3TJFA

Crystal structure of human peroxiredoxin iv c51a mutant in reduced form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
195
structure length
195
Chain Sequence
HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin-4
publication title Crystal Structure of Reduced and of Oxidized Peroxiredoxin IV Enzyme Reveals a Stable Oxidized Decamer and a Non-disulfide-bonded Intermediate in the Catalytic Cycle.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 195
sequence length 195
chains with identical sequence B, C, D, E
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tjfA00
2YPMA 1JZRA 1X0RA 1H4OA 5D9TA 5LCZA 5IO2A 4GSNA 3MNGA 3ZFBA 2VM2A 4OCEA 2OJLA 2M80A 4EVMA 1FW1A 4HDEA 4BL7A 1EOHA 2CZ2A 2CX4A 1TU8A 4YQMA 3GKMA 1PL2A 3KTBA 1Y25A 3GRXA 2PPTA 3I43A 4J2FA 2ON7A 4HZ4A 3S9FA 2GQMA 6GSUA 2DIZA 3C8EA 2JSYA 3G7JA 2OE0A 3HZ8A 1CQHA 2NTOA 5KEJA 1O73A 1BEDA 3ED3A 3Q18A 1YZXA 4ZL9A 1ILOA 3ZMLA 1PX7A 2B6MA 2VCVA 1U88A 1EV4A 2YWMA 5G5FA 2DLXA 4G9HA 1V40A 2E0QA 3KCMA 4CDOA 3VURA 1XW5A 3HCZA 2DJ0A 5COHA 1K0DA 3M9JA 1N2AA 3IHQA 3NIVA 1UVZA 4QQ7A 4TR1B 2YWNA 3TRXA 2B5EA 4K0GA 4HU7A 4ZXGA 2CX3A 1SD8A 4KB3A 4BWQA 2I81A 4IBPA 5IO0A 3HYPA 4F82A 3WGDA 1ML6A 1GSYA 2MMZA 2KHPA 1PD21 1GLPA 5IMVA 3KZQA 4ZB8A 3BBYA 3ZITA 2TIRA 2P5QA 2RM5A 4XRAA 2XC2A 4KA0A 3A2VA 4D73A 1JLWA 3LQ7A 2R37A 2WS2A 1GNWA 1GRXA 1O7UA 1V57A 1HNAA 2R4VA 4IP1A 3EMPA 2L4QA 3GHAA 1FB0A 2H1BA 1EP8A 4OFNA 4GLTA 5IMAA 3QAGA 1SK2A 3EVIA 8GSSA 4MMMA 5DDLA 2DC5A 1Z5YE 5G1KA 1OKTA 4G2EA 1GTUA 4NPBA 3BD2A 1QFNA 4XS4A 4BWSA 2BJXA 3QMXA 3A5WA 3VWVA 5AIXA 2CVBA 2I4AA 3TKQA 2H01A 1TK5B 2LTKA 2MZCA 2H75A 2FCHA 1SJ6A 3E9JB 3EU4A 2HZEA 1YJ6A 1TW9A 5D93A 2KLXA 5HQPA 5ECHB 2OE1A 3WT2A 2KOKA 2N5AA 5ABRA 3DD3A 2H8LA 1JHBA 1QGVA 4ECIA 3TJFA 1IYIA 2QC7A 4KDYA 4OO5A 3HHVA 1WOUA 1PL1A 1XVQA 5ECIB 3ZREA 5CP1A 1G0TA 2MYGA 3D5JA 4KUNA 4KSOA 4JR4A 2NVLA 3TJJA 5EVOA 3QCPA 4LLRA 2X8GA 3WD6A 4HZ2A 2M46A 4DVCA 5HFGA 1QUWA 2C4JA 2VD1A 5IIZA 2OA7A 1PKZA 3OR5A 4ZB6A 2IFQA 4X43A 1A23A 1GWCA 1PN9A 1GUKA 2P0GA 1DSBA 2VLTA 5HFIA 1EGOA 2A2SA 2C0GA 3LWAA 3G9BA 1XFLA 2GTUA 2LRTA 1A2JA 1A0RP 1M2BA 2OE3A 2NBSA 3IRAA 5L71A 2ES7A 4O32A 3FZ4A 1T4ZA 5D8IA 2C0EA 4N0VA 3IK7A 1YKAA 3C1SA 2GVPA 4HS1A 2KP1A 3EE2A 3TB2A 3P7XA 1X9MB 4ZBAA 2XPEA 2YP6A 1SL1B 4N11A 3D4MA 3KM6A 2E2GA 2HI7A 5AIVA 3FKFA 4ML1A 1MD3A 4ZBDA 3F6FA 4Q5QA 2H76A 3TUEA 4MJAA 1QQ2A 4TXOB 3DYRA 3VWWA 4LA1A 4MF6A 3HZ4A 1VF1A 2IMDA 3H93A 4K1FA 1JZWA 2I1UA 5DAKA 16GSA 3BJ5A 2L6CA 4ZB9A 5JWQB 1VRSD 2LV3A 5ECQB 2D2ZA 4F2IA 1YY7A 1Z6MA 4OO4A 3L4NA 2E7PA 4FIWA 4HOJA 4DSRA 1R4WA 3FRCA 3ZMKA 3HJOA 2R2JA 2AJQB 3QR6A 5G2ZA 4PUAA 1ZGNA 1HNCA 1UN2A 2HLSA 11GSA 4FYUA 1TTZA 4NWYA 1QK8A 3QAVA 5ECRB 2C80A 1OE8A 3GUSA 5JWOB 1MTCA 1U6TA 2C0DA 4NV5A 1GTAA 2FLSA 1RK4A 3JCML 3SWLA 3VWUA 5DVBA 3H4KA 3DXBA 2L6DA 1XOAA 5ECPB 3TKSA 2YANA 2O89A 1TU7A 3EMXA 4TR0A 2C0FA 3EU3A 1G7OA 1DE1A 2IFQB 2YWOA 3TRQA 5JCUA 1MDJA 3I6AA 5CRGA 3F4SA 3P2AA 3ERGA 3KH7A 1TRWA 1FVKA 2EC4A 4WR4A 2H1GA 3LFLA 4PXOA 2VL9A 1TK8B 1V9WA 2FWEA 4TR1A 2LNTA 2V2GA 1BAYA 5DCGA 3I69A 1A24A 4EDYA 1WRYA 3APSA 4K6XA 3QD9A 3QDNA 4K0NA 4IHUA 2H1DA 3M1GA 5DBQA 1EV9A 5HR3A 5IPHA 5CAXA 3L9SA 1S3AA 3ZZXA 2F8AA 4MZBA 1AXDA 4OFTA 1MEKA 4OFMA 5GZZB 1GULA 3L9UA 1S3CA 4HUAA 1FAAA 1CQGA 3ERFA 4EL1A 2KP2A 3TGZA 1FOVA 4MP4A 2VL2A 3UAPA 1XIYA 4KX4A 3GKXA 3EWLA 2VOCA 5E4WA 3H79A 1R26A 2FWFA 3GL5A 2AYTA 3ME8A 1EWXA 1SL0B 1UA5A 2C1YA 4JBBA 3GX0A 5CRDA 2IJYA 3W8JA 4MLYA 2J23A 4KAEA 3EURA 3TJKA 2YV9A 2H73A 2VCZA 1SU9A 4DSSB 4RI7A 5AISA 1R7HA 4POLA 1ZYEA 4NAXA 5IOXA 1SK0A 3HJMA 3IA1A 5A4UA 1ZCPA 3IXRA 2Z9SA 5IMZA 1ZYQB 2YV7A 5EY6A 5EL8A 2PN8A 4LMWA 4WBJA 1LJRA 2VLUA 2VO4A 1K0MA 5FWGA 1SKWB 3ME7A 1AQXA 2VIMA 4X1UA 3E0UA 2FWGA 4GSTA 2H6ZA 7GSSA 4MZCA 3UBLA 4FYCA 3FK8A 2WULA 2GSQA 3P90A 1Y6EA 2ALBA 3VWXA 1F3BA 4PQ1A 2CT6A 1OAZA 3C71A 4ULXA 10GSA 1AW9A 3M0FA 2FA8A 3IBHA 3IDVA 2GSRA 5D9WA 5CNWA 2LJAA 2GSSA 5E59A 4EF0A 2H0GA 3FYGA 2QGVA 5G31A 1ZZYA 3KIJA 3F4RA 2IIYA 2RLIA 3GURA 4IS0A 4HEA2 3C73A 5IMCA 1GNEA 4PUFC 2DJJA 1AIUA 2GQLA 2LRCA 5GAND 3TKSC 1WE0A 1B9XC 1GSUA 3A2XA 4GQCA 4FO5A 3J7Yb 1URMA 1IYHA 3WYWA 4L5LA 5JCGA 3FR6A 3Q6OA 2WZ9A 1SK1A 3GNJA 3PR8A 2WB9A 2JACA 2LUSA 4IKHA 2L5LA 3HD5A 2GZPA 3D4TA 2PU9C 1NSWA 3UMAA 3UEMA 3KP8A 3ZLPA 3D0ZA 1K0CA 4I2TA 1XPVA 2L57A 4QL9A 5A4VA 2CVDA 3U5RE 3ZFLA 2HZFA 1F37A 1XWGA 2WFCA 2FWHA 1NHOA 1WJKA 1ERVA 4PURA 2JADA 4MF7A 1TJDA 5A5KA 2OBIA 3RPPA 4TVEA 2V1MA 1SJZA 2YZHA 1B4QA 2DJ1A 5KN0A 4V2MA 2V41A 3HVSA 4TXOA 3M9KA 1WIKA 2FNOA 5ELGA 1KTEA 1SYXA 5F8BA 4EUYA 1HYUA 2LNSA 1FHEA 2X99A 3L78A 4GRFA 1K3OA 2P5RA 2FGXA 3KJYA 5DJMA 3F4TA 4N0ZA 3LSZA 3VFIA 1OC9B 2DJ2A 2N5FA 5ECKB 4LMVA 1ZMAA 2RM6A 4HU9A 3CSJA 1TI3A 2LS5A 1USBA 4F03A 4KGIA 2WCIA 5JCWA 4KDUA 1SENA 1B9YC 1TRSA 1U3AA 4EKZA 4EE0A 1Z9HA 3G7IA 2H71A 4MJCA 3GN3A 4O5RA 2H74A 4HQSA 4I6XA 4WKWA 1BYEA 1ZL9A 1ON4A 2GZYA 3PGTA 1NW2A 3TCOA 2CZ3A 3G7YA 2WRTA 3FZ9A 3DMLA 3FZAA 1K0BA 3HJPA 4PQIA 5G30A 2IPAA 2BTOT 4XS6A 5J9BA 4IJ3A 4E8HA 1E2YA 1EOGA 2FY6A 3CMIA 5KN1A 18GSA 2DMLA 3VPQA 1XWBA 1UC7A 2YWIA 1TKDB 3V1WA 3KD0A 1M9BA 1I9DA 1SD9A 1VGLA 1EGRA 4F0CA 9GSSA 4WEYA 1F3AA 1O6JA 2LRNA 2DSAA 2P31A 3W8SA 2O8VB 2EIQA 3Q19A 5IOWA 1T1VA 2CV4A 2HNLA 3WT1A 1KNGA 2HRNA 2PERA 2K8SA 4L0UA 1TK0B 3KTLA 5EPFA 3GSSA 5ID2B 4IP6A 1NM3A 5KN2A 5G1LA 1W4VA 3M8NA 3CSIA 3J7Yk 3LXTA 1HNBA 3TJGA 3RPNA 4N30A 2LJRA 3O76A 1MDKA 4MF5A 2HXKA 2ZUPA 5B6MA 5HR0A 3TJBA 3HDCA 1GUMA 1LU4A 1M0UA 3UJ1A 1Z6NA 1EP7A 2DJKA 2C3TA 2JU5A 2R3XA 3QAWA 5FT3A 1ERUA 4PNFA 4H86A 2A2RA 5IMFA 2GQKA 4MJEA 2GSTA 1YQ1A 1PA3A 1PSQA 3RHBA 3D21A 3GKNA 4WETA 1A8LA 2BMXA 2XBIA 2YJ7A 1F2EA 5C00A 3GMFA 1X5EA 4V2NA 1HD2A 4DSSA 2X8CA 4JR6A 2L59A 3IC4A 3IR4A 4N10A 3E3EA 2NPBA 4MZWA 1ABAA 4MPGA 2IN3A 4RI6A 3N5OA 3H8QA 3TOTA 5IM9A 5F06A 1BG5A 2O7KA 2ON5A 4I97A 19GSA 3GYKA 2V6OA 4K7NA 1DE2A 3UARA 4IVFA 1WWJA 3BCIA 3UVHA 2B1KA 2H66A 2VCTA 4RQXA 4I2UA 3P8WA 2H72A 3KP9A 4TW5A 3IV4A 4ECCA 2AB6A 4KH7A 3F3RA 17GSA 5HR2A 1THXA 2FA4A 3FEUA 2OADA 4OCFA 2HFDA 14GSA 4RQRA 2MBSA 5J3RA 5DALB 3NZNA 4Q5FA 1GSFA 5GSSA 3LGCA 4E8EA 6GSVA 5F0GA 2HSHA 3BOAA 1MD4A 3QPMA 4NXIA 3DGQA 1H75A 1XWAA 1AUCA 3UOMA 2X8HA 1J08A 2J9HA 1JLVA 5A4WA 2LEGA 4XIHA 5IMDA 2IL3A 4KCEA 2TRXA 3AY8A 1A2LA 4POBA 4F9ZA 2RUEA 3IAM2 1OYJA 4TN8A 1PRXA 1XOBA 2MMAA 2K9FA 13GSA 3LORA 2YNXA 3F0IA 3O3TA 6GSYA 2VL3A 3IK9A 3LJRA 3O6TA 3FY7A 4LL1B 4I8BA 5J4UA 2PGTA 5ENUA 4GWRA 2F51A 3DVWA 6GSXA 4YH2A 3N9JA 1YF1A 4CW9A 3GL3A 2JZTA 4DSQA 1A8YA 3LYPA 3DRNA 1DBYA 4MJBA 1PQNA 2I9HA 4IN0A 5F05A 4MCUA 1A2MA 3TKRA 1OC3A 1SKSB 3PH9A 4NV2A 2H70A 3NOFA 3GV1A 1ACVA 3KMNA 3FR9A 1K0NA 3CSHA 4IQAA 4EXJA 3KH9A 5ECMB 1XZOA 1THOA 2PVOC 3M3MA 4TOPA 4ECJA 2B5YA 2VLVA 3K8NA 3GTUB 1LBKA 1XW6A 3VLNA 1ERWA 2RUFA 1T4YA 4JU5A 1OC9A 2ZCTA 2GT5A 5CRHA 3TOUA 4WXTA 2AAWA 5J41A 1WMJA 1WP0A 3KMOA 4AJ7A 4AJ6A 2FUG2 4DEJA 3GH6A 4ILFA 3R2QA 2F8FA 4XCSA 3APOA 1MDIA 1SKRB 3LG6A 4TR4A 1YEXA 1GSQA 1RQMA 1VF2A 3MSZA 2IMIA 5ECSA 3QFAC 4JRRA 5ECNB 4V1Ag 3FW2A 4OD7A 3DEXA 3ZVJD 2VUPA 3RDWA 4NHWA 3VI5A 4IQ1A 1OKDA 1Q98A 4GTUA 1FB6A 2XPDA 4YAVA 4GSSA 1WPIA 5DCHA 3UVTA 3KXOA 5AGYA 3CTFA 4Q5NA 1C72A 4JE1A 4J56E 1BX9A 5GSTA 1T8EB 2GZZA 2NDOA 3GFKA 4IJIA 2VM1A 3A3TA 1QXHA 2JZRA 4L5OA 1T3BA 4WBRD 5AN1A 4HJMA 1O85A 1VF3A 2WDUA 1G7EA 2PWJA 3CBUA 5J5NA 2G0FA 1B8XA 3Q74A 1Z7RA 2CVKA 2XBQA 3LXZA 3H1NA 4L0WA 1K3YA 3WGXA 1W89A 5ID2A 1RW1A 3GSTA 2PUKC 4IW9A 1SJIA 2B5XA 2YCDA 1OVNA 5C04A 22GSA 5HR1A 2CQ9A 3IE3A 1GSDA 3W6GA 2MMNA 1M7TA 4ID0A 3QFBC 2FHEA 2GLRA 4QL7A 4GCIA 2FD3A 1F9MA 3IAS2 2VAFA 2H6YA 1M9AA 4I5QA 1X9SB 4MDCA 4TXVA 1DUGA 3KGKA 2H6XA 1KBNA 1S3DA 6GSSA 4MABA 1T7PB 2JL4A 1G6YA 4LL4B 3GX8A 2YOIA 3CYNA 3DWVA 2CAQA 2VL2C 1YF0A 4FYBA 1FO5A 3ERWA 3VK9A 1JZDA 4PNGA 4WF4A 1YKCA 4AF2A 4IELA 4YAPA 4Z7XA 2PBJA 2OKAA 1GUHA 1TP9A 1U3IA 4K7OA 2HRFA 4K8MA 2AHEA 5H5RA 2R5GA 3RBTA 3HVXA 3VI7A 1QMVA 1O8WA 5FHIA 5F07A 4EC0A 1AQVA 1TOFA 4POMA 1PGTA 2HT9A 2LQOA 3APQA 1R5PA 4TRXA 3RAZA 3F9UA 5D73A 2WJUA 2L5OA 2A4VA 4V1Ap 3UL3A 2C3NA 2H19A 3U6VA 2V6KA 2H0HA 2O87A 1B48A 2MBTA 5INYA 4GF0A 4JEDA 1KEBA 1V98A 4XRDA 1FVJA 4AJ8A 2MMOA 1TRVA 3QOUA 5CRWA 5IQYA 5G5EA 1V2AA 4ACSA 3D6IA 1EEJA 2LKUA 2CA8A 4PGTA 3KEBA 5H5SA 5DALA 5CREA 4WR5A 5J9CA 3CRUA 2C3QA 6GSTA 3L0HA 2YJHA 4ISDA 3ZVJA 1TI1A 3GA4A 4K7IA 2TRCP 1XXUA 2QKEA 2OACA 2OBKA 2HYXA 1A0FA 5HFKA 1K0OA 4HI7A 4ZL7A 1XWKA 2X64A 4KDXA 1EZKA 4XS1A 3ZL5A 3TKPA 1GSEA 3EINA 3VPTA 1AC1A 1XBSA 1O81A 2K18A 3LYKA 4O7HA 3HXSA 3ZRDA 5H5QA 1GP1A 1JZOA 4G19A 2O85A 1E6BA 1OE7A 2H30A 5ELAA 3CTGA 4KCAA 4YQUA 3ZTLA 5LD0A 1OC8A 1AQWA 1VF4A 1PX6A 5KN3A 2HE3A 2L4CA 1O8XA 2EIRA 5B7CA 5ECOB 2K8VA 5D96A 1I5GA 1FG4A 3C7MA 1GH2A 4D73B 1X5CA 1TRUA 1X5DA 3DVXA 2VD0A 1SL2B 1GTIA 4BVYA 3ZIVA 2YZUA 3SBCA 2H1AA 2E2MA 4Q5RA 4G10A 3HY2A 4TR3A 2GS3A 2PMTA 1GSSA 2AUVA 1K3LA 1PKWA 5B8BA 4L8EA 2JSZA 4PX1A 12GSA 4J57E 5B8AA 2B7KA 2QSIA 2RIIA 1AAZA 3HVVA 1M2AA 2F3MA 1XCCA 1BQ7A 2CAIA 3F3QA 2B7JA 4XS4B 2XHFA 3IOSA 3GTUA 2R6KA 1NHYA 2LQQA 3HKRA 3IPZA 1N8JA 4KSMA 4BVXA 5LNKe 3HA9A 4XHMA 3GIXA 2K6VA 2B3SA 1R5AA 3EYTA 3ISOA 4TKYA 2G2QA 2HZEB 4O92A 3US3A 4MK3A 1XVWA 1Q4JA 2YN1A 3FR3A 2REMA 1XW9A 3ZYWA 5ECLB 4X0XA 4PQHA 4NHZA 4OMVA 3TDGA 4RUVA 3UBKA 3TKSE 20GSA 2VCWA 4ZBBA 4AGSA 1XWCA 1M2DA 2C8UA 2GDRA 3A2WA 1ZOFA 4GXZA 1ST9A 5IPGA 1Z7PA 3LEFA 2IMFA 4IGJA 3F8UA 4ML6A 4EDZA 4BA7A 2AV4A 1BJXA 1G6WA 2N5BA 1EEMA 2DJ3A 1GL8A 2IMEA 4GQFA 2GGTA 5B6NA 4V2LA 2V32A 4WF5A 3MDKA 4KW6A 4XTSA 1T00A 2DMMA 1Z3EA 3CXGA 2WGRA 4POKA 4ZL8A 2I3YA 2EIOA 3F63A 1HQOA 3C1RA 4CHSA 2B1LA 2H0IA 2LSTA 1B4PA 2ZNMA 3UIWA 3EC3A 2LJKA 4HQZA 3D22A 3MAKA 1J9BA 4NMUA 4JZQA 4MA9A 4EO3A 4FH8A 4P3YB 1YEPA 5DQSA 5JWRB 2DBCA 3F6DA 3PINA 1SYRA 2DIYA 3GKKA 5D9XA 4MH2A 1K0AA 1PMTA 3GH9A 4MPFA 5D9VA 1GTBA 1V58A 1U87A 5DQYA 3DIEA 2VCQA 1X9WB 3DKSA 3ZIJA 3BCKA 5DJLA 2KUCA 2VCXA 3TRPA 3MWHA 1J0FA 3CRTA 3FZ5A 4KNDA 4BPYA 5GAPD 2GT6A 1YDKA 2JZSA 1TDIA 2PVQA 1JFUA 1TXXA 3I9V2 4YQVA 4OWYA 4KE3A 1F6MC 4MH3A 4F0BA 1M99A 4ECBA 4ZIJA 2IWTA 4ZILA 3WGEA 5DAKB 4HJ2A 4K9ZA 1GLQA 2M72A 2HSYA 5CYYA 1ERTA 3L9VA 3FHKA 2F9SA 2IMKA 3RHCA 6GSWA 5CO3A 4K2DA
chains in the Genus database with same CATH superfamily
2YPMA 1JZRA 1X0RA 1H4OA 5D9TA 5LCZA 5IO2A 4GSNA 3MNGA 3ZFBA 2VM2A 4OCEA 2OJLA 2M80A 4EVMA 1FW1A 4HDEA 4BL7A 1EOHA 2CZ2A 2CX4A 1TU8A 4YQMA 3GKMA 1PL2A 3KTBA 1Y25A 3GRXA 2PPTA 3I43A 4J2FA 2ON7A 3LW9A 4HZ4A 3S9FA 2GQMA 6GSUA 2DIZA 3C8EA 1FOHA 2JSYA 3G7JA 4G0KA 2OE0A 3HZ8A 1CQHA 2NTOA 5KEJA 1O73A 1BEDA 3ED3A 3Q18A 1YZXA 4ZL9A 1ILOA 3ZMLA 1PX7A 2B6MA 2VCVA 1U88A 1EV4A 2YWMA 5G5FA 2DLXA 4G9HA 1V40A 2E0QA 3KCMA 4CDOA 3VURA 1XW5A 3HCZA 2DJ0A 5COHA 1K0DA 3M9JA 1N2AA 3IHQA 3PPUA 3NIVA 1UVZA 4QQ7A 4TR1B 2YWNA 3TRXA 2B5EA 4K0GA 4HU7A 4ZXGA 2CX3A 1SD8A 4KB3A 4BWQA 2I81A 4IBPA 5IO0A 3HYPA 4F82A 3WGDA 1ML6A 1GSYA 2MMZA 2KHPA 1PD21 1GLPA 5IMVA 3KZQA 4ZB8A 3BBYA 3ZITA 2TIRA 2P5QA 2RM5A 4XRAA 2XC2A 4KA0A 3A2VA 4D73A 1JLWA 3LQ7A 2R37A 2WS2A 1GNWA 1GRXA 1O7UA 1V57A 1HNAA 2R4VA 4IP1A 3EMPA 2L4QA 3GHAA 1FB0A 2H1BA 1EP8A 4OFNA 4GLTA 5IMAA 3QAGA 1SK2A 3EVIA 8GSSA 4MMMA 5DDLA 2R0PA 2DC5A 1Z5YE 5G1KA 1OKTA 4G2EA 1GTUA 4NPBA 3BD2A 1QFNA 4XS4A 4BWSA 2BJXA 3QMXA 3A5WA 3VWVA 5AIXA 2CVBA 2I4AA 3TKQA 2H01A 1TK5B 2LTKA 2MZCA 2H75A 2FCHA 1SJ6A 3E9JB 3EU4A 2HZEA 1YJ6A 1TW9A 2QA1A 5D93A 2KLXA 5HQPA 5ECHB 2OE1A 3WT2A 2KOKA 2N5AA 5ABRA 3DD3A 2H8LA 1JHBA 1QGVA 4ECIA 3TJFA 4USSA 1IYIA 2QC7A 4KDYA 4OO5A 3HHVA 1WOUA 1PL1A 1XVQA 5ECIB 3ZREA 5CP1A 1G0TA 2MYGA 3D5JA 4KUNA 4KSOA 4JR4A 2NVLA 3TJJA 5EVOA 3QCPA 4LLRA 2X8GA 3WD6A 4HZ2A 2M46A 4DVCA 5HFGA 1QUWA 2C4JA 2VD1A 5IIZA 2OA7A 1PKZA 3OR5A 4ZB6A 2IFQA 4X43A 1A23A 1GWCA 1PN9A 1GUKA 2P0GA 1DSBA 2VLTA 5HFIA 1EGOA 2A2SA 2C0GA 3LWAA 3G9BA 1XFLA 2GTUA 2LRTA 1A2JA 1A0RP 1M2BA 2OE3A 2NBSA 3IRAA 5L71A 2ES7A 4O32A 3FZ4A 1T4ZA 5D8IA 2C0EA 4N0VA 3IK7A 1YKAA 3C1SA 4Z2UA 2GVPA 4HS1A 2KP1A 3EE2A 3TB2A 3P7XA 1X9MB 4ZBAA 2XPEA 2YP6A 1SL1B 4N11A 3D4MA 3KM6A 2E2GA 2HI7A 5AIVA 3FKFA 4ML1A 1MD3A 4ZBDA 3F6FA 4Q5QA 2H76A 3TUEA 4MJAA 1QQ2A 4TXOB 3DYRA 3VWWA 4LA1A 4MF6A 4Z2TA 5BMUA 3HZ4A 1VF1A 2IMDA 3H93A 4K1FA 1JZWA 2I1UA 5DAKA 16GSA 3BJ5A 2L6CA 4ZB9A 5JWQB 1VRSD 2LV3A 5ECQB 2D2ZA 4F2IA 1YY7A 1Z6MA 4OO4A 3L4NA 2E7PA 4FIWA 4HOJA 4DSRA 1R4WA 3FRCA 3ZMKA 3HJOA 2R2JA 2AJQB 3QR6A 5G2ZA 4PUAA 1ZGNA 1HNCA 1UN2A 2HLSA 11GSA 4FYUA 1TTZA 4NWYA 1QK8A 3QAVA 5ECRB 2C80A 1OE8A 3GUSA 5JWOB 1MTCA 1U6TA 2C0DA 4NV5A 1GTAA 2FLSA 1RK4A 3JCML 3SWLA 4YKFA 3VWUA 5DVBA 3H4KA 3DXBA 2L6DA 1XOAA 5ECPB 3TKSA 2YANA 2O89A 1TU7A 3EMXA 4TR0A 2C0FA 3EU3A 1G7OA 1DE1A 2IFQB 2YWOA 3TRQA 5JCUA 1MDJA 3I6AA 5CRGA 3F4SA 3P2AA 3ERGA 3KH7A 1TRWA 1FVKA 2EC4A 4WR4A 2H1GA 3LFLA 4PXOA 2VL9A 1TK8B 1V9WA 2FWEA 4TR1A 2LNTA 2V2GA 1BAYA 5DCGA 3I69A 1A24A 4EDYA 1WRYA 3APSA 4K6XA 3QD9A 3QDNA 4K0NA 4IHUA 2H1DA 3M1GA 5DBQA 1EV9A 3CQFA 5HR3A 5IPHA 5CAXA 2HRAA 3L9SA 1S3AA 3ZZXA 2F8AA 4MZBA 1AXDA 4OFTA 1MEKA 4OFMA 5GZZB 1GULA 3L9UA 1S3CA 4HUAA 1FAAA 1CQGA 3ERFA 4EL1A 2KP2A 3TGZA 1FOVA 4MP4A 2VL2A 3UAPA 1XIYA 4KX4A 3GKXA 3EWLA 2VOCA 5E4WA 3H79A 1R26A 2FWFA 3GL5A 2AYTA 3ME8A 1EWXA 1SL0B 1UA5A 2C1YA 4JBBA 3GX0A 5CRDA 2IJYA 3W8JA 4MLYA 2J23A 4KAEA 3EURA 3TJKA 2YV9A 2H73A 2VCZA 1SU9A 4DSSB 2HSMA 4ICYA 4RI7A 5AISA 1R7HA 4POLA 1ZYEA 4NAXA 3IHGA 5IOXA 1SK0A 3HJMA 3IA1A 5A4UA 1ZCPA 3IXRA 2Z9SA 5IMZA 1ZYQB 2YV7A 5EY6A 5EL8A 2PN8A 4LMWA 4WBJA 1LJRA 2VLUA 2VO4A 1K0MA 5FWGA 1SKWB 3ME7A 1AQXA 2VIMA 4X1UA 3E0UA 2FWGA 4GSTA 2H6ZA 7GSSA 4MZCA 3UBLA 4FYCA 3FK8A 2WULA 2GSQA 3P90A 1Y6EA 2ALBA 3VWXA 1F3BA 4PQ1A 2CT6A 1OAZA 3C71A 4ULXA 10GSA 1AW9A 3M0FA 2FA8A 3IBHA 3IDVA 2GSRA 5D9WA 5CNWA 2LJAA 2GSSA 5E59A 4EF0A 2H0GA 3FYGA 4EIQA 2QGVA 5G31A 1ZZYA 3KIJA 3F4RA 2IIYA 2RLIA 3GURA 4IS0A 4HEA2 3C73A 5IMCA 1GNEA 4PUFC 2DJJA 1AIUA 2GQLA 2LRCA 5GAND 3TKSC 1WE0A 2X4AA 1B9XC 1GSUA 3A2XA 4K5RA 4GQCA 4FO5A 3J7Yb 1URMA 1IYHA 3HVNA 3WYWA 4L5LA 5JCGA 3FR6A 3Q6OA 3R3EA 2WZ9A 1SK1A 3GNJA 3PR8A 2WB9A 2JACA 2LUSA 4IKHA 2L5LA 3HD5A 2GZPA 3D4TA 2PU9C 1NSWA 3UMAA 3UEMA 3KP8A 3ZLPA 3D0ZA 1K0CA 4I2TA 1XPVA 2L57A 4QL9A 5A4VA 2CVDA 3U5RE 3ZFLA 2HZFA 1F37A 1XWGA 2WFCA 1M3IA 2FWHA 4A5PA 1NHOA 1WJKA 1ERVA 4PURA 2JADA 4MF7A 1TJDA 5A5KA 2OBIA 3RPPA 2DKIA 5BRTA 4TVEA 2V1MA 1SJZA 2YZHA 1B4QA 2DJ1A 5KN0A 2HRKA 4V2MA 2V41A 3HVSA 4TXOA 2QA2A 3M9KA 1WIKA 2FNOA 4Z2RA 5ELGA 1KTEA 1SYXA 5F8BA 4EUYA 1HYUA 2LNSA 1FHEA 2X99A 3L78A 4GRFA 1K3OA 2P5RA 2FGXA 3KJYA 5DJMA 3F4TA 4N0ZA 3LSZA 3VFIA 1OC9B 2DJ2A 2N5FA 5ECKB 4LMVA 1ZMAA 2RM6A 4HU9A 3CSJA 1TI3A 2LS5A 1USBA 4F03A 4KGIA 2WCIA 5JCWA 4KDUA 1SENA 1B9YC 1TRSA 1U3AA 4EKZA 4EE0A 1Z9HA 3G7IA 2H71A 4MJCA 3GN3A 4O5RA 2H74A 4CY6A 4HQSA 4I6XA 4WKWA 1BYEA 1ZL9A 1ON4A 2GZYA 3PGTA 4G0LA 1NW2A 3TCOA 2CZ3A 3G7YA 2A4HA 2WRTA 3FZ9A 3DMLA 3FZAA 1K0BA 3HJPA 4PQIA 5G30A 2IPAA 2BTOT 4XS6A 5J9BA 4IJ3A 4E8HA 1E2YA 1EOGA 2FY6A 3CMIA 5KN1A 18GSA 2DMLA 3VPQA 1XWBA 1UC7A 2YWIA 1PN0A 1TKDB 3V1WA 3KD0A 1M9BA 1I9DA 1SD9A 4CY8A 1VGLA 1EGRA 4F0CA 9GSSA 4WEYA 1F3AA 1O6JA 2LRNA 2DSAA 2P31A 3W8SA 2O8VB 2EIQA 3Q19A 5IOWA 1T1VA 2CV4A 2HNLA 3WT1A 4YKGA 1KNGA 2HRNA 4O5UA 2PERA 2K8SA 4L0UA 1TK0B 3KTLA 5EPFA 3GSSA 5ID2B 4IP6A 1NM3A 5KN2A 5G1LA 1W4VA 3M8NA 3CSIA 3J7Yk 3LXTA 1HNBA 3TJGA 3RPNA 4N30A 2LJRA 3O76A 1MDKA 4MF5A 2HXKA 2ZUPA 5B6MA 5HR0A 3TJBA 3HDCA 1GUMA 1LU4A 1M0UA 3UJ1A 1Z6NA 1EP7A 2DJKA 2C3TA 2JU5A 2R3XA 3QAWA 5FT3A 1ERUA 4PNFA 4H86A 2A2RA 5IMFA 2GQKA 4MJEA 2GSTA 1YQ1A 1PA3A 1PSQA 3RHBA 3D21A 3GKNA 4WETA 1A8LA 2BMXA 2XBIA 2YJ7A 1F2EA 5C00A 3GMFA 1X5EA 4V2NA 1HD2A 4DSSA 2X8CA 4JR6A 2L59A 3IC4A 3IR4A 4N10A 3E3EA 2NPBA 4MZWA 1ABAA 4MPGA 2IN3A 4RI6A 3N5OA 3H8QA 3TOTA 5IM9A 5F06A 1BG5A 2O7KA 2ON5A 4I97A 4KF9A 19GSA 3GYKA 2V6OA 4K7NA 1DE2A 3UARA 4IVFA 1WWJA 3MIXA 3BCIA 3UVHA 2B1KA 2H66A 2VCTA 4RQXA 4I2UA 3P8WA 2H72A 3KP9A 4TW5A 3IV4A 3MYDA 4ECCA 2AB6A 4KH7A 3F3RA 17GSA 5HR2A 1THXA 2FA4A 3FEUA 2OADA 4OCFA 2HFDA 14GSA 4RQRA 2MBSA 5J3RA 5DALB 3NZNA 4Q5FA 1GSFA 5GSSA 3LGCA 4FQUA 4E8EA 6GSVA 5F0GA 2HSHA 2X49A 1MD4A 3BOAA 3QPMA 4NXIA 3DGQA 1H75A 1XWAA 1AUCA 3UOMA 2X8HA 3EPTA 1J08A 2J9HA 1JLVA 5A4WA 2LEGA 4XIHA 5IMDA 2IL3A 4KCEA 5KOWA 2TRXA 3AY8A 1A2LA 4POBA 4F9ZA 2RUEA 3IAM2 1OYJA 4TN8A 1PRXA 1XOBA 2MMAA 2K9FA 13GSA 3LORA 2YNXA 3F0IA 3O3TA 6GSYA 2VL3A 3IK9A 3LJRA 3O6TA 3FY7A 4LL1B 4I8BA 5J4UA 2PGTA 5ENUA 4GWRA 2F51A 3DVWA 4BVYB 6GSXA 4YH2A 3N9JA 1YF1A 4CW9A 3GL3A 2JZTA 4DSQA 1A8YA 3LYPA 3DRNA 1DBYA 4MJBA 1PQNA 2I9HA 4HSCX 4IN0A 5F05A 4MCUA 1A2MA 3TKRA 1OC3A 1SKSB 3PH9A 4NV2A 2H70A 3NOFA 3GV1A 1ACVA 3KMNA 3FR9A 1K0NA 3CSHA 4IQAA 4EXJA 3KH9A 1XZOA 5ECMB 2UZ8A 1THOA 2PVOC 3M3MA 4TOPA 4ECJA 2B5YA 2VLVA 3K8NA 3GTUB 1LBKA 1XW6A 3VLNA 1ERWA 2RUFA 1T4YA 4BVXB 3A5IA 4JU5A 1OC9A 2ZCTA 2GT5A 5CRHA 3TOUA 4WXTA 2AAWA 5J41A 1WMJA 1WP0A 3KMOA 4AJ7A 4AJ6A 2FUG2 4DEJA 3GH6A 4ILFA 3R2QA 2F8FA 4XCSA 3APOA 1MDIA 1SKRB 3LG6A 4TR4A 1YEXA 1GSQA 1RQMA 1VF2A 3MSZA 2IMIA 5ECSA 3QFAC 4JRRA 5ECNB 4V1Ag 3FW2A 4OD7A 3DEXA 3ZVJD 2VUPA 3RDWA 4NHWA 3VI5A 4IQ1A 1OKDA 1Q98A 4GTUA 1FB6A 2XPDA 4YAVA 4GSSA 1WPIA 5DCHA 3UVTA 3KXOA 5AGYA 1ZYPA 3CTFA 4Q5NA 1C72A 4JE1A 4J56E 1BX9A 5GSTA 1T8EB 2GZZA 2NDOA 3GFKA 4IJIA 2VM1A 3A3TA 1QXHA 2JZRA 4L5OA 1T3BA 4WBRD 5AN1A 4HJMA 1O85A 1VF3A 2WDUA 1G7EA 2PWJA 3CBUA 5J5NA 2G0FA 1B8XA 3Q74A 1Z7RA 2CVKA 2XBQA 3LXZA 3H1NA 4L0WA 1K3YA 3WGXA 1W89A 5ID2A 1RW1A 3GSTA 2PUKC 4IW9A 1SJIA 2B5XA 2YCDA 1OVNA 5C04A 22GSA 5HR1A 2CQ9A 3IE3A 1GSDA 3W6GA 2MMNA 1M7TA 4ID0A 3QFBC 2FHEA 2GLRA 4QL7A 4GCIA 2FD3A 1F9MA 3IAS2 2VAFA 2H6YA 1M9AA 4I5QA 1X9SB 4MDCA 4TXVA 1DUGA 3KGKA 2H6XA 1KBNA 1S3DA 6GSSA 4MABA 1T7PB 2JL4A 1G6YA 4LL4B 3GX8A 2YOIA 3CYNA 3DWVA 2CAQA 2VL2C 1YF0A 4FYBA 1FO5A 3ERWA 3VK9A 1JZDA 4PNGA 4WF4A 1YKCA 4AF2A 4IELA 4YAPA 4Z7XA 2PBJA 2OKAA 1GUHA 1TP9A 1U3IA 4K7OA 2HRFA 4K8MA 2AHEA 5H5RA 2R5GA 3RBTA 3HVXA 3VI7A 1QMVA 1O8WA 5FHIA 4PTSA 5F07A 4EC0A 1AQVA 1TOFA 4POMA 1PGTA 2HT9A 2LQOA 3APQA 2DKHA 4BL7B 1R5PA 4TRXA 3RAZA 3F9UA 5D73A 2WJUA 2L5OA 2A4VA 4V1Ap 3UL3A 2C3NA 2H19A 3U6VA 2V6KA 2H0HA 2O87A 1B48A 2MBTA 5INYA 4GF0A 4JEDA 1KEBA 1V98A 4XRDA 1FVJA 1XG8A 4AJ8A 2MMOA 1TRVA 3QOUA 5CRWA 5IQYA 5G5EA 2A2PA 1V2AA 4ACSA 3D6IA 1M3JA 1EEJA 2LKUA 2CA8A 4PGTA 3KEBA 5H5SA 5DALA 5CREA 4WR5A 5J9CA 3CRUA 2C3QA 6GSTA 3L0HA 2YJHA 4ISDA 3ZVJA 1TI1A 3GA4A 4K7IA 2TRCP 1XXUA 2QKEA 2OACA 2OBKA 2HYXA 1A0FA 5HFKA 1K0OA 4EIPA 4HI7A 4ZL7A 1XWKA 2X64A 3IC8A 4KDXA 1EZKA 4XS1A 3ZL5A 3TKPA 1GSEA 3EINA 3VPTA 1AC1A 1XBSA 1O81A 4O5QA 2K18A 3LYKA 4O7HA 3HXSA 3ZRDA 5H5QA 1GP1A 1JZOA 4G19A 2O85A 1E6BA 1OE7A 2H30A 5ELAA 4K2XA 3CTGA 4KCAA 4YQUA 3ZTLA 5LD0A 1OC8A 1AQWA 1VF4A 1PX6A 5KN3A 2HE3A 2L4CA 1O8XA 2EIRA 5B7CA 2R0GA 5ECOB 2K8VA 5D96A 1I5GA 1FG4A 3C7MA 1GH2A 4D73B 1X5CA 1TRUA 1X5DA 3DVXA 2VD0A 1SL2B 1GTIA 4BVYA 3ZIVA 2YZUA 3SBCA 2H1AA 2E2MA 4Q5RA 4G10A 3HY2A 4TR3A 2GS3A 2PMTA 1GSSA 2AUVA 1K3LA 1PKWA 5B8BA 4L8EA 2JSZA 2R0CA 1S3RA 4PX1A 12GSA 4J57E 5B8AA 2B7KA 2QSIA 2RIIA 1AAZA 3HVVA 1M2AA 2F3MA 1XCCA 1BQ7A 4BIKA 2CAIA 3F3QA 2B7JA 4XS4B 2XHFA 3IOSA 3GTUA 2R6KA 1NHYA 2LQQA 3HKRA 3IPZA 1N8JA 4KSMA 4BVXA 5LNKe 3HA9A 4XHMA 3GIXA 2K6VA 2B3SA 1R5AA 3EYTA 3ISOA 4MNNA 4TKYA 2G2QA 2HZEB 4O92A 3US3A 4MK3A 1XVWA 1Q4JA 2YN1A 3FR3A 2REMA 1XW9A 3ZYWA 5ECLB 4X0XA 4PQHA 4NHZA 4OMVA 3TDGA 4RUVA 3UBKA 3TKSE 20GSA 2VCWA 4ZBBA 4AGSA 1XWCA 3FMWA 1M2DA 2C8UA 2GDRA 3A2WA 1PFOA 1ZOFA 4GXZA 1ST9A 5IPGA 1Z7PA 3LEFA 2IMFA 4IGJA 3F8UA 4ML6A 4EDZA 4BA7A 2AV4A 1BJXA 1G6WA 2N5BA 1EEMA 2DJ3A 4G0IA 1GL8A 4K5SA 2IMEA 4GQFA 1ZYNA 2GGTA 5B6NA 4V2LA 2V32A 4WF5A 3MDKA 4KW6A 4XTSA 1T00A 5KOXA 2DMMA 1Z3EA 3CXGA 2WGRA 4POKA 4ZL8A 2I3YA 2EIOA 3F63A 1HQOA 3C1RA 4CHSA 2B1LA 2H0IA 2LSTA 1B4PA 2ZNMA 3UIWA 3EC3A 2LJKA 4HQZA 3D22A 3MAKA 4X4JA 1J9BA 4NMUA 4JZQA 4MA9A 4EO3A 4FH8A 4P3YB 1YEPA 5DQSA 5JWRB 2DBCA 3F6DA 3PINA 1SYRA 2DIYA 3GKKA 5D9XA 4MH2A 1K0AA 1PMTA 3GH9A 4MPFA 5D9VA 1GTBA 1V58A 1U87A 5DQYA 3DIEA 2VCQA 1X9WB 3DKSA 3ZIJA 3BCKA 5DJLA 2KUCA 2VCXA 3TRPA 3MWHA 1J0FA 3CRTA 3FZ5A 4KNDA 4BPYA 5GAPD 2GT6A 1YDKA 2JZSA 1TDIA 2PVQA 1JFUA 1TXXA 3I9V2 4YQVA 4OWYA 4KE3A 1F6MC 4MH3A 4F0BA 1M99A 4ECBA 4ZIJA 2IWTA 4ZILA 3WGEA 5DAKB 4HJ2A 4K9ZA 1GLQA 2M72A 2HSYA 5CYYA 1ERTA 3L9VA 3FHKA 2F9SA 2IMKA 3RHCA 6GSWA 5CO3A 4K2DA
chains in the Genus database with same CATH topology
2YPMA 1JZRA 1X0RA 1H4OA 5D9TA 5LCZA 5IO2A 4GSNA 3MNGA 3ZFBA 2VM2A 4OCEA 2OJLA 2M80A 4EVMA 1FW1A 4HDEA 4BL7A 1EOHA 2CZ2A 2CX4A 1TU8A 4YQMA 3GKMA 1PL2A 3KTBA 1Y25A 3GRXA 2PPTA 3I43A 4J2FA 2ON7A 3LW9A 4HZ4A 3S9FA 2GQMA 6GSUA 2DIZA 3C8EA 1FOHA 2JSYA 3G7JA 4G0KA 2OE0A 3HZ8A 1CQHA 2NTOA 5KEJA 1O73A 1BEDA 3ED3A 3Q18A 1YZXA 4ZL9A 1ILOA 3ZMLA 1PX7A 2B6MA 2VCVA 1U88A 1EV4A 2YWMA 5G5FA 2DLXA 4G9HA 1V40A 2E0QA 3KCMA 4CDOA 3VURA 1XW5A 3HCZA 2DJ0A 5COHA 1K0DA 3M9JA 1N2AA 3IHQA 3PPUA 3NIVA 1UVZA 4QQ7A 4TR1B 2YWNA 3TRXA 2B5EA 4K0GA 4HU7A 4ZXGA 2CX3A 1SD8A 4KB3A 4BWQA 2I81A 4IBPA 5IO0A 3HYPA 4F82A 3WGDA 1ML6A 1GSYA 2MMZA 2KHPA 1PD21 1GLPA 5IMVA 3KZQA 4ZB8A 3BBYA 3ZITA 2TIRA 2P5QA 2RM5A 4XRAA 2XC2A 4KA0A 3A2VA 4D73A 1JLWA 3LQ7A 2R37A 2WS2A 1GNWA 1GRXA 1O7UA 1V57A 1HNAA 2R4VA 4IP1A 3EMPA 2L4QA 3GHAA 1FB0A 2H1BA 1EP8A 4OFNA 4GLTA 5IMAA 3QAGA 1SK2A 3EVIA 8GSSA 4MMMA 5DDLA 2R0PA 2DC5A 1Z5YE 5G1KA 1OKTA 4G2EA 1GTUA 4NPBA 3BD2A 1QFNA 4XS4A 4BWSA 2BJXA 3QMXA 3A5WA 3VWVA 5AIXA 2CVBA 2I4AA 3TKQA 2H01A 1TK5B 2LTKA 2MZCA 2H75A 2FCHA 1SJ6A 3E9JB 3EU4A 2HZEA 1YJ6A 1TW9A 2QA1A 5D93A 2KLXA 5HQPA 5ECHB 2OE1A 3WT2A 2KOKA 2N5AA 5ABRA 3DD3A 2H8LA 1JHBA 1QGVA 4ECIA 3TJFA 4USSA 1IYIA 2QC7A 4KDYA 4OO5A 3HHVA 1WOUA 1PL1A 1XVQA 5ECIB 3ZREA 5CP1A 1G0TA 2MYGA 3D5JA 4KUNA 4KSOA 4JR4A 2NVLA 3TJJA 5EVOA 3QCPA 4LLRA 2X8GA 3WD6A 4HZ2A 2M46A 4DVCA 5HFGA 1QUWA 2C4JA 2VD1A 5IIZA 2OA7A 1PKZA 3OR5A 4ZB6A 2IFQA 4X43A 1A23A 1GWCA 1PN9A 1GUKA 2P0GA 1DSBA 2VLTA 5HFIA 1EGOA 2A2SA 2C0GA 3LWAA 3G9BA 1XFLA 2GTUA 2LRTA 1A2JA 1A0RP 1M2BA 2OE3A 2NBSA 3IRAA 5L71A 2ES7A 4O32A 3FZ4A 1T4ZA 5D8IA 2C0EA 4N0VA 3IK7A 1YKAA 3C1SA 4Z2UA 2GVPA 4HS1A 2KP1A 3EE2A 3TB2A 3P7XA 1X9MB 4ZBAA 2XPEA 2YP6A 1SL1B 4N11A 3D4MA 3KM6A 2E2GA 2HI7A 5AIVA 3FKFA 4ML1A 1MD3A 4ZBDA 3F6FA 4Q5QA 2H76A 3TUEA 4MJAA 1QQ2A 4TXOB 3DYRA 3VWWA 4LA1A 4MF6A 4Z2TA 5BMUA 3HZ4A 1VF1A 2IMDA 3H93A 4K1FA 1JZWA 2I1UA 5DAKA 16GSA 3BJ5A 2L6CA 4ZB9A 5JWQB 1VRSD 2LV3A 5ECQB 2D2ZA 4F2IA 1YY7A 1Z6MA 4OO4A 3L4NA 2E7PA 4FIWA 4HOJA 4DSRA 1R4WA 3FRCA 3ZMKA 3HJOA 2R2JA 2AJQB 3QR6A 5G2ZA 4PUAA 1ZGNA 1HNCA 1UN2A 2HLSA 11GSA 4FYUA 1TTZA 4NWYA 1QK8A 3QAVA 5ECRB 2C80A 1OE8A 3GUSA 5JWOB 1MTCA 1U6TA 2C0DA 4NV5A 1GTAA 2FLSA 1RK4A 3JCML 3SWLA 4YKFA 3VWUA 5DVBA 3H4KA 3DXBA 2L6DA 1XOAA 5ECPB 3TKSA 2YANA 2O89A 1TU7A 3EMXA 4TR0A 2C0FA 3EU3A 1G7OA 1DE1A 2IFQB 2YWOA 3TRQA 5JCUA 1MDJA 3I6AA 5CRGA 3F4SA 3P2AA 3ERGA 3KH7A 1TRWA 1FVKA 2EC4A 4WR4A 2H1GA 3LFLA 4PXOA 2VL9A 1TK8B 1V9WA 2FWEA 4TR1A 2LNTA 2V2GA 1BAYA 5DCGA 3I69A 1A24A 4EDYA 1WRYA 3APSA 4K6XA 3QD9A 3QDNA 4K0NA 4IHUA 2H1DA 3M1GA 5DBQA 1EV9A 5HR3A 5IPHA 5CAXA 2HRAA 3L9SA 1S3AA 3ZZXA 2F8AA 4MZBA 1AXDA 4OFTA 1MEKA 4OFMA 5GZZB 1GULA 3L9UA 1S3CA 4HUAA 1FAAA 1CQGA 3ERFA 4EL1A 2KP2A 3TGZA 1FOVA 4MP4A 2VL2A 3UAPA 1XIYA 4KX4A 3GKXA 3EWLA 2VOCA 5E4WA 3H79A 1R26A 2FWFA 3GL5A 2AYTA 3ME8A 1EWXA 1SL0B 1UA5A 2C1YA 4JBBA 3GX0A 5CRDA 2IJYA 3W8JA 4MLYA 2J23A 4KAEA 3EURA 3TJKA 2YV9A 2H73A 2VCZA 1SU9A 4DSSB 2HSMA 4ICYA 4RI7A 5AISA 1R7HA 4POLA 1ZYEA 4NAXA 3IHGA 5IOXA 1SK0A 3HJMA 3IA1A 5A4UA 1ZCPA 3IXRA 2Z9SA 5IMZA 1ZYQB 2YV7A 5EY6A 5EL8A 2PN8A 4LMWA 4WBJA 1LJRA 2VLUA 2VO4A 1K0MA 5FWGA 1SKWB 3ME7A 1AQXA 2VIMA 4X1UA 3E0UA 2FWGA 4GSTA 2H6ZA 7GSSA 4MZCA 3UBLA 4FYCA 3FK8A 2WULA 2GSQA 3P90A 1Y6EA 2ALBA 3VWXA 1F3BA 4PQ1A 2CT6A 1OAZA 3C71A 4ULXA 10GSA 1AW9A 3M0FA 2FA8A 3IBHA 3IDVA 2GSRA 5D9WA 5CNWA 2LJAA 2GSSA 5E59A 4EF0A 2H0GA 3FYGA 4EIQA 2QGVA 5G31A 1ZZYA 3KIJA 3F4RA 2IIYA 2RLIA 3GURA 4IS0A 4HEA2 3C73A 5IMCA 1GNEA 4PUFC 2DJJA 1AIUA 2GQLA 2LRCA 5GAND 3TKSC 1WE0A 2X4AA 1B9XC 1GSUA 3A2XA 4K5RA 4GQCA 4FO5A 3J7Yb 1URMA 1IYHA 3WYWA 4L5LA 5JCGA 3FR6A 3Q6OA 3R3EA 2WZ9A 1SK1A 3GNJA 3PR8A 2WB9A 2JACA 2LUSA 4IKHA 2L5LA 3HD5A 2GZPA 3D4TA 2PU9C 1NSWA 3UMAA 3UEMA 3KP8A 3ZLPA 3D0ZA 1K0CA 4I2TA 1XPVA 2L57A 4QL9A 5A4VA 2CVDA 3U5RE 3ZFLA 2HZFA 1F37A 1XWGA 2WFCA 2FWHA 4A5PA 1NHOA 1WJKA 1ERVA 4PURA 2JADA 4MF7A 1TJDA 5A5KA 2OBIA 3RPPA 2DKIA 5BRTA 4TVEA 2V1MA 1SJZA 2YZHA 1B4QA 2DJ1A 5KN0A 2HRKA 4V2MA 2V41A 3HVSA 4TXOA 2QA2A 3M9KA 1WIKA 2FNOA 4Z2RA 5ELGA 1KTEA 1SYXA 5F8BA 4EUYA 1HYUA 2LNSA 1FHEA 2X99A 3L78A 4GRFA 1K3OA 2P5RA 2FGXA 3KJYA 5DJMA 3F4TA 4N0ZA 3LSZA 3VFIA 1OC9B 2DJ2A 2N5FA 5ECKB 4LMVA 1ZMAA 2RM6A 4HU9A 3CSJA 1TI3A 2LS5A 1USBA 4F03A 4KGIA 2WCIA 5JCWA 4KDUA 1SENA 1B9YC 1TRSA 1U3AA 4EKZA 4EE0A 1Z9HA 3G7IA 2H71A 4MJCA 3GN3A 4O5RA 2H74A 4CY6A 4HQSA 4I6XA 4WKWA 1BYEA 1ZL9A 1ON4A 2GZYA 3PGTA 4G0LA 1NW2A 3TCOA 2CZ3A 3G7YA 2A4HA 2WRTA 3FZ9A 3DMLA 3FZAA 1K0BA 3HJPA 4PQIA 5G30A 2IPAA 2BTOT 4XS6A 5J9BA 4IJ3A 4E8HA 1E2YA 1EOGA 2FY6A 3CMIA 5KN1A 18GSA 2DMLA 3VPQA 1XWBA 1UC7A 2YWIA 1PN0A 1TKDB 3V1WA 3KD0A 1M9BA 1I9DA 1SD9A 4CY8A 1VGLA 1EGRA 4F0CA 9GSSA 4WEYA 1F3AA 1O6JA 2LRNA 2DSAA 2P31A 3W8SA 2O8VB 2EIQA 3Q19A 5IOWA 1T1VA 2CV4A 2HNLA 3WT1A 4YKGA 1KNGA 2HRNA 4O5UA 2PERA 2K8SA 4L0UA 1TK0B 3KTLA 5EPFA 3GSSA 5ID2B 4IP6A 1NM3A 5KN2A 5G1LA 1W4VA 3M8NA 3CSIA 3J7Yk 3LXTA 1HNBA 3TJGA 3RPNA 4N30A 2LJRA 3O76A 1MDKA 4MF5A 2HXKA 2ZUPA 5B6MA 5HR0A 3TJBA 3HDCA 1GUMA 1LU4A 1M0UA 3UJ1A 1Z6NA 1EP7A 2DJKA 2C3TA 2JU5A 2R3XA 3QAWA 5FT3A 1ERUA 4PNFA 4H86A 2A2RA 5IMFA 2GQKA 4MJEA 2GSTA 1YQ1A 1PA3A 1PSQA 3RHBA 3D21A 3GKNA 4WETA 1A8LA 2BMXA 2XBIA 2YJ7A 1F2EA 5C00A 3GMFA 1X5EA 4V2NA 1HD2A 4DSSA 2X8CA 4JR6A 2L59A 3IC4A 3IR4A 4N10A 3E3EA 2NPBA 4MZWA 1ABAA 4MPGA 2IN3A 4RI6A 3N5OA 3H8QA 3TOTA 5IM9A 5F06A 1BG5A 2O7KA 2ON5A 4I97A 4KF9A 19GSA 3GYKA 2V6OA 4K7NA 1DE2A 3UARA 4IVFA 1WWJA 3MIXA 3BCIA 3UVHA 2B1KA 2H66A 2VCTA 4RQXA 4I2UA 3P8WA 2H72A 3KP9A 4TW5A 3IV4A 3MYDA 4ECCA 2AB6A 4KH7A 3F3RA 17GSA 5HR2A 1THXA 2FA4A 3FEUA 2OADA 4OCFA 2HFDA 14GSA 4RQRA 2MBSA 5J3RA 5DALB 3NZNA 4Q5FA 1GSFA 5GSSA 3LGCA 4FQUA 4E8EA 6GSVA 5F0GA 2HSHA 2X49A 1MD4A 3BOAA 3QPMA 4NXIA 3DGQA 1H75A 1XWAA 1AUCA 3UOMA 2X8HA 3EPTA 1J08A 2J9HA 1JLVA 5A4WA 2LEGA 4XIHA 5IMDA 2IL3A 4KCEA 5KOWA 2TRXA 3AY8A 1A2LA 4POBA 4F9ZA 2RUEA 3IAM2 1OYJA 4TN8A 1PRXA 1XOBA 2MMAA 2K9FA 13GSA 3LORA 2YNXA 3F0IA 3O3TA 6GSYA 2VL3A 3IK9A 3LJRA 3O6TA 3FY7A 4LL1B 4I8BA 5J4UA 2PGTA 5ENUA 4GWRA 2F51A 3DVWA 4BVYB 6GSXA 4YH2A 3N9JA 1YF1A 4CW9A 3GL3A 2JZTA 4DSQA 1A8YA 3LYPA 3DRNA 1DBYA 4MJBA 1PQNA 2I9HA 4IN0A 5F05A 4MCUA 1A2MA 3TKRA 1OC3A 1SKSB 3PH9A 4NV2A 2H70A 3NOFA 3GV1A 1ACVA 3KMNA 3FR9A 1K0NA 3CSHA 4IQAA 4EXJA 3KH9A 1XZOA 5ECMB 2UZ8A 1THOA 2PVOC 3M3MA 4TOPA 4ECJA 2B5YA 2VLVA 3K8NA 3GTUB 1LBKA 1XW6A 3VLNA 1ERWA 2RUFA 1T4YA 4BVXB 3A5IA 4JU5A 1OC9A 2ZCTA 2GT5A 5CRHA 3TOUA 4WXTA 2AAWA 5J41A 1WMJA 1WP0A 3KMOA 4AJ7A 4AJ6A 2FUG2 4DEJA 3GH6A 4ILFA 3R2QA 2F8FA 4XCSA 3APOA 1MDIA 1SKRB 3LG6A 4TR4A 1YEXA 1GSQA 1RQMA 1VF2A 3MSZA 2IMIA 5ECSA 3QFAC 4JRRA 5ECNB 4V1Ag 3FW2A 4OD7A 3DEXA 3ZVJD 2VUPA 3RDWA 4NHWA 3VI5A 4IQ1A 1OKDA 1Q98A 4GTUA 1FB6A 2XPDA 4YAVA 4GSSA 1WPIA 5DCHA 3UVTA 3KXOA 5AGYA 1ZYPA 3CTFA 4Q5NA 1C72A 4JE1A 4J56E 1BX9A 5GSTA 1T8EB 2GZZA 2NDOA 3GFKA 4IJIA 2VM1A 3A3TA 1QXHA 2JZRA 4L5OA 1T3BA 4WBRD 5AN1A 4HJMA 1O85A 1VF3A 2WDUA 1G7EA 2PWJA 3CBUA 5J5NA 2G0FA 1B8XA 3Q74A 1Z7RA 2CVKA 2XBQA 3LXZA 3H1NA 4L0WA 1K3YA 3WGXA 1W89A 5ID2A 1RW1A 3GSTA 2PUKC 4IW9A 1SJIA 2B5XA 2YCDA 1OVNA 5C04A 22GSA 5HR1A 2CQ9A 3IE3A 1GSDA 3W6GA 2MMNA 1M7TA 4ID0A 3QFBC 2FHEA 2GLRA 4QL7A 4GCIA 2FD3A 1F9MA 3IAS2 2VAFA 2H6YA 1M9AA 4I5QA 1X9SB 4MDCA 4TXVA 1DUGA 3KGKA 2H6XA 1KBNA 1S3DA 6GSSA 4MABA 1T7PB 2JL4A 1G6YA 4LL4B 3GX8A 2YOIA 3CYNA 3DWVA 2CAQA 2VL2C 1YF0A 4FYBA 1FO5A 3ERWA 3VK9A 1JZDA 4PNGA 4WF4A 1YKCA 4AF2A 4IELA 4YAPA 4Z7XA 2PBJA 2OKAA 1GUHA 1TP9A 1U3IA 4K7OA 2HRFA 4K8MA 2AHEA 5H5RA 2R5GA 3RBTA 3HVXA 3VI7A 1QMVA 1O8WA 5FHIA 4PTSA 5F07A 4EC0A 1AQVA 1TOFA 4POMA 1PGTA 2HT9A 2LQOA 3APQA 2DKHA 4BL7B 1R5PA 4TRXA 3RAZA 3F9UA 5D73A 2WJUA 2L5OA 2A4VA 4V1Ap 3UL3A 2C3NA 2H19A 3U6VA 2V6KA 2H0HA 2O87A 1B48A 2MBTA 5INYA 4GF0A 4JEDA 1KEBA 1V98A 4XRDA 1FVJA 4AJ8A 2MMOA 1TRVA 3QOUA 5CRWA 5IQYA 5G5EA 2A2PA 1V2AA 4ACSA 3D6IA 1EEJA 2LKUA 2CA8A 4PGTA 3KEBA 5H5SA 5DALA 5CREA 4WR5A 5J9CA 3CRUA 2C3QA 6GSTA 3L0HA 2YJHA 4ISDA 3ZVJA 1TI1A 3GA4A 4K7IA 2TRCP 1XXUA 2QKEA 2OACA 2OBKA 2HYXA 1A0FA 5HFKA 1K0OA 4EIPA 4HI7A 4ZL7A 1XWKA 2X64A 3IC8A 4KDXA 1EZKA 4XS1A 3ZL5A 3TKPA 1GSEA 3EINA 3VPTA 1AC1A 1XBSA 1O81A 4O5QA 2K18A 3LYKA 4O7HA 3HXSA 3ZRDA 5H5QA 1GP1A 1JZOA 4G19A 2O85A 1E6BA 1OE7A 2H30A 5ELAA 4K2XA 3CTGA 4KCAA 4YQUA 3ZTLA 5LD0A 1OC8A 1AQWA 1VF4A 1PX6A 5KN3A 2HE3A 2L4CA 1O8XA 2EIRA 5B7CA 2R0GA 5ECOB 2K8VA 5D96A 1I5GA 1FG4A 3C7MA 1GH2A 4D73B 1X5CA 1TRUA 1X5DA 3DVXA 2VD0A 1SL2B 1GTIA 4BVYA 3ZIVA 2YZUA 3SBCA 2H1AA 2E2MA 4Q5RA 4G10A 3HY2A 4TR3A 2GS3A 2PMTA 1GSSA 2AUVA 1K3LA 1PKWA 5B8BA 4L8EA 2JSZA 2R0CA 4PX1A 12GSA 4J57E 5B8AA 2B7KA 2QSIA 2RIIA 1AAZA 3HVVA 1M2AA 2F3MA 1XCCA 1BQ7A 2CAIA 3F3QA 2B7JA 4XS4B 2XHFA 3IOSA 3GTUA 2R6KA 1NHYA 2LQQA 3HKRA 3IPZA 1N8JA 4KSMA 4BVXA 5LNKe 3HA9A 4XHMA 3GIXA 2K6VA 2B3SA 1R5AA 3EYTA 3ISOA 4MNNA 4TKYA 2G2QA 2HZEB 4O92A 3US3A 4MK3A 1XVWA 1Q4JA 2YN1A 3FR3A 2REMA 1XW9A 3ZYWA 5ECLB 4X0XA 4PQHA 4NHZA 4OMVA 3TDGA 4RUVA 3UBKA 3TKSE 20GSA 2VCWA 4ZBBA 4AGSA 1XWCA 3FMWA 1M2DA 2C8UA 2GDRA 3A2WA 1ZOFA 4GXZA 1ST9A 5IPGA 1Z7PA 3LEFA 2IMFA 4IGJA 3F8UA 4ML6A 4EDZA 4BA7A 2AV4A 1BJXA 1G6WA 2N5BA 1EEMA 2DJ3A 4G0IA 1GL8A 4K5SA 2IMEA 4GQFA 1ZYNA 2GGTA 5B6NA 4V2LA 2V32A 4WF5A 3MDKA 4KW6A 4XTSA 1T00A 5KOXA 2DMMA 1Z3EA 3CXGA 2WGRA 4POKA 4ZL8A 2I3YA 2EIOA 3F63A 1HQOA 3C1RA 4CHSA 2B1LA 2H0IA 2LSTA 1B4PA 2ZNMA 3UIWA 3EC3A 2LJKA 4HQZA 3D22A 3MAKA 4X4JA 1J9BA 4NMUA 4JZQA 4MA9A 4EO3A 4FH8A 4P3YB 1YEPA 5DQSA 5JWRB 2DBCA 3F6DA 3PINA 1SYRA 2DIYA 3GKKA 5D9XA 4MH2A 1K0AA 1PMTA 3GH9A 4MPFA 5D9VA 1GTBA 1V58A 1U87A 5DQYA 3DIEA 2VCQA 1X9WB 3DKSA 3ZIJA 3BCKA 5DJLA 2KUCA 2VCXA 3TRPA 3MWHA 1J0FA 3CRTA 3FZ5A 4KNDA 4BPYA 5GAPD 2GT6A 1YDKA 2JZSA 1TDIA 2PVQA 1JFUA 1TXXA 3I9V2 4YQVA 4OWYA 4KE3A 1F6MC 4MH3A 4F0BA 1M99A 4ECBA 4ZIJA 2IWTA 4ZILA 3WGEA 5DAKB 4HJ2A 4K9ZA 1GLQA 2M72A 2HSYA 5CYYA 1ERTA 3L9VA 3FHKA 2F9SA 2IMKA 3RHCA 6GSWA 5CO3A 4K2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YPM A;  1JZR A;  1X0R A;  1H4O A;  5D9T A;  5LCZ A;  5IO2 A;  4GSN A;  3MNG A;  3ZFB A;  2VM2 A;  4OCE A;  2OJL A;  2M80 A;  4EVM A;  1FW1 A;  4HDE A;  4BL7 A;  1EOH A;  2CZ2 A;  2CX4 A;  1TU8 A;  4YQM A;  3GKM A;  1PL2 A;  3KTB A;  1Y25 A;  3GRX A;  2PPT A;  3I43 A;  4J2F A;  2ON7 A;  4HZ4 A;  3S9F A;  2GQM A;  6GSU A;  2DIZ A;  3C8E A;  2JSY A;  3G7J A;  2OE0 A;  3HZ8 A;  1CQH A;  2NTO A;  5KEJ A;  1O73 A;  1BED A;  3ED3 A;  3Q18 A;  1YZX A;  4ZL9 A;  1ILO A;  3ZML A;  1PX7 A;  2B6M A;  2VCV A;  1U88 A;  1EV4 A;  2YWM A;  5G5F A;  2DLX A;  4G9H A;  1V40 A;  2E0Q A;  3KCM A;  4CDO A;  3VUR A;  1XW5 A;  3HCZ A;  2DJ0 A;  5COH A;  1K0D A;  3M9J A;  1N2A A;  3IHQ A;  3NIV A;  1UVZ A;  4QQ7 A;  4TR1 B;  2YWN A;  3TRX A;  2B5E A;  4K0G A;  4HU7 A;  4ZXG A;  2CX3 A;  1SD8 A;  4KB3 A;  4BWQ A;  2I81 A;  4IBP A;  5IO0 A;  3HYP A;  4F82 A;  3WGD A;  1ML6 A;  1GSY A;  2MMZ A;  2KHP A;  1PD2 1;  1GLP A;  5IMV A;  3KZQ A;  4ZB8 A;  3BBY A;  3ZIT A;  2TIR A;  2P5Q A;  2RM5 A;  4XRA A;  2XC2 A;  4KA0 A;  3A2V A;  4D73 A;  1JLW A;  3LQ7 A;  2R37 A;  2WS2 A;  1GNW A;  1GRX A;  1O7U A;  1V57 A;  1HNA A;  2R4V A;  4IP1 A;  3EMP A;  2L4Q A;  3GHA A;  1FB0 A;  2H1B A;  1EP8 A;  4OFN A;  4GLT A;  5IMA A;  3QAG A;  1SK2 A;  3EVI A;  8GSS A;  4MMM A;  5DDL A;  2DC5 A;  1Z5Y E;  5G1K A;  1OKT A;  4G2E A;  1GTU A;  4NPB A;  3BD2 A;  1QFN A;  4XS4 A;  4BWS A;  2BJX A;  3QMX A;  3A5W A;  3VWV A;  5AIX A;  2CVB A;  2I4A A;  3TKQ A;  2H01 A;  1TK5 B;  2LTK A;  2MZC A;  2H75 A;  2FCH A;  1SJ6 A;  3E9J B;  3EU4 A;  2HZE A;  1YJ6 A;  1TW9 A;  5D93 A;  2KLX A;  5HQP A;  5ECH B;  2OE1 A;  3WT2 A;  2KOK A;  2N5A A;  5ABR A;  3DD3 A;  2H8L A;  1JHB A;  1QGV A;  4ECI A;  3TJF A;  1IYI A;  2QC7 A;  4KDY A;  4OO5 A;  3HHV A;  1WOU A;  1PL1 A;  1XVQ A;  5ECI B;  3ZRE A;  5CP1 A;  1G0T A;  2MYG A;  3D5J A;  4KUN A;  4KSO A;  4JR4 A;  2NVL A;  3TJJ A;  5EVO A;  3QCP A;  4LLR A;  2X8G A;  3WD6 A;  4HZ2 A;  2M46 A;  4DVC A;  5HFG A;  1QUW A;  2C4J A;  2VD1 A;  5IIZ A;  2OA7 A;  1PKZ A;  3OR5 A;  4ZB6 A;  2IFQ A;  4X43 A;  1A23 A;  1GWC A;  1PN9 A;  1GUK A;  2P0G A;  1DSB A;  2VLT A;  5HFI A;  1EGO A;  2A2S A;  2C0G A;  3LWA A;  3G9B A;  1XFL A;  2GTU A;  2LRT A;  1A2J A;  1A0R P;  1M2B A;  2OE3 A;  2NBS A;  3IRA A;  5L71 A;  2ES7 A;  4O32 A;  3FZ4 A;  1T4Z A;  5D8I A;  2C0E A;  4N0V A;  3IK7 A;  1YKA A;  3C1S A;  2GVP A;  4HS1 A;  2KP1 A;  3EE2 A;  3TB2 A;  3P7X A;  1X9M B;  4ZBA A;  2XPE A;  2YP6 A;  1SL1 B;  4N11 A;  3D4M A;  3KM6 A;  2E2G A;  2HI7 A;  5AIV A;  3FKF A;  4ML1 A;  1MD3 A;  4ZBD A;  3F6F A;  4Q5Q A;  2H76 A;  3TUE A;  4MJA A;  1QQ2 A;  4TXO B;  3DYR A;  3VWW A;  4LA1 A;  4MF6 A;  3HZ4 A;  1VF1 A;  2IMD A;  3H93 A;  4K1F A;  1JZW A;  2I1U A;  5DAK A;  16GS A;  3BJ5 A;  2L6C A;  4ZB9 A;  5JWQ B;  1VRS D;  2LV3 A;  5ECQ B;  2D2Z A;  4F2I A;  1YY7 A;  1Z6M A;  4OO4 A;  3L4N A;  2E7P A;  4FIW A;  4HOJ A;  4DSR A;  1R4W A;  3FRC A;  3ZMK A;  3HJO A;  2R2J A;  2AJQ B;  3QR6 A;  5G2Z A;  4PUA A;  1ZGN A;  1HNC A;  1UN2 A;  2HLS A;  11GS A;  4FYU A;  1TTZ A;  4NWY A;  1QK8 A;  3QAV A;  5ECR B;  2C80 A;  1OE8 A;  3GUS A;  5JWO B;  1MTC A;  1U6T A;  2C0D A;  4NV5 A;  1GTA A;  2FLS A;  1RK4 A;  3JCM L;  3SWL A;  3VWU A;  5DVB A;  3H4K A;  3DXB A;  2L6D A;  1XOA A;  5ECP B;  3TKS A;  2YAN A;  2O89 A;  1TU7 A;  3EMX A;  4TR0 A;  2C0F A;  3EU3 A;  1G7O A;  1DE1 A;  2IFQ B;  2YWO A;  3TRQ A;  5JCU A;  1MDJ A;  3I6A A;  5CRG A;  3F4S A;  3P2A A;  3ERG A;  3KH7 A;  1TRW A;  1FVK A;  2EC4 A;  4WR4 A;  2H1G A;  3LFL A;  4PXO A;  2VL9 A;  1TK8 B;  1V9W A;  2FWE A;  4TR1 A;  2LNT A;  2V2G A;  1BAY A;  5DCG A;  3I69 A;  1A24 A;  4EDY A;  1WRY A;  3APS A;  4K6X A;  3QD9 A;  3QDN A;  4K0N A;  4IHU A;  2H1D A;  3M1G A;  5DBQ A;  1EV9 A;  5HR3 A;  5IPH A;  5CAX A;  3L9S A;  1S3A A;  3ZZX A;  2F8A A;  4MZB A;  1AXD A;  4OFT A;  1MEK A;  4OFM A;  5GZZ B;  1GUL A;  3L9U A;  1S3C A;  4HUA A;  1FAA A;  1CQG A;  3ERF A;  4EL1 A;  2KP2 A;  3TGZ A;  1FOV A;  4MP4 A;  2VL2 A;  3UAP A;  1XIY A;  4KX4 A;  3GKX A;  3EWL A;  2VOC A;  5E4W A;  3H79 A;  1R26 A;  2FWF A;  3GL5 A;  2AYT A;  3ME8 A;  1EWX A;  1SL0 B;  1UA5 A;  2C1Y A;  4JBB A;  3GX0 A;  5CRD A;  2IJY A;  3W8J A;  4MLY A;  2J23 A;  4KAE A;  3EUR A;  3TJK A;  2YV9 A;  2H73 A;  2VCZ A;  1SU9 A;  4DSS B;  4RI7 A;  5AIS A;  1R7H A;  4POL A;  1ZYE A;  4NAX A;  5IOX A;  1SK0 A;  3HJM A;  3IA1 A;  5A4U A;  1ZCP A;  3IXR A;  2Z9S A;  5IMZ A;  1ZYQ B;  2YV7 A;  5EY6 A;  5EL8 A;  2PN8 A;  4LMW A;  4WBJ A;  1LJR A;  2VLU A;  2VO4 A;  1K0M A;  5FWG A;  1SKW B;  3ME7 A;  1AQX A;  2VIM A;  4X1U A;  3E0U A;  2FWG A;  4GST A;  2H6Z A;  7GSS A;  4MZC A;  3UBL A;  4FYC A;  3FK8 A;  2WUL A;  2GSQ A;  3P90 A;  1Y6E A;  2ALB A;  3VWX A;  1F3B A;  4PQ1 A;  2CT6 A;  1OAZ A;  3C71 A;  4ULX A;  10GS A;  1AW9 A;  3M0F A;  2FA8 A;  3IBH A;  3IDV A;  2GSR A;  5D9W A;  5CNW A;  2LJA A;  2GSS A;  5E59 A;  4EF0 A;  2H0G A;  3FYG A;  2QGV A;  5G31 A;  1ZZY A;  3KIJ A;  3F4R A;  2IIY A;  2RLI A;  3GUR A;  4IS0 A;  4HEA 2;  3C73 A;  5IMC A;  1GNE A;  4PUF C;  2DJJ A;  1AIU A;  2GQL A;  2LRC A;  5GAN D;  3TKS C;  1WE0 A;  1B9X C;  1GSU A;  3A2X A;  4GQC A;  4FO5 A;  3J7Y b;  1URM A;  1IYH A;  3WYW A;  4L5L A;  5JCG A;  3FR6 A;  3Q6O A;  2WZ9 A;  1SK1 A;  3GNJ A;  3PR8 A;  2WB9 A;  2JAC A;  2LUS A;  4IKH A;  2L5L A;  3HD5 A;  2GZP A;  3D4T A;  2PU9 C;  1NSW A;  3UMA A;  3UEM A;  3KP8 A;  3ZLP A;  3D0Z A;  1K0C A;  4I2T A;  1XPV A;  2L57 A;  4QL9 A;  5A4V A;  2CVD A;  3U5R E;  3ZFL A;  2HZF A;  1F37 A;  1XWG A;  2WFC A;  2FWH A;  1NHO A;  1WJK A;  1ERV A;  4PUR A;  2JAD A;  4MF7 A;  1TJD A;  5A5K A;  2OBI A;  3RPP A;  4TVE A;  2V1M A;  1SJZ A;  2YZH A;  1B4Q A;  2DJ1 A;  5KN0 A;  4V2M A;  2V41 A;  3HVS A;  4TXO A;  3M9K A;  1WIK A;  2FNO A;  5ELG A;  1KTE A;  1SYX A;  5F8B A;  4EUY A;  1HYU A;  2LNS A;  1FHE A;  2X99 A;  3L78 A;  4GRF A;  1K3O A;  2P5R A;  2FGX A;  3KJY A;  5DJM A;  3F4T A;  4N0Z A;  3LSZ A;  3VFI A;  1OC9 B;  2DJ2 A;  2N5F A;  5ECK B;  4LMV A;  1ZMA A;  2RM6 A;  4HU9 A;  3CSJ A;  1TI3 A;  2LS5 A;  1USB A;  4F03 A;  4KGI A;  2WCI A;  5JCW A;  4KDU A;  1SEN A;  1B9Y C;  1TRS A;  1U3A A;  4EKZ A;  4EE0 A;  1Z9H A;  3G7I A;  2H71 A;  4MJC A;  3GN3 A;  4O5R A;  2H74 A;  4HQS A;  4I6X A;  4WKW A;  1BYE A;  1ZL9 A;  1ON4 A;  2GZY A;  3PGT A;  1NW2 A;  3TCO A;  2CZ3 A;  3G7Y A;  2WRT A;  3FZ9 A;  3DML A;  3FZA A;  1K0B A;  3HJP A;  4PQI A;  5G30 A;  2IPA A;  2BTO T;  4XS6 A;  5J9B A;  4IJ3 A;  4E8H A;  1E2Y A;  1EOG A;  2FY6 A;  3CMI A;  5KN1 A;  18GS A;  2DML A;  3VPQ A;  1XWB A;  1UC7 A;  2YWI A;  1TKD B;  3V1W A;  3KD0 A;  1M9B A;  1I9D A;  1SD9 A;  1VGL A;  1EGR A;  4F0C A;  9GSS A;  4WEY A;  1F3A A;  1O6J A;  2LRN A;  2DSA A;  2P31 A;  3W8S A;  2O8V B;  2EIQ A;  3Q19 A;  5IOW A;  1T1V A;  2CV4 A;  2HNL A;  3WT1 A;  1KNG A;  2HRN A;  2PER A;  2K8S A;  4L0U A;  1TK0 B;  3KTL A;  5EPF A;  3GSS A;  5ID2 B;  4IP6 A;  1NM3 A;  5KN2 A;  5G1L A;  1W4V A;  3M8N A;  3CSI A;  3J7Y k;  3LXT A;  1HNB A;  3TJG A;  3RPN A;  4N30 A;  2LJR A;  3O76 A;  1MDK A;  4MF5 A;  2HXK A;  2ZUP A;  5B6M A;  5HR0 A;  3TJB A;  3HDC A;  1GUM A;  1LU4 A;  1M0U A;  3UJ1 A;  1Z6N A;  1EP7 A;  2DJK A;  2C3T A;  2JU5 A;  2R3X A;  3QAW A;  5FT3 A;  1ERU A;  4PNF A;  4H86 A;  2A2R A;  5IMF A;  2GQK A;  4MJE A;  2GST A;  1YQ1 A;  1PA3 A;  1PSQ A;  3RHB A;  3D21 A;  3GKN A;  4WET A;  1A8L A;  2BMX A;  2XBI A;  2YJ7 A;  1F2E A;  5C00 A;  3GMF A;  1X5E A;  4V2N A;  1HD2 A;  4DSS A;  2X8C A;  4JR6 A;  2L59 A;  3IC4 A;  3IR4 A;  4N10 A;  3E3E A;  2NPB A;  4MZW A;  1ABA A;  4MPG A;  2IN3 A;  4RI6 A;  3N5O A;  3H8Q A;  3TOT A;  5IM9 A;  5F06 A;  1BG5 A;  2O7K A;  2ON5 A;  4I97 A;  19GS A;  3GYK A;  2V6O A;  4K7N A;  1DE2 A;  3UAR A;  4IVF A;  1WWJ A;  3BCI A;  3UVH A;  2B1K A;  2H66 A;  2VCT A;  4RQX A;  4I2U A;  3P8W A;  2H72 A;  3KP9 A;  4TW5 A;  3IV4 A;  4ECC A;  2AB6 A;  4KH7 A;  3F3R A;  17GS A;  5HR2 A;  1THX A;  2FA4 A;  3FEU A;  2OAD A;  4OCF A;  2HFD A;  14GS A;  4RQR A;  2MBS A;  5J3R A;  5DAL B;  3NZN A;  4Q5F A;  1GSF A;  5GSS A;  3LGC A;  4E8E A;  6GSV A;  5F0G A;  2HSH A;  3BOA A;  1MD4 A;  3QPM A;  4NXI A;  3DGQ A;  1H75 A;  1XWA A;  1AUC A;  3UOM A;  2X8H A;  1J08 A;  2J9H A;  1JLV A;  5A4W A;  2LEG A;  4XIH A;  5IMD A;  2IL3 A;  4KCE A;  2TRX A;  3AY8 A;  1A2L A;  4POB A;  4F9Z A;  2RUE A;  3IAM 2;  1OYJ A;  4TN8 A;  1PRX A;  1XOB A;  2MMA A;  2K9F A;  13GS A;  3LOR A;  2YNX A;  3F0I A;  3O3T A;  6GSY A;  2VL3 A;  3IK9 A;  3LJR A;  3O6T A;  3FY7 A;  4LL1 B;  4I8B A;  5J4U A;  2PGT A;  5ENU A;  4GWR A;  2F51 A;  3DVW A;  6GSX A;  4YH2 A;  3N9J A;  1YF1 A;  4CW9 A;  3GL3 A;  2JZT A;  4DSQ A;  1A8Y A;  3LYP A;  3DRN A;  1DBY A;  4MJB A;  1PQN A;  2I9H A;  4IN0 A;  5F05 A;  4MCU A;  1A2M A;  3TKR A;  1OC3 A;  1SKS B;  3PH9 A;  4NV2 A;  2H70 A;  3NOF A;  3GV1 A;  1ACV A;  3KMN A;  3FR9 A;  1K0N A;  3CSH A;  4IQA A;  4EXJ A;  3KH9 A;  5ECM B;  1XZO A;  1THO A;  2PVO C;  3M3M A;  4TOP A;  4ECJ A;  2B5Y A;  2VLV A;  3K8N A;  3GTU B;  1LBK A;  1XW6 A;  3VLN A;  1ERW A;  2RUF A;  1T4Y A;  4JU5 A;  1OC9 A;  2ZCT A;  2GT5 A;  5CRH A;  3TOU A;  4WXT A;  2AAW A;  5J41 A;  1WMJ A;  1WP0 A;  3KMO A;  4AJ7 A;  4AJ6 A;  2FUG 2;  4DEJ A;  3GH6 A;  4ILF A;  3R2Q A;  2F8F A;  4XCS A;  3APO A;  1MDI A;  1SKR B;  3LG6 A;  4TR4 A;  1YEX A;  1GSQ A;  1RQM A;  1VF2 A;  3MSZ A;  2IMI A;  5ECS A;  3QFA C;  4JRR A;  5ECN B;  4V1A g;  3FW2 A;  4OD7 A;  3DEX A;  3ZVJ D;  2VUP A;  3RDW A;  4NHW A;  3VI5 A;  4IQ1 A;  1OKD A;  1Q98 A;  4GTU A;  1FB6 A;  2XPD A;  4YAV A;  4GSS A;  1WPI A;  5DCH A;  3UVT A;  3KXO A;  5AGY A;  3CTF A;  4Q5N A;  1C72 A;  4JE1 A;  4J56 E;  1BX9 A;  5GST A;  1T8E B;  2GZZ A;  2NDO A;  3GFK A;  4IJI A;  2VM1 A;  3A3T A;  1QXH A;  2JZR A;  4L5O A;  1T3B A;  4WBR D;  5AN1 A;  4HJM A;  1O85 A;  1VF3 A;  2WDU A;  1G7E A;  2PWJ A;  3CBU A;  5J5N A;  2G0F A;  1B8X A;  3Q74 A;  1Z7R A;  2CVK A;  2XBQ A;  3LXZ A;  3H1N A;  4L0W A;  1K3Y A;  3WGX A;  1W89 A;  5ID2 A;  1RW1 A;  3GST A;  2PUK C;  4IW9 A;  1SJI A;  2B5X A;  2YCD A;  1OVN A;  5C04 A;  22GS A;  5HR1 A;  2CQ9 A;  3IE3 A;  1GSD A;  3W6G A;  2MMN A;  1M7T A;  4ID0 A;  3QFB C;  2FHE A;  2GLR A;  4QL7 A;  4GCI A;  2FD3 A;  1F9M A;  3IAS 2;  2VAF A;  2H6Y A;  1M9A A;  4I5Q A;  1X9S B;  4MDC A;  4TXV A;  1DUG A;  3KGK A;  2H6X A;  1KBN A;  1S3D A;  6GSS A;  4MAB A;  1T7P B;  2JL4 A;  1G6Y A;  4LL4 B;  3GX8 A;  2YOI A;  3CYN A;  3DWV A;  2CAQ A;  2VL2 C;  1YF0 A;  4FYB A;  1FO5 A;  3ERW A;  3VK9 A;  1JZD A;  4PNG A;  4WF4 A;  1YKC A;  4AF2 A;  4IEL A;  4YAP A;  4Z7X A;  2PBJ A;  2OKA A;  1GUH A;  1TP9 A;  1U3I A;  4K7O A;  2HRF A;  4K8M A;  2AHE A;  5H5R A;  2R5G A;  3RBT A;  3HVX A;  3VI7 A;  1QMV A;  1O8W A;  5FHI A;  5F07 A;  4EC0 A;  1AQV A;  1TOF A;  4POM A;  1PGT A;  2HT9 A;  2LQO A;  3APQ A;  1R5P A;  4TRX A;  3RAZ A;  3F9U A;  5D73 A;  2WJU A;  2L5O A;  2A4V A;  4V1A p;  3UL3 A;  2C3N A;  2H19 A;  3U6V A;  2V6K A;  2H0H A;  2O87 A;  1B48 A;  2MBT A;  5INY A;  4GF0 A;  4JED A;  1KEB A;  1V98 A;  4XRD A;  1FVJ A;  4AJ8 A;  2MMO A;  1TRV A;  3QOU A;  5CRW A;  5IQY A;  5G5E A;  1V2A A;  4ACS A;  3D6I A;  1EEJ A;  2LKU A;  2CA8 A;  4PGT A;  3KEB A;  5H5S A;  5DAL A;  5CRE A;  4WR5 A;  5J9C A;  3CRU A;  2C3Q A;  6GST A;  3L0H A;  2YJH A;  4ISD A;  3ZVJ A;  1TI1 A;  3GA4 A;  4K7I A;  2TRC P;  1XXU A;  2QKE A;  2OAC A;  2OBK A;  2HYX A;  1A0F A;  5HFK A;  1K0O A;  4HI7 A;  4ZL7 A;  1XWK A;  2X64 A;  4KDX A;  1EZK A;  4XS1 A;  3ZL5 A;  3TKP A;  1GSE A;  3EIN A;  3VPT A;  1AC1 A;  1XBS A;  1O81 A;  2K18 A;  3LYK A;  4O7H A;  3HXS A;  3ZRD A;  5H5Q A;  1GP1 A;  1JZO A;  4G19 A;  2O85 A;  1E6B A;  1OE7 A;  2H30 A;  5ELA A;  3CTG A;  4KCA A;  4YQU A;  3ZTL A;  5LD0 A;  1OC8 A;  1AQW A;  1VF4 A;  1PX6 A;  5KN3 A;  2HE3 A;  2L4C A;  1O8X A;  2EIR A;  5B7C A;  5ECO B;  2K8V A;  5D96 A;  1I5G A;  1FG4 A;  3C7M A;  1GH2 A;  4D73 B;  1X5C A;  1TRU A;  1X5D A;  3DVX A;  2VD0 A;  1SL2 B;  1GTI A;  4BVY A;  3ZIV A;  2YZU A;  3SBC A;  2H1A A;  2E2M A;  4Q5R A;  4G10 A;  3HY2 A;  4TR3 A;  2GS3 A;  2PMT A;  1GSS A;  2AUV A;  1K3L A;  1PKW A;  5B8B A;  4L8E A;  2JSZ A;  4PX1 A;  12GS A;  4J57 E;  5B8A A;  2B7K A;  2QSI A;  2RII A;  1AAZ A;  3HVV A;  1M2A A;  2F3M A;  1XCC A;  1BQ7 A;  2CAI A;  3F3Q A;  2B7J A;  4XS4 B;  2XHF A;  3IOS A;  3GTU A;  2R6K A;  1NHY A;  2LQQ A;  3HKR A;  3IPZ A;  1N8J A;  4KSM A;  4BVX A;  5LNK e;  3HA9 A;  4XHM A;  3GIX A;  2K6V A;  2B3S A;  1R5A A;  3EYT A;  3ISO A;  4TKY A;  2G2Q A;  2HZE B;  4O92 A;  3US3 A;  4MK3 A;  1XVW A;  1Q4J A;  2YN1 A;  3FR3 A;  2REM A;  1XW9 A;  3ZYW A;  5ECL B;  4X0X A;  4PQH A;  4NHZ A;  4OMV A;  3TDG A;  4RUV A;  3UBK A;  3TKS E;  20GS A;  2VCW A;  4ZBB A;  4AGS A;  1XWC A;  1M2D A;  2C8U A;  2GDR A;  3A2W A;  1ZOF A;  4GXZ A;  1ST9 A;  5IPG A;  1Z7P A;  3LEF A;  2IMF A;  4IGJ A;  3F8U A;  4ML6 A;  4EDZ A;  4BA7 A;  2AV4 A;  1BJX A;  1G6W A;  2N5B A;  1EEM A;  2DJ3 A;  1GL8 A;  2IME A;  4GQF A;  2GGT A;  5B6N A;  4V2L A;  2V32 A;  4WF5 A;  3MDK A;  4KW6 A;  4XTS A;  1T00 A;  2DMM A;  1Z3E A;  3CXG A;  2WGR A;  4POK A;  4ZL8 A;  2I3Y A;  2EIO A;  3F63 A;  1HQO A;  3C1R A;  4CHS A;  2B1L A;  2H0I A;  2LST A;  1B4P A;  2ZNM A;  3UIW A;  3EC3 A;  2LJK A;  4HQZ A;  3D22 A;  3MAK A;  1J9B A;  4NMU A;  4JZQ A;  4MA9 A;  4EO3 A;  4FH8 A;  4P3Y B;  1YEP A;  5DQS A;  5JWR B;  2DBC A;  3F6D A;  3PIN A;  1SYR A;  2DIY A;  3GKK A;  5D9X A;  4MH2 A;  1K0A A;  1PMT A;  3GH9 A;  4MPF A;  5D9V A;  1GTB A;  1V58 A;  1U87 A;  5DQY A;  3DIE A;  2VCQ A;  1X9W B;  3DKS A;  3ZIJ A;  3BCK A;  5DJL A;  2KUC A;  2VCX A;  3TRP A;  3MWH A;  1J0F A;  3CRT A;  3FZ5 A;  4KND A;  4BPY A;  5GAP D;  2GT6 A;  1YDK A;  2JZS A;  1TDI A;  2PVQ A;  1JFU A;  1TXX A;  3I9V 2;  4YQV A;  4OWY A;  4KE3 A;  1F6M C;  4MH3 A;  4F0B A;  1M99 A;  4ECB A;  4ZIJ A;  2IWT A;  4ZIL A;  3WGE A;  5DAK B;  4HJ2 A;  4K9Z A;  1GLQ A;  2M72 A;  2HSY A;  5CYY A;  1ERT A;  3L9V A;  3FHK A;  2F9S A;  2IMK A;  3RHC A;  6GSW A;  5CO3 A;  4K2D A; 
#chains in the Genus database with same CATH topology
 2YPM A;  1JZR A;  1X0R A;  1H4O A;  5D9T A;  5LCZ A;  5IO2 A;  4GSN A;  3MNG A;  3ZFB A;  2VM2 A;  4OCE A;  2OJL A;  2M80 A;  4EVM A;  1FW1 A;  4HDE A;  4BL7 A;  1EOH A;  2CZ2 A;  2CX4 A;  1TU8 A;  4YQM A;  3GKM A;  1PL2 A;  3KTB A;  1Y25 A;  3GRX A;  2PPT A;  3I43 A;  4J2F A;  2ON7 A;  3LW9 A;  4HZ4 A;  3S9F A;  2GQM A;  6GSU A;  2DIZ A;  3C8E A;  1FOH A;  2JSY A;  3G7J A;  4G0K A;  2OE0 A;  3HZ8 A;  1CQH A;  2NTO A;  5KEJ A;  1O73 A;  1BED A;  3ED3 A;  3Q18 A;  1YZX A;  4ZL9 A;  1ILO A;  3ZML A;  1PX7 A;  2B6M A;  2VCV A;  1U88 A;  1EV4 A;  2YWM A;  5G5F A;  2DLX A;  4G9H A;  1V40 A;  2E0Q A;  3KCM A;  4CDO A;  3VUR A;  1XW5 A;  3HCZ A;  2DJ0 A;  5COH A;  1K0D A;  3M9J A;  1N2A A;  3IHQ A;  3PPU A;  3NIV A;  1UVZ A;  4QQ7 A;  4TR1 B;  2YWN A;  3TRX A;  2B5E A;  4K0G A;  4HU7 A;  4ZXG A;  2CX3 A;  1SD8 A;  4KB3 A;  4BWQ A;  2I81 A;  4IBP A;  5IO0 A;  3HYP A;  4F82 A;  3WGD A;  1ML6 A;  1GSY A;  2MMZ A;  2KHP A;  1PD2 1;  1GLP A;  5IMV A;  3KZQ A;  4ZB8 A;  3BBY A;  3ZIT A;  2TIR A;  2P5Q A;  2RM5 A;  4XRA A;  2XC2 A;  4KA0 A;  3A2V A;  4D73 A;  1JLW A;  3LQ7 A;  2R37 A;  2WS2 A;  1GNW A;  1GRX A;  1O7U A;  1V57 A;  1HNA A;  2R4V A;  4IP1 A;  3EMP A;  2L4Q A;  3GHA A;  1FB0 A;  2H1B A;  1EP8 A;  4OFN A;  4GLT A;  5IMA A;  3QAG A;  1SK2 A;  3EVI A;  8GSS A;  4MMM A;  5DDL A;  2R0P A;  2DC5 A;  1Z5Y E;  5G1K A;  1OKT A;  4G2E A;  1GTU A;  4NPB A;  3BD2 A;  1QFN A;  4XS4 A;  4BWS A;  2BJX A;  3QMX A;  3A5W A;  3VWV A;  5AIX A;  2CVB A;  2I4A A;  3TKQ A;  2H01 A;  1TK5 B;  2LTK A;  2MZC A;  2H75 A;  2FCH A;  1SJ6 A;  3E9J B;  3EU4 A;  2HZE A;  1YJ6 A;  1TW9 A;  2QA1 A;  5D93 A;  2KLX A;  5HQP A;  5ECH B;  2OE1 A;  3WT2 A;  2KOK A;  2N5A A;  5ABR A;  3DD3 A;  2H8L A;  1JHB A;  1QGV A;  4ECI A;  3TJF A;  4USS A;  1IYI A;  2QC7 A;  4KDY A;  4OO5 A;  3HHV A;  1WOU A;  1PL1 A;  1XVQ A;  5ECI B;  3ZRE A;  5CP1 A;  1G0T A;  2MYG A;  3D5J A;  4KUN A;  4KSO A;  4JR4 A;  2NVL A;  3TJJ A;  5EVO A;  3QCP A;  4LLR A;  2X8G A;  3WD6 A;  4HZ2 A;  2M46 A;  4DVC A;  5HFG A;  1QUW A;  2C4J A;  2VD1 A;  5IIZ A;  2OA7 A;  1PKZ A;  3OR5 A;  4ZB6 A;  2IFQ A;  4X43 A;  1A23 A;  1GWC A;  1PN9 A;  1GUK A;  2P0G A;  1DSB A;  2VLT A;  5HFI A;  1EGO A;  2A2S A;  2C0G A;  3LWA A;  3G9B A;  1XFL A;  2GTU A;  2LRT A;  1A2J A;  1A0R P;  1M2B A;  2OE3 A;  2NBS A;  3IRA A;  5L71 A;  2ES7 A;  4O32 A;  3FZ4 A;  1T4Z A;  5D8I A;  2C0E A;  4N0V A;  3IK7 A;  1YKA A;  3C1S A;  4Z2U A;  2GVP A;  4HS1 A;  2KP1 A;  3EE2 A;  3TB2 A;  3P7X A;  1X9M B;  4ZBA A;  2XPE A;  2YP6 A;  1SL1 B;  4N11 A;  3D4M A;  3KM6 A;  2E2G A;  2HI7 A;  5AIV A;  3FKF A;  4ML1 A;  1MD3 A;  4ZBD A;  3F6F A;  4Q5Q A;  2H76 A;  3TUE A;  4MJA A;  1QQ2 A;  4TXO B;  3DYR A;  3VWW A;  4LA1 A;  4MF6 A;  4Z2T A;  5BMU A;  3HZ4 A;  1VF1 A;  2IMD A;  3H93 A;  4K1F A;  1JZW A;  2I1U A;  5DAK A;  16GS A;  3BJ5 A;  2L6C A;  4ZB9 A;  5JWQ B;  1VRS D;  2LV3 A;  5ECQ B;  2D2Z A;  4F2I A;  1YY7 A;  1Z6M A;  4OO4 A;  3L4N A;  2E7P A;  4FIW A;  4HOJ A;  4DSR A;  1R4W A;  3FRC A;  3ZMK A;  3HJO A;  2R2J A;  2AJQ B;  3QR6 A;  5G2Z A;  4PUA A;  1ZGN A;  1HNC A;  1UN2 A;  2HLS A;  11GS A;  4FYU A;  1TTZ A;  4NWY A;  1QK8 A;  3QAV A;  5ECR B;  2C80 A;  1OE8 A;  3GUS A;  5JWO B;  1MTC A;  1U6T A;  2C0D A;  4NV5 A;  1GTA A;  2FLS A;  1RK4 A;  3JCM L;  3SWL A;  4YKF A;  3VWU A;  5DVB A;  3H4K A;  3DXB A;  2L6D A;  1XOA A;  5ECP B;  3TKS A;  2YAN A;  2O89 A;  1TU7 A;  3EMX A;  4TR0 A;  2C0F A;  3EU3 A;  1G7O A;  1DE1 A;  2IFQ B;  2YWO A;  3TRQ A;  5JCU A;  1MDJ A;  3I6A A;  5CRG A;  3F4S A;  3P2A A;  3ERG A;  3KH7 A;  1TRW A;  1FVK A;  2EC4 A;  4WR4 A;  2H1G A;  3LFL A;  4PXO A;  2VL9 A;  1TK8 B;  1V9W A;  2FWE A;  4TR1 A;  2LNT A;  2V2G A;  1BAY A;  5DCG A;  3I69 A;  1A24 A;  4EDY A;  1WRY A;  3APS A;  4K6X A;  3QD9 A;  3QDN A;  4K0N A;  4IHU A;  2H1D A;  3M1G A;  5DBQ A;  1EV9 A;  3CQF A;  5HR3 A;  5IPH A;  5CAX A;  2HRA A;  3L9S A;  1S3A A;  3ZZX A;  2F8A A;  4MZB A;  1AXD A;  4OFT A;  1MEK A;  4OFM A;  5GZZ B;  1GUL A;  3L9U A;  1S3C A;  4HUA A;  1FAA A;  1CQG A;  3ERF A;  4EL1 A;  2KP2 A;  3TGZ A;  1FOV A;  4MP4 A;  2VL2 A;  3UAP A;  1XIY A;  4KX4 A;  3GKX A;  3EWL A;  2VOC A;  5E4W A;  3H79 A;  1R26 A;  2FWF A;  3GL5 A;  2AYT A;  3ME8 A;  1EWX A;  1SL0 B;  1UA5 A;  2C1Y A;  4JBB A;  3GX0 A;  5CRD A;  2IJY A;  3W8J A;  4MLY A;  2J23 A;  4KAE A;  3EUR A;  3TJK A;  2YV9 A;  2H73 A;  2VCZ A;  1SU9 A;  4DSS B;  2HSM A;  4ICY A;  4RI7 A;  5AIS A;  1R7H A;  4POL A;  1ZYE A;  4NAX A;  3IHG A;  5IOX A;  1SK0 A;  3HJM A;  3IA1 A;  5A4U A;  1ZCP A;  3IXR A;  2Z9S A;  5IMZ A;  1ZYQ B;  2YV7 A;  5EY6 A;  5EL8 A;  2PN8 A;  4LMW A;  4WBJ A;  1LJR A;  2VLU A;  2VO4 A;  1K0M A;  5FWG A;  1SKW B;  3ME7 A;  1AQX A;  2VIM A;  4X1U A;  3E0U A;  2FWG A;  4GST A;  2H6Z A;  7GSS A;  4MZC A;  3UBL A;  4FYC A;  3FK8 A;  2WUL A;  2GSQ A;  3P90 A;  1Y6E A;  2ALB A;  3VWX A;  1F3B A;  4PQ1 A;  2CT6 A;  1OAZ A;  3C71 A;  4ULX A;  10GS A;  1AW9 A;  3M0F A;  2FA8 A;  3IBH A;  3IDV A;  2GSR A;  5D9W A;  5CNW A;  2LJA A;  2GSS A;  5E59 A;  4EF0 A;  2H0G A;  3FYG A;  4EIQ A;  2QGV A;  5G31 A;  1ZZY A;  3KIJ A;  3F4R A;  2IIY A;  2RLI A;  3GUR A;  4IS0 A;  4HEA 2;  3C73 A;  5IMC A;  1GNE A;  4PUF C;  2DJJ A;  1AIU A;  2GQL A;  2LRC A;  5GAN D;  3TKS C;  1WE0 A;  2X4A A;  1B9X C;  1GSU A;  3A2X A;  4K5R A;  4GQC A;  4FO5 A;  3J7Y b;  1URM A;  1IYH A;  3HVN A;  3WYW A;  4L5L A;  5JCG A;  3FR6 A;  3Q6O A;  3R3E A;  2WZ9 A;  1SK1 A;  3GNJ A;  3PR8 A;  2WB9 A;  2JAC A;  2LUS A;  4IKH A;  2L5L A;  3HD5 A;  2GZP A;  3D4T A;  2PU9 C;  1NSW A;  3UMA A;  3UEM A;  3KP8 A;  3ZLP A;  3D0Z A;  1K0C A;  4I2T A;  1XPV A;  2L57 A;  4QL9 A;  5A4V A;  2CVD A;  3U5R E;  3ZFL A;  2HZF A;  1F37 A;  1XWG A;  2WFC A;  1M3I A;  2FWH A;  4A5P A;  1NHO A;  1WJK A;  1ERV A;  4PUR A;  2JAD A;  4MF7 A;  1TJD A;  5A5K A;  2OBI A;  3RPP A;  2DKI A;  5BRT A;  4TVE A;  2V1M A;  1SJZ A;  2YZH A;  1B4Q A;  2DJ1 A;  5KN0 A;  2HRK A;  4V2M A;  2V41 A;  3HVS A;  4TXO A;  2QA2 A;  3M9K A;  1WIK A;  2FNO A;  4Z2R A;  5ELG A;  1KTE A;  1SYX A;  5F8B A;  4EUY A;  1HYU A;  2LNS A;  1FHE A;  2X99 A;  3L78 A;  4GRF A;  1K3O A;  2P5R A;  2FGX A;  3KJY A;  5DJM A;  3F4T A;  4N0Z A;  3LSZ A;  3VFI A;  1OC9 B;  2DJ2 A;  2N5F A;  5ECK B;  4LMV A;  1ZMA A;  2RM6 A;  4HU9 A;  3CSJ A;  1TI3 A;  2LS5 A;  1USB A;  4F03 A;  4KGI A;  2WCI A;  5JCW A;  4KDU A;  1SEN A;  1B9Y C;  1TRS A;  1U3A A;  4EKZ A;  4EE0 A;  1Z9H A;  3G7I A;  2H71 A;  4MJC A;  3GN3 A;  4O5R A;  2H74 A;  4CY6 A;  4HQS A;  4I6X A;  4WKW A;  1BYE A;  1ZL9 A;  1ON4 A;  2GZY A;  3PGT A;  4G0L A;  1NW2 A;  3TCO A;  2CZ3 A;  3G7Y A;  2A4H A;  2WRT A;  3FZ9 A;  3DML A;  3FZA A;  1K0B A;  3HJP A;  4PQI A;  5G30 A;  2IPA A;  2BTO T;  4XS6 A;  5J9B A;  4IJ3 A;  4E8H A;  1E2Y A;  1EOG A;  2FY6 A;  3CMI A;  5KN1 A;  18GS A;  2DML A;  3VPQ A;  1XWB A;  1UC7 A;  2YWI A;  1PN0 A;  1TKD B;  3V1W A;  3KD0 A;  1M9B A;  1I9D A;  1SD9 A;  4CY8 A;  1VGL A;  1EGR A;  4F0C A;  9GSS A;  4WEY A;  1F3A A;  1O6J A;  2LRN A;  2DSA A;  2P31 A;  3W8S A;  2O8V B;  2EIQ A;  3Q19 A;  5IOW A;  1T1V A;  2CV4 A;  2HNL A;  3WT1 A;  4YKG A;  1KNG A;  2HRN A;  4O5U A;  2PER A;  2K8S A;  4L0U A;  1TK0 B;  3KTL A;  5EPF A;  3GSS A;  5ID2 B;  4IP6 A;  1NM3 A;  5KN2 A;  5G1L A;  1W4V A;  3M8N A;  3CSI A;  3J7Y k;  3LXT A;  1HNB A;  3TJG A;  3RPN A;  4N30 A;  2LJR A;  3O76 A;  1MDK A;  4MF5 A;  2HXK A;  2ZUP A;  5B6M A;  5HR0 A;  3TJB A;  3HDC A;  1GUM A;  1LU4 A;  1M0U A;  3UJ1 A;  1Z6N A;  1EP7 A;  2DJK A;  2C3T A;  2JU5 A;  2R3X A;  3QAW A;  5FT3 A;  1ERU A;  4PNF A;  4H86 A;  2A2R A;  5IMF A;  2GQK A;  4MJE A;  2GST A;  1YQ1 A;  1PA3 A;  1PSQ A;  3RHB A;  3D21 A;  3GKN A;  4WET A;  1A8L A;  2BMX A;  2XBI A;  2YJ7 A;  1F2E A;  5C00 A;  3GMF A;  1X5E A;  4V2N A;  1HD2 A;  4DSS A;  2X8C A;  4JR6 A;  2L59 A;  3IC4 A;  3IR4 A;  4N10 A;  3E3E A;  2NPB A;  4MZW A;  1ABA A;  4MPG A;  2IN3 A;  4RI6 A;  3N5O A;  3H8Q A;  3TOT A;  5IM9 A;  5F06 A;  1BG5 A;  2O7K A;  2ON5 A;  4I97 A;  4KF9 A;  19GS A;  3GYK A;  2V6O A;  4K7N A;  1DE2 A;  3UAR A;  4IVF A;  1WWJ A;  3MIX A;  3BCI A;  3UVH A;  2B1K A;  2H66 A;  2VCT A;  4RQX A;  4I2U A;  3P8W A;  2H72 A;  3KP9 A;  4TW5 A;  3IV4 A;  3MYD A;  4ECC A;  2AB6 A;  4KH7 A;  3F3R A;  17GS A;  5HR2 A;  1THX A;  2FA4 A;  3FEU A;  2OAD A;  4OCF A;  2HFD A;  14GS A;  4RQR A;  2MBS A;  5J3R A;  5DAL B;  3NZN A;  4Q5F A;  1GSF A;  5GSS A;  3LGC A;  4FQU A;  4E8E A;  6GSV A;  5F0G A;  2HSH A;  2X49 A;  1MD4 A;  3BOA A;  3QPM A;  4NXI A;  3DGQ A;  1H75 A;  1XWA A;  1AUC A;  3UOM A;  2X8H A;  3EPT A;  1J08 A;  2J9H A;  1JLV A;  5A4W A;  2LEG A;  4XIH A;  5IMD A;  2IL3 A;  4KCE A;  5KOW A;  2TRX A;  3AY8 A;  1A2L A;  4POB A;  4F9Z A;  2RUE A;  3IAM 2;  1OYJ A;  4TN8 A;  1PRX A;  1XOB A;  2MMA A;  2K9F A;  13GS A;  3LOR A;  2YNX A;  3F0I A;  3O3T A;  6GSY A;  2VL3 A;  3IK9 A;  3LJR A;  3O6T A;  3FY7 A;  4LL1 B;  4I8B A;  5J4U A;  2PGT A;  5ENU A;  4GWR A;  2F51 A;  3DVW A;  4BVY B;  6GSX A;  4YH2 A;  3N9J A;  1YF1 A;  4CW9 A;  3GL3 A;  2JZT A;  4DSQ A;  1A8Y A;  3LYP A;  3DRN A;  1DBY A;  4MJB A;  1PQN A;  2I9H A;  4HSC X;  4IN0 A;  5F05 A;  4MCU A;  1A2M A;  3TKR A;  1OC3 A;  1SKS B;  3PH9 A;  4NV2 A;  2H70 A;  3NOF A;  3GV1 A;  1ACV A;  3KMN A;  3FR9 A;  1K0N A;  3CSH A;  4IQA A;  4EXJ A;  3KH9 A;  1XZO A;  5ECM B;  2UZ8 A;  1THO A;  2PVO C;  3M3M A;  4TOP A;  4ECJ A;  2B5Y A;  2VLV A;  3K8N A;  3GTU B;  1LBK A;  1XW6 A;  3VLN A;  1ERW A;  2RUF A;  1T4Y A;  4BVX B;  3A5I A;  4JU5 A;  1OC9 A;  2ZCT A;  2GT5 A;  5CRH A;  3TOU A;  4WXT A;  2AAW A;  5J41 A;  1WMJ A;  1WP0 A;  3KMO A;  4AJ7 A;  4AJ6 A;  2FUG 2;  4DEJ A;  3GH6 A;  4ILF A;  3R2Q A;  2F8F A;  4XCS A;  3APO A;  1MDI A;  1SKR B;  3LG6 A;  4TR4 A;  1YEX A;  1GSQ A;  1RQM A;  1VF2 A;  3MSZ A;  2IMI A;  5ECS A;  3QFA C;  4JRR A;  5ECN B;  4V1A g;  3FW2 A;  4OD7 A;  3DEX A;  3ZVJ D;  2VUP A;  3RDW A;  4NHW A;  3VI5 A;  4IQ1 A;  1OKD A;  1Q98 A;  4GTU A;  1FB6 A;  2XPD A;  4YAV A;  4GSS A;  1WPI A;  5DCH A;  3UVT A;  3KXO A;  5AGY A;  1ZYP A;  3CTF A;  4Q5N A;  1C72 A;  4JE1 A;  4J56 E;  1BX9 A;  5GST A;  1T8E B;  2GZZ A;  2NDO A;  3GFK A;  4IJI A;  2VM1 A;  3A3T A;  1QXH A;  2JZR A;  4L5O A;  1T3B A;  4WBR D;  5AN1 A;  4HJM A;  1O85 A;  1VF3 A;  2WDU A;  1G7E A;  2PWJ A;  3CBU A;  5J5N A;  2G0F A;  1B8X A;  3Q74 A;  1Z7R A;  2CVK A;  2XBQ A;  3LXZ A;  3H1N A;  4L0W A;  1K3Y A;  3WGX A;  1W89 A;  5ID2 A;  1RW1 A;  3GST A;  2PUK C;  4IW9 A;  1SJI A;  2B5X A;  2YCD A;  1OVN A;  5C04 A;  22GS A;  5HR1 A;  2CQ9 A;  3IE3 A;  1GSD A;  3W6G A;  2MMN A;  1M7T A;  4ID0 A;  3QFB C;  2FHE A;  2GLR A;  4QL7 A;  4GCI A;  2FD3 A;  1F9M A;  3IAS 2;  2VAF A;  2H6Y A;  1M9A A;  4I5Q A;  1X9S B;  4MDC A;  4TXV A;  1DUG A;  3KGK A;  2H6X A;  1KBN A;  1S3D A;  6GSS A;  4MAB A;  1T7P B;  2JL4 A;  1G6Y A;  4LL4 B;  3GX8 A;  2YOI A;  3CYN A;  3DWV A;  2CAQ A;  2VL2 C;  1YF0 A;  4FYB A;  1FO5 A;  3ERW A;  3VK9 A;  1JZD A;  4PNG A;  4WF4 A;  1YKC A;  4AF2 A;  4IEL A;  4YAP A;  4Z7X A;  2PBJ A;  2OKA A;  1GUH A;  1TP9 A;  1U3I A;  4K7O A;  2HRF A;  4K8M A;  2AHE A;  5H5R A;  2R5G A;  3RBT A;  3HVX A;  3VI7 A;  1QMV A;  1O8W A;  5FHI A;  4PTS A;  5F07 A;  4EC0 A;  1AQV A;  1TOF A;  4POM A;  1PGT A;  2HT9 A;  2LQO A;  3APQ A;  2DKH A;  4BL7 B;  1R5P A;  4TRX A;  3RAZ A;  3F9U A;  5D73 A;  2WJU A;  2L5O A;  2A4V A;  4V1A p;  3UL3 A;  2C3N A;  2H19 A;  3U6V A;  2V6K A;  2H0H A;  2O87 A;  1B48 A;  2MBT A;  5INY A;  4GF0 A;  4JED A;  1KEB A;  1V98 A;  4XRD A;  1FVJ A;  1XG8 A;  4AJ8 A;  2MMO A;  1TRV A;  3QOU A;  5CRW A;  5IQY A;  5G5E A;  2A2P A;  1V2A A;  4ACS A;  3D6I A;  1M3J A;  1EEJ A;  2LKU A;  2CA8 A;  4PGT A;  3KEB A;  5H5S A;  5DAL A;  5CRE A;  4WR5 A;  5J9C A;  3CRU A;  2C3Q A;  6GST A;  3L0H A;  2YJH A;  4ISD A;  3ZVJ A;  1TI1 A;  3GA4 A;  4K7I A;  2TRC P;  1XXU A;  2QKE A;  2OAC A;  2OBK A;  2HYX A;  1A0F A;  5HFK A;  1K0O A;  4EIP A;  4HI7 A;  4ZL7 A;  1XWK A;  2X64 A;  3IC8 A;  4KDX A;  1EZK A;  4XS1 A;  3ZL5 A;  3TKP A;  1GSE A;  3EIN A;  3VPT A;  1AC1 A;  1XBS A;  1O81 A;  4O5Q A;  2K18 A;  3LYK A;  4O7H A;  3HXS A;  3ZRD A;  5H5Q A;  1GP1 A;  1JZO A;  4G19 A;  2O85 A;  1E6B A;  1OE7 A;  2H30 A;  5ELA A;  4K2X A;  3CTG A;  4KCA A;  4YQU A;  3ZTL A;  5LD0 A;  1OC8 A;  1AQW A;  1VF4 A;  1PX6 A;  5KN3 A;  2HE3 A;  2L4C A;  1O8X A;  2EIR A;  5B7C A;  2R0G A;  5ECO B;  2K8V A;  5D96 A;  1I5G A;  1FG4 A;  3C7M A;  1GH2 A;  4D73 B;  1X5C A;  1TRU A;  1X5D A;  3DVX A;  2VD0 A;  1SL2 B;  1GTI A;  4BVY A;  3ZIV A;  2YZU A;  3SBC A;  2H1A A;  2E2M A;  4Q5R A;  4G10 A;  3HY2 A;  4TR3 A;  2GS3 A;  2PMT A;  1GSS A;  2AUV A;  1K3L A;  1PKW A;  5B8B A;  4L8E A;  2JSZ A;  2R0C A;  1S3R A;  4PX1 A;  12GS A;  4J57 E;  5B8A A;  2B7K A;  2QSI A;  2RII A;  1AAZ A;  3HVV A;  1M2A A;  2F3M A;  1XCC A;  1BQ7 A;  4BIK A;  2CAI A;  3F3Q A;  2B7J A;  4XS4 B;  2XHF A;  3IOS A;  3GTU A;  2R6K A;  1NHY A;  2LQQ A;  3HKR A;  3IPZ A;  1N8J A;  4KSM A;  4BVX A;  5LNK e;  3HA9 A;  4XHM A;  3GIX A;  2K6V A;  2B3S A;  1R5A A;  3EYT A;  3ISO A;  4MNN A;  4TKY A;  2G2Q A;  2HZE B;  4O92 A;  3US3 A;  4MK3 A;  1XVW A;  1Q4J A;  2YN1 A;  3FR3 A;  2REM A;  1XW9 A;  3ZYW A;  5ECL B;  4X0X A;  4PQH A;  4NHZ A;  4OMV A;  3TDG A;  4RUV A;  3UBK A;  3TKS E;  20GS A;  2VCW A;  4ZBB A;  4AGS A;  1XWC A;  3FMW A;  1M2D A;  2C8U A;  2GDR A;  3A2W A;  1PFO A;  1ZOF A;  4GXZ A;  1ST9 A;  5IPG A;  1Z7P A;  3LEF A;  2IMF A;  4IGJ A;  3F8U A;  4ML6 A;  4EDZ A;  4BA7 A;  2AV4 A;  1BJX A;  1G6W A;  2N5B A;  1EEM A;  2DJ3 A;  4G0I A;  1GL8 A;  4K5S A;  2IME A;  4GQF A;  1ZYN A;  2GGT A;  5B6N A;  4V2L A;  2V32 A;  4WF5 A;  3MDK A;  4KW6 A;  4XTS A;  1T00 A;  5KOX A;  2DMM A;  1Z3E A;  3CXG A;  2WGR A;  4POK A;  4ZL8 A;  2I3Y A;  2EIO A;  3F63 A;  1HQO A;  3C1R A;  4CHS A;  2B1L A;  2H0I A;  2LST A;  1B4P A;  2ZNM A;  3UIW A;  3EC3 A;  2LJK A;  4HQZ A;  3D22 A;  3MAK A;  4X4J A;  1J9B A;  4NMU A;  4JZQ A;  4MA9 A;  4EO3 A;  4FH8 A;  4P3Y B;  1YEP A;  5DQS A;  5JWR B;  2DBC A;  3F6D A;  3PIN A;  1SYR A;  2DIY A;  3GKK A;  5D9X A;  4MH2 A;  1K0A A;  1PMT A;  3GH9 A;  4MPF A;  5D9V A;  1GTB A;  1V58 A;  1U87 A;  5DQY A;  3DIE A;  2VCQ A;  1X9W B;  3DKS A;  3ZIJ A;  3BCK A;  5DJL A;  2KUC A;  2VCX A;  3TRP A;  3MWH A;  1J0F A;  3CRT A;  3FZ5 A;  4KND A;  4BPY A;  5GAP D;  2GT6 A;  1YDK A;  2JZS A;  1TDI A;  2PVQ A;  1JFU A;  1TXX A;  3I9V 2;  4YQV A;  4OWY A;  4KE3 A;  1F6M C;  4MH3 A;  4F0B A;  1M99 A;  4ECB A;  4ZIJ A;  2IWT A;  4ZIL A;  3WGE A;  5DAK B;  4HJ2 A;  4K9Z A;  1GLQ A;  2M72 A;  2HSY A;  5CYY A;  1ERT A;  3L9V A;  3FHK A;  2F9S A;  2IMK A;  3RHC A;  6GSW A;  5CO3 A;  4K2D A; 
#chains in the Genus database with same CATH homology
 2YPM A;  1JZR A;  1X0R A;  1H4O A;  5D9T A;  5LCZ A;  5IO2 A;  4GSN A;  3MNG A;  3ZFB A;  2VM2 A;  4OCE A;  2OJL A;  2M80 A;  4EVM A;  1FW1 A;  4HDE A;  4BL7 A;  1EOH A;  2CZ2 A;  2CX4 A;  1TU8 A;  4YQM A;  3GKM A;  1PL2 A;  3KTB A;  1Y25 A;  3GRX A;  2PPT A;  3I43 A;  4J2F A;  2ON7 A;  3LW9 A;  4HZ4 A;  3S9F A;  2GQM A;  6GSU A;  2DIZ A;  3C8E A;  1FOH A;  2JSY A;  3G7J A;  4G0K A;  2OE0 A;  3HZ8 A;  1CQH A;  2NTO A;  5KEJ A;  1O73 A;  1BED A;  3ED3 A;  3Q18 A;  1YZX A;  4ZL9 A;  1ILO A;  3ZML A;  1PX7 A;  2B6M A;  2VCV A;  1U88 A;  1EV4 A;  2YWM A;  5G5F A;  2DLX A;  4G9H A;  1V40 A;  2E0Q A;  3KCM A;  4CDO A;  3VUR A;  1XW5 A;  3HCZ A;  2DJ0 A;  5COH A;  1K0D A;  3M9J A;  1N2A A;  3IHQ A;  3PPU A;  3NIV A;  1UVZ A;  4QQ7 A;  4TR1 B;  2YWN A;  3TRX A;  2B5E A;  4K0G A;  4HU7 A;  4ZXG A;  2CX3 A;  1SD8 A;  4KB3 A;  4BWQ A;  2I81 A;  4IBP A;  5IO0 A;  3HYP A;  4F82 A;  3WGD A;  1ML6 A;  1GSY A;  2MMZ A;  2KHP A;  1PD2 1;  1GLP A;  5IMV A;  3KZQ A;  4ZB8 A;  3BBY A;  3ZIT A;  2TIR A;  2P5Q A;  2RM5 A;  4XRA A;  2XC2 A;  4KA0 A;  3A2V A;  4D73 A;  1JLW A;  3LQ7 A;  2R37 A;  2WS2 A;  1GNW A;  1GRX A;  1O7U A;  1V57 A;  1HNA A;  2R4V A;  4IP1 A;  3EMP A;  2L4Q A;  3GHA A;  1FB0 A;  2H1B A;  1EP8 A;  4OFN A;  4GLT A;  5IMA A;  3QAG A;  1SK2 A;  3EVI A;  8GSS A;  4MMM A;  5DDL A;  2R0P A;  2DC5 A;  1Z5Y E;  5G1K A;  1OKT A;  4G2E A;  1GTU A;  4NPB A;  3BD2 A;  1QFN A;  4XS4 A;  4BWS A;  2BJX A;  3QMX A;  3A5W A;  3VWV A;  5AIX A;  2CVB A;  2I4A A;  3TKQ A;  2H01 A;  1TK5 B;  2LTK A;  2MZC A;  2H75 A;  2FCH A;  1SJ6 A;  3E9J B;  3EU4 A;  2HZE A;  1YJ6 A;  1TW9 A;  2QA1 A;  5D93 A;  2KLX A;  5HQP A;  5ECH B;  2OE1 A;  3WT2 A;  2KOK A;  2N5A A;  5ABR A;  3DD3 A;  2H8L A;  1JHB A;  1QGV A;  4ECI A;  3TJF A;  4USS A;  1IYI A;  2QC7 A;  4KDY A;  4OO5 A;  3HHV A;  1WOU A;  1PL1 A;  1XVQ A;  5ECI B;  3ZRE A;  5CP1 A;  1G0T A;  2MYG A;  3D5J A;  4KUN A;  4KSO A;  4JR4 A;  2NVL A;  3TJJ A;  5EVO A;  3QCP A;  4LLR A;  2X8G A;  3WD6 A;  4HZ2 A;  2M46 A;  4DVC A;  5HFG A;  1QUW A;  2C4J A;  2VD1 A;  5IIZ A;  2OA7 A;  1PKZ A;  3OR5 A;  4ZB6 A;  2IFQ A;  4X43 A;  1A23 A;  1GWC A;  1PN9 A;  1GUK A;  2P0G A;  1DSB A;  2VLT A;  5HFI A;  1EGO A;  2A2S A;  2C0G A;  3LWA A;  3G9B A;  1XFL A;  2GTU A;  2LRT A;  1A2J A;  1A0R P;  1M2B A;  2OE3 A;  2NBS A;  3IRA A;  5L71 A;  2ES7 A;  4O32 A;  3FZ4 A;  1T4Z A;  5D8I A;  2C0E A;  4N0V A;  3IK7 A;  1YKA A;  3C1S A;  4Z2U A;  2GVP A;  4HS1 A;  2KP1 A;  3EE2 A;  3TB2 A;  3P7X A;  1X9M B;  4ZBA A;  2XPE A;  2YP6 A;  1SL1 B;  4N11 A;  3D4M A;  3KM6 A;  2E2G A;  2HI7 A;  5AIV A;  3FKF A;  4ML1 A;  1MD3 A;  4ZBD A;  3F6F A;  4Q5Q A;  2H76 A;  3TUE A;  4MJA A;  1QQ2 A;  4TXO B;  3DYR A;  3VWW A;  4LA1 A;  4MF6 A;  4Z2T A;  5BMU A;  3HZ4 A;  1VF1 A;  2IMD A;  3H93 A;  4K1F A;  1JZW A;  2I1U A;  5DAK A;  16GS A;  3BJ5 A;  2L6C A;  4ZB9 A;  5JWQ B;  1VRS D;  2LV3 A;  5ECQ B;  2D2Z A;  4F2I A;  1YY7 A;  1Z6M A;  4OO4 A;  3L4N A;  2E7P A;  4FIW A;  4HOJ A;  4DSR A;  1R4W A;  3FRC A;  3ZMK A;  3HJO A;  2R2J A;  2AJQ B;  3QR6 A;  5G2Z A;  4PUA A;  1ZGN A;  1HNC A;  1UN2 A;  2HLS A;  11GS A;  4FYU A;  1TTZ A;  4NWY A;  1QK8 A;  3QAV A;  5ECR B;  2C80 A;  1OE8 A;  3GUS A;  5JWO B;  1MTC A;  1U6T A;  2C0D A;  4NV5 A;  1GTA A;  2FLS A;  1RK4 A;  3JCM L;  3SWL A;  4YKF A;  3VWU A;  5DVB A;  3H4K A;  3DXB A;  2L6D A;  1XOA A;  5ECP B;  3TKS A;  2YAN A;  2O89 A;  1TU7 A;  3EMX A;  4TR0 A;  2C0F A;  3EU3 A;  1G7O A;  1DE1 A;  2IFQ B;  2YWO A;  3TRQ A;  5JCU A;  1MDJ A;  3I6A A;  5CRG A;  3F4S A;  3P2A A;  3ERG A;  3KH7 A;  1TRW A;  1FVK A;  2EC4 A;  4WR4 A;  2H1G A;  3LFL A;  4PXO A;  2VL9 A;  1TK8 B;  1V9W A;  2FWE A;  4TR1 A;  2LNT A;  2V2G A;  1BAY A;  5DCG A;  3I69 A;  1A24 A;  4EDY A;  1WRY A;  3APS A;  4K6X A;  3QD9 A;  3QDN A;  4K0N A;  4IHU A;  2H1D A;  3M1G A;  5DBQ A;  1EV9 A;  5HR3 A;  5IPH A;  5CAX A;  2HRA A;  3L9S A;  1S3A A;  3ZZX A;  2F8A A;  4MZB A;  1AXD A;  4OFT A;  1MEK A;  4OFM A;  5GZZ B;  1GUL A;  3L9U A;  1S3C A;  4HUA A;  1FAA A;  1CQG A;  3ERF A;  4EL1 A;  2KP2 A;  3TGZ A;  1FOV A;  4MP4 A;  2VL2 A;  3UAP A;  1XIY A;  4KX4 A;  3GKX A;  3EWL A;  2VOC A;  5E4W A;  3H79 A;  1R26 A;  2FWF A;  3GL5 A;  2AYT A;  3ME8 A;  1EWX A;  1SL0 B;  1UA5 A;  2C1Y A;  4JBB A;  3GX0 A;  5CRD A;  2IJY A;  3W8J A;  4MLY A;  2J23 A;  4KAE A;  3EUR A;  3TJK A;  2YV9 A;  2H73 A;  2VCZ A;  1SU9 A;  4DSS B;  2HSM A;  4ICY A;  4RI7 A;  5AIS A;  1R7H A;  4POL A;  1ZYE A;  4NAX A;  3IHG A;  5IOX A;  1SK0 A;  3HJM A;  3IA1 A;  5A4U A;  1ZCP A;  3IXR A;  2Z9S A;  5IMZ A;  1ZYQ B;  2YV7 A;  5EY6 A;  5EL8 A;  2PN8 A;  4LMW A;  4WBJ A;  1LJR A;  2VLU A;  2VO4 A;  1K0M A;  5FWG A;  1SKW B;  3ME7 A;  1AQX A;  2VIM A;  4X1U A;  3E0U A;  2FWG A;  4GST A;  2H6Z A;  7GSS A;  4MZC A;  3UBL A;  4FYC A;  3FK8 A;  2WUL A;  2GSQ A;  3P90 A;  1Y6E A;  2ALB A;  3VWX A;  1F3B A;  4PQ1 A;  2CT6 A;  1OAZ A;  3C71 A;  4ULX A;  10GS A;  1AW9 A;  3M0F A;  2FA8 A;  3IBH A;  3IDV A;  2GSR A;  5D9W A;  5CNW A;  2LJA A;  2GSS A;  5E59 A;  4EF0 A;  2H0G A;  3FYG A;  4EIQ A;  2QGV A;  5G31 A;  1ZZY A;  3KIJ A;  3F4R A;  2IIY A;  2RLI A;  3GUR A;  4IS0 A;  4HEA 2;  3C73 A;  5IMC A;  1GNE A;  4PUF C;  2DJJ A;  1AIU A;  2GQL A;  2LRC A;  5GAN D;  3TKS C;  1WE0 A;  2X4A A;  1B9X C;  1GSU A;  3A2X A;  4K5R A;  4GQC A;  4FO5 A;  3J7Y b;  1URM A;  1IYH A;  3WYW A;  4L5L A;  5JCG A;  3FR6 A;  3Q6O A;  3R3E A;  2WZ9 A;  1SK1 A;  3GNJ A;  3PR8 A;  2WB9 A;  2JAC A;  2LUS A;  4IKH A;  2L5L A;  3HD5 A;  2GZP A;  3D4T A;  2PU9 C;  1NSW A;  3UMA A;  3UEM A;  3KP8 A;  3ZLP A;  3D0Z A;  1K0C A;  4I2T A;  1XPV A;  2L57 A;  4QL9 A;  5A4V A;  2CVD A;  3U5R E;  3ZFL A;  2HZF A;  1F37 A;  1XWG A;  2WFC A;  2FWH A;  4A5P A;  1NHO A;  1WJK A;  1ERV A;  4PUR A;  2JAD A;  4MF7 A;  1TJD A;  5A5K A;  2OBI A;  3RPP A;  2DKI A;  5BRT A;  4TVE A;  2V1M A;  1SJZ A;  2YZH A;  1B4Q A;  2DJ1 A;  5KN0 A;  2HRK A;  4V2M A;  2V41 A;  3HVS A;  4TXO A;  2QA2 A;  3M9K A;  1WIK A;  2FNO A;  4Z2R A;  5ELG A;  1KTE A;  1SYX A;  5F8B A;  4EUY A;  1HYU A;  2LNS A;  1FHE A;  2X99 A;  3L78 A;  4GRF A;  1K3O A;  2P5R A;  2FGX A;  3KJY A;  5DJM A;  3F4T A;  4N0Z A;  3LSZ A;  3VFI A;  1OC9 B;  2DJ2 A;  2N5F A;  5ECK B;  4LMV A;  1ZMA A;  2RM6 A;  4HU9 A;  3CSJ A;  1TI3 A;  2LS5 A;  1USB A;  4F03 A;  4KGI A;  2WCI A;  5JCW A;  4KDU A;  1SEN A;  1B9Y C;  1TRS A;  1U3A A;  4EKZ A;  4EE0 A;  1Z9H A;  3G7I A;  2H71 A;  4MJC A;  3GN3 A;  4O5R A;  2H74 A;  4CY6 A;  4HQS A;  4I6X A;  4WKW A;  1BYE A;  1ZL9 A;  1ON4 A;  2GZY A;  3PGT A;  4G0L A;  1NW2 A;  3TCO A;  2CZ3 A;  3G7Y A;  2A4H A;  2WRT A;  3FZ9 A;  3DML A;  3FZA A;  1K0B A;  3HJP A;  4PQI A;  5G30 A;  2IPA A;  2BTO T;  4XS6 A;  5J9B A;  4IJ3 A;  4E8H A;  1E2Y A;  1EOG A;  2FY6 A;  3CMI A;  5KN1 A;  18GS A;  2DML A;  3VPQ A;  1XWB A;  1UC7 A;  2YWI A;  1PN0 A;  1TKD B;  3V1W A;  3KD0 A;  1M9B A;  1I9D A;  1SD9 A;  4CY8 A;  1VGL A;  1EGR A;  4F0C A;  9GSS A;  4WEY A;  1F3A A;  1O6J A;  2LRN A;  2DSA A;  2P31 A;  3W8S A;  2O8V B;  2EIQ A;  3Q19 A;  5IOW A;  1T1V A;  2CV4 A;  2HNL A;  3WT1 A;  4YKG A;  1KNG A;  2HRN A;  4O5U A;  2PER A;  2K8S A;  4L0U A;  1TK0 B;  3KTL A;  5EPF A;  3GSS A;  5ID2 B;  4IP6 A;  1NM3 A;  5KN2 A;  5G1L A;  1W4V A;  3M8N A;  3CSI A;  3J7Y k;  3LXT A;  1HNB A;  3TJG A;  3RPN A;  4N30 A;  2LJR A;  3O76 A;  1MDK A;  4MF5 A;  2HXK A;  2ZUP A;  5B6M A;  5HR0 A;  3TJB A;  3HDC A;  1GUM A;  1LU4 A;  1M0U A;  3UJ1 A;  1Z6N A;  1EP7 A;  2DJK A;  2C3T A;  2JU5 A;  2R3X A;  3QAW A;  5FT3 A;  1ERU A;  4PNF A;  4H86 A;  2A2R A;  5IMF A;  2GQK A;  4MJE A;  2GST A;  1YQ1 A;  1PA3 A;  1PSQ A;  3RHB A;  3D21 A;  3GKN A;  4WET A;  1A8L A;  2BMX A;  2XBI A;  2YJ7 A;  1F2E A;  5C00 A;  3GMF A;  1X5E A;  4V2N A;  1HD2 A;  4DSS A;  2X8C A;  4JR6 A;  2L59 A;  3IC4 A;  3IR4 A;  4N10 A;  3E3E A;  2NPB A;  4MZW A;  1ABA A;  4MPG A;  2IN3 A;  4RI6 A;  3N5O A;  3H8Q A;  3TOT A;  5IM9 A;  5F06 A;  1BG5 A;  2O7K A;  2ON5 A;  4I97 A;  4KF9 A;  19GS A;  3GYK A;  2V6O A;  4K7N A;  1DE2 A;  3UAR A;  4IVF A;  1WWJ A;  3MIX A;  3BCI A;  3UVH A;  2B1K A;  2H66 A;  2VCT A;  4RQX A;  4I2U A;  3P8W A;  2H72 A;  3KP9 A;  4TW5 A;  3IV4 A;  3MYD A;  4ECC A;  2AB6 A;  4KH7 A;  3F3R A;  17GS A;  5HR2 A;  1THX A;  2FA4 A;  3FEU A;  2OAD A;  4OCF A;  2HFD A;  14GS A;  4RQR A;  2MBS A;  5J3R A;  5DAL B;  3NZN A;  4Q5F A;  1GSF A;  5GSS A;  3LGC A;  4FQU A;  4E8E A;  6GSV A;  5F0G A;  2HSH A;  2X49 A;  1MD4 A;  3BOA A;  3QPM A;  4NXI A;  3DGQ A;  1H75 A;  1XWA A;  1AUC A;  3UOM A;  2X8H A;  3EPT A;  1J08 A;  2J9H A;  1JLV A;  5A4W A;  2LEG A;  4XIH A;  5IMD A;  2IL3 A;  4KCE A;  5KOW A;  2TRX A;  3AY8 A;  1A2L A;  4POB A;  4F9Z A;  2RUE A;  3IAM 2;  1OYJ A;  4TN8 A;  1PRX A;  1XOB A;  2MMA A;  2K9F A;  13GS A;  3LOR A;  2YNX A;  3F0I A;  3O3T A;  6GSY A;  2VL3 A;  3IK9 A;  3LJR A;  3O6T A;  3FY7 A;  4LL1 B;  4I8B A;  5J4U A;  2PGT A;  5ENU A;  4GWR A;  2F51 A;  3DVW A;  4BVY B;  6GSX A;  4YH2 A;  3N9J A;  1YF1 A;  4CW9 A;  3GL3 A;  2JZT A;  4DSQ A;  1A8Y A;  3LYP A;  3DRN A;  1DBY A;  4MJB A;  1PQN A;  2I9H A;  4IN0 A;  5F05 A;  4MCU A;  1A2M A;  3TKR A;  1OC3 A;  1SKS B;  3PH9 A;  4NV2 A;  2H70 A;  3NOF A;  3GV1 A;  1ACV A;  3KMN A;  3FR9 A;  1K0N A;  3CSH A;  4IQA A;  4EXJ A;  3KH9 A;  1XZO A;  5ECM B;  2UZ8 A;  1THO A;  2PVO C;  3M3M A;  4TOP A;  4ECJ A;  2B5Y A;  2VLV A;  3K8N A;  3GTU B;  1LBK A;  1XW6 A;  3VLN A;  1ERW A;  2RUF A;  1T4Y A;  4BVX B;  3A5I A;  4JU5 A;  1OC9 A;  2ZCT A;  2GT5 A;  5CRH A;  3TOU A;  4WXT A;  2AAW A;  5J41 A;  1WMJ A;  1WP0 A;  3KMO A;  4AJ7 A;  4AJ6 A;  2FUG 2;  4DEJ A;  3GH6 A;  4ILF A;  3R2Q A;  2F8F A;  4XCS A;  3APO A;  1MDI A;  1SKR B;  3LG6 A;  4TR4 A;  1YEX A;  1GSQ A;  1RQM A;  1VF2 A;  3MSZ A;  2IMI A;  5ECS A;  3QFA C;  4JRR A;  5ECN B;  4V1A g;  3FW2 A;  4OD7 A;  3DEX A;  3ZVJ D;  2VUP A;  3RDW A;  4NHW A;  3VI5 A;  4IQ1 A;  1OKD A;  1Q98 A;  4GTU A;  1FB6 A;  2XPD A;  4YAV A;  4GSS A;  1WPI A;  5DCH A;  3UVT A;  3KXO A;  5AGY A;  1ZYP A;  3CTF A;  4Q5N A;  1C72 A;  4JE1 A;  4J56 E;  1BX9 A;  5GST A;  1T8E B;  2GZZ A;  2NDO A;  3GFK A;  4IJI A;  2VM1 A;  3A3T A;  1QXH A;  2JZR A;  4L5O A;  1T3B A;  4WBR D;  5AN1 A;  4HJM A;  1O85 A;  1VF3 A;  2WDU A;  1G7E A;  2PWJ A;  3CBU A;  5J5N A;  2G0F A;  1B8X A;  3Q74 A;  1Z7R A;  2CVK A;  2XBQ A;  3LXZ A;  3H1N A;  4L0W A;  1K3Y A;  3WGX A;  1W89 A;  5ID2 A;  1RW1 A;  3GST A;  2PUK C;  4IW9 A;  1SJI A;  2B5X A;  2YCD A;  1OVN A;  5C04 A;  22GS A;  5HR1 A;  2CQ9 A;  3IE3 A;  1GSD A;  3W6G A;  2MMN A;  1M7T A;  4ID0 A;  3QFB C;  2FHE A;  2GLR A;  4QL7 A;  4GCI A;  2FD3 A;  1F9M A;  3IAS 2;  2VAF A;  2H6Y A;  1M9A A;  4I5Q A;  1X9S B;  4MDC A;  4TXV A;  1DUG A;  3KGK A;  2H6X A;  1KBN A;  1S3D A;  6GSS A;  4MAB A;  1T7P B;  2JL4 A;  1G6Y A;  4LL4 B;  3GX8 A;  2YOI A;  3CYN A;  3DWV A;  2CAQ A;  2VL2 C;  1YF0 A;  4FYB A;  1FO5 A;  3ERW A;  3VK9 A;  1JZD A;  4PNG A;  4WF4 A;  1YKC A;  4AF2 A;  4IEL A;  4YAP A;  4Z7X A;  2PBJ A;  2OKA A;  1GUH A;  1TP9 A;  1U3I A;  4K7O A;  2HRF A;  4K8M A;  2AHE A;  5H5R A;  2R5G A;  3RBT A;  3HVX A;  3VI7 A;  1QMV A;  1O8W A;  5FHI A;  4PTS A;  5F07 A;  4EC0 A;  1AQV A;  1TOF A;  4POM A;  1PGT A;  2HT9 A;  2LQO A;  3APQ A;  2DKH A;  4BL7 B;  1R5P A;  4TRX A;  3RAZ A;  3F9U A;  5D73 A;  2WJU A;  2L5O A;  2A4V A;  4V1A p;  3UL3 A;  2C3N A;  2H19 A;  3U6V A;  2V6K A;  2H0H A;  2O87 A;  1B48 A;  2MBT A;  5INY A;  4GF0 A;  4JED A;  1KEB A;  1V98 A;  4XRD A;  1FVJ A;  4AJ8 A;  2MMO A;  1TRV A;  3QOU A;  5CRW A;  5IQY A;  5G5E A;  2A2P A;  1V2A A;  4ACS A;  3D6I A;  1EEJ A;  2LKU A;  2CA8 A;  4PGT A;  3KEB A;  5H5S A;  5DAL A;  5CRE A;  4WR5 A;  5J9C A;  3CRU A;  2C3Q A;  6GST A;  3L0H A;  2YJH A;  4ISD A;  3ZVJ A;  1TI1 A;  3GA4 A;  4K7I A;  2TRC P;  1XXU A;  2QKE A;  2OAC A;  2OBK A;  2HYX A;  1A0F A;  5HFK A;  1K0O A;  4EIP A;  4HI7 A;  4ZL7 A;  1XWK A;  2X64 A;  3IC8 A;  4KDX A;  1EZK A;  4XS1 A;  3ZL5 A;  3TKP A;  1GSE A;  3EIN A;  3VPT A;  1AC1 A;  1XBS A;  1O81 A;  4O5Q A;  2K18 A;  3LYK A;  4O7H A;  3HXS A;  3ZRD A;  5H5Q A;  1GP1 A;  1JZO A;  4G19 A;  2O85 A;  1E6B A;  1OE7 A;  2H30 A;  5ELA A;  4K2X A;  3CTG A;  4KCA A;  4YQU A;  3ZTL A;  5LD0 A;  1OC8 A;  1AQW A;  1VF4 A;  1PX6 A;  5KN3 A;  2HE3 A;  2L4C A;  1O8X A;  2EIR A;  5B7C A;  2R0G A;  5ECO B;  2K8V A;  5D96 A;  1I5G A;  1FG4 A;  3C7M A;  1GH2 A;  4D73 B;  1X5C A;  1TRU A;  1X5D A;  3DVX A;  2VD0 A;  1SL2 B;  1GTI A;  4BVY A;  3ZIV A;  2YZU A;  3SBC A;  2H1A A;  2E2M A;  4Q5R A;  4G10 A;  3HY2 A;  4TR3 A;  2GS3 A;  2PMT A;  1GSS A;  2AUV A;  1K3L A;  1PKW A;  5B8B A;  4L8E A;  2JSZ A;  2R0C A;  4PX1 A;  12GS A;  4J57 E;  5B8A A;  2B7K A;  2QSI A;  2RII A;  1AAZ A;  3HVV A;  1M2A A;  2F3M A;  1XCC A;  1BQ7 A;  2CAI A;  3F3Q A;  2B7J A;  4XS4 B;  2XHF A;  3IOS A;  3GTU A;  2R6K A;  1NHY A;  2LQQ A;  3HKR A;  3IPZ A;  1N8J A;  4KSM A;  4BVX A;  5LNK e;  3HA9 A;  4XHM A;  3GIX A;  2K6V A;  2B3S A;  1R5A A;  3EYT A;  3ISO A;  4MNN A;  4TKY A;  2G2Q A;  2HZE B;  4O92 A;  3US3 A;  4MK3 A;  1XVW A;  1Q4J A;  2YN1 A;  3FR3 A;  2REM A;  1XW9 A;  3ZYW A;  5ECL B;  4X0X A;  4PQH A;  4NHZ A;  4OMV A;  3TDG A;  4RUV A;  3UBK A;  3TKS E;  20GS A;  2VCW A;  4ZBB A;  4AGS A;  1XWC A;  3FMW A;  1M2D A;  2C8U A;  2GDR A;  3A2W A;  1ZOF A;  4GXZ A;  1ST9 A;  5IPG A;  1Z7P A;  3LEF A;  2IMF A;  4IGJ A;  3F8U A;  4ML6 A;  4EDZ A;  4BA7 A;  2AV4 A;  1BJX A;  1G6W A;  2N5B A;  1EEM A;  2DJ3 A;  4G0I A;  1GL8 A;  4K5S A;  2IME A;  4GQF A;  1ZYN A;  2GGT A;  5B6N A;  4V2L A;  2V32 A;  4WF5 A;  3MDK A;  4KW6 A;  4XTS A;  1T00 A;  5KOX A;  2DMM A;  1Z3E A;  3CXG A;  2WGR A;  4POK A;  4ZL8 A;  2I3Y A;  2EIO A;  3F63 A;  1HQO A;  3C1R A;  4CHS A;  2B1L A;  2H0I A;  2LST A;  1B4P A;  2ZNM A;  3UIW A;  3EC3 A;  2LJK A;  4HQZ A;  3D22 A;  3MAK A;  4X4J A;  1J9B A;  4NMU A;  4JZQ A;  4MA9 A;  4EO3 A;  4FH8 A;  4P3Y B;  1YEP A;  5DQS A;  5JWR B;  2DBC A;  3F6D A;  3PIN A;  1SYR A;  2DIY A;  3GKK A;  5D9X A;  4MH2 A;  1K0A A;  1PMT A;  3GH9 A;  4MPF A;  5D9V A;  1GTB A;  1V58 A;  1U87 A;  5DQY A;  3DIE A;  2VCQ A;  1X9W B;  3DKS A;  3ZIJ A;  3BCK A;  5DJL A;  2KUC A;  2VCX A;  3TRP A;  3MWH A;  1J0F A;  3CRT A;  3FZ5 A;  4KND A;  4BPY A;  5GAP D;  2GT6 A;  1YDK A;  2JZS A;  1TDI A;  2PVQ A;  1JFU A;  1TXX A;  3I9V 2;  4YQV A;  4OWY A;  4KE3 A;  1F6M C;  4MH3 A;  4F0B A;  1M99 A;  4ECB A;  4ZIJ A;  2IWT A;  4ZIL A;  3WGE A;  5DAK B;  4HJ2 A;  4K9Z A;  1GLQ A;  2M72 A;  2HSY A;  5CYY A;  1ERT A;  3L9V A;  3FHK A;  2F9S A;  2IMK A;  3RHC A;  6GSW A;  5CO3 A;  4K2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...