;  4KSM A;  1EOH A;  3ZL5 A;  3RBT A;  3F4R A;  3H1N A;  3M0F A;  5ECQ B;  3HA9 A;  2DSA A;  2DJ0 A;  4GF0 A;  3FR3 A;  1JLV A;  4XRA A;  2OKA A;  1SKS B;  18GS A;  1TRW A;  4IP1 A;  4F0B A;  4TR0 A;  3DKS A;  1N8J A;  3I69 A;  4TXV A;  4YQU A;  1VGL A;  2YP6 A;  3CSI A;  1XIY A;  6GSS A;  4K2D A;  1OKT A;  2H75 A;  2VCZ A;  1S3D A;  3A2V A;  2C3N A;  4ILF A;  5G1L A;  2ON5 A;  4KDX A;  1M0U A;  3APQ A;  4XCS A;  3IK9 A;  3LJR A;  3DIE A;  5C04 A;  2J23 A;  2OE0 A;  2F8F A;  3ZIJ A;  1B4Q A;  2FWH A;  2AYT A;  3ZFB A;  3LEF A;  5G31 A;  4LA1 A;  1EZK A;  2PPT A;  2NDO A;  3KMN A;  2O89 A;  2H74 A;  2H66 A;  2B5E A;  2WB9 A;  1SL2 B;  5INY A;  1EV4 A;  4K6X A;  1AQX A;  2X8G A;  2AAW A;  3P7X A;  4RQX A;  1Q4J A;  4MZB A;  1QMV A;  4DSR A;  3GH6 A;  1GNE A;  3RDW A;  3ED3 A;  6GSY A;  1SD9 A;  1THO A;  3FW2 A;  4POK A;  3VWX A;  4EF0 A;  3P90 A;  1V58 A;  3HVX A;  1EEM A;  1YKC A;  1ZYQ B;  3HVS A;  3H4K A;  3L9S A;  3IHQ A;  3LYK A;  1U3I A;  3TKS A;  1R5P A;  1M7T A;  4XS4 A;  1K3L A;  5IOX A;  2YPM A;  1UC7 A;  2OE3 A;  4KX4 A;  2NBS A;  3LQ7 A;  1PA3 A;  4TRX A;  3TDG A;  1GTA A;  3VUR A;  1ZCP A;  4NV2 A;  3IDV A;  1SD8 A;  2OBK A;  3ZRD A;  2OAD A;  1BX9 A;  1GWC A;  2VM2 A;  1GUM A;  1HNA A;  1A0R P;  2PBJ A;  4I97 A;  5DJM A;  4ULX A;  4Q5F A;  3ZML A;  2EIO A;  1NHO A;  4K8M A;  2GSQ A;  2VCX A;  1VRS D;  4XS1 A;  1A2J A;  3GKN A;  4GQC A;  2K6V A;  2IMD A;  4K0N A;  4MJC A;  2GLR A;  2DJ2 A;  4PUR A;  4POL A;  2NVL A;  2ZUP A;  5B8B A;  4K7I A;  1UA5 A;  4YQM A;  1X9W B;  2DMM A;  2HLS A;  2QGV A;  4IW9 A;  4EC0 A;  2JSZ A;  3C1S A;  4IJ3 A;  4DVC A;  3SWL A;  1XW6 A;  3FZ5 A;  2M80 A;  3DVX A;  1GTU A;  2QC7 A;  4MJE A;  1KBN A;  4TVE A;  4ECI A;  1SYX A;  1CQG A;  3GKM A;  1EEJ A;  2VL2 C;  2LJK A;  4JZQ A;  1KTE A;  1YF0 A;  4IGJ A;  5LCZ A;  3LXZ A;  3ZLP A;  2ZNM A;  1QFN A;  4I2U A;  3EU4 A;  4E8H A;  3QAW A;  2DJ1 A;  2R3X A;  4AJ8 A;  1XPV A;  2L5L A;  1QXH A;  3D21 A;  2P5R A;  1JLW A;  2LST A;  1GUK A;  5G5F A;  2L5O A;  4GST A;  4JR4 A;  2XBQ A;  4KE3 A;  5AN1 A;  5KEJ A;  1XW9 A;  3EIN A;  2VD1 A;  3L0H A;  2RLI A;  4CHS A;  2OBI A;  4IEL A;  2VLU A;  4LMW A;  4IVF A;  3L78 A;  4WBJ A;  4MMM A;  3VI7 A;  1TU7 A;  1PRX A;  4L0W A;  2DIY A;  3O76 A;  5ECP B;  1PMT A;  1XOB A;  4EKZ A;  4MAB A;  2WRT A;  3L4N A;  2AB6 A;  2TRC P;  3UAR A;  1WPI A;  5F0G A;  5D93 A;  3KXO A;  2XPD A;  3FYG A;  4OO4 A;  3GKK A;  2MMO A;  1VF1 A;  2LEG A;  1C72 A;  3F6D A;  2I81 A;  2C0G A;  2VOC A;  4JED A;  3F0I A;  4MA9 A;  1ZMA A;  2H70 A;  3GL5 A;  4HOJ A;  3TRX A;  1K0N A;  2LNS A;  3FY7 A;  5JWQ B;  3IK7 A;  1YF1 A;  4IKH A;  4OFT A;  5HR3 A;  2LKU A;  2DIZ A;  5ECO B;  3KEB A;  1RK4 A;  3ISO A;  3RPP A; 
#chains in the Genus database with same CATH topology
 3QR6 A;  2V32 A;  4ZL8 A;  3GTU A;  3UEM A;  4MNN A;  1A8L A;  2REM A;  2F8A A;  4D73 B;  2FWF A;  3CRT A;  4PGT A;  4ZB6 A;  1A23 A;  4KF9 A;  2LUS A;  5B7C A;  3FK8 A;  3TKS C;  2IN3 A;  1ON4 A;  19GS A;  3TOU A;  17GS A;  2H6Y A;  1VF3 A;  4NHW A;  5EPF A;  2YWM A;  4G10 A;  4ISD A;  3FKF A;  4DSQ A;  1Y25 A;  3GV1 A;  2X64 A;  2B1K A;  4BVY A;  4K2X A;  2YZU A;  3G7J A;  3IHG A;  1TK0 B;  2HT9 A;  2JL4 A;  4ECB A;  2KP2 A;  1PKW A;  4GQF A;  1OKD A;  2H1A A;  3QOU A;  5B6N A;  2E7P A;  2KUC A;  1T8E B;  1GSQ A;  1XWG A;  5IMF A;  1KNG A;  3UOM A;  4KAE A;  3FR6 A;  5IO2 A;  1XWC A;  4K1F A;  5DBQ A;  2YWO A;  6GST A;  3L9U A;  3HZ8 A;  4Q5R A;  4K5R A;  1Z7P A;  1SL0 B;  4OFN A;  3G7I A;  1FVK A;  5IOW A;  4TR1 B;  4TN8 A;  2X99 A;  2R0C A;  5F07 A;  4F82 A;  2OJL A;  3MNG A;  3GUS A;  5ECH B;  3FZA A;  4GSS A;  1R7H A;  4IBP A;  3BCK A;  5JCU A;  1FG4 A;  1FAA A;  4HI7 A;  1XXU A;  4IQA A;  1V2A A;  1BQ7 A;  2CX4 A;  2LRN A;  1NHY A;  1OE8 A;  4N0V A;  4AGS A;  4KSO A;  4XIH A;  2X4A A;  2IME A;  2PVO C;  2E2G A;  4HJM A;  4I8B A;  4MCU A;  4ID0 A;  4KCA A;  5J4U A;  4G19 A;  1K3Y A;  1PX7 A;  3CTG A;  1ST9 A;  4POB A;  3FZ9 A;  2HSH A;  3EC3 A;  4KA0 A;  6GSU A;  1PN9 A;  3CXG A;  2B7K A;  3TJJ A;  2MMA A;  1QK8 A;  4PQI A;  4PQH A;  1GSY A;  4HSC X;  3ZIT A;  3TUE A;  1EGO A;  2PUK C;  1LBK A;  5CRD A;  3HY2 A;  1FOV A;  1M9A A;  3UBL A;  3IA1 A;  4MZW A;  4YH2 A;  3S9F A;  1A2L A;  2P5Q A;  2G2Q A;  2EIR A;  3TJK A;  2FHE A;  2K8S A;  3W8S A;  4D73 A;  4PTS A;  4K7N A;  2V6K A;  3E0U A;  2FLS A;  4GWR A;  2D2Z A;  4J57 E;  3TGZ A;  1YJ6 A;  4V1A p;  2YJH A;  2IPA A;  1W4V A;  5ENU A;  3SBC A;  1QGV A;  3NZN A;  5AIX A;  4N0Z A;  2XC2 A;  4G0K A;  3ZZX A;  5H5Q A;  4HQZ A;  5D9X A;  4ZL9 A;  2C0F A;  3KGK A;  1OVN A;  2HXK A;  3IXR A;  3DYR A;  4MH3 A;  5ECN B;  4XTS A;  2OE1 A;  4V1A g;  2HFD A;  2PMT A;  3TRP A;  1FHE A;  1XVQ A;  1XOA A;  3TKP A;  2H73 A;  4MF6 A;  4TW5 A;  4NXI A;  5A4W A;  1M2D A;  2X8H A;  2N5A A;  4LL4 B;  5ID2 B;  2HRA A;  5CAX A;  2R5G A;  1OYJ A;  2GGT A;  2B1L A;  1SK2 A;  5LD0 A;  3LYP A;  3F9U A;  4MJA A;  4OFM A;  2H8L A;  4Q5N A;  1U3A A;  5J3R A;  2VM1 A;  3KIJ A;  2LRC A;  5DCH A;  1TI1 A;  6GSV A;  3H93 A;  4FQU A;  5G30 A;  2O7K A;  5LNK e;  3WGX A;  1JZD A;  5AIS A;  1LU4 A;  4TR1 A;  5D9V A;  5ECM B;  3FHK A;  3E3E A;  2JAD A;  3FR9 A;  4ZB9 A;  4EUY A;  1GLQ A;  1AUC A;  1USB A;  4IQ1 A;  3BD2 A;  3ERW A;  4HZ2 A;  3EVI A;  3C8E A;  1HD2 A;  4QQ7 A;  5CRH A;  1OAZ A;  1B48 A;  4GCI A;  2LJR A;  3C73 A;  1THX A;  4EDZ A;  3MWH A;  2VL3 A;  5JCW A;  3RHB A;  3BJ5 A;  3RHC A;  1BJX A;  2A2P A;  1J9B A;  3D4M A;  4ECJ A;  4O5R A;  1J08 A;  5D73 A;  4MK3 A;  3BOA A;  3LWA A;  2A4H A;  4FYU A;  4EIP A;  1K0B A;  2HNL A;  3ME8 A;  3DVW A;  5D8I A;  3LXT A;  4L0U A;  5H5R A;  3VWW A;  1SKW B;  1PD2 1;  4POM A;  4BVX B;  3NOF A;  1XW5 A;  3APO A;  1ERW A;  4KND A;  1U87 A;  1X0R A;  1K3O A;  2J9H A;  4X1U A;  5DAL B;  4XS6 A;  4QL9 A;  2AHE A;  2HRK A;  4HS1 A;  2JAC A;  4NWY A;  4DSS A;  3H79 A;  2CAQ A;  1ERV A;  5HFG A;  5IPG A;  4J2F A;  4TR3 A;  3WT2 A;  3DGQ A;  1G7O A;  2H0G A;  2RII A;  4O5Q A;  3VWV A;  2M46 A;  4HU7 A;  5H5S A;  2X8C A;  3IV4 A;  3IRA A;  2MMZ A;  2IL3 A;  2WCI A;  2F3M A;  3EYT A;  4EXJ A;  4FO5 A;  4EVM A;  3TB2 A;  4GSN A;  2B5X A;  3GTU B;  4FYC A;  3LSZ A;  3DWV A;  3KZQ A;  1T4Z A;  1Z6N A;  1PKZ A;  5ID2 A;  2VCW A;  3TKR A;  3HDC A;  5J9B A;  1G6W A;  3GN3 A;  2F9S A;  5FWG A;  2C0D A;  2H1B A;  1XFL A;  3UVH A;  5KN0 A;  5IQY A;  2HSY A;  5DDL A;  4P3Y B;  1YY7 A;  2VAF A;  2IMF A;  2A2R A;  4KDY A;  3M3M A;  2GT6 A;  4CY6 A;  3DRN A;  4PX1 A;  2BTO T;  1NSW A;  3Q18 A;  2CZ2 A;  1Z7R A;  3EE2 A;  4XRD A;  5ECS A;  4MH2 A;  3ZMK A;  3GYK A;  4TR4 A;  1WIK A;  3GX8 A;  2CZ3 A;  2E0Q A;  1LJR A;  2HZF A;  2O85 A;  4K7O A;  1VF4 A;  5GAN D;  5HR0 A;  1FO5 A;  1WP0 A;  3C7M A;  3WYW A;  4IHU A;  3OR5 A;  3GIX A;  3Q6O A;  4X43 A;  3AY8 A;  2YN1 A;  2GQK A;  1F2E A;  4GLT A;  3PR8 A;  2H1D A;  4BVX A;  2YWI A;  3F4S A;  3RAZ A;  3JCM L;  1V57 A;  2WS2 A;  1HYU A;  1ZOF A;  2OAC A;  3VLN A;  3F3Q A;  3ZVJ D;  1F3A A;  1M3J A;  2N5B A;  1X5C A;  1NM3 A;  2GSR A;  3APS A;  5DAL A;  3EMP A;  3HKR A;  3DXB A;  3M9J A;  1SJI A;  5IMA A;  3C1R A;  1PX6 A;  5IM9 A;  1TP9 A;  4EE0 A;  4V2N A;  2HRN A;  2K8V A;  1OE7 A;  4JRR A;  2GZZ A;  4AF2 A;  4GXZ A;  2H1G A;  5J5N A;  1VF2 A;  2B5Y A;  16GS A;  5CYY A;  1ACV A;  4RQR A;  4PUF C;  4LLR A;  4HDE A;  2YV9 A;  4ZBB A;  4HZ4 A;  1MD4 A;  1JZR A;  1BYE A;  1TDI A;  3KTB A;  4AJ6 A;  4L8E A;  2H71 A;  1U6T A;  2JZT A;  4QL7 A;  4WET A;  2I4A A;  3CQF A;  3EMX A;  4KH7 A;  1ML6 A;  2PWJ A;  4A5P A;  5D96 A;  1R26 A;  5B8A A;  5D9T A;  3QFB C;  3P2A A;  3GUR A;  4BWQ A;  3VPT A;  3QDN A;  3KM6 A;  1S3C A;  3R3E A;  3TKS E;  1WJK A;  2QA1 A;  4PNG A;  1URM A;  2HZE B;  1A24 A;  3A2W A;  3UMA A;  2C3T A;  2GQM A;  2GS3 A;  1AW9 A;  2KLX A;  2L6C A;  4F0C A;  1TOF A;  2MBT A;  4MF5 A;  1Z5Y E;  1R4W A;  2BMX A;  5A5K A;  1N2A A;  1SU9 A;  13GS A;  2FGX A;  3ZTL A;  3GH9 A;  5CP1 A;  1PL1 A;  2VO4 A;  2K9F A;  2A4V A;  1S3A A;  4WKW A;  4K5S A;  1RQM A;  1K0O A;  3VPQ A;  3HJO A;  5KN2 A;  1AAZ A;  3UJ1 A;  3D5J A;  4PNF A;  2R2J A;  1O85 A;  4TOP A;  3P8W A;  4YAV A;  1EGR A;  3CSH A;  1EOG A;  1TI3 A;  4WR5 A;  2F51 A;  5COH A;  1M3I A;  4LL1 B;  1G0T A;  3HD5 A;  1Z9H A;  2O87 A;  1FW1 A;  1O6J A;  3PH9 A;  3UIW A;  5IO0 A;  8GSS A;  1T00 A;  1O7U A;  1WE0 A;  1UN2 A;  2FA4 A;  3CMI A;  4FH8 A;  2TIR A;  5JCG A;  3GFK A;  3ZYW A;  1H4O A;  4GTU A;  4BPY A;  5ECR B;  3MDK A;  1O81 A;  4GRF A;  11GS A;  2KOK A;  2KP1 A;  2AUV A;  1ILO A;  1YQ1 A;  3GKX A;  1GUH A;  2L4C A;  4OD7 A;  4NV5 A;  1TK5 B;  2CVD A;  5IMD A;  4IP6 A;  2VCQ A;  4MJB A;  1MD3 A;  4ZBD A;  1Z6M A;  2GZY A;  4FYB A;  4KW6 A;  4ZIJ A;  1PQN A;  1OC9 B;  4BIK A;  2YWN A;  5DJL A;  4CY8 A;  5G1K A;  1YEP A;  2RM5 A;  3D6I A;  3CSJ A;  12GS A;  3QFA C;  3ZRE A;  4EL1 A;  4X0X A;  2V41 A;  5ECK B;  5ECI B;  2VUP A;  4CW9 A;  2XHF A;  2RUF A;  5KOX A;  2IWT A;  2LS5 A;  4JBB A;  3LOR A;  2H6Z A;  1F37 A;  5DCG A;  1QQ2 A;  1GLP A;  3F6F A;  1AIU A;  1M99 A;  3GST A;  5G2Z A;  4O7H A;  4ZL7 A;  2MBS A;  1GP1 A;  2WFC A;  4FIW A;  4DSS B;  1V9W A;  3LFL A;  4N30 A;  5A4U A;  3HXS A;  3RPN A;  4WXT A;  1YKA A;  3A5W A;  4MPG A;  2DML A;  5KOW A;  3K8N A;  1EP8 A;  3M1G A;  2IMI A;  2MMN A;  2DKH A;  2H19 A;  3ZIV A;  1EWX A;  2HZE A;  3QCP A;  5DVB A;  3TOT A;  3FMW A;  3N5O A;  3MAK A;  4RUV A;  3WGE A;  5FHI A;  3ZVJ A;  4O5U A;  4CDO A;  2VCV A;  4EDY A;  2K18 A;  3I6A A;  20GS A;  4YQV A;  3BBY A;  1XZO A;  4Q5Q A;  1PSQ A;  2FWE A;  2GQL A;  2QA2 A;  5AIV A;  1WWJ A;  5J9C A;  2H76 A;  1PGT A;  1BG5 A;  2GSS A;  2KHP A;  5J41 A;  5CO3 A;  3M8N A;  3TJG A;  2ES7 A;  1TTZ A;  3QD9 A;  4MDC A;  4LMV A;  1YZX A;  5CRG A;  2NPB A;  3IBH A;  1MTC A;  1TK8 B;  1TKD B;  3CYN A;  2B3S A;  1AC1 A;  5ELA A;  3D0Z A;  14GS A;  4JR6 A;  2DJJ A;  4I5Q A;  2BJX A;  3HYP A;  1IYH A;  1FB0 A;  3KP9 A;  4HQS A;  1X9M B;  3GA4 A;  2R4V A;  1ZZY A;  4YKG A;  1DBY A;  5A4V A;  2CT6 A;  3D22 A;  1M9B A;  3BCI A;  2GDR A;  2UZ8 A;  1TJD A;  2MZC A;  3GMF A;  4MZC A;  1Q98 A;  2I9H A;  2YV7 A;  1UVZ A;  3IAS 2;  1OC9 A;  2I3Y A;  3HZ4 A;  2C4J A;  3LW9 A;  1GH2 A;  4KB3 A;  5GZZ B;  2VLT A;  3QAV A;  2LRT A;  4OWY A;  1HNC A;  3IC4 A;  2AV4 A;  4KUN A;  2V2G A;  4V2M A;  2CV4 A;  1A0F A;  2MYG A;  5HR2 A;  1NW2 A;  1F3B A;  2LQO A;  3CTF A;  2GT5 A;  3LGC A;  3G7Y A;  4PQ1 A;  1TXX A;  3KJY A;  2LNT A;  4KCE A;  1ZYP A;  10GS A;  5IIZ A;  5F06 A;  3WGD A;  1JZW A;  1W89 A;  5D9W A;  3U5R E;  3I9V 2;  4ZB8 A;  3MSZ A;  4BWS A;  2JU5 A;  2C8U A;  2C0E A;  4OMV A;  9GSS A;  3LG6 A;  4ML6 A;  2VCT A;  4WBR D;  3A5I A;  1KEB A;  3US3 A;  1SK1 A;  1JHB A;  1I9D A;  2CA8 A;  2R37 A;  1RW1 A;  2V1M A;  2QSI A;  4IN0 A;  3GRX A;  3KP8 A;  4Z7X A;  1FB6 A;  2H30 A;  2H0I A;  3QAG A;  1SEN A;  1PFO A;  2O8V B;  2FNO A;  3UBK A;  1EP7 A;  4ACS A;  2V6O A;  3DML A;  3UVT A;  5IMZ A;  4KGI A;  1ZYN A;  2R6K A;  1GL8 A;  1GNW A;  3IOS A;  3VWU A;  1YEX A;  2LV3 A;  4EO3 A;  5EL8 A;  2LJA A;  4MP4 A;  5GST A;  1GSE A;  3CRU A;  3WT1 A;  5EY6 A;  3HHV A;  4MPF A;  3F3R A;  2HRF A;  1AQW A;  2XPE A;  1E6B A;  2FWG A;  1V98 A;  3ERF A;  1GSU A;  2YJ7 A;  1TRV A;  1HQO A;  1SJ6 A;  2CX3 A;  3KH9 A;  3DEX A;  4XHM A;  1PN0 A;  4N11 A;  1SYR A;  2JSY A;  1SL1 B;  2CAI A;  4WF5 A;  3KTL A;  2C1Y A;  3DD3 A;  1PL2 A;  4OCE A;  1XVW A;  3F4T A;  2GVP A;  3HJP A;  1GUL A;  2JZR A;  3EU3 A;  3HCZ A;  4WEY A;  2CVK A;  2DJK A;  1GSS A;  4JU5 A;  4EIQ A;  3HVV A;  3WD6 A;  3PIN A;  5HFI A;  4TXO B;  1ERT A;  3IAM 2;  2PVQ A;  5DAK B;  4RI7 A;  4F03 A;  1B9Y C;  2IFQ B;  4BA7 A;  2XBI A;  1K0M A;  1OC3 A;  4MF7 A;  2TRX A;  5L71 A;  5JWO B;  4NMU A;  4ZIL A;  1S3R A;  4PXO A;  2GZP A;  2I1U A;  1WMJ A;  2PER A;  1GRX A;  2Z9S A;  3L9V A;  3U6V A;  4F2I A;  22GS A;  3PPU A;  3TJB A;  1AQV A;  4AJ7 A;  2DBC A;  2FA8 A;  3UAP A;  3FZ4 A;  1ABA A;  1AXD A;  3GSS A;  4E8E A;  4NPB A;  1CQH A;  3J7Y k;  4ICY A;  2H0H A;  4N10 A;  1X5D A;  1A2M A;  2H72 A;  3M9K A;  5CNW A;  2NTO A;  4I6X A;  3KH7 A;  3UL3 A;  2H6X A;  5HFK A;  3N9J A;  2R0G A;  4O32 A;  2H01 A;  4ZBA A;  1ZGN A;  1X5E A;  1X9S B;  1DUG A;  1ERU A;  5CRW A;  5E4W A;  4TKY A;  5ECL B;  5ABR A;  1TU8 A;  1K0A A;  5DQS A;  3H8Q A;  2YZH A;  3IR4 A;  3KMO A;  4KDU A;  1SKR B;  3IE3 A;  5KN3 A;  2ZCT A;  1T1V A;  2ALB A;  3IC8 A;  2HYX A;  5CRE A;  1WRY A;  1HNB A;  2L59 A;  5HQP A;  3FEU A;  1K0C A;  2IMK A;  5IMV A;  4PUA A;  3TRQ A;  3F63 A;  4HEA 2;  4WR4 A;  1MDI A;  2IJY A;  5DQY A;  1DE1 A;  2L57 A;  4Z2T A;  2P31 A;  4HU9 A;  5C00 A;  3GNJ A;  1V40 A;  5G5E A;  3EPT A;  4H86 A;  4V2L A;  2B7J A;  1R5A A;  2CVB A;  2YNX A;  3W6G A;  2C3Q A;  2CQ9 A;  2VLV A;  4F9Z A;  1BAY A;  4ML1 A;  4USS A;  3EUR A;  3C71 A;  2L6D A;  2EIQ A;  2WDU A;  2VIM A;  5GSS A;  2PU9 C;  1TW9 A;  2AJQ B;  3W8J A;  3J7Y b;  6GSW A;  4JE1 A;  4J56 E;  7GSS A;  1K0D A;  1O8X A;  3O6T A;  1J0F A;  1OC8 A;  4I2T A;  1ZL9 A;  1O8W A;  3E9J B;  1ZYE A;  1E2Y A;  3QMX A;  2R0P A;  5KN1 A;  3KCM A;  1XWK A;  2FY6 A;  4TXO A;  2VD0 A;  1EV9 A;  5DAK A;  5ELG A;  2IFQ A;  3VI5 A;  1T4Y A;  5B6M A;  3I43 A;  3ME7 A;  5HR1 A;  2M72 A;  2GTU A;  2C80 A;  1WOU A;  3O3T A;  5BRT A;  1DSB A;  1GTI A;  4BL7 A;  3HJM A;  3A3T A;  4MLY A;  1H75 A;  3TCO A;  3PGT A;  1XWA A;  3V1W A;  3A2X A;  1MEK A;  5F05 A;  2YAN A;  2QKE A;  2DJ3 A;  5F8B A;  3GHA A;  4K9Z A;  4G9H A;  2YOI A;  3GX0 A;  4WF4 A;  3ERG A;  2B6M A;  3G9B A;  3Q74 A;  3KD0 A;  3R2Q A;  1G6Y A;  1B4P A;  2HSM A;  2ON7 A;  1XCC A;  1SK0 A;  3QPM A;  3ZFL A;  3EWL A;  2PN8 A;  3VFI A;  1MDJ A;  1TRS A;  1GSF A;  1QUW A;  2E2M A;  2G0F A;  4HJ2 A;  2WGR A;  1U88 A;  2DLX A;  1M2A A;  3FRC A;  3NIV A;  2LTK A;  3IPZ A;  1JFU A;  2HE3 A;  4YAP A;  2WJU A;  2IIY A;  2P0G A;  4IS0 A;  4X4J A;  5AGY A;  2OA7 A;  1T7P B;  2WZ9 A;  5IPH A;  2N5F A;  4G2E A;  5JWR B;  1F6M C;  1MDK A;  1SJZ A;  1YDK A;  1M2B A;  1Y6E A;  3F8U A;  1XG8 A;  1XBS A;  1T3B A;  1Z3E A;  1O73 A;  5IMC A;  4OCF A;  3GL3 A;  1G7E A;  1XWB A;  3VK9 A;  4L5L A;  2DC5 A;  1GSD A;  4RI6 A;  1GTB A;  2LQQ A;  2RUE A;  3CBU A;  4XS4 B;  2RM6 A;  1DE2 A;  3TJF A;  3TKQ A;  5GAP D;  1TRU A;  2WUL A;  5FT3 A;  2HI7 A;  1FVJ A;  2FD3 A;  3Q19 A;  4NAX A;  5E59 A;  1BED A;  1JZO A;  4IJI A;  4OO5 A;  3D4T A;  2PGT A;  2EC4 A;  4NHZ A;  2A2S A;  2L4Q A;  2GST A;  2VL9 A;  4O92 A;  2JZS A;  2VL2 A;  2FUG 2;  4DEJ A;  1B9X C;  4HUA A;  5EVO A;  1I5G A;  2FCH A;  1A8Y A;  6GSX A;  4ZXG A;  2YCD A;  4L5O A;  1IYI A;  4G0L A;  4K0G A;  1F9M A;  1B8X A;  4ECC A;  4KSM A;  1EOH A;  3ZL5 A;  3RBT A;  3F4R A;  3H1N A;  3M0F A;  5ECQ B;  3HA9 A;  2DSA A;  5BMU A;  4YKF A;  3HVN A;  2DJ0 A;  4GF0 A;  3FR3 A;  1JLV A;  4XRA A;  2OKA A;  1SKS B;  18GS A;  1TRW A;  4IP1 A;  4F0B A;  4TR0 A;  3DKS A;  1N8J A;  3I69 A;  4TXV A;  4YQU A;  1VGL A;  2YP6 A;  3CSI A;  1XIY A;  3MYD A;  6GSS A;  4K2D A;  1OKT A;  2H75 A;  2VCZ A;  1S3D A;  3A2V A;  2C3N A;  4ILF A;  4Z2U A;  5G1L A;  2ON5 A;  3MIX A;  4KDX A;  1M0U A;  3APQ A;  4XCS A;  3IK9 A;  3LJR A;  3DIE A;  5C04 A;  2J23 A;  2OE0 A;  2F8F A;  3ZIJ A;  1B4Q A;  2FWH A;  2AYT A;  3ZFB A;  3LEF A;  5G31 A;  4LA1 A;  1EZK A;  2PPT A;  2NDO A;  3KMN A;  2O89 A;  2H74 A;  2H66 A;  2B5E A;  2WB9 A;  1SL2 B;  5INY A;  1EV4 A;  4K6X A;  1AQX A;  2X8G A;  2AAW A;  3P7X A;  4RQX A;  1Q4J A;  4MZB A;  1QMV A;  4DSR A;  3GH6 A;  1GNE A;  3RDW A;  4G0I A;  3ED3 A;  6GSY A;  1SD9 A;  1THO A;  3FW2 A;  4POK A;  3VWX A;  4EF0 A;  3P90 A;  1V58 A;  3HVX A;  1EEM A;  1YKC A;  1ZYQ B;  3HVS A;  3H4K A;  3L9S A;  1FOH A;  3IHQ A;  3LYK A;  1U3I A;  3TKS A;  1R5P A;  1M7T A;  4XS4 A;  1K3L A;  5IOX A;  2YPM A;  1UC7 A;  2OE3 A;  4KX4 A;  2NBS A;  3LQ7 A;  1PA3 A;  4TRX A;  3TDG A;  1GTA A;  3VUR A;  1ZCP A;  4NV2 A;  3IDV A;  1SD8 A;  2OBK A;  3ZRD A;  2OAD A;  1BX9 A;  1GWC A;  2VM2 A;  1GUM A;  1HNA A;  1A0R P;  2PBJ A;  4I97 A;  5DJM A;  4ULX A;  4Q5F A;  3ZML A;  2EIO A;  1NHO A;  4K8M A;  2GSQ A;  2VCX A;  1VRS D;  4XS1 A;  1A2J A;  3GKN A;  4GQC A;  2K6V A;  2IMD A;  4K0N A;  4MJC A;  2GLR A;  2DJ2 A;  4PUR A;  4POL A;  2NVL A;  2ZUP A;  5B8B A;  4K7I A;  1UA5 A;  4YQM A;  1X9W B;  2DMM A;  2HLS A;  2QGV A;  4IW9 A;  4EC0 A;  4BVY B;  2JSZ A;  3C1S A;  4IJ3 A;  4DVC A;  3SWL A;  1XW6 A;  3FZ5 A;  2M80 A;  3DVX A;  1GTU A;  2QC7 A;  4MJE A;  1KBN A;  4TVE A;  4ECI A;  1SYX A;  1CQG A;  3GKM A;  1EEJ A;  2VL2 C;  2LJK A;  4JZQ A;  1KTE A;  1YF0 A;  4IGJ A;  5LCZ A;  3LXZ A;  3ZLP A;  2ZNM A;  1QFN A;  4I2U A;  3EU4 A;  4BL7 B;  4E8H A;  3QAW A;  2DJ1 A;  2R3X A;  4AJ8 A;  1XPV A;  4Z2R A;  2L5L A;  1QXH A;  3D21 A;  2P5R A;  1JLW A;  2LST A;  1GUK A;  5G5F A;  2L5O A;  4GST A;  4JR4 A;  2XBQ A;  4KE3 A;  5AN1 A;  5KEJ A;  1XW9 A;  3EIN A;  2VD1 A;  3L0H A;  2DKI A;  2RLI A;  4CHS A;  2OBI A;  4IEL A;  2VLU A;  4LMW A;  4IVF A;  3L78 A;  4WBJ A;  4MMM A;  3VI7 A;  1TU7 A;  1PRX A;  4L0W A;  2DIY A;  3O76 A;  5ECP B;  1PMT A;  1XOB A;  4EKZ A;  4MAB A;  2WRT A;  2X49 A;  3L4N A;  2AB6 A;  2TRC P;  3UAR A;  1WPI A;  5F0G A;  3KXO A;  2XPD A;  3FYG A;  4OO4 A;  5D93 A;  3GKK A;  2MMO A;  1VF1 A;  2LEG A;  1C72 A;  3F6D A;  2I81 A;  2C0G A;  2VOC A;  4JED A;  3F0I A;  4MA9 A;  1ZMA A;  2H70 A;  3GL5 A;  4HOJ A;  3TRX A;  1K0N A;  2LNS A;  3FY7 A;  5JWQ B;  3IK7 A;  1YF1 A;  4IKH A;  4OFT A;  5HR3 A;  2LKU A;  2DIZ A;  5ECO B;  3KEB A;  1RK4 A;  3ISO A;  3RPP A; 
#chains in the Genus database with same CATH homology
 3QR6 A;  2V32 A;  4ZL8 A;  3GTU A;  3UEM A;  4MNN A;  1A8L A;  2REM A;  2F8A A;  4D73 B;  2FWF A;  3CRT A;  4PGT A;  4ZB6 A;  1A23 A;  4KF9 A;  2LUS A;  5B7C A;  3FK8 A;  3TKS C;  2IN3 A;  1ON4 A;  19GS A;  3TOU A;  17GS A;  2H6Y A;  1VF3 A;  4NHW A;  5EPF A;  2YWM A;  4G10 A;  4ISD A;  3FKF A;  4DSQ A;  1Y25 A;  3GV1 A;  2X64 A;  2B1K A;  4BVY A;  4K2X A;  2YZU A;  3G7J A;  3IHG A;  1TK0 B;  2HT9 A;  2JL4 A;  4ECB A;  2KP2 A;  1PKW A;  4GQF A;  1OKD A;  2H1A A;  3QOU A;  5B6N A;  2E7P A;  2KUC A;  1T8E B;  1GSQ A;  1XWG A;  5IMF A;  1KNG A;  3UOM A;  4KAE A;  3FR6 A;  5IO2 A;  1XWC A;  4K1F A;  5DBQ A;  2YWO A;  6GST A;  3L9U A;  3HZ8 A;  4Q5R A;  4K5R A;  1Z7P A;  1SL0 B;  4OFN A;  3G7I A;  1FVK A;  5IOW A;  4TR1 B;  4TN8 A;  2X99 A;  2R0C A;  5F07 A;  4F82 A;  2OJL A;  3MNG A;  3GUS A;  5ECH B;  3FZA A;  4GSS A;  1R7H A;  4IBP A;  3BCK A;  5JCU A;  1FG4 A;  1FAA A;  4HI7 A;  1XXU A;  4IQA A;  1V2A A;  1BQ7 A;  2CX4 A;  2LRN A;  1NHY A;  1OE8 A;  4N0V A;  4AGS A;  4KSO A;  4XIH A;  2X4A A;  2IME A;  2PVO C;  2E2G A;  4HJM A;  4I8B A;  4MCU A;  4ID0 A;  4KCA A;  5J4U A;  4G19 A;  1K3Y A;  1PX7 A;  3CTG A;  1ST9 A;  4POB A;  3FZ9 A;  2HSH A;  3EC3 A;  4KA0 A;  6GSU A;  1PN9 A;  3CXG A;  2B7K A;  3TJJ A;  2MMA A;  1QK8 A;  4PQI A;  4PQH A;  1GSY A;  3ZIT A;  1EGO A;  3TUE A;  2PUK C;  1LBK A;  5CRD A;  3HY2 A;  1FOV A;  1M9A A;  3UBL A;  3IA1 A;  4MZW A;  4YH2 A;  3S9F A;  1A2L A;  2P5Q A;  2G2Q A;  2EIR A;  3TJK A;  2FHE A;  2K8S A;  3W8S A;  4D73 A;  4PTS A;  4K7N A;  2V6K A;  3E0U A;  2FLS A;  4GWR A;  2D2Z A;  4J57 E;  3TGZ A;  1YJ6 A;  4V1A p;  2YJH A;  2IPA A;  1W4V A;  5ENU A;  3SBC A;  1QGV A;  3NZN A;  5AIX A;  4N0Z A;  2XC2 A;  4G0K A;  3ZZX A;  5H5Q A;  4HQZ A;  5D9X A;  4ZL9 A;  2C0F A;  3KGK A;  1OVN A;  2HXK A;  3IXR A;  3DYR A;  4MH3 A;  5ECN B;  4XTS A;  2OE1 A;  4V1A g;  2HFD A;  2PMT A;  3TRP A;  1FHE A;  1XVQ A;  1XOA A;  3TKP A;  2H73 A;  4MF6 A;  4TW5 A;  4NXI A;  5A4W A;  1M2D A;  2X8H A;  2N5A A;  4LL4 B;  5ID2 B;  2HRA A;  5CAX A;  2R5G A;  1OYJ A;  2GGT A;  2B1L A;  1SK2 A;  5LD0 A;  3LYP A;  3F9U A;  4MJA A;  4OFM A;  2H8L A;  4Q5N A;  1U3A A;  5J3R A;  2VM1 A;  3KIJ A;  2LRC A;  5DCH A;  1TI1 A;  6GSV A;  3H93 A;  4FQU A;  5G30 A;  2O7K A;  5LNK e;  3WGX A;  1JZD A;  5AIS A;  1LU4 A;  4TR1 A;  5D9V A;  5ECM B;  3FHK A;  3E3E A;  2JAD A;  3FR9 A;  4ZB9 A;  4EUY A;  1GLQ A;  1AUC A;  1USB A;  4IQ1 A;  3BD2 A;  3ERW A;  4HZ2 A;  3EVI A;  3C8E A;  1HD2 A;  4QQ7 A;  5CRH A;  1OAZ A;  1B48 A;  4GCI A;  2LJR A;  3C73 A;  1THX A;  4EDZ A;  3MWH A;  2VL3 A;  5JCW A;  3RHB A;  3BJ5 A;  3RHC A;  1BJX A;  2A2P A;  1J9B A;  3D4M A;  4ECJ A;  4O5R A;  1J08 A;  5D73 A;  4MK3 A;  3BOA A;  3LWA A;  2A4H A;  4FYU A;  4EIP A;  1K0B A;  2HNL A;  3ME8 A;  3DVW A;  5D8I A;  3LXT A;  4L0U A;  5H5R A;  3VWW A;  1SKW B;  1PD2 1;  4POM A;  4BVX B;  3NOF A;  1XW5 A;  3APO A;  1ERW A;  4KND A;  1U87 A;  1X0R A;  1K3O A;  2J9H A;  4X1U A;  5DAL B;  4XS6 A;  4QL9 A;  2AHE A;  2HRK A;  4HS1 A;  2JAC A;  4NWY A;  4DSS A;  3H79 A;  2CAQ A;  1ERV A;  5HFG A;  5IPG A;  4J2F A;  4TR3 A;  3WT2 A;  3DGQ A;  1G7O A;  2H0G A;  2RII A;  4O5Q A;  3VWV A;  2M46 A;  4HU7 A;  5H5S A;  2X8C A;  3IV4 A;  3IRA A;  2MMZ A;  2IL3 A;  2WCI A;  2F3M A;  3EYT A;  4EXJ A;  4FO5 A;  4EVM A;  3TB2 A;  4GSN A;  2B5X A;  3GTU B;  4FYC A;  3LSZ A;  3DWV A;  3KZQ A;  1T4Z A;  1Z6N A;  1PKZ A;  5ID2 A;  2VCW A;  3TKR A;  3HDC A;  5J9B A;  1G6W A;  3GN3 A;  2F9S A;  5FWG A;  2C0D A;  2H1B A;  1XFL A;  3UVH A;  5KN0 A;  5IQY A;  2HSY A;  5DDL A;  4P3Y B;  1YY7 A;  2VAF A;  2IMF A;  2A2R A;  4KDY A;  3M3M A;  2GT6 A;  4CY6 A;  3DRN A;  4PX1 A;  2BTO T;  1NSW A;  3Q18 A;  2CZ2 A;  1Z7R A;  3EE2 A;  4XRD A;  5ECS A;  4MH2 A;  3ZMK A;  3GYK A;  4TR4 A;  1WIK A;  3GX8 A;  2CZ3 A;  2E0Q A;  1LJR A;  2HZF A;  2O85 A;  4K7O A;  1VF4 A;  5GAN D;  5HR0 A;  1FO5 A;  1WP0 A;  3C7M A;  3WYW A;  4IHU A;  3OR5 A;  3GIX A;  3Q6O A;  4X43 A;  3AY8 A;  2YN1 A;  2GQK A;  1F2E A;  4GLT A;  3PR8 A;  2H1D A;  4BVX A;  2YWI A;  3F4S A;  3RAZ A;  3JCM L;  1V57 A;  2WS2 A;  1HYU A;  1ZOF A;  2OAC A;  3VLN A;  3F3Q A;  3ZVJ D;  1F3A A;  2N5B A;  1X5C A;  1NM3 A;  2GSR A;  3APS A;  5DAL A;  3EMP A;  3HKR A;  3DXB A;  3M9J A;  1SJI A;  5IMA A;  3C1R A;  1PX6 A;  5IM9 A;  1TP9 A;  4EE0 A;  4V2N A;  2HRN A;  2K8V A;  1OE7 A;  4JRR A;  2GZZ A;  4AF2 A;  4GXZ A;  2H1G A;  5J5N A;  1VF2 A;  2B5Y A;  16GS A;  5CYY A;  1ACV A;  4RQR A;  4PUF C;  4LLR A;  4HDE A;  2YV9 A;  4ZBB A;  4HZ4 A;  1MD4 A;  1JZR A;  1BYE A;  1TDI A;  3KTB A;  4AJ6 A;  4L8E A;  2H71 A;  1U6T A;  2JZT A;  4QL7 A;  4WET A;  2I4A A;  4KH7 A;  3EMX A;  1ML6 A;  2PWJ A;  4A5P A;  5D96 A;  1R26 A;  5B8A A;  5D9T A;  3QFB C;  3P2A A;  3GUR A;  4BWQ A;  3VPT A;  3QDN A;  3KM6 A;  1S3C A;  3R3E A;  3TKS E;  1WJK A;  2QA1 A;  4PNG A;  1URM A;  2HZE B;  1A24 A;  3A2W A;  3UMA A;  2C3T A;  2GQM A;  2GS3 A;  1AW9 A;  2KLX A;  2L6C A;  4F0C A;  1TOF A;  2MBT A;  4MF5 A;  1Z5Y E;  1R4W A;  2BMX A;  5A5K A;  1N2A A;  1SU9 A;  13GS A;  2FGX A;  3ZTL A;  3GH9 A;  5CP1 A;  1PL1 A;  2VO4 A;  2K9F A;  2A4V A;  1S3A A;  4WKW A;  4K5S A;  1RQM A;  1K0O A;  3VPQ A;  3HJO A;  5KN2 A;  1AAZ A;  3UJ1 A;  3D5J A;  4PNF A;  2R2J A;  1O85 A;  4TOP A;  3P8W A;  4YAV A;  1EGR A;  3CSH A;  1EOG A;  1TI3 A;  4WR5 A;  2F51 A;  5COH A;  4LL1 B;  1G0T A;  3HD5 A;  1Z9H A;  2O87 A;  1FW1 A;  1O6J A;  3PH9 A;  3UIW A;  5IO0 A;  8GSS A;  1T00 A;  1O7U A;  1WE0 A;  1UN2 A;  2FA4 A;  3CMI A;  4FH8 A;  2TIR A;  5JCG A;  3GFK A;  3ZYW A;  1H4O A;  4GTU A;  4BPY A;  5ECR B;  3MDK A;  1O81 A;  4GRF A;  11GS A;  2KOK A;  2KP1 A;  2AUV A;  1ILO A;  1YQ1 A;  3GKX A;  1GUH A;  2L4C A;  4OD7 A;  4NV5 A;  1TK5 B;  2CVD A;  5IMD A;  4IP6 A;  2VCQ A;  4MJB A;  1MD3 A;  4ZBD A;  1Z6M A;  2GZY A;  4FYB A;  4KW6 A;  4ZIJ A;  1PQN A;  1OC9 B;  2YWN A;  5DJL A;  4CY8 A;  5G1K A;  1YEP A;  2RM5 A;  3D6I A;  3CSJ A;  12GS A;  3QFA C;  3ZRE A;  4EL1 A;  4X0X A;  2V41 A;  5ECK B;  5ECI B;  2VUP A;  4CW9 A;  2XHF A;  2RUF A;  5KOX A;  2IWT A;  2LS5 A;  4JBB A;  3LOR A;  2H6Z A;  1F37 A;  5DCG A;  1QQ2 A;  1GLP A;  3F6F A;  1AIU A;  1M99 A;  3GST A;  5G2Z A;  4O7H A;  4ZL7 A;  2MBS A;  1GP1 A;  2WFC A;  4FIW A;  4DSS B;  1V9W A;  3LFL A;  4N30 A;  5A4U A;  3HXS A;  3RPN A;  4WXT A;  1YKA A;  3A5W A;  4MPG A;  2DML A;  5KOW A;  3K8N A;  1EP8 A;  3M1G A;  2IMI A;  2MMN A;  2DKH A;  2H19 A;  3ZIV A;  1EWX A;  2HZE A;  3QCP A;  5DVB A;  3TOT A;  3FMW A;  3N5O A;  3MAK A;  4RUV A;  3WGE A;  5FHI A;  3ZVJ A;  4O5U A;  4CDO A;  2VCV A;  4EDY A;  2K18 A;  3I6A A;  20GS A;  4YQV A;  3BBY A;  1XZO A;  4Q5Q A;  1PSQ A;  2FWE A;  2GQL A;  2QA2 A;  5AIV A;  1WWJ A;  5J9C A;  2H76 A;  1PGT A;  1BG5 A;  2GSS A;  2KHP A;  5J41 A;  5CO3 A;  3M8N A;  3TJG A;  2ES7 A;  1TTZ A;  3QD9 A;  4MDC A;  4LMV A;  1YZX A;  5CRG A;  2NPB A;  3IBH A;  1MTC A;  1TK8 B;  1TKD B;  3CYN A;  2B3S A;  1AC1 A;  5ELA A;  3D0Z A;  14GS A;  4JR6 A;  2DJJ A;  4I5Q A;  2BJX A;  3HYP A;  1IYH A;  1FB0 A;  3KP9 A;  4HQS A;  1X9M B;  3GA4 A;  2R4V A;  1ZZY A;  4YKG A;  1DBY A;  5A4V A;  2CT6 A;  3D22 A;  1M9B A;  3BCI A;  2GDR A;  2UZ8 A;  1TJD A;  2MZC A;  3GMF A;  4MZC A;  1Q98 A;  2I9H A;  2YV7 A;  1UVZ A;  3IAS 2;  1OC9 A;  2I3Y A;  3HZ4 A;  2C4J A;  3LW9 A;  1GH2 A;  4KB3 A;  5GZZ B;  2VLT A;  3QAV A;  2LRT A;  4OWY A;  1HNC A;  3IC4 A;  2AV4 A;  4KUN A;  2V2G A;  4V2M A;  2CV4 A;  1A0F A;  2MYG A;  5HR2 A;  1NW2 A;  1F3B A;  2LQO A;  3CTF A;  2GT5 A;  3LGC A;  3G7Y A;  4PQ1 A;  1TXX A;  3KJY A;  2LNT A;  4KCE A;  1ZYP A;  10GS A;  5IIZ A;  5F06 A;  3WGD A;  1JZW A;  1W89 A;  5D9W A;  3U5R E;  3I9V 2;  4ZB8 A;  3MSZ A;  4BWS A;  2JU5 A;  2C8U A;  2C0E A;  4OMV A;  9GSS A;  3LG6 A;  4ML6 A;  2VCT A;  4WBR D;  3A5I A;  1KEB A;  3US3 A;  1SK1 A;  1JHB A;  1I9D A;  2CA8 A;  2R37 A;  1RW1 A;  2V1M A;  2QSI A;  4IN0 A;  3GRX A;  3KP8 A;  4Z7X A;  1FB6 A;  2H30 A;  2H0I A;  3QAG A;  1SEN A;  2O8V B;  2FNO A;  3UBK A;  1EP7 A;  4ACS A;  2V6O A;  3DML A;  3UVT A;  5IMZ A;  4KGI A;  1ZYN A;  2R6K A;  1GL8 A;  1GNW A;  3IOS A;  3VWU A;  1YEX A;  2LV3 A;  4EO3 A;  5EL8 A;  2LJA A;  4MP4 A;  5GST A;  1GSE A;  3CRU A;  3WT1 A;  5EY6 A;  3HHV A;  4MPF A;  3F3R A;  2HRF A;  1AQW A;  2XPE A;  1E6B A;  2FWG A;  1V98 A;  3ERF A;  1GSU A;  2YJ7 A;  1TRV A;  1HQO A;  1SJ6 A;  2CX3 A;  3KH9 A;  3DEX A;  4XHM A;  1PN0 A;  4N11 A;  1SYR A;  2JSY A;  1SL1 B;  2CAI A;  4WF5 A;  3KTL A;  2C1Y A;  3DD3 A;  1PL2 A;  4OCE A;  1XVW A;  3F4T A;  2GVP A;  3HJP A;  1GUL A;  2JZR A;  3EU3 A;  3HCZ A;  4WEY A;  2CVK A;  2DJK A;  1GSS A;  4JU5 A;  4EIQ A;  3HVV A;  3WD6 A;  3PIN A;  5HFI A;  4TXO B;  1ERT A;  3IAM 2;  2PVQ A;  5DAK B;  4RI7 A;  4F03 A;  1B9Y C;  2IFQ B;  4BA7 A;  2XBI A;  1K0M A;  1OC3 A;  4MF7 A;  2TRX A;  5L71 A;  5JWO B;  4NMU A;  4ZIL A;  4PXO A;  2GZP A;  2I1U A;  1WMJ A;  2PER A;  1GRX A;  2Z9S A;  3L9V A;  3U6V A;  4F2I A;  22GS A;  3PPU A;  3TJB A;  1AQV A;  4AJ7 A;  2DBC A;  2FA8 A;  3UAP A;  3FZ4 A;  1ABA A;  1AXD A;  3GSS A;  4E8E A;  4NPB A;  1CQH A;  3J7Y k;  4ICY A;  2H0H A;  4N10 A;  1X5D A;  1A2M A;  2H72 A;  3M9K A;  5CNW A;  2NTO A;  4I6X A;  3KH7 A;  3UL3 A;  2H6X A;  5HFK A;  3N9J A;  2R0G A;  4O32 A;  2H01 A;  4ZBA A;  1ZGN A;  1X5E A;  1X9S B;  1DUG A;  1ERU A;  5CRW A;  5E4W A;  4TKY A;  5ECL B;  5ABR A;  1TU8 A;  1K0A A;  5DQS A;  3H8Q A;  2YZH A;  3IR4 A;  3KMO A;  4KDU A;  1SKR B;  3IE3 A;  5KN3 A;  2ZCT A;  1T1V A;  2ALB A;  3IC8 A;  2HYX A;  5CRE A;  1WRY A;  1HNB A;  2L59 A;  5HQP A;  3FEU A;  1K0C A;  2IMK A;  5IMV A;  4PUA A;  3TRQ A;  3F63 A;  4HEA 2;  4WR4 A;  1MDI A;  2IJY A;  5DQY A;  1DE1 A;  2L57 A;  4Z2T A;  2P31 A;  4HU9 A;  5C00 A;  3GNJ A;  1V40 A;  5G5E A;  3EPT A;  4H86 A;  4V2L A;  2B7J A;  1R5A A;  2CVB A;  2YNX A;  3W6G A;  2C3Q A;  2CQ9 A;  2VLV A;  4F9Z A;  1BAY A;  4ML1 A;  4USS A;  3EUR A;  3C71 A;  2L6D A;  2EIQ A;  2WDU A;  2VIM A;  5GSS A;  2PU9 C;  1TW9 A;  2AJQ B;  3W8J A;  3J7Y b;  6GSW A;  4JE1 A;  4J56 E;  7GSS A;  1K0D A;  1O8X A;  3O6T A;  1J0F A;  1OC8 A;  4I2T A;  1ZL9 A;  1O8W A;  3E9J B;  1ZYE A;  1E2Y A;  3QMX A;  2R0P A;  5KN1 A;  3KCM A;  1XWK A;  2FY6 A;  4TXO A;  2VD0 A;  1EV9 A;  5DAK A;  5ELG A;  2IFQ A;  3VI5 A;  1T4Y A;  5B6M A;  3I43 A;  3ME7 A;  5HR1 A;  2M72 A;  2GTU A;  2C80 A;  1WOU A;  3O3T A;  5BRT A;  1DSB A;  1GTI A;  4BL7 A;  3HJM A;  3A3T A;  4MLY A;  1H75 A;  3TCO A;  3PGT A;  1XWA A;  3V1W A;  3A2X A;  1MEK A;  5F05 A;  2YAN A;  2QKE A;  2DJ3 A;  5F8B A;  3GHA A;  4K9Z A;  4G9H A;  2YOI A;  3GX0 A;  4WF4 A;  3ERG A;  2B6M A;  3G9B A;  3Q74 A;  3KD0 A;  3R2Q A;  1G6Y A;  1B4P A;  2HSM A;  2ON7 A;  1XCC A;  1SK0 A;  3QPM A;  3ZFL A;  3EWL A;  2PN8 A;  3VFI A;  1MDJ A;  1TRS A;  1GSF A;  1QUW A;  2E2M A;  2G0F A;  4HJ2 A;  2WGR A;  1U88 A;  2DLX A;  1M2A A;  3FRC A;  3NIV A;  2LTK A;  3IPZ A;  1JFU A;  2HE3 A;  4YAP A;  2WJU A;  2IIY A;  2P0G A;  4IS0 A;  4X4J A;  5AGY A;  2OA7 A;  1T7P B;  2WZ9 A;  5IPH A;  2N5F A;  4G2E A;  5JWR B;  1F6M C;  1MDK A;  1SJZ A;  1YDK A;  1M2B A;  1Y6E A;  3F8U A;  1XBS A;  1T3B A;  1Z3E A;  1O73 A;  5IMC A;  4OCF A;  3GL3 A;  1G7E A;  1XWB A;  3VK9 A;  4L5L A;  2DC5 A;  1GSD A;  4RI6 A;  1GTB A;  2LQQ A;  2RUE A;  3CBU A;  4XS4 B;  2RM6 A;  1DE2 A;  3TJF A;  3TKQ A;  5GAP D;  1TRU A;  2WUL A;  5FT3 A;  2HI7 A;  1FVJ A;  2FD3 A;  3Q19 A;  4NAX A;  5E59 A;  1BED A;  1JZO A;  4IJI A;  4OO5 A;  3D4T A;  2PGT A;  2EC4 A;  4NHZ A;  2A2S A;  2L4Q A;  2GST A;  2VL9 A;  4O92 A;  2JZS A;  2VL2 A;  2FUG 2;  4DEJ A;  1B9X C;  4HUA A;  5EVO A;  1I5G A;  2FCH A;  1A8Y A;  6GSX A;  4ZXG A;  2YCD A;  4L5O A;  1IYI A;  4G0L A;  4K0G A;  1F9M A;  1B8X A;  4ECC A;  4KSM A;  1EOH A;  3ZL5 A;  3RBT A;  3F4R A;  3H1N A;  3M0F A;  5ECQ B;  3HA9 A;  2DSA A;  5BMU A;  4YKF A;  2DJ0 A;  4GF0 A;  3FR3 A;  1JLV A;  4XRA A;  2OKA A;  1SKS B;  18GS A;  1TRW A;  4IP1 A;  4F0B A;  4TR0 A;  3DKS A;  1N8J A;  3I69 A;  4TXV A;  4YQU A;  1VGL A;  2YP6 A;  3CSI A;  1XIY A;  3MYD A;  6GSS A;  4K2D A;  1OKT A;  2H75 A;  2VCZ A;  1S3D A;  3A2V A;  2C3N A;  4ILF A;  4Z2U A;  5G1L A;  2ON5 A;  3MIX A;  4KDX A;  1M0U A;  3APQ A;  4XCS A;  3IK9 A;  3LJR A;  3DIE A;  5C04 A;  2J23 A;  2OE0 A;  2F8F A;  3ZIJ A;  1B4Q A;  2FWH A;  2AYT A;  3ZFB A;  3LEF A;  5G31 A;  4LA1 A;  1EZK A;  2PPT A;  2NDO A;  3KMN A;  2O89 A;  2H74 A;  2H66 A;  2B5E A;  2WB9 A;  1SL2 B;  5INY A;  1EV4 A;  4K6X A;  1AQX A;  2X8G A;  2AAW A;  3P7X A;  4RQX A;  1Q4J A;  4MZB A;  1QMV A;  4DSR A;  3GH6 A;  1GNE A;  3RDW A;  4G0I A;  3ED3 A;  6GSY A;  1SD9 A;  1THO A;  3FW2 A;  4POK A;  3VWX A;  4EF0 A;  3P90 A;  1V58 A;  3HVX A;  1EEM A;  1YKC A;  1ZYQ B;  3HVS A;  3H4K A;  3L9S A;  1FOH A;  3IHQ A;  3LYK A;  1U3I A;  3TKS A;  1R5P A;  1M7T A;  4XS4 A;  1K3L A;  5IOX A;  2YPM A;  1UC7 A;  2OE3 A;  4KX4 A;  2NBS A;  3LQ7 A;  1PA3 A;  4TRX A;  3TDG A;  1GTA A;  3VUR A;  1ZCP A;  4NV2 A;  3IDV A;  1SD8 A;  2OBK A;  3ZRD A;  2OAD A;  1BX9 A;  1GWC A;  2VM2 A;  1GUM A;  1HNA A;  1A0R P;  2PBJ A;  4I97 A;  5DJM A;  4ULX A;  4Q5F A;  3ZML A;  2EIO A;  1NHO A;  4K8M A;  2GSQ A;  2VCX A;  1VRS D;  4XS1 A;  1A2J A;  3GKN A;  4GQC A;  2K6V A;  2IMD A;  4K0N A;  4MJC A;  2GLR A;  2DJ2 A;  4PUR A;  4POL A;  2NVL A;  2ZUP A;  5B8B A;  4K7I A;  1UA5 A;  4YQM A;  1X9W B;  2DMM A;  2HLS A;  2QGV A;  4IW9 A;  4EC0 A;  4BVY B;  2JSZ A;  3C1S A;  4IJ3 A;  4DVC A;  3SWL A;  1XW6 A;  3FZ5 A;  2M80 A;  3DVX A;  1GTU A;  2QC7 A;  4MJE A;  1KBN A;  4TVE A;  4ECI A;  1SYX A;  1CQG A;  3GKM A;  1EEJ A;  2VL2 C;  2LJK A;  4JZQ A;  1KTE A;  1YF0 A;  4IGJ A;  5LCZ A;  3LXZ A;  3ZLP A;  2ZNM A;  1QFN A;  4I2U A;  3EU4 A;  4BL7 B;  4E8H A;  3QAW A;  2DJ1 A;  2R3X A;  4AJ8 A;  1XPV A;  4Z2R A;  2L5L A;  1QXH A;  3D21 A;  2P5R A;  1JLW A;  2LST A;  1GUK A;  5G5F A;  2L5O A;  4GST A;  4JR4 A;  2XBQ A;  4KE3 A;  5AN1 A;  5KEJ A;  1XW9 A;  3EIN A;  2VD1 A;  3L0H A;  2DKI A;  2RLI A;  4CHS A;  2OBI A;  4IEL A;  2VLU A;  4LMW A;  4IVF A;  3L78 A;  4WBJ A;  4MMM A;  3VI7 A;  1TU7 A;  1PRX A;  4L0W A;  2DIY A;  3O76 A;  5ECP B;  1PMT A;  1XOB A;  4EKZ A;  4MAB A;  2WRT A;  2X49 A;  3L4N A;  2AB6 A;  2TRC P;  3UAR A;  1WPI A;  5F0G A;  3KXO A;  2XPD A;  3FYG A;  4OO4 A;  5D93 A;  3GKK A;  2MMO A;  1VF1 A;  2LEG A;  1C72 A;  3F6D A;  2I81 A;  2C0G A;  2VOC A;  4JED A;  3F0I A;  4MA9 A;  1ZMA A;  2H70 A;  3GL5 A;  4HOJ A;  3TRX A;  1K0N A;  2LNS A;  3FY7 A;  5JWQ B;  3IK7 A;  1YF1 A;  4IKH A;  4OFT A;  5HR3 A;  2LKU A;  2DIZ A;  5ECO B;  3KEB A;  1RK4 A;  3ISO A;  3RPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...