3TJFA

Crystal structure of human peroxiredoxin iv c51a mutant in reduced form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
195
structure length
195
Chain Sequence
HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin-4
publication title Crystal Structure of Reduced and of Oxidized Peroxiredoxin IV Enzyme Reveals a Stable Oxidized Decamer and a Non-disulfide-bonded Intermediate in the Catalytic Cycle.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 65
structure length 195
sequence length 195
chains with identical sequence B, C, D, E
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tjfA00
1YF1A 2OACA 1SK2A 5D73A 1M2DA 3KTLA 2H6ZA 2MMOA 2NVLA 3CSIA 4MPFA 4EO3A 5A4VA 4QL7A 4PGTA 1QFNA 2H01A 2YNXA 4AGSA 1GNEA 2QGVA 4YAPA 4LMWA 1MDKA 2FCHA 3EMXA 2K8VA 3IAS2 3BOAA 1V40A 1K0MA 2Z9SA 1WIKA 2KUCA 3MNGA 1PMTA 4BL7A 2B7JA 4GCIA 3SWLA 2H0HA 3DD3A 4I2UA 2YCDA 4Z7XA 1GSDA 1OKTA 2JADA 3BD2A 4X0XA 3EE2A 1MD4A 2R4VA 1S3DA 4OWYA 4MF5A 4OCFA 1GTUA 2WCIA 3IK9A 1FAAA 2IWTA 1PL1A 5IM9A 4TOPA 4TKYA 1AQXA 1KTEA 2IL3A 1ERUA 3I69A 2I3YA 3HVSA 2X99A 2M80A 1XWAA 3C71A 4WETA 2G0FA 1WOUA 5AIVA 2KHPA 3ZFBA 1YKAA 3A2WA 2LRTA 4V1Ap 1USBA 2RLIA 3F3RA 2DJ3A 4KSMA 3KEBA 5HR2A 4F0CA 1GUMA 1FW1A 2VLVA 3M8NA 4RI7A 2C1YA 3PGTA 4IJIA 1DSBA 2E0QA 3HCZA 1ML6A 4ZILA 1JZOA 3DYRA 1FOVA 1N2AA 4AJ6A 3CRUA 12GSA 1CQHA 1LU4A 4IP6A 3H93A 2RM5A 2PN8A 2KOKA 5CP1A 1BQ7A 1M2BA 1GTIA 1PKWA 1G6YA 1MDJA 1OC9A 4WBJA 4GXZA 3RHCA 3S9FA 3GNJA 1TW9A 2OE0A 3GUSA 3D4MA 1EV4A 1GSUA 2VCWA 4ECJA 4JBBA 4GSNA 2LJAA 4V2MA 5EL8A 2H8LA 3ZMLA 2IMFA 3H8QA 1I5GA 2GLRA 3EYTA 1T3BA 3TJGA 3LXZA 3GYKA 4IKHA 4OFMA 2B6MA 3CYNA 1A8LA 3VI7A 2JSZA 3ZL5A 6GSUA 1UA5A 1TI3A 2FA4A 5J9BA 3FR9A 4TR1B 5DALB 4JE1A 3PINA 3HA9A 1KEBA 2PVQA 3NIVA 3RPPA 1AUCA 1EGRA 2H1GA 5A4UA 2GSSA 7GSSA 1SD8A 1K0OA 4JRRA 2YWIA 6GSXA 5ECNB 1TK8B 1W4VA 5DJMA 2H73A 4PQ1A 2MMAA 1HQOA 4EKZA 1V9WA 3UOMA 5CO3A 4XS6A 1X9SB 2LNSA 1YDKA 5L71A 5JCGA 5D9WA 1GTBA 1XWKA 1TRWA 4JR4A 5F07A 1JZRA 4ZXGA 3I43A 4N0VA 3A5WA 3E3EA 2B5EA 3TB2A 1T4YA 5ECPB 3KCMA 2VCZA 4TR1A 3UARA 1M99A 5DALA 1YKCA 3G7JA 2VD1A 5J5NA 5KEJA 1O8XA 2JSYA 3GURA 3QOUA 3TJKA 1XWBA 1ZOFA 2LTKA 4ML6A 3WD6A 10GSA 3TKSC 9GSSA 1O6JA 5DDLA 2CAIA 3ME7A 3MAKA 2N5FA 5IO2A 3DGQA 2IIYA 4IHUA 1TRVA 3I6AA 4ZBDA 2B3SA 3C7MA 3KP8A 3ZIJA 3GIXA 4IW9A 1GP1A 2VAFA 2GQMA 2OADA 1NSWA 4MF7A 3LXTA 3UEMA 4ZB6A 1DBYA 1AIUA 4NHWA 1T7PB 3FZ4A 3Q74A 5DCGA 2IMEA 1PSQA 2VL9A 5INYA 4K7OA 4LA1A 5DJLA 4GSSA 2EIOA 2VL3A 4POMA 3ZRDA 4NXIA 2DC5A 1MD3A 3GTUB 4FH8A 19GSA 4PURA 3P8WA 2GSRA 2B1KA 2L5LA 2P0GA 1SK0A 4NHZA 3ZVJA 5ECHB 5GZZB 2NBSA 3DVWA 1F3BA 1G6WA 4Q5NA 3KMOA 1ILOA 5D93A 3UJ1A 2PGTA 3O3TA 1F2EA 2K18A 3KIJA 2WJUA 1NM3A 2YZHA 5G30A 2E2GA 2FY6A 3CXGA 5HR0A 4FO5A 5IQYA 3ZVJD 4FIWA 1XXUA 3A2XA 1V58A 1VRSD 1VGLA 3HZ8A 3AY8A 2L4CA 2PUKC 6GSVA 2KP1A 3ME8A 2JZRA 5G1LA 3FYGA 2E2MA 2GZZA 4ECCA 5B8AA 1LBKA 2WFCA 1Z6NA 2BJXA 3IOSA 1HNCA 2OJLA 4L8EA 4QQ7A 1XW9A 3M3MA 3GTUA 5ECLB 1QUWA 3TJFA 4POLA 1EWXA 2PVOC 5E4WA 4MJCA 3RDWA 2VM2A 5A4WA 3LG6A 1I9DA 4FYBA 2PBJA 4G2EA 2MBTA 2PERA 4BVYA 2XBQA 1GUHA 1XW6A 2X8HA 4NMUA 3IRAA 1J08A 2YJHA 2MMZA 2CAQA 3L9SA 1BYEA 1JFUA 4HQSA 1GWCA 1PGTA 3KH7A 2OBIA 2H1AA 1O81A 1B9XC 4H86A 1K0BA 1EOHA 4E8HA 4K7IA 1EEJA 1Q4JA 1T00A 1ON4A 4Q5QA 4HUAA 4DSSB 2LQQA 4ML1A 2GSTA 4GSTA 2NTOA 2ZCTA 2YP6A 3ERWA 1JLWA 4MZCA 2GQLA 2H66A 1SL2B 3BJ5A 5HFGA 2I81A 5FHIA 4ZL7A 13GSA 2PMTA 3U6VA 3GH6A 5KN2A 2JL4A 1JZDA 4KDUA 3KD0A 4RUVA 5CREA 14GSA 1XVWA 2GTUA 4KDXA 3KTBA 1VF2A 3P7XA 3BCKA 3DIEA 2MMNA 2HSHA 2GS3A 2GSQA 2FWGA 5ECOB 5ECKB 3CRTA 2V6OA 4KW6A 5COHA 3F3QA 4N10A 3QMXA 1QXHA 2G2QA 1OE7A 5G31A 1HD2A 4DSSA 3HY2A 3NZNA 3CBUA 3TOUA 4NV2A 2GDRA 1R26A 1X5EA 3QAVA 2YANA 5IMFA 4ZB9A 1OAZA 2H71A 1AQVA 1TU7A 2H0GA 2L6DA 2DBCA 3GKKA 1F3AA 1BAYA 4LLRA 3F8UA 5F06A 4EE0A 4IVFA 4DVCA 5IOXA 2H74A 3BBYA 1SYRA 3VWVA 1E2YA 4DEJA 1XW5A 4XHMA 2GVPA 4PUFC 4YQMA 4WR4A 2VO4A 3CMIA 1WP0A 1ZMAA 2B5XA 1A8YA 1FHEA 1W89A 5IMZA 2H6YA 2WULA 4N0ZA 2IFQB 4NV5A 1A24A 1SD9A 2CX3A 1TDIA 1YY7A 4JEDA 2WZ9A 1WMJA 1XZOA 5ECMB 3Q19A 3WGDA 2BTOT 3P2AA 4KDYA 5CRWA 5IPHA 4K6XA 4CW9A 2AB6A 3TOTA 2C3TA 3QAWA 2ON5A 1J9BA 1PX6A 2YZUA 3LGCA 1R5PA 4HJMA 3GA4A 4GF0A 2PWJA 3DRNA 2K9FA 5EY6A 4HI7A 1GSQA 2REMA 3EINA 2IMIA 1G7OA 1BG5A 2L4QA 2I4AA 3HJPA 1SK1A 3HKRA 3Q6OA 1XWCA 2PPTA 1ABAA 3QPMA 3IK7A 1MEKA 1YZXA 4ID0A 2X64A 1JHBA 2V2GA 1F6MC 1X0RA 1GL8A 1O73A 2IFQA 1G7EA 1WJKA 3ED3A 4MCUA 1ERTA 1ZCPA 3LYPA 1UVZA 3F63A 3UBLA 2C3NA 4IQ1A 2FWEA 1Q98A 2TRCP 1ZZYA 1Z7PA 2AJQB 1GNWA 1JZWA 3G7IA 4KE3A 4DSRA 3LSZA 2O8VB 1XBSA 1ERWA 4ZIJA 4L0WA 3EU4A 3IXRA 3HVVA 4MLYA 4MMMA 4GTUA 6GSWA 1O8WA 3HZ4A 4KGIA 1E6BA 3CSJA 3HYPA 3LWAA 2LJRA 4HS1A 4EXJA 3APQA 4MK3A 3QFBC 2FHEA 1AQWA 1GRXA 2HXKA 5GSTA 1OC3A 4CHSA 2F3MA 4HEA2 1FB0A 5J4UA 4XRAA 1F9MA 4PUAA 3DWVA 4BA7A 2DJ2A 4GWRA 3C1RA 3N9JA 4NAXA 2I1UA 2VL2A 4TXOB 6GSYA 1HYUA 1XOBA 4KUNA 2YN1A 2YWNA 1ZL9A 4K8MA 5H5RA 1SYXA 5DQSA 4HZ2A 5F0GA 3E9JB 5DAKB 3BCIA 3O76A 1B8XA 2CX4A 5E59A 2L57A 3GL3A 3TKRA 18GSA 4BPYA 1YEPA 2WDUA 2N5BA 2H72A 4X1UA 3GMFA 2FGXA 3UMAA 2B1LA 4XRDA 1GLQA 5G2ZA 3P90A 2C80A 3FZ9A 1EP8A 1PX7A 2EC4A 17GSA 4CDOA 1DUGA 3HXSA 3NOFA 1ERVA 2H1BA 2FWHA 5IMDA 4HDEA 3LYKA 5J3RA 3F6DA 2NDOA 4TXOA 4PX1A 1DE2A 2ON7A 2F8FA 4K2DA 5ECRB 5IMVA 2X8CA 3EMPA 3JCML 2FNOA 5DCHA 2K8SA 5DAKA 2HNLA 3FRCA 3TKSA 1SJ6A 5LNKe 2C0GA 1MDIA 6GSTA 1VF4A 2E7PA 1TRUA 3GN3A 2CV4A 3KP9A 3GSTA 4MABA 4ACSA 2R37A 4ZB8A 4I5QA 2V1MA 3L9VA 4I97A 3DEXA 5HR3A 3US3A 3WYWA 2QSIA 2YV9A 3E0UA 3GV1A 2HI7A 3TRXA 3UVHA 2EIQA 2A2RA 2H30A 2O7KA 2B5YA 1H75A 2L6CA 2GZYA 3EU3A 4ULXA 2FD3A 3GFKA 2K6VA 3CTGA 2HLSA 2C0EA 4F03A 1THOA 4G19A 4KAEA 3QCPA 1YEXA 1U3AA 1EGOA 4LL1B 1MTCA 3RPNA 3APOA 1H4OA 4YAVA 3QD9A 2GT5A 5CAXA 2VCTA 1V57A 3FHKA 1R7HA 2H75A 1BX9A 3C8EA 3TUEA 2ZNMA 2ZUPA 2XBIA 4V2NA 3K8NA 1OC8A 2DJ1A 2C8UA 4E8EA 2C0FA 1K0DA 1TTZA 2KLXA 2P5RA 4ZL9A 2OKAA 1T8EB 4OD7A 1K0NA 4DSQA 4AF2A 2HT9A 2C4JA 1XIYA 2VOCA 2HFDA 4MF6A 2VCVA 1OE8A 1EV9A 1HNAA 5JWOB 2V32A 5IMCA 3F4SA 3VK9A 2O87A 4J2FA 4GLTA 4KX4A 1TU8A 1SKSB 1KNGA 3IDVA 2MBSA 5ECIB 11GSA 4F2IA 3TKSE 4KNDA 4KCEA 3D22A 3VWWA 1V98A 3L78A 3DMLA 5IMAA 3APSA 2YV7A 3IR4A 2N5AA 2LJKA 2LUSA 2KP2A 2F9SA 2RM6A 5ELGA 2VD0A 4IGJA 1M2AA 2DJKA 5D8IA 1NW2A 2ES7A 3VLNA 2FA8A 4J56E 3IE3A 2YJ7A 2RUEA 2L59A 1TK0B 1R5AA 4V1Ag 1OYJA 4TRXA 3GSSA 5ECSA 1PQNA 1Z5YE 1M7TA 2WGRA 2CVKA 4XIHA 5IPGA 1XFLA 1OKDA 2OE1A 4L5LA 5KN0A 2CZ2A 2IJYA 3ZFLA 4WXTA 4MJEA 4BWQA 1YF0A 22GSA 1B4PA 4ZL8A 1GLPA 1TJDA 4P3YB 6GSSA 2MYGA 1XOAA 4XS4B 1B4QA 4ZBAA 5G1KA 1HNBA 4I2TA 3FR6A 2H70A 1ZYQB 2HYXA 4GQCA 1ST9A 2PU9C 3LFLA 3R2QA 3VPTA 3ZIVA 3ZTLA 1FG4A 1FVJA 3HVXA 2OA7A 5HQPA 2CZ3A 2C0DA 2F51A 2NPBA 5C04A 2VCXA 1S3AA 5DBQA 5DQYA 1LJRA 4AJ8A 4TN8A 5DVBA 1K0AA 3EWLA 4ECIA 2VIMA 1O7UA 3PR8A 4TR3A 2O89A 2XPEA 5AN1A 1F37A 2V6KA 3F9UA 4F82A 1PN9A 1J0FA 1WPIA 4I6XA 4FYCA 1URMA 1BJXA 1GH2A 3F4RA 2JZSA 3LQ7A 3J7Yk 4XS4A 3LORA 1EP7A 5J9CA 4MZBA 5LCZA 5JCUA 1R4WA 4K9ZA 5C00A 3W8JA 4G9HA 4NWYA 3FR3A 3IHQA 3W8SA 1SL1B 2GT6A 3G9BA 2IN3A 5B8BA 2YPMA 2HE3A 3KJYA 3TCOA 1UN2A 1EOGA 2VCQA 3HHVA 4EDZA 5GSSA 4KA0A 3FZAA 2MZCA 3PH9A 3IA1A 5AIXA 2YWMA 3GKXA 3GX0A 2LQOA 2JZTA 1B9YC 5FWGA 1GSSA 3VPQA 1SENA 1X9MB 4ILFA 2TIRA 3KH9A 4L5OA 1JLVA 3W6GA 1AW9A 3DXBA 4OFNA 4IBPA 1A2JA 3FEUA 4MP4A 1OC9B 4RQXA 8GSSA 3FK8A 3Q18A 1T1VA 1AC1A 1U3IA 5IO0A 3GKMA 2JU5A 5ELAA 4MDCA 5GAPD 4KSOA 2RIIA 4PXOA 4J57E 3UL3A 4TXVA 2CT6A 4EDYA 1A0FA 5KN3A 2LSTA 1G0TA 1SU9A 4Q5RA 3VI5A 1M9BA 1DE1A 4X43A 3CSHA 3F6FA 1GSEA 5JCWA 3WGEA 3H1NA 3A3TA 1O85A 2LEGA 3D5JA 1IYHA 1X5DA 3WGXA 2HSYA 2LKUA 4V2LA 4YQUA 3D21A 4XTSA 5JWQB 1Z7RA 2VUPA 2JACA 2J9HA 4N11A 1TP9A 2V41A 1GSFA 3HDCA 4JZQA 1A2LA 4KH7A 3TGZA 2VM1A 2AUVA 1K0CA 4IELA 3WT2A 3H79A 3ZMKA 3IAM2 2CVDA 3D4TA 2OBKA 4F9ZA 2H19A 1YJ6A 4WKWA 2O85A 1UC7A 2D2ZA 3F0IA 4IJ3A 4KB3A 3HJOA 2H76A 1NHYA 3ERFA 4MJAA 1YQ1A 3IV4A 2LRNA 4AJ7A 2XPDA 2VL2C 4EC0A 1SL0B 1Z9HA 2HRFA 3TJBA 1A23A 4BVXA 3RBTA 1V2AA 5EVOA 1PL2A 3M1GA 3UIWA 3LJRA 1THXA 2CVBA 2IMDA 4O92A 4WF4A 1SJZA 2AHEA 5G5FA 4XS1A 1TI1A 1B48A 1KBNA 2IPAA 2WRTA 3ZZXA 2HZFA 5B7CA 3MDKA 2H0IA 1Z6MA 2QKEA 5F8BA 1VF3A 2L5OA 3GL5A 4OFTA 4K1FA 1AXDA 2M72A 3UAPA 4K0GA 3KM6A 2R6KA 1WRYA 4WR5A 3RAZA 3J7Yb 1K3LA 1GSYA 1K3YA 1U87A 2DJ0A 2FUG2 1GULA 3GX8A 3EVIA 1NHOA 1A0RP 1TK5B 2R5GA 1PD21 4YH2A 1M0UA 1RQMA 2LV3A 2XC2A 1U88A 1XPVA 4JU5A 2DIZA 3GH9A 1Y6EA 1N8JA 1TOFA 1ZGNA 3TKPA 2VLUA 4JR6A 5IOWA 3DVXA 4TR0A 2M46A 5ECQB 2F8AA 2CA8A 5GAND 5D9TA 1TRSA 1XVQA 4WBRD 3GKNA 1QGVA 2RUFA 4D73B 2P31A 4LL4B 2DIYA 4Q5FA 4PNGA 5AGYA 2H1DA 2FWFA 4PQIA 4MJBA 4K7NA 1CQGA 3IBHA 1QK8A 2X8GA 4MA9A 2DMMA 3M9JA 4TVEA 3WT1A 3HD5A 5KN1A 1OVNA 3ISOA 4LMVA 4MPGA 2GQKA 2EIRA 3QDNA 4RI6A 4IP1A 3A2VA 5HFKA 4OO4A 3ZLPA 2B7KA 4K0NA 2HZEB 2OE3A 2YWOA 5IIZA 4O7HA 3QR6A 3N5OA 5CNWA 1T4ZA 5D96A 5B6NA 1C72A 1SKRB 3TKQA 3IC4A 4POBA 3G7YA 16GSA 20GSA 3VWXA 3ERGA 3ZYWA 4TW5A 3KZQA 1QMVA 2DLXA 4D73A 1EZKA 4N30A 1VF1A 3C73A 1Y25A 4HZ4A 2AAWA 2A2SA 1TXXA 2BMXA 3FY7A 4HU9A 4HJ2A 5H5QA 4HOJA 2ALBA 2QC7A 2HRNA 5FT3A 4BWSA 5CRDA 2AV4A 2XHFA 2IMKA 2WS2A 2LRCA 1GUKA 4TR4A 4YQVA 5G5EA 1Z3EA 4FYUA 3KGKA 2HZEA 4PQHA 3MSZA 4IN0A 5ID2B 1QQ2A 5A5KA 4EF0A 4EL1A 5D9VA 1K3OA 1RK4A 1ZYEA 3QAGA 3TDGA 5LD0A 3TJJA 4MH3A 2R2JA 5CRGA 2P5QA 4ZBBA 1X5CA 1XCCA 4HQZA 4WF5A 3VWUA 4F0BA 1S3CA 2GGTA 2H6XA 3L4NA 3L0HA 1A2MA 1FVKA 3M9KA 5CRHA 3U5RE 5AISA 5B6MA 2R3XA 3ZREA 2C3QA 1TKDB 2DJJA 3H4KA 1PA3A 3UVTA 3SBCA 1PRXA 3VURA 4OO5A 5HR1A 3FKFA 1U6TA 4O5RA 5JWRB 3O6TA 1XWGA 4ISDA 3ZITA 4EUYA 4EVMA 3GHAA 2AYTA 3D0ZA 4OCEA 3TRQA 3QFAC 3I9V2 3UBKA 1BEDA 3F4TA 5F05A 1RW1A 1SJIA 2LS5A 3C1SA 3EC3A 4L0UA 4NPBA 5CYYA 5ABRA 2DSAA 2I9HA 5ID2A 4KCAA 4ECBA 1M9AA 3TRPA 4G10A 5J41A 3KXOA 3CTFA 2DMLA 3OR5A 3FW2A 4RQRA 4IQAA 2FLSA 3L9UA 4POKA 2VLTA 5HFIA 1FB6A 3IPZA 3KMNA 1ACVA 4IS0A 4WEYA 1WE0A 2TRXA 3M0FA 1PKZA 3VFIA 4PNFA 1X9WB 1WWJA 2WB9A 2LNTA 5ENUA 1EEMA 5EPFA 4QL9A 4I8BA 4MH2A 2A4VA 3D6IA 5D9XA 3MWHA 1GTAA 3DKSA 2GZPA 5H5SA 2YOIA 3V1WA 1IYIA 3LEFA 2CQ9A 3FZ5A 3RHBA 4GRFA 3HJMA 4O32A 4XCSA 1FO5A 3EURA 3GRXA 4HU7A 1SKWB 1AAZA 2J23A 4GQFA 4OMVA 4MZWA
chains in the Genus database with same CATH superfamily
1YF1A 2OACA 4O5UA 1SK2A 5D73A 1M2DA 3KTLA 2H6ZA 2MMOA 2NVLA 3CSIA 4MPFA 4EO3A 5A4VA 4QL7A 4PGTA 1QFNA 2H01A 2YNXA 4AGSA 1GNEA 4G0LA 2QGVA 4YAPA 4LMWA 1MDKA 2FCHA 3EMXA 2K8VA 3IAS2 3BOAA 1V40A 1K0MA 2Z9SA 1WIKA 2KUCA 3MNGA 1PMTA 4BL7A 2B7JA 4GCIA 3SWLA 2H0HA 3DD3A 4I2UA 2YCDA 4Z7XA 1S3RA 1GSDA 1OKTA 2JADA 3BD2A 4X0XA 3EE2A 1MD4A 2R4VA 1S3DA 4OWYA 4MF5A 4OCFA 1GTUA 2WCIA 3IK9A 1FAAA 2IWTA 1PL1A 5IM9A 4TOPA 4TKYA 1AQXA 1KTEA 2IL3A 1ERUA 3I69A 2I3YA 3HVSA 2X99A 2M80A 1XWAA 3C71A 1PN0A 4WETA 2G0FA 1WOUA 5AIVA 4EIQA 2KHPA 3ZFBA 2A4HA 1YKAA 3A2WA 2LRTA 4V1Ap 1USBA 2RLIA 3F3RA 2DJ3A 3IC8A 4KSMA 3KEBA 5HR2A 4F0CA 1GUMA 1FW1A 2VLVA 3M8NA 4RI7A 2C1YA 3PGTA 4IJIA 1DSBA 2E0QA 4K5SA 3HCZA 1ML6A 1XG8A 4ZILA 1JZOA 3DYRA 1FOVA 1N2AA 4AJ6A 3CRUA 2HRAA 12GSA 1CQHA 1LU4A 4IP6A 3H93A 2RM5A 2PN8A 2KOKA 5CP1A 1BQ7A 1M2BA 1GTIA 1PKWA 1G6YA 1MDJA 1OC9A 4WBJA 4GXZA 3RHCA 1M3IA 3S9FA 3A5IA 3GNJA 1TW9A 2OE0A 3GUSA 3D4MA 1EV4A 1GSUA 1ZYPA 2VCWA 4ECJA 2DKHA 4JBBA 4GSNA 2LJAA 4V2MA 5EL8A 2H8LA 3ZMLA 2IMFA 3H8QA 1I5GA 2GLRA 3EYTA 1T3BA 3TJGA 3LXZA 3GYKA 4IKHA 4OFMA 2B6MA 3CYNA 1A8LA 3VI7A 2JSZA 3ZL5A 6GSUA 1UA5A 1TI3A 2FA4A 5J9BA 3FR9A 4TR1B 5DALB 4JE1A 3PINA 3HA9A 1KEBA 2PVQA 3NIVA 3RPPA 1AUCA 1EGRA 2H1GA 5A4UA 2GSSA 7GSSA 1SD8A 1K0OA 4JRRA 2YWIA 6GSXA 5ECNB 1TK8B 1W4VA 5DJMA 2H73A 4PQ1A 2MMAA 1HQOA 4EKZA 1V9WA 3UOMA 5CO3A 4XS6A 1X9SB 2LNSA 1YDKA 5L71A 5JCGA 5D9WA 1GTBA 1XWKA 1TRWA 4JR4A 5F07A 1JZRA 4ZXGA 3I43A 4N0VA 3A5WA 3E3EA 2B5EA 3TB2A 1T4YA 4MNNA 5ECPB 3KCMA 2VCZA 4TR1A 3UARA 1M99A 5DALA 1YKCA 3G7JA 2VD1A 5J5NA 3MYDA 5KEJA 1O8XA 2JSYA 3GURA 3QOUA 3TJKA 1XWBA 1ZOFA 2LTKA 4ML6A 3WD6A 10GSA 3TKSC 9GSSA 1O6JA 5DDLA 2CAIA 3ME7A 3MAKA 2N5FA 1PFOA 5IO2A 3DGQA 2IIYA 4IHUA 1TRVA 4Z2UA 3I6AA 4ZBDA 2B3SA 3C7MA 3KP8A 3ZIJA 3GIXA 4IW9A 1GP1A 2VAFA 2GQMA 2OADA 1NSWA 4MF7A 4EIPA 3LXTA 3UEMA 4ZB6A 1DBYA 1AIUA 4NHWA 1T7PB 3FZ4A 3Q74A 5DCGA 2IMEA 1PSQA 2VL9A 5INYA 4K7OA 4LA1A 5DJLA 4GSSA 2EIOA 2VL3A 4POMA 3ZRDA 4NXIA 2DC5A 1MD3A 3GTUB 4FH8A 19GSA 4PURA 3P8WA 2GSRA 2B1KA 2L5LA 2P0GA 1SK0A 4NHZA 3ZVJA 5ECHB 5GZZB 2NBSA 3DVWA 1F3BA 4G0KA 1G6WA 4Q5NA 3KMOA 1ILOA 5D93A 3UJ1A 2PGTA 3O3TA 1F2EA 2K18A 4X4JA 4BVYB 3KIJA 2WJUA 1NM3A 2YZHA 5G30A 2R0CA 2E2GA 2FY6A 3CXGA 5HR0A 4FO5A 5IQYA 3ZVJD 4FIWA 1XXUA 3A2XA 1V58A 1VRSD 1VGLA 3HZ8A 3AY8A 2L4CA 2PUKC 6GSVA 2KP1A 3ME8A 2JZRA 5G1LA 3FYGA 2E2MA 2GZZA 4ECCA 5B8AA 1LBKA 2WFCA 1Z6NA 2BJXA 3IOSA 1HNCA 2OJLA 4L8EA 4QQ7A 1XW9A 3M3MA 3GTUA 5ECLB 1QUWA 3TJFA 4POLA 1EWXA 2PVOC 5E4WA 4MJCA 3RDWA 2VM2A 5A4WA 3LG6A 1I9DA 4FYBA 2PBJA 4G2EA 2MBTA 2PERA 4BVYA 2XBQA 1GUHA 1XW6A 2X8HA 4NMUA 3IRAA 1J08A 2YJHA 2MMZA 2CAQA 3L9SA 1BYEA 1JFUA 4HQSA 1GWCA 1PGTA 3KH7A 2OBIA 2H1AA 1O81A 1B9XC 4H86A 1K0BA 1EOHA 4E8HA 4K7IA 1EEJA 1Q4JA 1T00A 1ON4A 4Q5QA 4HUAA 4DSSB 2LQQA 4ML1A 2GSTA 4GSTA 4G0IA 2NTOA 2ZCTA 2YP6A 3ERWA 1JLWA 4FQUA 4MZCA 2GQLA 2H66A 1SL2B 3BJ5A 5HFGA 1FOHA 2I81A 5FHIA 4ZL7A 13GSA 2PMTA 3U6VA 3GH6A 5KN2A 2JL4A 1JZDA 4KDUA 3KD0A 4RUVA 5CREA 14GSA 1XVWA 2GTUA 4KDXA 3KTBA 1VF2A 3P7XA 3BCKA 3DIEA 2MMNA 2HSHA 2GS3A 2GSQA 2FWGA 5ECOB 5ECKB 3CRTA 2V6OA 4KW6A 5COHA 3F3QA 4N10A 3QMXA 1QXHA 2G2QA 1OE7A 5G31A 1HD2A 4DSSA 3HY2A 4CY8A 3NZNA 3CBUA 3TOUA 4NV2A 2GDRA 1R26A 1X5EA 3QAVA 2YANA 5IMFA 4ZB9A 1OAZA 2H71A 1AQVA 1TU7A 2H0GA 2L6DA 2DBCA 3GKKA 1F3AA 1BAYA 4LLRA 3F8UA 5F06A 4EE0A 4IVFA 4DVCA 5IOXA 2H74A 3BBYA 1SYRA 3VWVA 1E2YA 4DEJA 1XW5A 4XHMA 2GVPA 4PUFC 4YQMA 4WR4A 2VO4A 3CMIA 1WP0A 1ZMAA 2B5XA 3EPTA 1A8YA 1FHEA 1W89A 5IMZA 2H6YA 2WULA 4N0ZA 2IFQB 4NV5A 1A24A 1SD9A 2CX3A 1TDIA 1YY7A 4JEDA 2WZ9A 1WMJA 4A5PA 1XZOA 5ECMB 3Q19A 3WGDA 2BTOT 3P2AA 4KDYA 5CRWA 5IPHA 4K6XA 4CW9A 2AB6A 3TOTA 2C3TA 3QAWA 2ON5A 1J9BA 1PX6A 2YZUA 3LGCA 1R5PA 4HJMA 3GA4A 4GF0A 2PWJA 3DRNA 2K9FA 5EY6A 4HI7A 1GSQA 2REMA 3EINA 2IMIA 1G7OA 1BG5A 2L4QA 2I4AA 3HJPA 1SK1A 3HKRA 3Q6OA 1XWCA 2PPTA 1ABAA 3QPMA 3IK7A 1MEKA 1YZXA 4ID0A 2X64A 1ZYNA 1JHBA 2V2GA 1F6MC 1X0RA 1GL8A 1O73A 2IFQA 1G7EA 1WJKA 3ED3A 4MCUA 1ERTA 1ZCPA 3LYPA 1UVZA 3F63A 2X4AA 3UBLA 2C3NA 4IQ1A 2FWEA 1Q98A 2TRCP 1ZZYA 2HRKA 1Z7PA 4YKFA 2AJQB 1GNWA 1JZWA 3G7IA 4KE3A 2UZ8A 4DSRA 3LSZA 2O8VB 1XBSA 1ERWA 4ZIJA 4L0WA 3EU4A 3IXRA 3HVVA 4MLYA 4MMMA 4GTUA 6GSWA 1O8WA 3HZ4A 4KGIA 1E6BA 3CSJA 3HYPA 3HVNA 3LWAA 2LJRA 4HS1A 4EXJA 3APQA 4MK3A 3QFBC 2FHEA 1AQWA 1GRXA 2HXKA 5GSTA 1OC3A 4CHSA 2F3MA 4HEA2 1FB0A 5J4UA 4XRAA 1F9MA 4PUAA 3DWVA 4BA7A 2DJ2A 4GWRA 3C1RA 3N9JA 4NAXA 2I1UA 2VL2A 4TXOB 6GSYA 1HYUA 1XOBA 4KUNA 2YN1A 2YWNA 1ZL9A 4K8MA 5H5RA 1SYXA 5DQSA 4HZ2A 5F0GA 3E9JB 5DAKB 3BCIA 3O76A 1B8XA 2CX4A 5E59A 2L57A 3CQFA 3GL3A 3TKRA 18GSA 4BPYA 1YEPA 2QA1A 2WDUA 2N5BA 2H72A 4X1UA 3GMFA 2FGXA 3UMAA 2B1LA 4XRDA 1GLQA 5G2ZA 3P90A 2C80A 3FZ9A 1EP8A 1PX7A 2EC4A 17GSA 4CDOA 1DUGA 3HXSA 3NOFA 1ERVA 2H1BA 2FWHA 5IMDA 4HDEA 3LYKA 5J3RA 3F6DA 2NDOA 4TXOA 4PX1A 1DE2A 2ON7A 2F8FA 4K2DA 5ECRB 5IMVA 2X8CA 3EMPA 3JCML 2FNOA 5DCHA 2K8SA 5DAKA 2HNLA 3FRCA 3TKSA 1SJ6A 2A2PA 5LNKe 2C0GA 1MDIA 6GSTA 1VF4A 2E7PA 1TRUA 3GN3A 2CV4A 3KP9A 3GSTA 4MABA 4ACSA 2R37A 4ZB8A 4I5QA 2V1MA 3L9VA 4I97A 3DEXA 5HR3A 3US3A 3WYWA 2QSIA 2YV9A 3E0UA 3GV1A 2HI7A 3TRXA 3UVHA 2EIQA 2A2RA 2H30A 2O7KA 2B5YA 1H75A 2L6CA 2GZYA 3EU3A 4KF9A 4ULXA 2FD3A 3GFKA 2K6VA 3CTGA 2HLSA 2C0EA 4F03A 1THOA 4G19A 4KAEA 3QCPA 1YEXA 1U3AA 1EGOA 5BRTA 4LL1B 1MTCA 3RPNA 3APOA 1H4OA 4YAVA 3QD9A 2GT5A 5CAXA 2VCTA 1V57A 3FHKA 1R7HA 2H75A 1BX9A 3C8EA 3FMWA 3TUEA 2ZNMA 2ZUPA 2XBIA 4V2NA 3K8NA 1OC8A 2DJ1A 2C8UA 4E8EA 2C0FA 1K0DA 1TTZA 2KLXA 2P5RA 4ZL9A 2OKAA 1T8EB 4OD7A 1K0NA 4DSQA 4AF2A 5KOXA 2HT9A 2C4JA 1XIYA 2VOCA 2HFDA 4MF6A 2VCVA 1OE8A 1EV9A 1HNAA 5JWOB 2V32A 5IMCA 3F4SA 3VK9A 2O87A 4J2FA 4GLTA 4KX4A 1TU8A 1SKSB 1KNGA 3IDVA 2MBSA 5ECIB 11GSA 4F2IA 3TKSE 4KNDA 4KCEA 3D22A 3VWWA 1V98A 3L78A 3DMLA 5IMAA 3APSA 4CY6A 2YV7A 3IR4A 2N5AA 2LJKA 2LUSA 2KP2A 2F9SA 2RM6A 5ELGA 2VD0A 4IGJA 4HSCX 1M2AA 2DJKA 5D8IA 1NW2A 2ES7A 3VLNA 2FA8A 4J56E 3IE3A 2YJ7A 2RUEA 2L59A 2DKIA 1TK0B 1R5AA 4V1Ag 1OYJA 4TRXA 3GSSA 5ECSA 1PQNA 1Z5YE 1M7TA 2WGRA 2CVKA 4XIHA 5IPGA 1XFLA 1OKDA 2OE1A 4L5LA 5KN0A 2CZ2A 2IJYA 3ZFLA 4WXTA 4MJEA 4BWQA 1YF0A 22GSA 1B4PA 4ZL8A 1GLPA 4Z2RA 1TJDA 4P3YB 6GSSA 2MYGA 1XOAA 4XS4B 1B4QA 4ZBAA 5G1KA 1HNBA 4I2TA 3FR6A 2H70A 1ZYQB 2HYXA 4GQCA 1ST9A 2PU9C 3LFLA 3R2QA 3VPTA 3ZIVA 3ZTLA 1FG4A 1FVJA 3HVXA 2OA7A 2R0PA 5HQPA 2CZ3A 2C0DA 2F51A 2NPBA 5C04A 2VCXA 1S3AA 5DBQA 5DQYA 1LJRA 4AJ8A 4TN8A 5DVBA 1K0AA 3EWLA 4ECIA 2VIMA 1O7UA 3PR8A 4TR3A 2O89A 2XPEA 5AN1A 1F37A 2QA2A 2V6KA 3F9UA 4F82A 1PN9A 1J0FA 1WPIA 4I6XA 4FYCA 1URMA 1BJXA 1GH2A 3F4RA 2JZSA 3LQ7A 3J7Yk 5KOWA 4XS4A 3LORA 1EP7A 5J9CA 4MZBA 5LCZA 5JCUA 1R4WA 4K9ZA 5C00A 3W8JA 4G9HA 4NWYA 3FR3A 3IHQA 3W8SA 1SL1B 2GT6A 3G9BA 2IN3A 4Z2TA 5B8BA 2YPMA 2HE3A 3KJYA 3TCOA 1UN2A 1EOGA 2VCQA 3HHVA 4EDZA 5GSSA 4BIKA 4KA0A 3FZAA 2MZCA 3PH9A 3IA1A 5AIXA 2YWMA 3GKXA 3GX0A 2LQOA 2JZTA 1B9YC 5FWGA 1GSSA 3VPQA 1SENA 1X9MB 4ILFA 2TIRA 3KH9A 4L5OA 2X49A 1JLVA 3W6GA 1AW9A 3DXBA 4OFNA 4IBPA 1A2JA 3FEUA 4MP4A 1OC9B 4RQXA 8GSSA 3FK8A 3Q18A 1T1VA 1AC1A 1U3IA 5IO0A 3GKMA 2JU5A 5ELAA 4MDCA 5GAPD 4KSOA 2RIIA 4PXOA 4J57E 3UL3A 4TXVA 2CT6A 4ICYA 4EDYA 1A0FA 5KN3A 2LSTA 1G0TA 1SU9A 4Q5RA 3VI5A 1M9BA 1DE1A 4X43A 3CSHA 3F6FA 1GSEA 5JCWA 5BMUA 3WGEA 3H1NA 3A3TA 1O85A 2LEGA 3D5JA 4BVXB 1IYHA 1X5DA 3WGXA 2HSYA 2LKUA 4V2LA 4YQUA 3D21A 4XTSA 5JWQB 1Z7RA 2VUPA 2JACA 2J9HA 4N11A 1TP9A 2V41A 1GSFA 3HDCA 4JZQA 4K2XA 1A2LA 4KH7A 3TGZA 2VM1A 2AUVA 1K0CA 4IELA 3WT2A 3H79A 3ZMKA 3IAM2 2CVDA 3D4TA 2OBKA 4F9ZA 2H19A 1YJ6A 4WKWA 2O85A 1UC7A 2D2ZA 3F0IA 4IJ3A 4KB3A 3HJOA 2H76A 1NHYA 3ERFA 4MJAA 1YQ1A 3IV4A 2LRNA 4AJ7A 2XPDA 2VL2C 4EC0A 1SL0B 1Z9HA 2HRFA 3TJBA 1A23A 4BVXA 3RBTA 1V2AA 5EVOA 4YKGA 1PL2A 3M1GA 3UIWA 3LJRA 1THXA 2CVBA 2IMDA 4O92A 4WF4A 1SJZA 2AHEA 5G5FA 4XS1A 2HSMA 1TI1A 1B48A 1KBNA 2IPAA 2WRTA 3ZZXA 2HZFA 5B7CA 3MDKA 2H0IA 1Z6MA 2QKEA 5F8BA 1VF3A 2L5OA 3GL5A 4OFTA 4K1FA 1AXDA 2M72A 3UAPA 4K0GA 3KM6A 3R3EA 2R6KA 1WRYA 4WR5A 3RAZA 3J7Yb 1K3LA 1GSYA 1K3YA 1U87A 2DJ0A 2FUG2 1GULA 3GX8A 1M3JA 3EVIA 1NHOA 1A0RP 1TK5B 2R5GA 1PD21 4YH2A 1M0UA 1RQMA 2LV3A 2XC2A 1U88A 1XPVA 4JU5A 2DIZA 3GH9A 1Y6EA 1N8JA 1TOFA 1ZGNA 3TKPA 4O5QA 2VLUA 4JR6A 5IOWA 3DVXA 4TR0A 2M46A 5ECQB 2F8AA 2CA8A 5GAND 5D9TA 1TRSA 1XVQA 4WBRD 3GKNA 1QGVA 2RUFA 4D73B 2P31A 4LL4B 2DIYA 4Q5FA 4PNGA 5AGYA 2H1DA 2FWFA 4PQIA 4MJBA 4K7NA 3IHGA 1CQGA 3IBHA 1QK8A 2X8GA 4MA9A 2DMMA 3M9JA 4TVEA 3WT1A 3HD5A 5KN1A 2R0GA 1OVNA 3ISOA 4LMVA 4MPGA 2GQKA 2EIRA 3QDNA 4RI6A 4IP1A 3A2VA 5HFKA 4OO4A 3ZLPA 2B7KA 4K0NA 2HZEB 2OE3A 2YWOA 5IIZA 4O7HA 3QR6A 3N5OA 5CNWA 1T4ZA 5D96A 5B6NA 1C72A 1SKRB 3TKQA 3IC4A 4POBA 3G7YA 16GSA 20GSA 3VWXA 3ERGA 3ZYWA 4TW5A 3KZQA 1QMVA 2DLXA 4D73A 1EZKA 4N30A 1VF1A 3C73A 1Y25A 4HZ4A 2AAWA 2A2SA 1TXXA 2BMXA 3FY7A 4HU9A 4HJ2A 5H5QA 4HOJA 4PTSA 2ALBA 2QC7A 2HRNA 5FT3A 4BWSA 5CRDA 2AV4A 2XHFA 2IMKA 2WS2A 2LRCA 1GUKA 4TR4A 4YQVA 5G5EA 1Z3EA 4FYUA 3KGKA 2HZEA 4PQHA 3MSZA 4IN0A 5ID2B 1QQ2A 5A5KA 4EF0A 4EL1A 5D9VA 1K3OA 1RK4A 1ZYEA 3QAGA 3TDGA 5LD0A 3TJJA 4MH3A 2R2JA 5CRGA 2P5QA 4ZBBA 1X5CA 1XCCA 4HQZA 4WF5A 3VWUA 4F0BA 1S3CA 2GGTA 2H6XA 3L4NA 3L0HA 1A2MA 1FVKA 3M9KA 5CRHA 3U5RE 5AISA 5B6MA 2R3XA 3ZREA 2C3QA 1TKDB 2DJJA 3H4KA 1PA3A 3UVTA 3SBCA 1PRXA 3VURA 4OO5A 5HR1A 3FKFA 1U6TA 4O5RA 5JWRB 3O6TA 1XWGA 4ISDA 3ZITA 4EUYA 4EVMA 3GHAA 3LW9A 2AYTA 3D0ZA 4OCEA 3TRQA 3QFAC 3I9V2 3UBKA 1BEDA 3F4TA 5F05A 1RW1A 1SJIA 2LS5A 3C1SA 3EC3A 4L0UA 4NPBA 5CYYA 5ABRA 2DSAA 2I9HA 5ID2A 4KCAA 4ECBA 1M9AA 3TRPA 4G10A 5J41A 3KXOA 3CTFA 2DMLA 3OR5A 3FW2A 4K5RA 4RQRA 4IQAA 2FLSA 3L9UA 3MIXA 4POKA 2VLTA 5HFIA 1FB6A 3IPZA 3KMNA 1ACVA 4IS0A 4WEYA 1WE0A 2TRXA 3M0FA 1PKZA 3VFIA 4PNFA 1X9WB 1WWJA 2WB9A 2LNTA 5ENUA 1EEMA 5EPFA 4QL9A 4I8BA 4MH2A 2A4VA 3D6IA 5D9XA 3MWHA 4USSA 1GTAA 3DKSA 2GZPA 5H5SA 3PPUA 2YOIA 3V1WA 4BL7B 1IYIA 3LEFA 2CQ9A 3FZ5A 3RHBA 4GRFA 3HJMA 4O32A 4XCSA 1FO5A 3EURA 3GRXA 4HU7A 1SKWB 1AAZA 2J23A 4GQFA 4OMVA 4MZWA
chains in the Genus database with same CATH topology
1YF1A 2OACA 4O5UA 1SK2A 5D73A 1M2DA 3KTLA 2H6ZA 2MMOA 2NVLA 3CSIA 4MPFA 4EO3A 5A4VA 4QL7A 4PGTA 1QFNA 2H01A 2YNXA 4AGSA 1GNEA 4G0LA 2QGVA 4YAPA 4LMWA 1MDKA 2FCHA 3EMXA 2K8VA 3IAS2 3BOAA 1V40A 1K0MA 2Z9SA 1WIKA 2KUCA 3MNGA 1PMTA 4BL7A 2B7JA 4GCIA 3SWLA 2H0HA 3DD3A 4I2UA 2YCDA 4Z7XA 1GSDA 1OKTA 2JADA 3BD2A 4X0XA 3EE2A 1MD4A 2R4VA 1S3DA 4OWYA 4MF5A 4OCFA 1GTUA 2WCIA 3IK9A 1FAAA 2IWTA 1PL1A 5IM9A 4TOPA 4TKYA 1AQXA 1KTEA 2IL3A 1ERUA 3I69A 2I3YA 3HVSA 2X99A 2M80A 1XWAA 3C71A 1PN0A 4WETA 2G0FA 1WOUA 5AIVA 4EIQA 2KHPA 3ZFBA 2A4HA 1YKAA 3A2WA 2LRTA 4V1Ap 1USBA 2RLIA 3F3RA 2DJ3A 3IC8A 4KSMA 3KEBA 5HR2A 4F0CA 1GUMA 1FW1A 2VLVA 3M8NA 4RI7A 2C1YA 3PGTA 4IJIA 1DSBA 2E0QA 4K5SA 3HCZA 1ML6A 4ZILA 1JZOA 3DYRA 1FOVA 1N2AA 4AJ6A 3CRUA 2HRAA 12GSA 1CQHA 1LU4A 4IP6A 3H93A 2RM5A 2PN8A 2KOKA 5CP1A 1BQ7A 1M2BA 1GTIA 1PKWA 1G6YA 1MDJA 1OC9A 4WBJA 4GXZA 3RHCA 3S9FA 3A5IA 3GNJA 1TW9A 2OE0A 3GUSA 3D4MA 1EV4A 1GSUA 1ZYPA 2VCWA 4ECJA 2DKHA 4JBBA 4GSNA 2LJAA 4V2MA 5EL8A 2H8LA 3ZMLA 2IMFA 3H8QA 1I5GA 2GLRA 3EYTA 1T3BA 3TJGA 3LXZA 3GYKA 4IKHA 4OFMA 2B6MA 3CYNA 1A8LA 3VI7A 2JSZA 3ZL5A 6GSUA 1UA5A 1TI3A 2FA4A 5J9BA 3FR9A 4TR1B 5DALB 4JE1A 3PINA 3HA9A 1KEBA 2PVQA 3NIVA 3RPPA 1AUCA 1EGRA 2H1GA 5A4UA 2GSSA 7GSSA 1SD8A 1K0OA 4JRRA 2YWIA 6GSXA 5ECNB 1TK8B 1W4VA 5DJMA 2H73A 4PQ1A 2MMAA 1HQOA 4EKZA 1V9WA 3UOMA 5CO3A 4XS6A 1X9SB 2LNSA 1YDKA 5L71A 5JCGA 5D9WA 1GTBA 1XWKA 1TRWA 4JR4A 5F07A 1JZRA 4ZXGA 3I43A 4N0VA 3A5WA 3E3EA 2B5EA 3TB2A 1T4YA 4MNNA 5ECPB 3KCMA 2VCZA 4TR1A 3UARA 1M99A 5DALA 1YKCA 3G7JA 2VD1A 5J5NA 3MYDA 5KEJA 1O8XA 2JSYA 3GURA 3QOUA 3TJKA 1XWBA 1ZOFA 2LTKA 4ML6A 3WD6A 10GSA 3TKSC 9GSSA 1O6JA 5DDLA 2CAIA 3ME7A 3MAKA 2N5FA 5IO2A 3DGQA 2IIYA 4IHUA 1TRVA 4Z2UA 3I6AA 4ZBDA 2B3SA 3C7MA 3KP8A 3ZIJA 3GIXA 4IW9A 1GP1A 2VAFA 2GQMA 2OADA 1NSWA 4MF7A 4EIPA 3LXTA 3UEMA 4ZB6A 1DBYA 1AIUA 4NHWA 1T7PB 3FZ4A 3Q74A 5DCGA 2IMEA 1PSQA 2VL9A 5INYA 4K7OA 4LA1A 5DJLA 4GSSA 2EIOA 2VL3A 4POMA 3ZRDA 4NXIA 2DC5A 1MD3A 3GTUB 4FH8A 19GSA 4PURA 3P8WA 2GSRA 2B1KA 2L5LA 2P0GA 1SK0A 4NHZA 3ZVJA 5ECHB 5GZZB 2NBSA 3DVWA 1F3BA 4G0KA 1G6WA 4Q5NA 3KMOA 1ILOA 5D93A 3UJ1A 2PGTA 3O3TA 1F2EA 2K18A 4X4JA 4BVYB 3KIJA 2WJUA 1NM3A 2YZHA 5G30A 2R0CA 2E2GA 2FY6A 3CXGA 5HR0A 4FO5A 5IQYA 3ZVJD 4FIWA 1XXUA 3A2XA 1V58A 1VRSD 1VGLA 3HZ8A 3AY8A 2L4CA 2PUKC 6GSVA 2KP1A 3ME8A 2JZRA 5G1LA 3FYGA 2E2MA 2GZZA 4ECCA 5B8AA 1LBKA 2WFCA 1Z6NA 2BJXA 3IOSA 1HNCA 2OJLA 4L8EA 4QQ7A 1XW9A 3M3MA 3GTUA 5ECLB 1QUWA 3TJFA 4POLA 1EWXA 2PVOC 5E4WA 4MJCA 3RDWA 2VM2A 5A4WA 3LG6A 1I9DA 4FYBA 2PBJA 4G2EA 2MBTA 2PERA 4BVYA 2XBQA 1GUHA 1XW6A 2X8HA 4NMUA 3IRAA 1J08A 2YJHA 2MMZA 2CAQA 3L9SA 1BYEA 1JFUA 4HQSA 1GWCA 1PGTA 3KH7A 2OBIA 2H1AA 1O81A 1B9XC 4H86A 1K0BA 1EOHA 4E8HA 4K7IA 1EEJA 1Q4JA 1T00A 1ON4A 4Q5QA 4HUAA 4DSSB 2LQQA 4ML1A 2GSTA 4GSTA 4G0IA 2NTOA 2ZCTA 2YP6A 3ERWA 1JLWA 4FQUA 4MZCA 2GQLA 2H66A 1SL2B 3BJ5A 5HFGA 1FOHA 2I81A 5FHIA 4ZL7A 13GSA 2PMTA 3U6VA 3GH6A 5KN2A 2JL4A 1JZDA 4KDUA 3KD0A 4RUVA 5CREA 14GSA 1XVWA 2GTUA 4KDXA 3KTBA 1VF2A 3P7XA 3BCKA 3DIEA 2MMNA 2HSHA 2GS3A 2GSQA 2FWGA 5ECOB 5ECKB 3CRTA 2V6OA 4KW6A 5COHA 3F3QA 4N10A 3QMXA 1QXHA 2G2QA 1OE7A 5G31A 1HD2A 4DSSA 3HY2A 4CY8A 3NZNA 3CBUA 3TOUA 4NV2A 2GDRA 1R26A 1X5EA 3QAVA 2YANA 5IMFA 4ZB9A 1OAZA 2H71A 1AQVA 1TU7A 2H0GA 2L6DA 2DBCA 3GKKA 1F3AA 1BAYA 4LLRA 3F8UA 5F06A 4EE0A 4IVFA 4DVCA 5IOXA 2H74A 3BBYA 1SYRA 3VWVA 1E2YA 4DEJA 1XW5A 4XHMA 2GVPA 4PUFC 4YQMA 4WR4A 2VO4A 3CMIA 1WP0A 1ZMAA 2B5XA 3EPTA 1A8YA 1FHEA 1W89A 5IMZA 2H6YA 2WULA 4N0ZA 2IFQB 4NV5A 1A24A 1SD9A 2CX3A 1TDIA 1YY7A 4JEDA 2WZ9A 1WMJA 4A5PA 1XZOA 5ECMB 3Q19A 3WGDA 2BTOT 3P2AA 4KDYA 5CRWA 5IPHA 4K6XA 4CW9A 2AB6A 3TOTA 2C3TA 3QAWA 2ON5A 1J9BA 1PX6A 2YZUA 3LGCA 1R5PA 4HJMA 3GA4A 4GF0A 2PWJA 3DRNA 2K9FA 5EY6A 4HI7A 1GSQA 2REMA 3EINA 2IMIA 1G7OA 1BG5A 2L4QA 2I4AA 3HJPA 1SK1A 3HKRA 3Q6OA 1XWCA 2PPTA 1ABAA 3QPMA 3IK7A 1MEKA 1YZXA 4ID0A 2X64A 1ZYNA 1JHBA 2V2GA 1F6MC 1X0RA 1GL8A 1O73A 2IFQA 1G7EA 1WJKA 3ED3A 4MCUA 1ERTA 1ZCPA 3LYPA 1UVZA 3F63A 2X4AA 3UBLA 2C3NA 4IQ1A 2FWEA 1Q98A 2TRCP 1ZZYA 2HRKA 1Z7PA 4YKFA 2AJQB 1GNWA 1JZWA 3G7IA 4KE3A 2UZ8A 4DSRA 3LSZA 2O8VB 1XBSA 1ERWA 4ZIJA 4L0WA 3EU4A 3IXRA 3HVVA 4MLYA 4MMMA 4GTUA 6GSWA 1O8WA 3HZ4A 4KGIA 1E6BA 3CSJA 3HYPA 3LWAA 2LJRA 4HS1A 4EXJA 3APQA 4MK3A 3QFBC 2FHEA 1AQWA 1GRXA 2HXKA 5GSTA 1OC3A 4CHSA 2F3MA 4HEA2 1FB0A 5J4UA 4XRAA 1F9MA 4PUAA 3DWVA 4BA7A 2DJ2A 4GWRA 3C1RA 3N9JA 4NAXA 2I1UA 2VL2A 4TXOB 6GSYA 1HYUA 1XOBA 4KUNA 2YN1A 2YWNA 1ZL9A 4K8MA 5H5RA 1SYXA 5DQSA 4HZ2A 5F0GA 3E9JB 5DAKB 3BCIA 3O76A 1B8XA 2CX4A 5E59A 2L57A 3GL3A 3TKRA 18GSA 4BPYA 1YEPA 2QA1A 2WDUA 2N5BA 2H72A 4X1UA 3GMFA 2FGXA 3UMAA 2B1LA 4XRDA 1GLQA 5G2ZA 3P90A 2C80A 3FZ9A 1EP8A 1PX7A 2EC4A 17GSA 4CDOA 1DUGA 3HXSA 3NOFA 1ERVA 2H1BA 2FWHA 5IMDA 4HDEA 3LYKA 5J3RA 3F6DA 2NDOA 4TXOA 4PX1A 1DE2A 2ON7A 2F8FA 4K2DA 5ECRB 5IMVA 2X8CA 3EMPA 3JCML 2FNOA 5DCHA 2K8SA 5DAKA 2HNLA 3FRCA 3TKSA 1SJ6A 2A2PA 5LNKe 2C0GA 1MDIA 6GSTA 1VF4A 2E7PA 1TRUA 3GN3A 2CV4A 3KP9A 3GSTA 4MABA 4ACSA 2R37A 4ZB8A 4I5QA 2V1MA 3L9VA 4I97A 3DEXA 5HR3A 3US3A 3WYWA 2QSIA 2YV9A 3E0UA 3GV1A 2HI7A 3TRXA 3UVHA 2EIQA 2A2RA 2H30A 2O7KA 2B5YA 1H75A 2L6CA 2GZYA 3EU3A 4KF9A 4ULXA 2FD3A 3GFKA 2K6VA 3CTGA 2HLSA 2C0EA 4F03A 1THOA 4G19A 4KAEA 3QCPA 1YEXA 1U3AA 1EGOA 5BRTA 4LL1B 1MTCA 3RPNA 3APOA 1H4OA 4YAVA 3QD9A 2GT5A 5CAXA 2VCTA 1V57A 3FHKA 1R7HA 2H75A 1BX9A 3C8EA 3FMWA 3TUEA 2ZNMA 2ZUPA 2XBIA 4V2NA 3K8NA 1OC8A 2DJ1A 2C8UA 4E8EA 2C0FA 1K0DA 1TTZA 2KLXA 2P5RA 4ZL9A 2OKAA 1T8EB 4OD7A 1K0NA 4DSQA 4AF2A 5KOXA 2HT9A 2C4JA 1XIYA 2VOCA 2HFDA 4MF6A 2VCVA 1OE8A 1EV9A 1HNAA 5JWOB 2V32A 5IMCA 3F4SA 3VK9A 2O87A 4J2FA 4GLTA 4KX4A 1TU8A 1SKSB 1KNGA 3IDVA 2MBSA 5ECIB 11GSA 4F2IA 3TKSE 4KNDA 4KCEA 3D22A 3VWWA 1V98A 3L78A 3DMLA 5IMAA 3APSA 4CY6A 2YV7A 3IR4A 2N5AA 2LJKA 2LUSA 2KP2A 2F9SA 2RM6A 5ELGA 2VD0A 4IGJA 1M2AA 2DJKA 5D8IA 1NW2A 2ES7A 3VLNA 2FA8A 4J56E 3IE3A 2YJ7A 2RUEA 2L59A 2DKIA 1TK0B 1R5AA 4V1Ag 1OYJA 4TRXA 3GSSA 5ECSA 1PQNA 1Z5YE 1M7TA 2WGRA 2CVKA 4XIHA 5IPGA 1XFLA 1OKDA 2OE1A 4L5LA 5KN0A 2CZ2A 2IJYA 3ZFLA 4WXTA 4MJEA 4BWQA 1YF0A 22GSA 1B4PA 4ZL8A 1GLPA 4Z2RA 1TJDA 4P3YB 6GSSA 2MYGA 1XOAA 4XS4B 1B4QA 4ZBAA 5G1KA 1HNBA 4I2TA 3FR6A 2H70A 1ZYQB 2HYXA 4GQCA 1ST9A 2PU9C 3LFLA 3R2QA 3VPTA 3ZIVA 3ZTLA 1FG4A 1FVJA 3HVXA 2OA7A 2R0PA 5HQPA 2CZ3A 2C0DA 2F51A 2NPBA 5C04A 2VCXA 1S3AA 5DBQA 5DQYA 1LJRA 4AJ8A 4TN8A 5DVBA 1K0AA 3EWLA 4ECIA 2VIMA 1O7UA 3PR8A 4TR3A 2O89A 2XPEA 5AN1A 1F37A 2QA2A 2V6KA 3F9UA 4F82A 1PN9A 1J0FA 1WPIA 4I6XA 4FYCA 1URMA 1BJXA 1GH2A 3F4RA 2JZSA 3LQ7A 3J7Yk 5KOWA 4XS4A 3LORA 1EP7A 5J9CA 4MZBA 5LCZA 5JCUA 1R4WA 4K9ZA 5C00A 3W8JA 4G9HA 4NWYA 3FR3A 3IHQA 3W8SA 1SL1B 2GT6A 3G9BA 2IN3A 4Z2TA 5B8BA 2YPMA 2HE3A 3KJYA 3TCOA 1UN2A 1EOGA 2VCQA 3HHVA 4EDZA 5GSSA 4KA0A 3FZAA 2MZCA 3PH9A 3IA1A 5AIXA 2YWMA 3GKXA 3GX0A 2LQOA 2JZTA 1B9YC 5FWGA 1GSSA 3VPQA 1SENA 1X9MB 4ILFA 2TIRA 3KH9A 4L5OA 2X49A 1JLVA 3W6GA 1AW9A 3DXBA 4OFNA 4IBPA 1A2JA 3FEUA 4MP4A 1OC9B 4RQXA 8GSSA 3FK8A 3Q18A 1T1VA 1AC1A 1U3IA 5IO0A 3GKMA 2JU5A 5ELAA 4MDCA 5GAPD 4KSOA 2RIIA 4PXOA 4J57E 3UL3A 4TXVA 2CT6A 4ICYA 4EDYA 1A0FA 5KN3A 2LSTA 1G0TA 1SU9A 4Q5RA 3VI5A 1M9BA 1DE1A 4X43A 3CSHA 3F6FA 1GSEA 5JCWA 5BMUA 3WGEA 3H1NA 3A3TA 1O85A 2LEGA 3D5JA 4BVXB 1IYHA 1X5DA 3WGXA 2HSYA 2LKUA 4V2LA 4YQUA 3D21A 4XTSA 5JWQB 1Z7RA 2VUPA 2JACA 2J9HA 4N11A 1TP9A 2V41A 1GSFA 3HDCA 4JZQA 4K2XA 1A2LA 4KH7A 3TGZA 2VM1A 2AUVA 1K0CA 4IELA 3WT2A 3H79A 3ZMKA 3IAM2 2CVDA 3D4TA 2OBKA 4F9ZA 2H19A 1YJ6A 4WKWA 2O85A 1UC7A 2D2ZA 3F0IA 4IJ3A 4KB3A 3HJOA 2H76A 1NHYA 3ERFA 4MJAA 1YQ1A 3IV4A 2LRNA 4AJ7A 2XPDA 2VL2C 4EC0A 1SL0B 1Z9HA 2HRFA 3TJBA 1A23A 4BVXA 3RBTA 1V2AA 5EVOA 4YKGA 1PL2A 3M1GA 3UIWA 3LJRA 1THXA 2CVBA 2IMDA 4O92A 4WF4A 1SJZA 2AHEA 5G5FA 4XS1A 2HSMA 1TI1A 1B48A 1KBNA 2IPAA 2WRTA 3ZZXA 2HZFA 5B7CA 3MDKA 2H0IA 1Z6MA 2QKEA 5F8BA 1VF3A 2L5OA 3GL5A 4OFTA 4K1FA 1AXDA 2M72A 3UAPA 4K0GA 3KM6A 3R3EA 2R6KA 1WRYA 4WR5A 3RAZA 3J7Yb 1K3LA 1GSYA 1K3YA 1U87A 2DJ0A 2FUG2 1GULA 3GX8A 3EVIA 1NHOA 1A0RP 1TK5B 2R5GA 1PD21 4YH2A 1M0UA 1RQMA 2LV3A 2XC2A 1U88A 1XPVA 4JU5A 2DIZA 3GH9A 1Y6EA 1N8JA 1TOFA 1ZGNA 3TKPA 4O5QA 2VLUA 4JR6A 5IOWA 3DVXA 4TR0A 2M46A 5ECQB 2F8AA 2CA8A 5GAND 5D9TA 1TRSA 1XVQA 4WBRD 3GKNA 1QGVA 2RUFA 4D73B 2P31A 4LL4B 2DIYA 4Q5FA 4PNGA 5AGYA 2H1DA 2FWFA 4PQIA 4MJBA 4K7NA 3IHGA 1CQGA 3IBHA 1QK8A 2X8GA 4MA9A 2DMMA 3M9JA 4TVEA 3WT1A 3HD5A 5KN1A 2R0GA 1OVNA 3ISOA 4LMVA 4MPGA 2GQKA 2EIRA 3QDNA 4RI6A 4IP1A 3A2VA 5HFKA 4OO4A 3ZLPA 2B7KA 4K0NA 2HZEB 2OE3A 2YWOA 5IIZA 4O7HA 3QR6A 3N5OA 5CNWA 1T4ZA 5D96A 5B6NA 1C72A 1SKRB 3TKQA 3IC4A 4POBA 3G7YA 16GSA 20GSA 3VWXA 3ERGA 3ZYWA 4TW5A 3KZQA 1QMVA 2DLXA 4D73A 1EZKA 4N30A 1VF1A 3C73A 1Y25A 4HZ4A 2AAWA 2A2SA 1TXXA 2BMXA 3FY7A 4HU9A 4HJ2A 5H5QA 4HOJA 4PTSA 2ALBA 2QC7A 2HRNA 5FT3A 4BWSA 5CRDA 2AV4A 2XHFA 2IMKA 2WS2A 2LRCA 1GUKA 4TR4A 4YQVA 5G5EA 1Z3EA 4FYUA 3KGKA 2HZEA 4PQHA 3MSZA 4IN0A 5ID2B 1QQ2A 5A5KA 4EF0A 4EL1A 5D9VA 1K3OA 1RK4A 1ZYEA 3QAGA 3TDGA 5LD0A 3TJJA 4MH3A 2R2JA 5CRGA 2P5QA 4ZBBA 1X5CA 1XCCA 4HQZA 4WF5A 3VWUA 4F0BA 1S3CA 2GGTA 2H6XA 3L4NA 3L0HA 1A2MA 1FVKA 3M9KA 5CRHA 3U5RE 5AISA 5B6MA 2R3XA 3ZREA 2C3QA 1TKDB 2DJJA 3H4KA 1PA3A 3UVTA 3SBCA 1PRXA 3VURA 4OO5A 5HR1A 3FKFA 1U6TA 4O5RA 5JWRB 3O6TA 1XWGA 4ISDA 3ZITA 4EUYA 4EVMA 3GHAA 3LW9A 2AYTA 3D0ZA 4OCEA 3TRQA 3QFAC 3I9V2 3UBKA 1BEDA 3F4TA 5F05A 1RW1A 1SJIA 2LS5A 3C1SA 3EC3A 4L0UA 4NPBA 5CYYA 5ABRA 2DSAA 2I9HA 5ID2A 4KCAA 4ECBA 1M9AA 3TRPA 4G10A 5J41A 3KXOA 3CTFA 2DMLA 3OR5A 3FW2A 4K5RA 4RQRA 4IQAA 2FLSA 3L9UA 3MIXA 4POKA 2VLTA 5HFIA 1FB6A 3IPZA 3KMNA 1ACVA 4IS0A 4WEYA 1WE0A 2TRXA 3M0FA 1PKZA 3VFIA 4PNFA 1X9WB 1WWJA 2WB9A 2LNTA 5ENUA 1EEMA 5EPFA 4QL9A 4I8BA 4MH2A 2A4VA 3D6IA 5D9XA 3MWHA 4USSA 1GTAA 3DKSA 2GZPA 5H5SA 3PPUA 2YOIA 3V1WA 4BL7B 1IYIA 3LEFA 2CQ9A 3FZ5A 3RHBA 4GRFA 3HJMA 4O32A 4XCSA 1FO5A 3EURA 3GRXA 4HU7A 1SKWB 1AAZA 2J23A 4GQFA 4OMVA 4MZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YF1 A;  2OAC A;  1SK2 A;  5D73 A;  1M2D A;  3KTL A;  2H6Z A;  2MMO A;  2NVL A;  3CSI A;  4MPF A;  4EO3 A;  5A4V A;  4QL7 A;  4PGT A;  1QFN A;  2H01 A;  2YNX A;  4AGS A;  1GNE A;  2QGV A;  4YAP A;  4LMW A;  1MDK A;  2FCH A;  3EMX A;  2K8V A;  3IAS 2;  3BOA A;  1V40 A;  1K0M A;  2Z9S A;  1WIK A;  2KUC A;  3MNG A;  1PMT A;  4BL7 A;  2B7J A;  4GCI A;  3SWL A;  2H0H A;  3DD3 A;  4I2U A;  2YCD A;  4Z7X A;  1GSD A;  1OKT A;  2JAD A;  3BD2 A;  4X0X A;  3EE2 A;  1MD4 A;  2R4V A;  1S3D A;  4OWY A;  4MF5 A;  4OCF A;  1GTU A;  2WCI A;  3IK9 A;  1FAA A;  2IWT A;  1PL1 A;  5IM9 A;  4TOP A;  4TKY A;  1AQX A;  1KTE A;  2IL3 A;  1ERU A;  3I69 A;  2I3Y A;  3HVS A;  2X99 A;  2M80 A;  1XWA A;  3C71 A;  4WET A;  2G0F A;  1WOU A;  5AIV A;  2KHP A;  3ZFB A;  1YKA A;  3A2W A;  2LRT A;  4V1A p;  1USB A;  2RLI A;  3F3R A;  2DJ3 A;  4KSM A;  3KEB A;  5HR2 A;  4F0C A;  1GUM A;  1FW1 A;  2VLV A;  3M8N A;  4RI7 A;  2C1Y A;  3PGT A;  4IJI A;  1DSB A;  2E0Q A;  3HCZ A;  1ML6 A;  4ZIL A;  1JZO A;  3DYR A;  1FOV A;  1N2A A;  4AJ6 A;  3CRU A;  12GS A;  1CQH A;  1LU4 A;  4IP6 A;  3H93 A;  2RM5 A;  2PN8 A;  2KOK A;  5CP1 A;  1BQ7 A;  1M2B A;  1GTI A;  1PKW A;  1G6Y A;  1MDJ A;  1OC9 A;  4WBJ A;  4GXZ A;  3RHC A;  3S9F A;  3GNJ A;  1TW9 A;  2OE0 A;  3GUS A;  3D4M A;  1EV4 A;  1GSU A;  2VCW A;  4ECJ A;  4JBB A;  4GSN A;  2LJA A;  4V2M A;  5EL8 A;  2H8L A;  3ZML A;  2IMF A;  3H8Q A;  1I5G A;  2GLR A;  3EYT A;  1T3B A;  3TJG A;  3LXZ A;  3GYK A;  4IKH A;  4OFM A;  2B6M A;  3CYN A;  1A8L A;  3VI7 A;  2JSZ A;  3ZL5 A;  6GSU A;  1UA5 A;  1TI3 A;  2FA4 A;  5J9B A;  3FR9 A;  4TR1 B;  5DAL B;  4JE1 A;  3PIN A;  3HA9 A;  1KEB A;  2PVQ A;  3NIV A;  3RPP A;  1AUC A;  1EGR A;  2H1G A;  5A4U A;  2GSS A;  7GSS A;  1SD8 A;  1K0O A;  4JRR A;  2YWI A;  6GSX A;  5ECN B;  1TK8 B;  1W4V A;  5DJM A;  2H73 A;  4PQ1 A;  2MMA A;  1HQO A;  4EKZ A;  1V9W A;  3UOM A;  5CO3 A;  4XS6 A;  1X9S B;  2LNS A;  1YDK A;  5L71 A;  5JCG A;  5D9W A;  1GTB A;  1XWK A;  1TRW A;  4JR4 A;  5F07 A;  1JZR A;  4ZXG A;  3I43 A;  4N0V A;  3A5W A;  3E3E A;  2B5E A;  3TB2 A;  1T4Y A;  5ECP B;  3KCM A;  2VCZ A;  4TR1 A;  3UAR A;  1M99 A;  5DAL A;  1YKC A;  3G7J A;  2VD1 A;  5J5N A;  5KEJ A;  1O8X A;  2JSY A;  3GUR A;  3QOU A;  3TJK A;  1XWB A;  1ZOF A;  2LTK A;  4ML6 A;  3WD6 A;  10GS A;  3TKS C;  9GSS A;  1O6J A;  5DDL A;  2CAI A;  3ME7 A;  3MAK A;  2N5F A;  5IO2 A;  3DGQ A;  2IIY A;  4IHU A;  1TRV A;  3I6A A;  4ZBD A;  2B3S A;  3C7M A;  3KP8 A;  3ZIJ A;  3GIX A;  4IW9 A;  1GP1 A;  2VAF A;  2GQM A;  2OAD A;  1NSW A;  4MF7 A;  3LXT A;  3UEM A;  4ZB6 A;  1DBY A;  1AIU A;  4NHW A;  1T7P B;  3FZ4 A;  3Q74 A;  5DCG A;  2IME A;  1PSQ A;  2VL9 A;  5INY A;  4K7O A;  4LA1 A;  5DJL A;  4GSS A;  2EIO A;  2VL3 A;  4POM A;  3ZRD A;  4NXI A;  2DC5 A;  1MD3 A;  3GTU B;  4FH8 A;  19GS A;  4PUR A;  3P8W A;  2GSR A;  2B1K A;  2L5L A;  2P0G A;  1SK0 A;  4NHZ A;  3ZVJ A;  5ECH B;  5GZZ B;  2NBS A;  3DVW A;  1F3B A;  1G6W A;  4Q5N A;  3KMO A;  1ILO A;  5D93 A;  3UJ1 A;  2PGT A;  3O3T A;  1F2E A;  2K18 A;  3KIJ A;  2WJU A;  1NM3 A;  2YZH A;  5G30 A;  2E2G A;  2FY6 A;  3CXG A;  5HR0 A;  4FO5 A;  5IQY A;  3ZVJ D;  4FIW A;  1XXU A;  3A2X A;  1V58 A;  1VRS D;  1VGL A;  3HZ8 A;  3AY8 A;  2L4C A;  2PUK C;  6GSV A;  2KP1 A;  3ME8 A;  2JZR A;  5G1L A;  3FYG A;  2E2M A;  2GZZ A;  4ECC A;  5B8A A;  1LBK A;  2WFC A;  1Z6N A;  2BJX A;  3IOS A;  1HNC A;  2OJL A;  4L8E A;  4QQ7 A;  1XW9 A;  3M3M A;  3GTU A;  5ECL B;  1QUW A;  3TJF A;  4POL A;  1EWX A;  2PVO C;  5E4W A;  4MJC A;  3RDW A;  2VM2 A;  5A4W A;  3LG6 A;  1I9D A;  4FYB A;  2PBJ A;  4G2E A;  2MBT A;  2PER A;  4BVY A;  2XBQ A;  1GUH A;  1XW6 A;  2X8H A;  4NMU A;  3IRA A;  1J08 A;  2YJH A;  2MMZ A;  2CAQ A;  3L9S A;  1BYE A;  1JFU A;  4HQS A;  1GWC A;  1PGT A;  3KH7 A;  2OBI A;  2H1A A;  1O81 A;  1B9X C;  4H86 A;  1K0B A;  1EOH A;  4E8H A;  4K7I A;  1EEJ A;  1Q4J A;  1T00 A;  1ON4 A;  4Q5Q A;  4HUA A;  4DSS B;  2LQQ A;  4ML1 A;  2GST A;  4GST A;  2NTO A;  2ZCT A;  2YP6 A;  3ERW A;  1JLW A;  4MZC A;  2GQL A;  2H66 A;  1SL2 B;  3BJ5 A;  5HFG A;  2I81 A;  5FHI A;  4ZL7 A;  13GS A;  2PMT A;  3U6V A;  3GH6 A;  5KN2 A;  2JL4 A;  1JZD A;  4KDU A;  3KD0 A;  4RUV A;  5CRE A;  14GS A;  1XVW A;  2GTU A;  4KDX A;  3KTB A;  1VF2 A;  3P7X A;  3BCK A;  3DIE A;  2MMN A;  2HSH A;  2GS3 A;  2GSQ A;  2FWG A;  5ECO B;  5ECK B;  3CRT A;  2V6O A;  4KW6 A;  5COH A;  3F3Q A;  4N10 A;  3QMX A;  1QXH A;  2G2Q A;  1OE7 A;  5G31 A;  1HD2 A;  4DSS A;  3HY2 A;  3NZN A;  3CBU A;  3TOU A;  4NV2 A;  2GDR A;  1R26 A;  1X5E A;  3QAV A;  2YAN A;  5IMF A;  4ZB9 A;  1OAZ A;  2H71 A;  1AQV A;  1TU7 A;  2H0G A;  2L6D A;  2DBC A;  3GKK A;  1F3A A;  1BAY A;  4LLR A;  3F8U A;  5F06 A;  4EE0 A;  4IVF A;  4DVC A;  5IOX A;  2H74 A;  3BBY A;  1SYR A;  3VWV A;  1E2Y A;  4DEJ A;  1XW5 A;  4XHM A;  2GVP A;  4PUF C;  4YQM A;  4WR4 A;  2VO4 A;  3CMI A;  1WP0 A;  1ZMA A;  2B5X A;  1A8Y A;  1FHE A;  1W89 A;  5IMZ A;  2H6Y A;  2WUL A;  4N0Z A;  2IFQ B;  4NV5 A;  1A24 A;  1SD9 A;  2CX3 A;  1TDI A;  1YY7 A;  4JED A;  2WZ9 A;  1WMJ A;  1XZO A;  5ECM B;  3Q19 A;  3WGD A;  2BTO T;  3P2A A;  4KDY A;  5CRW A;  5IPH A;  4K6X A;  4CW9 A;  2AB6 A;  3TOT A;  2C3T A;  3QAW A;  2ON5 A;  1J9B A;  1PX6 A;  2YZU A;  3LGC A;  1R5P A;  4HJM A;  3GA4 A;  4GF0 A;  2PWJ A;  3DRN A;  2K9F A;  5EY6 A;  4HI7 A;  1GSQ A;  2REM A;  3EIN A;  2IMI A;  1G7O A;  1BG5 A;  2L4Q A;  2I4A A;  3HJP A;  1SK1 A;  3HKR A;  3Q6O A;  1XWC A;  2PPT A;  1ABA A;  3QPM A;  3IK7 A;  1MEK A;  1YZX A;  4ID0 A;  2X64 A;  1JHB A;  2V2G A;  1F6M C;  1X0R A;  1GL8 A;  1O73 A;  2IFQ A;  1G7E A;  1WJK A;  3ED3 A;  4MCU A;  1ERT A;  1ZCP A;  3LYP A;  1UVZ A;  3F63 A;  3UBL A;  2C3N A;  4IQ1 A;  2FWE A;  1Q98 A;  2TRC P;  1ZZY A;  1Z7P A;  2AJQ B;  1GNW A;  1JZW A;  3G7I A;  4KE3 A;  4DSR A;  3LSZ A;  2O8V B;  1XBS A;  1ERW A;  4ZIJ A;  4L0W A;  3EU4 A;  3IXR A;  3HVV A;  4MLY A;  4MMM A;  4GTU A;  6GSW A;  1O8W A;  3HZ4 A;  4KGI A;  1E6B A;  3CSJ A;  3HYP A;  3LWA A;  2LJR A;  4HS1 A;  4EXJ A;  3APQ A;  4MK3 A;  3QFB C;  2FHE A;  1AQW A;  1GRX A;  2HXK A;  5GST A;  1OC3 A;  4CHS A;  2F3M A;  4HEA 2;  1FB0 A;  5J4U A;  4XRA A;  1F9M A;  4PUA A;  3DWV A;  4BA7 A;  2DJ2 A;  4GWR A;  3C1R A;  3N9J A;  4NAX A;  2I1U A;  2VL2 A;  4TXO B;  6GSY A;  1HYU A;  1XOB A;  4KUN A;  2YN1 A;  2YWN A;  1ZL9 A;  4K8M A;  5H5R A;  1SYX A;  5DQS A;  4HZ2 A;  5F0G A;  3E9J B;  5DAK B;  3BCI A;  3O76 A;  1B8X A;  2CX4 A;  5E59 A;  2L57 A;  3GL3 A;  3TKR A;  18GS A;  4BPY A;  1YEP A;  2WDU A;  2N5B A;  2H72 A;  4X1U A;  3GMF A;  2FGX A;  3UMA A;  2B1L A;  4XRD A;  1GLQ A;  5G2Z A;  3P90 A;  2C80 A;  3FZ9 A;  1EP8 A;  1PX7 A;  2EC4 A;  17GS A;  4CDO A;  1DUG A;  3HXS A;  3NOF A;  1ERV A;  2H1B A;  2FWH A;  5IMD A;  4HDE A;  3LYK A;  5J3R A;  3F6D A;  2NDO A;  4TXO A;  4PX1 A;  1DE2 A;  2ON7 A;  2F8F A;  4K2D A;  5ECR B;  5IMV A;  2X8C A;  3EMP A;  3JCM L;  2FNO A;  5DCH A;  2K8S A;  5DAK A;  2HNL A;  3FRC A;  3TKS A;  1SJ6 A;  5LNK e;  2C0G A;  1MDI A;  6GST A;  1VF4 A;  2E7P A;  1TRU A;  3GN3 A;  2CV4 A;  3KP9 A;  3GST A;  4MAB A;  4ACS A;  2R37 A;  4ZB8 A;  4I5Q A;  2V1M A;  3L9V A;  4I97 A;  3DEX A;  5HR3 A;  3US3 A;  3WYW A;  2QSI A;  2YV9 A;  3E0U A;  3GV1 A;  2HI7 A;  3TRX A;  3UVH A;  2EIQ A;  2A2R A;  2H30 A;  2O7K A;  2B5Y A;  1H75 A;  2L6C A;  2GZY A;  3EU3 A;  4ULX A;  2FD3 A;  3GFK A;  2K6V A;  3CTG A;  2HLS A;  2C0E A;  4F03 A;  1THO A;  4G19 A;  4KAE A;  3QCP A;  1YEX A;  1U3A A;  1EGO A;  4LL1 B;  1MTC A;  3RPN A;  3APO A;  1H4O A;  4YAV A;  3QD9 A;  2GT5 A;  5CAX A;  2VCT A;  1V57 A;  3FHK A;  1R7H A;  2H75 A;  1BX9 A;  3C8E A;  3TUE A;  2ZNM A;  2ZUP A;  2XBI A;  4V2N A;  3K8N A;  1OC8 A;  2DJ1 A;  2C8U A;  4E8E A;  2C0F A;  1K0D A;  1TTZ A;  2KLX A;  2P5R A;  4ZL9 A;  2OKA A;  1T8E B;  4OD7 A;  1K0N A;  4DSQ A;  4AF2 A;  2HT9 A;  2C4J A;  1XIY A;  2VOC A;  2HFD A;  4MF6 A;  2VCV A;  1OE8 A;  1EV9 A;  1HNA A;  5JWO B;  2V32 A;  5IMC A;  3F4S A;  3VK9 A;  2O87 A;  4J2F A;  4GLT A;  4KX4 A;  1TU8 A;  1SKS B;  1KNG A;  3IDV A;  2MBS A;  5ECI B;  11GS A;  4F2I A;  3TKS E;  4KND A;  4KCE A;  3D22 A;  3VWW A;  1V98 A;  3L78 A;  3DML A;  5IMA A;  3APS A;  2YV7 A;  3IR4 A;  2N5A A;  2LJK A;  2LUS A;  2KP2 A;  2F9S A;  2RM6 A;  5ELG A;  2VD0 A;  4IGJ A;  1M2A A;  2DJK A;  5D8I A;  1NW2 A;  2ES7 A;  3VLN A;  2FA8 A;  4J56 E;  3IE3 A;  2YJ7 A;  2RUE A;  2L59 A;  1TK0 B;  1R5A A;  4V1A g;  1OYJ A;  4TRX A;  3GSS A;  5ECS A;  1PQN A;  1Z5Y E;  1M7T A;  2WGR A;  2CVK A;  4XIH A;  5IPG A;  1XFL A;  1OKD A;  2OE1 A;  4L5L A;  5KN0 A;  2CZ2 A;  2IJY A;  3ZFL A;  4WXT A;  4MJE A;  4BWQ A;  1YF0 A;  22GS A;  1B4P A;  4ZL8 A;  1GLP A;  1TJD A;  4P3Y B;  6GSS A;  2MYG A;  1XOA A;  4XS4 B;  1B4Q A;  4ZBA A;  5G1K A;  1HNB A;  4I2T A;  3FR6 A;  2H70 A;  1ZYQ B;  2HYX A;  4GQC A;  1ST9 A;  2PU9 C;  3LFL A;  3R2Q A;  3VPT A;  3ZIV A;  3ZTL A;  1FG4 A;  1FVJ A;  3HVX A;  2OA7 A;  5HQP A;  2CZ3 A;  2C0D A;  2F51 A;  2NPB A;  5C04 A;  2VCX A;  1S3A A;  5DBQ A;  5DQY A;  1LJR A;  4AJ8 A;  4TN8 A;  5DVB A;  1K0A A;  3EWL A;  4ECI A;  2VIM A;  1O7U A;  3PR8 A;  4TR3 A;  2O89 A;  2XPE A;  5AN1 A;  1F37 A;  2V6K A;  3F9U A;  4F82 A;  1PN9 A;  1J0F A;  1WPI A;  4I6X A;  4FYC A;  1URM A;  1BJX A;  1GH2 A;  3F4R A;  2JZS A;  3LQ7 A;  3J7Y k;  4XS4 A;  3LOR A;  1EP7 A;  5J9C A;  4MZB A;  5LCZ A;  5JCU A;  1R4W A;  4K9Z A;  5C00 A;  3W8J A;  4G9H A;  4NWY A;  3FR3 A;  3IHQ A;  3W8S A;  1SL1 B;  2GT6 A;  3G9B A;  2IN3 A;  5B8B A;  2YPM A;  2HE3 A;  3KJY A;  3TCO A;  1UN2 A;  1EOG A;  2VCQ A;  3HHV A;  4EDZ A;  5GSS A;  4KA0 A;  3FZA A;  2MZC A;  3PH9 A;  3IA1 A;  5AIX A;  2YWM A;  3GKX A;  3GX0 A;  2LQO A;  2JZT A;  1B9Y C;  5FWG A;  1GSS A;  3VPQ A;  1SEN A;  1X9M B;  4ILF A;  2TIR A;  3KH9 A;  4L5O A;  1JLV A;  3W6G A;  1AW9 A;  3DXB A;  4OFN A;  4IBP A;  1A2J A;  3FEU A;  4MP4 A;  1OC9 B;  4RQX A;  8GSS A;  3FK8 A;  3Q18 A;  1T1V A;  1AC1 A;  1U3I A;  5IO0 A;  3GKM A;  2JU5 A;  5ELA A;  4MDC A;  5GAP D;  4KSO A;  2RII A;  4PXO A;  4J57 E;  3UL3 A;  4TXV A;  2CT6 A;  4EDY A;  1A0F A;  5KN3 A;  2LST A;  1G0T A;  1SU9 A;  4Q5R A;  3VI5 A;  1M9B A;  1DE1 A;  4X43 A;  3CSH A;  3F6F A;  1GSE A;  5JCW A;  3WGE A;  3H1N A;  3A3T A;  1O85 A;  2LEG A;  3D5J A;  1IYH A;  1X5D A;  3WGX A;  2HSY A;  2LKU A;  4V2L A;  4YQU A;  3D21 A;  4XTS A;  5JWQ B;  1Z7R A;  2VUP A;  2JAC A;  2J9H A;  4N11 A;  1TP9 A;  2V41 A;  1GSF A;  3HDC A;  4JZQ A;  1A2L A;  4KH7 A;  3TGZ A;  2VM1 A;  2AUV A;  1K0C A;  4IEL A;  3WT2 A;  3H79 A;  3ZMK A;  3IAM 2;  2CVD A;  3D4T A;  2OBK A;  4F9Z A;  2H19 A;  1YJ6 A;  4WKW A;  2O85 A;  1UC7 A;  2D2Z A;  3F0I A;  4IJ3 A;  4KB3 A;  3HJO A;  2H76 A;  1NHY A;  3ERF A;  4MJA A;  1YQ1 A;  3IV4 A;  2LRN A;  4AJ7 A;  2XPD A;  2VL2 C;  4EC0 A;  1SL0 B;  1Z9H A;  2HRF A;  3TJB A;  1A23 A;  4BVX A;  3RBT A;  1V2A A;  5EVO A;  1PL2 A;  3M1G A;  3UIW A;  3LJR A;  1THX A;  2CVB A;  2IMD A;  4O92 A;  4WF4 A;  1SJZ A;  2AHE A;  5G5F A;  4XS1 A;  1TI1 A;  1B48 A;  1KBN A;  2IPA A;  2WRT A;  3ZZX A;  2HZF A;  5B7C A;  3MDK A;  2H0I A;  1Z6M A;  2QKE A;  5F8B A;  1VF3 A;  2L5O A;  3GL5 A;  4OFT A;  4K1F A;  1AXD A;  2M72 A;  3UAP A;  4K0G A;  3KM6 A;  2R6K A;  1WRY A;  4WR5 A;  3RAZ A;  3J7Y b;  1K3L A;  1GSY A;  1K3Y A;  1U87 A;  2DJ0 A;  2FUG 2;  1GUL A;  3GX8 A;  3EVI A;  1NHO A;  1A0R P;  1TK5 B;  2R5G A;  1PD2 1;  4YH2 A;  1M0U A;  1RQM A;  2LV3 A;  2XC2 A;  1U88 A;  1XPV A;  4JU5 A;  2DIZ A;  3GH9 A;  1Y6E A;  1N8J A;  1TOF A;  1ZGN A;  3TKP A;  2VLU A;  4JR6 A;  5IOW A;  3DVX A;  4TR0 A;  2M46 A;  5ECQ B;  2F8A A;  2CA8 A;  5GAN D;  5D9T A;  1TRS A;  1XVQ A;  4WBR D;  3GKN A;  1QGV A;  2RUF A;  4D73 B;  2P31 A;  4LL4 B;  2DIY A;  4Q5F A;  4PNG A;  5AGY A;  2H1D A;  2FWF A;  4PQI A;  4MJB A;  4K7N A;  1CQG A;  3IBH A;  1QK8 A;  2X8G A;  4MA9 A;  2DMM A;  3M9J A;  4TVE A;  3WT1 A;  3HD5 A;  5KN1 A;  1OVN A;  3ISO A;  4LMV A;  4MPG A;  2GQK A;  2EIR A;  3QDN A;  4RI6 A;  4IP1 A;  3A2V A;  5HFK A;  4OO4 A;  3ZLP A;  2B7K A;  4K0N A;  2HZE B;  2OE3 A;  2YWO A;  5IIZ A;  4O7H A;  3QR6 A;  3N5O A;  5CNW A;  1T4Z A;  5D96 A;  5B6N A;  1C72 A;  1SKR B;  3TKQ A;  3IC4 A;  4POB A;  3G7Y A;  16GS A;  20GS A;  3VWX A;  3ERG A;  3ZYW A;  4TW5 A;  3KZQ A;  1QMV A;  2DLX A;  4D73 A;  1EZK A;  4N30 A;  1VF1 A;  3C73 A;  1Y25 A;  4HZ4 A;  2AAW A;  2A2S A;  1TXX A;  2BMX A;  3FY7 A;  4HU9 A;  4HJ2 A;  5H5Q A;  4HOJ A;  2ALB A;  2QC7 A;  2HRN A;  5FT3 A;  4BWS A;  5CRD A;  2AV4 A;  2XHF A;  2IMK A;  2WS2 A;  2LRC A;  1GUK A;  4TR4 A;  4YQV A;  5G5E A;  1Z3E A;  4FYU A;  3KGK A;  2HZE A;  4PQH A;  3MSZ A;  4IN0 A;  5ID2 B;  1QQ2 A;  5A5K A;  4EF0 A;  4EL1 A;  5D9V A;  1K3O A;  1RK4 A;  1ZYE A;  3QAG A;  3TDG A;  5LD0 A;  3TJJ A;  4MH3 A;  2R2J A;  5CRG A;  2P5Q A;  4ZBB A;  1X5C A;  1XCC A;  4HQZ A;  4WF5 A;  3VWU A;  4F0B A;  1S3C A;  2GGT A;  2H6X A;  3L4N A;  3L0H A;  1A2M A;  1FVK A;  3M9K A;  5CRH A;  3U5R E;  5AIS A;  5B6M A;  2R3X A;  3ZRE A;  2C3Q A;  1TKD B;  2DJJ A;  3H4K A;  1PA3 A;  3UVT A;  3SBC A;  1PRX A;  3VUR A;  4OO5 A;  5HR1 A;  3FKF A;  1U6T A;  4O5R A;  5JWR B;  3O6T A;  1XWG A;  4ISD A;  3ZIT A;  4EUY A;  4EVM A;  3GHA A;  2AYT A;  3D0Z A;  4OCE A;  3TRQ A;  3QFA C;  3I9V 2;  3UBK A;  1BED A;  3F4T A;  5F05 A;  1RW1 A;  1SJI A;  2LS5 A;  3C1S A;  3EC3 A;  4L0U A;  4NPB A;  5CYY A;  5ABR A;  2DSA A;  2I9H A;  5ID2 A;  4KCA A;  4ECB A;  1M9A A;  3TRP A;  4G10 A;  5J41 A;  3KXO A;  3CTF A;  2DML A;  3OR5 A;  3FW2 A;  4RQR A;  4IQA A;  2FLS A;  3L9U A;  4POK A;  2VLT A;  5HFI A;  1FB6 A;  3IPZ A;  3KMN A;  1ACV A;  4IS0 A;  4WEY A;  1WE0 A;  2TRX A;  3M0F A;  1PKZ A;  3VFI A;  4PNF A;  1X9W B;  1WWJ A;  2WB9 A;  2LNT A;  5ENU A;  1EEM A;  5EPF A;  4QL9 A;  4I8B A;  4MH2 A;  2A4V A;  3D6I A;  5D9X A;  3MWH A;  1GTA A;  3DKS A;  2GZP A;  5H5S A;  2YOI A;  3V1W A;  1IYI A;  3LEF A;  2CQ9 A;  3FZ5 A;  3RHB A;  4GRF A;  3HJM A;  4O32 A;  4XCS A;  1FO5 A;  3EUR A;  3GRX A;  4HU7 A;  1SKW B;  1AAZ A;  2J23 A;  4GQF A;  4OMV A;  4MZW A; 
#chains in the Genus database with same CATH topology
 1YF1 A;  2OAC A;  4O5U A;  1SK2 A;  5D73 A;  1M2D A;  3KTL A;  2H6Z A;  2MMO A;  2NVL A;  3CSI A;  4MPF A;  4EO3 A;  5A4V A;  4QL7 A;  4PGT A;  1QFN A;  2H01 A;  2YNX A;  4AGS A;  1GNE A;  4G0L A;  2QGV A;  4YAP A;  4LMW A;  1MDK A;  2FCH A;  3EMX A;  2K8V A;  3IAS 2;  3BOA A;  1V40 A;  1K0M A;  2Z9S A;  1WIK A;  2KUC A;  3MNG A;  1PMT A;  4BL7 A;  2B7J A;  4GCI A;  3SWL A;  2H0H A;  3DD3 A;  4I2U A;  2YCD A;  4Z7X A;  1S3R A;  1GSD A;  1OKT A;  2JAD A;  3BD2 A;  4X0X A;  3EE2 A;  1MD4 A;  2R4V A;  1S3D A;  4OWY A;  4MF5 A;  4OCF A;  1GTU A;  2WCI A;  3IK9 A;  1FAA A;  2IWT A;  1PL1 A;  5IM9 A;  4TOP A;  4TKY A;  1AQX A;  1KTE A;  2IL3 A;  1ERU A;  3I69 A;  2I3Y A;  3HVS A;  2X99 A;  2M80 A;  1XWA A;  3C71 A;  1PN0 A;  4WET A;  2G0F A;  1WOU A;  5AIV A;  4EIQ A;  2KHP A;  3ZFB A;  2A4H A;  1YKA A;  3A2W A;  2LRT A;  4V1A p;  1USB A;  2RLI A;  3F3R A;  2DJ3 A;  3IC8 A;  4KSM A;  3KEB A;  5HR2 A;  4F0C A;  1GUM A;  1FW1 A;  2VLV A;  3M8N A;  4RI7 A;  2C1Y A;  3PGT A;  4IJI A;  1DSB A;  2E0Q A;  4K5S A;  3HCZ A;  1ML6 A;  1XG8 A;  4ZIL A;  1JZO A;  3DYR A;  1FOV A;  1N2A A;  4AJ6 A;  3CRU A;  2HRA A;  12GS A;  1CQH A;  1LU4 A;  4IP6 A;  3H93 A;  2RM5 A;  2PN8 A;  2KOK A;  5CP1 A;  1BQ7 A;  1M2B A;  1GTI A;  1PKW A;  1G6Y A;  1MDJ A;  1OC9 A;  4WBJ A;  4GXZ A;  3RHC A;  1M3I A;  3S9F A;  3A5I A;  3GNJ A;  1TW9 A;  2OE0 A;  3GUS A;  3D4M A;  1EV4 A;  1GSU A;  1ZYP A;  2VCW A;  4ECJ A;  2DKH A;  4JBB A;  4GSN A;  2LJA A;  4V2M A;  5EL8 A;  2H8L A;  3ZML A;  2IMF A;  3H8Q A;  1I5G A;  2GLR A;  3EYT A;  1T3B A;  3TJG A;  3LXZ A;  3GYK A;  4IKH A;  4OFM A;  2B6M A;  3CYN A;  1A8L A;  3VI7 A;  2JSZ A;  3ZL5 A;  6GSU A;  1UA5 A;  1TI3 A;  2FA4 A;  5J9B A;  3FR9 A;  4TR1 B;  5DAL B;  4JE1 A;  3PIN A;  3HA9 A;  1KEB A;  2PVQ A;  3NIV A;  3RPP A;  1AUC A;  1EGR A;  2H1G A;  5A4U A;  2GSS A;  7GSS A;  1SD8 A;  1K0O A;  4JRR A;  2YWI A;  6GSX A;  5ECN B;  1TK8 B;  1W4V A;  5DJM A;  2H73 A;  4PQ1 A;  2MMA A;  1HQO A;  4EKZ A;  1V9W A;  3UOM A;  5CO3 A;  4XS6 A;  1X9S B;  2LNS A;  1YDK A;  5L71 A;  5JCG A;  5D9W A;  1GTB A;  1XWK A;  1TRW A;  4JR4 A;  5F07 A;  1JZR A;  4ZXG A;  3I43 A;  4N0V A;  3A5W A;  3E3E A;  2B5E A;  3TB2 A;  1T4Y A;  4MNN A;  5ECP B;  3KCM A;  2VCZ A;  4TR1 A;  3UAR A;  1M99 A;  5DAL A;  1YKC A;  3G7J A;  2VD1 A;  5J5N A;  3MYD A;  5KEJ A;  1O8X A;  2JSY A;  3GUR A;  3QOU A;  3TJK A;  1XWB A;  1ZOF A;  2LTK A;  4ML6 A;  3WD6 A;  10GS A;  3TKS C;  9GSS A;  1O6J A;  5DDL A;  2CAI A;  3ME7 A;  3MAK A;  2N5F A;  1PFO A;  5IO2 A;  3DGQ A;  2IIY A;  4IHU A;  1TRV A;  4Z2U A;  3I6A A;  4ZBD A;  2B3S A;  3C7M A;  3KP8 A;  3ZIJ A;  3GIX A;  4IW9 A;  1GP1 A;  2VAF A;  2GQM A;  2OAD A;  1NSW A;  4MF7 A;  4EIP A;  3LXT A;  3UEM A;  4ZB6 A;  1DBY A;  1AIU A;  4NHW A;  1T7P B;  3FZ4 A;  3Q74 A;  5DCG A;  2IME A;  1PSQ A;  2VL9 A;  5INY A;  4K7O A;  4LA1 A;  5DJL A;  4GSS A;  2EIO A;  2VL3 A;  4POM A;  3ZRD A;  4NXI A;  2DC5 A;  1MD3 A;  3GTU B;  4FH8 A;  19GS A;  4PUR A;  3P8W A;  2GSR A;  2B1K A;  2L5L A;  2P0G A;  1SK0 A;  4NHZ A;  3ZVJ A;  5ECH B;  5GZZ B;  2NBS A;  3DVW A;  1F3B A;  4G0K A;  1G6W A;  4Q5N A;  3KMO A;  1ILO A;  5D93 A;  3UJ1 A;  2PGT A;  3O3T A;  1F2E A;  2K18 A;  4X4J A;  4BVY B;  3KIJ A;  2WJU A;  1NM3 A;  2YZH A;  5G30 A;  2R0C A;  2E2G A;  2FY6 A;  3CXG A;  5HR0 A;  4FO5 A;  5IQY A;  3ZVJ D;  4FIW A;  1XXU A;  3A2X A;  1V58 A;  1VRS D;  1VGL A;  3HZ8 A;  3AY8 A;  2L4C A;  2PUK C;  6GSV A;  2KP1 A;  3ME8 A;  2JZR A;  5G1L A;  3FYG A;  2E2M A;  2GZZ A;  4ECC A;  5B8A A;  1LBK A;  2WFC A;  1Z6N A;  2BJX A;  3IOS A;  1HNC A;  2OJL A;  4L8E A;  4QQ7 A;  1XW9 A;  3M3M A;  3GTU A;  5ECL B;  1QUW A;  3TJF A;  4POL A;  1EWX A;  2PVO C;  5E4W A;  4MJC A;  3RDW A;  2VM2 A;  5A4W A;  3LG6 A;  1I9D A;  4FYB A;  2PBJ A;  4G2E A;  2MBT A;  2PER A;  4BVY A;  2XBQ A;  1GUH A;  1XW6 A;  2X8H A;  4NMU A;  3IRA A;  1J08 A;  2YJH A;  2MMZ A;  2CAQ A;  3L9S A;  1BYE A;  1JFU A;  4HQS A;  1GWC A;  1PGT A;  3KH7 A;  2OBI A;  2H1A A;  1O81 A;  1B9X C;  4H86 A;  1K0B A;  1EOH A;  4E8H A;  4K7I A;  1EEJ A;  1Q4J A;  1T00 A;  1ON4 A;  4Q5Q A;  4HUA A;  4DSS B;  2LQQ A;  4ML1 A;  2GST A;  4GST A;  4G0I A;  2NTO A;  2ZCT A;  2YP6 A;  3ERW A;  1JLW A;  4FQU A;  4MZC A;  2GQL A;  2H66 A;  1SL2 B;  3BJ5 A;  5HFG A;  1FOH A;  2I81 A;  5FHI A;  4ZL7 A;  13GS A;  2PMT A;  3U6V A;  3GH6 A;  5KN2 A;  2JL4 A;  1JZD A;  4KDU A;  3KD0 A;  4RUV A;  5CRE A;  14GS A;  1XVW A;  2GTU A;  4KDX A;  3KTB A;  1VF2 A;  3P7X A;  3BCK A;  3DIE A;  2MMN A;  2HSH A;  2GS3 A;  2GSQ A;  2FWG A;  5ECO B;  5ECK B;  3CRT A;  2V6O A;  4KW6 A;  5COH A;  3F3Q A;  4N10 A;  3QMX A;  1QXH A;  2G2Q A;  1OE7 A;  5G31 A;  1HD2 A;  4DSS A;  3HY2 A;  4CY8 A;  3NZN A;  3CBU A;  3TOU A;  4NV2 A;  2GDR A;  1R26 A;  1X5E A;  3QAV A;  2YAN A;  5IMF A;  4ZB9 A;  1OAZ A;  2H71 A;  1AQV A;  1TU7 A;  2H0G A;  2L6D A;  2DBC A;  3GKK A;  1F3A A;  1BAY A;  4LLR A;  3F8U A;  5F06 A;  4EE0 A;  4IVF A;  4DVC A;  5IOX A;  2H74 A;  3BBY A;  1SYR A;  3VWV A;  1E2Y A;  4DEJ A;  1XW5 A;  4XHM A;  2GVP A;  4PUF C;  4YQM A;  4WR4 A;  2VO4 A;  3CMI A;  1WP0 A;  1ZMA A;  2B5X A;  3EPT A;  1A8Y A;  1FHE A;  1W89 A;  5IMZ A;  2H6Y A;  2WUL A;  4N0Z A;  2IFQ B;  4NV5 A;  1A24 A;  1SD9 A;  2CX3 A;  1TDI A;  1YY7 A;  4JED A;  2WZ9 A;  1WMJ A;  4A5P A;  1XZO A;  5ECM B;  3Q19 A;  3WGD A;  2BTO T;  3P2A A;  4KDY A;  5CRW A;  5IPH A;  4K6X A;  4CW9 A;  2AB6 A;  3TOT A;  2C3T A;  3QAW A;  2ON5 A;  1J9B A;  1PX6 A;  2YZU A;  3LGC A;  1R5P A;  4HJM A;  3GA4 A;  4GF0 A;  2PWJ A;  3DRN A;  2K9F A;  5EY6 A;  4HI7 A;  1GSQ A;  2REM A;  3EIN A;  2IMI A;  1G7O A;  1BG5 A;  2L4Q A;  2I4A A;  3HJP A;  1SK1 A;  3HKR A;  3Q6O A;  1XWC A;  2PPT A;  1ABA A;  3QPM A;  3IK7 A;  1MEK A;  1YZX A;  4ID0 A;  2X64 A;  1ZYN A;  1JHB A;  2V2G A;  1F6M C;  1X0R A;  1GL8 A;  1O73 A;  2IFQ A;  1G7E A;  1WJK A;  3ED3 A;  4MCU A;  1ERT A;  1ZCP A;  3LYP A;  1UVZ A;  3F63 A;  2X4A A;  3UBL A;  2C3N A;  4IQ1 A;  2FWE A;  1Q98 A;  2TRC P;  1ZZY A;  2HRK A;  1Z7P A;  4YKF A;  2AJQ B;  1GNW A;  1JZW A;  3G7I A;  4KE3 A;  2UZ8 A;  4DSR A;  3LSZ A;  2O8V B;  1XBS A;  1ERW A;  4ZIJ A;  4L0W A;  3EU4 A;  3IXR A;  3HVV A;  4MLY A;  4MMM A;  4GTU A;  6GSW A;  1O8W A;  3HZ4 A;  4KGI A;  1E6B A;  3CSJ A;  3HYP A;  3HVN A;  3LWA A;  2LJR A;  4HS1 A;  4EXJ A;  3APQ A;  4MK3 A;  3QFB C;  2FHE A;  1AQW A;  1GRX A;  2HXK A;  5GST A;  1OC3 A;  4CHS A;  2F3M A;  4HEA 2;  1FB0 A;  5J4U A;  4XRA A;  1F9M A;  4PUA A;  3DWV A;  4BA7 A;  2DJ2 A;  4GWR A;  3C1R A;  3N9J A;  4NAX A;  2I1U A;  2VL2 A;  4TXO B;  6GSY A;  1HYU A;  1XOB A;  4KUN A;  2YN1 A;  2YWN A;  1ZL9 A;  4K8M A;  5H5R A;  1SYX A;  5DQS A;  4HZ2 A;  5F0G A;  3E9J B;  5DAK B;  3BCI A;  3O76 A;  1B8X A;  2CX4 A;  5E59 A;  2L57 A;  3CQF A;  3GL3 A;  3TKR A;  18GS A;  4BPY A;  1YEP A;  2QA1 A;  2WDU A;  2N5B A;  2H72 A;  4X1U A;  3GMF A;  2FGX A;  3UMA A;  2B1L A;  4XRD A;  1GLQ A;  5G2Z A;  3P90 A;  2C80 A;  3FZ9 A;  1EP8 A;  1PX7 A;  2EC4 A;  17GS A;  4CDO A;  1DUG A;  3HXS A;  3NOF A;  1ERV A;  2H1B A;  2FWH A;  5IMD A;  4HDE A;  3LYK A;  5J3R A;  3F6D A;  2NDO A;  4TXO A;  4PX1 A;  1DE2 A;  2ON7 A;  2F8F A;  4K2D A;  5ECR B;  5IMV A;  2X8C A;  3EMP A;  3JCM L;  2FNO A;  5DCH A;  2K8S A;  5DAK A;  2HNL A;  3FRC A;  3TKS A;  1SJ6 A;  2A2P A;  5LNK e;  2C0G A;  1MDI A;  6GST A;  1VF4 A;  2E7P A;  1TRU A;  3GN3 A;  2CV4 A;  3KP9 A;  3GST A;  4MAB A;  4ACS A;  2R37 A;  4ZB8 A;  4I5Q A;  2V1M A;  3L9V A;  4I97 A;  3DEX A;  5HR3 A;  3US3 A;  3WYW A;  2QSI A;  2YV9 A;  3E0U A;  3GV1 A;  2HI7 A;  3TRX A;  3UVH A;  2EIQ A;  2A2R A;  2H30 A;  2O7K A;  2B5Y A;  1H75 A;  2L6C A;  2GZY A;  3EU3 A;  4KF9 A;  4ULX A;  2FD3 A;  3GFK A;  2K6V A;  3CTG A;  2HLS A;  2C0E A;  4F03 A;  1THO A;  4G19 A;  4KAE A;  3QCP A;  1YEX A;  1U3A A;  1EGO A;  5BRT A;  4LL1 B;  1MTC A;  3RPN A;  3APO A;  1H4O A;  4YAV A;  3QD9 A;  2GT5 A;  5CAX A;  2VCT A;  1V57 A;  3FHK A;  1R7H A;  2H75 A;  1BX9 A;  3C8E A;  3FMW A;  3TUE A;  2ZNM A;  2ZUP A;  2XBI A;  4V2N A;  3K8N A;  1OC8 A;  2DJ1 A;  2C8U A;  4E8E A;  2C0F A;  1K0D A;  1TTZ A;  2KLX A;  2P5R A;  4ZL9 A;  2OKA A;  1T8E B;  4OD7 A;  1K0N A;  4DSQ A;  4AF2 A;  5KOX A;  2HT9 A;  2C4J A;  1XIY A;  2VOC A;  2HFD A;  4MF6 A;  2VCV A;  1OE8 A;  1EV9 A;  1HNA A;  5JWO B;  2V32 A;  5IMC A;  3F4S A;  3VK9 A;  2O87 A;  4J2F A;  4GLT A;  4KX4 A;  1TU8 A;  1SKS B;  1KNG A;  3IDV A;  2MBS A;  5ECI B;  11GS A;  4F2I A;  3TKS E;  4KND A;  4KCE A;  3D22 A;  3VWW A;  1V98 A;  3L78 A;  3DML A;  5IMA A;  3APS A;  4CY6 A;  2YV7 A;  3IR4 A;  2N5A A;  2LJK A;  2LUS A;  2KP2 A;  2F9S A;  2RM6 A;  5ELG A;  2VD0 A;  4IGJ A;  4HSC X;  1M2A A;  2DJK A;  5D8I A;  1NW2 A;  2ES7 A;  3VLN A;  2FA8 A;  4J56 E;  3IE3 A;  2YJ7 A;  2RUE A;  2L59 A;  2DKI A;  1TK0 B;  1R5A A;  4V1A g;  1OYJ A;  4TRX A;  3GSS A;  5ECS A;  1PQN A;  1Z5Y E;  1M7T A;  2WGR A;  2CVK A;  4XIH A;  5IPG A;  1XFL A;  1OKD A;  2OE1 A;  4L5L A;  5KN0 A;  2CZ2 A;  2IJY A;  3ZFL A;  4WXT A;  4MJE A;  4BWQ A;  1YF0 A;  22GS A;  1B4P A;  4ZL8 A;  1GLP A;  4Z2R A;  1TJD A;  4P3Y B;  6GSS A;  2MYG A;  1XOA A;  4XS4 B;  1B4Q A;  4ZBA A;  5G1K A;  1HNB A;  4I2T A;  3FR6 A;  2H70 A;  1ZYQ B;  2HYX A;  4GQC A;  1ST9 A;  2PU9 C;  3LFL A;  3R2Q A;  3VPT A;  3ZIV A;  3ZTL A;  1FG4 A;  1FVJ A;  3HVX A;  2OA7 A;  2R0P A;  5HQP A;  2CZ3 A;  2C0D A;  2F51 A;  2NPB A;  5C04 A;  2VCX A;  1S3A A;  5DBQ A;  5DQY A;  1LJR A;  4AJ8 A;  4TN8 A;  5DVB A;  1K0A A;  3EWL A;  4ECI A;  2VIM A;  1O7U A;  3PR8 A;  4TR3 A;  2O89 A;  2XPE A;  5AN1 A;  1F37 A;  2QA2 A;  2V6K A;  3F9U A;  4F82 A;  1PN9 A;  1J0F A;  1WPI A;  4I6X A;  4FYC A;  1URM A;  1BJX A;  1GH2 A;  3F4R A;  2JZS A;  3LQ7 A;  3J7Y k;  5KOW A;  4XS4 A;  3LOR A;  1EP7 A;  5J9C A;  4MZB A;  5LCZ A;  5JCU A;  1R4W A;  4K9Z A;  5C00 A;  3W8J A;  4G9H A;  4NWY A;  3FR3 A;  3IHQ A;  3W8S A;  1SL1 B;  2GT6 A;  3G9B A;  2IN3 A;  4Z2T A;  5B8B A;  2YPM A;  2HE3 A;  3KJY A;  3TCO A;  1UN2 A;  1EOG A;  2VCQ A;  3HHV A;  4EDZ A;  5GSS A;  4BIK A;  4KA0 A;  3FZA A;  2MZC A;  3PH9 A;  3IA1 A;  5AIX A;  2YWM A;  3GKX A;  3GX0 A;  2LQO A;  2JZT A;  1B9Y C;  5FWG A;  1GSS A;  3VPQ A;  1SEN A;  1X9M B;  4ILF A;  2TIR A;  3KH9 A;  4L5O A;  2X49 A;  1JLV A;  3W6G A;  1AW9 A;  3DXB A;  4OFN A;  4IBP A;  1A2J A;  3FEU A;  4MP4 A;  1OC9 B;  4RQX A;  8GSS A;  3FK8 A;  3Q18 A;  1T1V A;  1AC1 A;  1U3I A;  5IO0 A;  3GKM A;  2JU5 A;  5ELA A;  4MDC A;  5GAP D;  4KSO A;  2RII A;  4PXO A;  4J57 E;  3UL3 A;  4TXV A;  2CT6 A;  4ICY A;  4EDY A;  1A0F A;  5KN3 A;  2LST A;  1G0T A;  1SU9 A;  4Q5R A;  3VI5 A;  1M9B A;  1DE1 A;  4X43 A;  3CSH A;  3F6F A;  1GSE A;  5JCW A;  5BMU A;  3WGE A;  3H1N A;  3A3T A;  1O85 A;  2LEG A;  3D5J A;  4BVX B;  1IYH A;  1X5D A;  3WGX A;  2HSY A;  2LKU A;  4V2L A;  4YQU A;  3D21 A;  4XTS A;  5JWQ B;  1Z7R A;  2VUP A;  2JAC A;  2J9H A;  4N11 A;  1TP9 A;  2V41 A;  1GSF A;  3HDC A;  4JZQ A;  4K2X A;  1A2L A;  4KH7 A;  3TGZ A;  2VM1 A;  2AUV A;  1K0C A;  4IEL A;  3WT2 A;  3H79 A;  3ZMK A;  3IAM 2;  2CVD A;  3D4T A;  2OBK A;  4F9Z A;  2H19 A;  1YJ6 A;  4WKW A;  2O85 A;  1UC7 A;  2D2Z A;  3F0I A;  4IJ3 A;  4KB3 A;  3HJO A;  2H76 A;  1NHY A;  3ERF A;  4MJA A;  1YQ1 A;  3IV4 A;  2LRN A;  4AJ7 A;  2XPD A;  2VL2 C;  4EC0 A;  1SL0 B;  1Z9H A;  2HRF A;  3TJB A;  1A23 A;  4BVX A;  3RBT A;  1V2A A;  5EVO A;  4YKG A;  1PL2 A;  3M1G A;  3UIW A;  3LJR A;  1THX A;  2CVB A;  2IMD A;  4O92 A;  4WF4 A;  1SJZ A;  2AHE A;  5G5F A;  4XS1 A;  2HSM A;  1TI1 A;  1B48 A;  1KBN A;  2IPA A;  2WRT A;  3ZZX A;  2HZF A;  5B7C A;  3MDK A;  2H0I A;  1Z6M A;  2QKE A;  5F8B A;  1VF3 A;  2L5O A;  3GL5 A;  4OFT A;  4K1F A;  1AXD A;  2M72 A;  3UAP A;  4K0G A;  3KM6 A;  3R3E A;  2R6K A;  1WRY A;  4WR5 A;  3RAZ A;  3J7Y b;  1K3L A;  1GSY A;  1K3Y A;  1U87 A;  2DJ0 A;  2FUG 2;  1GUL A;  3GX8 A;  1M3J A;  3EVI A;  1NHO A;  1A0R P;  1TK5 B;  2R5G A;  1PD2 1;  4YH2 A;  1M0U A;  1RQM A;  2LV3 A;  2XC2 A;  1U88 A;  1XPV A;  4JU5 A;  2DIZ A;  3GH9 A;  1Y6E A;  1N8J A;  1TOF A;  1ZGN A;  3TKP A;  4O5Q A;  2VLU A;  4JR6 A;  5IOW A;  3DVX A;  4TR0 A;  2M46 A;  5ECQ B;  2F8A A;  2CA8 A;  5GAN D;  5D9T A;  1TRS A;  1XVQ A;  4WBR D;  3GKN A;  1QGV A;  2RUF A;  4D73 B;  2P31 A;  4LL4 B;  2DIY A;  4Q5F A;  4PNG A;  5AGY A;  2H1D A;  2FWF A;  4PQI A;  4MJB A;  4K7N A;  3IHG A;  1CQG A;  3IBH A;  1QK8 A;  2X8G A;  4MA9 A;  2DMM A;  3M9J A;  4TVE A;  3WT1 A;  3HD5 A;  5KN1 A;  2R0G A;  1OVN A;  3ISO A;  4LMV A;  4MPG A;  2GQK A;  2EIR A;  3QDN A;  4RI6 A;  4IP1 A;  3A2V A;  5HFK A;  4OO4 A;  3ZLP A;  2B7K A;  4K0N A;  2HZE B;  2OE3 A;  2YWO A;  5IIZ A;  4O7H A;  3QR6 A;  3N5O A;  5CNW A;  1T4Z A;  5D96 A;  5B6N A;  1C72 A;  1SKR B;  3TKQ A;  3IC4 A;  4POB A;  3G7Y A;  16GS A;  20GS A;  3VWX A;  3ERG A;  3ZYW A;  4TW5 A;  3KZQ A;  1QMV A;  2DLX A;  4D73 A;  1EZK A;  4N30 A;  1VF1 A;  3C73 A;  1Y25 A;  4HZ4 A;  2AAW A;  2A2S A;  1TXX A;  2BMX A;  3FY7 A;  4HU9 A;  4HJ2 A;  5H5Q A;  4HOJ A;  4PTS A;  2ALB A;  2QC7 A;  2HRN A;  5FT3 A;  4BWS A;  5CRD A;  2AV4 A;  2XHF A;  2IMK A;  2WS2 A;  2LRC A;  1GUK A;  4TR4 A;  4YQV A;  5G5E A;  1Z3E A;  4FYU A;  3KGK A;  2HZE A;  4PQH A;  3MSZ A;  4IN0 A;  5ID2 B;  1QQ2 A;  5A5K A;  4EF0 A;  4EL1 A;  5D9V A;  1K3O A;  1RK4 A;  1ZYE A;  3QAG A;  3TDG A;  5LD0 A;  3TJJ A;  4MH3 A;  2R2J A;  5CRG A;  2P5Q A;  4ZBB A;  1X5C A;  1XCC A;  4HQZ A;  4WF5 A;  3VWU A;  4F0B A;  1S3C A;  2GGT A;  2H6X A;  3L4N A;  3L0H A;  1A2M A;  1FVK A;  3M9K A;  5CRH A;  3U5R E;  5AIS A;  5B6M A;  2R3X A;  3ZRE A;  2C3Q A;  1TKD B;  2DJJ A;  3H4K A;  1PA3 A;  3UVT A;  3SBC A;  1PRX A;  3VUR A;  4OO5 A;  5HR1 A;  3FKF A;  1U6T A;  4O5R A;  5JWR B;  3O6T A;  1XWG A;  4ISD A;  3ZIT A;  4EUY A;  4EVM A;  3GHA A;  3LW9 A;  2AYT A;  3D0Z A;  4OCE A;  3TRQ A;  3QFA C;  3I9V 2;  3UBK A;  1BED A;  3F4T A;  5F05 A;  1RW1 A;  1SJI A;  2LS5 A;  3C1S A;  3EC3 A;  4L0U A;  4NPB A;  5CYY A;  5ABR A;  2DSA A;  2I9H A;  5ID2 A;  4KCA A;  4ECB A;  1M9A A;  3TRP A;  4G10 A;  5J41 A;  3KXO A;  3CTF A;  2DML A;  3OR5 A;  3FW2 A;  4K5R A;  4RQR A;  4IQA A;  2FLS A;  3L9U A;  3MIX A;  4POK A;  2VLT A;  5HFI A;  1FB6 A;  3IPZ A;  3KMN A;  1ACV A;  4IS0 A;  4WEY A;  1WE0 A;  2TRX A;  3M0F A;  1PKZ A;  3VFI A;  4PNF A;  1X9W B;  1WWJ A;  2WB9 A;  2LNT A;  5ENU A;  1EEM A;  5EPF A;  4QL9 A;  4I8B A;  4MH2 A;  2A4V A;  3D6I A;  5D9X A;  3MWH A;  4USS A;  1GTA A;  3DKS A;  2GZP A;  5H5S A;  3PPU A;  2YOI A;  3V1W A;  4BL7 B;  1IYI A;  3LEF A;  2CQ9 A;  3FZ5 A;  3RHB A;  4GRF A;  3HJM A;  4O32 A;  4XCS A;  1FO5 A;  3EUR A;  3GRX A;  4HU7 A;  1SKW B;  1AAZ A;  2J23 A;  4GQF A;  4OMV A;  4MZW A; 
#chains in the Genus database with same CATH homology
 1YF1 A;  2OAC A;  4O5U A;  1SK2 A;  5D73 A;  1M2D A;  3KTL A;  2H6Z A;  2MMO A;  2NVL A;  3CSI A;  4MPF A;  4EO3 A;  5A4V A;  4QL7 A;  4PGT A;  1QFN A;  2H01 A;  2YNX A;  4AGS A;  1GNE A;  4G0L A;  2QGV A;  4YAP A;  4LMW A;  1MDK A;  2FCH A;  3EMX A;  2K8V A;  3IAS 2;  3BOA A;  1V40 A;  1K0M A;  2Z9S A;  1WIK A;  2KUC A;  3MNG A;  1PMT A;  4BL7 A;  2B7J A;  4GCI A;  3SWL A;  2H0H A;  3DD3 A;  4I2U A;  2YCD A;  4Z7X A;  1GSD A;  1OKT A;  2JAD A;  3BD2 A;  4X0X A;  3EE2 A;  1MD4 A;  2R4V A;  1S3D A;  4OWY A;  4MF5 A;  4OCF A;  1GTU A;  2WCI A;  3IK9 A;  1FAA A;  2IWT A;  1PL1 A;  5IM9 A;  4TOP A;  4TKY A;  1AQX A;  1KTE A;  2IL3 A;  1ERU A;  3I69 A;  2I3Y A;  3HVS A;  2X99 A;  2M80 A;  1XWA A;  3C71 A;  1PN0 A;  4WET A;  2G0F A;  1WOU A;  5AIV A;  4EIQ A;  2KHP A;  3ZFB A;  2A4H A;  1YKA A;  3A2W A;  2LRT A;  4V1A p;  1USB A;  2RLI A;  3F3R A;  2DJ3 A;  3IC8 A;  4KSM A;  3KEB A;  5HR2 A;  4F0C A;  1GUM A;  1FW1 A;  2VLV A;  3M8N A;  4RI7 A;  2C1Y A;  3PGT A;  4IJI A;  1DSB A;  2E0Q A;  4K5S A;  3HCZ A;  1ML6 A;  4ZIL A;  1JZO A;  3DYR A;  1FOV A;  1N2A A;  4AJ6 A;  3CRU A;  2HRA A;  12GS A;  1CQH A;  1LU4 A;  4IP6 A;  3H93 A;  2RM5 A;  2PN8 A;  2KOK A;  5CP1 A;  1BQ7 A;  1M2B A;  1GTI A;  1PKW A;  1G6Y A;  1MDJ A;  1OC9 A;  4WBJ A;  4GXZ A;  3RHC A;  3S9F A;  3A5I A;  3GNJ A;  1TW9 A;  2OE0 A;  3GUS A;  3D4M A;  1EV4 A;  1GSU A;  1ZYP A;  2VCW A;  4ECJ A;  2DKH A;  4JBB A;  4GSN A;  2LJA A;  4V2M A;  5EL8 A;  2H8L A;  3ZML A;  2IMF A;  3H8Q A;  1I5G A;  2GLR A;  3EYT A;  1T3B A;  3TJG A;  3LXZ A;  3GYK A;  4IKH A;  4OFM A;  2B6M A;  3CYN A;  1A8L A;  3VI7 A;  2JSZ A;  3ZL5 A;  6GSU A;  1UA5 A;  1TI3 A;  2FA4 A;  5J9B A;  3FR9 A;  4TR1 B;  5DAL B;  4JE1 A;  3PIN A;  3HA9 A;  1KEB A;  2PVQ A;  3NIV A;  3RPP A;  1AUC A;  1EGR A;  2H1G A;  5A4U A;  2GSS A;  7GSS A;  1SD8 A;  1K0O A;  4JRR A;  2YWI A;  6GSX A;  5ECN B;  1TK8 B;  1W4V A;  5DJM A;  2H73 A;  4PQ1 A;  2MMA A;  1HQO A;  4EKZ A;  1V9W A;  3UOM A;  5CO3 A;  4XS6 A;  1X9S B;  2LNS A;  1YDK A;  5L71 A;  5JCG A;  5D9W A;  1GTB A;  1XWK A;  1TRW A;  4JR4 A;  5F07 A;  1JZR A;  4ZXG A;  3I43 A;  4N0V A;  3A5W A;  3E3E A;  2B5E A;  3TB2 A;  1T4Y A;  4MNN A;  5ECP B;  3KCM A;  2VCZ A;  4TR1 A;  3UAR A;  1M99 A;  5DAL A;  1YKC A;  3G7J A;  2VD1 A;  5J5N A;  3MYD A;  5KEJ A;  1O8X A;  2JSY A;  3GUR A;  3QOU A;  3TJK A;  1XWB A;  1ZOF A;  2LTK A;  4ML6 A;  3WD6 A;  10GS A;  3TKS C;  9GSS A;  1O6J A;  5DDL A;  2CAI A;  3ME7 A;  3MAK A;  2N5F A;  5IO2 A;  3DGQ A;  2IIY A;  4IHU A;  1TRV A;  4Z2U A;  3I6A A;  4ZBD A;  2B3S A;  3C7M A;  3KP8 A;  3ZIJ A;  3GIX A;  4IW9 A;  1GP1 A;  2VAF A;  2GQM A;  2OAD A;  1NSW A;  4MF7 A;  4EIP A;  3LXT A;  3UEM A;  4ZB6 A;  1DBY A;  1AIU A;  4NHW A;  1T7P B;  3FZ4 A;  3Q74 A;  5DCG A;  2IME A;  1PSQ A;  2VL9 A;  5INY A;  4K7O A;  4LA1 A;  5DJL A;  4GSS A;  2EIO A;  2VL3 A;  4POM A;  3ZRD A;  4NXI A;  2DC5 A;  1MD3 A;  3GTU B;  4FH8 A;  19GS A;  4PUR A;  3P8W A;  2GSR A;  2B1K A;  2L5L A;  2P0G A;  1SK0 A;  4NHZ A;  3ZVJ A;  5ECH B;  5GZZ B;  2NBS A;  3DVW A;  1F3B A;  4G0K A;  1G6W A;  4Q5N A;  3KMO A;  1ILO A;  5D93 A;  3UJ1 A;  2PGT A;  3O3T A;  1F2E A;  2K18 A;  4X4J A;  4BVY B;  3KIJ A;  2WJU A;  1NM3 A;  2YZH A;  5G30 A;  2R0C A;  2E2G A;  2FY6 A;  3CXG A;  5HR0 A;  4FO5 A;  5IQY A;  3ZVJ D;  4FIW A;  1XXU A;  3A2X A;  1V58 A;  1VRS D;  1VGL A;  3HZ8 A;  3AY8 A;  2L4C A;  2PUK C;  6GSV A;  2KP1 A;  3ME8 A;  2JZR A;  5G1L A;  3FYG A;  2E2M A;  2GZZ A;  4ECC A;  5B8A A;  1LBK A;  2WFC A;  1Z6N A;  2BJX A;  3IOS A;  1HNC A;  2OJL A;  4L8E A;  4QQ7 A;  1XW9 A;  3M3M A;  3GTU A;  5ECL B;  1QUW A;  3TJF A;  4POL A;  1EWX A;  2PVO C;  5E4W A;  4MJC A;  3RDW A;  2VM2 A;  5A4W A;  3LG6 A;  1I9D A;  4FYB A;  2PBJ A;  4G2E A;  2MBT A;  2PER A;  4BVY A;  2XBQ A;  1GUH A;  1XW6 A;  2X8H A;  4NMU A;  3IRA A;  1J08 A;  2YJH A;  2MMZ A;  2CAQ A;  3L9S A;  1BYE A;  1JFU A;  4HQS A;  1GWC A;  1PGT A;  3KH7 A;  2OBI A;  2H1A A;  1O81 A;  1B9X C;  4H86 A;  1K0B A;  1EOH A;  4E8H A;  4K7I A;  1EEJ A;  1Q4J A;  1T00 A;  1ON4 A;  4Q5Q A;  4HUA A;  4DSS B;  2LQQ A;  4ML1 A;  2GST A;  4GST A;  4G0I A;  2NTO A;  2ZCT A;  2YP6 A;  3ERW A;  1JLW A;  4FQU A;  4MZC A;  2GQL A;  2H66 A;  1SL2 B;  3BJ5 A;  5HFG A;  1FOH A;  2I81 A;  5FHI A;  4ZL7 A;  13GS A;  2PMT A;  3U6V A;  3GH6 A;  5KN2 A;  2JL4 A;  1JZD A;  4KDU A;  3KD0 A;  4RUV A;  5CRE A;  14GS A;  1XVW A;  2GTU A;  4KDX A;  3KTB A;  1VF2 A;  3P7X A;  3BCK A;  3DIE A;  2MMN A;  2HSH A;  2GS3 A;  2GSQ A;  2FWG A;  5ECO B;  5ECK B;  3CRT A;  2V6O A;  4KW6 A;  5COH A;  3F3Q A;  4N10 A;  3QMX A;  1QXH A;  2G2Q A;  1OE7 A;  5G31 A;  1HD2 A;  4DSS A;  3HY2 A;  4CY8 A;  3NZN A;  3CBU A;  3TOU A;  4NV2 A;  2GDR A;  1R26 A;  1X5E A;  3QAV A;  2YAN A;  5IMF A;  4ZB9 A;  1OAZ A;  2H71 A;  1AQV A;  1TU7 A;  2H0G A;  2L6D A;  2DBC A;  3GKK A;  1F3A A;  1BAY A;  4LLR A;  3F8U A;  5F06 A;  4EE0 A;  4IVF A;  4DVC A;  5IOX A;  2H74 A;  3BBY A;  1SYR A;  3VWV A;  1E2Y A;  4DEJ A;  1XW5 A;  4XHM A;  2GVP A;  4PUF C;  4YQM A;  4WR4 A;  2VO4 A;  3CMI A;  1WP0 A;  1ZMA A;  2B5X A;  3EPT A;  1A8Y A;  1FHE A;  1W89 A;  5IMZ A;  2H6Y A;  2WUL A;  4N0Z A;  2IFQ B;  4NV5 A;  1A24 A;  1SD9 A;  2CX3 A;  1TDI A;  1YY7 A;  4JED A;  2WZ9 A;  1WMJ A;  4A5P A;  1XZO A;  5ECM B;  3Q19 A;  3WGD A;  2BTO T;  3P2A A;  4KDY A;  5CRW A;  5IPH A;  4K6X A;  4CW9 A;  2AB6 A;  3TOT A;  2C3T A;  3QAW A;  2ON5 A;  1J9B A;  1PX6 A;  2YZU A;  3LGC A;  1R5P A;  4HJM A;  3GA4 A;  4GF0 A;  2PWJ A;  3DRN A;  2K9F A;  5EY6 A;  4HI7 A;  1GSQ A;  2REM A;  3EIN A;  2IMI A;  1G7O A;  1BG5 A;  2L4Q A;  2I4A A;  3HJP A;  1SK1 A;  3HKR A;  3Q6O A;  1XWC A;  2PPT A;  1ABA A;  3QPM A;  3IK7 A;  1MEK A;  1YZX A;  4ID0 A;  2X64 A;  1ZYN A;  1JHB A;  2V2G A;  1F6M C;  1X0R A;  1GL8 A;  1O73 A;  2IFQ A;  1G7E A;  1WJK A;  3ED3 A;  4MCU A;  1ERT A;  1ZCP A;  3LYP A;  1UVZ A;  3F63 A;  2X4A A;  3UBL A;  2C3N A;  4IQ1 A;  2FWE A;  1Q98 A;  2TRC P;  1ZZY A;  2HRK A;  1Z7P A;  4YKF A;  2AJQ B;  1GNW A;  1JZW A;  3G7I A;  4KE3 A;  2UZ8 A;  4DSR A;  3LSZ A;  2O8V B;  1XBS A;  1ERW A;  4ZIJ A;  4L0W A;  3EU4 A;  3IXR A;  3HVV A;  4MLY A;  4MMM A;  4GTU A;  6GSW A;  1O8W A;  3HZ4 A;  4KGI A;  1E6B A;  3CSJ A;  3HYP A;  3LWA A;  2LJR A;  4HS1 A;  4EXJ A;  3APQ A;  4MK3 A;  3QFB C;  2FHE A;  1AQW A;  1GRX A;  2HXK A;  5GST A;  1OC3 A;  4CHS A;  2F3M A;  4HEA 2;  1FB0 A;  5J4U A;  4XRA A;  1F9M A;  4PUA A;  3DWV A;  4BA7 A;  2DJ2 A;  4GWR A;  3C1R A;  3N9J A;  4NAX A;  2I1U A;  2VL2 A;  4TXO B;  6GSY A;  1HYU A;  1XOB A;  4KUN A;  2YN1 A;  2YWN A;  1ZL9 A;  4K8M A;  5H5R A;  1SYX A;  5DQS A;  4HZ2 A;  5F0G A;  3E9J B;  5DAK B;  3BCI A;  3O76 A;  1B8X A;  2CX4 A;  5E59 A;  2L57 A;  3GL3 A;  3TKR A;  18GS A;  4BPY A;  1YEP A;  2QA1 A;  2WDU A;  2N5B A;  2H72 A;  4X1U A;  3GMF A;  2FGX A;  3UMA A;  2B1L A;  4XRD A;  1GLQ A;  5G2Z A;  3P90 A;  2C80 A;  3FZ9 A;  1EP8 A;  1PX7 A;  2EC4 A;  17GS A;  4CDO A;  1DUG A;  3HXS A;  3NOF A;  1ERV A;  2H1B A;  2FWH A;  5IMD A;  4HDE A;  3LYK A;  5J3R A;  3F6D A;  2NDO A;  4TXO A;  4PX1 A;  1DE2 A;  2ON7 A;  2F8F A;  4K2D A;  5ECR B;  5IMV A;  2X8C A;  3EMP A;  3JCM L;  2FNO A;  5DCH A;  2K8S A;  5DAK A;  2HNL A;  3FRC A;  3TKS A;  1SJ6 A;  2A2P A;  5LNK e;  2C0G A;  1MDI A;  6GST A;  1VF4 A;  2E7P A;  1TRU A;  3GN3 A;  2CV4 A;  3KP9 A;  3GST A;  4MAB A;  4ACS A;  2R37 A;  4ZB8 A;  4I5Q A;  2V1M A;  3L9V A;  4I97 A;  3DEX A;  5HR3 A;  3US3 A;  3WYW A;  2QSI A;  2YV9 A;  3E0U A;  3GV1 A;  2HI7 A;  3TRX A;  3UVH A;  2EIQ A;  2A2R A;  2H30 A;  2O7K A;  2B5Y A;  1H75 A;  2L6C A;  2GZY A;  3EU3 A;  4KF9 A;  4ULX A;  2FD3 A;  3GFK A;  2K6V A;  3CTG A;  2HLS A;  2C0E A;  4F03 A;  1THO A;  4G19 A;  4KAE A;  3QCP A;  1YEX A;  1U3A A;  1EGO A;  5BRT A;  4LL1 B;  1MTC A;  3RPN A;  3APO A;  1H4O A;  4YAV A;  3QD9 A;  2GT5 A;  5CAX A;  2VCT A;  1V57 A;  3FHK A;  1R7H A;  2H75 A;  1BX9 A;  3C8E A;  3FMW A;  3TUE A;  2ZNM A;  2ZUP A;  2XBI A;  4V2N A;  3K8N A;  1OC8 A;  2DJ1 A;  2C8U A;  4E8E A;  2C0F A;  1K0D A;  1TTZ A;  2KLX A;  2P5R A;  4ZL9 A;  2OKA A;  1T8E B;  4OD7 A;  1K0N A;  4DSQ A;  4AF2 A;  5KOX A;  2HT9 A;  2C4J A;  1XIY A;  2VOC A;  2HFD A;  4MF6 A;  2VCV A;  1OE8 A;  1EV9 A;  1HNA A;  5JWO B;  2V32 A;  5IMC A;  3F4S A;  3VK9 A;  2O87 A;  4J2F A;  4GLT A;  4KX4 A;  1TU8 A;  1SKS B;  1KNG A;  3IDV A;  2MBS A;  5ECI B;  11GS A;  4F2I A;  3TKS E;  4KND A;  4KCE A;  3D22 A;  3VWW A;  1V98 A;  3L78 A;  3DML A;  5IMA A;  3APS A;  4CY6 A;  2YV7 A;  3IR4 A;  2N5A A;  2LJK A;  2LUS A;  2KP2 A;  2F9S A;  2RM6 A;  5ELG A;  2VD0 A;  4IGJ A;  1M2A A;  2DJK A;  5D8I A;  1NW2 A;  2ES7 A;  3VLN A;  2FA8 A;  4J56 E;  3IE3 A;  2YJ7 A;  2RUE A;  2L59 A;  2DKI A;  1TK0 B;  1R5A A;  4V1A g;  1OYJ A;  4TRX A;  3GSS A;  5ECS A;  1PQN A;  1Z5Y E;  1M7T A;  2WGR A;  2CVK A;  4XIH A;  5IPG A;  1XFL A;  1OKD A;  2OE1 A;  4L5L A;  5KN0 A;  2CZ2 A;  2IJY A;  3ZFL A;  4WXT A;  4MJE A;  4BWQ A;  1YF0 A;  22GS A;  1B4P A;  4ZL8 A;  1GLP A;  4Z2R A;  1TJD A;  4P3Y B;  6GSS A;  2MYG A;  1XOA A;  4XS4 B;  1B4Q A;  4ZBA A;  5G1K A;  1HNB A;  4I2T A;  3FR6 A;  2H70 A;  1ZYQ B;  2HYX A;  4GQC A;  1ST9 A;  2PU9 C;  3LFL A;  3R2Q A;  3VPT A;  3ZIV A;  3ZTL A;  1FG4 A;  1FVJ A;  3HVX A;  2OA7 A;  2R0P A;  5HQP A;  2CZ3 A;  2C0D A;  2F51 A;  2NPB A;  5C04 A;  2VCX A;  1S3A A;  5DBQ A;  5DQY A;  1LJR A;  4AJ8 A;  4TN8 A;  5DVB A;  1K0A A;  3EWL A;  4ECI A;  2VIM A;  1O7U A;  3PR8 A;  4TR3 A;  2O89 A;  2XPE A;  5AN1 A;  1F37 A;  2QA2 A;  2V6K A;  3F9U A;  4F82 A;  1PN9 A;  1J0F A;  1WPI A;  4I6X A;  4FYC A;  1URM A;  1BJX A;  1GH2 A;  3F4R A;  2JZS A;  3LQ7 A;  3J7Y k;  5KOW A;  4XS4 A;  3LOR A;  1EP7 A;  5J9C A;  4MZB A;  5LCZ A;  5JCU A;  1R4W A;  4K9Z A;  5C00 A;  3W8J A;  4G9H A;  4NWY A;  3FR3 A;  3IHQ A;  3W8S A;  1SL1 B;  2GT6 A;  3G9B A;  2IN3 A;  4Z2T A;  5B8B A;  2YPM A;  2HE3 A;  3KJY A;  3TCO A;  1UN2 A;  1EOG A;  2VCQ A;  3HHV A;  4EDZ A;  5GSS A;  4KA0 A;  3FZA A;  2MZC A;  3PH9 A;  3IA1 A;  5AIX A;  2YWM A;  3GKX A;  3GX0 A;  2LQO A;  2JZT A;  1B9Y C;  5FWG A;  1GSS A;  3VPQ A;  1SEN A;  1X9M B;  4ILF A;  2TIR A;  3KH9 A;  4L5O A;  2X49 A;  1JLV A;  3W6G A;  1AW9 A;  3DXB A;  4OFN A;  4IBP A;  1A2J A;  3FEU A;  4MP4 A;  1OC9 B;  4RQX A;  8GSS A;  3FK8 A;  3Q18 A;  1T1V A;  1AC1 A;  1U3I A;  5IO0 A;  3GKM A;  2JU5 A;  5ELA A;  4MDC A;  5GAP D;  4KSO A;  2RII A;  4PXO A;  4J57 E;  3UL3 A;  4TXV A;  2CT6 A;  4ICY A;  4EDY A;  1A0F A;  5KN3 A;  2LST A;  1G0T A;  1SU9 A;  4Q5R A;  3VI5 A;  1M9B A;  1DE1 A;  4X43 A;  3CSH A;  3F6F A;  1GSE A;  5JCW A;  5BMU A;  3WGE A;  3H1N A;  3A3T A;  1O85 A;  2LEG A;  3D5J A;  4BVX B;  1IYH A;  1X5D A;  3WGX A;  2HSY A;  2LKU A;  4V2L A;  4YQU A;  3D21 A;  4XTS A;  5JWQ B;  1Z7R A;  2VUP A;  2JAC A;  2J9H A;  4N11 A;  1TP9 A;  2V41 A;  1GSF A;  3HDC A;  4JZQ A;  4K2X A;  1A2L A;  4KH7 A;  3TGZ A;  2VM1 A;  2AUV A;  1K0C A;  4IEL A;  3WT2 A;  3H79 A;  3ZMK A;  3IAM 2;  2CVD A;  3D4T A;  2OBK A;  4F9Z A;  2H19 A;  1YJ6 A;  4WKW A;  2O85 A;  1UC7 A;  2D2Z A;  3F0I A;  4IJ3 A;  4KB3 A;  3HJO A;  2H76 A;  1NHY A;  3ERF A;  4MJA A;  1YQ1 A;  3IV4 A;  2LRN A;  4AJ7 A;  2XPD A;  2VL2 C;  4EC0 A;  1SL0 B;  1Z9H A;  2HRF A;  3TJB A;  1A23 A;  4BVX A;  3RBT A;  1V2A A;  5EVO A;  4YKG A;  1PL2 A;  3M1G A;  3UIW A;  3LJR A;  1THX A;  2CVB A;  2IMD A;  4O92 A;  4WF4 A;  1SJZ A;  2AHE A;  5G5F A;  4XS1 A;  2HSM A;  1TI1 A;  1B48 A;  1KBN A;  2IPA A;  2WRT A;  3ZZX A;  2HZF A;  5B7C A;  3MDK A;  2H0I A;  1Z6M A;  2QKE A;  5F8B A;  1VF3 A;  2L5O A;  3GL5 A;  4OFT A;  4K1F A;  1AXD A;  2M72 A;  3UAP A;  4K0G A;  3KM6 A;  3R3E A;  2R6K A;  1WRY A;  4WR5 A;  3RAZ A;  3J7Y b;  1K3L A;  1GSY A;  1K3Y A;  1U87 A;  2DJ0 A;  2FUG 2;  1GUL A;  3GX8 A;  3EVI A;  1NHO A;  1A0R P;  1TK5 B;  2R5G A;  1PD2 1;  4YH2 A;  1M0U A;  1RQM A;  2LV3 A;  2XC2 A;  1U88 A;  1XPV A;  4JU5 A;  2DIZ A;  3GH9 A;  1Y6E A;  1N8J A;  1TOF A;  1ZGN A;  3TKP A;  4O5Q A;  2VLU A;  4JR6 A;  5IOW A;  3DVX A;  4TR0 A;  2M46 A;  5ECQ B;  2F8A A;  2CA8 A;  5GAN D;  5D9T A;  1TRS A;  1XVQ A;  4WBR D;  3GKN A;  1QGV A;  2RUF A;  4D73 B;  2P31 A;  4LL4 B;  2DIY A;  4Q5F A;  4PNG A;  5AGY A;  2H1D A;  2FWF A;  4PQI A;  4MJB A;  4K7N A;  3IHG A;  1CQG A;  3IBH A;  1QK8 A;  2X8G A;  4MA9 A;  2DMM A;  3M9J A;  4TVE A;  3WT1 A;  3HD5 A;  5KN1 A;  2R0G A;  1OVN A;  3ISO A;  4LMV A;  4MPG A;  2GQK A;  2EIR A;  3QDN A;  4RI6 A;  4IP1 A;  3A2V A;  5HFK A;  4OO4 A;  3ZLP A;  2B7K A;  4K0N A;  2HZE B;  2OE3 A;  2YWO A;  5IIZ A;  4O7H A;  3QR6 A;  3N5O A;  5CNW A;  1T4Z A;  5D96 A;  5B6N A;  1C72 A;  1SKR B;  3TKQ A;  3IC4 A;  4POB A;  3G7Y A;  16GS A;  20GS A;  3VWX A;  3ERG A;  3ZYW A;  4TW5 A;  3KZQ A;  1QMV A;  2DLX A;  4D73 A;  1EZK A;  4N30 A;  1VF1 A;  3C73 A;  1Y25 A;  4HZ4 A;  2AAW A;  2A2S A;  1TXX A;  2BMX A;  3FY7 A;  4HU9 A;  4HJ2 A;  5H5Q A;  4HOJ A;  4PTS A;  2ALB A;  2QC7 A;  2HRN A;  5FT3 A;  4BWS A;  5CRD A;  2AV4 A;  2XHF A;  2IMK A;  2WS2 A;  2LRC A;  1GUK A;  4TR4 A;  4YQV A;  5G5E A;  1Z3E A;  4FYU A;  3KGK A;  2HZE A;  4PQH A;  3MSZ A;  4IN0 A;  5ID2 B;  1QQ2 A;  5A5K A;  4EF0 A;  4EL1 A;  5D9V A;  1K3O A;  1RK4 A;  1ZYE A;  3QAG A;  3TDG A;  5LD0 A;  3TJJ A;  4MH3 A;  2R2J A;  5CRG A;  2P5Q A;  4ZBB A;  1X5C A;  1XCC A;  4HQZ A;  4WF5 A;  3VWU A;  4F0B A;  1S3C A;  2GGT A;  2H6X A;  3L4N A;  3L0H A;  1A2M A;  1FVK A;  3M9K A;  5CRH A;  3U5R E;  5AIS A;  5B6M A;  2R3X A;  3ZRE A;  2C3Q A;  1TKD B;  2DJJ A;  3H4K A;  1PA3 A;  3UVT A;  3SBC A;  1PRX A;  3VUR A;  4OO5 A;  5HR1 A;  3FKF A;  1U6T A;  4O5R A;  5JWR B;  3O6T A;  1XWG A;  4ISD A;  3ZIT A;  4EUY A;  4EVM A;  3GHA A;  3LW9 A;  2AYT A;  3D0Z A;  4OCE A;  3TRQ A;  3QFA C;  3I9V 2;  3UBK A;  1BED A;  3F4T A;  5F05 A;  1RW1 A;  1SJI A;  2LS5 A;  3C1S A;  3EC3 A;  4L0U A;  4NPB A;  5CYY A;  5ABR A;  2DSA A;  2I9H A;  5ID2 A;  4KCA A;  4ECB A;  1M9A A;  3TRP A;  4G10 A;  5J41 A;  3KXO A;  3CTF A;  2DML A;  3OR5 A;  3FW2 A;  4K5R A;  4RQR A;  4IQA A;  2FLS A;  3L9U A;  3MIX A;  4POK A;  2VLT A;  5HFI A;  1FB6 A;  3IPZ A;  3KMN A;  1ACV A;  4IS0 A;  4WEY A;  1WE0 A;  2TRX A;  3M0F A;  1PKZ A;  3VFI A;  4PNF A;  1X9W B;  1WWJ A;  2WB9 A;  2LNT A;  5ENU A;  1EEM A;  5EPF A;  4QL9 A;  4I8B A;  4MH2 A;  2A4V A;  3D6I A;  5D9X A;  3MWH A;  4USS A;  1GTA A;  3DKS A;  2GZP A;  5H5S A;  3PPU A;  2YOI A;  3V1W A;  4BL7 B;  1IYI A;  3LEF A;  2CQ9 A;  3FZ5 A;  3RHB A;  4GRF A;  3HJM A;  4O32 A;  4XCS A;  1FO5 A;  3EUR A;  3GRX A;  4HU7 A;  1SKW B;  1AAZ A;  2J23 A;  4GQF A;  4OMV A;  4MZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...