1KTEA

Crystal structure of thioltransferase at 2.2 angstrom resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
105
structure length
105
Chain Sequence
AQAFVNSKIQPGKVVVFIKPTCPFCRKTQELLSQLPFKEGLLEFVDITATSDTNEIQDYLQQLTGARTVPRVFIGKECIGGCTDLESMHKRGELLTRLQQVGAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords THIOLTRANSFERASE
publication title Crystal structure of thioltransferase at 2.2 A resolution.
pubmed rcsb
source organism Sus scrofa
total genus 35
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1996-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1kteA00
3DYRA 2MBTA 1PSQA 2GSQA 1TK0B 4TXOA 1SKWB 3W8SA 4JEDA 4HQZA 3F4TA 3TJJA 3ZL5A 1GL8A 3LJRA 1J9BA 2I3YA 2N5BA 1FHEA 5GAND 2VUPA 1GULA 2YWIA 3Q18A 4PNFA 5A4WA 1FB6A 3ME7A 5IMZA 1M2DA 2NDOA 5ECOB 2C0GA 5HFGA 1VGLA 3VWVA 3TKSE 5LNKe 5DALB 4NAXA 5J4UA 2LNSA 2BJXA 4ZL9A 4GF0A 1WMJA 1BEDA 3F0IA 2N5FA 2VL3A 5IOXA 2QC7A 4O92A 1M2AA 3IE3A 3WGDA 3IOSA 5B6MA 4EUYA 5DBQA 1YZXA 2C3NA 2XBQA 3KIJA 4EDZA 5DCGA 2ON5A 4K0GA 1SU9A 2E0QA 1G6YA 2HRFA 1TI3A 2AYTA 4KSOA 2V6OA 1VF3A 5G31A 2HZEB 3GL3A 3GURA 2OE3A 5IIZA 3U5RE 3IAM2 5A4UA 1EP8A 3APQA 16GSA 2CX4A 2AUVA 1GUKA 1TDIA 1T8EB 3UAPA 4EL1A 1F6MC 3L9VA 3HDCA 2H66A 2A2RA 2H6YA 1ZMAA 2C8UA 4TR4A 11GSA 1R26A 3ZMKA 2H1AA 3OR5A 5ECMB 3SWLA 2B3SA 2VM2A 5GSTA 2L5LA 3GHAA 2C0DA 6GSWA 4Z7XA 4F82A 4K7OA 2MMAA 4MF5A 5IM9A 2B6MA 3GX8A 2R6KA 2L4QA 1XOBA 4I8BA 4YQUA 1YJ6A 2H8LA 2YJ7A 5CAXA 2VCQA 2FGXA 1M99A 3L4NA 4JR6A 4JR4A 2B7KA 1O8WA 1JFUA 2DJJA 4KUNA 2MMNA 2JADA 1M7TA 2GVPA 2LRCA 1ERVA 3GA4A 2H0GA 4FYCA 4V2LA 3EINA 4X43A 2L57A 1XVWA 4ML6A 4RI6A 5GAPD 1ERTA 3WD6A 4XS4A 6GSYA 2VIMA 4I6XA 4MJCA 3TKPA 1RW1A 5ECNB 4BPYA 1GLQA 1SK1A 2OADA 2LJRA 2H1GA 3ZVJD 4IHUA 2PERA 5CRDA 2K8VA 3WYWA 2L5OA 4IN0A 3QD9A 2ZUPA 1TK8B 3GNJA 4EKZA 3C73A 1F3AA 5ECQB 5D93A 5IMCA 4MP4A 4F0CA 3ERWA 3WT1A 3ZIVA 2NVLA 2EC4A 1PN9A 4ZB8A 4OCFA 2JSYA 3TRPA 4L0WA 5C00A 2GQMA 1V98A 1JZOA 1QMVA 3VK9A 3HJMA 1HNBA 1IYHA 3C7MA 2P0GA 3EE2A 5DAKA 3HA9A 4ZILA 3EVIA 3ERGA 1OE8A 4L8EA 3HJPA 1W4VA 3ERFA 1UA5A 3GH6A 3QAGA 3P8WA 3KD0A 1RK4A 4WETA 2IWTA 3RHCA 3EYTA 2XHFA 4TXVA 2OE0A 3KMNA 1SL2B 2FWGA 1FAAA 3TJGA 2AB6A 1ABAA 1R4WA 1QFNA 1SYXA 3NZNA 1BQ7A 1U3AA 4IKHA 2VCVA 1J0FA 2DJKA 1TK5B 1G7OA 1A2LA 4OCEA 2DIZA 4K1FA 2CT6A 5CRWA 1TRSA 3FZ4A 1U87A 2C0EA 2RUFA 5J9BA 3D0ZA 1U88A 1SJIA 3IBHA 1OC3A 1S3DA 4JU5A 2BTOT 2C3QA 3HHVA 5JWQB 2R3XA 3W6GA 4FIWA 3D6IA 3E9JB 4WBJA 5D96A 2I4AA 1SD8A 3GTUB 1R7HA 4KX4A 1MD4A 3KTLA 4PGTA 4Q5FA 2FLSA 1YY7A 2IIYA 3TKRA 2WDUA 3FZ9A 2FD3A 2FY6A 2C3TA 7GSSA 1O7UA 4F2IA 1XCCA 4BWQA 4EVMA 3LWAA 2H1BA 1X5CA 2V41A 2VCTA 1XBSA 2OACA 3IK9A 3NOFA 3EU3A 1EEMA 5AIXA 2GT5A 4IJIA 5JCUA 1VF1A 2PVOC 14GSA 2VCXA 5G1KA 2HI7A 3VWXA 3QAVA 1G7EA 2KP2A 2H6XA 3E0UA 5COHA 2LSTA 2WFCA 3MNGA 4KCEA 1AW9A 2VL2C 5DVBA 1KTEA 1SL1B 3RHBA 1R5AA 6GSTA 3ZFBA 5KN1A 1X9WB 4HU9A 2D2ZA 10GSA 2L4CA 4ZB6A 4DSQA 3ZVJA 3F63A 3VI7A 4NPBA 1TU7A 3UARA 2PMTA 1YF1A 2DIYA 3FRCA 3F4RA 4MA9A 5L71A 2JZSA 1UN2A 1TXXA 3UBKA 1XWAA 4YQVA 1K0NA 2YPMA 4HUAA 4GSSA 2DSAA 2YP6A 5DQSA 2FWHA 3LGCA 2DJ1A 3FR9A 2NTOA 5IMVA 3F6FA 4N0VA 2R37A 1SK0A 4ECJA 2Z9SA 4MH2A 3Q74A 2YJHA 5ECIB 4K7NA 4KAEA 12GSA 4ZIJA 3P2AA 3LQ7A 3CTFA 3MDKA 4OFNA 4YH2A 3UL3A 2B1KA 4DVCA 1BX9A 1V58A 5IPGA 2M72A 1DSBA 2YZHA 5ECLB 5EVOA 5EPFA 1MTCA 3ISOA 5LCZA 1O85A 1ILOA 2HT9A 2GSTA 1K3OA 1F2EA 1K0MA 1Y6EA 3G9BA 1THOA 2EIQA 1K0DA 4FYUA 2RUEA 6GSVA 1U3IA 2CA8A 19GSA 2C0FA 2A4VA 2V2GA 5HFKA 2PUKC 3HXSA 2WZ9A 4AJ6A 3ZYWA 1TU8A 2H30A 4OFTA 2PGTA 4ILFA 4BVXA 1GNWA 3M9JA 2H0IA 4XS4B 3BBYA 4DSSA 2F3MA 2OE1A 2NBSA 5D9VA 1GP1A 3FEUA 4G9HA 4TN8A 4CDOA 1NHOA 3ZFLA 4L5LA 2CVBA 3FKFA 1XWKA 1UC7A 5E4WA 5IQYA 4MDCA 1SJZA 2DLXA 3KH9A 3D21A 3GIXA 3TCOA 4BWSA 2OBKA 3CYNA 3F4SA 3BCKA 4KSMA 4EE0A 4Q5NA 4CW9A 5F0GA 3TOTA 2E2GA 3I9V2 4EO3A 3BCIA 1T1VA 4EXJA 1GTBA 2KP1A 2HYXA 1TOFA 2K8SA 5DAKB 1XW5A 1PRXA 2VAFA 1QUWA 4MF6A 5G5EA 2B1LA 1M9AA 2H19A 2BMXA 3F8UA 4WF5A 2C80A 4PURA 1MD3A 1KEBA 4JBBA 3TGZA 3ZTLA 5ECKB 2M80A 4O32A 4IP6A 2YZUA 3RBTA 5J3RA 3HZ4A 4GRFA 1AAZA 1BJXA 3RAZA 3JCML 3LSZA 2J23A 2O85A 4ISDA 5HFIA 3EWLA 3IV4A 3TKSA 4K0NA 1F37A 2EIOA 2G2QA 3IPZA 2I81A 1XFLA 4LLRA 1Z6NA 1FW1A 1KNGA 4X0XA 1Q98A 2QSIA 1WE0A 4MPGA 2AJQB 3ME8A 2HLSA 5DQYA 1VF4A 4ECCA 20GSA 5HR2A 1G0TA 1Z7RA 1EGOA 2OJLA 3KP8A 3IK7A 3HVVA 1QXHA 1OE7A 6GSSA 2QKEA 4XRDA 3VI5A 3QMXA 4YAVA 3FW2A 1B48A 4KH7A 4AJ8A 2XC2A 1OAZA 5D9XA 3KGKA 1HYUA 2LEGA 2WRTA 5HR1A 3ZITA 4EF0A 3UMAA 1YDKA 2AAWA 2GT6A 4Q5QA 2B5EA 1FVKA 3FK8A 2IPAA 5AIVA 2J9HA 2KLXA 1OC9B 1F3BA 4FH8A 1EV9A 1LJRA 2LKUA 3CRUA 3IC4A 2TRXA 3Q19A 1T4YA 5F05A 2FA4A 2GGTA 2X64A 4MH3A 4MZCA 5IMFA 3GSSA 1DBYA 2C4JA 4KA0A 1MEKA 5IO2A 3ZREA 4IQ1A 4MK3A 2V1MA 5AGYA 4ZB9A 5EY6A 1TTZA 2PU9C 1LBKA 3CSJA 2NPBA 5KEJA 1PKWA 2H71A 4OD7A 1YQ1A 1F9MA 1A2JA 3KXOA 3CTGA 1TI1A 4FYBA 3LXTA 2FA8A 3EC3A 5FHIA 1DE2A 3VPTA 2EIRA 2WCIA 5CRGA 2GLRA 4QQ7A 2VLTA 2O8VB 1TKDB 3GH9A 5JWOB 2IMFA 4ECBA 4K6XA 2K18A 1ON4A 3FZ5A 4KCAA 1K0CA 5CRHA 1E6BA 2RLIA 2LJAA 1HNCA 4DEJA 4G19A 1Z5YE 5DALA 4PQ1A 1I5GA 1FOVA 3GKKA 1EGRA 3PH9A 4ZXGA 4F03A 2VD1A 1AUCA 1RQMA 3IA1A 1AQXA 3K8NA 2H6ZA 3KH7A 1XVQA 1FG4A 4V2NA 1SKRB 3VWUA 4MPFA 4DSRA 5GZZB 1O81A 3DXBA 4IBPA 3GKNA 1GSSA 4NMUA 4XCSA 2PVQA 3CMIA 4MLYA 2L6DA 3DVWA 2P5RA 3NIVA 4KDUA 3I6AA 2MZCA 1XXUA 3C1SA 3US3A 1GUMA 1GSYA 2HZFA 2F8FA 5F06A 5KN0A 2HZEA 1JZRA 3KMOA 3DRNA 3QR6A 5HR3A 1GSEA 5G2ZA 3W8JA 4HJ2A 4G10A 2IJYA 2MBSA 2LNTA 3A2VA 3TJFA 3LXZA 4YAPA 5KN2A 4F0BA 1T3BA 4TVEA 5DJLA 2C1YA 3FYGA 2H72A 4L5OA 1H4OA 1O73A 1A8YA 5CYYA 5CREA 5ID2A 5KN3A 2LQOA 1EOGA 2GSSA 2GSRA 4H86A 3MWHA 2X8HA 1XWCA 2WULA 2YWMA 1THXA 1ZL9A 4ZL8A 4AF2A 1HQOA 2GZPA 3RPNA 3UEMA 5J9CA 5IO0A 1WJKA 1GSFA 1SENA 1GWCA 2B5XA 2IMIA 5IPHA 2M46A 2I9HA 5DJMA 1YKAA 2P5QA 2GTUA 1EEJA 3HD5A 2V6KA 3I43A 4TXOB 2B5YA 2AHEA 3WT2A 4OO5A 3G7IA 3Q6OA 1TRUA 4QL7A 3MSZA 3C1RA 1GSQA 2GZZA 3EU4A 1PA3A 2IN3A 4LL1B 1TRWA 2VCZA 1EOHA 3C8EA 1A23A 2MMOA 3HZ8A 4K9ZA 2HFDA 4POBA 2MYGA 5CP1A 4JZQA 1N2AA 5C04A 3GMFA 1CQHA 4PQHA 2LRNA 5DDLA 4ZBAA 4TR1A 1V9WA 4IELA 2VL9A 4GTUA 3GKXA 3GUSA 5GSSA 4GQFA 1PX7A 3L9SA 1BG5A 3V1WA 3M3MA 2X8GA 5HR0A 1E2YA 2HXKA 2H73A 1V40A 1V2AA 1OC8A 5EL8A 1O6JA 3CRTA 3ZIJA 1OYJA 1K0BA 3O3TA 4WR4A 2HE3A 2HNLA 1QQ2A 1USBA 1X5EA 3KTBA 4TR3A 5D9TA 4ACSA 3A5WA 5FT3A 1IYIA 3DWVA 4KW6A 3TOUA 2DMMA 5F8BA 4NHWA 4OFMA 5ECSA 1MDIA 2IMEA 2HSHA 3FHKA 2GQKA 3A2XA 4BA7A 4N0ZA 2CAQA 1JZWA 3TRQA 3C71A 4XHMA 4RQXA 4MZWA 1X5DA 5J5NA 4IQAA 4ULXA 4KNDA 3M1GA 2OA7A 3ZMLA 2A2SA 2DJ0A 5B8BA 4TKYA 1M9BA 2WS2A 1NHYA 3GYKA 4MJAA 4IW9A 2CVKA 2I1UA 2IMDA 1BYEA 2PPTA 1B4QA 4IP1A 4GSTA 3TB2A 2YN1A 2CAIA 1EV4A 3J7Yb 1PMTA 4PUAA 3L9UA 2JL4A 1I9DA 2JZTA 4HDEA 1EZKA 3VWWA 3G7JA 3IHQA 4HJMA 3CXGA 1SJ6A 1NW2A 4XIHA 3H79A 3HVXA 2K6VA 3CBUA 1C72A 1PL1A 2VL2A 1UVZA 3RDWA 3CSIA 22GSA 1LU4A 1PL2A 3O6TA 3EURA 1VF2A 3M8NA 1GSDA 4LMWA 5H5SA 2KUCA 1XOAA 2LV3A 5JWRB 4WBRD 4O7HA 3LYKA 2H74A 2FCHA 5H5RA 4MABA 4J56E 3TJBA 3WGEA 3IRAA 4TR0A 3F6DA 4KGIA 1OKTA 1PGTA 1WIKA 2IL3A 1YEPA 3L78A 3H93A 4V2MA 5AN1A 2FNOA 3ZZXA 4K2DA 4XTSA 2RIIA 5J41A 4BVYA 4MZBA 2LQQA 4I5QA 2H0HA 2AV4A 2F9SA 3D4TA 2VD0A 5JCWA 4E8EA 4MMMA 3UVTA 1AC1A 2FWFA 3L0HA 2GZYA 3HY2A 2DJ3A 2V32A 2IFQA 3F9UA 5ECPB 2L6CA 1ML6A 1FO5A 1SYRA 1YKCA 3KZQA 2YWNA 3N9JA 1K0OA 2XPDA 3F3RA 5G5FA 1NM3A 5A5KA 4J2FA 1AQWA 1XW6A 2H76A 4CHSA 5FWGA 2CQ9A 3A3TA 4GWRA 4E8HA 3DEXA 4LA1A 2XBIA 4PX1A 2ON7A 4V1Ag 2VO4A 4P3YB 17GSA 4MF7A 3VURA 1AIUA 2JZRA 3FY7A 2YCDA 1BAYA 3UVHA 3ZLPA 4D73A 4I97A 2N5AA 2O87A 2CX3A 1GTUA 1OVNA 4WEYA 4RQRA 3FR3A 2FHEA 4IS0A 2ALBA 4MJBA 4POKA 1A2MA 3IXRA 1WWJA 4WR5A 4XS6A 4TRXA 2ZNMA 1PKZA 4LMVA 3O76A 5F07A 2YOIA 2O89A 3QAWA 1ERUA 4V1Ap 3VPQA 5ID2B 3UIWA 4PXOA 1M0UA 4PUFC 3EMXA 2JACA 3PR8A 3AY8A 3A2WA 5B7CA 4F9ZA 2JU5A 1G6WA 1Z7PA 4XS1A 4XRAA 5IMAA 2XPEA 3BJ5A 2R4VA 3KEBA 2IMKA 2X99A 1K3LA 1TP9A 1OKDA 1V57A 4I2TA 3TDGA 4ML1A 1GH2A 4X1UA 9GSSA 5LD0A 4HZ4A 1AXDA 2HRNA 4TW5A 3HJOA 4K7IA 3DD3A 1S3AA 4JE1A 1Z6MA 1TW9A 2WB9A 3G7YA 2WJUA 4HOJA 3M0FA 1QK8A 1X0RA 3GV1A 1GNEA 3HYPA 2X8CA 2LUSA 3D22A 4N30A 1GRXA 1JLWA 3IDVA 5D9WA 3H1NA 2GDRA 1XPVA 3BD2A 1T00A 2OBIA 4ECIA 1M2BA 2REMA 4TR1B 3QPMA 3H4KA 3GX0A 3QFAC 3RPPA 2VM1A 3GSTA 1H75A 1WPIA 2DC5A 3WGXA 2VOCA 1ERWA 2LJKA 3LG6A 5ENUA 4LL4B 5HQPA 1WRYA 5IOWA 4BL7A 4NWYA 1PX6A 2R5GA 4ID0A 5E59A 1ZZYA 4MJEA 4ZBDA 2F8AA 3UJ1A 1MDKA 1Y25A 3SBCA 3PGTA 3QCPA 1K0AA 1WOUA 6GSUA 18GSA 3FR6A 2QGVA 3S9FA 1SKSB 3TRXA 1X9MB 5G30A 1ACVA 4RI7A 4HS1A 3TUEA 3UOMA 3GL5A 4J57E 1N8JA 4AGSA 2WGRA 1J08A 2R2JA 3BOAA 3DKSA 1FB0A 1KBNA 5B6NA 3LYPA 1SD9A 3KCMA 1XWGA 4WXTA 4TOPA 2H1DA 2CZ3A 4KDYA 1ZGNA 3MAKA 4EC0A 3KM6A 3TKQA 1AQVA 2LRTA 4PQIA 2FUG2 3P7XA 5D8IA 2YWOA 1S3CA 8GSSA 4OMVA 4YQMA 5DCHA 3QDNA 4N10A 1B9XC 4N11A 2OKAA 2RM5A 2F51A 2H70A 1GTIA 2LTKA 1R5PA 4GCIA 3ED3A 3F3QA 4OWYA 4EDYA 3UBLA 3KP9A 3LORA 4IJ3A 3DVXA 1TJDA 4POMA 2YV7A 3R2QA 2E7PA 2E2MA 1Z9HA 1URMA 1A0RP 2P31A 4DSSB 2K9FA 4AJ7A 3LFLA 5ABRA 1ZYQB 4QL9A 4PNGA 1T4ZA 3VFIA 5JCGA 4NV2A 4NHZA 1PD21 1EP7A 3HCZA 1Q4JA 2MMZA 1TRVA 1EWXA 1GTAA 3KJYA 4ZL7A 1Z3EA 3DGQA 4GXZA 1A0FA 2DMLA 3D4MA 4I2UA 4JRRA 1OC9A 1SK2A 2O7KA 2CVDA 4L0UA 1SL0B 5D73A 5A4VA 4G2EA 4HZ2A 1NSWA 4KB3A 3VLNA 5H5QA 2LS5A 1JHBA 4MCUA 2KOKA 2TIRA 1B9YC 3DMLA 5IMDA 4HQSA 1XWBA 1PQNA 1YEXA 4WKWA 2YNXA 1ZYEA 3D5JA 1QGVA 2IFQB 4KE3A 13GSA 1GUHA 3GN3A 3TJKA 4GQCA 4IGJA 5INYA 1DUGA 2L59A 3DIEA 3H8QA 3GRXA 3GKMA 2KHPA 1K3YA 2YANA 1MDJA 2G0FA 4NXIA 2ES7A 3E3EA 4HI7A 4K8MA 1XIYA 1B8XA 3J7Yk 2H01A 1DE1A 1B4PA 1JLVA 2RM6A 3HVSA 3FZAA 5CO3A 2B7JA 5ECHB 2HSYA 2VLVA 4FO5A 1A8LA 4D73B 6GSXA 2H75A 1A24A 3APOA 2PWJA 3PINA 4OO4A 1ST9A 2YV9A 3IAS2 4RUVA 4Q5RA 4WF4A 4POLA 2VLUA 1U6TA 1HNAA 4NV5A 3HKRA 2PBJA 1VRSD 3N5OA 2DBCA 1ZCPA 2GS3A 1X9SB 5ELAA 2VCWA 2PN8A 1WP0A 2TRCP 1GSUA 3IR4A 3LEFA 5CNWA 2DJ2A 4GLTA 3GFKA 3APSA 3M9KA 3QFBC 4GSNA 3TKSC 4KDXA 2CV4A 5B8AA 1HD2A 5AISA 5G1LA 5ELGA 2GQLA 3GTUA 3U6VA 4HU7A 4O5RA 4ZBBA 2CZ2A 1YF0A 3EMPA 1XZOA 4IVFA 1GLPA 1ZOFA 1O8XA 2FWEA 1T7PB 1CQGA 1XW9A 2ZCTA 1FVJA 4HEA2 2JSZA 3QOUA 3CSHA 5ECRB 1JZDA 3P90A 1W89A 3I69A 3ZRDA
chains in the Genus database with same CATH superfamily
3DYRA 2MBTA 1PSQA 2GSQA 1TK0B 4TXOA 1SKWB 4A5PA 3W8SA 4JEDA 4HQZA 3F4TA 3TJJA 3ZL5A 1GL8A 3LJRA 1J9BA 2I3YA 2N5BA 1FHEA 5GAND 2VUPA 1GULA 2YWIA 2UZ8A 3Q18A 4PNFA 5A4WA 1FB6A 3ME7A 5IMZA 1M2DA 2NDOA 5ECOB 2C0GA 5HFGA 1VGLA 3VWVA 3TKSE 5LNKe 5DALB 4NAXA 5J4UA 2LNSA 2BJXA 4ZL9A 4GF0A 1WMJA 1BEDA 3F0IA 2N5FA 2VL3A 5IOXA 2QC7A 4O92A 1M2AA 3IE3A 3WGDA 3IOSA 5B6MA 4EUYA 5DBQA 1YZXA 2C3NA 2XBQA 4Z2RA 3KIJA 4EDZA 5DCGA 2ON5A 4K0GA 1SU9A 2E0QA 1G6YA 2HRFA 1TI3A 2AYTA 4KSOA 2V6OA 1VF3A 5G31A 2HZEB 3GL3A 3GURA 2OE3A 5IIZA 3U5RE 3IAM2 4G0IA 5A4UA 1EP8A 3APQA 16GSA 2CX4A 2AUVA 1GUKA 1TDIA 1T8EB 3UAPA 4EL1A 1F6MC 3L9VA 3HDCA 2H66A 2A2RA 2H6YA 1ZMAA 2C8UA 4TR4A 11GSA 1R26A 3ZMKA 2H1AA 3OR5A 5ECMB 3SWLA 2B3SA 2VM2A 5GSTA 2L5LA 3GHAA 2C0DA 6GSWA 5BRTA 4Z7XA 4F82A 4K7OA 2MMAA 4MF5A 5IM9A 2B6MA 3GX8A 2R6KA 2L4QA 1XOBA 4I8BA 4YQUA 1YJ6A 2H8LA 2YJ7A 5CAXA 2VCQA 2FGXA 1M99A 3L4NA 4JR6A 4JR4A 2B7KA 1O8WA 1JFUA 2DJJA 4KUNA 2MMNA 2JADA 1M7TA 2HRAA 2GVPA 2LRCA 1ERVA 3GA4A 2H0GA 4FYCA 4V2LA 3EINA 4X43A 2L57A 1XVWA 4ML6A 4RI6A 5GAPD 1ERTA 3WD6A 4XS4A 6GSYA 2VIMA 4I6XA 4MJCA 3TKPA 1RW1A 5ECNB 4BPYA 1GLQA 1SK1A 2OADA 2LJRA 2H1GA 3ZVJD 4IHUA 2PERA 5CRDA 2K8VA 3WYWA 2L5OA 4IN0A 3QD9A 2ZUPA 1TK8B 3GNJA 1PN0A 4EKZA 3C73A 1F3AA 5ECQB 5D93A 5IMCA 4MP4A 4F0CA 3ERWA 3WT1A 3ZIVA 2NVLA 2EC4A 1PN9A 4ZB8A 4OCFA 2JSYA 3TRPA 4L0WA 5C00A 3IC8A 2GQMA 1V98A 4G0LA 1JZOA 1QMVA 3VK9A 3HJMA 1HNBA 1IYHA 3C7MA 2P0GA 3EE2A 5DAKA 3HA9A 4ZILA 4CY6A 3EVIA 3ERGA 1OE8A 4L8EA 3HJPA 1W4VA 3ERFA 1UA5A 3GH6A 1PFOA 3QAGA 4K5RA 3P8WA 3KD0A 1RK4A 4WETA 2IWTA 3RHCA 3EYTA 2XHFA 4TXVA 2OE0A 3KMNA 1SL2B 2FWGA 1FAAA 3TJGA 2AB6A 1ABAA 1R4WA 2QA1A 1QFNA 1SYXA 3NZNA 1BQ7A 1U3AA 3HVNA 4IKHA 2VCVA 1J0FA 2DJKA 1TK5B 1G7OA 1A2LA 4OCEA 2DIZA 4K1FA 2CT6A 5CRWA 1TRSA 3FZ4A 1U87A 2C0EA 2RUFA 5J9BA 3D0ZA 1U88A 1SJIA 3IBHA 1OC3A 1S3DA 4JU5A 2BTOT 2C3QA 3HHVA 5JWQB 2R3XA 3W6GA 4FIWA 3D6IA 3E9JB 4WBJA 5D96A 2I4AA 1SD8A 3GTUB 1R7HA 4KX4A 1MD4A 3KTLA 4PGTA 4Q5FA 2FLSA 1YY7A 2IIYA 3TKRA 2WDUA 3FZ9A 2FD3A 2FY6A 2C3TA 7GSSA 1O7UA 4F2IA 4KF9A 1XCCA 4BWQA 4EVMA 3LWAA 2H1BA 1X5CA 2V41A 2VCTA 1XBSA 2OACA 3IK9A 3NOFA 3EU3A 1EEMA 5AIXA 2GT5A 4BVYB 4IJIA 5JCUA 1VF1A 2PVOC 14GSA 2VCXA 5G1KA 2HI7A 3VWXA 3QAVA 1G7EA 2KP2A 2H6XA 3E0UA 5COHA 2LSTA 2WFCA 3MNGA 4KCEA 1AW9A 2VL2C 5DVBA 1KTEA 1SL1B 3RHBA 1R5AA 6GSTA 3ZFBA 5KN1A 1X9WB 4HU9A 2D2ZA 10GSA 2L4CA 4ZB6A 4DSQA 3ZVJA 3F63A 3VI7A 4NPBA 1TU7A 3UARA 2PMTA 1YF1A 2DIYA 3FRCA 3F4RA 4MA9A 5L71A 2JZSA 1UN2A 1TXXA 3UBKA 1XWAA 4YQVA 1K0NA 2YPMA 4HUAA 4GSSA 2DSAA 2YP6A 5DQSA 2FWHA 3LGCA 2DJ1A 3FR9A 2NTOA 5IMVA 3F6FA 4N0VA 2R37A 1SK0A 4ECJA 2Z9SA 4MH2A 3Q74A 2YJHA 5ECIB 4K7NA 4KAEA 12GSA 4ZIJA 3P2AA 3LQ7A 3CTFA 3MDKA 4OFNA 4YH2A 3UL3A 3PPUA 2B1KA 4DVCA 1BX9A 1V58A 5IPGA 2M72A 1DSBA 2YZHA 5ECLB 5EVOA 5EPFA 1MTCA 3ISOA 5LCZA 1O85A 1ILOA 2HT9A 2GSTA 1K3OA 1F2EA 1K0MA 1Y6EA 3G9BA 1THOA 2EIQA 5KOXA 1K0DA 4FYUA 2RUEA 6GSVA 1U3IA 2CA8A 19GSA 2C0FA 2A4VA 2V2GA 5HFKA 2PUKC 3HXSA 2WZ9A 4AJ6A 3ZYWA 1TU8A 2H30A 4OFTA 2PGTA 4ILFA 4BVXA 1GNWA 3M9JA 2H0IA 4XS4B 3BBYA 4DSSA 1FOHA 2F3MA 2OE1A 2NBSA 5D9VA 1GP1A 3FEUA 4EIQA 4G9HA 4TN8A 4CDOA 1NHOA 2A2PA 3ZFLA 4L5LA 2CVBA 3FKFA 1XWKA 1UC7A 5E4WA 5IQYA 4MDCA 1SJZA 4CY8A 2DLXA 3KH9A 3D21A 3GIXA 3TCOA 4BWSA 2OBKA 3CYNA 3F4SA 3BCKA 4BL7B 4KSMA 4EE0A 4Q5NA 4CW9A 5F0GA 3TOTA 2E2GA 3I9V2 4EO3A 3BCIA 1T1VA 4EXJA 1GTBA 2KP1A 2HYXA 1TOFA 2K8SA 5DAKB 1XW5A 1PRXA 2VAFA 1QUWA 4MF6A 5G5EA 2B1LA 1M9AA 2H19A 2BMXA 3F8UA 4WF5A 2C80A 4PURA 3IHGA 1MD3A 1KEBA 4JBBA 3TGZA 3ZTLA 5ECKB 2M80A 4O32A 4IP6A 2YZUA 3RBTA 5J3RA 3HZ4A 4GRFA 1AAZA 1BJXA 3RAZA 3JCML 3LSZA 2J23A 2O85A 4ISDA 5HFIA 3EWLA 3IV4A 3TKSA 4K0NA 1F37A 2EIOA 2G2QA 3IPZA 2I81A 1XFLA 4LLRA 1Z6NA 4EIPA 1FW1A 1KNGA 4X0XA 1Q98A 2QSIA 1WE0A 4MPGA 2AJQB 3ME8A 2HLSA 5DQYA 1VF4A 4ECCA 20GSA 4HSCX 5HR2A 1G0TA 1Z7RA 1EGOA 2OJLA 3KP8A 3IK7A 3HVVA 1QXHA 1OE7A 6GSSA 4FQUA 4ICYA 2QKEA 1ZYPA 4XRDA 3VI5A 3QMXA 4YAVA 3FW2A 4K2XA 1B48A 4KH7A 4AJ8A 2XC2A 1OAZA 3KGKA 5D9XA 1HYUA 2LEGA 2WRTA 5HR1A 3ZITA 4EF0A 3UMAA 1YDKA 2AAWA 2GT6A 4YKGA 4Q5QA 3MYDA 2B5EA 1FVKA 3FK8A 2IPAA 5AIVA 2J9HA 2KLXA 1OC9B 1F3BA 4FH8A 1EV9A 1LJRA 2LKUA 3CRUA 3IC4A 2TRXA 3Q19A 1T4YA 5F05A 2FA4A 2GGTA 2X64A 4MH3A 4MZCA 5IMFA 3GSSA 1DBYA 2C4JA 4KA0A 4Z2UA 1MEKA 5IO2A 3ZREA 4IQ1A 4MK3A 2V1MA 5AGYA 4ZB9A 4O5QA 5EY6A 1TTZA 2PU9C 1LBKA 3CSJA 2NPBA 5KEJA 1PKWA 2H71A 4OD7A 1YQ1A 1F9MA 1A2JA 3KXOA 3CTGA 1TI1A 4FYBA 3LXTA 2FA8A 3EC3A 5FHIA 1DE2A 3VPTA 2EIRA 2WCIA 5CRGA 2GLRA 4QQ7A 2VLTA 2O8VB 1TKDB 3GH9A 5JWOB 2IMFA 4ECBA 4K6XA 2K18A 1ON4A 3FZ5A 4KCAA 1K0CA 5CRHA 1E6BA 2RLIA 2LJAA 1HNCA 4DEJA 4G19A 1Z5YE 5DALA 4PQ1A 1I5GA 1FOVA 3GKKA 1EGRA 3PH9A 4ZXGA 4F03A 2VD1A 1AUCA 1RQMA 3IA1A 1AQXA 3K8NA 2H6ZA 3KH7A 1XVQA 1FG4A 4V2NA 1SKRB 3VWUA 4MPFA 4DSRA 5GZZB 1O81A 3DXBA 4IBPA 3GKNA 1GSSA 4NMUA 4XCSA 2PVQA 3CMIA 4MLYA 2L6DA 3DVWA 2P5RA 3NIVA 4KDUA 3I6AA 2MZCA 1XXUA 3C1SA 3US3A 1GUMA 1GSYA 2HZFA 2F8FA 5F06A 5KN0A 3A5IA 2HZEA 1JZRA 3KMOA 3DRNA 3QR6A 5HR3A 1GSEA 5G2ZA 3W8JA 4HJ2A 4G10A 2IJYA 2MBSA 2LNTA 3A2VA 3TJFA 3LXZA 4YAPA 5KN2A 4BIKA 4F0BA 1T3BA 4TVEA 5DJLA 2C1YA 3FYGA 2H72A 4L5OA 1H4OA 1O73A 1A8YA 5CYYA 5CREA 3MIXA 5ID2A 5KN3A 2LQOA 2HRKA 1EOGA 2GSSA 2GSRA 4H86A 3MWHA 2X8HA 1XWCA 2WULA 2YWMA 1THXA 1ZL9A 4ZL8A 4AF2A 1HQOA 2GZPA 3RPNA 3UEMA 5J9CA 5IO0A 1WJKA 1GSFA 1SENA 1GWCA 2B5XA 2IMIA 5IPHA 2M46A 2I9HA 5DJMA 1YKAA 2P5QA 2GTUA 1EEJA 3HD5A 2V6KA 3I43A 4TXOB 2B5YA 2AHEA 4O5UA 3WT2A 4OO5A 3G7IA 3Q6OA 1TRUA 4QL7A 3MSZA 3C1RA 1GSQA 2GZZA 3EU4A 1PA3A 2IN3A 4LL1B 1TRWA 2VCZA 1EOHA 3C8EA 1A23A 2MMOA 3HZ8A 4K9ZA 2HFDA 4POBA 2MYGA 5CP1A 4JZQA 1N2AA 5C04A 3R3EA 3GMFA 1CQHA 4PQHA 2LRNA 5DDLA 4ZBAA 4TR1A 1V9WA 4IELA 2VL9A 4GTUA 3GKXA 3GUSA 5GSSA 4GQFA 1PX7A 3L9SA 1BG5A 3V1WA 3M3MA 2X8GA 4X4JA 5HR0A 1E2YA 2HXKA 2H73A 1V40A 1V2AA 1OC8A 5EL8A 1O6JA 3CRTA 3ZIJA 1OYJA 1K0BA 3O3TA 4WR4A 2HE3A 2HNLA 1QQ2A 1USBA 1X5EA 3KTBA 4TR3A 5D9TA 4ACSA 3A5WA 5FT3A 1IYIA 3DWVA 4KW6A 3TOUA 2DMMA 5F8BA 4NHWA 4OFMA 5ECSA 1MDIA 2IMEA 2HSHA 3FHKA 2GQKA 3A2XA 2R0PA 4BA7A 4N0ZA 2CAQA 1JZWA 3TRQA 3C71A 4XHMA 4RQXA 4MZWA 1X5DA 1M3IA 5J5NA 4IQAA 4ULXA 4KNDA 3M1GA 2OA7A 3ZMLA 2A2SA 2DJ0A 5B8BA 4TKYA 1M9BA 2WS2A 1NHYA 3GYKA 4MJAA 4IW9A 2CVKA 2I1UA 2IMDA 1BYEA 2PPTA 1B4QA 4IP1A 4GSTA 3TB2A 2YN1A 1S3RA 1EV4A 2CAIA 3J7Yb 1PMTA 4PUAA 3L9UA 2JL4A 1I9DA 2JZTA 4HDEA 1EZKA 3VWWA 3G7JA 3IHQA 4HJMA 3CXGA 1SJ6A 1NW2A 4XIHA 3H79A 3HVXA 2K6VA 3CBUA 1C72A 1PL1A 2VL2A 1UVZA 3RDWA 3CSIA 22GSA 1LU4A 1PL2A 3O6TA 3EURA 1VF2A 3M8NA 1GSDA 4LMWA 5H5SA 2KUCA 1XOAA 2LV3A 5JWRB 4WBRD 4O7HA 3LYKA 2H74A 2FCHA 5H5RA 4MABA 4J56E 3TJBA 3WGEA 3IRAA 3LW9A 4TR0A 3F6DA 4KGIA 1OKTA 1PGTA 1WIKA 2IL3A 1YEPA 3L78A 3H93A 4V2MA 5AN1A 2FNOA 3ZZXA 4K2DA 4XTSA 2RIIA 5J41A 4BVYA 4MZBA 2LQQA 4I5QA 2H0HA 2AV4A 2F9SA 3D4TA 2VD0A 5JCWA 4E8EA 4MMMA 3UVTA 1AC1A 2FWFA 3L0HA 2GZYA 3HY2A 2DJ3A 2V32A 2IFQA 3F9UA 4PTSA 5ECPB 2L6CA 1ML6A 1FO5A 1SYRA 1YKCA 3KZQA 2YWNA 3N9JA 1K0OA 2XPDA 3F3RA 5G5FA 1NM3A 5A5KA 4J2FA 1AQWA 1XW6A 2H76A 4CHSA 5FWGA 2CQ9A 3A3TA 4GWRA 4E8HA 3DEXA 4LA1A 2XBIA 4PX1A 2ON7A 4V1Ag 2VO4A 4P3YB 17GSA 4MF7A 3VURA 1AIUA 2JZRA 3FY7A 2YCDA 1BAYA 3UVHA 3ZLPA 4D73A 4I97A 2N5AA 2O87A 2CX3A 1GTUA 1OVNA 4WEYA 4RQRA 3FR3A 2FHEA 4IS0A 2ALBA 4MJBA 4POKA 1A2MA 3IXRA 1WWJA 4WR5A 4XS6A 4TRXA 2ZNMA 1PKZA 4LMVA 3O76A 5F07A 2YOIA 2O89A 3QAWA 1ERUA 4V1Ap 3VPQA 5ID2B 3UIWA 4PXOA 1M0UA 4PUFC 1ZYNA 3EMXA 2JACA 3PR8A 3AY8A 3A2WA 5B7CA 4F9ZA 2JU5A 1XG8A 1G6WA 1Z7PA 4XS1A 4XRAA 5IMAA 2XPEA 3BJ5A 2R4VA 3KEBA 2IMKA 2X99A 1K3LA 1TP9A 4G0KA 1OKDA 1V57A 4I2TA 3TDGA 4ML1A 1GH2A 4X1UA 9GSSA 5LD0A 4HZ4A 1AXDA 2HRNA 3CQFA 4TW5A 3HJOA 4K7IA 3DD3A 1S3AA 4JE1A 1Z6MA 1TW9A 2WB9A 3G7YA 2WJUA 4HOJA 3M0FA 1QK8A 1X0RA 3GV1A 1GNEA 3HYPA 2X8CA 2LUSA 3D22A 4N30A 1GRXA 1JLWA 3IDVA 1M3JA 5D9WA 3H1NA 2GDRA 1XPVA 3BD2A 1T00A 2OBIA 4ECIA 1M2BA 2REMA 4TR1B 3QPMA 3H4KA 3GX0A 3QFAC 3RPPA 2VM1A 3GSTA 1H75A 1WPIA 2DC5A 3WGXA 2VOCA 1ERWA 2LJKA 3LG6A 5ENUA 4LL4B 5HQPA 1WRYA 5IOWA 4BL7A 4NWYA 1PX6A 2R5GA 4ID0A 5E59A 1ZZYA 4MJEA 4ZBDA 2F8AA 3UJ1A 1MDKA 1Y25A 3SBCA 3PGTA 3QCPA 1K0AA 1WOUA 6GSUA 18GSA 3FR6A 2QGVA 3S9FA 1SKSB 3TRXA 1X9MB 5G30A 1ACVA 4RI7A 4HS1A 3TUEA 3UOMA 3GL5A 4J57E 1N8JA 4AGSA 2WGRA 1J08A 2R2JA 3BOAA 3FMWA 3DKSA 1FB0A 1KBNA 5B6NA 3LYPA 1SD9A 3KCMA 1XWGA 4WXTA 4TOPA 2H1DA 2CZ3A 4KDYA 1ZGNA 2X49A 3MAKA 4EC0A 3KM6A 3TKQA 1AQVA 2LRTA 2DKHA 4PQIA 2FUG2 3P7XA 5D8IA 2YWOA 1S3CA 8GSSA 4OMVA 4YQMA 5DCHA 3QDNA 4N10A 1B9XC 4N11A 2OKAA 2RM5A 2F51A 2H70A 1GTIA 2LTKA 1R5PA 4GCIA 3ED3A 3F3QA 4OWYA 4EDYA 5BMUA 3UBLA 3KP9A 3LORA 4IJ3A 3DVXA 1TJDA 4POMA 2YV7A 3R2QA 2E7PA 2E2MA 1Z9HA 4BVXB 1URMA 1A0RP 2P31A 4DSSB 2K9FA 4AJ7A 3LFLA 5ABRA 4MNNA 1ZYQB 4QL9A 4PNGA 1T4ZA 3VFIA 5JCGA 4NV2A 4NHZA 1PD21 1EP7A 3HCZA 1Q4JA 2MMZA 1TRVA 1EWXA 1GTAA 3KJYA 4ZL7A 1Z3EA 3DGQA 4GXZA 1A0FA 2DMLA 3D4MA 4I2UA 4JRRA 1OC9A 1SK2A 2O7KA 2CVDA 4L0UA 1SL0B 5D73A 5A4VA 4G2EA 4HZ2A 1NSWA 4KB3A 3VLNA 5H5QA 2LS5A 1JHBA 4MCUA 2KOKA 2TIRA 1B9YC 3DMLA 5IMDA 4HQSA 1XWBA 1PQNA 1YEXA 4WKWA 2YNXA 1ZYEA 3D5JA 1QGVA 2IFQB 2HSMA 4KE3A 13GSA 1GUHA 3GN3A 3TJKA 4GQCA 4IGJA 5INYA 1DUGA 2L59A 3DIEA 3H8QA 3GRXA 3GKMA 4USSA 2KHPA 1K3YA 2YANA 1MDJA 2G0FA 4NXIA 2ES7A 3E3EA 4HI7A 4K8MA 4YKFA 1XIYA 1B8XA 3J7Yk 2H01A 1DE1A 1B4PA 1JLVA 5KOWA 2RM6A 3HVSA 3FZAA 5CO3A 2R0GA 2B7JA 2A4HA 5ECHB 2HSYA 2VLVA 4FO5A 1A8LA 3EPTA 4D73B 6GSXA 2H75A 1A24A 3APOA 2PWJA 3PINA 4OO4A 1ST9A 2YV9A 3IAS2 4Z2TA 4RUVA 4Q5RA 4WF4A 4POLA 2VLUA 1U6TA 1HNAA 4K5SA 4NV5A 3HKRA 2PBJA 1VRSD 3N5OA 2DBCA 1ZCPA 2GS3A 1X9SB 5ELAA 2VCWA 2PN8A 1WP0A 2TRCP 1GSUA 3IR4A 3LEFA 2DKIA 5CNWA 2DJ2A 4GLTA 3GFKA 3APSA 3M9KA 3QFBC 4GSNA 3TKSC 4KDXA 2CV4A 5B8AA 1HD2A 5AISA 5G1LA 5ELGA 2GQLA 2R0CA 3GTUA 3U6VA 4HU7A 4O5RA 4ZBBA 2CZ2A 1YF0A 3EMPA 1XZOA 4IVFA 1GLPA 1ZOFA 1O8XA 2FWEA 1T7PB 1CQGA 1XW9A 2ZCTA 1FVJA 2X4AA 4HEA2 2JSZA 3QOUA 3CSHA 5ECRB 1JZDA 3P90A 1W89A 2QA2A 3I69A 3ZRDA
chains in the Genus database with same CATH topology
3DYRA 2MBTA 1PSQA 2GSQA 1TK0B 4TXOA 1SKWB 4A5PA 3W8SA 4JEDA 4HQZA 3F4TA 3TJJA 3ZL5A 1GL8A 3LJRA 1J9BA 2I3YA 2N5BA 1FHEA 5GAND 2VUPA 1GULA 2YWIA 2UZ8A 3Q18A 4PNFA 5A4WA 1FB6A 3ME7A 5IMZA 1M2DA 2NDOA 5ECOB 2C0GA 5HFGA 1VGLA 3VWVA 3TKSE 5LNKe 5DALB 4NAXA 5J4UA 2LNSA 2BJXA 4ZL9A 4GF0A 1WMJA 1BEDA 3F0IA 2N5FA 2VL3A 5IOXA 2QC7A 4O92A 1M2AA 3IE3A 3WGDA 3IOSA 5B6MA 4EUYA 5DBQA 1YZXA 2C3NA 2XBQA 4Z2RA 3KIJA 4EDZA 5DCGA 2ON5A 4K0GA 1SU9A 2E0QA 1G6YA 2HRFA 1TI3A 2AYTA 4KSOA 2V6OA 1VF3A 5G31A 2HZEB 3GL3A 3GURA 2OE3A 5IIZA 3U5RE 3IAM2 4G0IA 5A4UA 1EP8A 3APQA 16GSA 2CX4A 2AUVA 1GUKA 1TDIA 1T8EB 3UAPA 4EL1A 1F6MC 3L9VA 3HDCA 2H66A 2A2RA 2H6YA 1ZMAA 2C8UA 4TR4A 11GSA 1R26A 3ZMKA 2H1AA 3OR5A 5ECMB 3SWLA 2B3SA 2VM2A 5GSTA 2L5LA 3GHAA 2C0DA 6GSWA 5BRTA 4Z7XA 4F82A 4K7OA 2MMAA 4MF5A 5IM9A 2B6MA 3GX8A 2R6KA 2L4QA 1XOBA 4I8BA 4YQUA 1YJ6A 2H8LA 2YJ7A 5CAXA 2VCQA 2FGXA 1M99A 3L4NA 4JR6A 4JR4A 2B7KA 1O8WA 1JFUA 2DJJA 4KUNA 2MMNA 2JADA 1M7TA 2HRAA 2GVPA 2LRCA 1ERVA 3GA4A 2H0GA 4FYCA 4V2LA 3EINA 4X43A 2L57A 1XVWA 4ML6A 4RI6A 5GAPD 1ERTA 3WD6A 4XS4A 6GSYA 2VIMA 4I6XA 4MJCA 3TKPA 1RW1A 5ECNB 4BPYA 1GLQA 1SK1A 2OADA 2LJRA 2H1GA 3ZVJD 4IHUA 2PERA 5CRDA 2K8VA 3WYWA 2L5OA 4IN0A 3QD9A 2ZUPA 1TK8B 3GNJA 1PN0A 4EKZA 3C73A 1F3AA 5ECQB 5D93A 5IMCA 4MP4A 4F0CA 3ERWA 3WT1A 3ZIVA 2NVLA 2EC4A 1PN9A 4ZB8A 4OCFA 2JSYA 3TRPA 4L0WA 5C00A 3IC8A 2GQMA 1V98A 4G0LA 1JZOA 1QMVA 3VK9A 3HJMA 1HNBA 1IYHA 3C7MA 2P0GA 3EE2A 5DAKA 3HA9A 4ZILA 4CY6A 3EVIA 3ERGA 1OE8A 4L8EA 3HJPA 1W4VA 3ERFA 1UA5A 3GH6A 3QAGA 4K5RA 3P8WA 3KD0A 1RK4A 4WETA 2IWTA 3RHCA 3EYTA 2XHFA 4TXVA 2OE0A 3KMNA 1SL2B 2FWGA 1FAAA 3TJGA 2AB6A 1ABAA 1R4WA 2QA1A 1QFNA 1SYXA 3NZNA 1BQ7A 1U3AA 4IKHA 2VCVA 1J0FA 2DJKA 1TK5B 1G7OA 1A2LA 4OCEA 2DIZA 4K1FA 2CT6A 5CRWA 1TRSA 3FZ4A 1U87A 2C0EA 2RUFA 5J9BA 3D0ZA 1U88A 1SJIA 3IBHA 1OC3A 1S3DA 4JU5A 2BTOT 2C3QA 3HHVA 5JWQB 2R3XA 3W6GA 4FIWA 3D6IA 3E9JB 4WBJA 5D96A 2I4AA 1SD8A 3GTUB 1R7HA 4KX4A 1MD4A 3KTLA 4PGTA 4Q5FA 2FLSA 1YY7A 2IIYA 3TKRA 2WDUA 3FZ9A 2FD3A 2FY6A 2C3TA 7GSSA 1O7UA 4F2IA 4KF9A 1XCCA 4BWQA 4EVMA 3LWAA 2H1BA 1X5CA 2V41A 2VCTA 1XBSA 2OACA 3IK9A 3NOFA 3EU3A 1EEMA 5AIXA 2GT5A 4BVYB 4IJIA 5JCUA 1VF1A 2PVOC 14GSA 2VCXA 5G1KA 2HI7A 3VWXA 3QAVA 1G7EA 2KP2A 2H6XA 3E0UA 5COHA 2LSTA 2WFCA 3MNGA 4KCEA 1AW9A 2VL2C 5DVBA 1KTEA 1SL1B 3RHBA 1R5AA 6GSTA 3ZFBA 5KN1A 1X9WB 4HU9A 2D2ZA 10GSA 2L4CA 4ZB6A 4DSQA 3ZVJA 3F63A 3VI7A 4NPBA 1TU7A 3UARA 2PMTA 1YF1A 2DIYA 3FRCA 3F4RA 4MA9A 5L71A 2JZSA 1UN2A 1TXXA 3UBKA 1XWAA 4YQVA 1K0NA 2YPMA 4HUAA 4GSSA 2DSAA 2YP6A 5DQSA 2FWHA 3LGCA 2DJ1A 3FR9A 2NTOA 5IMVA 3F6FA 4N0VA 2R37A 1SK0A 4ECJA 2Z9SA 4MH2A 3Q74A 2YJHA 5ECIB 4K7NA 4KAEA 12GSA 4ZIJA 3P2AA 3LQ7A 3CTFA 3MDKA 4OFNA 4YH2A 3UL3A 3PPUA 2B1KA 4DVCA 1BX9A 1V58A 5IPGA 2M72A 1DSBA 2YZHA 5ECLB 5EVOA 5EPFA 1MTCA 3ISOA 5LCZA 1O85A 1ILOA 2HT9A 2GSTA 1K3OA 1F2EA 1K0MA 1Y6EA 3G9BA 1THOA 2EIQA 5KOXA 1K0DA 4FYUA 2RUEA 6GSVA 1U3IA 2CA8A 19GSA 2C0FA 2A4VA 2V2GA 5HFKA 2PUKC 3HXSA 2WZ9A 4AJ6A 3ZYWA 1TU8A 2H30A 4OFTA 2PGTA 4ILFA 4BVXA 1GNWA 3M9JA 2H0IA 4XS4B 3BBYA 4DSSA 1FOHA 2F3MA 2OE1A 2NBSA 5D9VA 1GP1A 3FEUA 4EIQA 4G9HA 4TN8A 4CDOA 1NHOA 2A2PA 3ZFLA 4L5LA 2CVBA 3FKFA 1XWKA 1UC7A 5E4WA 5IQYA 4MDCA 1SJZA 4CY8A 2DLXA 3KH9A 3D21A 3GIXA 3TCOA 4BWSA 2OBKA 3CYNA 3F4SA 3BCKA 4BL7B 4KSMA 4EE0A 4Q5NA 4CW9A 5F0GA 3TOTA 2E2GA 3I9V2 4EO3A 3BCIA 1T1VA 4EXJA 1GTBA 2KP1A 2HYXA 1TOFA 2K8SA 5DAKB 1XW5A 1PRXA 2VAFA 1QUWA 4MF6A 5G5EA 2B1LA 1M9AA 2H19A 2BMXA 3F8UA 4WF5A 2C80A 4PURA 3IHGA 1MD3A 1KEBA 4JBBA 3TGZA 3ZTLA 5ECKB 2M80A 4O32A 4IP6A 2YZUA 3RBTA 5J3RA 3HZ4A 4GRFA 1AAZA 1BJXA 3RAZA 3JCML 3LSZA 2J23A 2O85A 4ISDA 5HFIA 3EWLA 3IV4A 3TKSA 4K0NA 1F37A 2EIOA 2G2QA 3IPZA 2I81A 1XFLA 4LLRA 1Z6NA 4EIPA 1FW1A 1KNGA 4X0XA 1Q98A 2QSIA 1WE0A 4MPGA 2AJQB 3ME8A 2HLSA 5DQYA 1VF4A 4ECCA 20GSA 5HR2A 1G0TA 1Z7RA 1EGOA 2OJLA 3KP8A 3IK7A 3HVVA 1QXHA 1OE7A 6GSSA 4FQUA 4ICYA 2QKEA 1ZYPA 4XRDA 3VI5A 3QMXA 4YAVA 3FW2A 4K2XA 1B48A 4KH7A 4AJ8A 2XC2A 1OAZA 3KGKA 5D9XA 1HYUA 2LEGA 2WRTA 5HR1A 3ZITA 4EF0A 3UMAA 1YDKA 2AAWA 2GT6A 4YKGA 4Q5QA 3MYDA 2B5EA 1FVKA 3FK8A 2IPAA 5AIVA 2J9HA 2KLXA 1OC9B 1F3BA 4FH8A 1EV9A 1LJRA 2LKUA 3CRUA 3IC4A 2TRXA 3Q19A 1T4YA 5F05A 2FA4A 2GGTA 2X64A 4MH3A 4MZCA 5IMFA 3GSSA 1DBYA 2C4JA 4KA0A 4Z2UA 1MEKA 5IO2A 3ZREA 4IQ1A 4MK3A 2V1MA 5AGYA 4ZB9A 4O5QA 5EY6A 1TTZA 2PU9C 1LBKA 3CSJA 2NPBA 5KEJA 1PKWA 2H71A 4OD7A 1YQ1A 1F9MA 1A2JA 3KXOA 3CTGA 1TI1A 4FYBA 3LXTA 2FA8A 3EC3A 5FHIA 1DE2A 3VPTA 2EIRA 2WCIA 5CRGA 2GLRA 4QQ7A 2VLTA 2O8VB 1TKDB 3GH9A 5JWOB 2IMFA 4ECBA 4K6XA 2K18A 1ON4A 3FZ5A 4KCAA 1K0CA 5CRHA 1E6BA 2RLIA 2LJAA 1HNCA 4DEJA 4G19A 1Z5YE 5DALA 4PQ1A 1I5GA 1FOVA 3GKKA 1EGRA 3PH9A 4ZXGA 4F03A 2VD1A 1AUCA 1RQMA 3IA1A 1AQXA 3K8NA 2H6ZA 3KH7A 1XVQA 1FG4A 4V2NA 1SKRB 3VWUA 4MPFA 4DSRA 5GZZB 1O81A 3DXBA 4IBPA 3GKNA 1GSSA 4NMUA 4XCSA 2PVQA 3CMIA 4MLYA 2L6DA 3DVWA 2P5RA 3NIVA 4KDUA 3I6AA 2MZCA 1XXUA 3C1SA 3US3A 1GUMA 1GSYA 2HZFA 2F8FA 5F06A 5KN0A 3A5IA 2HZEA 1JZRA 3KMOA 3DRNA 3QR6A 5HR3A 1GSEA 5G2ZA 3W8JA 4HJ2A 4G10A 2IJYA 2MBSA 2LNTA 3A2VA 3TJFA 3LXZA 4YAPA 5KN2A 4F0BA 1T3BA 4TVEA 5DJLA 2C1YA 3FYGA 2H72A 4L5OA 1H4OA 1O73A 1A8YA 5CYYA 5CREA 3MIXA 5ID2A 5KN3A 2LQOA 2HRKA 1EOGA 2GSSA 2GSRA 4H86A 3MWHA 2X8HA 1XWCA 2WULA 2YWMA 1THXA 1ZL9A 4ZL8A 4AF2A 1HQOA 2GZPA 3RPNA 3UEMA 5J9CA 5IO0A 1WJKA 1GSFA 1SENA 1GWCA 2B5XA 2IMIA 5IPHA 2M46A 2I9HA 5DJMA 1YKAA 2P5QA 2GTUA 1EEJA 3HD5A 2V6KA 3I43A 4TXOB 2B5YA 2AHEA 4O5UA 3WT2A 4OO5A 3G7IA 3Q6OA 1TRUA 4QL7A 3MSZA 3C1RA 1GSQA 2GZZA 3EU4A 1PA3A 2IN3A 4LL1B 1TRWA 2VCZA 1EOHA 3C8EA 1A23A 2MMOA 3HZ8A 4K9ZA 2HFDA 4POBA 2MYGA 5CP1A 4JZQA 1N2AA 5C04A 3R3EA 3GMFA 1CQHA 4PQHA 2LRNA 5DDLA 4ZBAA 4TR1A 1V9WA 4IELA 2VL9A 4GTUA 3GKXA 3GUSA 5GSSA 4GQFA 1PX7A 3L9SA 1BG5A 3V1WA 3M3MA 2X8GA 4X4JA 5HR0A 1E2YA 2HXKA 2H73A 1V40A 1V2AA 1OC8A 5EL8A 1O6JA 3CRTA 3ZIJA 1OYJA 1K0BA 3O3TA 4WR4A 2HE3A 2HNLA 1QQ2A 1USBA 1X5EA 3KTBA 4TR3A 5D9TA 4ACSA 3A5WA 5FT3A 1IYIA 3DWVA 4KW6A 3TOUA 2DMMA 5F8BA 4NHWA 4OFMA 5ECSA 1MDIA 2IMEA 2HSHA 3FHKA 2GQKA 3A2XA 2R0PA 4BA7A 4N0ZA 2CAQA 1JZWA 3TRQA 3C71A 4XHMA 4RQXA 4MZWA 1X5DA 5J5NA 4IQAA 4ULXA 4KNDA 3M1GA 2OA7A 3ZMLA 2A2SA 2DJ0A 5B8BA 4TKYA 1M9BA 2WS2A 1NHYA 3GYKA 4MJAA 4IW9A 2CVKA 2I1UA 2IMDA 1BYEA 2PPTA 1B4QA 4IP1A 4GSTA 3TB2A 2YN1A 2CAIA 1EV4A 3J7Yb 1PMTA 4PUAA 3L9UA 2JL4A 1I9DA 2JZTA 4HDEA 1EZKA 3VWWA 3G7JA 3IHQA 4HJMA 3CXGA 1SJ6A 1NW2A 4XIHA 3H79A 3HVXA 2K6VA 3CBUA 1C72A 1PL1A 2VL2A 1UVZA 3RDWA 3CSIA 22GSA 1LU4A 1PL2A 3O6TA 3EURA 1VF2A 3M8NA 1GSDA 4LMWA 5H5SA 2KUCA 1XOAA 2LV3A 5JWRB 4WBRD 4O7HA 3LYKA 2H74A 2FCHA 5H5RA 4MABA 4J56E 3TJBA 3WGEA 3IRAA 3LW9A 4TR0A 3F6DA 4KGIA 1OKTA 1PGTA 1WIKA 2IL3A 1YEPA 3L78A 3H93A 4V2MA 5AN1A 2FNOA 3ZZXA 4K2DA 4XTSA 2RIIA 5J41A 4BVYA 4MZBA 2LQQA 4I5QA 2H0HA 2AV4A 2F9SA 3D4TA 2VD0A 5JCWA 4E8EA 4MMMA 3UVTA 1AC1A 2FWFA 3L0HA 2GZYA 3HY2A 2DJ3A 2V32A 2IFQA 3F9UA 4PTSA 5ECPB 2L6CA 1ML6A 1FO5A 1SYRA 1YKCA 3KZQA 2YWNA 3N9JA 1K0OA 2XPDA 3F3RA 5G5FA 1NM3A 5A5KA 4J2FA 1AQWA 1XW6A 2H76A 4CHSA 5FWGA 2CQ9A 3A3TA 4GWRA 4E8HA 3DEXA 4LA1A 2XBIA 4PX1A 2ON7A 4V1Ag 2VO4A 4P3YB 17GSA 4MF7A 3VURA 1AIUA 2JZRA 3FY7A 2YCDA 1BAYA 3UVHA 3ZLPA 4D73A 4I97A 2N5AA 2O87A 2CX3A 1GTUA 1OVNA 4WEYA 4RQRA 3FR3A 2FHEA 4IS0A 2ALBA 4MJBA 4POKA 1A2MA 3IXRA 1WWJA 4WR5A 4XS6A 4TRXA 2ZNMA 1PKZA 4LMVA 3O76A 5F07A 2YOIA 2O89A 3QAWA 1ERUA 4V1Ap 3VPQA 5ID2B 3UIWA 4PXOA 1M0UA 4PUFC 1ZYNA 3EMXA 2JACA 3PR8A 3AY8A 3A2WA 5B7CA 4F9ZA 2JU5A 1G6WA 1Z7PA 4XS1A 4XRAA 5IMAA 2XPEA 3BJ5A 2R4VA 3KEBA 2IMKA 2X99A 1K3LA 1TP9A 4G0KA 1OKDA 1V57A 4I2TA 3TDGA 4ML1A 1GH2A 4X1UA 9GSSA 5LD0A 4HZ4A 1AXDA 2HRNA 4TW5A 3HJOA 4K7IA 3DD3A 1S3AA 4JE1A 1Z6MA 1TW9A 2WB9A 3G7YA 2WJUA 4HOJA 3M0FA 1QK8A 1X0RA 3GV1A 1GNEA 3HYPA 2X8CA 2LUSA 3D22A 4N30A 1GRXA 1JLWA 3IDVA 5D9WA 3H1NA 2GDRA 1XPVA 3BD2A 1T00A 2OBIA 4ECIA 1M2BA 2REMA 4TR1B 3QPMA 3H4KA 3GX0A 3QFAC 3RPPA 2VM1A 3GSTA 1H75A 1WPIA 2DC5A 3WGXA 2VOCA 1ERWA 2LJKA 3LG6A 5ENUA 4LL4B 5HQPA 1WRYA 5IOWA 4BL7A 4NWYA 1PX6A 2R5GA 4ID0A 5E59A 1ZZYA 4MJEA 4ZBDA 2F8AA 3UJ1A 1MDKA 1Y25A 3SBCA 3PGTA 3QCPA 1K0AA 1WOUA 6GSUA 18GSA 3FR6A 2QGVA 3S9FA 1SKSB 3TRXA 1X9MB 5G30A 1ACVA 4RI7A 4HS1A 3TUEA 3UOMA 3GL5A 4J57E 1N8JA 4AGSA 2WGRA 1J08A 2R2JA 3BOAA 3FMWA 3DKSA 1FB0A 1KBNA 5B6NA 3LYPA 1SD9A 3KCMA 1XWGA 4WXTA 4TOPA 2H1DA 2CZ3A 4KDYA 1ZGNA 2X49A 3MAKA 4EC0A 3KM6A 3TKQA 1AQVA 2LRTA 2DKHA 4PQIA 2FUG2 3P7XA 5D8IA 2YWOA 1S3CA 8GSSA 4OMVA 4YQMA 5DCHA 3QDNA 4N10A 1B9XC 4N11A 2OKAA 2RM5A 2F51A 2H70A 1GTIA 2LTKA 1R5PA 4GCIA 3ED3A 3F3QA 4OWYA 4EDYA 5BMUA 3UBLA 3KP9A 3LORA 4IJ3A 3DVXA 1TJDA 4POMA 2YV7A 3R2QA 2E7PA 2E2MA 1Z9HA 4BVXB 1URMA 1A0RP 2P31A 4DSSB 2K9FA 4AJ7A 3LFLA 5ABRA 4MNNA 1ZYQB 4QL9A 4PNGA 1T4ZA 3VFIA 5JCGA 4NV2A 4NHZA 1PD21 1EP7A 3HCZA 1Q4JA 2MMZA 1TRVA 1EWXA 1GTAA 3KJYA 4ZL7A 1Z3EA 3DGQA 4GXZA 1A0FA 2DMLA 3D4MA 4I2UA 4JRRA 1OC9A 1SK2A 2O7KA 2CVDA 4L0UA 1SL0B 5D73A 5A4VA 4G2EA 4HZ2A 1NSWA 4KB3A 3VLNA 5H5QA 2LS5A 1JHBA 4MCUA 2KOKA 2TIRA 1B9YC 3DMLA 5IMDA 4HQSA 1XWBA 1PQNA 1YEXA 4WKWA 2YNXA 1ZYEA 3D5JA 1QGVA 2IFQB 2HSMA 4KE3A 13GSA 1GUHA 3GN3A 3TJKA 4GQCA 4IGJA 5INYA 1DUGA 2L59A 3DIEA 3H8QA 3GRXA 3GKMA 4USSA 2KHPA 1K3YA 2YANA 1MDJA 2G0FA 4NXIA 2ES7A 3E3EA 4HI7A 4K8MA 4YKFA 1XIYA 1B8XA 3J7Yk 2H01A 1DE1A 1B4PA 1JLVA 5KOWA 2RM6A 3HVSA 3FZAA 5CO3A 2R0GA 2B7JA 2A4HA 5ECHB 2HSYA 2VLVA 4FO5A 1A8LA 3EPTA 4D73B 6GSXA 2H75A 1A24A 3APOA 2PWJA 3PINA 4OO4A 1ST9A 2YV9A 3IAS2 4Z2TA 4RUVA 4Q5RA 4WF4A 4POLA 2VLUA 1U6TA 1HNAA 4K5SA 4NV5A 3HKRA 2PBJA 1VRSD 3N5OA 2DBCA 1ZCPA 2GS3A 1X9SB 5ELAA 2VCWA 2PN8A 1WP0A 2TRCP 1GSUA 3IR4A 3LEFA 2DKIA 5CNWA 2DJ2A 4GLTA 3GFKA 3APSA 3M9KA 3QFBC 4GSNA 3TKSC 4KDXA 2CV4A 5B8AA 1HD2A 5AISA 5G1LA 5ELGA 2GQLA 2R0CA 3GTUA 3U6VA 4HU7A 4O5RA 4ZBBA 2CZ2A 1YF0A 3EMPA 1XZOA 4IVFA 1GLPA 1ZOFA 1O8XA 2FWEA 1T7PB 1CQGA 1XW9A 2ZCTA 1FVJA 2X4AA 4HEA2 2JSZA 3QOUA 3CSHA 5ECRB 1JZDA 3P90A 1W89A 2QA2A 3I69A 3ZRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DYR A;  2MBT A;  1PSQ A;  2GSQ A;  1TK0 B;  4TXO A;  1SKW B;  3W8S A;  4JED A;  4HQZ A;  3F4T A;  3TJJ A;  3ZL5 A;  1GL8 A;  3LJR A;  1J9B A;  2I3Y A;  2N5B A;  1FHE A;  5GAN D;  2VUP A;  1GUL A;  2YWI A;  3Q18 A;  4PNF A;  5A4W A;  1FB6 A;  3ME7 A;  5IMZ A;  1M2D A;  2NDO A;  5ECO B;  2C0G A;  5HFG A;  1VGL A;  3VWV A;  3TKS E;  5LNK e;  5DAL B;  4NAX A;  5J4U A;  2LNS A;  2BJX A;  4ZL9 A;  4GF0 A;  1WMJ A;  1BED A;  3F0I A;  2N5F A;  2VL3 A;  5IOX A;  2QC7 A;  4O92 A;  1M2A A;  3IE3 A;  3WGD A;  3IOS A;  5B6M A;  4EUY A;  5DBQ A;  1YZX A;  2C3N A;  2XBQ A;  3KIJ A;  4EDZ A;  5DCG A;  2ON5 A;  4K0G A;  1SU9 A;  2E0Q A;  1G6Y A;  2HRF A;  1TI3 A;  2AYT A;  4KSO A;  2V6O A;  1VF3 A;  5G31 A;  2HZE B;  3GL3 A;  3GUR A;  2OE3 A;  5IIZ A;  3U5R E;  3IAM 2;  5A4U A;  1EP8 A;  3APQ A;  16GS A;  2CX4 A;  2AUV A;  1GUK A;  1TDI A;  1T8E B;  3UAP A;  4EL1 A;  1F6M C;  3L9V A;  3HDC A;  2H66 A;  2A2R A;  2H6Y A;  1ZMA A;  2C8U A;  4TR4 A;  11GS A;  1R26 A;  3ZMK A;  2H1A A;  3OR5 A;  5ECM B;  3SWL A;  2B3S A;  2VM2 A;  5GST A;  2L5L A;  3GHA A;  2C0D A;  6GSW A;  4Z7X A;  4F82 A;  4K7O A;  2MMA A;  4MF5 A;  5IM9 A;  2B6M A;  3GX8 A;  2R6K A;  2L4Q A;  1XOB A;  4I8B A;  4YQU A;  1YJ6 A;  2H8L A;  2YJ7 A;  5CAX A;  2VCQ A;  2FGX A;  1M99 A;  3L4N A;  4JR6 A;  4JR4 A;  2B7K A;  1O8W A;  1JFU A;  2DJJ A;  4KUN A;  2MMN A;  2JAD A;  1M7T A;  2GVP A;  2LRC A;  1ERV A;  3GA4 A;  2H0G A;  4FYC A;  4V2L A;  3EIN A;  4X43 A;  2L57 A;  1XVW A;  4ML6 A;  4RI6 A;  5GAP D;  1ERT A;  3WD6 A;  4XS4 A;  6GSY A;  2VIM A;  4I6X A;  4MJC A;  3TKP A;  1RW1 A;  5ECN B;  4BPY A;  1GLQ A;  1SK1 A;  2OAD A;  2LJR A;  2H1G A;  3ZVJ D;  4IHU A;  2PER A;  5CRD A;  2K8V A;  3WYW A;  2L5O A;  4IN0 A;  3QD9 A;  2ZUP A;  1TK8 B;  3GNJ A;  4EKZ A;  3C73 A;  1F3A A;  5ECQ B;  5D93 A;  5IMC A;  4MP4 A;  4F0C A;  3ERW A;  3WT1 A;  3ZIV A;  2NVL A;  2EC4 A;  1PN9 A;  4ZB8 A;  4OCF A;  2JSY A;  3TRP A;  4L0W A;  5C00 A;  2GQM A;  1V98 A;  1JZO A;  1QMV A;  3VK9 A;  3HJM A;  1HNB A;  1IYH A;  3C7M A;  2P0G A;  3EE2 A;  5DAK A;  3HA9 A;  4ZIL A;  3EVI A;  3ERG A;  1OE8 A;  4L8E A;  3HJP A;  1W4V A;  3ERF A;  1UA5 A;  3GH6 A;  3QAG A;  3P8W A;  3KD0 A;  1RK4 A;  4WET A;  2IWT A;  3RHC A;  3EYT A;  2XHF A;  4TXV A;  2OE0 A;  3KMN A;  1SL2 B;  2FWG A;  1FAA A;  3TJG A;  2AB6 A;  1ABA A;  1R4W A;  1QFN A;  1SYX A;  3NZN A;  1BQ7 A;  1U3A A;  4IKH A;  2VCV A;  1J0F A;  2DJK A;  1TK5 B;  1G7O A;  1A2L A;  4OCE A;  2DIZ A;  4K1F A;  2CT6 A;  5CRW A;  1TRS A;  3FZ4 A;  1U87 A;  2C0E A;  2RUF A;  5J9B A;  3D0Z A;  1U88 A;  1SJI A;  3IBH A;  1OC3 A;  1S3D A;  4JU5 A;  2BTO T;  2C3Q A;  3HHV A;  5JWQ B;  2R3X A;  3W6G A;  4FIW A;  3D6I A;  3E9J B;  4WBJ A;  5D96 A;  2I4A A;  1SD8 A;  3GTU B;  1R7H A;  4KX4 A;  1MD4 A;  3KTL A;  4PGT A;  4Q5F A;  2FLS A;  1YY7 A;  2IIY A;  3TKR A;  2WDU A;  3FZ9 A;  2FD3 A;  2FY6 A;  2C3T A;  7GSS A;  1O7U A;  4F2I A;  1XCC A;  4BWQ A;  4EVM A;  3LWA A;  2H1B A;  1X5C A;  2V41 A;  2VCT A;  1XBS A;  2OAC A;  3IK9 A;  3NOF A;  3EU3 A;  1EEM A;  5AIX A;  2GT5 A;  4IJI A;  5JCU A;  1VF1 A;  2PVO C;  14GS A;  2VCX A;  5G1K A;  2HI7 A;  3VWX A;  3QAV A;  1G7E A;  2KP2 A;  2H6X A;  3E0U A;  5COH A;  2LST A;  2WFC A;  3MNG A;  4KCE A;  1AW9 A;  2VL2 C;  5DVB A;  1KTE A;  1SL1 B;  3RHB A;  1R5A A;  6GST A;  3ZFB A;  5KN1 A;  1X9W B;  4HU9 A;  2D2Z A;  10GS A;  2L4C A;  4ZB6 A;  4DSQ A;  3ZVJ A;  3F63 A;  3VI7 A;  4NPB A;  1TU7 A;  3UAR A;  2PMT A;  1YF1 A;  2DIY A;  3FRC A;  3F4R A;  4MA9 A;  5L71 A;  2JZS A;  1UN2 A;  1TXX A;  3UBK A;  1XWA A;  4YQV A;  1K0N A;  2YPM A;  4HUA A;  4GSS A;  2DSA A;  2YP6 A;  5DQS A;  2FWH A;  3LGC A;  2DJ1 A;  3FR9 A;  2NTO A;  5IMV A;  3F6F A;  4N0V A;  2R37 A;  1SK0 A;  4ECJ A;  2Z9S A;  4MH2 A;  3Q74 A;  2YJH A;  5ECI B;  4K7N A;  4KAE A;  12GS A;  4ZIJ A;  3P2A A;  3LQ7 A;  3CTF A;  3MDK A;  4OFN A;  4YH2 A;  3UL3 A;  2B1K A;  4DVC A;  1BX9 A;  1V58 A;  5IPG A;  2M72 A;  1DSB A;  2YZH A;  5ECL B;  5EVO A;  5EPF A;  1MTC A;  3ISO A;  5LCZ A;  1O85 A;  1ILO A;  2HT9 A;  2GST A;  1K3O A;  1F2E A;  1K0M A;  1Y6E A;  3G9B A;  1THO A;  2EIQ A;  1K0D A;  4FYU A;  2RUE A;  6GSV A;  1U3I A;  2CA8 A;  19GS A;  2C0F A;  2A4V A;  2V2G A;  5HFK A;  2PUK C;  3HXS A;  2WZ9 A;  4AJ6 A;  3ZYW A;  1TU8 A;  2H30 A;  4OFT A;  2PGT A;  4ILF A;  4BVX A;  1GNW A;  3M9J A;  2H0I A;  4XS4 B;  3BBY A;  4DSS A;  2F3M A;  2OE1 A;  2NBS A;  5D9V A;  1GP1 A;  3FEU A;  4G9H A;  4TN8 A;  4CDO A;  1NHO A;  3ZFL A;  4L5L A;  2CVB A;  3FKF A;  1XWK A;  1UC7 A;  5E4W A;  5IQY A;  4MDC A;  1SJZ A;  2DLX A;  3KH9 A;  3D21 A;  3GIX A;  3TCO A;  4BWS A;  2OBK A;  3CYN A;  3F4S A;  3BCK A;  4KSM A;  4EE0 A;  4Q5N A;  4CW9 A;  5F0G A;  3TOT A;  2E2G A;  3I9V 2;  4EO3 A;  3BCI A;  1T1V A;  4EXJ A;  1GTB A;  2KP1 A;  2HYX A;  1TOF A;  2K8S A;  5DAK B;  1XW5 A;  1PRX A;  2VAF A;  1QUW A;  4MF6 A;  5G5E A;  2B1L A;  1M9A A;  2H19 A;  2BMX A;  3F8U A;  4WF5 A;  2C80 A;  4PUR A;  1MD3 A;  1KEB A;  4JBB A;  3TGZ A;  3ZTL A;  5ECK B;  2M80 A;  4O32 A;  4IP6 A;  2YZU A;  3RBT A;  5J3R A;  3HZ4 A;  4GRF A;  1AAZ A;  1BJX A;  3RAZ A;  3JCM L;  3LSZ A;  2J23 A;  2O85 A;  4ISD A;  5HFI A;  3EWL A;  3IV4 A;  3TKS A;  4K0N A;  1F37 A;  2EIO A;  2G2Q A;  3IPZ A;  2I81 A;  1XFL A;  4LLR A;  1Z6N A;  1FW1 A;  1KNG A;  4X0X A;  1Q98 A;  2QSI A;  1WE0 A;  4MPG A;  2AJQ B;  3ME8 A;  2HLS A;  5DQY A;  1VF4 A;  4ECC A;  20GS A;  5HR2 A;  1G0T A;  1Z7R A;  1EGO A;  2OJL A;  3KP8 A;  3IK7 A;  3HVV A;  1QXH A;  1OE7 A;  6GSS A;  2QKE A;  4XRD A;  3VI5 A;  3QMX A;  4YAV A;  3FW2 A;  1B48 A;  4KH7 A;  4AJ8 A;  2XC2 A;  1OAZ A;  5D9X A;  3KGK A;  1HYU A;  2LEG A;  2WRT A;  5HR1 A;  3ZIT A;  4EF0 A;  3UMA A;  1YDK A;  2AAW A;  2GT6 A;  4Q5Q A;  2B5E A;  1FVK A;  3FK8 A;  2IPA A;  5AIV A;  2J9H A;  2KLX A;  1OC9 B;  1F3B A;  4FH8 A;  1EV9 A;  1LJR A;  2LKU A;  3CRU A;  3IC4 A;  2TRX A;  3Q19 A;  1T4Y A;  5F05 A;  2FA4 A;  2GGT A;  2X64 A;  4MH3 A;  4MZC A;  5IMF A;  3GSS A;  1DBY A;  2C4J A;  4KA0 A;  1MEK A;  5IO2 A;  3ZRE A;  4IQ1 A;  4MK3 A;  2V1M A;  5AGY A;  4ZB9 A;  5EY6 A;  1TTZ A;  2PU9 C;  1LBK A;  3CSJ A;  2NPB A;  5KEJ A;  1PKW A;  2H71 A;  4OD7 A;  1YQ1 A;  1F9M A;  1A2J A;  3KXO A;  3CTG A;  1TI1 A;  4FYB A;  3LXT A;  2FA8 A;  3EC3 A;  5FHI A;  1DE2 A;  3VPT A;  2EIR A;  2WCI A;  5CRG A;  2GLR A;  4QQ7 A;  2VLT A;  2O8V B;  1TKD B;  3GH9 A;  5JWO B;  2IMF A;  4ECB A;  4K6X A;  2K18 A;  1ON4 A;  3FZ5 A;  4KCA A;  1K0C A;  5CRH A;  1E6B A;  2RLI A;  2LJA A;  1HNC A;  4DEJ A;  4G19 A;  1Z5Y E;  5DAL A;  4PQ1 A;  1I5G A;  1FOV A;  3GKK A;  1EGR A;  3PH9 A;  4ZXG A;  4F03 A;  2VD1 A;  1AUC A;  1RQM A;  3IA1 A;  1AQX A;  3K8N A;  2H6Z A;  3KH7 A;  1XVQ A;  1FG4 A;  4V2N A;  1SKR B;  3VWU A;  4MPF A;  4DSR A;  5GZZ B;  1O81 A;  3DXB A;  4IBP A;  3GKN A;  1GSS A;  4NMU A;  4XCS A;  2PVQ A;  3CMI A;  4MLY A;  2L6D A;  3DVW A;  2P5R A;  3NIV A;  4KDU A;  3I6A A;  2MZC A;  1XXU A;  3C1S A;  3US3 A;  1GUM A;  1GSY A;  2HZF A;  2F8F A;  5F06 A;  5KN0 A;  2HZE A;  1JZR A;  3KMO A;  3DRN A;  3QR6 A;  5HR3 A;  1GSE A;  5G2Z A;  3W8J A;  4HJ2 A;  4G10 A;  2IJY A;  2MBS A;  2LNT A;  3A2V A;  3TJF A;  3LXZ A;  4YAP A;  5KN2 A;  4F0B A;  1T3B A;  4TVE A;  5DJL A;  2C1Y A;  3FYG A;  2H72 A;  4L5O A;  1H4O A;  1O73 A;  1A8Y A;  5CYY A;  5CRE A;  5ID2 A;  5KN3 A;  2LQO A;  1EOG A;  2GSS A;  2GSR A;  4H86 A;  3MWH A;  2X8H A;  1XWC A;  2WUL A;  2YWM A;  1THX A;  1ZL9 A;  4ZL8 A;  4AF2 A;  1HQO A;  2GZP A;  3RPN A;  3UEM A;  5J9C A;  5IO0 A;  1WJK A;  1GSF A;  1SEN A;  1GWC A;  2B5X A;  2IMI A;  5IPH A;  2M46 A;  2I9H A;  5DJM A;  1YKA A;  2P5Q A;  2GTU A;  1EEJ A;  3HD5 A;  2V6K A;  3I43 A;  4TXO B;  2B5Y A;  2AHE A;  3WT2 A;  4OO5 A;  3G7I A;  3Q6O A;  1TRU A;  4QL7 A;  3MSZ A;  3C1R A;  1GSQ A;  2GZZ A;  3EU4 A;  1PA3 A;  2IN3 A;  4LL1 B;  1TRW A;  2VCZ A;  1EOH A;  3C8E A;  1A23 A;  2MMO A;  3HZ8 A;  4K9Z A;  2HFD A;  4POB A;  2MYG A;  5CP1 A;  4JZQ A;  1N2A A;  5C04 A;  3GMF A;  1CQH A;  4PQH A;  2LRN A;  5DDL A;  4ZBA A;  4TR1 A;  1V9W A;  4IEL A;  2VL9 A;  4GTU A;  3GKX A;  3GUS A;  5GSS A;  4GQF A;  1PX7 A;  3L9S A;  1BG5 A;  3V1W A;  3M3M A;  2X8G A;  5HR0 A;  1E2Y A;  2HXK A;  2H73 A;  1V40 A;  1V2A A;  1OC8 A;  5EL8 A;  1O6J A;  3CRT A;  3ZIJ A;  1OYJ A;  1K0B A;  3O3T A;  4WR4 A;  2HE3 A;  2HNL A;  1QQ2 A;  1USB A;  1X5E A;  3KTB A;  4TR3 A;  5D9T A;  4ACS A;  3A5W A;  5FT3 A;  1IYI A;  3DWV A;  4KW6 A;  3TOU A;  2DMM A;  5F8B A;  4NHW A;  4OFM A;  5ECS A;  1MDI A;  2IME A;  2HSH A;  3FHK A;  2GQK A;  3A2X A;  4BA7 A;  4N0Z A;  2CAQ A;  1JZW A;  3TRQ A;  3C71 A;  4XHM A;  4RQX A;  4MZW A;  1X5D A;  5J5N A;  4IQA A;  4ULX A;  4KND A;  3M1G A;  2OA7 A;  3ZML A;  2A2S A;  2DJ0 A;  5B8B A;  4TKY A;  1M9B A;  2WS2 A;  1NHY A;  3GYK A;  4MJA A;  4IW9 A;  2CVK A;  2I1U A;  2IMD A;  1BYE A;  2PPT A;  1B4Q A;  4IP1 A;  4GST A;  3TB2 A;  2YN1 A;  2CAI A;  1EV4 A;  3J7Y b;  1PMT A;  4PUA A;  3L9U A;  2JL4 A;  1I9D A;  2JZT A;  4HDE A;  1EZK A;  3VWW A;  3G7J A;  3IHQ A;  4HJM A;  3CXG A;  1SJ6 A;  1NW2 A;  4XIH A;  3H79 A;  3HVX A;  2K6V A;  3CBU A;  1C72 A;  1PL1 A;  2VL2 A;  1UVZ A;  3RDW A;  3CSI A;  22GS A;  1LU4 A;  1PL2 A;  3O6T A;  3EUR A;  1VF2 A;  3M8N A;  1GSD A;  4LMW A;  5H5S A;  2KUC A;  1XOA A;  2LV3 A;  5JWR B;  4WBR D;  4O7H A;  3LYK A;  2H74 A;  2FCH A;  5H5R A;  4MAB A;  4J56 E;  3TJB A;  3WGE A;  3IRA A;  4TR0 A;  3F6D A;  4KGI A;  1OKT A;  1PGT A;  1WIK A;  2IL3 A;  1YEP A;  3L78 A;  3H93 A;  4V2M A;  5AN1 A;  2FNO A;  3ZZX A;  4K2D A;  4XTS A;  2RII A;  5J41 A;  4BVY A;  4MZB A;  2LQQ A;  4I5Q A;  2H0H A;  2AV4 A;  2F9S A;  3D4T A;  2VD0 A;  5JCW A;  4E8E A;  4MMM A;  3UVT A;  1AC1 A;  2FWF A;  3L0H A;  2GZY A;  3HY2 A;  2DJ3 A;  2V32 A;  2IFQ A;  3F9U A;  5ECP B;  2L6C A;  1ML6 A;  1FO5 A;  1SYR A;  1YKC A;  3KZQ A;  2YWN A;  3N9J A;  1K0O A;  2XPD A;  3F3R A;  5G5F A;  1NM3 A;  5A5K A;  4J2F A;  1AQW A;  1XW6 A;  2H76 A;  4CHS A;  5FWG A;  2CQ9 A;  3A3T A;  4GWR A;  4E8H A;  3DEX A;  4LA1 A;  2XBI A;  4PX1 A;  2ON7 A;  4V1A g;  2VO4 A;  4P3Y B;  17GS A;  4MF7 A;  3VUR A;  1AIU A;  2JZR A;  3FY7 A;  2YCD A;  1BAY A;  3UVH A;  3ZLP A;  4D73 A;  4I97 A;  2N5A A;  2O87 A;  2CX3 A;  1GTU A;  1OVN A;  4WEY A;  4RQR A;  3FR3 A;  2FHE A;  4IS0 A;  2ALB A;  4MJB A;  4POK A;  1A2M A;  3IXR A;  1WWJ A;  4WR5 A;  4XS6 A;  4TRX A;  2ZNM A;  1PKZ A;  4LMV A;  3O76 A;  5F07 A;  2YOI A;  2O89 A;  3QAW A;  1ERU A;  4V1A p;  3VPQ A;  5ID2 B;  3UIW A;  4PXO A;  1M0U A;  4PUF C;  3EMX A;  2JAC A;  3PR8 A;  3AY8 A;  3A2W A;  5B7C A;  4F9Z A;  2JU5 A;  1G6W A;  1Z7P A;  4XS1 A;  4XRA A;  5IMA A;  2XPE A;  3BJ5 A;  2R4V A;  3KEB A;  2IMK A;  2X99 A;  1K3L A;  1TP9 A;  1OKD A;  1V57 A;  4I2T A;  3TDG A;  4ML1 A;  1GH2 A;  4X1U A;  9GSS A;  5LD0 A;  4HZ4 A;  1AXD A;  2HRN A;  4TW5 A;  3HJO A;  4K7I A;  3DD3 A;  1S3A A;  4JE1 A;  1Z6M A;  1TW9 A;  2WB9 A;  3G7Y A;  2WJU A;  4HOJ A;  3M0F A;  1QK8 A;  1X0R A;  3GV1 A;  1GNE A;  3HYP A;  2X8C A;  2LUS A;  3D22 A;  4N30 A;  1GRX A;  1JLW A;  3IDV A;  5D9W A;  3H1N A;  2GDR A;  1XPV A;  3BD2 A;  1T00 A;  2OBI A;  4ECI A;  1M2B A;  2REM A;  4TR1 B;  3QPM A;  3H4K A;  3GX0 A;  3QFA C;  3RPP A;  2VM1 A;  3GST A;  1H75 A;  1WPI A;  2DC5 A;  3WGX A;  2VOC A;  1ERW A;  2LJK A;  3LG6 A;  5ENU A;  4LL4 B;  5HQP A;  1WRY A;  5IOW A;  4BL7 A;  4NWY A;  1PX6 A;  2R5G A;  4ID0 A;  5E59 A;  1ZZY A;  4MJE A;  4ZBD A;  2F8A A;  3UJ1 A;  1MDK A;  1Y25 A;  3SBC A;  3PGT A;  3QCP A;  1K0A A;  1WOU A;  6GSU A;  18GS A;  3FR6 A;  2QGV A;  3S9F A;  1SKS B;  3TRX A;  1X9M B;  5G30 A;  1ACV A;  4RI7 A;  4HS1 A;  3TUE A;  3UOM A;  3GL5 A;  4J57 E;  1N8J A;  4AGS A;  2WGR A;  1J08 A;  2R2J A;  3BOA A;  3DKS A;  1FB0 A;  1KBN A;  5B6N A;  3LYP A;  1SD9 A;  3KCM A;  1XWG A;  4WXT A;  4TOP A;  2H1D A;  2CZ3 A;  4KDY A;  1ZGN A;  3MAK A;  4EC0 A;  3KM6 A;  3TKQ A;  1AQV A;  2LRT A;  4PQI A;  2FUG 2;  3P7X A;  5D8I A;  2YWO A;  1S3C A;  8GSS A;  4OMV A;  4YQM A;  5DCH A;  3QDN A;  4N10 A;  1B9X C;  4N11 A;  2OKA A;  2RM5 A;  2F51 A;  2H70 A;  1GTI A;  2LTK A;  1R5P A;  4GCI A;  3ED3 A;  3F3Q A;  4OWY A;  4EDY A;  3UBL A;  3KP9 A;  3LOR A;  4IJ3 A;  3DVX A;  1TJD A;  4POM A;  2YV7 A;  3R2Q A;  2E7P A;  2E2M A;  1Z9H A;  1URM A;  1A0R P;  2P31 A;  4DSS B;  2K9F A;  4AJ7 A;  3LFL A;  5ABR A;  1ZYQ B;  4QL9 A;  4PNG A;  1T4Z A;  3VFI A;  5JCG A;  4NV2 A;  4NHZ A;  1PD2 1;  1EP7 A;  3HCZ A;  1Q4J A;  2MMZ A;  1TRV A;  1EWX A;  1GTA A;  3KJY A;  4ZL7 A;  1Z3E A;  3DGQ A;  4GXZ A;  1A0F A;  2DML A;  3D4M A;  4I2U A;  4JRR A;  1OC9 A;  1SK2 A;  2O7K A;  2CVD A;  4L0U A;  1SL0 B;  5D73 A;  5A4V A;  4G2E A;  4HZ2 A;  1NSW A;  4KB3 A;  3VLN A;  5H5Q A;  2LS5 A;  1JHB A;  4MCU A;  2KOK A;  2TIR A;  1B9Y C;  3DML A;  5IMD A;  4HQS A;  1XWB A;  1PQN A;  1YEX A;  4WKW A;  2YNX A;  1ZYE A;  3D5J A;  1QGV A;  2IFQ B;  4KE3 A;  13GS A;  1GUH A;  3GN3 A;  3TJK A;  4GQC A;  4IGJ A;  5INY A;  1DUG A;  2L59 A;  3DIE A;  3H8Q A;  3GRX A;  3GKM A;  2KHP A;  1K3Y A;  2YAN A;  1MDJ A;  2G0F A;  4NXI A;  2ES7 A;  3E3E A;  4HI7 A;  4K8M A;  1XIY A;  1B8X A;  3J7Y k;  2H01 A;  1DE1 A;  1B4P A;  1JLV A;  2RM6 A;  3HVS A;  3FZA A;  5CO3 A;  2B7J A;  5ECH B;  2HSY A;  2VLV A;  4FO5 A;  1A8L A;  4D73 B;  6GSX A;  2H75 A;  1A24 A;  3APO A;  2PWJ A;  3PIN A;  4OO4 A;  1ST9 A;  2YV9 A;  3IAS 2;  4RUV A;  4Q5R A;  4WF4 A;  4POL A;  2VLU A;  1U6T A;  1HNA A;  4NV5 A;  3HKR A;  2PBJ A;  1VRS D;  3N5O A;  2DBC A;  1ZCP A;  2GS3 A;  1X9S B;  5ELA A;  2VCW A;  2PN8 A;  1WP0 A;  2TRC P;  1GSU A;  3IR4 A;  3LEF A;  5CNW A;  2DJ2 A;  4GLT A;  3GFK A;  3APS A;  3M9K A;  3QFB C;  4GSN A;  3TKS C;  4KDX A;  2CV4 A;  5B8A A;  1HD2 A;  5AIS A;  5G1L A;  5ELG A;  2GQL A;  3GTU A;  3U6V A;  4HU7 A;  4O5R A;  4ZBB A;  2CZ2 A;  1YF0 A;  3EMP A;  1XZO A;  4IVF A;  1GLP A;  1ZOF A;  1O8X A;  2FWE A;  1T7P B;  1CQG A;  1XW9 A;  2ZCT A;  1FVJ A;  4HEA 2;  2JSZ A;  3QOU A;  3CSH A;  5ECR B;  1JZD A;  3P90 A;  1W89 A;  3I69 A;  3ZRD A; 
#chains in the Genus database with same CATH topology
 3DYR A;  2MBT A;  1PSQ A;  2GSQ A;  1TK0 B;  4TXO A;  1SKW B;  4A5P A;  3W8S A;  4JED A;  4HQZ A;  3F4T A;  3TJJ A;  3ZL5 A;  1GL8 A;  3LJR A;  1J9B A;  2I3Y A;  2N5B A;  1FHE A;  5GAN D;  2VUP A;  1GUL A;  2YWI A;  2UZ8 A;  3Q18 A;  4PNF A;  5A4W A;  1FB6 A;  3ME7 A;  5IMZ A;  1M2D A;  2NDO A;  5ECO B;  2C0G A;  5HFG A;  1VGL A;  3VWV A;  3TKS E;  5LNK e;  5DAL B;  4NAX A;  5J4U A;  2LNS A;  2BJX A;  4ZL9 A;  4GF0 A;  1WMJ A;  1BED A;  3F0I A;  2N5F A;  2VL3 A;  5IOX A;  2QC7 A;  4O92 A;  1M2A A;  3IE3 A;  3WGD A;  3IOS A;  5B6M A;  4EUY A;  5DBQ A;  1YZX A;  2C3N A;  2XBQ A;  4Z2R A;  3KIJ A;  4EDZ A;  5DCG A;  2ON5 A;  4K0G A;  1SU9 A;  2E0Q A;  1G6Y A;  2HRF A;  1TI3 A;  2AYT A;  4KSO A;  2V6O A;  1VF3 A;  5G31 A;  2HZE B;  3GL3 A;  3GUR A;  2OE3 A;  5IIZ A;  3U5R E;  3IAM 2;  4G0I A;  5A4U A;  1EP8 A;  3APQ A;  16GS A;  2CX4 A;  2AUV A;  1GUK A;  1TDI A;  1T8E B;  3UAP A;  4EL1 A;  1F6M C;  3L9V A;  3HDC A;  2H66 A;  2A2R A;  2H6Y A;  1ZMA A;  2C8U A;  4TR4 A;  11GS A;  1R26 A;  3ZMK A;  2H1A A;  3OR5 A;  5ECM B;  3SWL A;  2B3S A;  2VM2 A;  5GST A;  2L5L A;  3GHA A;  2C0D A;  6GSW A;  5BRT A;  4Z7X A;  4F82 A;  4K7O A;  2MMA A;  4MF5 A;  5IM9 A;  2B6M A;  3GX8 A;  2R6K A;  2L4Q A;  1XOB A;  4I8B A;  4YQU A;  1YJ6 A;  2H8L A;  2YJ7 A;  5CAX A;  2VCQ A;  2FGX A;  1M99 A;  3L4N A;  4JR6 A;  4JR4 A;  2B7K A;  1O8W A;  1JFU A;  2DJJ A;  4KUN A;  2MMN A;  2JAD A;  1M7T A;  2HRA A;  2GVP A;  2LRC A;  1ERV A;  3GA4 A;  2H0G A;  4FYC A;  4V2L A;  3EIN A;  4X43 A;  2L57 A;  1XVW A;  4ML6 A;  4RI6 A;  5GAP D;  1ERT A;  3WD6 A;  4XS4 A;  6GSY A;  2VIM A;  4I6X A;  4MJC A;  3TKP A;  1RW1 A;  5ECN B;  4BPY A;  1GLQ A;  1SK1 A;  2OAD A;  2LJR A;  2H1G A;  3ZVJ D;  4IHU A;  2PER A;  5CRD A;  2K8V A;  3WYW A;  2L5O A;  4IN0 A;  3QD9 A;  2ZUP A;  1TK8 B;  3GNJ A;  1PN0 A;  4EKZ A;  3C73 A;  1F3A A;  5ECQ B;  5D93 A;  5IMC A;  4MP4 A;  4F0C A;  3ERW A;  3WT1 A;  3ZIV A;  2NVL A;  2EC4 A;  1PN9 A;  4ZB8 A;  4OCF A;  2JSY A;  3TRP A;  4L0W A;  5C00 A;  3IC8 A;  2GQM A;  1V98 A;  4G0L A;  1JZO A;  1QMV A;  3VK9 A;  3HJM A;  1HNB A;  1IYH A;  3C7M A;  2P0G A;  3EE2 A;  5DAK A;  3HA9 A;  4ZIL A;  4CY6 A;  3EVI A;  3ERG A;  1OE8 A;  4L8E A;  3HJP A;  1W4V A;  3ERF A;  1UA5 A;  3GH6 A;  1PFO A;  3QAG A;  4K5R A;  3P8W A;  3KD0 A;  1RK4 A;  4WET A;  2IWT A;  3RHC A;  3EYT A;  2XHF A;  4TXV A;  2OE0 A;  3KMN A;  1SL2 B;  2FWG A;  1FAA A;  3TJG A;  2AB6 A;  1ABA A;  1R4W A;  2QA1 A;  1QFN A;  1SYX A;  3NZN A;  1BQ7 A;  1U3A A;  3HVN A;  4IKH A;  2VCV A;  1J0F A;  2DJK A;  1TK5 B;  1G7O A;  1A2L A;  4OCE A;  2DIZ A;  4K1F A;  2CT6 A;  5CRW A;  1TRS A;  3FZ4 A;  1U87 A;  2C0E A;  2RUF A;  5J9B A;  3D0Z A;  1U88 A;  1SJI A;  3IBH A;  1OC3 A;  1S3D A;  4JU5 A;  2BTO T;  2C3Q A;  3HHV A;  5JWQ B;  2R3X A;  3W6G A;  4FIW A;  3D6I A;  3E9J B;  4WBJ A;  5D96 A;  2I4A A;  1SD8 A;  3GTU B;  1R7H A;  4KX4 A;  1MD4 A;  3KTL A;  4PGT A;  4Q5F A;  2FLS A;  1YY7 A;  2IIY A;  3TKR A;  2WDU A;  3FZ9 A;  2FD3 A;  2FY6 A;  2C3T A;  7GSS A;  1O7U A;  4F2I A;  4KF9 A;  1XCC A;  4BWQ A;  4EVM A;  3LWA A;  2H1B A;  1X5C A;  2V41 A;  2VCT A;  1XBS A;  2OAC A;  3IK9 A;  3NOF A;  3EU3 A;  1EEM A;  5AIX A;  2GT5 A;  4BVY B;  4IJI A;  5JCU A;  1VF1 A;  2PVO C;  14GS A;  2VCX A;  5G1K A;  2HI7 A;  3VWX A;  3QAV A;  1G7E A;  2KP2 A;  2H6X A;  3E0U A;  5COH A;  2LST A;  2WFC A;  3MNG A;  4KCE A;  1AW9 A;  2VL2 C;  5DVB A;  1KTE A;  1SL1 B;  3RHB A;  1R5A A;  6GST A;  3ZFB A;  5KN1 A;  1X9W B;  4HU9 A;  2D2Z A;  10GS A;  2L4C A;  4ZB6 A;  4DSQ A;  3ZVJ A;  3F63 A;  3VI7 A;  4NPB A;  1TU7 A;  3UAR A;  2PMT A;  1YF1 A;  2DIY A;  3FRC A;  3F4R A;  4MA9 A;  5L71 A;  2JZS A;  1UN2 A;  1TXX A;  3UBK A;  1XWA A;  4YQV A;  1K0N A;  2YPM A;  4HUA A;  4GSS A;  2DSA A;  2YP6 A;  5DQS A;  2FWH A;  3LGC A;  2DJ1 A;  3FR9 A;  2NTO A;  5IMV A;  3F6F A;  4N0V A;  2R37 A;  1SK0 A;  4ECJ A;  2Z9S A;  4MH2 A;  3Q74 A;  2YJH A;  5ECI B;  4K7N A;  4KAE A;  12GS A;  4ZIJ A;  3P2A A;  3LQ7 A;  3CTF A;  3MDK A;  4OFN A;  4YH2 A;  3UL3 A;  3PPU A;  2B1K A;  4DVC A;  1BX9 A;  1V58 A;  5IPG A;  2M72 A;  1DSB A;  2YZH A;  5ECL B;  5EVO A;  5EPF A;  1MTC A;  3ISO A;  5LCZ A;  1O85 A;  1ILO A;  2HT9 A;  2GST A;  1K3O A;  1F2E A;  1K0M A;  1Y6E A;  3G9B A;  1THO A;  2EIQ A;  5KOX A;  1K0D A;  4FYU A;  2RUE A;  6GSV A;  1U3I A;  2CA8 A;  19GS A;  2C0F A;  2A4V A;  2V2G A;  5HFK A;  2PUK C;  3HXS A;  2WZ9 A;  4AJ6 A;  3ZYW A;  1TU8 A;  2H30 A;  4OFT A;  2PGT A;  4ILF A;  4BVX A;  1GNW A;  3M9J A;  2H0I A;  4XS4 B;  3BBY A;  4DSS A;  1FOH A;  2F3M A;  2OE1 A;  2NBS A;  5D9V A;  1GP1 A;  3FEU A;  4EIQ A;  4G9H A;  4TN8 A;  4CDO A;  1NHO A;  2A2P A;  3ZFL A;  4L5L A;  2CVB A;  3FKF A;  1XWK A;  1UC7 A;  5E4W A;  5IQY A;  4MDC A;  1SJZ A;  4CY8 A;  2DLX A;  3KH9 A;  3D21 A;  3GIX A;  3TCO A;  4BWS A;  2OBK A;  3CYN A;  3F4S A;  3BCK A;  4BL7 B;  4KSM A;  4EE0 A;  4Q5N A;  4CW9 A;  5F0G A;  3TOT A;  2E2G A;  3I9V 2;  4EO3 A;  3BCI A;  1T1V A;  4EXJ A;  1GTB A;  2KP1 A;  2HYX A;  1TOF A;  2K8S A;  5DAK B;  1XW5 A;  1PRX A;  2VAF A;  1QUW A;  4MF6 A;  5G5E A;  2B1L A;  1M9A A;  2H19 A;  2BMX A;  3F8U A;  4WF5 A;  2C80 A;  4PUR A;  3IHG A;  1MD3 A;  1KEB A;  4JBB A;  3TGZ A;  3ZTL A;  5ECK B;  2M80 A;  4O32 A;  4IP6 A;  2YZU A;  3RBT A;  5J3R A;  3HZ4 A;  4GRF A;  1AAZ A;  1BJX A;  3RAZ A;  3JCM L;  3LSZ A;  2J23 A;  2O85 A;  4ISD A;  5HFI A;  3EWL A;  3IV4 A;  3TKS A;  4K0N A;  1F37 A;  2EIO A;  2G2Q A;  3IPZ A;  2I81 A;  1XFL A;  4LLR A;  1Z6N A;  4EIP A;  1FW1 A;  1KNG A;  4X0X A;  1Q98 A;  2QSI A;  1WE0 A;  4MPG A;  2AJQ B;  3ME8 A;  2HLS A;  5DQY A;  1VF4 A;  4ECC A;  20GS A;  4HSC X;  5HR2 A;  1G0T A;  1Z7R A;  1EGO A;  2OJL A;  3KP8 A;  3IK7 A;  3HVV A;  1QXH A;  1OE7 A;  6GSS A;  4FQU A;  4ICY A;  2QKE A;  1ZYP A;  4XRD A;  3VI5 A;  3QMX A;  4YAV A;  3FW2 A;  4K2X A;  1B48 A;  4KH7 A;  4AJ8 A;  2XC2 A;  1OAZ A;  3KGK A;  5D9X A;  1HYU A;  2LEG A;  2WRT A;  5HR1 A;  3ZIT A;  4EF0 A;  3UMA A;  1YDK A;  2AAW A;  2GT6 A;  4YKG A;  4Q5Q A;  3MYD A;  2B5E A;  1FVK A;  3FK8 A;  2IPA A;  5AIV A;  2J9H A;  2KLX A;  1OC9 B;  1F3B A;  4FH8 A;  1EV9 A;  1LJR A;  2LKU A;  3CRU A;  3IC4 A;  2TRX A;  3Q19 A;  1T4Y A;  5F05 A;  2FA4 A;  2GGT A;  2X64 A;  4MH3 A;  4MZC A;  5IMF A;  3GSS A;  1DBY A;  2C4J A;  4KA0 A;  4Z2U A;  1MEK A;  5IO2 A;  3ZRE A;  4IQ1 A;  4MK3 A;  2V1M A;  5AGY A;  4ZB9 A;  4O5Q A;  5EY6 A;  1TTZ A;  2PU9 C;  1LBK A;  3CSJ A;  2NPB A;  5KEJ A;  1PKW A;  2H71 A;  4OD7 A;  1YQ1 A;  1F9M A;  1A2J A;  3KXO A;  3CTG A;  1TI1 A;  4FYB A;  3LXT A;  2FA8 A;  3EC3 A;  5FHI A;  1DE2 A;  3VPT A;  2EIR A;  2WCI A;  5CRG A;  2GLR A;  4QQ7 A;  2VLT A;  2O8V B;  1TKD B;  3GH9 A;  5JWO B;  2IMF A;  4ECB A;  4K6X A;  2K18 A;  1ON4 A;  3FZ5 A;  4KCA A;  1K0C A;  5CRH A;  1E6B A;  2RLI A;  2LJA A;  1HNC A;  4DEJ A;  4G19 A;  1Z5Y E;  5DAL A;  4PQ1 A;  1I5G A;  1FOV A;  3GKK A;  1EGR A;  3PH9 A;  4ZXG A;  4F03 A;  2VD1 A;  1AUC A;  1RQM A;  3IA1 A;  1AQX A;  3K8N A;  2H6Z A;  3KH7 A;  1XVQ A;  1FG4 A;  4V2N A;  1SKR B;  3VWU A;  4MPF A;  4DSR A;  5GZZ B;  1O81 A;  3DXB A;  4IBP A;  3GKN A;  1GSS A;  4NMU A;  4XCS A;  2PVQ A;  3CMI A;  4MLY A;  2L6D A;  3DVW A;  2P5R A;  3NIV A;  4KDU A;  3I6A A;  2MZC A;  1XXU A;  3C1S A;  3US3 A;  1GUM A;  1GSY A;  2HZF A;  2F8F A;  5F06 A;  5KN0 A;  3A5I A;  2HZE A;  1JZR A;  3KMO A;  3DRN A;  3QR6 A;  5HR3 A;  1GSE A;  5G2Z A;  3W8J A;  4HJ2 A;  4G10 A;  2IJY A;  2MBS A;  2LNT A;  3A2V A;  3TJF A;  3LXZ A;  4YAP A;  5KN2 A;  4BIK A;  4F0B A;  1T3B A;  4TVE A;  5DJL A;  2C1Y A;  3FYG A;  2H72 A;  4L5O A;  1H4O A;  1O73 A;  1A8Y A;  5CYY A;  5CRE A;  3MIX A;  5ID2 A;  5KN3 A;  2LQO A;  2HRK A;  1EOG A;  2GSS A;  2GSR A;  4H86 A;  3MWH A;  2X8H A;  1XWC A;  2WUL A;  2YWM A;  1THX A;  1ZL9 A;  4ZL8 A;  4AF2 A;  1HQO A;  2GZP A;  3RPN A;  3UEM A;  5J9C A;  5IO0 A;  1WJK A;  1GSF A;  1SEN A;  1GWC A;  2B5X A;  2IMI A;  5IPH A;  2M46 A;  2I9H A;  5DJM A;  1YKA A;  2P5Q A;  2GTU A;  1EEJ A;  3HD5 A;  2V6K A;  3I43 A;  4TXO B;  2B5Y A;  2AHE A;  4O5U A;  3WT2 A;  4OO5 A;  3G7I A;  3Q6O A;  1TRU A;  4QL7 A;  3MSZ A;  3C1R A;  1GSQ A;  2GZZ A;  3EU4 A;  1PA3 A;  2IN3 A;  4LL1 B;  1TRW A;  2VCZ A;  1EOH A;  3C8E A;  1A23 A;  2MMO A;  3HZ8 A;  4K9Z A;  2HFD A;  4POB A;  2MYG A;  5CP1 A;  4JZQ A;  1N2A A;  5C04 A;  3R3E A;  3GMF A;  1CQH A;  4PQH A;  2LRN A;  5DDL A;  4ZBA A;  4TR1 A;  1V9W A;  4IEL A;  2VL9 A;  4GTU A;  3GKX A;  3GUS A;  5GSS A;  4GQF A;  1PX7 A;  3L9S A;  1BG5 A;  3V1W A;  3M3M A;  2X8G A;  4X4J A;  5HR0 A;  1E2Y A;  2HXK A;  2H73 A;  1V40 A;  1V2A A;  1OC8 A;  5EL8 A;  1O6J A;  3CRT A;  3ZIJ A;  1OYJ A;  1K0B A;  3O3T A;  4WR4 A;  2HE3 A;  2HNL A;  1QQ2 A;  1USB A;  1X5E A;  3KTB A;  4TR3 A;  5D9T A;  4ACS A;  3A5W A;  5FT3 A;  1IYI A;  3DWV A;  4KW6 A;  3TOU A;  2DMM A;  5F8B A;  4NHW A;  4OFM A;  5ECS A;  1MDI A;  2IME A;  2HSH A;  3FHK A;  2GQK A;  3A2X A;  2R0P A;  4BA7 A;  4N0Z A;  2CAQ A;  1JZW A;  3TRQ A;  3C71 A;  4XHM A;  4RQX A;  4MZW A;  1X5D A;  1M3I A;  5J5N A;  4IQA A;  4ULX A;  4KND A;  3M1G A;  2OA7 A;  3ZML A;  2A2S A;  2DJ0 A;  5B8B A;  4TKY A;  1M9B A;  2WS2 A;  1NHY A;  3GYK A;  4MJA A;  4IW9 A;  2CVK A;  2I1U A;  2IMD A;  1BYE A;  2PPT A;  1B4Q A;  4IP1 A;  4GST A;  3TB2 A;  2YN1 A;  1S3R A;  1EV4 A;  2CAI A;  3J7Y b;  1PMT A;  4PUA A;  3L9U A;  2JL4 A;  1I9D A;  2JZT A;  4HDE A;  1EZK A;  3VWW A;  3G7J A;  3IHQ A;  4HJM A;  3CXG A;  1SJ6 A;  1NW2 A;  4XIH A;  3H79 A;  3HVX A;  2K6V A;  3CBU A;  1C72 A;  1PL1 A;  2VL2 A;  1UVZ A;  3RDW A;  3CSI A;  22GS A;  1LU4 A;  1PL2 A;  3O6T A;  3EUR A;  1VF2 A;  3M8N A;  1GSD A;  4LMW A;  5H5S A;  2KUC A;  1XOA A;  2LV3 A;  5JWR B;  4WBR D;  4O7H A;  3LYK A;  2H74 A;  2FCH A;  5H5R A;  4MAB A;  4J56 E;  3TJB A;  3WGE A;  3IRA A;  3LW9 A;  4TR0 A;  3F6D A;  4KGI A;  1OKT A;  1PGT A;  1WIK A;  2IL3 A;  1YEP A;  3L78 A;  3H93 A;  4V2M A;  5AN1 A;  2FNO A;  3ZZX A;  4K2D A;  4XTS A;  2RII A;  5J41 A;  4BVY A;  4MZB A;  2LQQ A;  4I5Q A;  2H0H A;  2AV4 A;  2F9S A;  3D4T A;  2VD0 A;  5JCW A;  4E8E A;  4MMM A;  3UVT A;  1AC1 A;  2FWF A;  3L0H A;  2GZY A;  3HY2 A;  2DJ3 A;  2V32 A;  2IFQ A;  3F9U A;  4PTS A;  5ECP B;  2L6C A;  1ML6 A;  1FO5 A;  1SYR A;  1YKC A;  3KZQ A;  2YWN A;  3N9J A;  1K0O A;  2XPD A;  3F3R A;  5G5F A;  1NM3 A;  5A5K A;  4J2F A;  1AQW A;  1XW6 A;  2H76 A;  4CHS A;  5FWG A;  2CQ9 A;  3A3T A;  4GWR A;  4E8H A;  3DEX A;  4LA1 A;  2XBI A;  4PX1 A;  2ON7 A;  4V1A g;  2VO4 A;  4P3Y B;  17GS A;  4MF7 A;  3VUR A;  1AIU A;  2JZR A;  3FY7 A;  2YCD A;  1BAY A;  3UVH A;  3ZLP A;  4D73 A;  4I97 A;  2N5A A;  2O87 A;  2CX3 A;  1GTU A;  1OVN A;  4WEY A;  4RQR A;  3FR3 A;  2FHE A;  4IS0 A;  2ALB A;  4MJB A;  4POK A;  1A2M A;  3IXR A;  1WWJ A;  4WR5 A;  4XS6 A;  4TRX A;  2ZNM A;  1PKZ A;  4LMV A;  3O76 A;  5F07 A;  2YOI A;  2O89 A;  3QAW A;  1ERU A;  4V1A p;  3VPQ A;  5ID2 B;  3UIW A;  4PXO A;  1M0U A;  4PUF C;  1ZYN A;  3EMX A;  2JAC A;  3PR8 A;  3AY8 A;  3A2W A;  5B7C A;  4F9Z A;  2JU5 A;  1XG8 A;  1G6W A;  1Z7P A;  4XS1 A;  4XRA A;  5IMA A;  2XPE A;  3BJ5 A;  2R4V A;  3KEB A;  2IMK A;  2X99 A;  1K3L A;  1TP9 A;  4G0K A;  1OKD A;  1V57 A;  4I2T A;  3TDG A;  4ML1 A;  1GH2 A;  4X1U A;  9GSS A;  5LD0 A;  4HZ4 A;  1AXD A;  2HRN A;  3CQF A;  4TW5 A;  3HJO A;  4K7I A;  3DD3 A;  1S3A A;  4JE1 A;  1Z6M A;  1TW9 A;  2WB9 A;  3G7Y A;  2WJU A;  4HOJ A;  3M0F A;  1QK8 A;  1X0R A;  3GV1 A;  1GNE A;  3HYP A;  2X8C A;  2LUS A;  3D22 A;  4N30 A;  1GRX A;  1JLW A;  3IDV A;  1M3J A;  5D9W A;  3H1N A;  2GDR A;  1XPV A;  3BD2 A;  1T00 A;  2OBI A;  4ECI A;  1M2B A;  2REM A;  4TR1 B;  3QPM A;  3H4K A;  3GX0 A;  3QFA C;  3RPP A;  2VM1 A;  3GST A;  1H75 A;  1WPI A;  2DC5 A;  3WGX A;  2VOC A;  1ERW A;  2LJK A;  3LG6 A;  5ENU A;  4LL4 B;  5HQP A;  1WRY A;  5IOW A;  4BL7 A;  4NWY A;  1PX6 A;  2R5G A;  4ID0 A;  5E59 A;  1ZZY A;  4MJE A;  4ZBD A;  2F8A A;  3UJ1 A;  1MDK A;  1Y25 A;  3SBC A;  3PGT A;  3QCP A;  1K0A A;  1WOU A;  6GSU A;  18GS A;  3FR6 A;  2QGV A;  3S9F A;  1SKS B;  3TRX A;  1X9M B;  5G30 A;  1ACV A;  4RI7 A;  4HS1 A;  3TUE A;  3UOM A;  3GL5 A;  4J57 E;  1N8J A;  4AGS A;  2WGR A;  1J08 A;  2R2J A;  3BOA A;  3FMW A;  3DKS A;  1FB0 A;  1KBN A;  5B6N A;  3LYP A;  1SD9 A;  3KCM A;  1XWG A;  4WXT A;  4TOP A;  2H1D A;  2CZ3 A;  4KDY A;  1ZGN A;  2X49 A;  3MAK A;  4EC0 A;  3KM6 A;  3TKQ A;  1AQV A;  2LRT A;  2DKH A;  4PQI A;  2FUG 2;  3P7X A;  5D8I A;  2YWO A;  1S3C A;  8GSS A;  4OMV A;  4YQM A;  5DCH A;  3QDN A;  4N10 A;  1B9X C;  4N11 A;  2OKA A;  2RM5 A;  2F51 A;  2H70 A;  1GTI A;  2LTK A;  1R5P A;  4GCI A;  3ED3 A;  3F3Q A;  4OWY A;  4EDY A;  5BMU A;  3UBL A;  3KP9 A;  3LOR A;  4IJ3 A;  3DVX A;  1TJD A;  4POM A;  2YV7 A;  3R2Q A;  2E7P A;  2E2M A;  1Z9H A;  4BVX B;  1URM A;  1A0R P;  2P31 A;  4DSS B;  2K9F A;  4AJ7 A;  3LFL A;  5ABR A;  4MNN A;  1ZYQ B;  4QL9 A;  4PNG A;  1T4Z A;  3VFI A;  5JCG A;  4NV2 A;  4NHZ A;  1PD2 1;  1EP7 A;  3HCZ A;  1Q4J A;  2MMZ A;  1TRV A;  1EWX A;  1GTA A;  3KJY A;  4ZL7 A;  1Z3E A;  3DGQ A;  4GXZ A;  1A0F A;  2DML A;  3D4M A;  4I2U A;  4JRR A;  1OC9 A;  1SK2 A;  2O7K A;  2CVD A;  4L0U A;  1SL0 B;  5D73 A;  5A4V A;  4G2E A;  4HZ2 A;  1NSW A;  4KB3 A;  3VLN A;  5H5Q A;  2LS5 A;  1JHB A;  4MCU A;  2KOK A;  2TIR A;  1B9Y C;  3DML A;  5IMD A;  4HQS A;  1XWB A;  1PQN A;  1YEX A;  4WKW A;  2YNX A;  1ZYE A;  3D5J A;  1QGV A;  2IFQ B;  2HSM A;  4KE3 A;  13GS A;  1GUH A;  3GN3 A;  3TJK A;  4GQC A;  4IGJ A;  5INY A;  1DUG A;  2L59 A;  3DIE A;  3H8Q A;  3GRX A;  3GKM A;  4USS A;  2KHP A;  1K3Y A;  2YAN A;  1MDJ A;  2G0F A;  4NXI A;  2ES7 A;  3E3E A;  4HI7 A;  4K8M A;  4YKF A;  1XIY A;  1B8X A;  3J7Y k;  2H01 A;  1DE1 A;  1B4P A;  1JLV A;  5KOW A;  2RM6 A;  3HVS A;  3FZA A;  5CO3 A;  2R0G A;  2B7J A;  2A4H A;  5ECH B;  2HSY A;  2VLV A;  4FO5 A;  1A8L A;  3EPT A;  4D73 B;  6GSX A;  2H75 A;  1A24 A;  3APO A;  2PWJ A;  3PIN A;  4OO4 A;  1ST9 A;  2YV9 A;  3IAS 2;  4Z2T A;  4RUV A;  4Q5R A;  4WF4 A;  4POL A;  2VLU A;  1U6T A;  1HNA A;  4K5S A;  4NV5 A;  3HKR A;  2PBJ A;  1VRS D;  3N5O A;  2DBC A;  1ZCP A;  2GS3 A;  1X9S B;  5ELA A;  2VCW A;  2PN8 A;  1WP0 A;  2TRC P;  1GSU A;  3IR4 A;  3LEF A;  2DKI A;  5CNW A;  2DJ2 A;  4GLT A;  3GFK A;  3APS A;  3M9K A;  3QFB C;  4GSN A;  3TKS C;  4KDX A;  2CV4 A;  5B8A A;  1HD2 A;  5AIS A;  5G1L A;  5ELG A;  2GQL A;  2R0C A;  3GTU A;  3U6V A;  4HU7 A;  4O5R A;  4ZBB A;  2CZ2 A;  1YF0 A;  3EMP A;  1XZO A;  4IVF A;  1GLP A;  1ZOF A;  1O8X A;  2FWE A;  1T7P B;  1CQG A;  1XW9 A;  2ZCT A;  1FVJ A;  2X4A A;  4HEA 2;  2JSZ A;  3QOU A;  3CSH A;  5ECR B;  1JZD A;  3P90 A;  1W89 A;  2QA2 A;  3I69 A;  3ZRD A; 
#chains in the Genus database with same CATH homology
 3DYR A;  2MBT A;  1PSQ A;  2GSQ A;  1TK0 B;  4TXO A;  1SKW B;  4A5P A;  3W8S A;  4JED A;  4HQZ A;  3F4T A;  3TJJ A;  3ZL5 A;  1GL8 A;  3LJR A;  1J9B A;  2I3Y A;  2N5B A;  1FHE A;  5GAN D;  2VUP A;  1GUL A;  2YWI A;  2UZ8 A;  3Q18 A;  4PNF A;  5A4W A;  1FB6 A;  3ME7 A;  5IMZ A;  1M2D A;  2NDO A;  5ECO B;  2C0G A;  5HFG A;  1VGL A;  3VWV A;  3TKS E;  5LNK e;  5DAL B;  4NAX A;  5J4U A;  2LNS A;  2BJX A;  4ZL9 A;  4GF0 A;  1WMJ A;  1BED A;  3F0I A;  2N5F A;  2VL3 A;  5IOX A;  2QC7 A;  4O92 A;  1M2A A;  3IE3 A;  3WGD A;  3IOS A;  5B6M A;  4EUY A;  5DBQ A;  1YZX A;  2C3N A;  2XBQ A;  4Z2R A;  3KIJ A;  4EDZ A;  5DCG A;  2ON5 A;  4K0G A;  1SU9 A;  2E0Q A;  1G6Y A;  2HRF A;  1TI3 A;  2AYT A;  4KSO A;  2V6O A;  1VF3 A;  5G31 A;  2HZE B;  3GL3 A;  3GUR A;  2OE3 A;  5IIZ A;  3U5R E;  3IAM 2;  4G0I A;  5A4U A;  1EP8 A;  3APQ A;  16GS A;  2CX4 A;  2AUV A;  1GUK A;  1TDI A;  1T8E B;  3UAP A;  4EL1 A;  1F6M C;  3L9V A;  3HDC A;  2H66 A;  2A2R A;  2H6Y A;  1ZMA A;  2C8U A;  4TR4 A;  11GS A;  1R26 A;  3ZMK A;  2H1A A;  3OR5 A;  5ECM B;  3SWL A;  2B3S A;  2VM2 A;  5GST A;  2L5L A;  3GHA A;  2C0D A;  6GSW A;  5BRT A;  4Z7X A;  4F82 A;  4K7O A;  2MMA A;  4MF5 A;  5IM9 A;  2B6M A;  3GX8 A;  2R6K A;  2L4Q A;  1XOB A;  4I8B A;  4YQU A;  1YJ6 A;  2H8L A;  2YJ7 A;  5CAX A;  2VCQ A;  2FGX A;  1M99 A;  3L4N A;  4JR6 A;  4JR4 A;  2B7K A;  1O8W A;  1JFU A;  2DJJ A;  4KUN A;  2MMN A;  2JAD A;  1M7T A;  2HRA A;  2GVP A;  2LRC A;  1ERV A;  3GA4 A;  2H0G A;  4FYC A;  4V2L A;  3EIN A;  4X43 A;  2L57 A;  1XVW A;  4ML6 A;  4RI6 A;  5GAP D;  1ERT A;  3WD6 A;  4XS4 A;  6GSY A;  2VIM A;  4I6X A;  4MJC A;  3TKP A;  1RW1 A;  5ECN B;  4BPY A;  1GLQ A;  1SK1 A;  2OAD A;  2LJR A;  2H1G A;  3ZVJ D;  4IHU A;  2PER A;  5CRD A;  2K8V A;  3WYW A;  2L5O A;  4IN0 A;  3QD9 A;  2ZUP A;  1TK8 B;  3GNJ A;  1PN0 A;  4EKZ A;  3C73 A;  1F3A A;  5ECQ B;  5D93 A;  5IMC A;  4MP4 A;  4F0C A;  3ERW A;  3WT1 A;  3ZIV A;  2NVL A;  2EC4 A;  1PN9 A;  4ZB8 A;  4OCF A;  2JSY A;  3TRP A;  4L0W A;  5C00 A;  3IC8 A;  2GQM A;  1V98 A;  4G0L A;  1JZO A;  1QMV A;  3VK9 A;  3HJM A;  1HNB A;  1IYH A;  3C7M A;  2P0G A;  3EE2 A;  5DAK A;  3HA9 A;  4ZIL A;  4CY6 A;  3EVI A;  3ERG A;  1OE8 A;  4L8E A;  3HJP A;  1W4V A;  3ERF A;  1UA5 A;  3GH6 A;  3QAG A;  4K5R A;  3P8W A;  3KD0 A;  1RK4 A;  4WET A;  2IWT A;  3RHC A;  3EYT A;  2XHF A;  4TXV A;  2OE0 A;  3KMN A;  1SL2 B;  2FWG A;  1FAA A;  3TJG A;  2AB6 A;  1ABA A;  1R4W A;  2QA1 A;  1QFN A;  1SYX A;  3NZN A;  1BQ7 A;  1U3A A;  4IKH A;  2VCV A;  1J0F A;  2DJK A;  1TK5 B;  1G7O A;  1A2L A;  4OCE A;  2DIZ A;  4K1F A;  2CT6 A;  5CRW A;  1TRS A;  3FZ4 A;  1U87 A;  2C0E A;  2RUF A;  5J9B A;  3D0Z A;  1U88 A;  1SJI A;  3IBH A;  1OC3 A;  1S3D A;  4JU5 A;  2BTO T;  2C3Q A;  3HHV A;  5JWQ B;  2R3X A;  3W6G A;  4FIW A;  3D6I A;  3E9J B;  4WBJ A;  5D96 A;  2I4A A;  1SD8 A;  3GTU B;  1R7H A;  4KX4 A;  1MD4 A;  3KTL A;  4PGT A;  4Q5F A;  2FLS A;  1YY7 A;  2IIY A;  3TKR A;  2WDU A;  3FZ9 A;  2FD3 A;  2FY6 A;  2C3T A;  7GSS A;  1O7U A;  4F2I A;  4KF9 A;  1XCC A;  4BWQ A;  4EVM A;  3LWA A;  2H1B A;  1X5C A;  2V41 A;  2VCT A;  1XBS A;  2OAC A;  3IK9 A;  3NOF A;  3EU3 A;  1EEM A;  5AIX A;  2GT5 A;  4BVY B;  4IJI A;  5JCU A;  1VF1 A;  2PVO C;  14GS A;  2VCX A;  5G1K A;  2HI7 A;  3VWX A;  3QAV A;  1G7E A;  2KP2 A;  2H6X A;  3E0U A;  5COH A;  2LST A;  2WFC A;  3MNG A;  4KCE A;  1AW9 A;  2VL2 C;  5DVB A;  1KTE A;  1SL1 B;  3RHB A;  1R5A A;  6GST A;  3ZFB A;  5KN1 A;  1X9W B;  4HU9 A;  2D2Z A;  10GS A;  2L4C A;  4ZB6 A;  4DSQ A;  3ZVJ A;  3F63 A;  3VI7 A;  4NPB A;  1TU7 A;  3UAR A;  2PMT A;  1YF1 A;  2DIY A;  3FRC A;  3F4R A;  4MA9 A;  5L71 A;  2JZS A;  1UN2 A;  1TXX A;  3UBK A;  1XWA A;  4YQV A;  1K0N A;  2YPM A;  4HUA A;  4GSS A;  2DSA A;  2YP6 A;  5DQS A;  2FWH A;  3LGC A;  2DJ1 A;  3FR9 A;  2NTO A;  5IMV A;  3F6F A;  4N0V A;  2R37 A;  1SK0 A;  4ECJ A;  2Z9S A;  4MH2 A;  3Q74 A;  2YJH A;  5ECI B;  4K7N A;  4KAE A;  12GS A;  4ZIJ A;  3P2A A;  3LQ7 A;  3CTF A;  3MDK A;  4OFN A;  4YH2 A;  3UL3 A;  3PPU A;  2B1K A;  4DVC A;  1BX9 A;  1V58 A;  5IPG A;  2M72 A;  1DSB A;  2YZH A;  5ECL B;  5EVO A;  5EPF A;  1MTC A;  3ISO A;  5LCZ A;  1O85 A;  1ILO A;  2HT9 A;  2GST A;  1K3O A;  1F2E A;  1K0M A;  1Y6E A;  3G9B A;  1THO A;  2EIQ A;  5KOX A;  1K0D A;  4FYU A;  2RUE A;  6GSV A;  1U3I A;  2CA8 A;  19GS A;  2C0F A;  2A4V A;  2V2G A;  5HFK A;  2PUK C;  3HXS A;  2WZ9 A;  4AJ6 A;  3ZYW A;  1TU8 A;  2H30 A;  4OFT A;  2PGT A;  4ILF A;  4BVX A;  1GNW A;  3M9J A;  2H0I A;  4XS4 B;  3BBY A;  4DSS A;  1FOH A;  2F3M A;  2OE1 A;  2NBS A;  5D9V A;  1GP1 A;  3FEU A;  4EIQ A;  4G9H A;  4TN8 A;  4CDO A;  1NHO A;  2A2P A;  3ZFL A;  4L5L A;  2CVB A;  3FKF A;  1XWK A;  1UC7 A;  5E4W A;  5IQY A;  4MDC A;  1SJZ A;  4CY8 A;  2DLX A;  3KH9 A;  3D21 A;  3GIX A;  3TCO A;  4BWS A;  2OBK A;  3CYN A;  3F4S A;  3BCK A;  4BL7 B;  4KSM A;  4EE0 A;  4Q5N A;  4CW9 A;  5F0G A;  3TOT A;  2E2G A;  3I9V 2;  4EO3 A;  3BCI A;  1T1V A;  4EXJ A;  1GTB A;  2KP1 A;  2HYX A;  1TOF A;  2K8S A;  5DAK B;  1XW5 A;  1PRX A;  2VAF A;  1QUW A;  4MF6 A;  5G5E A;  2B1L A;  1M9A A;  2H19 A;  2BMX A;  3F8U A;  4WF5 A;  2C80 A;  4PUR A;  3IHG A;  1MD3 A;  1KEB A;  4JBB A;  3TGZ A;  3ZTL A;  5ECK B;  2M80 A;  4O32 A;  4IP6 A;  2YZU A;  3RBT A;  5J3R A;  3HZ4 A;  4GRF A;  1AAZ A;  1BJX A;  3RAZ A;  3JCM L;  3LSZ A;  2J23 A;  2O85 A;  4ISD A;  5HFI A;  3EWL A;  3IV4 A;  3TKS A;  4K0N A;  1F37 A;  2EIO A;  2G2Q A;  3IPZ A;  2I81 A;  1XFL A;  4LLR A;  1Z6N A;  4EIP A;  1FW1 A;  1KNG A;  4X0X A;  1Q98 A;  2QSI A;  1WE0 A;  4MPG A;  2AJQ B;  3ME8 A;  2HLS A;  5DQY A;  1VF4 A;  4ECC A;  20GS A;  5HR2 A;  1G0T A;  1Z7R A;  1EGO A;  2OJL A;  3KP8 A;  3IK7 A;  3HVV A;  1QXH A;  1OE7 A;  6GSS A;  4FQU A;  4ICY A;  2QKE A;  1ZYP A;  4XRD A;  3VI5 A;  3QMX A;  4YAV A;  3FW2 A;  4K2X A;  1B48 A;  4KH7 A;  4AJ8 A;  2XC2 A;  1OAZ A;  3KGK A;  5D9X A;  1HYU A;  2LEG A;  2WRT A;  5HR1 A;  3ZIT A;  4EF0 A;  3UMA A;  1YDK A;  2AAW A;  2GT6 A;  4YKG A;  4Q5Q A;  3MYD A;  2B5E A;  1FVK A;  3FK8 A;  2IPA A;  5AIV A;  2J9H A;  2KLX A;  1OC9 B;  1F3B A;  4FH8 A;  1EV9 A;  1LJR A;  2LKU A;  3CRU A;  3IC4 A;  2TRX A;  3Q19 A;  1T4Y A;  5F05 A;  2FA4 A;  2GGT A;  2X64 A;  4MH3 A;  4MZC A;  5IMF A;  3GSS A;  1DBY A;  2C4J A;  4KA0 A;  4Z2U A;  1MEK A;  5IO2 A;  3ZRE A;  4IQ1 A;  4MK3 A;  2V1M A;  5AGY A;  4ZB9 A;  4O5Q A;  5EY6 A;  1TTZ A;  2PU9 C;  1LBK A;  3CSJ A;  2NPB A;  5KEJ A;  1PKW A;  2H71 A;  4OD7 A;  1YQ1 A;  1F9M A;  1A2J A;  3KXO A;  3CTG A;  1TI1 A;  4FYB A;  3LXT A;  2FA8 A;  3EC3 A;  5FHI A;  1DE2 A;  3VPT A;  2EIR A;  2WCI A;  5CRG A;  2GLR A;  4QQ7 A;  2VLT A;  2O8V B;  1TKD B;  3GH9 A;  5JWO B;  2IMF A;  4ECB A;  4K6X A;  2K18 A;  1ON4 A;  3FZ5 A;  4KCA A;  1K0C A;  5CRH A;  1E6B A;  2RLI A;  2LJA A;  1HNC A;  4DEJ A;  4G19 A;  1Z5Y E;  5DAL A;  4PQ1 A;  1I5G A;  1FOV A;  3GKK A;  1EGR A;  3PH9 A;  4ZXG A;  4F03 A;  2VD1 A;  1AUC A;  1RQM A;  3IA1 A;  1AQX A;  3K8N A;  2H6Z A;  3KH7 A;  1XVQ A;  1FG4 A;  4V2N A;  1SKR B;  3VWU A;  4MPF A;  4DSR A;  5GZZ B;  1O81 A;  3DXB A;  4IBP A;  3GKN A;  1GSS A;  4NMU A;  4XCS A;  2PVQ A;  3CMI A;  4MLY A;  2L6D A;  3DVW A;  2P5R A;  3NIV A;  4KDU A;  3I6A A;  2MZC A;  1XXU A;  3C1S A;  3US3 A;  1GUM A;  1GSY A;  2HZF A;  2F8F A;  5F06 A;  5KN0 A;  3A5I A;  2HZE A;  1JZR A;  3KMO A;  3DRN A;  3QR6 A;  5HR3 A;  1GSE A;  5G2Z A;  3W8J A;  4HJ2 A;  4G10 A;  2IJY A;  2MBS A;  2LNT A;  3A2V A;  3TJF A;  3LXZ A;  4YAP A;  5KN2 A;  4F0B A;  1T3B A;  4TVE A;  5DJL A;  2C1Y A;  3FYG A;  2H72 A;  4L5O A;  1H4O A;  1O73 A;  1A8Y A;  5CYY A;  5CRE A;  3MIX A;  5ID2 A;  5KN3 A;  2LQO A;  2HRK A;  1EOG A;  2GSS A;  2GSR A;  4H86 A;  3MWH A;  2X8H A;  1XWC A;  2WUL A;  2YWM A;  1THX A;  1ZL9 A;  4ZL8 A;  4AF2 A;  1HQO A;  2GZP A;  3RPN A;  3UEM A;  5J9C A;  5IO0 A;  1WJK A;  1GSF A;  1SEN A;  1GWC A;  2B5X A;  2IMI A;  5IPH A;  2M46 A;  2I9H A;  5DJM A;  1YKA A;  2P5Q A;  2GTU A;  1EEJ A;  3HD5 A;  2V6K A;  3I43 A;  4TXO B;  2B5Y A;  2AHE A;  4O5U A;  3WT2 A;  4OO5 A;  3G7I A;  3Q6O A;  1TRU A;  4QL7 A;  3MSZ A;  3C1R A;  1GSQ A;  2GZZ A;  3EU4 A;  1PA3 A;  2IN3 A;  4LL1 B;  1TRW A;  2VCZ A;  1EOH A;  3C8E A;  1A23 A;  2MMO A;  3HZ8 A;  4K9Z A;  2HFD A;  4POB A;  2MYG A;  5CP1 A;  4JZQ A;  1N2A A;  5C04 A;  3R3E A;  3GMF A;  1CQH A;  4PQH A;  2LRN A;  5DDL A;  4ZBA A;  4TR1 A;  1V9W A;  4IEL A;  2VL9 A;  4GTU A;  3GKX A;  3GUS A;  5GSS A;  4GQF A;  1PX7 A;  3L9S A;  1BG5 A;  3V1W A;  3M3M A;  2X8G A;  4X4J A;  5HR0 A;  1E2Y A;  2HXK A;  2H73 A;  1V40 A;  1V2A A;  1OC8 A;  5EL8 A;  1O6J A;  3CRT A;  3ZIJ A;  1OYJ A;  1K0B A;  3O3T A;  4WR4 A;  2HE3 A;  2HNL A;  1QQ2 A;  1USB A;  1X5E A;  3KTB A;  4TR3 A;  5D9T A;  4ACS A;  3A5W A;  5FT3 A;  1IYI A;  3DWV A;  4KW6 A;  3TOU A;  2DMM A;  5F8B A;  4NHW A;  4OFM A;  5ECS A;  1MDI A;  2IME A;  2HSH A;  3FHK A;  2GQK A;  3A2X A;  2R0P A;  4BA7 A;  4N0Z A;  2CAQ A;  1JZW A;  3TRQ A;  3C71 A;  4XHM A;  4RQX A;  4MZW A;  1X5D A;  5J5N A;  4IQA A;  4ULX A;  4KND A;  3M1G A;  2OA7 A;  3ZML A;  2A2S A;  2DJ0 A;  5B8B A;  4TKY A;  1M9B A;  2WS2 A;  1NHY A;  3GYK A;  4MJA A;  4IW9 A;  2CVK A;  2I1U A;  2IMD A;  1BYE A;  2PPT A;  1B4Q A;  4IP1 A;  4GST A;  3TB2 A;  2YN1 A;  2CAI A;  1EV4 A;  3J7Y b;  1PMT A;  4PUA A;  3L9U A;  2JL4 A;  1I9D A;  2JZT A;  4HDE A;  1EZK A;  3VWW A;  3G7J A;  3IHQ A;  4HJM A;  3CXG A;  1SJ6 A;  1NW2 A;  4XIH A;  3H79 A;  3HVX A;  2K6V A;  3CBU A;  1C72 A;  1PL1 A;  2VL2 A;  1UVZ A;  3RDW A;  3CSI A;  22GS A;  1LU4 A;  1PL2 A;  3O6T A;  3EUR A;  1VF2 A;  3M8N A;  1GSD A;  4LMW A;  5H5S A;  2KUC A;  1XOA A;  2LV3 A;  5JWR B;  4WBR D;  4O7H A;  3LYK A;  2H74 A;  2FCH A;  5H5R A;  4MAB A;  4J56 E;  3TJB A;  3WGE A;  3IRA A;  3LW9 A;  4TR0 A;  3F6D A;  4KGI A;  1OKT A;  1PGT A;  1WIK A;  2IL3 A;  1YEP A;  3L78 A;  3H93 A;  4V2M A;  5AN1 A;  2FNO A;  3ZZX A;  4K2D A;  4XTS A;  2RII A;  5J41 A;  4BVY A;  4MZB A;  2LQQ A;  4I5Q A;  2H0H A;  2AV4 A;  2F9S A;  3D4T A;  2VD0 A;  5JCW A;  4E8E A;  4MMM A;  3UVT A;  1AC1 A;  2FWF A;  3L0H A;  2GZY A;  3HY2 A;  2DJ3 A;  2V32 A;  2IFQ A;  3F9U A;  4PTS A;  5ECP B;  2L6C A;  1ML6 A;  1FO5 A;  1SYR A;  1YKC A;  3KZQ A;  2YWN A;  3N9J A;  1K0O A;  2XPD A;  3F3R A;  5G5F A;  1NM3 A;  5A5K A;  4J2F A;  1AQW A;  1XW6 A;  2H76 A;  4CHS A;  5FWG A;  2CQ9 A;  3A3T A;  4GWR A;  4E8H A;  3DEX A;  4LA1 A;  2XBI A;  4PX1 A;  2ON7 A;  4V1A g;  2VO4 A;  4P3Y B;  17GS A;  4MF7 A;  3VUR A;  1AIU A;  2JZR A;  3FY7 A;  2YCD A;  1BAY A;  3UVH A;  3ZLP A;  4D73 A;  4I97 A;  2N5A A;  2O87 A;  2CX3 A;  1GTU A;  1OVN A;  4WEY A;  4RQR A;  3FR3 A;  2FHE A;  4IS0 A;  2ALB A;  4MJB A;  4POK A;  1A2M A;  3IXR A;  1WWJ A;  4WR5 A;  4XS6 A;  4TRX A;  2ZNM A;  1PKZ A;  4LMV A;  3O76 A;  5F07 A;  2YOI A;  2O89 A;  3QAW A;  1ERU A;  4V1A p;  3VPQ A;  5ID2 B;  3UIW A;  4PXO A;  1M0U A;  4PUF C;  1ZYN A;  3EMX A;  2JAC A;  3PR8 A;  3AY8 A;  3A2W A;  5B7C A;  4F9Z A;  2JU5 A;  1G6W A;  1Z7P A;  4XS1 A;  4XRA A;  5IMA A;  2XPE A;  3BJ5 A;  2R4V A;  3KEB A;  2IMK A;  2X99 A;  1K3L A;  1TP9 A;  4G0K A;  1OKD A;  1V57 A;  4I2T A;  3TDG A;  4ML1 A;  1GH2 A;  4X1U A;  9GSS A;  5LD0 A;  4HZ4 A;  1AXD A;  2HRN A;  4TW5 A;  3HJO A;  4K7I A;  3DD3 A;  1S3A A;  4JE1 A;  1Z6M A;  1TW9 A;  2WB9 A;  3G7Y A;  2WJU A;  4HOJ A;  3M0F A;  1QK8 A;  1X0R A;  3GV1 A;  1GNE A;  3HYP A;  2X8C A;  2LUS A;  3D22 A;  4N30 A;  1GRX A;  1JLW A;  3IDV A;  5D9W A;  3H1N A;  2GDR A;  1XPV A;  3BD2 A;  1T00 A;  2OBI A;  4ECI A;  1M2B A;  2REM A;  4TR1 B;  3QPM A;  3H4K A;  3GX0 A;  3QFA C;  3RPP A;  2VM1 A;  3GST A;  1H75 A;  1WPI A;  2DC5 A;  3WGX A;  2VOC A;  1ERW A;  2LJK A;  3LG6 A;  5ENU A;  4LL4 B;  5HQP A;  1WRY A;  5IOW A;  4BL7 A;  4NWY A;  1PX6 A;  2R5G A;  4ID0 A;  5E59 A;  1ZZY A;  4MJE A;  4ZBD A;  2F8A A;  3UJ1 A;  1MDK A;  1Y25 A;  3SBC A;  3PGT A;  3QCP A;  1K0A A;  1WOU A;  6GSU A;  18GS A;  3FR6 A;  2QGV A;  3S9F A;  1SKS B;  3TRX A;  1X9M B;  5G30 A;  1ACV A;  4RI7 A;  4HS1 A;  3TUE A;  3UOM A;  3GL5 A;  4J57 E;  1N8J A;  4AGS A;  2WGR A;  1J08 A;  2R2J A;  3BOA A;  3FMW A;  3DKS A;  1FB0 A;  1KBN A;  5B6N A;  3LYP A;  1SD9 A;  3KCM A;  1XWG A;  4WXT A;  4TOP A;  2H1D A;  2CZ3 A;  4KDY A;  1ZGN A;  2X49 A;  3MAK A;  4EC0 A;  3KM6 A;  3TKQ A;  1AQV A;  2LRT A;  2DKH A;  4PQI A;  2FUG 2;  3P7X A;  5D8I A;  2YWO A;  1S3C A;  8GSS A;  4OMV A;  4YQM A;  5DCH A;  3QDN A;  4N10 A;  1B9X C;  4N11 A;  2OKA A;  2RM5 A;  2F51 A;  2H70 A;  1GTI A;  2LTK A;  1R5P A;  4GCI A;  3ED3 A;  3F3Q A;  4OWY A;  4EDY A;  5BMU A;  3UBL A;  3KP9 A;  3LOR A;  4IJ3 A;  3DVX A;  1TJD A;  4POM A;  2YV7 A;  3R2Q A;  2E7P A;  2E2M A;  1Z9H A;  4BVX B;  1URM A;  1A0R P;  2P31 A;  4DSS B;  2K9F A;  4AJ7 A;  3LFL A;  5ABR A;  4MNN A;  1ZYQ B;  4QL9 A;  4PNG A;  1T4Z A;  3VFI A;  5JCG A;  4NV2 A;  4NHZ A;  1PD2 1;  1EP7 A;  3HCZ A;  1Q4J A;  2MMZ A;  1TRV A;  1EWX A;  1GTA A;  3KJY A;  4ZL7 A;  1Z3E A;  3DGQ A;  4GXZ A;  1A0F A;  2DML A;  3D4M A;  4I2U A;  4JRR A;  1OC9 A;  1SK2 A;  2O7K A;  2CVD A;  4L0U A;  1SL0 B;  5D73 A;  5A4V A;  4G2E A;  4HZ2 A;  1NSW A;  4KB3 A;  3VLN A;  5H5Q A;  2LS5 A;  1JHB A;  4MCU A;  2KOK A;  2TIR A;  1B9Y C;  3DML A;  5IMD A;  4HQS A;  1XWB A;  1PQN A;  1YEX A;  4WKW A;  2YNX A;  1ZYE A;  3D5J A;  1QGV A;  2IFQ B;  2HSM A;  4KE3 A;  13GS A;  1GUH A;  3GN3 A;  3TJK A;  4GQC A;  4IGJ A;  5INY A;  1DUG A;  2L59 A;  3DIE A;  3H8Q A;  3GRX A;  3GKM A;  4USS A;  2KHP A;  1K3Y A;  2YAN A;  1MDJ A;  2G0F A;  4NXI A;  2ES7 A;  3E3E A;  4HI7 A;  4K8M A;  4YKF A;  1XIY A;  1B8X A;  3J7Y k;  2H01 A;  1DE1 A;  1B4P A;  1JLV A;  5KOW A;  2RM6 A;  3HVS A;  3FZA A;  5CO3 A;  2R0G A;  2B7J A;  2A4H A;  5ECH B;  2HSY A;  2VLV A;  4FO5 A;  1A8L A;  3EPT A;  4D73 B;  6GSX A;  2H75 A;  1A24 A;  3APO A;  2PWJ A;  3PIN A;  4OO4 A;  1ST9 A;  2YV9 A;  3IAS 2;  4Z2T A;  4RUV A;  4Q5R A;  4WF4 A;  4POL A;  2VLU A;  1U6T A;  1HNA A;  4K5S A;  4NV5 A;  3HKR A;  2PBJ A;  1VRS D;  3N5O A;  2DBC A;  1ZCP A;  2GS3 A;  1X9S B;  5ELA A;  2VCW A;  2PN8 A;  1WP0 A;  2TRC P;  1GSU A;  3IR4 A;  3LEF A;  2DKI A;  5CNW A;  2DJ2 A;  4GLT A;  3GFK A;  3APS A;  3M9K A;  3QFB C;  4GSN A;  3TKS C;  4KDX A;  2CV4 A;  5B8A A;  1HD2 A;  5AIS A;  5G1L A;  5ELG A;  2GQL A;  2R0C A;  3GTU A;  3U6V A;  4HU7 A;  4O5R A;  4ZBB A;  2CZ2 A;  1YF0 A;  3EMP A;  1XZO A;  4IVF A;  1GLP A;  1ZOF A;  1O8X A;  2FWE A;  1T7P B;  1CQG A;  1XW9 A;  2ZCT A;  1FVJ A;  2X4A A;  4HEA 2;  2JSZ A;  3QOU A;  3CSH A;  5ECR B;  1JZD A;  3P90 A;  1W89 A;  2QA2 A;  3I69 A;  3ZRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...