1KTEA

Crystal structure of thioltransferase at 2.2 angstrom resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
105
structure length
105
Chain Sequence
AQAFVNSKIQPGKVVVFIKPTCPFCRKTQELLSQLPFKEGLLEFVDITATSDTNEIQDYLQQLTGARTVPRVFIGKECIGGCTDLESMHKRGELLTRLQQVGAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOLTRANSFERASE
publication title Crystal structure of thioltransferase at 2.2 A resolution.
pubmed rcsb
source organism Sus scrofa
molecule tags Electron transport
total genus 35
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1996-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1kteA00
2E2MA 3G7YA 5DJLA 1XWCA 1X9WB 4IJ3A 4KW6A 3HVSA 4PURA 1GUKA 3OR5A 4IELA 2FLSA 2X64A 2FUG2 4PXOA 2FA8A 2GTUA 5DALB 5HR1A 3VPQA 4FIWA 3NIVA 1ZYEA 3RHBA 2IMKA 1OE8A 2WZ9A 3TJFA 5KN2A 4MP4A 5FWGA 4MJBA 2H1BA 3IV4A 1ZYQB 1A8YA 3LQ7A 2IFQA 4AJ8A 5D93A 2HYXA 1SU9A 1X9MB 2L57A 2PWJA 1T3BA 4JR4A 2GVPA 2VL2C 2H72A 1TI3A 2L59A 2PUKC 1GSQA 3MAKA 2F8FA 3TKSA 4DEJA 1AC1A 4DSSA 4FYBA 1ZMAA 6GSSA 2GZPA 2G2QA 2VUPA 3VWWA 1K3OA 1VGLA 4IGJA 3CBUA 3VWUA 1PKWA 2JACA 2M72A 2IMDA 4Q5FA 1SL0B 3TUEA 3FZ5A 3VI7A 5LNKe 1JLVA 4D73A 2YZUA 2HT9A 3QAGA 2GQMA 4EO3A 1TK5B 3UJ1A 2MYGA 3BCKA 2CVDA 2AB6A 4ZILA 3KMNA 4ISDA 2KLXA 2VL2A 4H86A 4MA9A 3RPPA 5D96A 5ID2B 4N0ZA 4RQRA 5CRHA 1AXDA 4IKHA 4OWYA 3UMAA 3H1NA 1GNEA 3I9V2 2DJJA 2DIYA 3M9JA 2LJAA 3KGKA 2NVLA 5G1LA 1KTEA 2NBSA 1F2EA 2XBQA 3QPMA 4F0BA 4IHUA 2FWGA 4TR4A 4WR5A 2C1YA 2YV7A 1BAYA 1GSFA 4AF2A 5DQSA 3E3EA 2CV4A 3EC3A 4N30A 3H79A 2F9SA 1XBSA 3GL3A 1TXXA 4J56E 1PRXA 3GTUB 1VRSD 2FWFA 3ERWA 2LRTA 4TXOA 1F9MA 3DKSA 4CW9A 2FY6A 2KP2A 2JZSA 4XS6A 2LTKA 1R7HA 4KCEA 2H73A 4EL1A 3IRAA 3C1SA 3M1GA 5IMZA 2C0EA 4JEDA 2WB9A 1FVJA 3G7JA 4WF5A 2WDUA 5D8IA 2C8UA 4POMA 3DD3A 2ES7A 1OVNA 3KP9A 1S3CA 5G5FA 4GLTA 2JZTA 2H6ZA 5CRGA 1AQVA 5B7CA 2QGVA 5A4UA 3TKSE 1GTIA 1F3BA 2LS5A 3GUSA 5DBQA 1O81A 4KSMA 1CQHA 2TRCP 5JWQB 1K0MA 1G6YA 2K8SA 1PGTA 1YZXA 3O6TA 1ZGNA 5KN1A 1USBA 2CA8A 1R26A 3PINA 4ULXA 10GSA 1UA5A 1R4WA 1PX7A 5INYA 4MJEA 4MH2A 2MZCA 5IPHA 2YJ7A 1SJ6A 1Y6EA 1HD2A 2H1GA 1SK0A 1JZOA 5ELAA 1H4OA 4HEA2 1AQXA 3A2XA 4ECCA 3ZTLA 2C0DA 3L9SA 2PVOC 3P7XA 1XZOA 1XW9A 1Z6MA 5J41A 4WBRD 2YWMA 4DSQA 1O85A 4ZL9A 2EIRA 18GSA 3RHCA 2GSSA 2NDOA 3KZQA 2O85A 5FHIA 1PL2A 1SL2B 4HJMA 3KM6A 1Z3EA 1TRVA 4HI7A 2CAQA 2LNSA 1TW9A 1XVWA 2MBSA 1OKTA 4F03A 1FO5A 3ME8A 1Y25A 2RM6A 2LEGA 2F51A 2I3YA 1Z9HA 2K18A 1GSDA 4ZB9A 3QDNA 3KTBA 2QKEA 1GSSA 2K6VA 1JZRA 1FOVA 3KMOA 2HE3A 5HR3A 1W4VA 1MDIA 1BEDA 1B9XC 2KUCA 2PVQA 2HSHA 4POKA 5DALA 4V1Ag 4D73B 2CVBA 1Z7RA 2P5RA 2F8AA 2FD3A 5KN0A 2WFCA 2XPDA 1NHYA 5J3RA 3D5JA 1UVZA 1J0FA 1WP0A 4X0XA 2L6CA 2AV4A 3W8JA 5CNWA 3HXSA 3BOAA 3QCPA 5AIXA 3IOSA 4K0GA 3ZFBA 4IJIA 3N5OA 4KSOA 2GQKA 3CTFA 4TN8A 2IMEA 5EVOA 3LGCA 5IMDA 3CXGA 1EOHA 2GSTA 2N5AA 2DJ1A 2HZEB 5B8BA 2MMAA 4KX4A 1GSYA 3QMXA 1PMTA 3F0IA 3DWVA 2YJHA 1DSBA 3TRXA 2M80A 1PD21 2H19A 2H0HA 5ECLB 3TJJA 4BVXA 1GSEA 2IMFA 1SL1B 5FT3A 5H5SA 2OKAA 4MPFA 1TI1A 3ME7A 1Z7PA 6GSUA 3DXBA 4TXOB 2LV3A 1V57A 2YWIA 4KUNA 3F8UA 3SWLA 4XRDA 5IMCA 1JFUA 1G7EA 1DE2A 2YOIA 13GSA 2DSAA 4HZ2A 5ECMB 3TRQA 5HFKA 1LU4A 3IK7A 4I2UA 5LCZA 1ON4A 4KDUA 3IE3A 2H8LA 5JWOB 2DJ2A 2CVKA 5GSTA 2VD1A 1SYRA 4K9ZA 4GSSA 4WEYA 2V41A 5CRDA 3ERGA 3IC4A 1O8WA 4XHMA 5IMFA 4JZQA 1VF4A 5A4WA 3IXRA 3F3QA 2VCZA 1YEPA 3HCZA 1X9SB 2VCTA 4I8BA 4YQMA 1M2DA 3GTUA 1M2AA 4PNFA 5DCHA 2C4JA 3H8QA 2JL4A 1YKCA 2H71A 1OAZA 2CZ3A 2HSYA 1Q98A 3FZ4A 4ACSA 4XS1A 3EINA 3MWHA 5G5EA 1HNBA 1FB0A 4I2TA 4NV2A 2L4QA 5CREA 4AGSA 3VWXA 4MDCA 3EMPA 1GH2A 1A24A 1KBNA 1Q4JA 2V6OA 1LBKA 1VF1A 1F37A 1GTAA 3O3TA 3E0UA 3FZ9A 4WR4A 2B5XA 3LG6A 3JCML 1TRSA 2C0FA 2WULA 3EWLA 3HZ8A 5F0GA 3F4RA 4DSRA 4POLA 5IO0A 4NHWA 3IR4A 3HD5A 4J57E 5J9BA 1PL1A 1WRYA 3KTLA 2R37A 4K7OA 1FW1A 2YCDA 2N5BA 4OO5A 3ZZXA 1A0RP 5COHA 4NPBA 5ECNB 3HJOA 1B4QA 4HU7A 1WE0A 4CDOA 1CQGA 2E0QA 2R4VA 1X5EA 5ECKB 3NZNA 1A8LA 22GSA 6GSTA 2X8GA 4FYUA 3I69A 5JCUA 16GSA 1GL8A 1GULA 2JZRA 2H01A 3L9UA 4WETA 3DIEA 3EU3A 1I5GA 4LL1B 4MK3A 5HR0A 4KCAA 3HHVA 1EV4A 1T8EB 1B9YC 2B6MA 2VL9A 2ZUPA 5DQYA 3J7Yk 3KH9A 3VLNA 4F2IA 7GSSA 3IAS2 1LJRA 4TVEA 3L4NA 1GNWA 1RQMA 2GT6A 6GSYA 5IQYA 2FCHA 1BJXA 3F4SA 3K8NA 4V2LA 1EOGA 4GF0A 3O76A 3LXTA 3PR8A 2OJLA 1XW6A 2LKUA 4GSTA 2OE0A 3ZVJA 3I43A 2WGRA 3ZREA 3GL5A 2V32A 2HZFA 4BA7A 2OADA 2E2GA 2YN1A 2R5GA 2YPMA 4FH8A 2GLRA 1PKZA 1URMA 2VL3A 4QL9A 1GUHA 1WOUA 2TRXA 2LQOA 2O87A 4KA0A 2G0FA 3TJBA 1THOA 2DIZA 4ECIA 1WMJA 1K0NA 1KEBA 4MF6A 4ZBDA 1M0UA 2E7PA 2HZEA 3ZIVA 3DRNA 2PN8A 3APSA 6GSXA 1A2JA 2CAIA 4OCEA 5AGYA 1NSWA 1WPIA 4XS4B 3ZYWA 2B5YA 5J4UA 2X8CA 2I4AA 2GZZA 4PUAA 4MF7A 2N5FA 1A2MA 1VF2A 2BTOT 5ECIB 5F06A 1ERWA 2BMXA 4IQ1A 3GSTA 3RAZA 3I6AA 4MMMA 4XTSA 4V2MA 4GQFA 4HU9A 1SD9A 3Q19A 2B1KA 3TDGA 4LA1A 1QFNA 2YP6A 1BG5A 1HNAA 4GCIA 2VCWA 4V2NA 3P2AA 1YDKA 2VCQA 1TTZA 3IK9A 3D4MA 5D9XA 2FNOA 2C0GA 2H76A 4PQHA 2C3NA 3A3TA 4HJ2A 3IAM2 1THXA 1O8XA 1N8JA 4IP1A 4PQIA 4Z7XA 1MTCA 3CSHA 1X5CA 2LQQA 3MSZA 4O5RA 3TGZA 4TW5A 3EMXA 11GSA 1SKWB 4HQZA 4ILFA 3QFAC 1FB6A 5DJMA 1QGVA 3W8SA 4YQVA 1GWCA 5IIZA 5H5QA 2JSZA 2DC5A 1K0DA 3GH6A 2H6YA 1SK2A 1BQ7A 3DVXA 2IL3A 2P0GA 4ZB6A 3U5RE 4L0WA 1K0CA 3LWAA 3GMFA 1ACVA 4N0VA 2DJ3A 1ZOFA 1SJIA 3TKQA 3J7Yb 3RBTA 1B8XA 3GRXA 3F9UA 3LXZA 2PERA 2OBIA 1TKDB 3P90A 4XRAA 1WIKA 2AYTA 4IBPA 2VLTA 4F9ZA 4JR6A 3LEFA 2NTOA 3D21A 1Z6NA 5CRWA 3C7MA 1XPVA 3MNGA 5ECSA 5KEJA 1AUCA 2H1DA 1SYXA 2H30A 3QFBC 4ZXGA 4MH3A 1GP1A 2BJXA 1ERUA 1GLPA 2B3SA 3HJMA 3FY7A 1MD4A 3DVWA 2VCVA 1YJ6A 3ZMKA 4HZ4A 1A2LA 2LJKA 2VO4A 5AN1A 5KN3A 1TU8A 1PX6A 3LYKA 3FR9A 4MABA 4EDZA 2A2SA 1RW1A 4MZCA 1EEJA 3CSJA 1IYIA 4WF4A 1J08A 1V58A 3VI5A 4TR1A 6GSWA 4J2FA 3FKFA 5E4WA 5JCWA 5ENUA 2MMNA 5J5NA 1R5PA 1TP9A 3UVTA 4BWQA 2ON7A 2PBJA 2OA7A 1R5AA 3ERFA 4QL7A 1PSQA 1EZKA 5A4VA 2JSYA 1ZL9A 1JZDA 4KNDA 4MJAA 5IMVA 1QK8A 2H66A 6GSVA 1YKAA 2OE1A 5JCGA 1S3DA 3F6DA 2DMLA 3V1WA 1X0RA 3M9KA 5D73A 2VLVA 5CAXA 4BL7A 2I81A 2OBKA 3LYPA 1B4PA 4O92A 5J9CA 3SBCA 1EP7A 1UC7A 1G6WA 3TKRA 2CX4A 4ECBA 3UOMA 2FWHA 3DEXA 3VFIA 3GX8A 2FWEA 2M46A 4XCSA 2GSRA 1C72A 2AUVA 1MEKA 4RQXA 4NHZA 5E59A 2R3XA 4K0NA 3FEUA 3WGDA 5IOWA 3W6GA 1NW2A 4IQAA 2KP1A 1T4YA 3F63A 3QAVA 3LSZA 3KXOA 4LL4B 1EGRA 4WKWA 1MDJA 3CMIA 3QD9A 4MCUA 4PQ1A 2F3MA 3BJ5A 2KOKA 2GQLA 2CZ2A 3GURA 5EY6A 1NM3A 1M9BA 2XHFA 1G7OA 4Q5RA 4ZBAA 5LD0A 3KH7A 1B48A 1G0TA 3WGEA 3WGXA 1HQOA 3DMLA 2ZNMA 3VWVA 1A23A 3WT1A 3GKXA 2L5LA 2LNTA 5DCGA 3GYKA 4OFNA 4WXTA 4LMWA 4K7NA 1K3YA 5EL8A 4XS4A 2ZCTA 1OC9A 4YAPA 3IHQA 3GV1A 1GUMA 1ZZYA 2D2ZA 2X99A 3Q6OA 1O7UA 3GSSA 4JE1A 4IVFA 1PN9A 3MDKA 2DMMA 2JU5A 1SKSB 3HYPA 2XC2A 1W89A 1PA3A 4GWRA 4PGTA 3CRUA 1ZCPA 4EKZA 3HA9A 2ALBA 3ED3A 4TKYA 3KJYA 2H74A 3VK9A 5AIVA 2HNLA 2V2GA 3EURA 1T1VA 2J23A 3PH9A 5ECRB 5DVBA 1S3AA 5HFIA 2A4VA 1BYEA 1M9AA 3QOUA 3ZITA 4GSNA 4YQUA 1T4ZA 3HKRA 4NV5A 3GFKA 1XWKA 17GSA 4KDYA 1DE1A 1M99A 1K0AA 1K0OA 1OE7A 2VLUA 3KCMA 4E8HA 2VOCA 1YF1A 4L5LA 1AQWA 3F6FA 1O73A 1XVQA 4TR1B 2RIIA 4KH7A 1U3AA 1E2YA 3ZLPA 3H93A 1TRWA 4IW9A 2FA4A 3FHKA 2L4CA 2GT5A 3PGTA 3H4KA 3TKPA 3CRTA 3TKSC 1VF3A 2WCIA 4EVMA 1K0BA 4X1UA 2WS2A 1V9WA 20GSA 3CYNA 4OCFA 3LORA 2GS3A 4OMVA 1XWGA 5JWRB 4ML1A 1JHBA 3ZL5A 3VURA 3U6VA 1K3LA 4GRFA 3TOTA 2B1LA 4EE0A 5C00A 2B7KA 3M3MA 3GKNA 4OFMA 4HQSA 1OYJA 4AJ7A 4K6XA 2IPAA 1XOAA 4LMVA 3KEBA 1UN2A 2GZYA 2V1MA 4ML6A 2LJRA 2YZHA 4V1Ap 4KDXA 4FYCA 2H75A 4EXJA 3GX0A 4ZL7A 3P8WA 4HOJA 2FHEA 4TOPA 2VM1A 1AW9A 1HNCA 5IO2A 3M8NA 4K1FA 2RUFA 2P31A 3HJPA 1YQ1A 4ZB8A 4L8EA 4F0CA 3FZAA 3L78A 4N11A 1ILOA 4TR0A 3F3RA 1YEXA 5A5KA 4LLRA 1Z5YE 2H0IA 4JBBA 4RI7A 1V40A 2EIQA 1GLQA 3D6IA 3KP8A 4EDYA 3US3A 3QR6A 5ECPB 1A0FA 1ST9A 8GSSA 1SK1A 3EVIA 4NMUA 1KNGA 2AAWA 4K8MA 1JLWA 4YAVA 2O89A 5AISA 5GZZB 1F6MC 2HRFA 4AJ6A 2HXKA 5HQPA 2VM2A 1QUWA 3ZIJA 1QMVA 2PU9C 5D9WA 1OC9B 2XBIA 2YWOA 4CHSA 2LRNA 5IM9A 1EWXA 3A2VA 3IDVA 4F82A 1H75A 4MPGA 1TK8B 4DVCA 3S9FA 5G2ZA 4KAEA 4I6XA 2IJYA 2REMA 2CQ9A 9GSSA 2EC4A 3ZVJD 1I9DA 4OFTA 5GSSA 5HR2A 5IMAA 1XOBA 3WT2A 2K8VA 1OC3A 1V98A 3TRPA 12GSA 3HDCA 1U3IA 5F07A 3KD0A 5G30A 3A5WA 2VIMA 2IN3A 4EF0A 1U87A 3UIWA 2GGTA 2AJQB 3BD2A 3TJGA 2WRTA 3GHAA 4O7HA 4NWYA 4HDEA 3UL3A 14GSA 2YNXA 2RLIA 1U6TA 4ECJA 4G2EA 1ML6A 4EUYA 2YV9A 4PNGA 1TJDA 3C8EA 5ECHB 2LSTA 2IIYA 2OACA 5CO3A 4TRXA 4P3YB 1FVKA 3UEMA 2IMIA 3EU4A 4JRRA 4IS0A 4Q5NA 2H6XA 2MMOA 2VD0A 4E8EA 1O6JA 2YANA 2P5QA 1BX9A 5DAKB 3RDWA 3APOA 3D22A 3TOUA 2DBCA 5H5RA 2JADA 3L9VA 3UAPA 1YF0A 1TOFA 3CSIA 1SD8A 2GSQA 2B5EA 1TU7A 1J9BA 4L0UA 5D9VA 2PPTA 3GIXA 4GXZA 2B7JA 5IPGA 1YY7A 4WBJA 4EC0A 1JZWA 1ABAA 5G1KA 2L6DA 2DLXA 2DJKA 3D4TA 1QQ2A 2GDRA 2RM5A 2L5OA 4O32A 3HVVA 3Q74A 2IFQB 2I1UA 1SKRB 3GN3A 3GKMA 4YH2A 4ZL8A 4G9HA 4L5OA 3HY2A 1F3AA 2C3TA 4OD7A 1WJKA 3VPTA 2CX3A 5B6NA 2I9HA 1HYUA 2K9FA 3NOFA 4I5QA 2H70A 1T00A 4DSSB 2C80A 1XW5A 2HRNA 2O8VB 2PMTA 3TJKA 1XIYA 3DYRA 4GQCA 2H0GA 2V6KA 3C73A 4RI6A 1AAZA 5C04A 2VCXA 2R6KA 4IN0A 4QQ7A 3AY8A 1TDIA 4MZBA 2QC7A 3E9JB 2LUSA 3CTGA 2WJUA 1XCCA 4TR3A 1M2BA 5EPFA 2LRCA 1TK0B 3QAWA 1FAAA 3EYTA 1XWBA 2J9HA 2MBTA 3Q18A 2H1AA 3KIJA 3UBKA 3DGQA 4MF5A 1GSUA 4KGIA 5CP1A 2R2JA 3G9BA 5F8BA 4NAXA 2RUEA 1DUGA 2HI7A 3UBLA 2HLSA 3ISOA 3TCOA 2QSIA 4RUVA 2ON5A 4KB3A 2O7KA 3GNJA 2NPBA 2A2RA 4MJCA 3FR3A 4PUFC 5HFGA 1XWAA 3APQA 4N10A 3ZRDA 3UVHA 1T7PB 3D0ZA 1FG4A 2CT6A 3UARA 3IPZA 5B8AA 1N2AA 3N9JA 3FK8A 3WD6A 4MZWA 4Q5QA 3C71A 19GSA 1EEMA 2XPEA 5ECOB 2AHEA 4FO5A 3L0HA 4ZIJA 1AIUA 1GTUA 1ERTA 4KE3A 3EE2A 3TB2A 5ID2A 2HFDA 1V2AA 4NXIA 3F4TA 2PGTA 5DDLA 5D9TA 4TXVA 1EGOA 4BWSA 3C1RA 4HS1A 3RPNA 1X5DA 3IA1A 1QXHA 3BBYA 3G7IA 3R2QA 3FYGA 5IOXA 1GRXA 1EV9A 1OC8A 2FGXA 1GTBA 4X43A 1FHEA 3ZMLA 5CYYA 5B6MA 1ERVA 4HUAA 3LJRA 2Z9SA 1DBYA 2C3QA 2TIRA 1IYHA 4K7IA 3FW2A 2MMZA 4BPYA 1SENA 3LFLA 1MD3A 2OE3A 4PX1A 3GKKA 3FRCA 4ID0A 4JU5A 5GAND 5ELGA 3HZ4A 2KHPA 3BCIA 3IBHA 4MLYA 4OO4A 4K2DA 5L71A 3WYWA 1E6BA 3M0FA 2EIOA 1U88A 3ZFLA 4ZBBA 1MDKA 4GTUA 1NHOA 1TRUA 4I97A 1XFLA 1SJZA 4IP6A 5ABRA 1XXUA 1RK4A 3GH9A 5F05A 4BVYA 1WWJA 4G19A 2DJ0A 1EP8A 5GAPD 1OKDA 2IWTA 5DAKA 3A2WA 3FR6A 3HVXA 4POBA 5G31A 1M7TA 4G10A 2YWNA 2VAFA 4XIHA 3GA4A 5ECQB 1PQNA 2X8HA
chains in the Genus database with same CATH superfamily
2E2MA 3G7YA 5DJLA 1XWCA 1X9WB 4IJ3A 4KW6A 3HVSA 4PURA 1GUKA 3OR5A 4IELA 2FLSA 2X64A 2FUG2 4PXOA 2FA8A 2GTUA 5DALB 5HR1A 3VPQA 4FIWA 3NIVA 1ZYEA 3RHBA 2IMKA 1OE8A 2WZ9A 3TJFA 5KN2A 4MP4A 5FWGA 4MJBA 2H1BA 3IV4A 1ZYQB 1A8YA 3LQ7A 2IFQA 4AJ8A 5D93A 2HYXA 1SU9A 1X9MB 2L57A 2PWJA 4Z2TA 1T3BA 4JR4A 2GVPA 2VL2C 2H72A 1TI3A 2L59A 2PUKC 1GSQA 3MAKA 2F8FA 3TKSA 4DEJA 1AC1A 4DSSA 4FYBA 1ZMAA 6GSSA 2GZPA 2G2QA 2VUPA 3VWWA 1K3OA 1VGLA 4BVXB 4IGJA 3CBUA 3VWUA 1PKWA 4CY6A 2JACA 2M72A 2IMDA 4Q5FA 1SL0B 3TUEA 3FZ5A 3VI7A 5LNKe 1JLVA 4D73A 2YZUA 2HT9A 3QAGA 2GQMA 4EO3A 1TK5B 3UJ1A 2MYGA 3BCKA 2CVDA 2AB6A 4ZILA 3KMNA 4ISDA 2KLXA 2VL2A 4H86A 4MA9A 3RPPA 4G0IA 5D96A 5ID2B 4N0ZA 4RQRA 5CRHA 1AXDA 4IKHA 4OWYA 3UMAA 3H1NA 1GNEA 3I9V2 2DJJA 2DIYA 3M9JA 2LJAA 3KGKA 2NVLA 5G1LA 1KTEA 2NBSA 1F2EA 2XBQA 3QPMA 4F0BA 4IHUA 2FWGA 4TR4A 4WR5A 2C1YA 2YV7A 1BAYA 1GSFA 4AF2A 5DQSA 3E3EA 2CV4A 3EC3A 4N30A 3H79A 2F9SA 1XBSA 3GL3A 1TXXA 4J56E 1PRXA 3GTUB 1VRSD 3IC8A 2FWFA 3ERWA 2LRTA 4TXOA 1F9MA 3DKSA 4CW9A 2FY6A 2KP2A 5BMUA 2JZSA 4XS6A 2LTKA 1R7HA 4KCEA 2H73A 4EL1A 3IRAA 3C1SA 3M1GA 5IMZA 2C0EA 4JEDA 2WB9A 1FVJA 3G7JA 4WF5A 2WDUA 5D8IA 2C8UA 4POMA 3DD3A 2ES7A 1OVNA 3KP9A 1S3CA 5G5FA 4GLTA 2JZTA 2H6ZA 5CRGA 1AQVA 5B7CA 2QGVA 5A4UA 3TKSE 1GTIA 1F3BA 2LS5A 3GUSA 4USSA 5DBQA 1O81A 4KSMA 1CQHA 2TRCP 5JWQB 1K0MA 1G6YA 2K8SA 1PGTA 1YZXA 3O6TA 1ZGNA 5KN1A 1USBA 2CA8A 1R26A 3PINA 4ULXA 10GSA 1UA5A 1R4WA 1PX7A 5INYA 4MJEA 4MH2A 2MZCA 5IPHA 2YJ7A 1SJ6A 1Y6EA 1HD2A 2H1GA 1SK0A 4EIQA 1JZOA 5ELAA 1H4OA 4HEA2 1AQXA 3A2XA 4ECCA 3ZTLA 2C0DA 3L9SA 2PVOC 3P7XA 4X4JA 1XZOA 1XW9A 1Z6MA 5J41A 4WBRD 2YWMA 4DSQA 1O85A 4ZL9A 2EIRA 18GSA 3RHCA 2GSSA 2NDOA 3KZQA 2O85A 5FHIA 1PL2A 1SL2B 4HJMA 3KM6A 1Z3EA 1TRVA 4HI7A 2CAQA 2LNSA 1TW9A 1XVWA 2MBSA 1OKTA 4F03A 1FO5A 3ME8A 1Y25A 2RM6A 2LEGA 2F51A 2I3YA 1Z9HA 2K18A 1GSDA 4ZB9A 3CQFA 3QDNA 3KTBA 2QKEA 1GSSA 2K6VA 1JZRA 1FOVA 3KMOA 2HE3A 5HR3A 1W4VA 1MDIA 1BEDA 1B9XC 3R3EA 2KUCA 2PVQA 2HSHA 4POKA 5DALA 4V1Ag 4D73B 2CVBA 1Z7RA 2P5RA 2F8AA 2FD3A 5KN0A 2WFCA 2XPDA 1NHYA 5J3RA 3D5JA 4Z2RA 1UVZA 1J0FA 1WP0A 4X0XA 2L6CA 2AV4A 3W8JA 5CNWA 3HXSA 3BOAA 3QCPA 5AIXA 3IOSA 4K0GA 3ZFBA 4IJIA 3N5OA 4KSOA 2GQKA 3CTFA 4TN8A 2IMEA 5EVOA 3LGCA 5IMDA 3CXGA 1EOHA 2GSTA 2N5AA 2DJ1A 1XG8A 2HZEB 5B8BA 2MMAA 4O5UA 4KX4A 1GSYA 3QMXA 1PMTA 3F0IA 3DWVA 2YJHA 1DSBA 3TRXA 2M80A 1PD21 2H19A 2H0HA 5ECLB 3TJJA 4BVXA 1GSEA 2IMFA 1SL1B 5FT3A 5H5SA 2OKAA 4MPFA 1TI1A 3ME7A 1Z7PA 6GSUA 3DXBA 4TXOB 2LV3A 1V57A 2YWIA 4KUNA 3F8UA 3SWLA 4XRDA 5IMCA 1JFUA 1G7EA 1PN0A 1DE2A 2YOIA 13GSA 2DSAA 4HZ2A 5ECMB 3TRQA 5HFKA 1LU4A 3IK7A 4I2UA 5LCZA 1ON4A 4KDUA 3IE3A 2H8LA 5JWOB 2DJ2A 2R0PA 2CVKA 5GSTA 2VD1A 1SYRA 4K9ZA 4GSSA 4WEYA 2V41A 5CRDA 3ERGA 3IC4A 1O8WA 4XHMA 5IMFA 4JZQA 1VF4A 5A4WA 3IXRA 3F3QA 2VCZA 1YEPA 3HCZA 1X9SB 2VCTA 4I8BA 4YQMA 1M2DA 3GTUA 1M2AA 4PNFA 5DCHA 2C4JA 3H8QA 2JL4A 1YKCA 2H71A 1OAZA 2UZ8A 2CZ3A 2HSYA 1Q98A 3FZ4A 4ACSA 4XS1A 3EINA 3MWHA 5G5EA 1HNBA 1FB0A 4I2TA 4NV2A 5BRTA 1M3JA 2QA2A 2L4QA 5CREA 4AGSA 3VWXA 4MDCA 3EMPA 1GH2A 1A24A 1KBNA 1Q4JA 2V6OA 1LBKA 1VF1A 1F37A 1GTAA 3O3TA 3E0UA 3FZ9A 4WR4A 4G0LA 2B5XA 3LG6A 3JCML 1TRSA 2C0FA 2WULA 3EWLA 3HZ8A 5F0GA 3F4RA 4DSRA 4POLA 5IO0A 4NHWA 3IR4A 3HD5A 4J57E 5J9BA 1PL1A 1WRYA 3KTLA 2R37A 4K7OA 1FW1A 2YCDA 2N5BA 4OO5A 3PPUA 3ZZXA 1A0RP 5COHA 4NPBA 5ECNB 3HJOA 1B4QA 4HU7A 1WE0A 4CDOA 1CQGA 2E0QA 2R4VA 1X5EA 5ECKB 3NZNA 1A8LA 22GSA 6GSTA 2X8GA 3HVNA 4FYUA 3I69A 5JCUA 16GSA 1GL8A 1GULA 2JZRA 2H01A 3L9UA 4WETA 3DIEA 3EU3A 1I5GA 4LL1B 4MK3A 5HR0A 4KCAA 3HHVA 4BL7B 1EV4A 1T8EB 1B9YC 2B6MA 2VL9A 2ZUPA 5DQYA 3J7Yk 3KH9A 1S3RA 3VLNA 4F2IA 7GSSA 3IAS2 1LJRA 4TVEA 3L4NA 1GNWA 1RQMA 2GT6A 1PFOA 6GSYA 5IQYA 2FCHA 3A5IA 1BJXA 3F4SA 3K8NA 4V2LA 1EOGA 4GF0A 3O76A 3LXTA 3PR8A 2OJLA 1XW6A 2LKUA 4GSTA 2OE0A 3ZVJA 3I43A 2WGRA 3ZREA 3GL5A 2V32A 2HZFA 4BA7A 2OADA 2E2GA 2YN1A 2R5GA 2YPMA 4FH8A 2GLRA 1PKZA 1URMA 2VL3A 4QL9A 1GUHA 1WOUA 2TRXA 2LQOA 2O87A 4KA0A 2G0FA 3TJBA 1THOA 2DIZA 4ECIA 1WMJA 1K0NA 1KEBA 4MF6A 4ZBDA 1M0UA 2E7PA 2HZEA 3EPTA 3ZIVA 3DRNA 2PN8A 3APSA 6GSXA 1A2JA 2CAIA 4OCEA 5AGYA 1NSWA 1WPIA 4XS4B 3ZYWA 2B5YA 5J4UA 2X8CA 2I4AA 2GZZA 4PUAA 4MF7A 2N5FA 1A2MA 1VF2A 2BTOT 2HRAA 5ECIB 5F06A 1ERWA 2BMXA 4IQ1A 3GSTA 1FOHA 3RAZA 3I6AA 4MMMA 4XTSA 4V2MA 4GQFA 4HU9A 1SD9A 3Q19A 2B1KA 3TDGA 4LA1A 1QFNA 2YP6A 1BG5A 1HNAA 4GCIA 2VCWA 4KF9A 4V2NA 3P2AA 1YDKA 2VCQA 1TTZA 3IK9A 3D4MA 5D9XA 2FNOA 2C0GA 2H76A 4PQHA 2C3NA 3A3TA 4HJ2A 3IAM2 1THXA 1O8XA 1N8JA 4IP1A 2DKHA 4PQIA 4Z7XA 5KOWA 1MTCA 3CSHA 1X5CA 2LQQA 3MSZA 4O5RA 3TGZA 4TW5A 2A4HA 3EMXA 1M3IA 11GSA 1SKWB 4HQZA 4ILFA 3QFAC 1FB6A 5DJMA 1QGVA 2HSMA 3W8SA 4YQVA 1GWCA 5IIZA 5H5QA 2JSZA 2DC5A 1K0DA 3GH6A 2H6YA 1SK2A 1BQ7A 3DVXA 2IL3A 2P0GA 4ZB6A 3U5RE 4L0WA 1K0CA 3LWAA 3GMFA 1ACVA 4N0VA 2DJ3A 1ZOFA 1SJIA 3TKQA 3J7Yb 3RBTA 1B8XA 3GRXA 3F9UA 3LXZA 2PERA 2OBIA 1TKDB 3P90A 4XRAA 1WIKA 2AYTA 4IBPA 2VLTA 4F9ZA 4JR6A 3LEFA 2NTOA 3D21A 1Z6NA 5CRWA 3C7MA 1XPVA 3MNGA 5ECSA 5KEJA 1AUCA 2H1DA 1SYXA 2H30A 3QFBC 4ZXGA 4MH3A 1GP1A 2BJXA 1ERUA 1GLPA 2B3SA 3HJMA 3FY7A 1MD4A 3DVWA 2VCVA 1YJ6A 3ZMKA 4HZ4A 1A2LA 2HRKA 2LJKA 2VO4A 5AN1A 4K5SA 5KN3A 1TU8A 2R0GA 1PX6A 3LYKA 3FR9A 4MABA 4EDZA 2A2SA 1RW1A 4MZCA 1EEJA 3CSJA 1IYIA 4WF4A 4MNNA 1J08A 1V58A 3VI5A 4TR1A 6GSWA 4J2FA 3FKFA 5E4WA 5JCWA 5ENUA 2MMNA 5J5NA 1R5PA 1TP9A 3UVTA 4BWQA 2ON7A 2PBJA 2OA7A 1R5AA 3ERFA 4QL7A 1PSQA 1EZKA 5A4VA 2JSYA 1ZL9A 1JZDA 4KNDA 4MJAA 5IMVA 1QK8A 2H66A 6GSVA 1YKAA 2OE1A 5JCGA 1S3DA 3F6DA 2DMLA 4HSCX 3V1WA 1X0RA 3M9KA 5D73A 2VLVA 5CAXA 4BL7A 2I81A 2OBKA 3LYPA 1B4PA 4O92A 4K5RA 5KOXA 5J9CA 3SBCA 1EP7A 1UC7A 1G6WA 3TKRA 2CX4A 4ECBA 3UOMA 2FWHA 3DEXA 3VFIA 3GX8A 2FWEA 2M46A 4XCSA 2GSRA 1C72A 2AUVA 1MEKA 4RQXA 4NHZA 5E59A 2R3XA 4K0NA 3FEUA 3WGDA 5IOWA 3W6GA 1NW2A 4IQAA 2KP1A 1T4YA 4O5QA 3F63A 3QAVA 3LSZA 3KXOA 4LL4B 1EGRA 4WKWA 4CY8A 1MDJA 3CMIA 3QD9A 4MCUA 4PQ1A 2F3MA 3BJ5A 2KOKA 2GQLA 4K2XA 2CZ2A 3GURA 5EY6A 1NM3A 1M9BA 2XHFA 1G7OA 4Q5RA 4ZBAA 5LD0A 3KH7A 1B48A 1G0TA 3WGEA 3WGXA 1HQOA 3DMLA 2ZNMA 3VWVA 1A23A 3WT1A 3GKXA 2L5LA 2LNTA 5DCGA 3GYKA 1ZYNA 2R0CA 4OFNA 4WXTA 4LMWA 4K7NA 1K3YA 5EL8A 4XS4A 2ZCTA 1OC9A 4YAPA 3IHQA 3GV1A 1GUMA 1ZZYA 2D2ZA 2X99A 3Q6OA 1O7UA 3GSSA 4JE1A 4IVFA 1PN9A 3MDKA 2DMMA 2JU5A 1SKSB 3HYPA 2XC2A 1W89A 1PA3A 4GWRA 4PGTA 3CRUA 1ZCPA 4EKZA 3HA9A 2ALBA 3ED3A 4TKYA 3KJYA 2H74A 4PTSA 3VK9A 5AIVA 2HNLA 2V2GA 3EURA 1T1VA 2J23A 3PH9A 5ECRB 5DVBA 1S3AA 5HFIA 2A4VA 1BYEA 1M9AA 3QOUA 3ZITA 4GSNA 4YQUA 4YKGA 1T4ZA 3HKRA 4NV5A 4Z2UA 3GFKA 1XWKA 17GSA 4KDYA 1DE1A 1M99A 1K0AA 1K0OA 1OE7A 2VLUA 3KCMA 4E8HA 2VOCA 1YF1A 4L5LA 1AQWA 3F6FA 1O73A 1XVQA 4TR1B 2RIIA 4KH7A 1U3AA 1E2YA 3ZLPA 3H93A 1TRWA 4IW9A 2FA4A 3FHKA 2L4CA 2GT5A 3PGTA 3H4KA 3TKPA 3CRTA 3TKSC 1VF3A 2WCIA 4EVMA 1K0BA 4X1UA 2WS2A 1V9WA 20GSA 3CYNA 4OCFA 3LORA 2GS3A 4OMVA 1XWGA 5JWRB 4ML1A 1JHBA 3ZL5A 3VURA 3U6VA 1K3LA 4GRFA 3TOTA 2B1LA 4EE0A 5C00A 2B7KA 3M3MA 3GKNA 4OFMA 4HQSA 1OYJA 4AJ7A 4K6XA 2IPAA 1XOAA 4LMVA 3KEBA 1UN2A 2GZYA 2V1MA 4ML6A 2LJRA 2YZHA 4V1Ap 4KDXA 4FYCA 2H75A 4EXJA 3GX0A 4ZL7A 3P8WA 4HOJA 2FHEA 4TOPA 2VM1A 1AW9A 1HNCA 5IO2A 4EIPA 3M8NA 4K1FA 2RUFA 2P31A 3HJPA 1YQ1A 4ZB8A 4L8EA 4F0CA 3FZAA 3L78A 4N11A 1ILOA 4TR0A 3F3RA 1YEXA 5A5KA 4LLRA 1Z5YE 2H0IA 4JBBA 4RI7A 1V40A 2EIQA 1ZYPA 1GLQA 3MIXA 3D6IA 3KP8A 4EDYA 3US3A 3FMWA 3QR6A 5ECPB 1A0FA 1ST9A 8GSSA 1SK1A 3EVIA 4NMUA 1KNGA 2AAWA 4K8MA 1JLWA 4YAVA 2O89A 5AISA 5GZZB 1F6MC 2HRFA 4AJ6A 2HXKA 5HQPA 4FQUA 2VM2A 1QUWA 3ZIJA 1QMVA 2PU9C 5D9WA 1OC9B 2XBIA 2YWOA 4CHSA 2LRNA 5IM9A 1EWXA 3A2VA 3IDVA 4F82A 1H75A 4MPGA 1TK8B 4DVCA 3S9FA 5G2ZA 4KAEA 4I6XA 2IJYA 2REMA 2CQ9A 9GSSA 2EC4A 3ZVJD 1I9DA 4OFTA 5GSSA 5HR2A 5IMAA 1XOBA 3WT2A 2K8VA 1OC3A 1V98A 3TRPA 12GSA 3HDCA 1U3IA 5F07A 3KD0A 5G30A 3A5WA 2VIMA 2IN3A 4EF0A 1U87A 3UIWA 2GGTA 2AJQB 3BD2A 3TJGA 2WRTA 3GHAA 4O7HA 4NWYA 4HDEA 3UL3A 14GSA 2YNXA 2RLIA 1U6TA 4ECJA 4G2EA 1ML6A 4EUYA 2YV9A 4PNGA 1TJDA 3C8EA 2X49A 5ECHB 2LSTA 2IIYA 2OACA 5CO3A 4TRXA 4P3YB 1FVKA 3UEMA 2IMIA 4BVYB 3EU4A 3IHGA 4JRRA 4IS0A 4Q5NA 2H6XA 2MMOA 2VD0A 4E8EA 1O6JA 2YANA 2P5QA 1BX9A 5DAKB 3RDWA 3APOA 3D22A 3TOUA 2DBCA 5H5RA 2JADA 3L9VA 3UAPA 1YF0A 1TOFA 3CSIA 1SD8A 2GSQA 2B5EA 2X4AA 1TU7A 1J9BA 4L0UA 5D9VA 2PPTA 3GIXA 4GXZA 2B7JA 5IPGA 1YY7A 4WBJA 4EC0A 1JZWA 1ABAA 5G1KA 2L6DA 2DLXA 2DJKA 3D4TA 1QQ2A 2GDRA 2RM5A 2L5OA 4O32A 3HVVA 3Q74A 2IFQB 2I1UA 1SKRB 3GN3A 3GKMA 4YH2A 4ZL8A 4G9HA 4L5OA 3HY2A 1F3AA 2C3TA 4ICYA 4OD7A 1WJKA 3VPTA 2CX3A 5B6NA 2I9HA 3LW9A 1HYUA 2K9FA 3NOFA 4I5QA 2QA1A 2H70A 1T00A 4DSSB 2C80A 1XW5A 2HRNA 2O8VB 2PMTA 3TJKA 1XIYA 3DYRA 4GQCA 2H0GA 2V6KA 3C73A 4RI6A 1AAZA 5C04A 2VCXA 2R6KA 4IN0A 4QQ7A 3AY8A 1TDIA 4MZBA 2QC7A 3E9JB 2LUSA 3CTGA 2WJUA 1XCCA 4TR3A 1M2BA 5EPFA 2LRCA 1TK0B 3QAWA 1FAAA 3EYTA 1XWBA 2J9HA 2MBTA 3Q18A 2H1AA 2DKIA 3KIJA 3UBKA 3DGQA 4MF5A 1GSUA 4KGIA 5CP1A 2R2JA 3G9BA 5F8BA 4NAXA 2RUEA 1DUGA 2HI7A 4G0KA 3MYDA 3UBLA 2HLSA 3ISOA 3TCOA 2QSIA 4RUVA 2ON5A 4KB3A 2O7KA 3GNJA 2NPBA 2A2RA 4MJCA 3FR3A 4PUFC 5HFGA 1XWAA 3APQA 4N10A 3ZRDA 3UVHA 1T7PB 3D0ZA 1FG4A 2CT6A 3UARA 3IPZA 5B8AA 1N2AA 3N9JA 3FK8A 3WD6A 4MZWA 4Q5QA 3C71A 19GSA 1EEMA 2XPEA 5ECOB 2AHEA 4FO5A 3L0HA 4ZIJA 1AIUA 1GTUA 1ERTA 4KE3A 3EE2A 3TB2A 5ID2A 2HFDA 1V2AA 4NXIA 3F4TA 2PGTA 5DDLA 5D9TA 4TXVA 1EGOA 4BWSA 3C1RA 2A2PA 4HS1A 3RPNA 1X5DA 3IA1A 1QXHA 3BBYA 3G7IA 3R2QA 3FYGA 5IOXA 1GRXA 1EV9A 1OC8A 2FGXA 1GTBA 4X43A 1FHEA 3ZMLA 5CYYA 5B6MA 1ERVA 4HUAA 3LJRA 2Z9SA 1DBYA 2C3QA 4YKFA 2TIRA 1IYHA 4K7IA 3FW2A 2MMZA 4BPYA 1SENA 3LFLA 1MD3A 2OE3A 4PX1A 3GKKA 3FRCA 4ID0A 4JU5A 5GAND 5ELGA 3HZ4A 2KHPA 3BCIA 3IBHA 4A5PA 4MLYA 4OO4A 4K2DA 5L71A 3WYWA 1E6BA 3M0FA 2EIOA 1U88A 3ZFLA 4ZBBA 1MDKA 4GTUA 1NHOA 1TRUA 4I97A 1XFLA 1SJZA 4IP6A 5ABRA 1XXUA 1RK4A 3GH9A 5F05A 4BVYA 1WWJA 4BIKA 4G19A 2DJ0A 1EP8A 5GAPD 1OKDA 2IWTA 5DAKA 3A2WA 3FR6A 3HVXA 4POBA 5G31A 1M7TA 4G10A 2YWNA 2VAFA 4XIHA 3GA4A 5ECQB 1PQNA 2X8HA
chains in the Genus database with same CATH topology
2E2MA 3G7YA 5DJLA 1XWCA 1X9WB 4IJ3A 4KW6A 3HVSA 4PURA 1GUKA 3OR5A 4IELA 2FLSA 2X64A 2FUG2 4PXOA 2FA8A 2GTUA 5DALB 5HR1A 3VPQA 4FIWA 3NIVA 1ZYEA 3RHBA 2IMKA 1OE8A 2WZ9A 3TJFA 5KN2A 4MP4A 5FWGA 4MJBA 2H1BA 3IV4A 1ZYQB 1A8YA 3LQ7A 2IFQA 4AJ8A 5D93A 2HYXA 1SU9A 1X9MB 2L57A 2PWJA 4Z2TA 1T3BA 4JR4A 2GVPA 2VL2C 2H72A 1TI3A 2L59A 2PUKC 1GSQA 3MAKA 2F8FA 3TKSA 4DEJA 1AC1A 4DSSA 4FYBA 1ZMAA 6GSSA 2GZPA 2G2QA 2VUPA 3VWWA 1K3OA 1VGLA 4BVXB 4IGJA 3CBUA 3VWUA 1PKWA 4CY6A 2JACA 2M72A 2IMDA 4Q5FA 1SL0B 3TUEA 3FZ5A 3VI7A 5LNKe 1JLVA 4D73A 2YZUA 2HT9A 3QAGA 2GQMA 4EO3A 1TK5B 3UJ1A 2MYGA 3BCKA 2CVDA 2AB6A 4ZILA 3KMNA 4ISDA 2KLXA 2VL2A 4H86A 4MA9A 3RPPA 4G0IA 5D96A 5ID2B 4N0ZA 4RQRA 5CRHA 1AXDA 4IKHA 4OWYA 3UMAA 3H1NA 1GNEA 3I9V2 2DJJA 2DIYA 3M9JA 2LJAA 3KGKA 2NVLA 5G1LA 1KTEA 2NBSA 1F2EA 2XBQA 3QPMA 4F0BA 4IHUA 2FWGA 4TR4A 4WR5A 2C1YA 2YV7A 1BAYA 1GSFA 4AF2A 5DQSA 3E3EA 2CV4A 3EC3A 4N30A 3H79A 2F9SA 1XBSA 3GL3A 1TXXA 4J56E 1PRXA 3GTUB 1VRSD 3IC8A 2FWFA 3ERWA 2LRTA 4TXOA 1F9MA 3DKSA 4CW9A 2FY6A 2KP2A 5BMUA 2JZSA 4XS6A 2LTKA 1R7HA 4KCEA 2H73A 4EL1A 3IRAA 3C1SA 3M1GA 5IMZA 2C0EA 4JEDA 2WB9A 1FVJA 3G7JA 4WF5A 2WDUA 5D8IA 2C8UA 4POMA 3DD3A 2ES7A 1OVNA 3KP9A 1S3CA 5G5FA 4GLTA 2JZTA 2H6ZA 5CRGA 1AQVA 5B7CA 2QGVA 5A4UA 3TKSE 1GTIA 1F3BA 2LS5A 3GUSA 4USSA 5DBQA 1O81A 4KSMA 1CQHA 2TRCP 5JWQB 1K0MA 1G6YA 2K8SA 1PGTA 1YZXA 3O6TA 1ZGNA 5KN1A 1USBA 2CA8A 1R26A 3PINA 4ULXA 10GSA 1UA5A 1R4WA 1PX7A 5INYA 4MJEA 4MH2A 2MZCA 5IPHA 2YJ7A 1SJ6A 1Y6EA 1HD2A 2H1GA 1SK0A 4EIQA 1JZOA 5ELAA 1H4OA 4HEA2 1AQXA 3A2XA 4ECCA 3ZTLA 2C0DA 3L9SA 2PVOC 3P7XA 4X4JA 1XZOA 1XW9A 1Z6MA 5J41A 4WBRD 2YWMA 4DSQA 1O85A 4ZL9A 2EIRA 18GSA 3RHCA 2GSSA 2NDOA 3KZQA 2O85A 5FHIA 1PL2A 1SL2B 4HJMA 3KM6A 1Z3EA 1TRVA 4HI7A 2CAQA 2LNSA 1TW9A 1XVWA 2MBSA 1OKTA 4F03A 1FO5A 3ME8A 1Y25A 2RM6A 2LEGA 2F51A 2I3YA 1Z9HA 2K18A 1GSDA 4ZB9A 3QDNA 3KTBA 2QKEA 1GSSA 2K6VA 1JZRA 1FOVA 3KMOA 2HE3A 5HR3A 1W4VA 1MDIA 1BEDA 1B9XC 3R3EA 2KUCA 2PVQA 2HSHA 4POKA 5DALA 4V1Ag 4D73B 2CVBA 1Z7RA 2P5RA 2F8AA 2FD3A 5KN0A 2WFCA 2XPDA 1NHYA 5J3RA 3D5JA 4Z2RA 1UVZA 1J0FA 1WP0A 4X0XA 2L6CA 2AV4A 3W8JA 5CNWA 3HXSA 3BOAA 3QCPA 5AIXA 3IOSA 4K0GA 3ZFBA 4IJIA 3N5OA 4KSOA 2GQKA 3CTFA 4TN8A 2IMEA 5EVOA 3LGCA 5IMDA 3CXGA 1EOHA 2GSTA 2N5AA 2DJ1A 2HZEB 5B8BA 2MMAA 4O5UA 4KX4A 1GSYA 3QMXA 1PMTA 3F0IA 3DWVA 2YJHA 1DSBA 3TRXA 2M80A 1PD21 2H19A 2H0HA 5ECLB 3TJJA 4BVXA 1GSEA 2IMFA 1SL1B 5FT3A 5H5SA 2OKAA 4MPFA 1TI1A 3ME7A 1Z7PA 6GSUA 3DXBA 4TXOB 2LV3A 1V57A 2YWIA 4KUNA 3F8UA 3SWLA 4XRDA 5IMCA 1JFUA 1G7EA 1PN0A 1DE2A 2YOIA 13GSA 2DSAA 4HZ2A 5ECMB 3TRQA 5HFKA 1LU4A 3IK7A 4I2UA 5LCZA 1ON4A 4KDUA 3IE3A 2H8LA 5JWOB 2DJ2A 2R0PA 2CVKA 5GSTA 2VD1A 1SYRA 4K9ZA 4GSSA 4WEYA 2V41A 5CRDA 3ERGA 3IC4A 1O8WA 4XHMA 5IMFA 4JZQA 1VF4A 5A4WA 3IXRA 3F3QA 2VCZA 1YEPA 3HCZA 1X9SB 2VCTA 4I8BA 4YQMA 1M2DA 3GTUA 1M2AA 4PNFA 5DCHA 2C4JA 3H8QA 2JL4A 1YKCA 2H71A 1OAZA 2UZ8A 2CZ3A 2HSYA 1Q98A 3FZ4A 4ACSA 4XS1A 3EINA 3MWHA 5G5EA 1HNBA 1FB0A 4I2TA 4NV2A 5BRTA 2QA2A 2L4QA 5CREA 4AGSA 3VWXA 4MDCA 3EMPA 1GH2A 1A24A 1KBNA 1Q4JA 2V6OA 1LBKA 1VF1A 1F37A 1GTAA 3O3TA 3E0UA 3FZ9A 4WR4A 4G0LA 2B5XA 3LG6A 3JCML 1TRSA 2C0FA 2WULA 3EWLA 3HZ8A 5F0GA 3F4RA 4DSRA 4POLA 5IO0A 4NHWA 3IR4A 3HD5A 4J57E 5J9BA 1PL1A 1WRYA 3KTLA 2R37A 4K7OA 1FW1A 2YCDA 2N5BA 4OO5A 3PPUA 3ZZXA 1A0RP 5COHA 4NPBA 5ECNB 3HJOA 1B4QA 4HU7A 1WE0A 4CDOA 1CQGA 2E0QA 2R4VA 1X5EA 5ECKB 3NZNA 1A8LA 22GSA 6GSTA 2X8GA 4FYUA 3I69A 5JCUA 16GSA 1GL8A 1GULA 2JZRA 2H01A 3L9UA 4WETA 3DIEA 3EU3A 1I5GA 4LL1B 4MK3A 5HR0A 4KCAA 3HHVA 4BL7B 1EV4A 1T8EB 1B9YC 2B6MA 2VL9A 2ZUPA 5DQYA 3J7Yk 3KH9A 3VLNA 4F2IA 7GSSA 3IAS2 1LJRA 4TVEA 3L4NA 1GNWA 1RQMA 2GT6A 6GSYA 5IQYA 2FCHA 3A5IA 1BJXA 3F4SA 3K8NA 4V2LA 1EOGA 4GF0A 3O76A 3LXTA 3PR8A 2OJLA 1XW6A 2LKUA 4GSTA 2OE0A 3ZVJA 3I43A 2WGRA 3ZREA 3GL5A 2V32A 2HZFA 4BA7A 2OADA 2E2GA 2YN1A 2R5GA 2YPMA 4FH8A 2GLRA 1PKZA 1URMA 2VL3A 4QL9A 1GUHA 1WOUA 2TRXA 2LQOA 2O87A 4KA0A 2G0FA 3TJBA 1THOA 2DIZA 4ECIA 1WMJA 1K0NA 1KEBA 4MF6A 4ZBDA 1M0UA 2E7PA 2HZEA 3EPTA 3ZIVA 3DRNA 2PN8A 3APSA 6GSXA 1A2JA 2CAIA 4OCEA 5AGYA 1NSWA 1WPIA 4XS4B 3ZYWA 2B5YA 5J4UA 2X8CA 2I4AA 2GZZA 4PUAA 4MF7A 2N5FA 1A2MA 1VF2A 2BTOT 2HRAA 5ECIB 5F06A 1ERWA 2BMXA 4IQ1A 3GSTA 1FOHA 3RAZA 3I6AA 4MMMA 4XTSA 4V2MA 4GQFA 4HU9A 1SD9A 3Q19A 2B1KA 3TDGA 4LA1A 1QFNA 2YP6A 1BG5A 1HNAA 4GCIA 2VCWA 4KF9A 4V2NA 3P2AA 1YDKA 2VCQA 1TTZA 3IK9A 3D4MA 5D9XA 2FNOA 2C0GA 2H76A 4PQHA 2C3NA 3A3TA 4HJ2A 3IAM2 1THXA 1O8XA 1N8JA 4IP1A 2DKHA 4PQIA 4Z7XA 5KOWA 1MTCA 3CSHA 1X5CA 2LQQA 3MSZA 4O5RA 3TGZA 4TW5A 2A4HA 3EMXA 11GSA 1SKWB 4HQZA 4ILFA 3QFAC 1FB6A 5DJMA 1QGVA 2HSMA 3W8SA 4YQVA 1GWCA 5IIZA 5H5QA 2JSZA 2DC5A 1K0DA 3GH6A 2H6YA 1SK2A 1BQ7A 3DVXA 2IL3A 2P0GA 4ZB6A 3U5RE 4L0WA 1K0CA 3LWAA 3GMFA 1ACVA 4N0VA 2DJ3A 1ZOFA 1SJIA 3TKQA 3J7Yb 3RBTA 1B8XA 3GRXA 3F9UA 3LXZA 2PERA 2OBIA 1TKDB 3P90A 4XRAA 1WIKA 2AYTA 4IBPA 2VLTA 4F9ZA 4JR6A 3LEFA 2NTOA 3D21A 1Z6NA 5CRWA 3C7MA 1XPVA 3MNGA 5ECSA 5KEJA 1AUCA 2H1DA 1SYXA 2H30A 3QFBC 4ZXGA 4MH3A 1GP1A 2BJXA 1ERUA 1GLPA 2B3SA 3HJMA 3FY7A 1MD4A 3DVWA 2VCVA 1YJ6A 3ZMKA 4HZ4A 1A2LA 2HRKA 2LJKA 2VO4A 5AN1A 4K5SA 5KN3A 1TU8A 2R0GA 1PX6A 3LYKA 3FR9A 4MABA 4EDZA 2A2SA 1RW1A 4MZCA 1EEJA 3CSJA 1IYIA 4WF4A 4MNNA 1J08A 1V58A 3VI5A 4TR1A 6GSWA 4J2FA 3FKFA 5E4WA 5JCWA 5ENUA 2MMNA 5J5NA 1R5PA 1TP9A 3UVTA 4BWQA 2ON7A 2PBJA 2OA7A 1R5AA 3ERFA 4QL7A 1PSQA 1EZKA 5A4VA 2JSYA 1ZL9A 1JZDA 4KNDA 4MJAA 5IMVA 1QK8A 2H66A 6GSVA 1YKAA 2OE1A 5JCGA 1S3DA 3F6DA 2DMLA 3V1WA 1X0RA 3M9KA 5D73A 2VLVA 5CAXA 4BL7A 2I81A 2OBKA 3LYPA 1B4PA 4O92A 4K5RA 5KOXA 5J9CA 3SBCA 1EP7A 1UC7A 1G6WA 3TKRA 2CX4A 4ECBA 3UOMA 2FWHA 3DEXA 3VFIA 3GX8A 2FWEA 2M46A 4XCSA 2GSRA 1C72A 2AUVA 1MEKA 4RQXA 4NHZA 5E59A 2R3XA 4K0NA 3FEUA 3WGDA 5IOWA 3W6GA 1NW2A 4IQAA 2KP1A 1T4YA 4O5QA 3F63A 3QAVA 3LSZA 3KXOA 4LL4B 1EGRA 4WKWA 4CY8A 1MDJA 3CMIA 3QD9A 4MCUA 4PQ1A 2F3MA 3BJ5A 2KOKA 2GQLA 4K2XA 2CZ2A 3GURA 5EY6A 1NM3A 1M9BA 2XHFA 1G7OA 4Q5RA 4ZBAA 5LD0A 3KH7A 1B48A 1G0TA 3WGEA 3WGXA 1HQOA 3DMLA 2ZNMA 3VWVA 1A23A 3WT1A 3GKXA 2L5LA 2LNTA 5DCGA 3GYKA 1ZYNA 2R0CA 4OFNA 4WXTA 4LMWA 4K7NA 1K3YA 5EL8A 4XS4A 2ZCTA 1OC9A 4YAPA 3IHQA 3GV1A 1GUMA 1ZZYA 2D2ZA 2X99A 3Q6OA 1O7UA 3GSSA 4JE1A 4IVFA 1PN9A 3MDKA 2DMMA 2JU5A 1SKSB 3HYPA 2XC2A 1W89A 1PA3A 4GWRA 4PGTA 3CRUA 1ZCPA 4EKZA 3HA9A 2ALBA 3ED3A 4TKYA 3KJYA 2H74A 4PTSA 3VK9A 5AIVA 2HNLA 2V2GA 3EURA 1T1VA 2J23A 3PH9A 5ECRB 5DVBA 1S3AA 5HFIA 2A4VA 1BYEA 1M9AA 3QOUA 3ZITA 4GSNA 4YQUA 4YKGA 1T4ZA 3HKRA 4NV5A 4Z2UA 3GFKA 1XWKA 17GSA 4KDYA 1DE1A 1M99A 1K0AA 1K0OA 1OE7A 2VLUA 3KCMA 4E8HA 2VOCA 1YF1A 4L5LA 1AQWA 3F6FA 1O73A 1XVQA 4TR1B 2RIIA 4KH7A 1U3AA 1E2YA 3ZLPA 3H93A 1TRWA 4IW9A 2FA4A 3FHKA 2L4CA 2GT5A 3PGTA 3H4KA 3TKPA 3CRTA 3TKSC 1VF3A 2WCIA 4EVMA 1K0BA 4X1UA 2WS2A 1V9WA 20GSA 3CYNA 4OCFA 3LORA 2GS3A 4OMVA 1XWGA 5JWRB 4ML1A 1JHBA 3ZL5A 3VURA 3U6VA 1K3LA 4GRFA 3TOTA 2B1LA 4EE0A 5C00A 2B7KA 3M3MA 3GKNA 4OFMA 4HQSA 1OYJA 4AJ7A 4K6XA 2IPAA 1XOAA 4LMVA 3KEBA 1UN2A 2GZYA 2V1MA 4ML6A 2LJRA 2YZHA 4V1Ap 4KDXA 4FYCA 2H75A 4EXJA 3GX0A 4ZL7A 3P8WA 4HOJA 2FHEA 4TOPA 2VM1A 1AW9A 1HNCA 5IO2A 4EIPA 3M8NA 4K1FA 2RUFA 2P31A 3HJPA 1YQ1A 4ZB8A 4L8EA 4F0CA 3FZAA 3L78A 4N11A 1ILOA 4TR0A 3F3RA 1YEXA 5A5KA 4LLRA 1Z5YE 2H0IA 4JBBA 4RI7A 1V40A 2EIQA 1ZYPA 1GLQA 3MIXA 3D6IA 3KP8A 4EDYA 3US3A 3FMWA 3QR6A 5ECPB 1A0FA 1ST9A 8GSSA 1SK1A 3EVIA 4NMUA 1KNGA 2AAWA 4K8MA 1JLWA 4YAVA 2O89A 5AISA 5GZZB 1F6MC 2HRFA 4AJ6A 2HXKA 5HQPA 4FQUA 2VM2A 1QUWA 3ZIJA 1QMVA 2PU9C 5D9WA 1OC9B 2XBIA 2YWOA 4CHSA 2LRNA 5IM9A 1EWXA 3A2VA 3IDVA 4F82A 1H75A 4MPGA 1TK8B 4DVCA 3S9FA 5G2ZA 4KAEA 4I6XA 2IJYA 2REMA 2CQ9A 9GSSA 2EC4A 3ZVJD 1I9DA 4OFTA 5GSSA 5HR2A 5IMAA 1XOBA 3WT2A 2K8VA 1OC3A 1V98A 3TRPA 12GSA 3HDCA 1U3IA 5F07A 3KD0A 5G30A 3A5WA 2VIMA 2IN3A 4EF0A 1U87A 3UIWA 2GGTA 2AJQB 3BD2A 3TJGA 2WRTA 3GHAA 4O7HA 4NWYA 4HDEA 3UL3A 14GSA 2YNXA 2RLIA 1U6TA 4ECJA 4G2EA 1ML6A 4EUYA 2YV9A 4PNGA 1TJDA 3C8EA 2X49A 5ECHB 2LSTA 2IIYA 2OACA 5CO3A 4TRXA 4P3YB 1FVKA 3UEMA 2IMIA 4BVYB 3EU4A 3IHGA 4JRRA 4IS0A 4Q5NA 2H6XA 2MMOA 2VD0A 4E8EA 1O6JA 2YANA 2P5QA 1BX9A 5DAKB 3RDWA 3APOA 3D22A 3TOUA 2DBCA 5H5RA 2JADA 3L9VA 3UAPA 1YF0A 1TOFA 3CSIA 1SD8A 2GSQA 2B5EA 2X4AA 1TU7A 1J9BA 4L0UA 5D9VA 2PPTA 3GIXA 4GXZA 2B7JA 5IPGA 1YY7A 4WBJA 4EC0A 1JZWA 1ABAA 5G1KA 2L6DA 2DLXA 2DJKA 3D4TA 1QQ2A 2GDRA 2RM5A 2L5OA 4O32A 3HVVA 3Q74A 2IFQB 2I1UA 1SKRB 3GN3A 3GKMA 4YH2A 4ZL8A 4G9HA 4L5OA 3HY2A 1F3AA 2C3TA 4ICYA 4OD7A 1WJKA 3VPTA 2CX3A 5B6NA 2I9HA 3LW9A 1HYUA 2K9FA 3NOFA 4I5QA 2QA1A 2H70A 1T00A 4DSSB 2C80A 1XW5A 2HRNA 2O8VB 2PMTA 3TJKA 1XIYA 3DYRA 4GQCA 2H0GA 2V6KA 3C73A 4RI6A 1AAZA 5C04A 2VCXA 2R6KA 4IN0A 4QQ7A 3AY8A 1TDIA 4MZBA 2QC7A 3E9JB 2LUSA 3CTGA 2WJUA 1XCCA 4TR3A 1M2BA 5EPFA 2LRCA 1TK0B 3QAWA 1FAAA 3EYTA 1XWBA 2J9HA 2MBTA 3Q18A 2H1AA 2DKIA 3KIJA 3UBKA 3DGQA 4MF5A 1GSUA 4KGIA 5CP1A 2R2JA 3G9BA 5F8BA 4NAXA 2RUEA 1DUGA 2HI7A 4G0KA 3MYDA 3UBLA 2HLSA 3ISOA 3TCOA 2QSIA 4RUVA 2ON5A 4KB3A 2O7KA 3GNJA 2NPBA 2A2RA 4MJCA 3FR3A 4PUFC 5HFGA 1XWAA 3APQA 4N10A 3ZRDA 3UVHA 1T7PB 3D0ZA 1FG4A 2CT6A 3UARA 3IPZA 5B8AA 1N2AA 3N9JA 3FK8A 3WD6A 4MZWA 4Q5QA 3C71A 19GSA 1EEMA 2XPEA 5ECOB 2AHEA 4FO5A 3L0HA 4ZIJA 1AIUA 1GTUA 1ERTA 4KE3A 3EE2A 3TB2A 5ID2A 2HFDA 1V2AA 4NXIA 3F4TA 2PGTA 5DDLA 5D9TA 4TXVA 1EGOA 4BWSA 3C1RA 2A2PA 4HS1A 3RPNA 1X5DA 3IA1A 1QXHA 3BBYA 3G7IA 3R2QA 3FYGA 5IOXA 1GRXA 1EV9A 1OC8A 2FGXA 1GTBA 4X43A 1FHEA 3ZMLA 5CYYA 5B6MA 1ERVA 4HUAA 3LJRA 2Z9SA 1DBYA 2C3QA 4YKFA 2TIRA 1IYHA 4K7IA 3FW2A 2MMZA 4BPYA 1SENA 3LFLA 1MD3A 2OE3A 4PX1A 3GKKA 3FRCA 4ID0A 4JU5A 5GAND 5ELGA 3HZ4A 2KHPA 3BCIA 3IBHA 4A5PA 4MLYA 4OO4A 4K2DA 5L71A 3WYWA 1E6BA 3M0FA 2EIOA 1U88A 3ZFLA 4ZBBA 1MDKA 4GTUA 1NHOA 1TRUA 4I97A 1XFLA 1SJZA 4IP6A 5ABRA 1XXUA 1RK4A 3GH9A 5F05A 4BVYA 1WWJA 4G19A 2DJ0A 1EP8A 5GAPD 1OKDA 2IWTA 5DAKA 3A2WA 3FR6A 3HVXA 4POBA 5G31A 1M7TA 4G10A 2YWNA 2VAFA 4XIHA 3GA4A 5ECQB 1PQNA 2X8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2M A;  3G7Y A;  5DJL A;  1XWC A;  1X9W B;  4IJ3 A;  4KW6 A;  3HVS A;  4PUR A;  1GUK A;  3OR5 A;  4IEL A;  2FLS A;  2X64 A;  2FUG 2;  4PXO A;  2FA8 A;  2GTU A;  5DAL B;  5HR1 A;  3VPQ A;  4FIW A;  3NIV A;  1ZYE A;  3RHB A;  2IMK A;  1OE8 A;  2WZ9 A;  3TJF A;  5KN2 A;  4MP4 A;  5FWG A;  4MJB A;  2H1B A;  3IV4 A;  1ZYQ B;  1A8Y A;  3LQ7 A;  2IFQ A;  4AJ8 A;  5D93 A;  2HYX A;  1SU9 A;  1X9M B;  2L57 A;  2PWJ A;  1T3B A;  4JR4 A;  2GVP A;  2VL2 C;  2H72 A;  1TI3 A;  2L59 A;  2PUK C;  1GSQ A;  3MAK A;  2F8F A;  3TKS A;  4DEJ A;  1AC1 A;  4DSS A;  4FYB A;  1ZMA A;  6GSS A;  2GZP A;  2G2Q A;  2VUP A;  3VWW A;  1K3O A;  1VGL A;  4IGJ A;  3CBU A;  3VWU A;  1PKW A;  2JAC A;  2M72 A;  2IMD A;  4Q5F A;  1SL0 B;  3TUE A;  3FZ5 A;  3VI7 A;  5LNK e;  1JLV A;  4D73 A;  2YZU A;  2HT9 A;  3QAG A;  2GQM A;  4EO3 A;  1TK5 B;  3UJ1 A;  2MYG A;  3BCK A;  2CVD A;  2AB6 A;  4ZIL A;  3KMN A;  4ISD A;  2KLX A;  2VL2 A;  4H86 A;  4MA9 A;  3RPP A;  5D96 A;  5ID2 B;  4N0Z A;  4RQR A;  5CRH A;  1AXD A;  4IKH A;  4OWY A;  3UMA A;  3H1N A;  1GNE A;  3I9V 2;  2DJJ A;  2DIY A;  3M9J A;  2LJA A;  3KGK A;  2NVL A;  5G1L A;  1KTE A;  2NBS A;  1F2E A;  2XBQ A;  3QPM A;  4F0B A;  4IHU A;  2FWG A;  4TR4 A;  4WR5 A;  2C1Y A;  2YV7 A;  1BAY A;  1GSF A;  4AF2 A;  5DQS A;  3E3E A;  2CV4 A;  3EC3 A;  4N30 A;  3H79 A;  2F9S A;  1XBS A;  3GL3 A;  1TXX A;  4J56 E;  1PRX A;  3GTU B;  1VRS D;  2FWF A;  3ERW A;  2LRT A;  4TXO A;  1F9M A;  3DKS A;  4CW9 A;  2FY6 A;  2KP2 A;  2JZS A;  4XS6 A;  2LTK A;  1R7H A;  4KCE A;  2H73 A;  4EL1 A;  3IRA A;  3C1S A;  3M1G A;  5IMZ A;  2C0E A;  4JED A;  2WB9 A;  1FVJ A;  3G7J A;  4WF5 A;  2WDU A;  5D8I A;  2C8U A;  4POM A;  3DD3 A;  2ES7 A;  1OVN A;  3KP9 A;  1S3C A;  5G5F A;  4GLT A;  2JZT A;  2H6Z A;  5CRG A;  1AQV A;  5B7C A;  2QGV A;  5A4U A;  3TKS E;  1GTI A;  1F3B A;  2LS5 A;  3GUS A;  5DBQ A;  1O81 A;  4KSM A;  1CQH A;  2TRC P;  5JWQ B;  1K0M A;  1G6Y A;  2K8S A;  1PGT A;  1YZX A;  3O6T A;  1ZGN A;  5KN1 A;  1USB A;  2CA8 A;  1R26 A;  3PIN A;  4ULX A;  10GS A;  1UA5 A;  1R4W A;  1PX7 A;  5INY A;  4MJE A;  4MH2 A;  2MZC A;  5IPH A;  2YJ7 A;  1SJ6 A;  1Y6E A;  1HD2 A;  2H1G A;  1SK0 A;  1JZO A;  5ELA A;  1H4O A;  4HEA 2;  1AQX A;  3A2X A;  4ECC A;  3ZTL A;  2C0D A;  3L9S A;  2PVO C;  3P7X A;  1XZO A;  1XW9 A;  1Z6M A;  5J41 A;  4WBR D;  2YWM A;  4DSQ A;  1O85 A;  4ZL9 A;  2EIR A;  18GS A;  3RHC A;  2GSS A;  2NDO A;  3KZQ A;  2O85 A;  5FHI A;  1PL2 A;  1SL2 B;  4HJM A;  3KM6 A;  1Z3E A;  1TRV A;  4HI7 A;  2CAQ A;  2LNS A;  1TW9 A;  1XVW A;  2MBS A;  1OKT A;  4F03 A;  1FO5 A;  3ME8 A;  1Y25 A;  2RM6 A;  2LEG A;  2F51 A;  2I3Y A;  1Z9H A;  2K18 A;  1GSD A;  4ZB9 A;  3QDN A;  3KTB A;  2QKE A;  1GSS A;  2K6V A;  1JZR A;  1FOV A;  3KMO A;  2HE3 A;  5HR3 A;  1W4V A;  1MDI A;  1BED A;  1B9X C;  2KUC A;  2PVQ A;  2HSH A;  4POK A;  5DAL A;  4V1A g;  4D73 B;  2CVB A;  1Z7R A;  2P5R A;  2F8A A;  2FD3 A;  5KN0 A;  2WFC A;  2XPD A;  1NHY A;  5J3R A;  3D5J A;  1UVZ A;  1J0F A;  1WP0 A;  4X0X A;  2L6C A;  2AV4 A;  3W8J A;  5CNW A;  3HXS A;  3BOA A;  3QCP A;  5AIX A;  3IOS A;  4K0G A;  3ZFB A;  4IJI A;  3N5O A;  4KSO A;  2GQK A;  3CTF A;  4TN8 A;  2IME A;  5EVO A;  3LGC A;  5IMD A;  3CXG A;  1EOH A;  2GST A;  2N5A A;  2DJ1 A;  2HZE B;  5B8B A;  2MMA A;  4KX4 A;  1GSY A;  3QMX A;  1PMT A;  3F0I A;  3DWV A;  2YJH A;  1DSB A;  3TRX A;  2M80 A;  1PD2 1;  2H19 A;  2H0H A;  5ECL B;  3TJJ A;  4BVX A;  1GSE A;  2IMF A;  1SL1 B;  5FT3 A;  5H5S A;  2OKA A;  4MPF A;  1TI1 A;  3ME7 A;  1Z7P A;  6GSU A;  3DXB A;  4TXO B;  2LV3 A;  1V57 A;  2YWI A;  4KUN A;  3F8U A;  3SWL A;  4XRD A;  5IMC A;  1JFU A;  1G7E A;  1DE2 A;  2YOI A;  13GS A;  2DSA A;  4HZ2 A;  5ECM B;  3TRQ A;  5HFK A;  1LU4 A;  3IK7 A;  4I2U A;  5LCZ A;  1ON4 A;  4KDU A;  3IE3 A;  2H8L A;  5JWO B;  2DJ2 A;  2CVK A;  5GST A;  2VD1 A;  1SYR A;  4K9Z A;  4GSS A;  4WEY A;  2V41 A;  5CRD A;  3ERG A;  3IC4 A;  1O8W A;  4XHM A;  5IMF A;  4JZQ A;  1VF4 A;  5A4W A;  3IXR A;  3F3Q A;  2VCZ A;  1YEP A;  3HCZ A;  1X9S B;  2VCT A;  4I8B A;  4YQM A;  1M2D A;  3GTU A;  1M2A A;  4PNF A;  5DCH A;  2C4J A;  3H8Q A;  2JL4 A;  1YKC A;  2H71 A;  1OAZ A;  2CZ3 A;  2HSY A;  1Q98 A;  3FZ4 A;  4ACS A;  4XS1 A;  3EIN A;  3MWH A;  5G5E A;  1HNB A;  1FB0 A;  4I2T A;  4NV2 A;  2L4Q A;  5CRE A;  4AGS A;  3VWX A;  4MDC A;  3EMP A;  1GH2 A;  1A24 A;  1KBN A;  1Q4J A;  2V6O A;  1LBK A;  1VF1 A;  1F37 A;  1GTA A;  3O3T A;  3E0U A;  3FZ9 A;  4WR4 A;  2B5X A;  3LG6 A;  3JCM L;  1TRS A;  2C0F A;  2WUL A;  3EWL A;  3HZ8 A;  5F0G A;  3F4R A;  4DSR A;  4POL A;  5IO0 A;  4NHW A;  3IR4 A;  3HD5 A;  4J57 E;  5J9B A;  1PL1 A;  1WRY A;  3KTL A;  2R37 A;  4K7O A;  1FW1 A;  2YCD A;  2N5B A;  4OO5 A;  3ZZX A;  1A0R P;  5COH A;  4NPB A;  5ECN B;  3HJO A;  1B4Q A;  4HU7 A;  1WE0 A;  4CDO A;  1CQG A;  2E0Q A;  2R4V A;  1X5E A;  5ECK B;  3NZN A;  1A8L A;  22GS A;  6GST A;  2X8G A;  4FYU A;  3I69 A;  5JCU A;  16GS A;  1GL8 A;  1GUL A;  2JZR A;  2H01 A;  3L9U A;  4WET A;  3DIE A;  3EU3 A;  1I5G A;  4LL1 B;  4MK3 A;  5HR0 A;  4KCA A;  3HHV A;  1EV4 A;  1T8E B;  1B9Y C;  2B6M A;  2VL9 A;  2ZUP A;  5DQY A;  3J7Y k;  3KH9 A;  3VLN A;  4F2I A;  7GSS A;  3IAS 2;  1LJR A;  4TVE A;  3L4N A;  1GNW A;  1RQM A;  2GT6 A;  6GSY A;  5IQY A;  2FCH A;  1BJX A;  3F4S A;  3K8N A;  4V2L A;  1EOG A;  4GF0 A;  3O76 A;  3LXT A;  3PR8 A;  2OJL A;  1XW6 A;  2LKU A;  4GST A;  2OE0 A;  3ZVJ A;  3I43 A;  2WGR A;  3ZRE A;  3GL5 A;  2V32 A;  2HZF A;  4BA7 A;  2OAD A;  2E2G A;  2YN1 A;  2R5G A;  2YPM A;  4FH8 A;  2GLR A;  1PKZ A;  1URM A;  2VL3 A;  4QL9 A;  1GUH A;  1WOU A;  2TRX A;  2LQO A;  2O87 A;  4KA0 A;  2G0F A;  3TJB A;  1THO A;  2DIZ A;  4ECI A;  1WMJ A;  1K0N A;  1KEB A;  4MF6 A;  4ZBD A;  1M0U A;  2E7P A;  2HZE A;  3ZIV A;  3DRN A;  2PN8 A;  3APS A;  6GSX A;  1A2J A;  2CAI A;  4OCE A;  5AGY A;  1NSW A;  1WPI A;  4XS4 B;  3ZYW A;  2B5Y A;  5J4U A;  2X8C A;  2I4A A;  2GZZ A;  4PUA A;  4MF7 A;  2N5F A;  1A2M A;  1VF2 A;  2BTO T;  5ECI B;  5F06 A;  1ERW A;  2BMX A;  4IQ1 A;  3GST A;  3RAZ A;  3I6A A;  4MMM A;  4XTS A;  4V2M A;  4GQF A;  4HU9 A;  1SD9 A;  3Q19 A;  2B1K A;  3TDG A;  4LA1 A;  1QFN A;  2YP6 A;  1BG5 A;  1HNA A;  4GCI A;  2VCW A;  4V2N A;  3P2A A;  1YDK A;  2VCQ A;  1TTZ A;  3IK9 A;  3D4M A;  5D9X A;  2FNO A;  2C0G A;  2H76 A;  4PQH A;  2C3N A;  3A3T A;  4HJ2 A;  3IAM 2;  1THX A;  1O8X A;  1N8J A;  4IP1 A;  4PQI A;  4Z7X A;  1MTC A;  3CSH A;  1X5C A;  2LQQ A;  3MSZ A;  4O5R A;  3TGZ A;  4TW5 A;  3EMX A;  11GS A;  1SKW B;  4HQZ A;  4ILF A;  3QFA C;  1FB6 A;  5DJM A;  1QGV A;  3W8S A;  4YQV A;  1GWC A;  5IIZ A;  5H5Q A;  2JSZ A;  2DC5 A;  1K0D A;  3GH6 A;  2H6Y A;  1SK2 A;  1BQ7 A;  3DVX A;  2IL3 A;  2P0G A;  4ZB6 A;  3U5R E;  4L0W A;  1K0C A;  3LWA A;  3GMF A;  1ACV A;  4N0V A;  2DJ3 A;  1ZOF A;  1SJI A;  3TKQ A;  3J7Y b;  3RBT A;  1B8X A;  3GRX A;  3F9U A;  3LXZ A;  2PER A;  2OBI A;  1TKD B;  3P90 A;  4XRA A;  1WIK A;  2AYT A;  4IBP A;  2VLT A;  4F9Z A;  4JR6 A;  3LEF A;  2NTO A;  3D21 A;  1Z6N A;  5CRW A;  3C7M A;  1XPV A;  3MNG A;  5ECS A;  5KEJ A;  1AUC A;  2H1D A;  1SYX A;  2H30 A;  3QFB C;  4ZXG A;  4MH3 A;  1GP1 A;  2BJX A;  1ERU A;  1GLP A;  2B3S A;  3HJM A;  3FY7 A;  1MD4 A;  3DVW A;  2VCV A;  1YJ6 A;  3ZMK A;  4HZ4 A;  1A2L A;  2LJK A;  2VO4 A;  5AN1 A;  5KN3 A;  1TU8 A;  1PX6 A;  3LYK A;  3FR9 A;  4MAB A;  4EDZ A;  2A2S A;  1RW1 A;  4MZC A;  1EEJ A;  3CSJ A;  1IYI A;  4WF4 A;  1J08 A;  1V58 A;  3VI5 A;  4TR1 A;  6GSW A;  4J2F A;  3FKF A;  5E4W A;  5JCW A;  5ENU A;  2MMN A;  5J5N A;  1R5P A;  1TP9 A;  3UVT A;  4BWQ A;  2ON7 A;  2PBJ A;  2OA7 A;  1R5A A;  3ERF A;  4QL7 A;  1PSQ A;  1EZK A;  5A4V A;  2JSY A;  1ZL9 A;  1JZD A;  4KND A;  4MJA A;  5IMV A;  1QK8 A;  2H66 A;  6GSV A;  1YKA A;  2OE1 A;  5JCG A;  1S3D A;  3F6D A;  2DML A;  3V1W A;  1X0R A;  3M9K A;  5D73 A;  2VLV A;  5CAX A;  4BL7 A;  2I81 A;  2OBK A;  3LYP A;  1B4P A;  4O92 A;  5J9C A;  3SBC A;  1EP7 A;  1UC7 A;  1G6W A;  3TKR A;  2CX4 A;  4ECB A;  3UOM A;  2FWH A;  3DEX A;  3VFI A;  3GX8 A;  2FWE A;  2M46 A;  4XCS A;  2GSR A;  1C72 A;  2AUV A;  1MEK A;  4RQX A;  4NHZ A;  5E59 A;  2R3X A;  4K0N A;  3FEU A;  3WGD A;  5IOW A;  3W6G A;  1NW2 A;  4IQA A;  2KP1 A;  1T4Y A;  3F63 A;  3QAV A;  3LSZ A;  3KXO A;  4LL4 B;  1EGR A;  4WKW A;  1MDJ A;  3CMI A;  3QD9 A;  4MCU A;  4PQ1 A;  2F3M A;  3BJ5 A;  2KOK A;  2GQL A;  2CZ2 A;  3GUR A;  5EY6 A;  1NM3 A;  1M9B A;  2XHF A;  1G7O A;  4Q5R A;  4ZBA A;  5LD0 A;  3KH7 A;  1B48 A;  1G0T A;  3WGE A;  3WGX A;  1HQO A;  3DML A;  2ZNM A;  3VWV A;  1A23 A;  3WT1 A;  3GKX A;  2L5L A;  2LNT A;  5DCG A;  3GYK A;  4OFN A;  4WXT A;  4LMW A;  4K7N A;  1K3Y A;  5EL8 A;  4XS4 A;  2ZCT A;  1OC9 A;  4YAP A;  3IHQ A;  3GV1 A;  1GUM A;  1ZZY A;  2D2Z A;  2X99 A;  3Q6O A;  1O7U A;  3GSS A;  4JE1 A;  4IVF A;  1PN9 A;  3MDK A;  2DMM A;  2JU5 A;  1SKS B;  3HYP A;  2XC2 A;  1W89 A;  1PA3 A;  4GWR A;  4PGT A;  3CRU A;  1ZCP A;  4EKZ A;  3HA9 A;  2ALB A;  3ED3 A;  4TKY A;  3KJY A;  2H74 A;  3VK9 A;  5AIV A;  2HNL A;  2V2G A;  3EUR A;  1T1V A;  2J23 A;  3PH9 A;  5ECR B;  5DVB A;  1S3A A;  5HFI A;  2A4V A;  1BYE A;  1M9A A;  3QOU A;  3ZIT A;  4GSN A;  4YQU A;  1T4Z A;  3HKR A;  4NV5 A;  3GFK A;  1XWK A;  17GS A;  4KDY A;  1DE1 A;  1M99 A;  1K0A A;  1K0O A;  1OE7 A;  2VLU A;  3KCM A;  4E8H A;  2VOC A;  1YF1 A;  4L5L A;  1AQW A;  3F6F A;  1O73 A;  1XVQ A;  4TR1 B;  2RII A;  4KH7 A;  1U3A A;  1E2Y A;  3ZLP A;  3H93 A;  1TRW A;  4IW9 A;  2FA4 A;  3FHK A;  2L4C A;  2GT5 A;  3PGT A;  3H4K A;  3TKP A;  3CRT A;  3TKS C;  1VF3 A;  2WCI A;  4EVM A;  1K0B A;  4X1U A;  2WS2 A;  1V9W A;  20GS A;  3CYN A;  4OCF A;  3LOR A;  2GS3 A;  4OMV A;  1XWG A;  5JWR B;  4ML1 A;  1JHB A;  3ZL5 A;  3VUR A;  3U6V A;  1K3L A;  4GRF A;  3TOT A;  2B1L A;  4EE0 A;  5C00 A;  2B7K A;  3M3M A;  3GKN A;  4OFM A;  4HQS A;  1OYJ A;  4AJ7 A;  4K6X A;  2IPA A;  1XOA A;  4LMV A;  3KEB A;  1UN2 A;  2GZY A;  2V1M A;  4ML6 A;  2LJR A;  2YZH A;  4V1A p;  4KDX A;  4FYC A;  2H75 A;  4EXJ A;  3GX0 A;  4ZL7 A;  3P8W A;  4HOJ A;  2FHE A;  4TOP A;  2VM1 A;  1AW9 A;  1HNC A;  5IO2 A;  3M8N A;  4K1F A;  2RUF A;  2P31 A;  3HJP A;  1YQ1 A;  4ZB8 A;  4L8E A;  4F0C A;  3FZA A;  3L78 A;  4N11 A;  1ILO A;  4TR0 A;  3F3R A;  1YEX A;  5A5K A;  4LLR A;  1Z5Y E;  2H0I A;  4JBB A;  4RI7 A;  1V40 A;  2EIQ A;  1GLQ A;  3D6I A;  3KP8 A;  4EDY A;  3US3 A;  3QR6 A;  5ECP B;  1A0F A;  1ST9 A;  8GSS A;  1SK1 A;  3EVI A;  4NMU A;  1KNG A;  2AAW A;  4K8M A;  1JLW A;  4YAV A;  2O89 A;  5AIS A;  5GZZ B;  1F6M C;  2HRF A;  4AJ6 A;  2HXK A;  5HQP A;  2VM2 A;  1QUW A;  3ZIJ A;  1QMV A;  2PU9 C;  5D9W A;  1OC9 B;  2XBI A;  2YWO A;  4CHS A;  2LRN A;  5IM9 A;  1EWX A;  3A2V A;  3IDV A;  4F82 A;  1H75 A;  4MPG A;  1TK8 B;  4DVC A;  3S9F A;  5G2Z A;  4KAE A;  4I6X A;  2IJY A;  2REM A;  2CQ9 A;  9GSS A;  2EC4 A;  3ZVJ D;  1I9D A;  4OFT A;  5GSS A;  5HR2 A;  5IMA A;  1XOB A;  3WT2 A;  2K8V A;  1OC3 A;  1V98 A;  3TRP A;  12GS A;  3HDC A;  1U3I A;  5F07 A;  3KD0 A;  5G30 A;  3A5W A;  2VIM A;  2IN3 A;  4EF0 A;  1U87 A;  3UIW A;  2GGT A;  2AJQ B;  3BD2 A;  3TJG A;  2WRT A;  3GHA A;  4O7H A;  4NWY A;  4HDE A;  3UL3 A;  14GS A;  2YNX A;  2RLI A;  1U6T A;  4ECJ A;  4G2E A;  1ML6 A;  4EUY A;  2YV9 A;  4PNG A;  1TJD A;  3C8E A;  5ECH B;  2LST A;  2IIY A;  2OAC A;  5CO3 A;  4TRX A;  4P3Y B;  1FVK A;  3UEM A;  2IMI A;  3EU4 A;  4JRR A;  4IS0 A;  4Q5N A;  2H6X A;  2MMO A;  2VD0 A;  4E8E A;  1O6J A;  2YAN A;  2P5Q A;  1BX9 A;  5DAK B;  3RDW A;  3APO A;  3D22 A;  3TOU A;  2DBC A;  5H5R A;  2JAD A;  3L9V A;  3UAP A;  1YF0 A;  1TOF A;  3CSI A;  1SD8 A;  2GSQ A;  2B5E A;  1TU7 A;  1J9B A;  4L0U A;  5D9V A;  2PPT A;  3GIX A;  4GXZ A;  2B7J A;  5IPG A;  1YY7 A;  4WBJ A;  4EC0 A;  1JZW A;  1ABA A;  5G1K A;  2L6D A;  2DLX A;  2DJK A;  3D4T A;  1QQ2 A;  2GDR A;  2RM5 A;  2L5O A;  4O32 A;  3HVV A;  3Q74 A;  2IFQ B;  2I1U A;  1SKR B;  3GN3 A;  3GKM A;  4YH2 A;  4ZL8 A;  4G9H A;  4L5O A;  3HY2 A;  1F3A A;  2C3T A;  4OD7 A;  1WJK A;  3VPT A;  2CX3 A;  5B6N A;  2I9H A;  1HYU A;  2K9F A;  3NOF A;  4I5Q A;  2H70 A;  1T00 A;  4DSS B;  2C80 A;  1XW5 A;  2HRN A;  2O8V B;  2PMT A;  3TJK A;  1XIY A;  3DYR A;  4GQC A;  2H0G A;  2V6K A;  3C73 A;  4RI6 A;  1AAZ A;  5C04 A;  2VCX A;  2R6K A;  4IN0 A;  4QQ7 A;  3AY8 A;  1TDI A;  4MZB A;  2QC7 A;  3E9J B;  2LUS A;  3CTG A;  2WJU A;  1XCC A;  4TR3 A;  1M2B A;  5EPF A;  2LRC A;  1TK0 B;  3QAW A;  1FAA A;  3EYT A;  1XWB A;  2J9H A;  2MBT A;  3Q18 A;  2H1A A;  3KIJ A;  3UBK A;  3DGQ A;  4MF5 A;  1GSU A;  4KGI A;  5CP1 A;  2R2J A;  3G9B A;  5F8B A;  4NAX A;  2RUE A;  1DUG A;  2HI7 A;  3UBL A;  2HLS A;  3ISO A;  3TCO A;  2QSI A;  4RUV A;  2ON5 A;  4KB3 A;  2O7K A;  3GNJ A;  2NPB A;  2A2R A;  4MJC A;  3FR3 A;  4PUF C;  5HFG A;  1XWA A;  3APQ A;  4N10 A;  3ZRD A;  3UVH A;  1T7P B;  3D0Z A;  1FG4 A;  2CT6 A;  3UAR A;  3IPZ A;  5B8A A;  1N2A A;  3N9J A;  3FK8 A;  3WD6 A;  4MZW A;  4Q5Q A;  3C71 A;  19GS A;  1EEM A;  2XPE A;  5ECO B;  2AHE A;  4FO5 A;  3L0H A;  4ZIJ A;  1AIU A;  1GTU A;  1ERT A;  4KE3 A;  3EE2 A;  3TB2 A;  5ID2 A;  2HFD A;  1V2A A;  4NXI A;  3F4T A;  2PGT A;  5DDL A;  5D9T A;  4TXV A;  1EGO A;  4BWS A;  3C1R A;  4HS1 A;  3RPN A;  1X5D A;  3IA1 A;  1QXH A;  3BBY A;  3G7I A;  3R2Q A;  3FYG A;  5IOX A;  1GRX A;  1EV9 A;  1OC8 A;  2FGX A;  1GTB A;  4X43 A;  1FHE A;  3ZML A;  5CYY A;  5B6M A;  1ERV A;  4HUA A;  3LJR A;  2Z9S A;  1DBY A;  2C3Q A;  2TIR A;  1IYH A;  4K7I A;  3FW2 A;  2MMZ A;  4BPY A;  1SEN A;  3LFL A;  1MD3 A;  2OE3 A;  4PX1 A;  3GKK A;  3FRC A;  4ID0 A;  4JU5 A;  5GAN D;  5ELG A;  3HZ4 A;  2KHP A;  3BCI A;  3IBH A;  4MLY A;  4OO4 A;  4K2D A;  5L71 A;  3WYW A;  1E6B A;  3M0F A;  2EIO A;  1U88 A;  3ZFL A;  4ZBB A;  1MDK A;  4GTU A;  1NHO A;  1TRU A;  4I97 A;  1XFL A;  1SJZ A;  4IP6 A;  5ABR A;  1XXU A;  1RK4 A;  3GH9 A;  5F05 A;  4BVY A;  1WWJ A;  4G19 A;  2DJ0 A;  1EP8 A;  5GAP D;  1OKD A;  2IWT A;  5DAK A;  3A2W A;  3FR6 A;  3HVX A;  4POB A;  5G31 A;  1M7T A;  4G10 A;  2YWN A;  2VAF A;  4XIH A;  3GA4 A;  5ECQ B;  1PQN A;  2X8H A; 
#chains in the Genus database with same CATH topology
 2E2M A;  3G7Y A;  5DJL A;  1XWC A;  1X9W B;  4IJ3 A;  4KW6 A;  3HVS A;  4PUR A;  1GUK A;  3OR5 A;  4IEL A;  2FLS A;  2X64 A;  2FUG 2;  4PXO A;  2FA8 A;  2GTU A;  5DAL B;  5HR1 A;  3VPQ A;  4FIW A;  3NIV A;  1ZYE A;  3RHB A;  2IMK A;  1OE8 A;  2WZ9 A;  3TJF A;  5KN2 A;  4MP4 A;  5FWG A;  4MJB A;  2H1B A;  3IV4 A;  1ZYQ B;  1A8Y A;  3LQ7 A;  2IFQ A;  4AJ8 A;  5D93 A;  2HYX A;  1SU9 A;  1X9M B;  2L57 A;  2PWJ A;  4Z2T A;  1T3B A;  4JR4 A;  2GVP A;  2VL2 C;  2H72 A;  1TI3 A;  2L59 A;  2PUK C;  1GSQ A;  3MAK A;  2F8F A;  3TKS A;  4DEJ A;  1AC1 A;  4DSS A;  4FYB A;  1ZMA A;  6GSS A;  2GZP A;  2G2Q A;  2VUP A;  3VWW A;  1K3O A;  1VGL A;  4BVX B;  4IGJ A;  3CBU A;  3VWU A;  1PKW A;  4CY6 A;  2JAC A;  2M72 A;  2IMD A;  4Q5F A;  1SL0 B;  3TUE A;  3FZ5 A;  3VI7 A;  5LNK e;  1JLV A;  4D73 A;  2YZU A;  2HT9 A;  3QAG A;  2GQM A;  4EO3 A;  1TK5 B;  3UJ1 A;  2MYG A;  3BCK A;  2CVD A;  2AB6 A;  4ZIL A;  3KMN A;  4ISD A;  2KLX A;  2VL2 A;  4H86 A;  4MA9 A;  3RPP A;  4G0I A;  5D96 A;  5ID2 B;  4N0Z A;  4RQR A;  5CRH A;  1AXD A;  4IKH A;  4OWY A;  3UMA A;  3H1N A;  1GNE A;  3I9V 2;  2DJJ A;  2DIY A;  3M9J A;  2LJA A;  3KGK A;  2NVL A;  5G1L A;  1KTE A;  2NBS A;  1F2E A;  2XBQ A;  3QPM A;  4F0B A;  4IHU A;  2FWG A;  4TR4 A;  4WR5 A;  2C1Y A;  2YV7 A;  1BAY A;  1GSF A;  4AF2 A;  5DQS A;  3E3E A;  2CV4 A;  3EC3 A;  4N30 A;  3H79 A;  2F9S A;  1XBS A;  3GL3 A;  1TXX A;  4J56 E;  1PRX A;  3GTU B;  1VRS D;  3IC8 A;  2FWF A;  3ERW A;  2LRT A;  4TXO A;  1F9M A;  3DKS A;  4CW9 A;  2FY6 A;  2KP2 A;  5BMU A;  2JZS A;  4XS6 A;  2LTK A;  1R7H A;  4KCE A;  2H73 A;  4EL1 A;  3IRA A;  3C1S A;  3M1G A;  5IMZ A;  2C0E A;  4JED A;  2WB9 A;  1FVJ A;  3G7J A;  4WF5 A;  2WDU A;  5D8I A;  2C8U A;  4POM A;  3DD3 A;  2ES7 A;  1OVN A;  3KP9 A;  1S3C A;  5G5F A;  4GLT A;  2JZT A;  2H6Z A;  5CRG A;  1AQV A;  5B7C A;  2QGV A;  5A4U A;  3TKS E;  1GTI A;  1F3B A;  2LS5 A;  3GUS A;  4USS A;  5DBQ A;  1O81 A;  4KSM A;  1CQH A;  2TRC P;  5JWQ B;  1K0M A;  1G6Y A;  2K8S A;  1PGT A;  1YZX A;  3O6T A;  1ZGN A;  5KN1 A;  1USB A;  2CA8 A;  1R26 A;  3PIN A;  4ULX A;  10GS A;  1UA5 A;  1R4W A;  1PX7 A;  5INY A;  4MJE A;  4MH2 A;  2MZC A;  5IPH A;  2YJ7 A;  1SJ6 A;  1Y6E A;  1HD2 A;  2H1G A;  1SK0 A;  4EIQ A;  1JZO A;  5ELA A;  1H4O A;  4HEA 2;  1AQX A;  3A2X A;  4ECC A;  3ZTL A;  2C0D A;  3L9S A;  2PVO C;  3P7X A;  4X4J A;  1XZO A;  1XW9 A;  1Z6M A;  5J41 A;  4WBR D;  2YWM A;  4DSQ A;  1O85 A;  4ZL9 A;  2EIR A;  18GS A;  3RHC A;  2GSS A;  2NDO A;  3KZQ A;  2O85 A;  5FHI A;  1PL2 A;  1SL2 B;  4HJM A;  3KM6 A;  1Z3E A;  1TRV A;  4HI7 A;  2CAQ A;  2LNS A;  1TW9 A;  1XVW A;  2MBS A;  1OKT A;  4F03 A;  1FO5 A;  3ME8 A;  1Y25 A;  2RM6 A;  2LEG A;  2F51 A;  2I3Y A;  1Z9H A;  2K18 A;  1GSD A;  4ZB9 A;  3CQF A;  3QDN A;  3KTB A;  2QKE A;  1GSS A;  2K6V A;  1JZR A;  1FOV A;  3KMO A;  2HE3 A;  5HR3 A;  1W4V A;  1MDI A;  1BED A;  1B9X C;  3R3E A;  2KUC A;  2PVQ A;  2HSH A;  4POK A;  5DAL A;  4V1A g;  4D73 B;  2CVB A;  1Z7R A;  2P5R A;  2F8A A;  2FD3 A;  5KN0 A;  2WFC A;  2XPD A;  1NHY A;  5J3R A;  3D5J A;  4Z2R A;  1UVZ A;  1J0F A;  1WP0 A;  4X0X A;  2L6C A;  2AV4 A;  3W8J A;  5CNW A;  3HXS A;  3BOA A;  3QCP A;  5AIX A;  3IOS A;  4K0G A;  3ZFB A;  4IJI A;  3N5O A;  4KSO A;  2GQK A;  3CTF A;  4TN8 A;  2IME A;  5EVO A;  3LGC A;  5IMD A;  3CXG A;  1EOH A;  2GST A;  2N5A A;  2DJ1 A;  1XG8 A;  2HZE B;  5B8B A;  2MMA A;  4O5U A;  4KX4 A;  1GSY A;  3QMX A;  1PMT A;  3F0I A;  3DWV A;  2YJH A;  1DSB A;  3TRX A;  2M80 A;  1PD2 1;  2H19 A;  2H0H A;  5ECL B;  3TJJ A;  4BVX A;  1GSE A;  2IMF A;  1SL1 B;  5FT3 A;  5H5S A;  2OKA A;  4MPF A;  1TI1 A;  3ME7 A;  1Z7P A;  6GSU A;  3DXB A;  4TXO B;  2LV3 A;  1V57 A;  2YWI A;  4KUN A;  3F8U A;  3SWL A;  4XRD A;  5IMC A;  1JFU A;  1G7E A;  1PN0 A;  1DE2 A;  2YOI A;  13GS A;  2DSA A;  4HZ2 A;  5ECM B;  3TRQ A;  5HFK A;  1LU4 A;  3IK7 A;  4I2U A;  5LCZ A;  1ON4 A;  4KDU A;  3IE3 A;  2H8L A;  5JWO B;  2DJ2 A;  2R0P A;  2CVK A;  5GST A;  2VD1 A;  1SYR A;  4K9Z A;  4GSS A;  4WEY A;  2V41 A;  5CRD A;  3ERG A;  3IC4 A;  1O8W A;  4XHM A;  5IMF A;  4JZQ A;  1VF4 A;  5A4W A;  3IXR A;  3F3Q A;  2VCZ A;  1YEP A;  3HCZ A;  1X9S B;  2VCT A;  4I8B A;  4YQM A;  1M2D A;  3GTU A;  1M2A A;  4PNF A;  5DCH A;  2C4J A;  3H8Q A;  2JL4 A;  1YKC A;  2H71 A;  1OAZ A;  2UZ8 A;  2CZ3 A;  2HSY A;  1Q98 A;  3FZ4 A;  4ACS A;  4XS1 A;  3EIN A;  3MWH A;  5G5E A;  1HNB A;  1FB0 A;  4I2T A;  4NV2 A;  5BRT A;  1M3J A;  2QA2 A;  2L4Q A;  5CRE A;  4AGS A;  3VWX A;  4MDC A;  3EMP A;  1GH2 A;  1A24 A;  1KBN A;  1Q4J A;  2V6O A;  1LBK A;  1VF1 A;  1F37 A;  1GTA A;  3O3T A;  3E0U A;  3FZ9 A;  4WR4 A;  4G0L A;  2B5X A;  3LG6 A;  3JCM L;  1TRS A;  2C0F A;  2WUL A;  3EWL A;  3HZ8 A;  5F0G A;  3F4R A;  4DSR A;  4POL A;  5IO0 A;  4NHW A;  3IR4 A;  3HD5 A;  4J57 E;  5J9B A;  1PL1 A;  1WRY A;  3KTL A;  2R37 A;  4K7O A;  1FW1 A;  2YCD A;  2N5B A;  4OO5 A;  3PPU A;  3ZZX A;  1A0R P;  5COH A;  4NPB A;  5ECN B;  3HJO A;  1B4Q A;  4HU7 A;  1WE0 A;  4CDO A;  1CQG A;  2E0Q A;  2R4V A;  1X5E A;  5ECK B;  3NZN A;  1A8L A;  22GS A;  6GST A;  2X8G A;  3HVN A;  4FYU A;  3I69 A;  5JCU A;  16GS A;  1GL8 A;  1GUL A;  2JZR A;  2H01 A;  3L9U A;  4WET A;  3DIE A;  3EU3 A;  1I5G A;  4LL1 B;  4MK3 A;  5HR0 A;  4KCA A;  3HHV A;  4BL7 B;  1EV4 A;  1T8E B;  1B9Y C;  2B6M A;  2VL9 A;  2ZUP A;  5DQY A;  3J7Y k;  3KH9 A;  1S3R A;  3VLN A;  4F2I A;  7GSS A;  3IAS 2;  1LJR A;  4TVE A;  3L4N A;  1GNW A;  1RQM A;  2GT6 A;  1PFO A;  6GSY A;  5IQY A;  2FCH A;  3A5I A;  1BJX A;  3F4S A;  3K8N A;  4V2L A;  1EOG A;  4GF0 A;  3O76 A;  3LXT A;  3PR8 A;  2OJL A;  1XW6 A;  2LKU A;  4GST A;  2OE0 A;  3ZVJ A;  3I43 A;  2WGR A;  3ZRE A;  3GL5 A;  2V32 A;  2HZF A;  4BA7 A;  2OAD A;  2E2G A;  2YN1 A;  2R5G A;  2YPM A;  4FH8 A;  2GLR A;  1PKZ A;  1URM A;  2VL3 A;  4QL9 A;  1GUH A;  1WOU A;  2TRX A;  2LQO A;  2O87 A;  4KA0 A;  2G0F A;  3TJB A;  1THO A;  2DIZ A;  4ECI A;  1WMJ A;  1K0N A;  1KEB A;  4MF6 A;  4ZBD A;  1M0U A;  2E7P A;  2HZE A;  3EPT A;  3ZIV A;  3DRN A;  2PN8 A;  3APS A;  6GSX A;  1A2J A;  2CAI A;  4OCE A;  5AGY A;  1NSW A;  1WPI A;  4XS4 B;  3ZYW A;  2B5Y A;  5J4U A;  2X8C A;  2I4A A;  2GZZ A;  4PUA A;  4MF7 A;  2N5F A;  1A2M A;  1VF2 A;  2BTO T;  2HRA A;  5ECI B;  5F06 A;  1ERW A;  2BMX A;  4IQ1 A;  3GST A;  1FOH A;  3RAZ A;  3I6A A;  4MMM A;  4XTS A;  4V2M A;  4GQF A;  4HU9 A;  1SD9 A;  3Q19 A;  2B1K A;  3TDG A;  4LA1 A;  1QFN A;  2YP6 A;  1BG5 A;  1HNA A;  4GCI A;  2VCW A;  4KF9 A;  4V2N A;  3P2A A;  1YDK A;  2VCQ A;  1TTZ A;  3IK9 A;  3D4M A;  5D9X A;  2FNO A;  2C0G A;  2H76 A;  4PQH A;  2C3N A;  3A3T A;  4HJ2 A;  3IAM 2;  1THX A;  1O8X A;  1N8J A;  4IP1 A;  2DKH A;  4PQI A;  4Z7X A;  5KOW A;  1MTC A;  3CSH A;  1X5C A;  2LQQ A;  3MSZ A;  4O5R A;  3TGZ A;  4TW5 A;  2A4H A;  3EMX A;  1M3I A;  11GS A;  1SKW B;  4HQZ A;  4ILF A;  3QFA C;  1FB6 A;  5DJM A;  1QGV A;  2HSM A;  3W8S A;  4YQV A;  1GWC A;  5IIZ A;  5H5Q A;  2JSZ A;  2DC5 A;  1K0D A;  3GH6 A;  2H6Y A;  1SK2 A;  1BQ7 A;  3DVX A;  2IL3 A;  2P0G A;  4ZB6 A;  3U5R E;  4L0W A;  1K0C A;  3LWA A;  3GMF A;  1ACV A;  4N0V A;  2DJ3 A;  1ZOF A;  1SJI A;  3TKQ A;  3J7Y b;  3RBT A;  1B8X A;  3GRX A;  3F9U A;  3LXZ A;  2PER A;  2OBI A;  1TKD B;  3P90 A;  4XRA A;  1WIK A;  2AYT A;  4IBP A;  2VLT A;  4F9Z A;  4JR6 A;  3LEF A;  2NTO A;  3D21 A;  1Z6N A;  5CRW A;  3C7M A;  1XPV A;  3MNG A;  5ECS A;  5KEJ A;  1AUC A;  2H1D A;  1SYX A;  2H30 A;  3QFB C;  4ZXG A;  4MH3 A;  1GP1 A;  2BJX A;  1ERU A;  1GLP A;  2B3S A;  3HJM A;  3FY7 A;  1MD4 A;  3DVW A;  2VCV A;  1YJ6 A;  3ZMK A;  4HZ4 A;  1A2L A;  2HRK A;  2LJK A;  2VO4 A;  5AN1 A;  4K5S A;  5KN3 A;  1TU8 A;  2R0G A;  1PX6 A;  3LYK A;  3FR9 A;  4MAB A;  4EDZ A;  2A2S A;  1RW1 A;  4MZC A;  1EEJ A;  3CSJ A;  1IYI A;  4WF4 A;  4MNN A;  1J08 A;  1V58 A;  3VI5 A;  4TR1 A;  6GSW A;  4J2F A;  3FKF A;  5E4W A;  5JCW A;  5ENU A;  2MMN A;  5J5N A;  1R5P A;  1TP9 A;  3UVT A;  4BWQ A;  2ON7 A;  2PBJ A;  2OA7 A;  1R5A A;  3ERF A;  4QL7 A;  1PSQ A;  1EZK A;  5A4V A;  2JSY A;  1ZL9 A;  1JZD A;  4KND A;  4MJA A;  5IMV A;  1QK8 A;  2H66 A;  6GSV A;  1YKA A;  2OE1 A;  5JCG A;  1S3D A;  3F6D A;  2DML A;  4HSC X;  3V1W A;  1X0R A;  3M9K A;  5D73 A;  2VLV A;  5CAX A;  4BL7 A;  2I81 A;  2OBK A;  3LYP A;  1B4P A;  4O92 A;  4K5R A;  5KOX A;  5J9C A;  3SBC A;  1EP7 A;  1UC7 A;  1G6W A;  3TKR A;  2CX4 A;  4ECB A;  3UOM A;  2FWH A;  3DEX A;  3VFI A;  3GX8 A;  2FWE A;  2M46 A;  4XCS A;  2GSR A;  1C72 A;  2AUV A;  1MEK A;  4RQX A;  4NHZ A;  5E59 A;  2R3X A;  4K0N A;  3FEU A;  3WGD A;  5IOW A;  3W6G A;  1NW2 A;  4IQA A;  2KP1 A;  1T4Y A;  4O5Q A;  3F63 A;  3QAV A;  3LSZ A;  3KXO A;  4LL4 B;  1EGR A;  4WKW A;  4CY8 A;  1MDJ A;  3CMI A;  3QD9 A;  4MCU A;  4PQ1 A;  2F3M A;  3BJ5 A;  2KOK A;  2GQL A;  4K2X A;  2CZ2 A;  3GUR A;  5EY6 A;  1NM3 A;  1M9B A;  2XHF A;  1G7O A;  4Q5R A;  4ZBA A;  5LD0 A;  3KH7 A;  1B48 A;  1G0T A;  3WGE A;  3WGX A;  1HQO A;  3DML A;  2ZNM A;  3VWV A;  1A23 A;  3WT1 A;  3GKX A;  2L5L A;  2LNT A;  5DCG A;  3GYK A;  1ZYN A;  2R0C A;  4OFN A;  4WXT A;  4LMW A;  4K7N A;  1K3Y A;  5EL8 A;  4XS4 A;  2ZCT A;  1OC9 A;  4YAP A;  3IHQ A;  3GV1 A;  1GUM A;  1ZZY A;  2D2Z A;  2X99 A;  3Q6O A;  1O7U A;  3GSS A;  4JE1 A;  4IVF A;  1PN9 A;  3MDK A;  2DMM A;  2JU5 A;  1SKS B;  3HYP A;  2XC2 A;  1W89 A;  1PA3 A;  4GWR A;  4PGT A;  3CRU A;  1ZCP A;  4EKZ A;  3HA9 A;  2ALB A;  3ED3 A;  4TKY A;  3KJY A;  2H74 A;  4PTS A;  3VK9 A;  5AIV A;  2HNL A;  2V2G A;  3EUR A;  1T1V A;  2J23 A;  3PH9 A;  5ECR B;  5DVB A;  1S3A A;  5HFI A;  2A4V A;  1BYE A;  1M9A A;  3QOU A;  3ZIT A;  4GSN A;  4YQU A;  4YKG A;  1T4Z A;  3HKR A;  4NV5 A;  4Z2U A;  3GFK A;  1XWK A;  17GS A;  4KDY A;  1DE1 A;  1M99 A;  1K0A A;  1K0O A;  1OE7 A;  2VLU A;  3KCM A;  4E8H A;  2VOC A;  1YF1 A;  4L5L A;  1AQW A;  3F6F A;  1O73 A;  1XVQ A;  4TR1 B;  2RII A;  4KH7 A;  1U3A A;  1E2Y A;  3ZLP A;  3H93 A;  1TRW A;  4IW9 A;  2FA4 A;  3FHK A;  2L4C A;  2GT5 A;  3PGT A;  3H4K A;  3TKP A;  3CRT A;  3TKS C;  1VF3 A;  2WCI A;  4EVM A;  1K0B A;  4X1U A;  2WS2 A;  1V9W A;  20GS A;  3CYN A;  4OCF A;  3LOR A;  2GS3 A;  4OMV A;  1XWG A;  5JWR B;  4ML1 A;  1JHB A;  3ZL5 A;  3VUR A;  3U6V A;  1K3L A;  4GRF A;  3TOT A;  2B1L A;  4EE0 A;  5C00 A;  2B7K A;  3M3M A;  3GKN A;  4OFM A;  4HQS A;  1OYJ A;  4AJ7 A;  4K6X A;  2IPA A;  1XOA A;  4LMV A;  3KEB A;  1UN2 A;  2GZY A;  2V1M A;  4ML6 A;  2LJR A;  2YZH A;  4V1A p;  4KDX A;  4FYC A;  2H75 A;  4EXJ A;  3GX0 A;  4ZL7 A;  3P8W A;  4HOJ A;  2FHE A;  4TOP A;  2VM1 A;  1AW9 A;  1HNC A;  5IO2 A;  4EIP A;  3M8N A;  4K1F A;  2RUF A;  2P31 A;  3HJP A;  1YQ1 A;  4ZB8 A;  4L8E A;  4F0C A;  3FZA A;  3L78 A;  4N11 A;  1ILO A;  4TR0 A;  3F3R A;  1YEX A;  5A5K A;  4LLR A;  1Z5Y E;  2H0I A;  4JBB A;  4RI7 A;  1V40 A;  2EIQ A;  1ZYP A;  1GLQ A;  3MIX A;  3D6I A;  3KP8 A;  4EDY A;  3US3 A;  3FMW A;  3QR6 A;  5ECP B;  1A0F A;  1ST9 A;  8GSS A;  1SK1 A;  3EVI A;  4NMU A;  1KNG A;  2AAW A;  4K8M A;  1JLW A;  4YAV A;  2O89 A;  5AIS A;  5GZZ B;  1F6M C;  2HRF A;  4AJ6 A;  2HXK A;  5HQP A;  4FQU A;  2VM2 A;  1QUW A;  3ZIJ A;  1QMV A;  2PU9 C;  5D9W A;  1OC9 B;  2XBI A;  2YWO A;  4CHS A;  2LRN A;  5IM9 A;  1EWX A;  3A2V A;  3IDV A;  4F82 A;  1H75 A;  4MPG A;  1TK8 B;  4DVC A;  3S9F A;  5G2Z A;  4KAE A;  4I6X A;  2IJY A;  2REM A;  2CQ9 A;  9GSS A;  2EC4 A;  3ZVJ D;  1I9D A;  4OFT A;  5GSS A;  5HR2 A;  5IMA A;  1XOB A;  3WT2 A;  2K8V A;  1OC3 A;  1V98 A;  3TRP A;  12GS A;  3HDC A;  1U3I A;  5F07 A;  3KD0 A;  5G30 A;  3A5W A;  2VIM A;  2IN3 A;  4EF0 A;  1U87 A;  3UIW A;  2GGT A;  2AJQ B;  3BD2 A;  3TJG A;  2WRT A;  3GHA A;  4O7H A;  4NWY A;  4HDE A;  3UL3 A;  14GS A;  2YNX A;  2RLI A;  1U6T A;  4ECJ A;  4G2E A;  1ML6 A;  4EUY A;  2YV9 A;  4PNG A;  1TJD A;  3C8E A;  2X49 A;  5ECH B;  2LST A;  2IIY A;  2OAC A;  5CO3 A;  4TRX A;  4P3Y B;  1FVK A;  3UEM A;  2IMI A;  4BVY B;  3EU4 A;  3IHG A;  4JRR A;  4IS0 A;  4Q5N A;  2H6X A;  2MMO A;  2VD0 A;  4E8E A;  1O6J A;  2YAN A;  2P5Q A;  1BX9 A;  5DAK B;  3RDW A;  3APO A;  3D22 A;  3TOU A;  2DBC A;  5H5R A;  2JAD A;  3L9V A;  3UAP A;  1YF0 A;  1TOF A;  3CSI A;  1SD8 A;  2GSQ A;  2B5E A;  2X4A A;  1TU7 A;  1J9B A;  4L0U A;  5D9V A;  2PPT A;  3GIX A;  4GXZ A;  2B7J A;  5IPG A;  1YY7 A;  4WBJ A;  4EC0 A;  1JZW A;  1ABA A;  5G1K A;  2L6D A;  2DLX A;  2DJK A;  3D4T A;  1QQ2 A;  2GDR A;  2RM5 A;  2L5O A;  4O32 A;  3HVV A;  3Q74 A;  2IFQ B;  2I1U A;  1SKR B;  3GN3 A;  3GKM A;  4YH2 A;  4ZL8 A;  4G9H A;  4L5O A;  3HY2 A;  1F3A A;  2C3T A;  4ICY A;  4OD7 A;  1WJK A;  3VPT A;  2CX3 A;  5B6N A;  2I9H A;  3LW9 A;  1HYU A;  2K9F A;  3NOF A;  4I5Q A;  2QA1 A;  2H70 A;  1T00 A;  4DSS B;  2C80 A;  1XW5 A;  2HRN A;  2O8V B;  2PMT A;  3TJK A;  1XIY A;  3DYR A;  4GQC A;  2H0G A;  2V6K A;  3C73 A;  4RI6 A;  1AAZ A;  5C04 A;  2VCX A;  2R6K A;  4IN0 A;  4QQ7 A;  3AY8 A;  1TDI A;  4MZB A;  2QC7 A;  3E9J B;  2LUS A;  3CTG A;  2WJU A;  1XCC A;  4TR3 A;  1M2B A;  5EPF A;  2LRC A;  1TK0 B;  3QAW A;  1FAA A;  3EYT A;  1XWB A;  2J9H A;  2MBT A;  3Q18 A;  2H1A A;  2DKI A;  3KIJ A;  3UBK A;  3DGQ A;  4MF5 A;  1GSU A;  4KGI A;  5CP1 A;  2R2J A;  3G9B A;  5F8B A;  4NAX A;  2RUE A;  1DUG A;  2HI7 A;  4G0K A;  3MYD A;  3UBL A;  2HLS A;  3ISO A;  3TCO A;  2QSI A;  4RUV A;  2ON5 A;  4KB3 A;  2O7K A;  3GNJ A;  2NPB A;  2A2R A;  4MJC A;  3FR3 A;  4PUF C;  5HFG A;  1XWA A;  3APQ A;  4N10 A;  3ZRD A;  3UVH A;  1T7P B;  3D0Z A;  1FG4 A;  2CT6 A;  3UAR A;  3IPZ A;  5B8A A;  1N2A A;  3N9J A;  3FK8 A;  3WD6 A;  4MZW A;  4Q5Q A;  3C71 A;  19GS A;  1EEM A;  2XPE A;  5ECO B;  2AHE A;  4FO5 A;  3L0H A;  4ZIJ A;  1AIU A;  1GTU A;  1ERT A;  4KE3 A;  3EE2 A;  3TB2 A;  5ID2 A;  2HFD A;  1V2A A;  4NXI A;  3F4T A;  2PGT A;  5DDL A;  5D9T A;  4TXV A;  1EGO A;  4BWS A;  3C1R A;  2A2P A;  4HS1 A;  3RPN A;  1X5D A;  3IA1 A;  1QXH A;  3BBY A;  3G7I A;  3R2Q A;  3FYG A;  5IOX A;  1GRX A;  1EV9 A;  1OC8 A;  2FGX A;  1GTB A;  4X43 A;  1FHE A;  3ZML A;  5CYY A;  5B6M A;  1ERV A;  4HUA A;  3LJR A;  2Z9S A;  1DBY A;  2C3Q A;  4YKF A;  2TIR A;  1IYH A;  4K7I A;  3FW2 A;  2MMZ A;  4BPY A;  1SEN A;  3LFL A;  1MD3 A;  2OE3 A;  4PX1 A;  3GKK A;  3FRC A;  4ID0 A;  4JU5 A;  5GAN D;  5ELG A;  3HZ4 A;  2KHP A;  3BCI A;  3IBH A;  4A5P A;  4MLY A;  4OO4 A;  4K2D A;  5L71 A;  3WYW A;  1E6B A;  3M0F A;  2EIO A;  1U88 A;  3ZFL A;  4ZBB A;  1MDK A;  4GTU A;  1NHO A;  1TRU A;  4I97 A;  1XFL A;  1SJZ A;  4IP6 A;  5ABR A;  1XXU A;  1RK4 A;  3GH9 A;  5F05 A;  4BVY A;  1WWJ A;  4BIK A;  4G19 A;  2DJ0 A;  1EP8 A;  5GAP D;  1OKD A;  2IWT A;  5DAK A;  3A2W A;  3FR6 A;  3HVX A;  4POB A;  5G31 A;  1M7T A;  4G10 A;  2YWN A;  2VAF A;  4XIH A;  3GA4 A;  5ECQ B;  1PQN A;  2X8H A; 
#chains in the Genus database with same CATH homology
 2E2M A;  3G7Y A;  5DJL A;  1XWC A;  1X9W B;  4IJ3 A;  4KW6 A;  3HVS A;  4PUR A;  1GUK A;  3OR5 A;  4IEL A;  2FLS A;  2X64 A;  2FUG 2;  4PXO A;  2FA8 A;  2GTU A;  5DAL B;  5HR1 A;  3VPQ A;  4FIW A;  3NIV A;  1ZYE A;  3RHB A;  2IMK A;  1OE8 A;  2WZ9 A;  3TJF A;  5KN2 A;  4MP4 A;  5FWG A;  4MJB A;  2H1B A;  3IV4 A;  1ZYQ B;  1A8Y A;  3LQ7 A;  2IFQ A;  4AJ8 A;  5D93 A;  2HYX A;  1SU9 A;  1X9M B;  2L57 A;  2PWJ A;  4Z2T A;  1T3B A;  4JR4 A;  2GVP A;  2VL2 C;  2H72 A;  1TI3 A;  2L59 A;  2PUK C;  1GSQ A;  3MAK A;  2F8F A;  3TKS A;  4DEJ A;  1AC1 A;  4DSS A;  4FYB A;  1ZMA A;  6GSS A;  2GZP A;  2G2Q A;  2VUP A;  3VWW A;  1K3O A;  1VGL A;  4BVX B;  4IGJ A;  3CBU A;  3VWU A;  1PKW A;  4CY6 A;  2JAC A;  2M72 A;  2IMD A;  4Q5F A;  1SL0 B;  3TUE A;  3FZ5 A;  3VI7 A;  5LNK e;  1JLV A;  4D73 A;  2YZU A;  2HT9 A;  3QAG A;  2GQM A;  4EO3 A;  1TK5 B;  3UJ1 A;  2MYG A;  3BCK A;  2CVD A;  2AB6 A;  4ZIL A;  3KMN A;  4ISD A;  2KLX A;  2VL2 A;  4H86 A;  4MA9 A;  3RPP A;  4G0I A;  5D96 A;  5ID2 B;  4N0Z A;  4RQR A;  5CRH A;  1AXD A;  4IKH A;  4OWY A;  3UMA A;  3H1N A;  1GNE A;  3I9V 2;  2DJJ A;  2DIY A;  3M9J A;  2LJA A;  3KGK A;  2NVL A;  5G1L A;  1KTE A;  2NBS A;  1F2E A;  2XBQ A;  3QPM A;  4F0B A;  4IHU A;  2FWG A;  4TR4 A;  4WR5 A;  2C1Y A;  2YV7 A;  1BAY A;  1GSF A;  4AF2 A;  5DQS A;  3E3E A;  2CV4 A;  3EC3 A;  4N30 A;  3H79 A;  2F9S A;  1XBS A;  3GL3 A;  1TXX A;  4J56 E;  1PRX A;  3GTU B;  1VRS D;  3IC8 A;  2FWF A;  3ERW A;  2LRT A;  4TXO A;  1F9M A;  3DKS A;  4CW9 A;  2FY6 A;  2KP2 A;  5BMU A;  2JZS A;  4XS6 A;  2LTK A;  1R7H A;  4KCE A;  2H73 A;  4EL1 A;  3IRA A;  3C1S A;  3M1G A;  5IMZ A;  2C0E A;  4JED A;  2WB9 A;  1FVJ A;  3G7J A;  4WF5 A;  2WDU A;  5D8I A;  2C8U A;  4POM A;  3DD3 A;  2ES7 A;  1OVN A;  3KP9 A;  1S3C A;  5G5F A;  4GLT A;  2JZT A;  2H6Z A;  5CRG A;  1AQV A;  5B7C A;  2QGV A;  5A4U A;  3TKS E;  1GTI A;  1F3B A;  2LS5 A;  3GUS A;  4USS A;  5DBQ A;  1O81 A;  4KSM A;  1CQH A;  2TRC P;  5JWQ B;  1K0M A;  1G6Y A;  2K8S A;  1PGT A;  1YZX A;  3O6T A;  1ZGN A;  5KN1 A;  1USB A;  2CA8 A;  1R26 A;  3PIN A;  4ULX A;  10GS A;  1UA5 A;  1R4W A;  1PX7 A;  5INY A;  4MJE A;  4MH2 A;  2MZC A;  5IPH A;  2YJ7 A;  1SJ6 A;  1Y6E A;  1HD2 A;  2H1G A;  1SK0 A;  4EIQ A;  1JZO A;  5ELA A;  1H4O A;  4HEA 2;  1AQX A;  3A2X A;  4ECC A;  3ZTL A;  2C0D A;  3L9S A;  2PVO C;  3P7X A;  4X4J A;  1XZO A;  1XW9 A;  1Z6M A;  5J41 A;  4WBR D;  2YWM A;  4DSQ A;  1O85 A;  4ZL9 A;  2EIR A;  18GS A;  3RHC A;  2GSS A;  2NDO A;  3KZQ A;  2O85 A;  5FHI A;  1PL2 A;  1SL2 B;  4HJM A;  3KM6 A;  1Z3E A;  1TRV A;  4HI7 A;  2CAQ A;  2LNS A;  1TW9 A;  1XVW A;  2MBS A;  1OKT A;  4F03 A;  1FO5 A;  3ME8 A;  1Y25 A;  2RM6 A;  2LEG A;  2F51 A;  2I3Y A;  1Z9H A;  2K18 A;  1GSD A;  4ZB9 A;  3QDN A;  3KTB A;  2QKE A;  1GSS A;  2K6V A;  1JZR A;  1FOV A;  3KMO A;  2HE3 A;  5HR3 A;  1W4V A;  1MDI A;  1BED A;  1B9X C;  3R3E A;  2KUC A;  2PVQ A;  2HSH A;  4POK A;  5DAL A;  4V1A g;  4D73 B;  2CVB A;  1Z7R A;  2P5R A;  2F8A A;  2FD3 A;  5KN0 A;  2WFC A;  2XPD A;  1NHY A;  5J3R A;  3D5J A;  4Z2R A;  1UVZ A;  1J0F A;  1WP0 A;  4X0X A;  2L6C A;  2AV4 A;  3W8J A;  5CNW A;  3HXS A;  3BOA A;  3QCP A;  5AIX A;  3IOS A;  4K0G A;  3ZFB A;  4IJI A;  3N5O A;  4KSO A;  2GQK A;  3CTF A;  4TN8 A;  2IME A;  5EVO A;  3LGC A;  5IMD A;  3CXG A;  1EOH A;  2GST A;  2N5A A;  2DJ1 A;  2HZE B;  5B8B A;  2MMA A;  4O5U A;  4KX4 A;  1GSY A;  3QMX A;  1PMT A;  3F0I A;  3DWV A;  2YJH A;  1DSB A;  3TRX A;  2M80 A;  1PD2 1;  2H19 A;  2H0H A;  5ECL B;  3TJJ A;  4BVX A;  1GSE A;  2IMF A;  1SL1 B;  5FT3 A;  5H5S A;  2OKA A;  4MPF A;  1TI1 A;  3ME7 A;  1Z7P A;  6GSU A;  3DXB A;  4TXO B;  2LV3 A;  1V57 A;  2YWI A;  4KUN A;  3F8U A;  3SWL A;  4XRD A;  5IMC A;  1JFU A;  1G7E A;  1PN0 A;  1DE2 A;  2YOI A;  13GS A;  2DSA A;  4HZ2 A;  5ECM B;  3TRQ A;  5HFK A;  1LU4 A;  3IK7 A;  4I2U A;  5LCZ A;  1ON4 A;  4KDU A;  3IE3 A;  2H8L A;  5JWO B;  2DJ2 A;  2R0P A;  2CVK A;  5GST A;  2VD1 A;  1SYR A;  4K9Z A;  4GSS A;  4WEY A;  2V41 A;  5CRD A;  3ERG A;  3IC4 A;  1O8W A;  4XHM A;  5IMF A;  4JZQ A;  1VF4 A;  5A4W A;  3IXR A;  3F3Q A;  2VCZ A;  1YEP A;  3HCZ A;  1X9S B;  2VCT A;  4I8B A;  4YQM A;  1M2D A;  3GTU A;  1M2A A;  4PNF A;  5DCH A;  2C4J A;  3H8Q A;  2JL4 A;  1YKC A;  2H71 A;  1OAZ A;  2UZ8 A;  2CZ3 A;  2HSY A;  1Q98 A;  3FZ4 A;  4ACS A;  4XS1 A;  3EIN A;  3MWH A;  5G5E A;  1HNB A;  1FB0 A;  4I2T A;  4NV2 A;  5BRT A;  2QA2 A;  2L4Q A;  5CRE A;  4AGS A;  3VWX A;  4MDC A;  3EMP A;  1GH2 A;  1A24 A;  1KBN A;  1Q4J A;  2V6O A;  1LBK A;  1VF1 A;  1F37 A;  1GTA A;  3O3T A;  3E0U A;  3FZ9 A;  4WR4 A;  4G0L A;  2B5X A;  3LG6 A;  3JCM L;  1TRS A;  2C0F A;  2WUL A;  3EWL A;  3HZ8 A;  5F0G A;  3F4R A;  4DSR A;  4POL A;  5IO0 A;  4NHW A;  3IR4 A;  3HD5 A;  4J57 E;  5J9B A;  1PL1 A;  1WRY A;  3KTL A;  2R37 A;  4K7O A;  1FW1 A;  2YCD A;  2N5B A;  4OO5 A;  3PPU A;  3ZZX A;  1A0R P;  5COH A;  4NPB A;  5ECN B;  3HJO A;  1B4Q A;  4HU7 A;  1WE0 A;  4CDO A;  1CQG A;  2E0Q A;  2R4V A;  1X5E A;  5ECK B;  3NZN A;  1A8L A;  22GS A;  6GST A;  2X8G A;  4FYU A;  3I69 A;  5JCU A;  16GS A;  1GL8 A;  1GUL A;  2JZR A;  2H01 A;  3L9U A;  4WET A;  3DIE A;  3EU3 A;  1I5G A;  4LL1 B;  4MK3 A;  5HR0 A;  4KCA A;  3HHV A;  4BL7 B;  1EV4 A;  1T8E B;  1B9Y C;  2B6M A;  2VL9 A;  2ZUP A;  5DQY A;  3J7Y k;  3KH9 A;  3VLN A;  4F2I A;  7GSS A;  3IAS 2;  1LJR A;  4TVE A;  3L4N A;  1GNW A;  1RQM A;  2GT6 A;  6GSY A;  5IQY A;  2FCH A;  3A5I A;  1BJX A;  3F4S A;  3K8N A;  4V2L A;  1EOG A;  4GF0 A;  3O76 A;  3LXT A;  3PR8 A;  2OJL A;  1XW6 A;  2LKU A;  4GST A;  2OE0 A;  3ZVJ A;  3I43 A;  2WGR A;  3ZRE A;  3GL5 A;  2V32 A;  2HZF A;  4BA7 A;  2OAD A;  2E2G A;  2YN1 A;  2R5G A;  2YPM A;  4FH8 A;  2GLR A;  1PKZ A;  1URM A;  2VL3 A;  4QL9 A;  1GUH A;  1WOU A;  2TRX A;  2LQO A;  2O87 A;  4KA0 A;  2G0F A;  3TJB A;  1THO A;  2DIZ A;  4ECI A;  1WMJ A;  1K0N A;  1KEB A;  4MF6 A;  4ZBD A;  1M0U A;  2E7P A;  2HZE A;  3EPT A;  3ZIV A;  3DRN A;  2PN8 A;  3APS A;  6GSX A;  1A2J A;  2CAI A;  4OCE A;  5AGY A;  1NSW A;  1WPI A;  4XS4 B;  3ZYW A;  2B5Y A;  5J4U A;  2X8C A;  2I4A A;  2GZZ A;  4PUA A;  4MF7 A;  2N5F A;  1A2M A;  1VF2 A;  2BTO T;  2HRA A;  5ECI B;  5F06 A;  1ERW A;  2BMX A;  4IQ1 A;  3GST A;  1FOH A;  3RAZ A;  3I6A A;  4MMM A;  4XTS A;  4V2M A;  4GQF A;  4HU9 A;  1SD9 A;  3Q19 A;  2B1K A;  3TDG A;  4LA1 A;  1QFN A;  2YP6 A;  1BG5 A;  1HNA A;  4GCI A;  2VCW A;  4KF9 A;  4V2N A;  3P2A A;  1YDK A;  2VCQ A;  1TTZ A;  3IK9 A;  3D4M A;  5D9X A;  2FNO A;  2C0G A;  2H76 A;  4PQH A;  2C3N A;  3A3T A;  4HJ2 A;  3IAM 2;  1THX A;  1O8X A;  1N8J A;  4IP1 A;  2DKH A;  4PQI A;  4Z7X A;  5KOW A;  1MTC A;  3CSH A;  1X5C A;  2LQQ A;  3MSZ A;  4O5R A;  3TGZ A;  4TW5 A;  2A4H A;  3EMX A;  11GS A;  1SKW B;  4HQZ A;  4ILF A;  3QFA C;  1FB6 A;  5DJM A;  1QGV A;  2HSM A;  3W8S A;  4YQV A;  1GWC A;  5IIZ A;  5H5Q A;  2JSZ A;  2DC5 A;  1K0D A;  3GH6 A;  2H6Y A;  1SK2 A;  1BQ7 A;  3DVX A;  2IL3 A;  2P0G A;  4ZB6 A;  3U5R E;  4L0W A;  1K0C A;  3LWA A;  3GMF A;  1ACV A;  4N0V A;  2DJ3 A;  1ZOF A;  1SJI A;  3TKQ A;  3J7Y b;  3RBT A;  1B8X A;  3GRX A;  3F9U A;  3LXZ A;  2PER A;  2OBI A;  1TKD B;  3P90 A;  4XRA A;  1WIK A;  2AYT A;  4IBP A;  2VLT A;  4F9Z A;  4JR6 A;  3LEF A;  2NTO A;  3D21 A;  1Z6N A;  5CRW A;  3C7M A;  1XPV A;  3MNG A;  5ECS A;  5KEJ A;  1AUC A;  2H1D A;  1SYX A;  2H30 A;  3QFB C;  4ZXG A;  4MH3 A;  1GP1 A;  2BJX A;  1ERU A;  1GLP A;  2B3S A;  3HJM A;  3FY7 A;  1MD4 A;  3DVW A;  2VCV A;  1YJ6 A;  3ZMK A;  4HZ4 A;  1A2L A;  2HRK A;  2LJK A;  2VO4 A;  5AN1 A;  4K5S A;  5KN3 A;  1TU8 A;  2R0G A;  1PX6 A;  3LYK A;  3FR9 A;  4MAB A;  4EDZ A;  2A2S A;  1RW1 A;  4MZC A;  1EEJ A;  3CSJ A;  1IYI A;  4WF4 A;  4MNN A;  1J08 A;  1V58 A;  3VI5 A;  4TR1 A;  6GSW A;  4J2F A;  3FKF A;  5E4W A;  5JCW A;  5ENU A;  2MMN A;  5J5N A;  1R5P A;  1TP9 A;  3UVT A;  4BWQ A;  2ON7 A;  2PBJ A;  2OA7 A;  1R5A A;  3ERF A;  4QL7 A;  1PSQ A;  1EZK A;  5A4V A;  2JSY A;  1ZL9 A;  1JZD A;  4KND A;  4MJA A;  5IMV A;  1QK8 A;  2H66 A;  6GSV A;  1YKA A;  2OE1 A;  5JCG A;  1S3D A;  3F6D A;  2DML A;  3V1W A;  1X0R A;  3M9K A;  5D73 A;  2VLV A;  5CAX A;  4BL7 A;  2I81 A;  2OBK A;  3LYP A;  1B4P A;  4O92 A;  4K5R A;  5KOX A;  5J9C A;  3SBC A;  1EP7 A;  1UC7 A;  1G6W A;  3TKR A;  2CX4 A;  4ECB A;  3UOM A;  2FWH A;  3DEX A;  3VFI A;  3GX8 A;  2FWE A;  2M46 A;  4XCS A;  2GSR A;  1C72 A;  2AUV A;  1MEK A;  4RQX A;  4NHZ A;  5E59 A;  2R3X A;  4K0N A;  3FEU A;  3WGD A;  5IOW A;  3W6G A;  1NW2 A;  4IQA A;  2KP1 A;  1T4Y A;  4O5Q A;  3F63 A;  3QAV A;  3LSZ A;  3KXO A;  4LL4 B;  1EGR A;  4WKW A;  4CY8 A;  1MDJ A;  3CMI A;  3QD9 A;  4MCU A;  4PQ1 A;  2F3M A;  3BJ5 A;  2KOK A;  2GQL A;  4K2X A;  2CZ2 A;  3GUR A;  5EY6 A;  1NM3 A;  1M9B A;  2XHF A;  1G7O A;  4Q5R A;  4ZBA A;  5LD0 A;  3KH7 A;  1B48 A;  1G0T A;  3WGE A;  3WGX A;  1HQO A;  3DML A;  2ZNM A;  3VWV A;  1A23 A;  3WT1 A;  3GKX A;  2L5L A;  2LNT A;  5DCG A;  3GYK A;  1ZYN A;  2R0C A;  4OFN A;  4WXT A;  4LMW A;  4K7N A;  1K3Y A;  5EL8 A;  4XS4 A;  2ZCT A;  1OC9 A;  4YAP A;  3IHQ A;  3GV1 A;  1GUM A;  1ZZY A;  2D2Z A;  2X99 A;  3Q6O A;  1O7U A;  3GSS A;  4JE1 A;  4IVF A;  1PN9 A;  3MDK A;  2DMM A;  2JU5 A;  1SKS B;  3HYP A;  2XC2 A;  1W89 A;  1PA3 A;  4GWR A;  4PGT A;  3CRU A;  1ZCP A;  4EKZ A;  3HA9 A;  2ALB A;  3ED3 A;  4TKY A;  3KJY A;  2H74 A;  4PTS A;  3VK9 A;  5AIV A;  2HNL A;  2V2G A;  3EUR A;  1T1V A;  2J23 A;  3PH9 A;  5ECR B;  5DVB A;  1S3A A;  5HFI A;  2A4V A;  1BYE A;  1M9A A;  3QOU A;  3ZIT A;  4GSN A;  4YQU A;  4YKG A;  1T4Z A;  3HKR A;  4NV5 A;  4Z2U A;  3GFK A;  1XWK A;  17GS A;  4KDY A;  1DE1 A;  1M99 A;  1K0A A;  1K0O A;  1OE7 A;  2VLU A;  3KCM A;  4E8H A;  2VOC A;  1YF1 A;  4L5L A;  1AQW A;  3F6F A;  1O73 A;  1XVQ A;  4TR1 B;  2RII A;  4KH7 A;  1U3A A;  1E2Y A;  3ZLP A;  3H93 A;  1TRW A;  4IW9 A;  2FA4 A;  3FHK A;  2L4C A;  2GT5 A;  3PGT A;  3H4K A;  3TKP A;  3CRT A;  3TKS C;  1VF3 A;  2WCI A;  4EVM A;  1K0B A;  4X1U A;  2WS2 A;  1V9W A;  20GS A;  3CYN A;  4OCF A;  3LOR A;  2GS3 A;  4OMV A;  1XWG A;  5JWR B;  4ML1 A;  1JHB A;  3ZL5 A;  3VUR A;  3U6V A;  1K3L A;  4GRF A;  3TOT A;  2B1L A;  4EE0 A;  5C00 A;  2B7K A;  3M3M A;  3GKN A;  4OFM A;  4HQS A;  1OYJ A;  4AJ7 A;  4K6X A;  2IPA A;  1XOA A;  4LMV A;  3KEB A;  1UN2 A;  2GZY A;  2V1M A;  4ML6 A;  2LJR A;  2YZH A;  4V1A p;  4KDX A;  4FYC A;  2H75 A;  4EXJ A;  3GX0 A;  4ZL7 A;  3P8W A;  4HOJ A;  2FHE A;  4TOP A;  2VM1 A;  1AW9 A;  1HNC A;  5IO2 A;  4EIP A;  3M8N A;  4K1F A;  2RUF A;  2P31 A;  3HJP A;  1YQ1 A;  4ZB8 A;  4L8E A;  4F0C A;  3FZA A;  3L78 A;  4N11 A;  1ILO A;  4TR0 A;  3F3R A;  1YEX A;  5A5K A;  4LLR A;  1Z5Y E;  2H0I A;  4JBB A;  4RI7 A;  1V40 A;  2EIQ A;  1ZYP A;  1GLQ A;  3MIX A;  3D6I A;  3KP8 A;  4EDY A;  3US3 A;  3FMW A;  3QR6 A;  5ECP B;  1A0F A;  1ST9 A;  8GSS A;  1SK1 A;  3EVI A;  4NMU A;  1KNG A;  2AAW A;  4K8M A;  1JLW A;  4YAV A;  2O89 A;  5AIS A;  5GZZ B;  1F6M C;  2HRF A;  4AJ6 A;  2HXK A;  5HQP A;  4FQU A;  2VM2 A;  1QUW A;  3ZIJ A;  1QMV A;  2PU9 C;  5D9W A;  1OC9 B;  2XBI A;  2YWO A;  4CHS A;  2LRN A;  5IM9 A;  1EWX A;  3A2V A;  3IDV A;  4F82 A;  1H75 A;  4MPG A;  1TK8 B;  4DVC A;  3S9F A;  5G2Z A;  4KAE A;  4I6X A;  2IJY A;  2REM A;  2CQ9 A;  9GSS A;  2EC4 A;  3ZVJ D;  1I9D A;  4OFT A;  5GSS A;  5HR2 A;  5IMA A;  1XOB A;  3WT2 A;  2K8V A;  1OC3 A;  1V98 A;  3TRP A;  12GS A;  3HDC A;  1U3I A;  5F07 A;  3KD0 A;  5G30 A;  3A5W A;  2VIM A;  2IN3 A;  4EF0 A;  1U87 A;  3UIW A;  2GGT A;  2AJQ B;  3BD2 A;  3TJG A;  2WRT A;  3GHA A;  4O7H A;  4NWY A;  4HDE A;  3UL3 A;  14GS A;  2YNX A;  2RLI A;  1U6T A;  4ECJ A;  4G2E A;  1ML6 A;  4EUY A;  2YV9 A;  4PNG A;  1TJD A;  3C8E A;  2X49 A;  5ECH B;  2LST A;  2IIY A;  2OAC A;  5CO3 A;  4TRX A;  4P3Y B;  1FVK A;  3UEM A;  2IMI A;  4BVY B;  3EU4 A;  3IHG A;  4JRR A;  4IS0 A;  4Q5N A;  2H6X A;  2MMO A;  2VD0 A;  4E8E A;  1O6J A;  2YAN A;  2P5Q A;  1BX9 A;  5DAK B;  3RDW A;  3APO A;  3D22 A;  3TOU A;  2DBC A;  5H5R A;  2JAD A;  3L9V A;  3UAP A;  1YF0 A;  1TOF A;  3CSI A;  1SD8 A;  2GSQ A;  2B5E A;  2X4A A;  1TU7 A;  1J9B A;  4L0U A;  5D9V A;  2PPT A;  3GIX A;  4GXZ A;  2B7J A;  5IPG A;  1YY7 A;  4WBJ A;  4EC0 A;  1JZW A;  1ABA A;  5G1K A;  2L6D A;  2DLX A;  2DJK A;  3D4T A;  1QQ2 A;  2GDR A;  2RM5 A;  2L5O A;  4O32 A;  3HVV A;  3Q74 A;  2IFQ B;  2I1U A;  1SKR B;  3GN3 A;  3GKM A;  4YH2 A;  4ZL8 A;  4G9H A;  4L5O A;  3HY2 A;  1F3A A;  2C3T A;  4ICY A;  4OD7 A;  1WJK A;  3VPT A;  2CX3 A;  5B6N A;  2I9H A;  3LW9 A;  1HYU A;  2K9F A;  3NOF A;  4I5Q A;  2QA1 A;  2H70 A;  1T00 A;  4DSS B;  2C80 A;  1XW5 A;  2HRN A;  2O8V B;  2PMT A;  3TJK A;  1XIY A;  3DYR A;  4GQC A;  2H0G A;  2V6K A;  3C73 A;  4RI6 A;  1AAZ A;  5C04 A;  2VCX A;  2R6K A;  4IN0 A;  4QQ7 A;  3AY8 A;  1TDI A;  4MZB A;  2QC7 A;  3E9J B;  2LUS A;  3CTG A;  2WJU A;  1XCC A;  4TR3 A;  1M2B A;  5EPF A;  2LRC A;  1TK0 B;  3QAW A;  1FAA A;  3EYT A;  1XWB A;  2J9H A;  2MBT A;  3Q18 A;  2H1A A;  2DKI A;  3KIJ A;  3UBK A;  3DGQ A;  4MF5 A;  1GSU A;  4KGI A;  5CP1 A;  2R2J A;  3G9B A;  5F8B A;  4NAX A;  2RUE A;  1DUG A;  2HI7 A;  4G0K A;  3MYD A;  3UBL A;  2HLS A;  3ISO A;  3TCO A;  2QSI A;  4RUV A;  2ON5 A;  4KB3 A;  2O7K A;  3GNJ A;  2NPB A;  2A2R A;  4MJC A;  3FR3 A;  4PUF C;  5HFG A;  1XWA A;  3APQ A;  4N10 A;  3ZRD A;  3UVH A;  1T7P B;  3D0Z A;  1FG4 A;  2CT6 A;  3UAR A;  3IPZ A;  5B8A A;  1N2A A;  3N9J A;  3FK8 A;  3WD6 A;  4MZW A;  4Q5Q A;  3C71 A;  19GS A;  1EEM A;  2XPE A;  5ECO B;  2AHE A;  4FO5 A;  3L0H A;  4ZIJ A;  1AIU A;  1GTU A;  1ERT A;  4KE3 A;  3EE2 A;  3TB2 A;  5ID2 A;  2HFD A;  1V2A A;  4NXI A;  3F4T A;  2PGT A;  5DDL A;  5D9T A;  4TXV A;  1EGO A;  4BWS A;  3C1R A;  2A2P A;  4HS1 A;  3RPN A;  1X5D A;  3IA1 A;  1QXH A;  3BBY A;  3G7I A;  3R2Q A;  3FYG A;  5IOX A;  1GRX A;  1EV9 A;  1OC8 A;  2FGX A;  1GTB A;  4X43 A;  1FHE A;  3ZML A;  5CYY A;  5B6M A;  1ERV A;  4HUA A;  3LJR A;  2Z9S A;  1DBY A;  2C3Q A;  4YKF A;  2TIR A;  1IYH A;  4K7I A;  3FW2 A;  2MMZ A;  4BPY A;  1SEN A;  3LFL A;  1MD3 A;  2OE3 A;  4PX1 A;  3GKK A;  3FRC A;  4ID0 A;  4JU5 A;  5GAN D;  5ELG A;  3HZ4 A;  2KHP A;  3BCI A;  3IBH A;  4A5P A;  4MLY A;  4OO4 A;  4K2D A;  5L71 A;  3WYW A;  1E6B A;  3M0F A;  2EIO A;  1U88 A;  3ZFL A;  4ZBB A;  1MDK A;  4GTU A;  1NHO A;  1TRU A;  4I97 A;  1XFL A;  1SJZ A;  4IP6 A;  5ABR A;  1XXU A;  1RK4 A;  3GH9 A;  5F05 A;  4BVY A;  1WWJ A;  4G19 A;  2DJ0 A;  1EP8 A;  5GAP D;  1OKD A;  2IWT A;  5DAK A;  3A2W A;  3FR6 A;  3HVX A;  4POB A;  5G31 A;  1M7T A;  4G10 A;  2YWN A;  2VAF A;  4XIH A;  3GA4 A;  5ECQ B;  1PQN A;  2X8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...