3UIWA

Zebrafish grx2 (apo)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
110
structure length
110
Chain Sequence
PGLSSSACGQFVQDIVSSNCVVIFSKTTCPYCKMAKGVFNEIGATYKVVELDEHNDGRRLQETLAELTGARTVPRVFINGQCIGGGSDTKQLHQQGKLLPLIEQCRPCCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin 2
publication title A New Mode of Iron-sulfur Cluster Coordination in Glutaredoxins is Crucial for Axonogenesis
rcsb
source organism Danio rerio
molecule tags Oxidoreductase
total genus 31
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3uiwA00
1PX6A 1JHBA 4KDUA 4F9ZA 3GH6A 1K3OA 3EWLA 5LD0A 1J9BA 2H73A 1VGLA 4HS1A 2X8HA 2DJ1A 2YJHA 2R2JA 2H1AA 4BL7A 3F3QA 4WF4A 4TN8A 1KEBA 1O81A 2HLSA 1H75A 1YY7A 1GSUA 2C0FA 2K6VA 2IIYA 2B5YA 2FWEA 1THOA 2GQLA 4ECCA 3ZFLA 3F4RA 4OMVA 3UIWA 5HFIA 1YZXA 3HJOA 12GSA 1M99A 2LJKA 4RI6A 5KN2A 4XCSA 1HQOA 3KH7A 4N10A 4L5LA 4MJBA 1VF1A 3A5WA 1TI3A 2IWTA 2L5OA 1PSQA 1YEPA 4I6XA 2DJKA 3E9JB 3KZQA 5DBQA 1FW1A 1VF3A 3GKKA 1O8WA 3ZFBA 1LBKA 4HU7A 2N5BA 4JEDA 1E2YA 2MMOA 2DC5A 4XS6A 3GIXA 3C7MA 1LU4A 2JZRA 1VF4A 1K0OA 4NWYA 4GTUA 3ZMKA 1W4VA 2ZUPA 2RLIA 1JLWA 2J9HA 1YQ1A 2H8LA 5C04A 4XRDA 1RQMA 3APSA 4IHUA 2TIRA 2HNLA 5AN1A 2LQOA 4KSMA 1TRVA 2GZYA 4O32A 5H5RA 2IJYA 4QL7A 2WS2A 1TKDB 1OE7A 3OR5A 2I3YA 4LA1A 2LJAA 3A2XA 4KSOA 4V2NA 1GTAA 2H71A 1ERTA 1DE2A 2IFQB 1O8XA 1SKSB 1WJKA 5DDLA 3FZAA 4EC0A 1Z3EA 5CRHA 4J57E 3FZ5A 1DSBA 2BJXA 3DEXA 4L0WA 4F0CA 5J9CA 1GLQA 4IW9A 5DJMA 3CMIA 4J2FA 1OKTA 2HZFA 3G7IA 1TTZA 1RW1A 5HR3A 5JWRB 2O85A 3HD5A 2H76A 1B48A 2OADA 3DVXA 5D9WA 5IMZA 5HQPA 3TB2A 2VCVA 5JCWA 1SD9A 2PVQA 2YWIA 2OA7A 3ZRDA 5KEJA 3HXSA 1DE1A 2B1LA 5D96A 5DJLA 1EGRA 4RI7A 1YJ6A 1Z6MA 2HRNA 1MTCA 3GSTA 4KCEA 4GCIA 5CRGA 2K8SA 4PQIA 2XBQA 3CTGA 3WT2A 1AQWA 1XWKA 2M80A 4XRAA 3GTUA 3QAWA 4E8EA 3ME7A 1C72A 3GNJA 2WRTA 2FWHA 3F6DA 1XWAA 3LEFA 1ZMAA 5HR2A 1PKWA 2YOIA 4RQXA 1XOAA 2LTKA 1NHOA 1GNEA 1O85A 4EE0A 1I5GA 1BYEA 1TK5B 1UN2A 2YPMA 1QMVA 2VM2A 5HR1A 1K0DA 2B7JA 4NMUA 2M46A 2JU5A 2VM1A 4AJ8A 1TRSA 5CRDA 1M0UA 5J9BA 1GULA 1TK0B 5A4WA 3HZ8A 2DLXA 1KNGA 5B6MA 1S3DA 4GRFA 1HNBA 2X8GA 4DSQA 4DSSB 4PNGA 1VRSD 4KCAA 1WE0A 5C00A 2AV4A 2XHFA 2GT5A 1X9SB 3QMXA 3RHBA 2CV4A 5DQYA 2FY6A 4LL1B 3HVXA 5A5KA 1XFLA 4GSTA 4BWQA 3HJPA 2YV7A 2V1MA 1MDIA 3C1RA 2H0GA 2C4JA 2E2GA 5IMVA 4NV2A 4YQUA 1XVQA 4XS4A 3UBLA 3AY8A 4NAXA 3SBCA 1F9MA 1KBNA 4ZBBA 5F8BA 1AXDA 2O87A 3J7Yk 1SENA 2GT6A 1A8LA 1SJ6A 1I9DA 1X0RA 5DAKA 3W8JA 4Q5QA 4OFNA 3HZ4A 1K0NA 11GSA 1ILOA 3GFKA 1U3AA 4TXOA 3N5OA 4RQRA 2K18A 4N0VA 2C0GA 2G0FA 1NSWA 2F3MA 2QKEA 3UOMA 3U6VA 3HA9A 2E0QA 4OFTA 5AIVA 3WGDA 2HZEB 3L0HA 2PPTA 5B8AA 2TRXA 2MMNA 2IMIA 5A4VA 3TKSA 2P0GA 1R5PA 3UAPA 2KP1A 2LRNA 2XPEA 4PQHA 1TRWA 2FD3A 3UVTA 2VCZA 5G5FA 3FW2A 4LMWA 1A0RP 5ECNB 5IMDA 1XOBA 1A24A 2H75A 4POBA 3EC3A 1M7TA 3TUEA 1F37A 1K0MA 1EEMA 5ECSA 1GL8A 5IMCA 2VLUA 5D93A 2NTOA 1YEXA 4L5OA 5DALA 4POMA 2PU9C 1H4OA 2DIZA 5ECHB 3M8NA 3F3RA 2VLTA 1BAYA 1EV4A 4XIHA 3TRQA 5F0GA 2OE0A 4PX1A 5FWGA 3IXRA 2JZTA 3LSZA 4OCEA 1ZCPA 3A3TA 3GMFA 3ERWA 2FGXA 5JWQB 4O7HA 1TRUA 5KN0A 3FY7A 3KIJA 2VO4A 3QPMA 5J5NA 4D73B 5IOWA 2GSQA 4WXTA 3F8UA 2YWOA 2MMZA 4KX4A 3QDNA 3HVSA 4WBRD 5ENUA 4Q5RA 1MEKA 1T00A 3EU4A 1A0FA 2DJ2A 4V2MA 1EOHA 3GUSA 4ZB6A 1ON4A 1PKZA 2E7PA 2LRCA 1XIYA 2L6CA 4ECIA 3KMOA 4PUFC 1SYXA 2GSRA 4ZXGA 3KP8A 4NHZA 3Q6OA 3L9SA 2MBSA 3U5RE 4MLYA 3L78A 3IC4A 2ON7A 3LORA 4JU5A 3ZIJA 2LEGA 3ZZXA 3A2VA 2VD0A 10GSA 3CBUA 4ZL7A 1FB0A 1UVZA 4ZILA 3UBKA 1XPVA 7GSSA 6GSUA 2H6YA 4K7IA 3TOTA 2F8FA 2OBIA 1M2BA 4X0XA 3Q74A 3W6GA 5F05A 4PURA 5CO3A 3VI5A 4F03A 2V6KA 4ISDA 3WGEA 4TR4A 4GQCA 4EF0A 2CT6A 1SL0B 1SJZA 4LL4B 1R7HA 3CRUA 4MH3A 2NBSA 4K9ZA 4KNDA 3C73A 5HFGA 1U3IA 4X43A 4EXJA 1UC7A 5ECQB 5IO0A 4EDYA 2LSTA 4HU9A 5B6NA 3R2QA 2WB9A 2YZUA 4J56E 3ZREA 3TDGA 5IPGA 3GSSA 1XWGA 3F63A 1EGOA 4V1Ag 4KE3A 2IN3A 2RUEA 1K0BA 5D9TA 2CAIA 4XS1A 2EIOA 3UMAA 2NDOA 2KHPA 4BA7A 5ELGA 3DMLA 5ID2A 3EU3A 16GSA 3NOFA 1IYHA 4I2TA 4MDCA 1AIUA 3MDKA 4LMVA 3IAS2 4K6XA 1YF1A 3ERFA 3GN3A 1T3BA 3QR6A 1SD8A 5H5SA 3KM6A 4G10A 5F07A 1EP8A 4ECBA 4BWSA 1ACVA 4MH2A 2BMXA 2JACA 4WETA 4FH8A 3ZLPA 3ERGA 3VPQA 3ME8A 4XHMA 3P7XA 4WF5A 4QL9A 4Q5NA 3TKQA 1X5DA 3KEBA 5CRWA 1SKWB 3PINA 4IELA 4IQAA 1GSYA 4MZBA 3LXTA 4CHSA 3HCZA 2H0HA 5DCGA 1PRXA 1VF2A 3CSIA 4MJCA 3GL5A 1LJRA 1A2JA 3EMXA 3H93A 4ILFA 1FVKA 2AJQB 2B3SA 5COHA 2DJ0A 3DKSA 2FNOA 2IMFA 1ST9A 2C0EA 1PL1A 2BTOT 5EY6A 2I1UA 1K0CA 2YWMA 2OE3A 3TKSC 1MDKA 2O7KA 1TXXA 5B7CA 13GSA 1MDJA 3CRTA 5HFKA 2ALBA 4N11A 3FZ4A 2L4QA 1FHEA 2FUG2 2L5LA 5CAXA 1AUCA 3IV4A 1O73A 1WOUA 1Z7PA 4KAEA 1ZL9A 2JADA 1WP0A 5J41A 5ELAA 2YN1A 3DRNA 4G2EA 2LRTA 1THXA 4HZ4A 1E6BA 4FIWA 1XW6A 1O6JA 1K3YA 5AISA 2FWGA 2C0DA 3N9JA 3LXZA 2VCXA 1EOGA 4IJIA 1PA3A 3RAZA 1F3BA 1QQ2A 1K3LA 4MABA 1OE8A 1B9YC 6GSXA 2L6DA 2VOCA 2PGTA 1U88A 2YP6A 2IMDA 2C3NA 3KD0A 3HKRA 3I43A 4JZQA 2B6MA 1N8JA 2HFDA 3M0FA 3VLNA 1R26A 4K0GA 3HHVA 4IP6A 3V1WA 3QAGA 1EZKA 4NPBA 3H8QA 2LV3A 2EIQA 1FG4A 1KTEA 1EP7A 3HDCA 2F9SA 4O92A 4MA9A 1HD2A 2CVDA 5LCZA 1TK8B 2N5AA 2J23A 4I5QA 5L71A 4QQ7A 1NHYA 3GH9A 1M9BA 1G7EA 2GZPA 3APQA 3TKPA 1ZYEA 4GLTA 4GQFA 3D4TA 2H6XA 1U87A 2DJJA 2GVPA 3IAM2 3KCMA 4Q5FA 5IPHA 1TOFA 3FEUA 2PERA 4H86A 3TGZA 3F4TA 1A2MA 3TJBA 5IIZA 3WGXA 1X5EA 1GH2A 1OC9B 1FAAA 2X8CA 3TRPA 5JCGA 1PX7A 3GHAA 2OBKA 2KLXA 2K9FA 2O89A 1G0TA 2GSTA 4NV5A 4TVEA 5G31A 1G7OA 5G1LA 4YAVA 4K1FA 2CZ2A 4IQ1A 3PGTA 1S3CA 4IS0A 1OVNA 3IE3A 4NHWA 2C80A 4P3YB 4TR1B 2FA8A 2CX4A 2B5EA 2VIMA 2GSSA 4WR4A 1PN9A 2IFQA 1AAZA 2YV9A 2HT9A 1XXUA 5A4UA 3UVHA 3GV1A 3GL3A 4ZL9A 1GTIA 1DBYA 5DCHA 2CZ3A 5CREA 9GSSA 3J7Yb 3C71A 1XW5A 2JSZA 3ZVJD 2VCQA 2C1YA 3BJ5A 2PBJA 4HI7A 8GSSA 1PGTA 1WIKA 4IKHA 2ES7A 1BG5A 3CYNA 4HJMA 4YAPA 1V40A 1ZOFA 3HVVA 1X9WB 3QOUA 3EVIA 1V2AA 1GUKA 1GNWA 5GSTA 3QFBC 6GSWA 4HZ2A 3TJKA 4RUVA 2B1KA 3KXOA 1AQVA 2LUSA 2FCHA 3W8SA 4EKZA 5ECOB 1SJIA 2WJUA 4I97A 4PQ1A 1GSSA 3MNGA 1GUMA 1DUGA 2KOKA 3M1GA 3RBTA 2LNTA 2VL9A 3K8NA 4ML6A 3WT1A 1BEDA 3H1NA 4G9HA 2FA4A 1F6MC 3MWHA 4I8BA 5GAND 3RPNA 1WPIA 2NVLA 3EMPA 2HSHA 4ECJA 3L9UA 4ZBDA 3TRXA 3KJYA 4MK3A 4KGIA 4POLA 1B4PA 3G7JA 2JSYA 2CX3A 2A2SA 2WCIA 5F06A 1PD21 4PGTA 4HQSA 1ZGNA 1XWCA 3ZTLA 3LYKA 5IO2A 4K8MA 4TR0A 2A4VA 3US3A 2RM6A 4ULXA 3D4MA 4GWRA 1SL2B 2I9HA 4MPFA 4TKYA 2H1GA 2WGRA 2WULA 5CP1A 4DSSA 2XC2A 2VCTA 2H72A 4YQMA 1M2DA 3BCKA 1M9AA 5FHIA 1CQGA 1OC8A 3F4SA 3VPTA 1Z6NA 1WRYA 3DVWA 4KDYA 3ZITA 22GSA 1ERVA 3FR6A 2FHEA 4ZIJA 1F3AA 2YZHA 5IOXA 2B5XA 5GAPD 4IVFA 3VFIA 1EEJA 2GQKA 3LYPA 3QD9A 1Y25A 2REMA 1CQHA 4O5RA 2H6ZA 4X1UA 2VD1A 1G6YA 2YWNA 2LNSA 2V41A 3IRAA 3GX0A 3UL3A 1GUHA 5EVOA 3LWAA 3WD6A 4HDEA 3GKMA 3DIEA 1Z7RA 3E3EA 1M2AA 4EUYA 2O8VB 1QK8A 1YKAA 1R4WA 1HNAA 3IBHA 5E59A 3LGCA 2P5RA 2KP2A 2L57A 4MF7A 4MJAA 4JR4A 2YANA 2HZEA 1GP1A 5JCUA 14GSA 1F2EA 2JL4A 3GURA 5KN3A 2F51A 1XWBA 1XVWA 3IK7A 3TOUA 1JZWA 2H74A 1X9MB 3VURA 1GSDA 5HR0A 2R37A 2VL2C 3QAVA 2XPDA 1SK2A 3M3MA 3TKRA 4DVCA 3GTUB 2GZZA 1JFUA 2OE1A 4WEYA 3D6IA 3D5JA 2LS5A 2PMTA 2RM5A 2L4CA 1GRXA 2RUFA 19GSA 2CA8A 3QFAC 4EVMA 2DIYA 2LJRA 5IQYA 1GWCA 4GSNA 4KA0A 2AHEA 4FYUA 1Y6EA 3D22A 1X5CA 2WZ9A 4MF5A 1FOVA 2VUPA 3F0IA 1PL2A 4V2LA 4BVYA 2X64A 1B9XC 3HY2A 1SK1A 2DMMA 2H30A 2IMEA 3ED3A 3BBYA 4F0BA 3IPZA 2P31A 5ECLB 3RDWA 3LQ7A 1R5AA 2H66A 1XCCA 3GA4A 3CSHA 5ECMB 1OYJA 4MZCA 1Z9HA 6GSVA 5IMAA 4FO5A 3IR4A 2CQ9A 5D9XA 3I9V2 5J3RA 4WR5A 4XTSA 4GF0A 4FYCA 1PQNA 3I6AA 4MPGA 1JZRA 5G5EA 1UA5A 1B8XA 2HI7A 3D0ZA 3KMNA 3FZ9A 3GKNA 1V98A 3M9KA 3TCOA 1ZYQB 2OACA 1B4QA 4D73A 4AJ6A 3WYWA 2CVKA 1AW9A 2V6OA 2PWJA 4IN0A 1J08A 1IYIA 3GKXA 2AB6A 2GGTA 1QFNA 2G2QA 4POKA 1QXHA 3NIVA 2FWFA 4XS4B 3DGQA 4ZBAA 4TOPA 4JRRA 1U6TA 2EIRA 4L8EA 1T8EB 3NZNA 1SKRB 2YNXA 5GZZB 3O3TA 1TDIA 3FR9A 1HNCA 4HQZA 2HYXA 1BQ7A 3KGKA 2QSIA 5DAKB 3Q19A 3HYPA 5D9VA 4PUAA 5D73A 4TXOB 4ACSA 4JBBA 1XW9A 4F2IA 3GYKA 5E4WA 6GSSA 2H19A 1HYUA 3CXGA 2YCDA 4KB3A 2LQQA 4K2DA 2GQMA 1FO5A 3CSJA 2GLRA 3DXBA 3JCML 1QUWA 4IJ3A 3ZVJA 3TJFA 3CTFA 1ERWA 1AC1A 1O7UA 1T7PB 3C8EA 2QC7A 3BOAA 4TW5A 1RK4A 3QCPA 4LLRA 3G7YA 3TKSE 1ML6A 3VI7A 2H0IA 3ZYWA 2CVBA 4L0UA 5DALB 4MCUA 4NXIA 2DMLA 3D21A 4EDZA 1GSFA 2VL2A 4G19A 5JWOB 3KP9A 4N0ZA 3ZIVA 3UEMA 1FVJA 5KN1A 2DSAA 4AF2A 4ID0A 1YF0A 5CYYA 3L4NA 4CDOA 3H79A 4JE1A 3VWXA 3UJ1A 1YKCA 2PUKC 1TP9A 1WMJA 2L59A 5ABRA 1TU7A 4YH2A 5IMFA 1N2AA 2KUCA 4OD7A 2AAWA 2LKUA 1TJDA 4ZB8A 4I2UA 1BX9A 2A2RA 5INYA 3S9FA 2JZSA 4HEA2 5G1KA 3KTBA 5EPFA 4OWYA 3LG6A 2R5GA 3RHCA 1NW2A 3IDVA 2TRCP 1K0AA 2GDRA 5H5QA 2ZNMA 1V57A 1OKDA 2IL3A 2R4VA 3FRCA 5LNKe 2AYTA 3PH9A 1T4ZA 1W89A 2FLSA 1TU8A 4EL1A 1GSEA 4K0NA 2WDUA 1V58A 1WWJA 3M9JA 1GTBA 1ABAA 3MAKA 1XBSA 1OAZA 3IHQA 3DD3A 2DBCA 2N5FA 3PR8A 5B8BA 1EWXA 2IPAA 3FK8A 2VCWA 2H1DA 1JLVA 1TI1A 1OC3A 18GSA 1Q4JA 3G9BA 1AQXA 1ERUA 4DEJA 3BD2A 3IOSA 3ZL5A 2R6KA 2B7KA 1S3AA 4IGJA 1URMA 3GX8A 4HUAA 4PXOA 3FHKA 3BCIA 1EV9A 4TXVA 5AIXA 1FB6A 2MMAA 3APOA 4KDXA 2CAQA 4N30A 1NM3A 1BJXA 4HJ2A 5ECPB 2AUVA 2I81A 4OO5A 1MD4A 1T4YA 4AJ7A 20GSA 3P90A 3RPPA 1MD3A 3I69A 2PVOC 4TRXA 2VAFA 3HJMA 3O6TA 3VK9A 1T1VA 3Q18A 3EYTA 1A2LA 2ON5A 2C8UA 3P2AA 1JZOA 3LFLA 1A8YA 4TR3A 17GSA 1SL1B 4PNFA 3TJGA 2OKAA 4IBPA 1QGVA 4ZL8A 2MYGA 3FYGA 4MP4A 2Z9SA 1SYRA 4KW6A 4HOJA 5J4UA 1J0FA 3DYRA 3L9VA 5DVBA 2PN8A 2IMKA 4BVXA 5ID2B 2K8VA 4WKWA 4GSSA 2GS3A 3C1SA 4K7NA 5DQSA 2DJ3A 3VWUA 4KH7A 4FYBA 4MJEA 2P5QA 2VLVA 1JZDA 3ISOA 3KH9A 3GRXA 4GXZA 3EE2A 5ECKB 3ZMLA 3VWWA 2H1BA 2MZCA 3VWVA 2VL3A 3P8WA 2MBTA 4ZB9A 4Z7XA 5AGYA 5D8IA 1ZZYA 3DWVA 5ECRB 2HE3A 2HSYA 2D2ZA 2HRFA 3H4KA 2C3QA 2QGVA 2RIIA 3IA1A 4DSRA 1GLPA 2OJLA 1SU9A 2C3TA 4ML1A 1YDKA 3TJJA 1G6WA 2H70A 4MMMA 3UARA 1SK0A 5EL8A 4F82A 2R3XA 2EC4A 4JR6A 1OC9A 4MF6A 5ECIB 1GTUA 5FT3A 1A23A 6GSYA 2XBIA 3SWLA 3LJRA 4WBJA 3A2WA 4MZWA 5GSSA 2I4AA 3F9UA 4KUNA 2V32A 3O76A 4EO3A 4YQVA 4IP1A 3IK9A 5G30A 3FR3A 5IM9A 4E8HA 4CW9A 1TW9A 2X99A 1XZOA 1GSQA 3F6FA 2F8AA 3MSZA 1V9WA 2M72A 4K7OA 2V2GA 4V1Ap 4OO4A 4TR1A 6GSTA 2GTUA 2YJ7A 4OFMA 1Q98A 2E2MA 1PMTA 3KTLA 4BPYA 3E0UA 1Z5YE 3FKFA 2ZCTA 4OCFA 5G2ZA 3EURA 4AGSA 2WFCA 2H01A 2HXKA 5CNWA 3EINA 1USBA 2NPBA
chains in the Genus database with same CATH superfamily
1PX6A 1JHBA 4KDUA 4F9ZA 3GH6A 1K3OA 3EWLA 5LD0A 1J9BA 2H73A 1VGLA 4HS1A 2X8HA 2DJ1A 2YJHA 2R2JA 2H1AA 4BL7A 3F3QA 4WF4A 4TN8A 3HVNA 1KEBA 1O81A 2HLSA 1H75A 1PFOA 1YY7A 1GSUA 2C0FA 2K6VA 2IIYA 2B5YA 2FWEA 1THOA 2GQLA 4ECCA 3ZFLA 3F4RA 4OMVA 3UIWA 5HFIA 1YZXA 3HJOA 12GSA 1M99A 2LJKA 4RI6A 5KN2A 4XCSA 1HQOA 3KH7A 4N10A 4L5LA 4MJBA 1VF1A 3A5WA 1TI3A 2IWTA 2L5OA 1PSQA 1YEPA 2QA2A 4I6XA 2DJKA 3E9JB 3KZQA 5DBQA 1FW1A 1VF3A 3GKKA 1O8WA 3IHGA 3ZFBA 1LBKA 4HU7A 2N5BA 4JEDA 1E2YA 2MMOA 2DC5A 4XS6A 3GIXA 3C7MA 1LU4A 2JZRA 1VF4A 1K0OA 4NWYA 4GTUA 3ZMKA 1W4VA 2ZUPA 2RLIA 1JLWA 2J9HA 1YQ1A 2H8LA 3PPUA 5C04A 4XRDA 1RQMA 3APSA 4IHUA 2TIRA 2HNLA 5AN1A 2LQOA 4KSMA 1TRVA 2GZYA 4O32A 5H5RA 4O5QA 2IJYA 4QL7A 2WS2A 1TKDB 1OE7A 3OR5A 2I3YA 4LA1A 4HSCX 2LJAA 3A2XA 4KSOA 4V2NA 1GTAA 2H71A 1ERTA 1DE2A 2IFQB 1O8XA 1SKSB 1WJKA 5DDLA 3FZAA 4EC0A 1Z3EA 5CRHA 4J57E 3FZ5A 1DSBA 2BJXA 3DEXA 4L0WA 4YKFA 4F0CA 5J9CA 1GLQA 4IW9A 5DJMA 3CMIA 4J2FA 1OKTA 2HZFA 3G7IA 1TTZA 1RW1A 5HR3A 5JWRB 2O85A 3HD5A 2H76A 1B48A 2OADA 3DVXA 5D9WA 5IMZA 5HQPA 3TB2A 2VCVA 5JCWA 1SD9A 2PVQA 2YWIA 2OA7A 3ZRDA 5KEJA 3HXSA 1DE1A 2B1LA 5D96A 5DJLA 1EGRA 4RI7A 1YJ6A 1Z6MA 2HRNA 1MTCA 3GSTA 4KCEA 4GCIA 5CRGA 2K8SA 4PQIA 2XBQA 3CTGA 3WT2A 1AQWA 1XWKA 2M80A 4G0IA 4XRAA 3GTUA 3QAWA 4E8EA 3ME7A 1C72A 3GNJA 2WRTA 2FWHA 3F6DA 1XWAA 3LEFA 1ZMAA 5HR2A 1PKWA 2YOIA 4RQXA 1XOAA 2LTKA 1NHOA 1GNEA 1O85A 4FQUA 1I5GA 4EE0A 1BYEA 1TK5B 1UN2A 1FOHA 2YPMA 1QMVA 2VM2A 5HR1A 1K0DA 2B7JA 4NMUA 2M46A 2JU5A 2VM1A 4AJ8A 1TRSA 5CRDA 1M0UA 5J9BA 1GULA 1TK0B 5A4WA 3HZ8A 2DLXA 1KNGA 5B6MA 1S3DA 4GRFA 1ZYNA 1HNBA 2X8GA 3MIXA 4DSQA 4DSSB 4PNGA 1VRSD 4KCAA 1WE0A 5C00A 2AV4A 2XHFA 4A5PA 2GT5A 1X9SB 3QMXA 3RHBA 2CV4A 5DQYA 2FY6A 4LL1B 3HVXA 5A5KA 1XFLA 4GSTA 4BWQA 3HJPA 2YV7A 2V1MA 1MDIA 3C1RA 2H0GA 2C4JA 2E2GA 1ZYPA 5IMVA 4NV2A 4YQUA 1XVQA 4XS4A 3UBLA 3AY8A 4NAXA 3SBCA 1F9MA 1KBNA 4ZBBA 5F8BA 1AXDA 2O87A 3J7Yk 1SENA 2GT6A 1A8LA 1SJ6A 1I9DA 1X0RA 5DAKA 3W8JA 4Q5QA 4OFNA 3HZ4A 1K0NA 11GSA 1ILOA 3GFKA 1U3AA 4TXOA 3N5OA 4RQRA 2K18A 4N0VA 2C0GA 2G0FA 1NSWA 2F3MA 2QKEA 3UOMA 3U6VA 3HA9A 2E0QA 4OFTA 5AIVA 3WGDA 2HZEB 3L0HA 2PPTA 5B8AA 2TRXA 2MMNA 2IMIA 1M3IA 4ICYA 5A4VA 3TKSA 2P0GA 1R5PA 3UAPA 2KP1A 2LRNA 2XPEA 4PQHA 1TRWA 2FD3A 3UVTA 2VCZA 5G5FA 3FW2A 4LMWA 1A0RP 5ECNB 5IMDA 1XOBA 1A24A 2H75A 4POBA 3EC3A 1M7TA 3TUEA 1F37A 1K0MA 1EEMA 5ECSA 1GL8A 5IMCA 2VLUA 5D93A 2NTOA 1YEXA 4K5SA 4L5OA 5DALA 4POMA 2PU9C 1H4OA 2DIZA 4BVYB 5ECHB 3M8NA 3F3RA 2VLTA 1BAYA 1EV4A 4XIHA 3TRQA 5F0GA 2OE0A 4PX1A 5FWGA 3IXRA 2JZTA 3LSZA 4OCEA 1ZCPA 3A3TA 3GMFA 3ERWA 2FGXA 4EIQA 5JWQB 4O7HA 1TRUA 5KN0A 3FY7A 3KIJA 2R0GA 2VO4A 3QPMA 5J5NA 2DKHA 4D73B 5IOWA 2GSQA 4WXTA 3F8UA 2YWOA 2MMZA 4KX4A 3QDNA 3HVSA 4WBRD 2HSMA 5ENUA 4Q5RA 1MEKA 1T00A 3EU4A 1S3RA 1A0FA 2DJ2A 4V2MA 1EOHA 3GUSA 4ZB6A 1ON4A 1PKZA 2E7PA 2LRCA 1XIYA 2L6CA 4ECIA 3KMOA 4PUFC 1SYXA 2GSRA 4ZXGA 3KP8A 4NHZA 3Q6OA 3L9SA 2MBSA 3U5RE 4MLYA 3L78A 3IC4A 2ON7A 3LORA 4JU5A 3ZIJA 2LEGA 3CQFA 3ZZXA 3A2VA 2VD0A 10GSA 4Z2TA 3CBUA 4ZL7A 1FB0A 1UVZA 4ZILA 3UBKA 1XPVA 7GSSA 6GSUA 2H6YA 4K7IA 3TOTA 2F8FA 2OBIA 1M2BA 4X0XA 3Q74A 3W6GA 5F05A 4PURA 2UZ8A 5CO3A 3VI5A 4F03A 2V6KA 4ISDA 3WGEA 4TR4A 4GQCA 4EF0A 2CT6A 1SL0B 1SJZA 4LL4B 1R7HA 3CRUA 4MH3A 5BMUA 2NBSA 4K9ZA 4KNDA 3C73A 5HFGA 1U3IA 4X43A 4EXJA 1UC7A 5ECQB 5IO0A 4EDYA 2LSTA 4HU9A 5B6NA 3R2QA 2WB9A 2YZUA 4J56E 3ZREA 3TDGA 5IPGA 3GSSA 1XWGA 3F63A 1EGOA 4V1Ag 4KE3A 2IN3A 2RUEA 1K0BA 5D9TA 2CAIA 4XS1A 2EIOA 3UMAA 2NDOA 2KHPA 4BA7A 4PTSA 5ELGA 4O5UA 3DMLA 5ID2A 3EU3A 16GSA 3NOFA 1IYHA 4I2TA 4MDCA 1AIUA 3MDKA 4LMVA 3IAS2 4K6XA 1YF1A 3ERFA 3GN3A 1T3BA 3QR6A 1SD8A 5H5SA 3KM6A 4G10A 5F07A 1EP8A 4ECBA 4BWSA 1ACVA 4MH2A 2BMXA 2JACA 4WETA 4FH8A 3ZLPA 3ERGA 3VPQA 3ME8A 4XHMA 3P7XA 4WF5A 4QL9A 4Q5NA 3TKQA 1X5DA 3KEBA 5CRWA 1SKWB 3PINA 4IELA 1XG8A 4IQAA 1GSYA 4MZBA 3LXTA 4CHSA 3HCZA 2H0HA 5DCGA 1PRXA 1VF2A 3CSIA 4MJCA 3GL5A 1LJRA 1A2JA 3EMXA 3H93A 4ILFA 1FVKA 2AJQB 2B3SA 5COHA 2DJ0A 3DKSA 2FNOA 2IMFA 1ST9A 2C0EA 1PL1A 2BTOT 5EY6A 2I1UA 1K0CA 2YWMA 2OE3A 3TKSC 1MDKA 2O7KA 1TXXA 5B7CA 13GSA 1MDJA 3CRTA 5HFKA 2ALBA 4N11A 2A4HA 3FZ4A 3EPTA 2L4QA 1FHEA 2FUG2 2L5LA 5CAXA 1AUCA 3IV4A 1O73A 1M3JA 1WOUA 1Z7PA 4KAEA 1ZL9A 2JADA 1WP0A 5J41A 5ELAA 2YN1A 3DRNA 4G2EA 2LRTA 1THXA 4HZ4A 1E6BA 4FIWA 1XW6A 1O6JA 1K3YA 5AISA 2FWGA 2C0DA 3N9JA 3LXZA 2VCXA 1EOGA 4IJIA 1PA3A 3RAZA 1F3BA 1QQ2A 1K3LA 4MABA 1OE8A 1B9YC 6GSXA 2L6DA 2VOCA 2PGTA 1U88A 2YP6A 2IMDA 2C3NA 3KD0A 3HKRA 3I43A 4JZQA 2B6MA 1N8JA 2HFDA 3M0FA 3VLNA 1R26A 4K0GA 4YKGA 3HHVA 4IP6A 3V1WA 3QAGA 1EZKA 4NPBA 4BVXB 3H8QA 2LV3A 4Z2UA 2EIQA 1FG4A 1KTEA 1EP7A 3HDCA 2F9SA 4O92A 4MA9A 1HD2A 2CVDA 5LCZA 1TK8B 2HRKA 2N5AA 2J23A 4I5QA 5L71A 4QQ7A 1NHYA 3GH9A 1M9BA 1G7EA 2GZPA 4CY6A 3APQA 3TKPA 1ZYEA 4GLTA 4GQFA 3D4TA 2H6XA 1U87A 2DJJA 2GVPA 3IAM2 3KCMA 4Q5FA 5IPHA 1TOFA 3FEUA 2PERA 4H86A 3TGZA 3F4TA 1A2MA 3TJBA 5IIZA 3WGXA 1X5EA 1GH2A 1OC9B 1FAAA 2X8CA 3TRPA 5JCGA 1PX7A 3GHAA 2OBKA 2KLXA 2K9FA 2O89A 1G0TA 2GSTA 4NV5A 4TVEA 5G31A 1G7OA 5G1LA 4YAVA 4K1FA 2CZ2A 4IQ1A 3PGTA 1S3CA 4EIPA 4IS0A 1OVNA 3IE3A 4NHWA 2C80A 4P3YB 4TR1B 2FA8A 2CX4A 2B5EA 2VIMA 2GSSA 4WR4A 3R3EA 1PN9A 2IFQA 1AAZA 2YV9A 2HT9A 5BRTA 1XXUA 5A4UA 3UVHA 3GV1A 3GL3A 4ZL9A 1GTIA 1DBYA 5DCHA 2CZ3A 5CREA 9GSSA 3J7Yb 3C71A 1XW5A 2JSZA 3ZVJD 2VCQA 2C1YA 3BJ5A 2PBJA 4HI7A 8GSSA 1PGTA 1WIKA 4IKHA 2ES7A 1BG5A 3CYNA 4HJMA 4YAPA 1V40A 1ZOFA 3HVVA 1X9WB 3QOUA 4BL7B 3EVIA 1V2AA 1GUKA 1GNWA 5GSTA 3QFBC 6GSWA 4HZ2A 3TJKA 4RUVA 2B1KA 3KXOA 1AQVA 2LUSA 2FCHA 3W8SA 4EKZA 5ECOB 1SJIA 2WJUA 4I97A 4PQ1A 1GSSA 3MNGA 1GUMA 1DUGA 3FMWA 2KOKA 3M1GA 3RBTA 2LNTA 2VL9A 3K8NA 4ML6A 3WT1A 1BEDA 3H1NA 4G9HA 2FA4A 1F6MC 3MWHA 4I8BA 5GAND 3RPNA 1WPIA 2NVLA 3EMPA 2HSHA 4ECJA 3L9UA 4ZBDA 3TRXA 3KJYA 4MK3A 4KGIA 4POLA 1B4PA 3G7JA 2JSYA 2CX3A 2A2SA 2WCIA 5F06A 1PD21 4PGTA 4HQSA 1ZGNA 1XWCA 3ZTLA 3LYKA 5IO2A 4K8MA 4TR0A 2A4VA 3US3A 2RM6A 4ULXA 3D4MA 4GWRA 1SL2B 2I9HA 4MPFA 4TKYA 2H1GA 2WGRA 2WULA 5CP1A 4DSSA 2XC2A 2VCTA 2H72A 4YQMA 1M2DA 3BCKA 4K2XA 1M9AA 5FHIA 1CQGA 1OC8A 3F4SA 3VPTA 1Z6NA 1WRYA 2X4AA 3DVWA 4KDYA 3ZITA 22GSA 1ERVA 3FR6A 2FHEA 4ZIJA 1F3AA 2YZHA 5IOXA 2B5XA 5GAPD 4IVFA 3VFIA 1EEJA 2GQKA 3LYPA 3QD9A 1Y25A 2REMA 2R0CA 1CQHA 4O5RA 2H6ZA 4X1UA 2VD1A 1G6YA 2YWNA 2LNSA 2V41A 3IRAA 3GX0A 3UL3A 1GUHA 5EVOA 3LWAA 3WD6A 4HDEA 3GKMA 3DIEA 1Z7RA 3E3EA 1M2AA 4EUYA 2O8VB 2R0PA 1QK8A 1YKAA 2DKIA 1R4WA 1HNAA 3IBHA 5E59A 3LGCA 2P5RA 2KP2A 2L57A 4MF7A 4MJAA 4JR4A 2YANA 2HZEA 1GP1A 5JCUA 14GSA 1F2EA 2JL4A 3GURA 5KN3A 2F51A 1XWBA 1XVWA 3IK7A 3TOUA 1JZWA 2H74A 1X9MB 3VURA 1GSDA 5HR0A 2R37A 2VL2C 3QAVA 2XPDA 1SK2A 3M3MA 3TKRA 4DVCA 3GTUB 2GZZA 1JFUA 2OE1A 4WEYA 3D6IA 3D5JA 2LS5A 2PMTA 2RM5A 2L4CA 1GRXA 3IC8A 2RUFA 19GSA 2CA8A 3QFAC 4EVMA 2DIYA 2LJRA 5IQYA 1GWCA 4GSNA 4KA0A 2AHEA 4FYUA 1Y6EA 3D22A 1X5CA 2WZ9A 4MF5A 1FOVA 2VUPA 3F0IA 1PL2A 4V2LA 4BVYA 2X64A 1B9XC 3HY2A 1SK1A 2DMMA 2H30A 2IMEA 3ED3A 3BBYA 4F0BA 3IPZA 2P31A 5ECLB 3RDWA 3LQ7A 1R5AA 2H66A 1XCCA 3GA4A 3CSHA 5ECMB 1OYJA 4MZCA 1Z9HA 6GSVA 5IMAA 4FO5A 3LW9A 3IR4A 2CQ9A 5D9XA 3I9V2 5J3RA 4WR5A 4XTSA 4GF0A 4FYCA 1PQNA 3I6AA 4MPGA 1JZRA 5G5EA 1UA5A 1B8XA 2HI7A 3D0ZA 3KMNA 3FZ9A 3GKNA 1V98A 3M9KA 3TCOA 1ZYQB 2OACA 1B4QA 4D73A 4AJ6A 3WYWA 2CVKA 1AW9A 2V6OA 2PWJA 4IN0A 4MNNA 1J08A 1IYIA 3GKXA 2AB6A 2GGTA 1QFNA 2G2QA 4K5RA 4POKA 1QXHA 3NIVA 2FWFA 4XS4B 3DGQA 4ZBAA 4TOPA 4JRRA 1U6TA 2EIRA 4L8EA 1T8EB 3NZNA 1SKRB 2YNXA 5GZZB 3O3TA 1TDIA 3FR9A 1HNCA 4HQZA 2X49A 2HYXA 1BQ7A 3KGKA 2QSIA 5DAKB 3Q19A 3HYPA 5D9VA 4PUAA 5D73A 2QA1A 4TXOB 4ACSA 4JBBA 1XW9A 4F2IA 3GYKA 5E4WA 6GSSA 2H19A 2HRAA 1HYUA 3CXGA 2YCDA 4KB3A 2LQQA 4K2DA 2GQMA 1FO5A 3CSJA 2GLRA 3DXBA 3JCML 1QUWA 4IJ3A 3ZVJA 3TJFA 3CTFA 1ERWA 4BIKA 1AC1A 1O7UA 1T7PB 3C8EA 2QC7A 3BOAA 4TW5A 1RK4A 3QCPA 4LLRA 3G7YA 3TKSE 1ML6A 3VI7A 2H0IA 3ZYWA 2CVBA 4L0UA 5DALB 4MCUA 4NXIA 2DMLA 3D21A 4EDZA 1GSFA 2VL2A 4G19A 5JWOB 3KP9A 4N0ZA 3ZIVA 3UEMA 1FVJA 5KN1A 2DSAA 4AF2A 4ID0A 1YF0A 5CYYA 3L4NA 4KF9A 4CDOA 4CY8A 3H79A 4JE1A 3VWXA 3UJ1A 1YKCA 2PUKC 1TP9A 1WMJA 2L59A 5ABRA 1TU7A 4YH2A 5IMFA 4G0KA 1N2AA 2KUCA 4OD7A 2AAWA 2LKUA 1TJDA 4ZB8A 4I2UA 1BX9A 2A2RA 5INYA 3S9FA 2JZSA 4HEA2 5G1KA 4USSA 3KTBA 5EPFA 4OWYA 3LG6A 2R5GA 3RHCA 1NW2A 3IDVA 2TRCP 1K0AA 2GDRA 4Z2RA 5H5QA 2ZNMA 1V57A 1OKDA 2IL3A 2R4VA 3FRCA 5LNKe 2AYTA 3PH9A 1T4ZA 1W89A 2FLSA 1TU8A 4EL1A 1GSEA 4K0NA 2WDUA 1V58A 1WWJA 3M9JA 1GTBA 1ABAA 3MAKA 1XBSA 1OAZA 3IHQA 3DD3A 2DBCA 2N5FA 3PR8A 5B8BA 1EWXA 2IPAA 3FK8A 4X4JA 2VCWA 2H1DA 1JLVA 1TI1A 1OC3A 5KOXA 18GSA 1Q4JA 3G9BA 1AQXA 1ERUA 4DEJA 3BD2A 3IOSA 3ZL5A 2R6KA 2B7KA 1S3AA 4IGJA 1URMA 3GX8A 4HUAA 4PXOA 3FHKA 3BCIA 1EV9A 4TXVA 5AIXA 1FB6A 2MMAA 3APOA 4KDXA 2CAQA 4N30A 1NM3A 1BJXA 4HJ2A 5ECPB 2AUVA 2I81A 4OO5A 1MD4A 1T4YA 4AJ7A 20GSA 3P90A 3RPPA 1MD3A 3I69A 2PVOC 4TRXA 2VAFA 3HJMA 3O6TA 3VK9A 1T1VA 3Q18A 3A5IA 3EYTA 1A2LA 2ON5A 2C8UA 3P2AA 1JZOA 3LFLA 1A8YA 4TR3A 17GSA 1SL1B 4PNFA 5KOWA 3TJGA 2OKAA 4IBPA 1QGVA 4ZL8A 2MYGA 3FYGA 4MP4A 2Z9SA 1SYRA 4KW6A 4HOJA 5J4UA 1J0FA 1PN0A 3DYRA 3L9VA 5DVBA 2PN8A 2IMKA 4BVXA 5ID2B 2K8VA 4WKWA 4GSSA 2GS3A 3C1SA 4K7NA 5DQSA 2DJ3A 3VWUA 4KH7A 4FYBA 4MJEA 2P5QA 2VLVA 1JZDA 3ISOA 3KH9A 3GRXA 4GXZA 3EE2A 5ECKB 3ZMLA 3VWWA 2H1BA 2MZCA 3VWVA 2VL3A 3P8WA 2MBTA 4ZB9A 4Z7XA 3MYDA 5AGYA 5D8IA 1ZZYA 3DWVA 5ECRB 2HE3A 2HSYA 2D2ZA 2HRFA 3H4KA 2C3QA 2QGVA 2RIIA 3IA1A 4DSRA 1GLPA 2OJLA 1SU9A 2C3TA 4ML1A 1YDKA 3TJJA 1G6WA 2H70A 4MMMA 3UARA 1SK0A 5EL8A 4F82A 2R3XA 2EC4A 4JR6A 1OC9A 4MF6A 5ECIB 1GTUA 5FT3A 1A23A 6GSYA 2XBIA 3SWLA 3LJRA 4WBJA 2A2PA 3A2WA 4MZWA 5GSSA 2I4AA 3F9UA 4KUNA 2V32A 3O76A 4EO3A 4YQVA 4IP1A 3IK9A 5G30A 3FR3A 5IM9A 4E8HA 4CW9A 1TW9A 2X99A 1XZOA 1GSQA 3F6FA 2F8AA 3MSZA 1V9WA 2M72A 4K7OA 2V2GA 4V1Ap 4OO4A 4TR1A 4G0LA 2GTUA 6GSTA 2YJ7A 4OFMA 1Q98A 2E2MA 1PMTA 3KTLA 4BPYA 3E0UA 1Z5YE 3FKFA 2ZCTA 4OCFA 5G2ZA 3EURA 4AGSA 2WFCA 2H01A 2HXKA 5CNWA 3EINA 1USBA 2NPBA
chains in the Genus database with same CATH topology
1PX6A 1JHBA 4KDUA 4F9ZA 3GH6A 1K3OA 3EWLA 5LD0A 1J9BA 2H73A 1VGLA 4HS1A 2X8HA 2DJ1A 2YJHA 2R2JA 2H1AA 4BL7A 3F3QA 4WF4A 4TN8A 1KEBA 1O81A 2HLSA 1H75A 1YY7A 1GSUA 2C0FA 2K6VA 2IIYA 2B5YA 2FWEA 1THOA 2GQLA 4ECCA 3ZFLA 3F4RA 4OMVA 3UIWA 5HFIA 1YZXA 3HJOA 12GSA 1M99A 2LJKA 4RI6A 5KN2A 4XCSA 1HQOA 3KH7A 4N10A 4L5LA 4MJBA 1VF1A 3A5WA 1TI3A 2IWTA 2L5OA 1PSQA 1YEPA 2QA2A 4I6XA 2DJKA 3E9JB 3KZQA 5DBQA 1FW1A 1VF3A 3GKKA 1O8WA 3IHGA 3ZFBA 1LBKA 4HU7A 2N5BA 4JEDA 1E2YA 2MMOA 2DC5A 4XS6A 3GIXA 3C7MA 1LU4A 2JZRA 1VF4A 1K0OA 4NWYA 4GTUA 3ZMKA 1W4VA 2ZUPA 2RLIA 1JLWA 2J9HA 1YQ1A 2H8LA 3PPUA 5C04A 4XRDA 1RQMA 3APSA 4IHUA 2TIRA 2HNLA 5AN1A 2LQOA 4KSMA 1TRVA 2GZYA 4O32A 5H5RA 4O5QA 2IJYA 4QL7A 2WS2A 1TKDB 1OE7A 3OR5A 2I3YA 4LA1A 2LJAA 3A2XA 4KSOA 4V2NA 1GTAA 2H71A 1ERTA 1DE2A 2IFQB 1O8XA 1SKSB 1WJKA 5DDLA 3FZAA 4EC0A 1Z3EA 5CRHA 4J57E 3FZ5A 1DSBA 2BJXA 3DEXA 4L0WA 4YKFA 4F0CA 5J9CA 1GLQA 4IW9A 5DJMA 3CMIA 4J2FA 1OKTA 2HZFA 3G7IA 1TTZA 1RW1A 5HR3A 5JWRB 2O85A 3HD5A 2H76A 1B48A 2OADA 3DVXA 5D9WA 5IMZA 5HQPA 3TB2A 2VCVA 5JCWA 1SD9A 2PVQA 2YWIA 2OA7A 3ZRDA 5KEJA 3HXSA 1DE1A 2B1LA 5D96A 5DJLA 1EGRA 4RI7A 1YJ6A 1Z6MA 2HRNA 1MTCA 3GSTA 4KCEA 4GCIA 5CRGA 2K8SA 4PQIA 2XBQA 3CTGA 3WT2A 1AQWA 1XWKA 2M80A 4G0IA 4XRAA 3GTUA 3QAWA 4E8EA 3ME7A 1C72A 3GNJA 2WRTA 2FWHA 3F6DA 1XWAA 3LEFA 1ZMAA 5HR2A 1PKWA 2YOIA 4RQXA 1XOAA 2LTKA 1NHOA 1GNEA 1O85A 4FQUA 1I5GA 4EE0A 1BYEA 1TK5B 1UN2A 1FOHA 2YPMA 1QMVA 2VM2A 5HR1A 1K0DA 2B7JA 4NMUA 2M46A 2JU5A 2VM1A 4AJ8A 1TRSA 5CRDA 1M0UA 5J9BA 1GULA 1TK0B 5A4WA 3HZ8A 2DLXA 1KNGA 5B6MA 1S3DA 4GRFA 1ZYNA 1HNBA 2X8GA 3MIXA 4DSQA 4DSSB 4PNGA 1VRSD 4KCAA 1WE0A 5C00A 2AV4A 2XHFA 4A5PA 2GT5A 1X9SB 3QMXA 3RHBA 2CV4A 5DQYA 2FY6A 4LL1B 3HVXA 5A5KA 1XFLA 4GSTA 4BWQA 3HJPA 2YV7A 2V1MA 1MDIA 3C1RA 2H0GA 2C4JA 2E2GA 1ZYPA 5IMVA 4NV2A 4YQUA 1XVQA 4XS4A 3UBLA 3AY8A 4NAXA 3SBCA 1F9MA 1KBNA 4ZBBA 5F8BA 1AXDA 2O87A 3J7Yk 1SENA 2GT6A 1A8LA 1SJ6A 1I9DA 1X0RA 5DAKA 3W8JA 4Q5QA 4OFNA 3HZ4A 1K0NA 11GSA 1ILOA 3GFKA 1U3AA 4TXOA 3N5OA 4RQRA 2K18A 4N0VA 2C0GA 2G0FA 1NSWA 2F3MA 2QKEA 3UOMA 3U6VA 3HA9A 2E0QA 4OFTA 5AIVA 3WGDA 2HZEB 3L0HA 2PPTA 5B8AA 2TRXA 2MMNA 2IMIA 4ICYA 5A4VA 3TKSA 2P0GA 1R5PA 3UAPA 2KP1A 2LRNA 2XPEA 4PQHA 1TRWA 2FD3A 3UVTA 2VCZA 5G5FA 3FW2A 4LMWA 1A0RP 5ECNB 5IMDA 1XOBA 1A24A 2H75A 4POBA 3EC3A 1M7TA 3TUEA 1F37A 1K0MA 1EEMA 5ECSA 1GL8A 5IMCA 2VLUA 5D93A 2NTOA 1YEXA 4K5SA 4L5OA 5DALA 4POMA 2PU9C 1H4OA 2DIZA 4BVYB 5ECHB 3M8NA 3F3RA 2VLTA 1BAYA 1EV4A 4XIHA 3TRQA 5F0GA 2OE0A 4PX1A 5FWGA 3IXRA 2JZTA 3LSZA 4OCEA 1ZCPA 3A3TA 3GMFA 3ERWA 2FGXA 4EIQA 5JWQB 4O7HA 1TRUA 5KN0A 3FY7A 3KIJA 2R0GA 2VO4A 3QPMA 5J5NA 2DKHA 4D73B 5IOWA 2GSQA 4WXTA 3F8UA 2YWOA 2MMZA 4KX4A 3QDNA 3HVSA 4WBRD 2HSMA 5ENUA 4Q5RA 1MEKA 1T00A 3EU4A 1A0FA 2DJ2A 4V2MA 1EOHA 3GUSA 4ZB6A 1ON4A 1PKZA 2E7PA 2LRCA 1XIYA 2L6CA 4ECIA 3KMOA 4PUFC 1SYXA 2GSRA 4ZXGA 3KP8A 4NHZA 3Q6OA 3L9SA 2MBSA 3U5RE 4MLYA 3L78A 3IC4A 2ON7A 3LORA 4JU5A 3ZIJA 2LEGA 3ZZXA 3A2VA 2VD0A 10GSA 4Z2TA 3CBUA 4ZL7A 1FB0A 1UVZA 4ZILA 3UBKA 1XPVA 7GSSA 6GSUA 2H6YA 4K7IA 3TOTA 2F8FA 2OBIA 1M2BA 4X0XA 3Q74A 3W6GA 5F05A 4PURA 2UZ8A 5CO3A 3VI5A 4F03A 2V6KA 4ISDA 3WGEA 4TR4A 4GQCA 4EF0A 2CT6A 1SL0B 1SJZA 4LL4B 1R7HA 3CRUA 4MH3A 5BMUA 2NBSA 4K9ZA 4KNDA 3C73A 5HFGA 1U3IA 4X43A 4EXJA 1UC7A 5ECQB 5IO0A 4EDYA 2LSTA 4HU9A 5B6NA 3R2QA 2WB9A 2YZUA 4J56E 3ZREA 3TDGA 5IPGA 3GSSA 1XWGA 3F63A 1EGOA 4V1Ag 4KE3A 2IN3A 2RUEA 1K0BA 5D9TA 2CAIA 4XS1A 2EIOA 3UMAA 2NDOA 2KHPA 4BA7A 4PTSA 5ELGA 4O5UA 3DMLA 5ID2A 3EU3A 16GSA 3NOFA 1IYHA 4I2TA 4MDCA 1AIUA 3MDKA 4LMVA 3IAS2 4K6XA 1YF1A 3ERFA 3GN3A 1T3BA 3QR6A 1SD8A 5H5SA 3KM6A 4G10A 5F07A 1EP8A 4ECBA 4BWSA 1ACVA 4MH2A 2BMXA 2JACA 4WETA 4FH8A 3ZLPA 3ERGA 3VPQA 3ME8A 4XHMA 3P7XA 4WF5A 4QL9A 4Q5NA 3TKQA 1X5DA 3KEBA 5CRWA 1SKWB 3PINA 4IELA 4IQAA 1GSYA 4MZBA 3LXTA 4CHSA 3HCZA 2H0HA 5DCGA 1PRXA 1VF2A 3CSIA 4MJCA 3GL5A 1LJRA 1A2JA 3EMXA 3H93A 4ILFA 1FVKA 2AJQB 2B3SA 5COHA 2DJ0A 3DKSA 2FNOA 2IMFA 1ST9A 2C0EA 1PL1A 2BTOT 5EY6A 2I1UA 1K0CA 2YWMA 2OE3A 3TKSC 1MDKA 2O7KA 1TXXA 5B7CA 13GSA 1MDJA 3CRTA 5HFKA 2ALBA 4N11A 2A4HA 3FZ4A 3EPTA 2L4QA 1FHEA 2FUG2 2L5LA 5CAXA 1AUCA 3IV4A 1O73A 1WOUA 1Z7PA 4KAEA 1ZL9A 2JADA 1WP0A 5J41A 5ELAA 2YN1A 3DRNA 4G2EA 2LRTA 1THXA 4HZ4A 1E6BA 4FIWA 1XW6A 1O6JA 1K3YA 5AISA 2FWGA 2C0DA 3N9JA 3LXZA 2VCXA 1EOGA 4IJIA 1PA3A 3RAZA 1F3BA 1QQ2A 1K3LA 4MABA 1OE8A 1B9YC 6GSXA 2L6DA 2VOCA 2PGTA 1U88A 2YP6A 2IMDA 2C3NA 3KD0A 3HKRA 3I43A 4JZQA 2B6MA 1N8JA 2HFDA 3M0FA 3VLNA 1R26A 4K0GA 4YKGA 3HHVA 4IP6A 3V1WA 3QAGA 1EZKA 4NPBA 4BVXB 3H8QA 2LV3A 4Z2UA 2EIQA 1FG4A 1KTEA 1EP7A 3HDCA 2F9SA 4O92A 4MA9A 1HD2A 2CVDA 5LCZA 1TK8B 2HRKA 2N5AA 2J23A 4I5QA 5L71A 4QQ7A 1NHYA 3GH9A 1M9BA 1G7EA 2GZPA 4CY6A 3APQA 3TKPA 1ZYEA 4GLTA 4GQFA 3D4TA 2H6XA 1U87A 2DJJA 2GVPA 3IAM2 3KCMA 4Q5FA 5IPHA 1TOFA 3FEUA 2PERA 4H86A 3TGZA 3F4TA 1A2MA 3TJBA 5IIZA 3WGXA 1X5EA 1GH2A 1OC9B 1FAAA 2X8CA 3TRPA 5JCGA 1PX7A 3GHAA 2OBKA 2KLXA 2K9FA 2O89A 1G0TA 2GSTA 4NV5A 4TVEA 5G31A 1G7OA 5G1LA 4YAVA 4K1FA 2CZ2A 4IQ1A 3PGTA 1S3CA 4EIPA 4IS0A 1OVNA 3IE3A 4NHWA 2C80A 4P3YB 4TR1B 2FA8A 2CX4A 2B5EA 2VIMA 2GSSA 4WR4A 3R3EA 1PN9A 2IFQA 1AAZA 2YV9A 2HT9A 5BRTA 1XXUA 5A4UA 3UVHA 3GV1A 3GL3A 4ZL9A 1GTIA 1DBYA 5DCHA 2CZ3A 5CREA 9GSSA 3J7Yb 3C71A 1XW5A 2JSZA 3ZVJD 2VCQA 2C1YA 3BJ5A 2PBJA 4HI7A 8GSSA 1PGTA 1WIKA 4IKHA 2ES7A 1BG5A 3CYNA 4HJMA 4YAPA 1V40A 1ZOFA 3HVVA 1X9WB 3QOUA 4BL7B 3EVIA 1V2AA 1GUKA 1GNWA 5GSTA 3QFBC 6GSWA 4HZ2A 3TJKA 4RUVA 2B1KA 3KXOA 1AQVA 2LUSA 2FCHA 3W8SA 4EKZA 5ECOB 1SJIA 2WJUA 4I97A 4PQ1A 1GSSA 3MNGA 1GUMA 1DUGA 3FMWA 2KOKA 3M1GA 3RBTA 2LNTA 2VL9A 3K8NA 4ML6A 3WT1A 1BEDA 3H1NA 4G9HA 2FA4A 1F6MC 3MWHA 4I8BA 5GAND 3RPNA 1WPIA 2NVLA 3EMPA 2HSHA 4ECJA 3L9UA 4ZBDA 3TRXA 3KJYA 4MK3A 4KGIA 4POLA 1B4PA 3G7JA 2JSYA 2CX3A 2A2SA 2WCIA 5F06A 1PD21 4PGTA 4HQSA 1ZGNA 1XWCA 3ZTLA 3LYKA 5IO2A 4K8MA 4TR0A 2A4VA 3US3A 2RM6A 4ULXA 3D4MA 4GWRA 1SL2B 2I9HA 4MPFA 4TKYA 2H1GA 2WGRA 2WULA 5CP1A 4DSSA 2XC2A 2VCTA 2H72A 4YQMA 1M2DA 3BCKA 4K2XA 1M9AA 5FHIA 1CQGA 1OC8A 3F4SA 3VPTA 1Z6NA 1WRYA 2X4AA 3DVWA 4KDYA 3ZITA 22GSA 1ERVA 3FR6A 2FHEA 4ZIJA 1F3AA 2YZHA 5IOXA 2B5XA 5GAPD 4IVFA 3VFIA 1EEJA 2GQKA 3LYPA 3QD9A 1Y25A 2REMA 2R0CA 1CQHA 4O5RA 2H6ZA 4X1UA 2VD1A 1G6YA 2YWNA 2LNSA 2V41A 3IRAA 3GX0A 3UL3A 1GUHA 5EVOA 3LWAA 3WD6A 4HDEA 3GKMA 3DIEA 1Z7RA 3E3EA 1M2AA 4EUYA 2O8VB 2R0PA 1QK8A 1YKAA 2DKIA 1R4WA 1HNAA 3IBHA 5E59A 3LGCA 2P5RA 2KP2A 2L57A 4MF7A 4MJAA 4JR4A 2YANA 2HZEA 1GP1A 5JCUA 14GSA 1F2EA 2JL4A 3GURA 5KN3A 2F51A 1XWBA 1XVWA 3IK7A 3TOUA 1JZWA 2H74A 1X9MB 3VURA 1GSDA 5HR0A 2R37A 2VL2C 3QAVA 2XPDA 1SK2A 3M3MA 3TKRA 4DVCA 3GTUB 2GZZA 1JFUA 2OE1A 4WEYA 3D6IA 3D5JA 2LS5A 2PMTA 2RM5A 2L4CA 1GRXA 3IC8A 2RUFA 19GSA 2CA8A 3QFAC 4EVMA 2DIYA 2LJRA 5IQYA 1GWCA 4GSNA 4KA0A 2AHEA 4FYUA 1Y6EA 3D22A 1X5CA 2WZ9A 4MF5A 1FOVA 2VUPA 3F0IA 1PL2A 4V2LA 4BVYA 2X64A 1B9XC 3HY2A 1SK1A 2DMMA 2H30A 2IMEA 3ED3A 3BBYA 4F0BA 3IPZA 2P31A 5ECLB 3RDWA 3LQ7A 1R5AA 2H66A 1XCCA 3GA4A 3CSHA 5ECMB 1OYJA 4MZCA 1Z9HA 6GSVA 5IMAA 4FO5A 3LW9A 3IR4A 2CQ9A 5D9XA 3I9V2 5J3RA 4WR5A 4XTSA 4GF0A 4FYCA 1PQNA 3I6AA 4MPGA 1JZRA 5G5EA 1UA5A 1B8XA 2HI7A 3D0ZA 3KMNA 3FZ9A 3GKNA 1V98A 3M9KA 3TCOA 1ZYQB 2OACA 1B4QA 4D73A 4AJ6A 3WYWA 2CVKA 1AW9A 2V6OA 2PWJA 4IN0A 4MNNA 1J08A 1IYIA 3GKXA 2AB6A 2GGTA 1QFNA 2G2QA 4K5RA 4POKA 1QXHA 3NIVA 2FWFA 4XS4B 3DGQA 4ZBAA 4TOPA 4JRRA 1U6TA 2EIRA 4L8EA 1T8EB 3NZNA 1SKRB 2YNXA 5GZZB 3O3TA 1TDIA 3FR9A 1HNCA 4HQZA 2X49A 2HYXA 1BQ7A 3KGKA 2QSIA 5DAKB 3Q19A 3HYPA 5D9VA 4PUAA 5D73A 2QA1A 4TXOB 4ACSA 4JBBA 1XW9A 4F2IA 3GYKA 5E4WA 6GSSA 2H19A 2HRAA 1HYUA 3CXGA 2YCDA 4KB3A 2LQQA 4K2DA 2GQMA 1FO5A 3CSJA 2GLRA 3DXBA 3JCML 1QUWA 4IJ3A 3ZVJA 3TJFA 3CTFA 1ERWA 1AC1A 1O7UA 1T7PB 3C8EA 2QC7A 3BOAA 4TW5A 1RK4A 3QCPA 4LLRA 3G7YA 3TKSE 1ML6A 3VI7A 2H0IA 3ZYWA 2CVBA 4L0UA 5DALB 4MCUA 4NXIA 2DMLA 3D21A 4EDZA 1GSFA 2VL2A 4G19A 5JWOB 3KP9A 4N0ZA 3ZIVA 3UEMA 1FVJA 5KN1A 2DSAA 4AF2A 4ID0A 1YF0A 5CYYA 3L4NA 4KF9A 4CDOA 4CY8A 3H79A 4JE1A 3VWXA 3UJ1A 1YKCA 2PUKC 1TP9A 1WMJA 2L59A 5ABRA 1TU7A 4YH2A 5IMFA 4G0KA 1N2AA 2KUCA 4OD7A 2AAWA 2LKUA 1TJDA 4ZB8A 4I2UA 1BX9A 2A2RA 5INYA 3S9FA 2JZSA 4HEA2 5G1KA 4USSA 3KTBA 5EPFA 4OWYA 3LG6A 2R5GA 3RHCA 1NW2A 3IDVA 2TRCP 1K0AA 2GDRA 4Z2RA 5H5QA 2ZNMA 1V57A 1OKDA 2IL3A 2R4VA 3FRCA 5LNKe 2AYTA 3PH9A 1T4ZA 1W89A 2FLSA 1TU8A 4EL1A 1GSEA 4K0NA 2WDUA 1V58A 1WWJA 3M9JA 1GTBA 1ABAA 3MAKA 1XBSA 1OAZA 3IHQA 3DD3A 2DBCA 2N5FA 3PR8A 5B8BA 1EWXA 2IPAA 3FK8A 4X4JA 2VCWA 2H1DA 1JLVA 1TI1A 1OC3A 5KOXA 18GSA 1Q4JA 3G9BA 1AQXA 1ERUA 4DEJA 3BD2A 3IOSA 3ZL5A 2R6KA 2B7KA 1S3AA 4IGJA 1URMA 3GX8A 4HUAA 4PXOA 3FHKA 3BCIA 1EV9A 4TXVA 5AIXA 1FB6A 2MMAA 3APOA 4KDXA 2CAQA 4N30A 1NM3A 1BJXA 4HJ2A 5ECPB 2AUVA 2I81A 4OO5A 1MD4A 1T4YA 4AJ7A 20GSA 3P90A 3RPPA 1MD3A 3I69A 2PVOC 4TRXA 2VAFA 3HJMA 3O6TA 3VK9A 1T1VA 3Q18A 3A5IA 3EYTA 1A2LA 2ON5A 2C8UA 3P2AA 1JZOA 3LFLA 1A8YA 4TR3A 17GSA 1SL1B 4PNFA 5KOWA 3TJGA 2OKAA 4IBPA 1QGVA 4ZL8A 2MYGA 3FYGA 4MP4A 2Z9SA 1SYRA 4KW6A 4HOJA 5J4UA 1J0FA 1PN0A 3DYRA 3L9VA 5DVBA 2PN8A 2IMKA 4BVXA 5ID2B 2K8VA 4WKWA 4GSSA 2GS3A 3C1SA 4K7NA 5DQSA 2DJ3A 3VWUA 4KH7A 4FYBA 4MJEA 2P5QA 2VLVA 1JZDA 3ISOA 3KH9A 3GRXA 4GXZA 3EE2A 5ECKB 3ZMLA 3VWWA 2H1BA 2MZCA 3VWVA 2VL3A 3P8WA 2MBTA 4ZB9A 4Z7XA 3MYDA 5AGYA 5D8IA 1ZZYA 3DWVA 5ECRB 2HE3A 2HSYA 2D2ZA 2HRFA 3H4KA 2C3QA 2QGVA 2RIIA 3IA1A 4DSRA 1GLPA 2OJLA 1SU9A 2C3TA 4ML1A 1YDKA 3TJJA 1G6WA 2H70A 4MMMA 3UARA 1SK0A 5EL8A 4F82A 2R3XA 2EC4A 4JR6A 1OC9A 4MF6A 5ECIB 1GTUA 5FT3A 1A23A 6GSYA 2XBIA 3SWLA 3LJRA 4WBJA 2A2PA 3A2WA 4MZWA 5GSSA 2I4AA 3F9UA 4KUNA 2V32A 3O76A 4EO3A 4YQVA 4IP1A 3IK9A 5G30A 3FR3A 5IM9A 4E8HA 4CW9A 1TW9A 2X99A 1XZOA 1GSQA 3F6FA 2F8AA 3MSZA 1V9WA 2M72A 4K7OA 2V2GA 4V1Ap 4OO4A 4TR1A 4G0LA 2GTUA 6GSTA 2YJ7A 4OFMA 1Q98A 2E2MA 1PMTA 3KTLA 4BPYA 3E0UA 1Z5YE 3FKFA 2ZCTA 4OCFA 5G2ZA 3EURA 4AGSA 2WFCA 2H01A 2HXKA 5CNWA 3EINA 1USBA 2NPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PX6 A;  1JHB A;  4KDU A;  4F9Z A;  3GH6 A;  1K3O A;  3EWL A;  5LD0 A;  1J9B A;  2H73 A;  1VGL A;  4HS1 A;  2X8H A;  2DJ1 A;  2YJH A;  2R2J A;  2H1A A;  4BL7 A;  3F3Q A;  4WF4 A;  4TN8 A;  1KEB A;  1O81 A;  2HLS A;  1H75 A;  1YY7 A;  1GSU A;  2C0F A;  2K6V A;  2IIY A;  2B5Y A;  2FWE A;  1THO A;  2GQL A;  4ECC A;  3ZFL A;  3F4R A;  4OMV A;  3UIW A;  5HFI A;  1YZX A;  3HJO A;  12GS A;  1M99 A;  2LJK A;  4RI6 A;  5KN2 A;  4XCS A;  1HQO A;  3KH7 A;  4N10 A;  4L5L A;  4MJB A;  1VF1 A;  3A5W A;  1TI3 A;  2IWT A;  2L5O A;  1PSQ A;  1YEP A;  4I6X A;  2DJK A;  3E9J B;  3KZQ A;  5DBQ A;  1FW1 A;  1VF3 A;  3GKK A;  1O8W A;  3ZFB A;  1LBK A;  4HU7 A;  2N5B A;  4JED A;  1E2Y A;  2MMO A;  2DC5 A;  4XS6 A;  3GIX A;  3C7M A;  1LU4 A;  2JZR A;  1VF4 A;  1K0O A;  4NWY A;  4GTU A;  3ZMK A;  1W4V A;  2ZUP A;  2RLI A;  1JLW A;  2J9H A;  1YQ1 A;  2H8L A;  5C04 A;  4XRD A;  1RQM A;  3APS A;  4IHU A;  2TIR A;  2HNL A;  5AN1 A;  2LQO A;  4KSM A;  1TRV A;  2GZY A;  4O32 A;  5H5R A;  2IJY A;  4QL7 A;  2WS2 A;  1TKD B;  1OE7 A;  3OR5 A;  2I3Y A;  4LA1 A;  2LJA A;  3A2X A;  4KSO A;  4V2N A;  1GTA A;  2H71 A;  1ERT A;  1DE2 A;  2IFQ B;  1O8X A;  1SKS B;  1WJK A;  5DDL A;  3FZA A;  4EC0 A;  1Z3E A;  5CRH A;  4J57 E;  3FZ5 A;  1DSB A;  2BJX A;  3DEX A;  4L0W A;  4F0C A;  5J9C A;  1GLQ A;  4IW9 A;  5DJM A;  3CMI A;  4J2F A;  1OKT A;  2HZF A;  3G7I A;  1TTZ A;  1RW1 A;  5HR3 A;  5JWR B;  2O85 A;  3HD5 A;  2H76 A;  1B48 A;  2OAD A;  3DVX A;  5D9W A;  5IMZ A;  5HQP A;  3TB2 A;  2VCV A;  5JCW A;  1SD9 A;  2PVQ A;  2YWI A;  2OA7 A;  3ZRD A;  5KEJ A;  3HXS A;  1DE1 A;  2B1L A;  5D96 A;  5DJL A;  1EGR A;  4RI7 A;  1YJ6 A;  1Z6M A;  2HRN A;  1MTC A;  3GST A;  4KCE A;  4GCI A;  5CRG A;  2K8S A;  4PQI A;  2XBQ A;  3CTG A;  3WT2 A;  1AQW A;  1XWK A;  2M80 A;  4XRA A;  3GTU A;  3QAW A;  4E8E A;  3ME7 A;  1C72 A;  3GNJ A;  2WRT A;  2FWH A;  3F6D A;  1XWA A;  3LEF A;  1ZMA A;  5HR2 A;  1PKW A;  2YOI A;  4RQX A;  1XOA A;  2LTK A;  1NHO A;  1GNE A;  1O85 A;  4EE0 A;  1I5G A;  1BYE A;  1TK5 B;  1UN2 A;  2YPM A;  1QMV A;  2VM2 A;  5HR1 A;  1K0D A;  2B7J A;  4NMU A;  2M46 A;  2JU5 A;  2VM1 A;  4AJ8 A;  1TRS A;  5CRD A;  1M0U A;  5J9B A;  1GUL A;  1TK0 B;  5A4W A;  3HZ8 A;  2DLX A;  1KNG A;  5B6M A;  1S3D A;  4GRF A;  1HNB A;  2X8G A;  4DSQ A;  4DSS B;  4PNG A;  1VRS D;  4KCA A;  1WE0 A;  5C00 A;  2AV4 A;  2XHF A;  2GT5 A;  1X9S B;  3QMX A;  3RHB A;  2CV4 A;  5DQY A;  2FY6 A;  4LL1 B;  3HVX A;  5A5K A;  1XFL A;  4GST A;  4BWQ A;  3HJP A;  2YV7 A;  2V1M A;  1MDI A;  3C1R A;  2H0G A;  2C4J A;  2E2G A;  5IMV A;  4NV2 A;  4YQU A;  1XVQ A;  4XS4 A;  3UBL A;  3AY8 A;  4NAX A;  3SBC A;  1F9M A;  1KBN A;  4ZBB A;  5F8B A;  1AXD A;  2O87 A;  3J7Y k;  1SEN A;  2GT6 A;  1A8L A;  1SJ6 A;  1I9D A;  1X0R A;  5DAK A;  3W8J A;  4Q5Q A;  4OFN A;  3HZ4 A;  1K0N A;  11GS A;  1ILO A;  3GFK A;  1U3A A;  4TXO A;  3N5O A;  4RQR A;  2K18 A;  4N0V A;  2C0G A;  2G0F A;  1NSW A;  2F3M A;  2QKE A;  3UOM A;  3U6V A;  3HA9 A;  2E0Q A;  4OFT A;  5AIV A;  3WGD A;  2HZE B;  3L0H A;  2PPT A;  5B8A A;  2TRX A;  2MMN A;  2IMI A;  5A4V A;  3TKS A;  2P0G A;  1R5P A;  3UAP A;  2KP1 A;  2LRN A;  2XPE A;  4PQH A;  1TRW A;  2FD3 A;  3UVT A;  2VCZ A;  5G5F A;  3FW2 A;  4LMW A;  1A0R P;  5ECN B;  5IMD A;  1XOB A;  1A24 A;  2H75 A;  4POB A;  3EC3 A;  1M7T A;  3TUE A;  1F37 A;  1K0M A;  1EEM A;  5ECS A;  1GL8 A;  5IMC A;  2VLU A;  5D93 A;  2NTO A;  1YEX A;  4L5O A;  5DAL A;  4POM A;  2PU9 C;  1H4O A;  2DIZ A;  5ECH B;  3M8N A;  3F3R A;  2VLT A;  1BAY A;  1EV4 A;  4XIH A;  3TRQ A;  5F0G A;  2OE0 A;  4PX1 A;  5FWG A;  3IXR A;  2JZT A;  3LSZ A;  4OCE A;  1ZCP A;  3A3T A;  3GMF A;  3ERW A;  2FGX A;  5JWQ B;  4O7H A;  1TRU A;  5KN0 A;  3FY7 A;  3KIJ A;  2VO4 A;  3QPM A;  5J5N A;  4D73 B;  5IOW A;  2GSQ A;  4WXT A;  3F8U A;  2YWO A;  2MMZ A;  4KX4 A;  3QDN A;  3HVS A;  4WBR D;  5ENU A;  4Q5R A;  1MEK A;  1T00 A;  3EU4 A;  1A0F A;  2DJ2 A;  4V2M A;  1EOH A;  3GUS A;  4ZB6 A;  1ON4 A;  1PKZ A;  2E7P A;  2LRC A;  1XIY A;  2L6C A;  4ECI A;  3KMO A;  4PUF C;  1SYX A;  2GSR A;  4ZXG A;  3KP8 A;  4NHZ A;  3Q6O A;  3L9S A;  2MBS A;  3U5R E;  4MLY A;  3L78 A;  3IC4 A;  2ON7 A;  3LOR A;  4JU5 A;  3ZIJ A;  2LEG A;  3ZZX A;  3A2V A;  2VD0 A;  10GS A;  3CBU A;  4ZL7 A;  1FB0 A;  1UVZ A;  4ZIL A;  3UBK A;  1XPV A;  7GSS A;  6GSU A;  2H6Y A;  4K7I A;  3TOT A;  2F8F A;  2OBI A;  1M2B A;  4X0X A;  3Q74 A;  3W6G A;  5F05 A;  4PUR A;  5CO3 A;  3VI5 A;  4F03 A;  2V6K A;  4ISD A;  3WGE A;  4TR4 A;  4GQC A;  4EF0 A;  2CT6 A;  1SL0 B;  1SJZ A;  4LL4 B;  1R7H A;  3CRU A;  4MH3 A;  2NBS A;  4K9Z A;  4KND A;  3C73 A;  5HFG A;  1U3I A;  4X43 A;  4EXJ A;  1UC7 A;  5ECQ B;  5IO0 A;  4EDY A;  2LST A;  4HU9 A;  5B6N A;  3R2Q A;  2WB9 A;  2YZU A;  4J56 E;  3ZRE A;  3TDG A;  5IPG A;  3GSS A;  1XWG A;  3F63 A;  1EGO A;  4V1A g;  4KE3 A;  2IN3 A;  2RUE A;  1K0B A;  5D9T A;  2CAI A;  4XS1 A;  2EIO A;  3UMA A;  2NDO A;  2KHP A;  4BA7 A;  5ELG A;  3DML A;  5ID2 A;  3EU3 A;  16GS A;  3NOF A;  1IYH A;  4I2T A;  4MDC A;  1AIU A;  3MDK A;  4LMV A;  3IAS 2;  4K6X A;  1YF1 A;  3ERF A;  3GN3 A;  1T3B A;  3QR6 A;  1SD8 A;  5H5S A;  3KM6 A;  4G10 A;  5F07 A;  1EP8 A;  4ECB A;  4BWS A;  1ACV A;  4MH2 A;  2BMX A;  2JAC A;  4WET A;  4FH8 A;  3ZLP A;  3ERG A;  3VPQ A;  3ME8 A;  4XHM A;  3P7X A;  4WF5 A;  4QL9 A;  4Q5N A;  3TKQ A;  1X5D A;  3KEB A;  5CRW A;  1SKW B;  3PIN A;  4IEL A;  4IQA A;  1GSY A;  4MZB A;  3LXT A;  4CHS A;  3HCZ A;  2H0H A;  5DCG A;  1PRX A;  1VF2 A;  3CSI A;  4MJC A;  3GL5 A;  1LJR A;  1A2J A;  3EMX A;  3H93 A;  4ILF A;  1FVK A;  2AJQ B;  2B3S A;  5COH A;  2DJ0 A;  3DKS A;  2FNO A;  2IMF A;  1ST9 A;  2C0E A;  1PL1 A;  2BTO T;  5EY6 A;  2I1U A;  1K0C A;  2YWM A;  2OE3 A;  3TKS C;  1MDK A;  2O7K A;  1TXX A;  5B7C A;  13GS A;  1MDJ A;  3CRT A;  5HFK A;  2ALB A;  4N11 A;  3FZ4 A;  2L4Q A;  1FHE A;  2FUG 2;  2L5L A;  5CAX A;  1AUC A;  3IV4 A;  1O73 A;  1WOU A;  1Z7P A;  4KAE A;  1ZL9 A;  2JAD A;  1WP0 A;  5J41 A;  5ELA A;  2YN1 A;  3DRN A;  4G2E A;  2LRT A;  1THX A;  4HZ4 A;  1E6B A;  4FIW A;  1XW6 A;  1O6J A;  1K3Y A;  5AIS A;  2FWG A;  2C0D A;  3N9J A;  3LXZ A;  2VCX A;  1EOG A;  4IJI A;  1PA3 A;  3RAZ A;  1F3B A;  1QQ2 A;  1K3L A;  4MAB A;  1OE8 A;  1B9Y C;  6GSX A;  2L6D A;  2VOC A;  2PGT A;  1U88 A;  2YP6 A;  2IMD A;  2C3N A;  3KD0 A;  3HKR A;  3I43 A;  4JZQ A;  2B6M A;  1N8J A;  2HFD A;  3M0F A;  3VLN A;  1R26 A;  4K0G A;  3HHV A;  4IP6 A;  3V1W A;  3QAG A;  1EZK A;  4NPB A;  3H8Q A;  2LV3 A;  2EIQ A;  1FG4 A;  1KTE A;  1EP7 A;  3HDC A;  2F9S A;  4O92 A;  4MA9 A;  1HD2 A;  2CVD A;  5LCZ A;  1TK8 B;  2N5A A;  2J23 A;  4I5Q A;  5L71 A;  4QQ7 A;  1NHY A;  3GH9 A;  1M9B A;  1G7E A;  2GZP A;  3APQ A;  3TKP A;  1ZYE A;  4GLT A;  4GQF A;  3D4T A;  2H6X A;  1U87 A;  2DJJ A;  2GVP A;  3IAM 2;  3KCM A;  4Q5F A;  5IPH A;  1TOF A;  3FEU A;  2PER A;  4H86 A;  3TGZ A;  3F4T A;  1A2M A;  3TJB A;  5IIZ A;  3WGX A;  1X5E A;  1GH2 A;  1OC9 B;  1FAA A;  2X8C A;  3TRP A;  5JCG A;  1PX7 A;  3GHA A;  2OBK A;  2KLX A;  2K9F A;  2O89 A;  1G0T A;  2GST A;  4NV5 A;  4TVE A;  5G31 A;  1G7O A;  5G1L A;  4YAV A;  4K1F A;  2CZ2 A;  4IQ1 A;  3PGT A;  1S3C A;  4IS0 A;  1OVN A;  3IE3 A;  4NHW A;  2C80 A;  4P3Y B;  4TR1 B;  2FA8 A;  2CX4 A;  2B5E A;  2VIM A;  2GSS A;  4WR4 A;  1PN9 A;  2IFQ A;  1AAZ A;  2YV9 A;  2HT9 A;  1XXU A;  5A4U A;  3UVH A;  3GV1 A;  3GL3 A;  4ZL9 A;  1GTI A;  1DBY A;  5DCH A;  2CZ3 A;  5CRE A;  9GSS A;  3J7Y b;  3C71 A;  1XW5 A;  2JSZ A;  3ZVJ D;  2VCQ A;  2C1Y A;  3BJ5 A;  2PBJ A;  4HI7 A;  8GSS A;  1PGT A;  1WIK A;  4IKH A;  2ES7 A;  1BG5 A;  3CYN A;  4HJM A;  4YAP A;  1V40 A;  1ZOF A;  3HVV A;  1X9W B;  3QOU A;  3EVI A;  1V2A A;  1GUK A;  1GNW A;  5GST A;  3QFB C;  6GSW A;  4HZ2 A;  3TJK A;  4RUV A;  2B1K A;  3KXO A;  1AQV A;  2LUS A;  2FCH A;  3W8S A;  4EKZ A;  5ECO B;  1SJI A;  2WJU A;  4I97 A;  4PQ1 A;  1GSS A;  3MNG A;  1GUM A;  1DUG A;  2KOK A;  3M1G A;  3RBT A;  2LNT A;  2VL9 A;  3K8N A;  4ML6 A;  3WT1 A;  1BED A;  3H1N A;  4G9H A;  2FA4 A;  1F6M C;  3MWH A;  4I8B A;  5GAN D;  3RPN A;  1WPI A;  2NVL A;  3EMP A;  2HSH A;  4ECJ A;  3L9U A;  4ZBD A;  3TRX A;  3KJY A;  4MK3 A;  4KGI A;  4POL A;  1B4P A;  3G7J A;  2JSY A;  2CX3 A;  2A2S A;  2WCI A;  5F06 A;  1PD2 1;  4PGT A;  4HQS A;  1ZGN A;  1XWC A;  3ZTL A;  3LYK A;  5IO2 A;  4K8M A;  4TR0 A;  2A4V A;  3US3 A;  2RM6 A;  4ULX A;  3D4M A;  4GWR A;  1SL2 B;  2I9H A;  4MPF A;  4TKY A;  2H1G A;  2WGR A;  2WUL A;  5CP1 A;  4DSS A;  2XC2 A;  2VCT A;  2H72 A;  4YQM A;  1M2D A;  3BCK A;  1M9A A;  5FHI A;  1CQG A;  1OC8 A;  3F4S A;  3VPT A;  1Z6N A;  1WRY A;  3DVW A;  4KDY A;  3ZIT A;  22GS A;  1ERV A;  3FR6 A;  2FHE A;  4ZIJ A;  1F3A A;  2YZH A;  5IOX A;  2B5X A;  5GAP D;  4IVF A;  3VFI A;  1EEJ A;  2GQK A;  3LYP A;  3QD9 A;  1Y25 A;  2REM A;  1CQH A;  4O5R A;  2H6Z A;  4X1U A;  2VD1 A;  1G6Y A;  2YWN A;  2LNS A;  2V41 A;  3IRA A;  3GX0 A;  3UL3 A;  1GUH A;  5EVO A;  3LWA A;  3WD6 A;  4HDE A;  3GKM A;  3DIE A;  1Z7R A;  3E3E A;  1M2A A;  4EUY A;  2O8V B;  1QK8 A;  1YKA A;  1R4W A;  1HNA A;  3IBH A;  5E59 A;  3LGC A;  2P5R A;  2KP2 A;  2L57 A;  4MF7 A;  4MJA A;  4JR4 A;  2YAN A;  2HZE A;  1GP1 A;  5JCU A;  14GS A;  1F2E A;  2JL4 A;  3GUR A;  5KN3 A;  2F51 A;  1XWB A;  1XVW A;  3IK7 A;  3TOU A;  1JZW A;  2H74 A;  1X9M B;  3VUR A;  1GSD A;  5HR0 A;  2R37 A;  2VL2 C;  3QAV A;  2XPD A;  1SK2 A;  3M3M A;  3TKR A;  4DVC A;  3GTU B;  2GZZ A;  1JFU A;  2OE1 A;  4WEY A;  3D6I A;  3D5J A;  2LS5 A;  2PMT A;  2RM5 A;  2L4C A;  1GRX A;  2RUF A;  19GS A;  2CA8 A;  3QFA C;  4EVM A;  2DIY A;  2LJR A;  5IQY A;  1GWC A;  4GSN A;  4KA0 A;  2AHE A;  4FYU A;  1Y6E A;  3D22 A;  1X5C A;  2WZ9 A;  4MF5 A;  1FOV A;  2VUP A;  3F0I A;  1PL2 A;  4V2L A;  4BVY A;  2X64 A;  1B9X C;  3HY2 A;  1SK1 A;  2DMM A;  2H30 A;  2IME A;  3ED3 A;  3BBY A;  4F0B A;  3IPZ A;  2P31 A;  5ECL B;  3RDW A;  3LQ7 A;  1R5A A;  2H66 A;  1XCC A;  3GA4 A;  3CSH A;  5ECM B;  1OYJ A;  4MZC A;  1Z9H A;  6GSV A;  5IMA A;  4FO5 A;  3IR4 A;  2CQ9 A;  5D9X A;  3I9V 2;  5J3R A;  4WR5 A;  4XTS A;  4GF0 A;  4FYC A;  1PQN A;  3I6A A;  4MPG A;  1JZR A;  5G5E A;  1UA5 A;  1B8X A;  2HI7 A;  3D0Z A;  3KMN A;  3FZ9 A;  3GKN A;  1V98 A;  3M9K A;  3TCO A;  1ZYQ B;  2OAC A;  1B4Q A;  4D73 A;  4AJ6 A;  3WYW A;  2CVK A;  1AW9 A;  2V6O A;  2PWJ A;  4IN0 A;  1J08 A;  1IYI A;  3GKX A;  2AB6 A;  2GGT A;  1QFN A;  2G2Q A;  4POK A;  1QXH A;  3NIV A;  2FWF A;  4XS4 B;  3DGQ A;  4ZBA A;  4TOP A;  4JRR A;  1U6T A;  2EIR A;  4L8E A;  1T8E B;  3NZN A;  1SKR B;  2YNX A;  5GZZ B;  3O3T A;  1TDI A;  3FR9 A;  1HNC A;  4HQZ A;  2HYX A;  1BQ7 A;  3KGK A;  2QSI A;  5DAK B;  3Q19 A;  3HYP A;  5D9V A;  4PUA A;  5D73 A;  4TXO B;  4ACS A;  4JBB A;  1XW9 A;  4F2I A;  3GYK A;  5E4W A;  6GSS A;  2H19 A;  1HYU A;  3CXG A;  2YCD A;  4KB3 A;  2LQQ A;  4K2D A;  2GQM A;  1FO5 A;  3CSJ A;  2GLR A;  3DXB A;  3JCM L;  1QUW A;  4IJ3 A;  3ZVJ A;  3TJF A;  3CTF A;  1ERW A;  1AC1 A;  1O7U A;  1T7P B;  3C8E A;  2QC7 A;  3BOA A;  4TW5 A;  1RK4 A;  3QCP A;  4LLR A;  3G7Y A;  3TKS E;  1ML6 A;  3VI7 A;  2H0I A;  3ZYW A;  2CVB A;  4L0U A;  5DAL B;  4MCU A;  4NXI A;  2DML A;  3D21 A;  4EDZ A;  1GSF A;  2VL2 A;  4G19 A;  5JWO B;  3KP9 A;  4N0Z A;  3ZIV A;  3UEM A;  1FVJ A;  5KN1 A;  2DSA A;  4AF2 A;  4ID0 A;  1YF0 A;  5CYY A;  3L4N A;  4CDO A;  3H79 A;  4JE1 A;  3VWX A;  3UJ1 A;  1YKC A;  2PUK C;  1TP9 A;  1WMJ A;  2L59 A;  5ABR A;  1TU7 A;  4YH2 A;  5IMF A;  1N2A A;  2KUC A;  4OD7 A;  2AAW A;  2LKU A;  1TJD A;  4ZB8 A;  4I2U A;  1BX9 A;  2A2R A;  5INY A;  3S9F A;  2JZS A;  4HEA 2;  5G1K A;  3KTB A;  5EPF A;  4OWY A;  3LG6 A;  2R5G A;  3RHC A;  1NW2 A;  3IDV A;  2TRC P;  1K0A A;  2GDR A;  5H5Q A;  2ZNM A;  1V57 A;  1OKD A;  2IL3 A;  2R4V A;  3FRC A;  5LNK e;  2AYT A;  3PH9 A;  1T4Z A;  1W89 A;  2FLS A;  1TU8 A;  4EL1 A;  1GSE A;  4K0N A;  2WDU A;  1V58 A;  1WWJ A;  3M9J A;  1GTB A;  1ABA A;  3MAK A;  1XBS A;  1OAZ A;  3IHQ A;  3DD3 A;  2DBC A;  2N5F A;  3PR8 A;  5B8B A;  1EWX A;  2IPA A;  3FK8 A;  2VCW A;  2H1D A;  1JLV A;  1TI1 A;  1OC3 A;  18GS A;  1Q4J A;  3G9B A;  1AQX A;  1ERU A;  4DEJ A;  3BD2 A;  3IOS A;  3ZL5 A;  2R6K A;  2B7K A;  1S3A A;  4IGJ A;  1URM A;  3GX8 A;  4HUA A;  4PXO A;  3FHK A;  3BCI A;  1EV9 A;  4TXV A;  5AIX A;  1FB6 A;  2MMA A;  3APO A;  4KDX A;  2CAQ A;  4N30 A;  1NM3 A;  1BJX A;  4HJ2 A;  5ECP B;  2AUV A;  2I81 A;  4OO5 A;  1MD4 A;  1T4Y A;  4AJ7 A;  20GS A;  3P90 A;  3RPP A;  1MD3 A;  3I69 A;  2PVO C;  4TRX A;  2VAF A;  3HJM A;  3O6T A;  3VK9 A;  1T1V A;  3Q18 A;  3EYT A;  1A2L A;  2ON5 A;  2C8U A;  3P2A A;  1JZO A;  3LFL A;  1A8Y A;  4TR3 A;  17GS A;  1SL1 B;  4PNF A;  3TJG A;  2OKA A;  4IBP A;  1QGV A;  4ZL8 A;  2MYG A;  3FYG A;  4MP4 A;  2Z9S A;  1SYR A;  4KW6 A;  4HOJ A;  5J4U A;  1J0F A;  3DYR A;  3L9V A;  5DVB A;  2PN8 A;  2IMK A;  4BVX A;  5ID2 B;  2K8V A;  4WKW A;  4GSS A;  2GS3 A;  3C1S A;  4K7N A;  5DQS A;  2DJ3 A;  3VWU A;  4KH7 A;  4FYB A;  4MJE A;  2P5Q A;  2VLV A;  1JZD A;  3ISO A;  3KH9 A;  3GRX A;  4GXZ A;  3EE2 A;  5ECK B;  3ZML A;  3VWW A;  2H1B A;  2MZC A;  3VWV A;  2VL3 A;  3P8W A;  2MBT A;  4ZB9 A;  4Z7X A;  5AGY A;  5D8I A;  1ZZY A;  3DWV A;  5ECR B;  2HE3 A;  2HSY A;  2D2Z A;  2HRF A;  3H4K A;  2C3Q A;  2QGV A;  2RII A;  3IA1 A;  4DSR A;  1GLP A;  2OJL A;  1SU9 A;  2C3T A;  4ML1 A;  1YDK A;  3TJJ A;  1G6W A;  2H70 A;  4MMM A;  3UAR A;  1SK0 A;  5EL8 A;  4F82 A;  2R3X A;  2EC4 A;  4JR6 A;  1OC9 A;  4MF6 A;  5ECI B;  1GTU A;  5FT3 A;  1A23 A;  6GSY A;  2XBI A;  3SWL A;  3LJR A;  4WBJ A;  3A2W A;  4MZW A;  5GSS A;  2I4A A;  3F9U A;  4KUN A;  2V32 A;  3O76 A;  4EO3 A;  4YQV A;  4IP1 A;  3IK9 A;  5G30 A;  3FR3 A;  5IM9 A;  4E8H A;  4CW9 A;  1TW9 A;  2X99 A;  1XZO A;  1GSQ A;  3F6F A;  2F8A A;  3MSZ A;  1V9W A;  2M72 A;  4K7O A;  2V2G A;  4V1A p;  4OO4 A;  4TR1 A;  6GST A;  2GTU A;  2YJ7 A;  4OFM A;  1Q98 A;  2E2M A;  1PMT A;  3KTL A;  4BPY A;  3E0U A;  1Z5Y E;  3FKF A;  2ZCT A;  4OCF A;  5G2Z A;  3EUR A;  4AGS A;  2WFC A;  2H01 A;  2HXK A;  5CNW A;  3EIN A;  1USB A;  2NPB A; 
#chains in the Genus database with same CATH topology
 1PX6 A;  1JHB A;  4KDU A;  4F9Z A;  3GH6 A;  1K3O A;  3EWL A;  5LD0 A;  1J9B A;  2H73 A;  1VGL A;  4HS1 A;  2X8H A;  2DJ1 A;  2YJH A;  2R2J A;  2H1A A;  4BL7 A;  3F3Q A;  4WF4 A;  4TN8 A;  3HVN A;  1KEB A;  1O81 A;  2HLS A;  1H75 A;  1PFO A;  1YY7 A;  1GSU A;  2C0F A;  2K6V A;  2IIY A;  2B5Y A;  2FWE A;  1THO A;  2GQL A;  4ECC A;  3ZFL A;  3F4R A;  4OMV A;  3UIW A;  5HFI A;  1YZX A;  3HJO A;  12GS A;  1M99 A;  2LJK A;  4RI6 A;  5KN2 A;  4XCS A;  1HQO A;  3KH7 A;  4N10 A;  4L5L A;  4MJB A;  1VF1 A;  3A5W A;  1TI3 A;  2IWT A;  2L5O A;  1PSQ A;  1YEP A;  2QA2 A;  4I6X A;  2DJK A;  3E9J B;  3KZQ A;  5DBQ A;  1FW1 A;  1VF3 A;  3GKK A;  1O8W A;  3IHG A;  3ZFB A;  1LBK A;  4HU7 A;  2N5B A;  4JED A;  1E2Y A;  2MMO A;  2DC5 A;  4XS6 A;  3GIX A;  3C7M A;  1LU4 A;  2JZR A;  1VF4 A;  1K0O A;  4NWY A;  4GTU A;  3ZMK A;  1W4V A;  2ZUP A;  2RLI A;  1JLW A;  2J9H A;  1YQ1 A;  2H8L A;  3PPU A;  5C04 A;  4XRD A;  1RQM A;  3APS A;  4IHU A;  2TIR A;  2HNL A;  5AN1 A;  2LQO A;  4KSM A;  1TRV A;  2GZY A;  4O32 A;  5H5R A;  4O5Q A;  2IJY A;  4QL7 A;  2WS2 A;  1TKD B;  1OE7 A;  3OR5 A;  2I3Y A;  4LA1 A;  4HSC X;  2LJA A;  3A2X A;  4KSO A;  4V2N A;  1GTA A;  2H71 A;  1ERT A;  1DE2 A;  2IFQ B;  1O8X A;  1SKS B;  1WJK A;  5DDL A;  3FZA A;  4EC0 A;  1Z3E A;  5CRH A;  4J57 E;  3FZ5 A;  1DSB A;  2BJX A;  3DEX A;  4L0W A;  4YKF A;  4F0C A;  5J9C A;  1GLQ A;  4IW9 A;  5DJM A;  3CMI A;  4J2F A;  1OKT A;  2HZF A;  3G7I A;  1TTZ A;  1RW1 A;  5HR3 A;  5JWR B;  2O85 A;  3HD5 A;  2H76 A;  1B48 A;  2OAD A;  3DVX A;  5D9W A;  5IMZ A;  5HQP A;  3TB2 A;  2VCV A;  5JCW A;  1SD9 A;  2PVQ A;  2YWI A;  2OA7 A;  3ZRD A;  5KEJ A;  3HXS A;  1DE1 A;  2B1L A;  5D96 A;  5DJL A;  1EGR A;  4RI7 A;  1YJ6 A;  1Z6M A;  2HRN A;  1MTC A;  3GST A;  4KCE A;  4GCI A;  5CRG A;  2K8S A;  4PQI A;  2XBQ A;  3CTG A;  3WT2 A;  1AQW A;  1XWK A;  2M80 A;  4G0I A;  4XRA A;  3GTU A;  3QAW A;  4E8E A;  3ME7 A;  1C72 A;  3GNJ A;  2WRT A;  2FWH A;  3F6D A;  1XWA A;  3LEF A;  1ZMA A;  5HR2 A;  1PKW A;  2YOI A;  4RQX A;  1XOA A;  2LTK A;  1NHO A;  1GNE A;  1O85 A;  4FQU A;  1I5G A;  4EE0 A;  1BYE A;  1TK5 B;  1UN2 A;  1FOH A;  2YPM A;  1QMV A;  2VM2 A;  5HR1 A;  1K0D A;  2B7J A;  4NMU A;  2M46 A;  2JU5 A;  2VM1 A;  4AJ8 A;  1TRS A;  5CRD A;  1M0U A;  5J9B A;  1GUL A;  1TK0 B;  5A4W A;  3HZ8 A;  2DLX A;  1KNG A;  5B6M A;  1S3D A;  4GRF A;  1ZYN A;  1HNB A;  2X8G A;  3MIX A;  4DSQ A;  4DSS B;  4PNG A;  1VRS D;  4KCA A;  1WE0 A;  5C00 A;  2AV4 A;  2XHF A;  4A5P A;  2GT5 A;  1X9S B;  3QMX A;  3RHB A;  2CV4 A;  5DQY A;  2FY6 A;  4LL1 B;  3HVX A;  5A5K A;  1XFL A;  4GST A;  4BWQ A;  3HJP A;  2YV7 A;  2V1M A;  1MDI A;  3C1R A;  2H0G A;  2C4J A;  2E2G A;  1ZYP A;  5IMV A;  4NV2 A;  4YQU A;  1XVQ A;  4XS4 A;  3UBL A;  3AY8 A;  4NAX A;  3SBC A;  1F9M A;  1KBN A;  4ZBB A;  5F8B A;  1AXD A;  2O87 A;  3J7Y k;  1SEN A;  2GT6 A;  1A8L A;  1SJ6 A;  1I9D A;  1X0R A;  5DAK A;  3W8J A;  4Q5Q A;  4OFN A;  3HZ4 A;  1K0N A;  11GS A;  1ILO A;  3GFK A;  1U3A A;  4TXO A;  3N5O A;  4RQR A;  2K18 A;  4N0V A;  2C0G A;  2G0F A;  1NSW A;  2F3M A;  2QKE A;  3UOM A;  3U6V A;  3HA9 A;  2E0Q A;  4OFT A;  5AIV A;  3WGD A;  2HZE B;  3L0H A;  2PPT A;  5B8A A;  2TRX A;  2MMN A;  2IMI A;  1M3I A;  4ICY A;  5A4V A;  3TKS A;  2P0G A;  1R5P A;  3UAP A;  2KP1 A;  2LRN A;  2XPE A;  4PQH A;  1TRW A;  2FD3 A;  3UVT A;  2VCZ A;  5G5F A;  3FW2 A;  4LMW A;  1A0R P;  5ECN B;  5IMD A;  1XOB A;  1A24 A;  2H75 A;  4POB A;  3EC3 A;  1M7T A;  3TUE A;  1F37 A;  1K0M A;  1EEM A;  5ECS A;  1GL8 A;  5IMC A;  2VLU A;  5D93 A;  2NTO A;  1YEX A;  4K5S A;  4L5O A;  5DAL A;  4POM A;  2PU9 C;  1H4O A;  2DIZ A;  4BVY B;  5ECH B;  3M8N A;  3F3R A;  2VLT A;  1BAY A;  1EV4 A;  4XIH A;  3TRQ A;  5F0G A;  2OE0 A;  4PX1 A;  5FWG A;  3IXR A;  2JZT A;  3LSZ A;  4OCE A;  1ZCP A;  3A3T A;  3GMF A;  3ERW A;  2FGX A;  4EIQ A;  5JWQ B;  4O7H A;  1TRU A;  5KN0 A;  3FY7 A;  3KIJ A;  2R0G A;  2VO4 A;  3QPM A;  5J5N A;  2DKH A;  4D73 B;  5IOW A;  2GSQ A;  4WXT A;  3F8U A;  2YWO A;  2MMZ A;  4KX4 A;  3QDN A;  3HVS A;  4WBR D;  2HSM A;  5ENU A;  4Q5R A;  1MEK A;  1T00 A;  3EU4 A;  1S3R A;  1A0F A;  2DJ2 A;  4V2M A;  1EOH A;  3GUS A;  4ZB6 A;  1ON4 A;  1PKZ A;  2E7P A;  2LRC A;  1XIY A;  2L6C A;  4ECI A;  3KMO A;  4PUF C;  1SYX A;  2GSR A;  4ZXG A;  3KP8 A;  4NHZ A;  3Q6O A;  3L9S A;  2MBS A;  3U5R E;  4MLY A;  3L78 A;  3IC4 A;  2ON7 A;  3LOR A;  4JU5 A;  3ZIJ A;  2LEG A;  3CQF A;  3ZZX A;  3A2V A;  2VD0 A;  10GS A;  4Z2T A;  3CBU A;  4ZL7 A;  1FB0 A;  1UVZ A;  4ZIL A;  3UBK A;  1XPV A;  7GSS A;  6GSU A;  2H6Y A;  4K7I A;  3TOT A;  2F8F A;  2OBI A;  1M2B A;  4X0X A;  3Q74 A;  3W6G A;  5F05 A;  4PUR A;  2UZ8 A;  5CO3 A;  3VI5 A;  4F03 A;  2V6K A;  4ISD A;  3WGE A;  4TR4 A;  4GQC A;  4EF0 A;  2CT6 A;  1SL0 B;  1SJZ A;  4LL4 B;  1R7H A;  3CRU A;  4MH3 A;  5BMU A;  2NBS A;  4K9Z A;  4KND A;  3C73 A;  5HFG A;  1U3I A;  4X43 A;  4EXJ A;  1UC7 A;  5ECQ B;  5IO0 A;  4EDY A;  2LST A;  4HU9 A;  5B6N A;  3R2Q A;  2WB9 A;  2YZU A;  4J56 E;  3ZRE A;  3TDG A;  5IPG A;  3GSS A;  1XWG A;  3F63 A;  1EGO A;  4V1A g;  4KE3 A;  2IN3 A;  2RUE A;  1K0B A;  5D9T A;  2CAI A;  4XS1 A;  2EIO A;  3UMA A;  2NDO A;  2KHP A;  4BA7 A;  4PTS A;  5ELG A;  4O5U A;  3DML A;  5ID2 A;  3EU3 A;  16GS A;  3NOF A;  1IYH A;  4I2T A;  4MDC A;  1AIU A;  3MDK A;  4LMV A;  3IAS 2;  4K6X A;  1YF1 A;  3ERF A;  3GN3 A;  1T3B A;  3QR6 A;  1SD8 A;  5H5S A;  3KM6 A;  4G10 A;  5F07 A;  1EP8 A;  4ECB A;  4BWS A;  1ACV A;  4MH2 A;  2BMX A;  2JAC A;  4WET A;  4FH8 A;  3ZLP A;  3ERG A;  3VPQ A;  3ME8 A;  4XHM A;  3P7X A;  4WF5 A;  4QL9 A;  4Q5N A;  3TKQ A;  1X5D A;  3KEB A;  5CRW A;  1SKW B;  3PIN A;  4IEL A;  1XG8 A;  4IQA A;  1GSY A;  4MZB A;  3LXT A;  4CHS A;  3HCZ A;  2H0H A;  5DCG A;  1PRX A;  1VF2 A;  3CSI A;  4MJC A;  3GL5 A;  1LJR A;  1A2J A;  3EMX A;  3H93 A;  4ILF A;  1FVK A;  2AJQ B;  2B3S A;  5COH A;  2DJ0 A;  3DKS A;  2FNO A;  2IMF A;  1ST9 A;  2C0E A;  1PL1 A;  2BTO T;  5EY6 A;  2I1U A;  1K0C A;  2YWM A;  2OE3 A;  3TKS C;  1MDK A;  2O7K A;  1TXX A;  5B7C A;  13GS A;  1MDJ A;  3CRT A;  5HFK A;  2ALB A;  4N11 A;  2A4H A;  3FZ4 A;  3EPT A;  2L4Q A;  1FHE A;  2FUG 2;  2L5L A;  5CAX A;  1AUC A;  3IV4 A;  1O73 A;  1M3J A;  1WOU A;  1Z7P A;  4KAE A;  1ZL9 A;  2JAD A;  1WP0 A;  5J41 A;  5ELA A;  2YN1 A;  3DRN A;  4G2E A;  2LRT A;  1THX A;  4HZ4 A;  1E6B A;  4FIW A;  1XW6 A;  1O6J A;  1K3Y A;  5AIS A;  2FWG A;  2C0D A;  3N9J A;  3LXZ A;  2VCX A;  1EOG A;  4IJI A;  1PA3 A;  3RAZ A;  1F3B A;  1QQ2 A;  1K3L A;  4MAB A;  1OE8 A;  1B9Y C;  6GSX A;  2L6D A;  2VOC A;  2PGT A;  1U88 A;  2YP6 A;  2IMD A;  2C3N A;  3KD0 A;  3HKR A;  3I43 A;  4JZQ A;  2B6M A;  1N8J A;  2HFD A;  3M0F A;  3VLN A;  1R26 A;  4K0G A;  4YKG A;  3HHV A;  4IP6 A;  3V1W A;  3QAG A;  1EZK A;  4NPB A;  4BVX B;  3H8Q A;  2LV3 A;  4Z2U A;  2EIQ A;  1FG4 A;  1KTE A;  1EP7 A;  3HDC A;  2F9S A;  4O92 A;  4MA9 A;  1HD2 A;  2CVD A;  5LCZ A;  1TK8 B;  2HRK A;  2N5A A;  2J23 A;  4I5Q A;  5L71 A;  4QQ7 A;  1NHY A;  3GH9 A;  1M9B A;  1G7E A;  2GZP A;  4CY6 A;  3APQ A;  3TKP A;  1ZYE A;  4GLT A;  4GQF A;  3D4T A;  2H6X A;  1U87 A;  2DJJ A;  2GVP A;  3IAM 2;  3KCM A;  4Q5F A;  5IPH A;  1TOF A;  3FEU A;  2PER A;  4H86 A;  3TGZ A;  3F4T A;  1A2M A;  3TJB A;  5IIZ A;  3WGX A;  1X5E A;  1GH2 A;  1OC9 B;  1FAA A;  2X8C A;  3TRP A;  5JCG A;  1PX7 A;  3GHA A;  2OBK A;  2KLX A;  2K9F A;  2O89 A;  1G0T A;  2GST A;  4NV5 A;  4TVE A;  5G31 A;  1G7O A;  5G1L A;  4YAV A;  4K1F A;  2CZ2 A;  4IQ1 A;  3PGT A;  1S3C A;  4EIP A;  4IS0 A;  1OVN A;  3IE3 A;  4NHW A;  2C80 A;  4P3Y B;  4TR1 B;  2FA8 A;  2CX4 A;  2B5E A;  2VIM A;  2GSS A;  4WR4 A;  3R3E A;  1PN9 A;  2IFQ A;  1AAZ A;  2YV9 A;  2HT9 A;  5BRT A;  1XXU A;  5A4U A;  3UVH A;  3GV1 A;  3GL3 A;  4ZL9 A;  1GTI A;  1DBY A;  5DCH A;  2CZ3 A;  5CRE A;  9GSS A;  3J7Y b;  3C71 A;  1XW5 A;  2JSZ A;  3ZVJ D;  2VCQ A;  2C1Y A;  3BJ5 A;  2PBJ A;  4HI7 A;  8GSS A;  1PGT A;  1WIK A;  4IKH A;  2ES7 A;  1BG5 A;  3CYN A;  4HJM A;  4YAP A;  1V40 A;  1ZOF A;  3HVV A;  1X9W B;  3QOU A;  4BL7 B;  3EVI A;  1V2A A;  1GUK A;  1GNW A;  5GST A;  3QFB C;  6GSW A;  4HZ2 A;  3TJK A;  4RUV A;  2B1K A;  3KXO A;  1AQV A;  2LUS A;  2FCH A;  3W8S A;  4EKZ A;  5ECO B;  1SJI A;  2WJU A;  4I97 A;  4PQ1 A;  1GSS A;  3MNG A;  1GUM A;  1DUG A;  3FMW A;  2KOK A;  3M1G A;  3RBT A;  2LNT A;  2VL9 A;  3K8N A;  4ML6 A;  3WT1 A;  1BED A;  3H1N A;  4G9H A;  2FA4 A;  1F6M C;  3MWH A;  4I8B A;  5GAN D;  3RPN A;  1WPI A;  2NVL A;  3EMP A;  2HSH A;  4ECJ A;  3L9U A;  4ZBD A;  3TRX A;  3KJY A;  4MK3 A;  4KGI A;  4POL A;  1B4P A;  3G7J A;  2JSY A;  2CX3 A;  2A2S A;  2WCI A;  5F06 A;  1PD2 1;  4PGT A;  4HQS A;  1ZGN A;  1XWC A;  3ZTL A;  3LYK A;  5IO2 A;  4K8M A;  4TR0 A;  2A4V A;  3US3 A;  2RM6 A;  4ULX A;  3D4M A;  4GWR A;  1SL2 B;  2I9H A;  4MPF A;  4TKY A;  2H1G A;  2WGR A;  2WUL A;  5CP1 A;  4DSS A;  2XC2 A;  2VCT A;  2H72 A;  4YQM A;  1M2D A;  3BCK A;  4K2X A;  1M9A A;  5FHI A;  1CQG A;  1OC8 A;  3F4S A;  3VPT A;  1Z6N A;  1WRY A;  2X4A A;  3DVW A;  4KDY A;  3ZIT A;  22GS A;  1ERV A;  3FR6 A;  2FHE A;  4ZIJ A;  1F3A A;  2YZH A;  5IOX A;  2B5X A;  5GAP D;  4IVF A;  3VFI A;  1EEJ A;  2GQK A;  3LYP A;  3QD9 A;  1Y25 A;  2REM A;  2R0C A;  1CQH A;  4O5R A;  2H6Z A;  4X1U A;  2VD1 A;  1G6Y A;  2YWN A;  2LNS A;  2V41 A;  3IRA A;  3GX0 A;  3UL3 A;  1GUH A;  5EVO A;  3LWA A;  3WD6 A;  4HDE A;  3GKM A;  3DIE A;  1Z7R A;  3E3E A;  1M2A A;  4EUY A;  2O8V B;  2R0P A;  1QK8 A;  1YKA A;  2DKI A;  1R4W A;  1HNA A;  3IBH A;  5E59 A;  3LGC A;  2P5R A;  2KP2 A;  2L57 A;  4MF7 A;  4MJA A;  4JR4 A;  2YAN A;  2HZE A;  1GP1 A;  5JCU A;  14GS A;  1F2E A;  2JL4 A;  3GUR A;  5KN3 A;  2F51 A;  1XWB A;  1XVW A;  3IK7 A;  3TOU A;  1JZW A;  2H74 A;  1X9M B;  3VUR A;  1GSD A;  5HR0 A;  2R37 A;  2VL2 C;  3QAV A;  2XPD A;  1SK2 A;  3M3M A;  3TKR A;  4DVC A;  3GTU B;  2GZZ A;  1JFU A;  2OE1 A;  4WEY A;  3D6I A;  3D5J A;  2LS5 A;  2PMT A;  2RM5 A;  2L4C A;  1GRX A;  3IC8 A;  2RUF A;  19GS A;  2CA8 A;  3QFA C;  4EVM A;  2DIY A;  2LJR A;  5IQY A;  1GWC A;  4GSN A;  4KA0 A;  2AHE A;  4FYU A;  1Y6E A;  3D22 A;  1X5C A;  2WZ9 A;  4MF5 A;  1FOV A;  2VUP A;  3F0I A;  1PL2 A;  4V2L A;  4BVY A;  2X64 A;  1B9X C;  3HY2 A;  1SK1 A;  2DMM A;  2H30 A;  2IME A;  3ED3 A;  3BBY A;  4F0B A;  3IPZ A;  2P31 A;  5ECL B;  3RDW A;  3LQ7 A;  1R5A A;  2H66 A;  1XCC A;  3GA4 A;  3CSH A;  5ECM B;  1OYJ A;  4MZC A;  1Z9H A;  6GSV A;  5IMA A;  4FO5 A;  3LW9 A;  3IR4 A;  2CQ9 A;  5D9X A;  3I9V 2;  5J3R A;  4WR5 A;  4XTS A;  4GF0 A;  4FYC A;  1PQN A;  3I6A A;  4MPG A;  1JZR A;  5G5E A;  1UA5 A;  1B8X A;  2HI7 A;  3D0Z A;  3KMN A;  3FZ9 A;  3GKN A;  1V98 A;  3M9K A;  3TCO A;  1ZYQ B;  2OAC A;  1B4Q A;  4D73 A;  4AJ6 A;  3WYW A;  2CVK A;  1AW9 A;  2V6O A;  2PWJ A;  4IN0 A;  4MNN A;  1J08 A;  1IYI A;  3GKX A;  2AB6 A;  2GGT A;  1QFN A;  2G2Q A;  4K5R A;  4POK A;  1QXH A;  3NIV A;  2FWF A;  4XS4 B;  3DGQ A;  4ZBA A;  4TOP A;  4JRR A;  1U6T A;  2EIR A;  4L8E A;  1T8E B;  3NZN A;  1SKR B;  2YNX A;  5GZZ B;  3O3T A;  1TDI A;  3FR9 A;  1HNC A;  4HQZ A;  2X49 A;  2HYX A;  1BQ7 A;  3KGK A;  2QSI A;  5DAK B;  3Q19 A;  3HYP A;  5D9V A;  4PUA A;  5D73 A;  2QA1 A;  4TXO B;  4ACS A;  4JBB A;  1XW9 A;  4F2I A;  3GYK A;  5E4W A;  6GSS A;  2H19 A;  2HRA A;  1HYU A;  3CXG A;  2YCD A;  4KB3 A;  2LQQ A;  4K2D A;  2GQM A;  1FO5 A;  3CSJ A;  2GLR A;  3DXB A;  3JCM L;  1QUW A;  4IJ3 A;  3ZVJ A;  3TJF A;  3CTF A;  1ERW A;  4BIK A;  1AC1 A;  1O7U A;  1T7P B;  3C8E A;  2QC7 A;  3BOA A;  4TW5 A;  1RK4 A;  3QCP A;  4LLR A;  3G7Y A;  3TKS E;  1ML6 A;  3VI7 A;  2H0I A;  3ZYW A;  2CVB A;  4L0U A;  5DAL B;  4MCU A;  4NXI A;  2DML A;  3D21 A;  4EDZ A;  1GSF A;  2VL2 A;  4G19 A;  5JWO B;  3KP9 A;  4N0Z A;  3ZIV A;  3UEM A;  1FVJ A;  5KN1 A;  2DSA A;  4AF2 A;  4ID0 A;  1YF0 A;  5CYY A;  3L4N A;  4KF9 A;  4CDO A;  4CY8 A;  3H79 A;  4JE1 A;  3VWX A;  3UJ1 A;  1YKC A;  2PUK C;  1TP9 A;  1WMJ A;  2L59 A;  5ABR A;  1TU7 A;  4YH2 A;  5IMF A;  4G0K A;  1N2A A;  2KUC A;  4OD7 A;  2AAW A;  2LKU A;  1TJD A;  4ZB8 A;  4I2U A;  1BX9 A;  2A2R A;  5INY A;  3S9F A;  2JZS A;  4HEA 2;  5G1K A;  4USS A;  3KTB A;  5EPF A;  4OWY A;  3LG6 A;  2R5G A;  3RHC A;  1NW2 A;  3IDV A;  2TRC P;  1K0A A;  2GDR A;  4Z2R A;  5H5Q A;  2ZNM A;  1V57 A;  1OKD A;  2IL3 A;  2R4V A;  3FRC A;  5LNK e;  2AYT A;  3PH9 A;  1T4Z A;  1W89 A;  2FLS A;  1TU8 A;  4EL1 A;  1GSE A;  4K0N A;  2WDU A;  1V58 A;  1WWJ A;  3M9J A;  1GTB A;  1ABA A;  3MAK A;  1XBS A;  1OAZ A;  3IHQ A;  3DD3 A;  2DBC A;  2N5F A;  3PR8 A;  5B8B A;  1EWX A;  2IPA A;  3FK8 A;  4X4J A;  2VCW A;  2H1D A;  1JLV A;  1TI1 A;  1OC3 A;  5KOX A;  18GS A;  1Q4J A;  3G9B A;  1AQX A;  1ERU A;  4DEJ A;  3BD2 A;  3IOS A;  3ZL5 A;  2R6K A;  2B7K A;  1S3A A;  4IGJ A;  1URM A;  3GX8 A;  4HUA A;  4PXO A;  3FHK A;  3BCI A;  1EV9 A;  4TXV A;  5AIX A;  1FB6 A;  2MMA A;  3APO A;  4KDX A;  2CAQ A;  4N30 A;  1NM3 A;  1BJX A;  4HJ2 A;  5ECP B;  2AUV A;  2I81 A;  4OO5 A;  1MD4 A;  1T4Y A;  4AJ7 A;  20GS A;  3P90 A;  3RPP A;  1MD3 A;  3I69 A;  2PVO C;  4TRX A;  2VAF A;  3HJM A;  3O6T A;  3VK9 A;  1T1V A;  3Q18 A;  3A5I A;  3EYT A;  1A2L A;  2ON5 A;  2C8U A;  3P2A A;  1JZO A;  3LFL A;  1A8Y A;  4TR3 A;  17GS A;  1SL1 B;  4PNF A;  5KOW A;  3TJG A;  2OKA A;  4IBP A;  1QGV A;  4ZL8 A;  2MYG A;  3FYG A;  4MP4 A;  2Z9S A;  1SYR A;  4KW6 A;  4HOJ A;  5J4U A;  1J0F A;  1PN0 A;  3DYR A;  3L9V A;  5DVB A;  2PN8 A;  2IMK A;  4BVX A;  5ID2 B;  2K8V A;  4WKW A;  4GSS A;  2GS3 A;  3C1S A;  4K7N A;  5DQS A;  2DJ3 A;  3VWU A;  4KH7 A;  4FYB A;  4MJE A;  2P5Q A;  2VLV A;  1JZD A;  3ISO A;  3KH9 A;  3GRX A;  4GXZ A;  3EE2 A;  5ECK B;  3ZML A;  3VWW A;  2H1B A;  2MZC A;  3VWV A;  2VL3 A;  3P8W A;  2MBT A;  4ZB9 A;  4Z7X A;  3MYD A;  5AGY A;  5D8I A;  1ZZY A;  3DWV A;  5ECR B;  2HE3 A;  2HSY A;  2D2Z A;  2HRF A;  3H4K A;  2C3Q A;  2QGV A;  2RII A;  3IA1 A;  4DSR A;  1GLP A;  2OJL A;  1SU9 A;  2C3T A;  4ML1 A;  1YDK A;  3TJJ A;  1G6W A;  2H70 A;  4MMM A;  3UAR A;  1SK0 A;  5EL8 A;  4F82 A;  2R3X A;  2EC4 A;  4JR6 A;  1OC9 A;  4MF6 A;  5ECI B;  1GTU A;  5FT3 A;  1A23 A;  6GSY A;  2XBI A;  3SWL A;  3LJR A;  4WBJ A;  2A2P A;  3A2W A;  4MZW A;  5GSS A;  2I4A A;  3F9U A;  4KUN A;  2V32 A;  3O76 A;  4EO3 A;  4YQV A;  4IP1 A;  3IK9 A;  5G30 A;  3FR3 A;  5IM9 A;  4E8H A;  4CW9 A;  1TW9 A;  2X99 A;  1XZO A;  1GSQ A;  3F6F A;  2F8A A;  3MSZ A;  1V9W A;  2M72 A;  4K7O A;  2V2G A;  4V1A p;  4OO4 A;  4TR1 A;  4G0L A;  2GTU A;  6GST A;  2YJ7 A;  4OFM A;  1Q98 A;  2E2M A;  1PMT A;  3KTL A;  4BPY A;  3E0U A;  1Z5Y E;  3FKF A;  2ZCT A;  4OCF A;  5G2Z A;  3EUR A;  4AGS A;  2WFC A;  2H01 A;  2HXK A;  5CNW A;  3EIN A;  1USB A;  2NPB A; 
#chains in the Genus database with same CATH homology
 1PX6 A;  1JHB A;  4KDU A;  4F9Z A;  3GH6 A;  1K3O A;  3EWL A;  5LD0 A;  1J9B A;  2H73 A;  1VGL A;  4HS1 A;  2X8H A;  2DJ1 A;  2YJH A;  2R2J A;  2H1A A;  4BL7 A;  3F3Q A;  4WF4 A;  4TN8 A;  1KEB A;  1O81 A;  2HLS A;  1H75 A;  1YY7 A;  1GSU A;  2C0F A;  2K6V A;  2IIY A;  2B5Y A;  2FWE A;  1THO A;  2GQL A;  4ECC A;  3ZFL A;  3F4R A;  4OMV A;  3UIW A;  5HFI A;  1YZX A;  3HJO A;  12GS A;  1M99 A;  2LJK A;  4RI6 A;  5KN2 A;  4XCS A;  1HQO A;  3KH7 A;  4N10 A;  4L5L A;  4MJB A;  1VF1 A;  3A5W A;  1TI3 A;  2IWT A;  2L5O A;  1PSQ A;  1YEP A;  2QA2 A;  4I6X A;  2DJK A;  3E9J B;  3KZQ A;  5DBQ A;  1FW1 A;  1VF3 A;  3GKK A;  1O8W A;  3IHG A;  3ZFB A;  1LBK A;  4HU7 A;  2N5B A;  4JED A;  1E2Y A;  2MMO A;  2DC5 A;  4XS6 A;  3GIX A;  3C7M A;  1LU4 A;  2JZR A;  1VF4 A;  1K0O A;  4NWY A;  4GTU A;  3ZMK A;  1W4V A;  2ZUP A;  2RLI A;  1JLW A;  2J9H A;  1YQ1 A;  2H8L A;  3PPU A;  5C04 A;  4XRD A;  1RQM A;  3APS A;  4IHU A;  2TIR A;  2HNL A;  5AN1 A;  2LQO A;  4KSM A;  1TRV A;  2GZY A;  4O32 A;  5H5R A;  4O5Q A;  2IJY A;  4QL7 A;  2WS2 A;  1TKD B;  1OE7 A;  3OR5 A;  2I3Y A;  4LA1 A;  2LJA A;  3A2X A;  4KSO A;  4V2N A;  1GTA A;  2H71 A;  1ERT A;  1DE2 A;  2IFQ B;  1O8X A;  1SKS B;  1WJK A;  5DDL A;  3FZA A;  4EC0 A;  1Z3E A;  5CRH A;  4J57 E;  3FZ5 A;  1DSB A;  2BJX A;  3DEX A;  4L0W A;  4YKF A;  4F0C A;  5J9C A;  1GLQ A;  4IW9 A;  5DJM A;  3CMI A;  4J2F A;  1OKT A;  2HZF A;  3G7I A;  1TTZ A;  1RW1 A;  5HR3 A;  5JWR B;  2O85 A;  3HD5 A;  2H76 A;  1B48 A;  2OAD A;  3DVX A;  5D9W A;  5IMZ A;  5HQP A;  3TB2 A;  2VCV A;  5JCW A;  1SD9 A;  2PVQ A;  2YWI A;  2OA7 A;  3ZRD A;  5KEJ A;  3HXS A;  1DE1 A;  2B1L A;  5D96 A;  5DJL A;  1EGR A;  4RI7 A;  1YJ6 A;  1Z6M A;  2HRN A;  1MTC A;  3GST A;  4KCE A;  4GCI A;  5CRG A;  2K8S A;  4PQI A;  2XBQ A;  3CTG A;  3WT2 A;  1AQW A;  1XWK A;  2M80 A;  4G0I A;  4XRA A;  3GTU A;  3QAW A;  4E8E A;  3ME7 A;  1C72 A;  3GNJ A;  2WRT A;  2FWH A;  3F6D A;  1XWA A;  3LEF A;  1ZMA A;  5HR2 A;  1PKW A;  2YOI A;  4RQX A;  1XOA A;  2LTK A;  1NHO A;  1GNE A;  1O85 A;  4FQU A;  1I5G A;  4EE0 A;  1BYE A;  1TK5 B;  1UN2 A;  1FOH A;  2YPM A;  1QMV A;  2VM2 A;  5HR1 A;  1K0D A;  2B7J A;  4NMU A;  2M46 A;  2JU5 A;  2VM1 A;  4AJ8 A;  1TRS A;  5CRD A;  1M0U A;  5J9B A;  1GUL A;  1TK0 B;  5A4W A;  3HZ8 A;  2DLX A;  1KNG A;  5B6M A;  1S3D A;  4GRF A;  1ZYN A;  1HNB A;  2X8G A;  3MIX A;  4DSQ A;  4DSS B;  4PNG A;  1VRS D;  4KCA A;  1WE0 A;  5C00 A;  2AV4 A;  2XHF A;  4A5P A;  2GT5 A;  1X9S B;  3QMX A;  3RHB A;  2CV4 A;  5DQY A;  2FY6 A;  4LL1 B;  3HVX A;  5A5K A;  1XFL A;  4GST A;  4BWQ A;  3HJP A;  2YV7 A;  2V1M A;  1MDI A;  3C1R A;  2H0G A;  2C4J A;  2E2G A;  1ZYP A;  5IMV A;  4NV2 A;  4YQU A;  1XVQ A;  4XS4 A;  3UBL A;  3AY8 A;  4NAX A;  3SBC A;  1F9M A;  1KBN A;  4ZBB A;  5F8B A;  1AXD A;  2O87 A;  3J7Y k;  1SEN A;  2GT6 A;  1A8L A;  1SJ6 A;  1I9D A;  1X0R A;  5DAK A;  3W8J A;  4Q5Q A;  4OFN A;  3HZ4 A;  1K0N A;  11GS A;  1ILO A;  3GFK A;  1U3A A;  4TXO A;  3N5O A;  4RQR A;  2K18 A;  4N0V A;  2C0G A;  2G0F A;  1NSW A;  2F3M A;  2QKE A;  3UOM A;  3U6V A;  3HA9 A;  2E0Q A;  4OFT A;  5AIV A;  3WGD A;  2HZE B;  3L0H A;  2PPT A;  5B8A A;  2TRX A;  2MMN A;  2IMI A;  4ICY A;  5A4V A;  3TKS A;  2P0G A;  1R5P A;  3UAP A;  2KP1 A;  2LRN A;  2XPE A;  4PQH A;  1TRW A;  2FD3 A;  3UVT A;  2VCZ A;  5G5F A;  3FW2 A;  4LMW A;  1A0R P;  5ECN B;  5IMD A;  1XOB A;  1A24 A;  2H75 A;  4POB A;  3EC3 A;  1M7T A;  3TUE A;  1F37 A;  1K0M A;  1EEM A;  5ECS A;  1GL8 A;  5IMC A;  2VLU A;  5D93 A;  2NTO A;  1YEX A;  4K5S A;  4L5O A;  5DAL A;  4POM A;  2PU9 C;  1H4O A;  2DIZ A;  4BVY B;  5ECH B;  3M8N A;  3F3R A;  2VLT A;  1BAY A;  1EV4 A;  4XIH A;  3TRQ A;  5F0G A;  2OE0 A;  4PX1 A;  5FWG A;  3IXR A;  2JZT A;  3LSZ A;  4OCE A;  1ZCP A;  3A3T A;  3GMF A;  3ERW A;  2FGX A;  4EIQ A;  5JWQ B;  4O7H A;  1TRU A;  5KN0 A;  3FY7 A;  3KIJ A;  2R0G A;  2VO4 A;  3QPM A;  5J5N A;  2DKH A;  4D73 B;  5IOW A;  2GSQ A;  4WXT A;  3F8U A;  2YWO A;  2MMZ A;  4KX4 A;  3QDN A;  3HVS A;  4WBR D;  2HSM A;  5ENU A;  4Q5R A;  1MEK A;  1T00 A;  3EU4 A;  1A0F A;  2DJ2 A;  4V2M A;  1EOH A;  3GUS A;  4ZB6 A;  1ON4 A;  1PKZ A;  2E7P A;  2LRC A;  1XIY A;  2L6C A;  4ECI A;  3KMO A;  4PUF C;  1SYX A;  2GSR A;  4ZXG A;  3KP8 A;  4NHZ A;  3Q6O A;  3L9S A;  2MBS A;  3U5R E;  4MLY A;  3L78 A;  3IC4 A;  2ON7 A;  3LOR A;  4JU5 A;  3ZIJ A;  2LEG A;  3ZZX A;  3A2V A;  2VD0 A;  10GS A;  4Z2T A;  3CBU A;  4ZL7 A;  1FB0 A;  1UVZ A;  4ZIL A;  3UBK A;  1XPV A;  7GSS A;  6GSU A;  2H6Y A;  4K7I A;  3TOT A;  2F8F A;  2OBI A;  1M2B A;  4X0X A;  3Q74 A;  3W6G A;  5F05 A;  4PUR A;  2UZ8 A;  5CO3 A;  3VI5 A;  4F03 A;  2V6K A;  4ISD A;  3WGE A;  4TR4 A;  4GQC A;  4EF0 A;  2CT6 A;  1SL0 B;  1SJZ A;  4LL4 B;  1R7H A;  3CRU A;  4MH3 A;  5BMU A;  2NBS A;  4K9Z A;  4KND A;  3C73 A;  5HFG A;  1U3I A;  4X43 A;  4EXJ A;  1UC7 A;  5ECQ B;  5IO0 A;  4EDY A;  2LST A;  4HU9 A;  5B6N A;  3R2Q A;  2WB9 A;  2YZU A;  4J56 E;  3ZRE A;  3TDG A;  5IPG A;  3GSS A;  1XWG A;  3F63 A;  1EGO A;  4V1A g;  4KE3 A;  2IN3 A;  2RUE A;  1K0B A;  5D9T A;  2CAI A;  4XS1 A;  2EIO A;  3UMA A;  2NDO A;  2KHP A;  4BA7 A;  4PTS A;  5ELG A;  4O5U A;  3DML A;  5ID2 A;  3EU3 A;  16GS A;  3NOF A;  1IYH A;  4I2T A;  4MDC A;  1AIU A;  3MDK A;  4LMV A;  3IAS 2;  4K6X A;  1YF1 A;  3ERF A;  3GN3 A;  1T3B A;  3QR6 A;  1SD8 A;  5H5S A;  3KM6 A;  4G10 A;  5F07 A;  1EP8 A;  4ECB A;  4BWS A;  1ACV A;  4MH2 A;  2BMX A;  2JAC A;  4WET A;  4FH8 A;  3ZLP A;  3ERG A;  3VPQ A;  3ME8 A;  4XHM A;  3P7X A;  4WF5 A;  4QL9 A;  4Q5N A;  3TKQ A;  1X5D A;  3KEB A;  5CRW A;  1SKW B;  3PIN A;  4IEL A;  4IQA A;  1GSY A;  4MZB A;  3LXT A;  4CHS A;  3HCZ A;  2H0H A;  5DCG A;  1PRX A;  1VF2 A;  3CSI A;  4MJC A;  3GL5 A;  1LJR A;  1A2J A;  3EMX A;  3H93 A;  4ILF A;  1FVK A;  2AJQ B;  2B3S A;  5COH A;  2DJ0 A;  3DKS A;  2FNO A;  2IMF A;  1ST9 A;  2C0E A;  1PL1 A;  2BTO T;  5EY6 A;  2I1U A;  1K0C A;  2YWM A;  2OE3 A;  3TKS C;  1MDK A;  2O7K A;  1TXX A;  5B7C A;  13GS A;  1MDJ A;  3CRT A;  5HFK A;  2ALB A;  4N11 A;  2A4H A;  3FZ4 A;  3EPT A;  2L4Q A;  1FHE A;  2FUG 2;  2L5L A;  5CAX A;  1AUC A;  3IV4 A;  1O73 A;  1WOU A;  1Z7P A;  4KAE A;  1ZL9 A;  2JAD A;  1WP0 A;  5J41 A;  5ELA A;  2YN1 A;  3DRN A;  4G2E A;  2LRT A;  1THX A;  4HZ4 A;  1E6B A;  4FIW A;  1XW6 A;  1O6J A;  1K3Y A;  5AIS A;  2FWG A;  2C0D A;  3N9J A;  3LXZ A;  2VCX A;  1EOG A;  4IJI A;  1PA3 A;  3RAZ A;  1F3B A;  1QQ2 A;  1K3L A;  4MAB A;  1OE8 A;  1B9Y C;  6GSX A;  2L6D A;  2VOC A;  2PGT A;  1U88 A;  2YP6 A;  2IMD A;  2C3N A;  3KD0 A;  3HKR A;  3I43 A;  4JZQ A;  2B6M A;  1N8J A;  2HFD A;  3M0F A;  3VLN A;  1R26 A;  4K0G A;  4YKG A;  3HHV A;  4IP6 A;  3V1W A;  3QAG A;  1EZK A;  4NPB A;  4BVX B;  3H8Q A;  2LV3 A;  4Z2U A;  2EIQ A;  1FG4 A;  1KTE A;  1EP7 A;  3HDC A;  2F9S A;  4O92 A;  4MA9 A;  1HD2 A;  2CVD A;  5LCZ A;  1TK8 B;  2HRK A;  2N5A A;  2J23 A;  4I5Q A;  5L71 A;  4QQ7 A;  1NHY A;  3GH9 A;  1M9B A;  1G7E A;  2GZP A;  4CY6 A;  3APQ A;  3TKP A;  1ZYE A;  4GLT A;  4GQF A;  3D4T A;  2H6X A;  1U87 A;  2DJJ A;  2GVP A;  3IAM 2;  3KCM A;  4Q5F A;  5IPH A;  1TOF A;  3FEU A;  2PER A;  4H86 A;  3TGZ A;  3F4T A;  1A2M A;  3TJB A;  5IIZ A;  3WGX A;  1X5E A;  1GH2 A;  1OC9 B;  1FAA A;  2X8C A;  3TRP A;  5JCG A;  1PX7 A;  3GHA A;  2OBK A;  2KLX A;  2K9F A;  2O89 A;  1G0T A;  2GST A;  4NV5 A;  4TVE A;  5G31 A;  1G7O A;  5G1L A;  4YAV A;  4K1F A;  2CZ2 A;  4IQ1 A;  3PGT A;  1S3C A;  4EIP A;  4IS0 A;  1OVN A;  3IE3 A;  4NHW A;  2C80 A;  4P3Y B;  4TR1 B;  2FA8 A;  2CX4 A;  2B5E A;  2VIM A;  2GSS A;  4WR4 A;  3R3E A;  1PN9 A;  2IFQ A;  1AAZ A;  2YV9 A;  2HT9 A;  5BRT A;  1XXU A;  5A4U A;  3UVH A;  3GV1 A;  3GL3 A;  4ZL9 A;  1GTI A;  1DBY A;  5DCH A;  2CZ3 A;  5CRE A;  9GSS A;  3J7Y b;  3C71 A;  1XW5 A;  2JSZ A;  3ZVJ D;  2VCQ A;  2C1Y A;  3BJ5 A;  2PBJ A;  4HI7 A;  8GSS A;  1PGT A;  1WIK A;  4IKH A;  2ES7 A;  1BG5 A;  3CYN A;  4HJM A;  4YAP A;  1V40 A;  1ZOF A;  3HVV A;  1X9W B;  3QOU A;  4BL7 B;  3EVI A;  1V2A A;  1GUK A;  1GNW A;  5GST A;  3QFB C;  6GSW A;  4HZ2 A;  3TJK A;  4RUV A;  2B1K A;  3KXO A;  1AQV A;  2LUS A;  2FCH A;  3W8S A;  4EKZ A;  5ECO B;  1SJI A;  2WJU A;  4I97 A;  4PQ1 A;  1GSS A;  3MNG A;  1GUM A;  1DUG A;  3FMW A;  2KOK A;  3M1G A;  3RBT A;  2LNT A;  2VL9 A;  3K8N A;  4ML6 A;  3WT1 A;  1BED A;  3H1N A;  4G9H A;  2FA4 A;  1F6M C;  3MWH A;  4I8B A;  5GAN D;  3RPN A;  1WPI A;  2NVL A;  3EMP A;  2HSH A;  4ECJ A;  3L9U A;  4ZBD A;  3TRX A;  3KJY A;  4MK3 A;  4KGI A;  4POL A;  1B4P A;  3G7J A;  2JSY A;  2CX3 A;  2A2S A;  2WCI A;  5F06 A;  1PD2 1;  4PGT A;  4HQS A;  1ZGN A;  1XWC A;  3ZTL A;  3LYK A;  5IO2 A;  4K8M A;  4TR0 A;  2A4V A;  3US3 A;  2RM6 A;  4ULX A;  3D4M A;  4GWR A;  1SL2 B;  2I9H A;  4MPF A;  4TKY A;  2H1G A;  2WGR A;  2WUL A;  5CP1 A;  4DSS A;  2XC2 A;  2VCT A;  2H72 A;  4YQM A;  1M2D A;  3BCK A;  4K2X A;  1M9A A;  5FHI A;  1CQG A;  1OC8 A;  3F4S A;  3VPT A;  1Z6N A;  1WRY A;  2X4A A;  3DVW A;  4KDY A;  3ZIT A;  22GS A;  1ERV A;  3FR6 A;  2FHE A;  4ZIJ A;  1F3A A;  2YZH A;  5IOX A;  2B5X A;  5GAP D;  4IVF A;  3VFI A;  1EEJ A;  2GQK A;  3LYP A;  3QD9 A;  1Y25 A;  2REM A;  2R0C A;  1CQH A;  4O5R A;  2H6Z A;  4X1U A;  2VD1 A;  1G6Y A;  2YWN A;  2LNS A;  2V41 A;  3IRA A;  3GX0 A;  3UL3 A;  1GUH A;  5EVO A;  3LWA A;  3WD6 A;  4HDE A;  3GKM A;  3DIE A;  1Z7R A;  3E3E A;  1M2A A;  4EUY A;  2O8V B;  2R0P A;  1QK8 A;  1YKA A;  2DKI A;  1R4W A;  1HNA A;  3IBH A;  5E59 A;  3LGC A;  2P5R A;  2KP2 A;  2L57 A;  4MF7 A;  4MJA A;  4JR4 A;  2YAN A;  2HZE A;  1GP1 A;  5JCU A;  14GS A;  1F2E A;  2JL4 A;  3GUR A;  5KN3 A;  2F51 A;  1XWB A;  1XVW A;  3IK7 A;  3TOU A;  1JZW A;  2H74 A;  1X9M B;  3VUR A;  1GSD A;  5HR0 A;  2R37 A;  2VL2 C;  3QAV A;  2XPD A;  1SK2 A;  3M3M A;  3TKR A;  4DVC A;  3GTU B;  2GZZ A;  1JFU A;  2OE1 A;  4WEY A;  3D6I A;  3D5J A;  2LS5 A;  2PMT A;  2RM5 A;  2L4C A;  1GRX A;  3IC8 A;  2RUF A;  19GS A;  2CA8 A;  3QFA C;  4EVM A;  2DIY A;  2LJR A;  5IQY A;  1GWC A;  4GSN A;  4KA0 A;  2AHE A;  4FYU A;  1Y6E A;  3D22 A;  1X5C A;  2WZ9 A;  4MF5 A;  1FOV A;  2VUP A;  3F0I A;  1PL2 A;  4V2L A;  4BVY A;  2X64 A;  1B9X C;  3HY2 A;  1SK1 A;  2DMM A;  2H30 A;  2IME A;  3ED3 A;  3BBY A;  4F0B A;  3IPZ A;  2P31 A;  5ECL B;  3RDW A;  3LQ7 A;  1R5A A;  2H66 A;  1XCC A;  3GA4 A;  3CSH A;  5ECM B;  1OYJ A;  4MZC A;  1Z9H A;  6GSV A;  5IMA A;  4FO5 A;  3LW9 A;  3IR4 A;  2CQ9 A;  5D9X A;  3I9V 2;  5J3R A;  4WR5 A;  4XTS A;  4GF0 A;  4FYC A;  1PQN A;  3I6A A;  4MPG A;  1JZR A;  5G5E A;  1UA5 A;  1B8X A;  2HI7 A;  3D0Z A;  3KMN A;  3FZ9 A;  3GKN A;  1V98 A;  3M9K A;  3TCO A;  1ZYQ B;  2OAC A;  1B4Q A;  4D73 A;  4AJ6 A;  3WYW A;  2CVK A;  1AW9 A;  2V6O A;  2PWJ A;  4IN0 A;  4MNN A;  1J08 A;  1IYI A;  3GKX A;  2AB6 A;  2GGT A;  1QFN A;  2G2Q A;  4K5R A;  4POK A;  1QXH A;  3NIV A;  2FWF A;  4XS4 B;  3DGQ A;  4ZBA A;  4TOP A;  4JRR A;  1U6T A;  2EIR A;  4L8E A;  1T8E B;  3NZN A;  1SKR B;  2YNX A;  5GZZ B;  3O3T A;  1TDI A;  3FR9 A;  1HNC A;  4HQZ A;  2X49 A;  2HYX A;  1BQ7 A;  3KGK A;  2QSI A;  5DAK B;  3Q19 A;  3HYP A;  5D9V A;  4PUA A;  5D73 A;  2QA1 A;  4TXO B;  4ACS A;  4JBB A;  1XW9 A;  4F2I A;  3GYK A;  5E4W A;  6GSS A;  2H19 A;  2HRA A;  1HYU A;  3CXG A;  2YCD A;  4KB3 A;  2LQQ A;  4K2D A;  2GQM A;  1FO5 A;  3CSJ A;  2GLR A;  3DXB A;  3JCM L;  1QUW A;  4IJ3 A;  3ZVJ A;  3TJF A;  3CTF A;  1ERW A;  1AC1 A;  1O7U A;  1T7P B;  3C8E A;  2QC7 A;  3BOA A;  4TW5 A;  1RK4 A;  3QCP A;  4LLR A;  3G7Y A;  3TKS E;  1ML6 A;  3VI7 A;  2H0I A;  3ZYW A;  2CVB A;  4L0U A;  5DAL B;  4MCU A;  4NXI A;  2DML A;  3D21 A;  4EDZ A;  1GSF A;  2VL2 A;  4G19 A;  5JWO B;  3KP9 A;  4N0Z A;  3ZIV A;  3UEM A;  1FVJ A;  5KN1 A;  2DSA A;  4AF2 A;  4ID0 A;  1YF0 A;  5CYY A;  3L4N A;  4KF9 A;  4CDO A;  4CY8 A;  3H79 A;  4JE1 A;  3VWX A;  3UJ1 A;  1YKC A;  2PUK C;  1TP9 A;  1WMJ A;  2L59 A;  5ABR A;  1TU7 A;  4YH2 A;  5IMF A;  4G0K A;  1N2A A;  2KUC A;  4OD7 A;  2AAW A;  2LKU A;  1TJD A;  4ZB8 A;  4I2U A;  1BX9 A;  2A2R A;  5INY A;  3S9F A;  2JZS A;  4HEA 2;  5G1K A;  4USS A;  3KTB A;  5EPF A;  4OWY A;  3LG6 A;  2R5G A;  3RHC A;  1NW2 A;  3IDV A;  2TRC P;  1K0A A;  2GDR A;  4Z2R A;  5H5Q A;  2ZNM A;  1V57 A;  1OKD A;  2IL3 A;  2R4V A;  3FRC A;  5LNK e;  2AYT A;  3PH9 A;  1T4Z A;  1W89 A;  2FLS A;  1TU8 A;  4EL1 A;  1GSE A;  4K0N A;  2WDU A;  1V58 A;  1WWJ A;  3M9J A;  1GTB A;  1ABA A;  3MAK A;  1XBS A;  1OAZ A;  3IHQ A;  3DD3 A;  2DBC A;  2N5F A;  3PR8 A;  5B8B A;  1EWX A;  2IPA A;  3FK8 A;  4X4J A;  2VCW A;  2H1D A;  1JLV A;  1TI1 A;  1OC3 A;  5KOX A;  18GS A;  1Q4J A;  3G9B A;  1AQX A;  1ERU A;  4DEJ A;  3BD2 A;  3IOS A;  3ZL5 A;  2R6K A;  2B7K A;  1S3A A;  4IGJ A;  1URM A;  3GX8 A;  4HUA A;  4PXO A;  3FHK A;  3BCI A;  1EV9 A;  4TXV A;  5AIX A;  1FB6 A;  2MMA A;  3APO A;  4KDX A;  2CAQ A;  4N30 A;  1NM3 A;  1BJX A;  4HJ2 A;  5ECP B;  2AUV A;  2I81 A;  4OO5 A;  1MD4 A;  1T4Y A;  4AJ7 A;  20GS A;  3P90 A;  3RPP A;  1MD3 A;  3I69 A;  2PVO C;  4TRX A;  2VAF A;  3HJM A;  3O6T A;  3VK9 A;  1T1V A;  3Q18 A;  3A5I A;  3EYT A;  1A2L A;  2ON5 A;  2C8U A;  3P2A A;  1JZO A;  3LFL A;  1A8Y A;  4TR3 A;  17GS A;  1SL1 B;  4PNF A;  5KOW A;  3TJG A;  2OKA A;  4IBP A;  1QGV A;  4ZL8 A;  2MYG A;  3FYG A;  4MP4 A;  2Z9S A;  1SYR A;  4KW6 A;  4HOJ A;  5J4U A;  1J0F A;  1PN0 A;  3DYR A;  3L9V A;  5DVB A;  2PN8 A;  2IMK A;  4BVX A;  5ID2 B;  2K8V A;  4WKW A;  4GSS A;  2GS3 A;  3C1S A;  4K7N A;  5DQS A;  2DJ3 A;  3VWU A;  4KH7 A;  4FYB A;  4MJE A;  2P5Q A;  2VLV A;  1JZD A;  3ISO A;  3KH9 A;  3GRX A;  4GXZ A;  3EE2 A;  5ECK B;  3ZML A;  3VWW A;  2H1B A;  2MZC A;  3VWV A;  2VL3 A;  3P8W A;  2MBT A;  4ZB9 A;  4Z7X A;  3MYD A;  5AGY A;  5D8I A;  1ZZY A;  3DWV A;  5ECR B;  2HE3 A;  2HSY A;  2D2Z A;  2HRF A;  3H4K A;  2C3Q A;  2QGV A;  2RII A;  3IA1 A;  4DSR A;  1GLP A;  2OJL A;  1SU9 A;  2C3T A;  4ML1 A;  1YDK A;  3TJJ A;  1G6W A;  2H70 A;  4MMM A;  3UAR A;  1SK0 A;  5EL8 A;  4F82 A;  2R3X A;  2EC4 A;  4JR6 A;  1OC9 A;  4MF6 A;  5ECI B;  1GTU A;  5FT3 A;  1A23 A;  6GSY A;  2XBI A;  3SWL A;  3LJR A;  4WBJ A;  2A2P A;  3A2W A;  4MZW A;  5GSS A;  2I4A A;  3F9U A;  4KUN A;  2V32 A;  3O76 A;  4EO3 A;  4YQV A;  4IP1 A;  3IK9 A;  5G30 A;  3FR3 A;  5IM9 A;  4E8H A;  4CW9 A;  1TW9 A;  2X99 A;  1XZO A;  1GSQ A;  3F6F A;  2F8A A;  3MSZ A;  1V9W A;  2M72 A;  4K7O A;  2V2G A;  4V1A p;  4OO4 A;  4TR1 A;  4G0L A;  2GTU A;  6GST A;  2YJ7 A;  4OFM A;  1Q98 A;  2E2M A;  1PMT A;  3KTL A;  4BPY A;  3E0U A;  1Z5Y E;  3FKF A;  2ZCT A;  4OCF A;  5G2Z A;  3EUR A;  4AGS A;  2WFC A;  2H01 A;  2HXK A;  5CNW A;  3EIN A;  1USB A;  2NPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...