5CYYA

Structure of the c-terminal domains of dipz from mycobacterium tuberculosis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
333
structure length
333
Chain Sequence
TGTEIREQLNLGGIVNAQNAQLSNCSDGAAQLESCGTAPDLKGITGWLNTPGNKPIDLKSLRGKVVLIDFWAYSCINCQRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAKGAANLGISYPIALDNNYATWTNYRNRYWPAEYLIDATGTVRHIKFGEGDYNVTETLVRQLLNDAKPGVKLPQPSSTTTPDLTPRAALTPETYFGVGKVVNYGGGGAYDEGSAVFDYPPSLAANSFALRGRWALDYQGATSDGNDAAIKLNYHAKDVYIVVGGTGTLTVVRDGKPATLPISGPPTTHQVVAGYRLASETLEVRPSKGLQVFSFTYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Protein DipZ
publication title Structure of the ectodomain of the electron transporter Rv2874 from Mycobacterium tuberculosis reveals a thioredoxin-like domain combined with a carbohydrate-binding module.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 91
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF17991 Thioredoxin_10 Thioredoxin like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5cyyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5cyyA01
4ZBAA 3P8WA 5I0DA 1OF3A 1K3OA 1DSBA 2O85A 1S3CA 2H6XA 5JXIA 2EIBA 2LTKA 4JKKA 1GTBA 1O85A 5JWOB 1SU9A 5F05A 4MABA 5D96A 3L9SA 3WNNA 1E6BA 4MLYA 3I3BA 3F3QA 5CAXA 3ACGA 4MH3A 1M9AA 2HYXA 3KM6A 3GYKA 4DEVA 4OYUA 2B5XA 1FW1A 2JU5A 5JWQB 4Z7XA 2RVAA 1PD21 3QFBC 1GUIA 4L5OA 3TRQA 1JZ2A 2LEGA 3UJ1A 2YZUA 2BGPA 1WCQA 2WZEA 3WGDA 5E59A 1XCCA 4JRRA 5HR2A 1NKGA 1P8JA 1A8LA 4X43A 4MGQA 3CMGA 4KH7A 3KD0A 3A5WA 3I69A 3ZYWA 4DSSA 3HKRA 2DJ0A 1XOBA 4RUVA 5D9TA 5INYA 5B8AA 2OA7A 1HD2A 3FR9A 2JZTA 3WNKA 1A23A 3TOTA 2WAAA 2KOKA 2OBKA 2PVQA 2W9XA 3EB7A 4WR5A 1EUTA 1TI3A 4ML6A 2YWMA 1XVQA 3LORA 1V9WA 3G7YA 4FYCA 2AAWA 3AC0A 1BHGA 3TJGA 5IMDA 1DYOA 1HNAA 4JR4A 1GWCA 1GU3A 2C0FA 1XVWA 2V72A 4EDYA 2J9HA 2ES7A 4NAXA 1XPVA 4V2LA 1F37A 2B1KA 3ISOA 2VMDA 3K4AA 1T3BA 1FO5A 4HG6B 4BK4A 1FB6A 1PA3A 2FWEA 2VCQA 4KUNA 3APOA 2OE1A 1ACVA 5D73A 2LQQA 1IQDC 1SK2A 4CUCA 1JYWA 3GSTA 3VD3A 1FG4A 1TDIA 3HZ4A 5E4WA 4ZIJA 2W3JA 1LU4A 2YV7A 1O8SA 1A0RP 2WO1A 3HJRA 3O76A 3OR5A 4Z2AA 2E31A 3CXGA 5IPHA 3HYPA 3GMFA 3C7HA 1DLCA 3NZNA 4LPLA 5HR0A 1GOGA 3GUSA 1Y6EA 3N5OA 3QD9A 3JXSA 1N2AA 4ACSA 3GN3A 4N0ZA 4HS1A 2YZHA 3NNGA 4TR4A 4DSRA 4DXSA 4FO5A 1B4QA 1ULOA 4LKSA 4TXVA 1NX9A 3THCA 4A6OA 1GTUA 1HNCA 2V32A 2XHNA 2LRCA 3MUZ1 3WF0A 4KX4A 3GTUB 3ZVJD 2AUVA 2QKEA 3OGSA 3LQCA 3ACHA 4ILFA 3MNGA 3TJBA 3CDZB 5G5EA 4GLTA 1K3IA 2JZSA 1V57A 3CTFA 3QOUA 3WF4A 2YP6A 3CRTA 5G05L 4ECBA 2OACA 4G19A 4HEA2 5B4XA 1G7EA 4ARYA 4ISDA 5DALB 4GWJA 3OG2A 5ECLB 1BQ7A 2X8HA 4IN0A 3NRUA 4D8MA 3N9JA 1EUUA 3D4TA 2W1WA 4D73A 1CZSA 1XZOA 5ECMB 2VZOA 12GSA 2CVDA 1VRSD 1SYRA 2Y6LA 3I2IA 1M0UA 4UOJA 3BOAA 2RM6A 3IAM2 5JUVA 1WJKA 4WBRD 5DJMA 1HN1A 3HJOA 3WNOA 1L7RA 5C71A 3LJRA 4YQUA 1O6JA 4E8HA 1GUMA 1R7HA 2LNTA 3UNPA 2W92A 5ECNB 2VMCA 2X09A 4J2FA 4ZXEA 3FHAA 2JE8A 3I97A 3SKVA 1AQVA 3UETA 2HRNA 1GSEA 3TUEA 2I9HA 3ZREA 2IMDA 3CSJA 1G0TA 4O7HA 1SYXA 3DRNA 1JYVA 1K0AA 4WBJA 4XHMA 1XXUA 1JZ4A 3K4DA 4P08A 1A8YA 3VWWA 1RYYA 1A2JA 1G6WA 1XW6A 2HSYA 3A2VA 4K0NA 3TKPA 4JR6A 2IMIA 2E32A 4HI7A 4DXTA 1JZ6A 4NV5A 3DVXA 3IR4A 4WR4A 2VM9A 2MMOA 2XONA 5H5QA 4XCSA 4JX0A 5DVBA 3KMNA 4I8BA 2GQMA 3F63A 3TJJA 1TW9A 2WS2A 3LYPA 4YAPA 2FA4A 3UOMA 1EV4A 1U87A 2JKXA 2VCCA 1NW2A 2V1MA 1CQGA 1PKWA 2XBQA 2N5FA 2XOMA 4HZ4A 1W89A 4NWYA 3EYTA 4EO3A 3TKRA 4ZL8A 2C0EA 2EIDA 3F9UA 1V58A 4XURA 3VD4A 5ECQB 5L71A 5CP1A 3APSA 2ZCTA 1X9WB 3LFLA 2ZEYA 4DSSB 4BPYA 1HQOA 1THXA 3GX0A 1ILOA 3CIHA 1SENA 3VFIA 2E2GA 16GSA 2YC4A 4LMVA 3FZ4A 4XS1A 3P7XA 4PT6A 1YQ1A 4HOJA 1EOHA 4WKWA 2C3QA 3DYMA 5LA1A 4PXOA 3C1SA 2WN2A 1M2DA 1PSQA 3VI5A 1K3YA 1GSYA 3TDGA 3WEZA 2OADA 1GLQA 2GSQA 2OKXA 4O5RA 4RQXA 1MEKA 4LHSA 3C7EA 2ON7A 2FY6A 1BG5A 2VL9A 1FAAA 2AB6A 3C8XA 3KTLA 3C7GA 4POKA 20GSA 3MV01 3IDAA 1TJDA 3ZLPA 4AAXA 4L0PA 5IMAA 1VF1A 4JHZA 4EUYA 4GQCA 3GM8A 3H1NA 3IIIA 2HI7A 2AV4A 2QQLA 2CQ9A 4MPFA 1TK8B 4PNFA 5ECHB 6GSXA 3KGKA 4KA0A 2C4XA 2XPDA 5J5NA 1OE8A 2RV9A 3FEUA 1W99A 3A3TA 1GUHA 1AXDA 3C1RA 2VZPA 1S3DA 2GSTA 1TI1A 2BGOA 3FHQA 1R5AA 4PGTA 2VL3A 3IPZA 1R64A 3PH9A 3L9VA 1OC8A 5F07A 4BK5A 4L5LA 4GQFA 2LJRA 4MA9A 2FLSA 1I9DA 4QQ7A 4A4AA 4MF7A 3M8NA 3T0AA 2R2JA 1VF3A 2B6MA 2LRNA 5CYYA 4DVCA 5IOWA 4JZQA 1PRXA 2FWGA 1XWAA 1M2BA 4F03A 3Q6OA 4L0UA 4QDQA 1J0FA 3HEIA 5LA2A 3LWAA 2I81A 3WF3A 1AQXA 4YH2A 1YF0A 1I5GA 2E0QA 1ON4A 4GSNA 3ZMLA 3EU3A 4GWIA 2VCZA 5DDLA 2GQLA 4QPWA 5G31A 2JADA 3TJFA 1TXXA 2TRXA 2M72A 2VUPA 2WRTA 4PF1A 1T4YA 3C7MA 1PL1A 1ZYQB 1O59A 1V40A 1UVZA 3EMXA 2LJKA 2QQNA 5HFGA 2H66A 2I4AA 5EIYB 3CYNA 4D73B 3T08A 1Z9HA 2BTOT 1AIUA 4RI7A 1J9BA 2DDUA 3UVTA 4BWSA 2WBKA 1OYJA 5KEJA 4DEQA 2J1UA 1BX9A 1EP8A 2L5OA 3SKJE 1XFLA 3HDCA 2IFQA 5KN2A 1T7PB 4MK3A 5LA0A 2R5GA 4GWRA 4HU7A 3PUIA 3IDVA 3F6FA 4IW9A 1PQNA 2XBIA 1GNWA 1S3AA 4QDSA 4POLA 2BZDA 1K0NA 1TVGA 4QX2A 1GNYA 3DECA 2LNSA 4QB6A 2DCKA 2H72A 3V1WA 3MAKA 3E1F1 5C7GA 4GXZA 3QAVA 2CZ3A 4L8EA 4FI9A 3D6IA 3PGTA 4EE0A 5JMOA 4MF6A 4XIHA 5EPFA 1EV9A 3F4TA 4Q5QA 2DMMA 5G30A 5IYYA 4QAWA 4KDYA 4MOAA 2C3TA 2H75A 1NUKA 4CVUA 5F8BA 2IN3A 4TXOA 3ZFBA 3VDCA 5ECIB 3RAZA 4LL4B 2QQOA 1Z6MA 4IS0A 2M46A 3O3TA 2VZ3A 1GUKA 1PGTA 2J1SA 3KCMA 6GSTA 2K8SA 3I2KA 1TP9A 4JE1A 4TOPA 2JD9A 1F3AA 2JACA 2RLIA 3ACIA 2H6YA 1QGVA 2ORXA 3L9UA 5ECKB 5LD0A 3HZ8A 3DD3A 2Z9SA 4PQ1A 1RW1A 2KD7A 3VURA 3SEEA 3RPNA 5JCUA 5D9WA 3L0HA 1T1VA 4Q5RA 2FUG2 3IB3A 2R6KA 2Y6JA 3QAGA 5HR1A 2I3YA 5AGYA 5D93A 4ZZ8A 3ZVJA 1JU4A 3DYPA 4MJBA 3TOUA 4BA7A 2YOIA 2W5FA 1ULPA 2WGRA 4PX1A 3FR6A 2P5RA 1U3AA 4I2TA 3A23A 1M7TA 2NPBA 2YNXA 3T09A 3W5NA 3ED3A 3RHCA 1SL2B 2LS6A 1KTEA 3OGVA 1HYUA 5JCWA 1A24A 2J1VA 3I6AA 4GSTA 1OKTA 3LEGA 2J1RA 1O8PA 2K18A 4XVHA 5J41A 4AGSA 3FYGA 4RQRA 1KEXA 4KCEA 2J1TA 4JKLA 1QQ2A 5IMZA 4FYBA 2DIYA 4ID0A 1OC9A 2D2ZA 2K6VA 5CNWA 3UBKA 2VAFA 4ULXA 3UL3A 4MH2A 4X1UA 3SWLA 2YPMA 4IP6A 2C0DA 3DIEA 3LSZA 3W8SA 3GKMA 5F06A 3EC3A 2PVOC 3D0ZA 3WNMA 3M3MA 1WP0A 2EICA 1R5PA 2VCBA 2MBTA 4YQVA 2KUCA 5J9CA 4KDXA 3LEIA 2VOCA 2H01A 3I2JA 1X5EA 2OE0A 3QR6A 2VD0A 5C04A 14GSA 1QXHA 1T00A 3ZITA 1J83A 2F8FA 3HD5A 2RM5A 1UY3A 4XRAA 2EIOA 3T0BA 1X5DA 5ECSA 2EC4A 1VF2A 4XUOA 4I5QA 4TRXA 4KB3A 1CQHA 3UESA 1MD4A 2DMLA 1OC3A 1USBA 4WEYA 4O32A 3U37A 5GZZB 4KNDA 5ECOB 4XS4A 2GQKA 3LYKA 5GAPD 2LQOA 5IFPA 4JKMA 1K0MA 2ZNMA 2YB7A 3UBLA 2KP2A 3BGAA 3HJPA 3UMAA 3WYWA 1LJRA 1SL0B 1JI6A 2H30A 1O73A 4TW5A 5EJZB 5IHRA 1PX6A 4K0GA 1UA5A 2ZEWA 1ERWA 4WETA 1FHEA 4XS6A 3ERGA 5A4WA 2C1YA 2FHEA 1UWWA 2GTUA 3M9KA 2GLRA 4OUEA 4DSQA 2X99A 4E8DA 5AISA 4BXSV 4KMQA 2PPTA 1JYNA 1SJZA 4IJIA 1PMHX 2IFQB 4EL1A 2VIMA 3NOFA 3IV4A 3S9FA 2L57A 1NHYA 4IVFA 2W47A 1DE2A 4K7IA 5J1XA 5JXGA 3I43A 5DQ0A 4IP1A 5KN1A 2B1LA 2QBXA 3F3RA 2DIZA 3CMIA 4OMVA 2WAOA 2ZEXA 1A0FA 2A2SA 2H8LA 1UMHA 3QPMA 5FUIA 4P3YB 2VZVA 5B6NA 1UY2A 2NTOA 3NQHA 1W9WA 2WO2A 2Y8KA 2TRCP 4KSMA 2VZQA 5AIXA 2EIQA 1Z7RA 4AJ7A 5DN2A 4CU7A 2EIEA 3BCKA 1HNBA 4LA1A 1ZCPA 3C8EA 2QQKA 1ZGNA 1TG7A 3FK8A 4TXOB 1GSUA 1EGOA 3HCZA 7GSSA 4N30A 1XW5A 3CSHA 3THDA 4OCFA 5DBQA 1FB0A 2GSSA 3UAPA 1KGYA 3LXZA 1MDJA 1SKRB 1O8WA 3VK9A 1OH4A 1QUWA 3BCIA 2PUKC 3IAQA 1W0NA 4MMMA 3KH9A 4NXIA 3MV11 3D22A 2YFUA 1SDDB 2F51A 4ZY9A 2GT6A 3VWVA 1ST9A 4F0CA 2WJUA 1OKDA 3IK7A 2J1AA 4E8EA 1DBYA 4P00B 1GULA 3VPTA 3OBAA 2R4VA 1ERVA 1Y25A 4W4ZA 4LMWA 3UARA 3HN3A 2VZUA 3ACFA 2CT6A 1SK0A 3HXSA 1VF4A 4N11A 5LCZA 2C80A 5COHA 5ID2A 2CX4A 2C3NA 6GSWA 4IKHA 3P90A 2DJ2A 2LUSA 3LGCA 4MJEA 1IYIA 5KN3A 4RI6A 2JDAA 1UZ0A 2YWOA 1AAZA 2VMFA 4MZWA 1US2A 4HUAA 4G2EA 3QDNA 3L4NA 4E8CA 2MMAA 2YV9A 3GFKA 1PMTA 1NSWA 5GSSA 3IA1A 1OF4A 1BAYA 2VO4A 5HR3A 3A22A 1T4ZA 1ABAA 3US3A 3DEXA 4WXTA 1UXZA 4YPJA 4OMCA 1YKAA 4J56E 3PR8A 1UC7A 2PQSA 5A5KA 2A2RA 3HHVA 2HSHA 19GSA 5C00A 4XUPA 4CU9A 3ZIJA 1OC9B 1K45A 4QL7A 4QX0A 1QK8A 1PX4A 4Q5NA 4Q5FA 5ELGA 2NBSA 1K12A 2VM2A 5HPOA 3G7JA 6GSYA 2WABA 1R26A 3HVSA 2KP1A 2BJXA 4O92A 1ZZYA 1N8JA 4F82A 2L6DA 1JZ3A 4I2UA 4EVMA 1GP1A 5IFTA 3FL7A 3H4KA 5DQYA 4TVEA 1GTAA 3FHKA 3LQ7A 4MCUA 1AQWA 1XPWA 1XOAA 5DCHA 3D3AA 3J7Yb 2DJJA 2PN8A 2K8VA 3F0IA 1GOHA 1K0BA 4IJ3A 4F9ZA 3GH6A 5EVOA 1JZ7A 1H6XA 4JU5A 3PUHA 3VDAA 2E33A 2GZZA 2V6KA 3ME8A 3GL3A 3LPFA 2XC2A 4W50A 2LS5A 3T2QA 5LCWL 2H76A 4V1Ag 3C7FA 3MO4A 3HNYM 4XS4B 2VD1A 4DEJA 5G1KA 1GLPA 2K9FA 5ELAA 1JHJA 4CU8A 4V2NA 3L78A 5ECRB 2WZ9A 1K42A 2GSRA 3EE2A 2BERA 3I2FA 3Q19A 4XUTA 1YJ6A 4PQIA 4AG4A 2AJQB 2IMFA 4DUXA 3HOBA 3MWHA 4ZBBA 1SD8A 1JLWA 2CAQA 2VL2C 3W8JA 2IPAA 1ZMAA 5GSTA 1EZKA 2XHFA 3CQOA 2E26A 2HFDA 3WT1A 2OBIA 4ECIA 3C71A 2B7KA 4ZILA 5D8IA 3WD6A 4MO3M 4P02B 4M4RA 2MMZA 1SHWB 2YANA 3GGLA 3FZ5A 4N10A 2OE3A 2B5EA 2BMXA 2W94A 1V98A 5ABRA 1WE0A 4OZOA 2AYTA 2GZYA 2E7PA 3ZMKA 1WOUA 2LW8A 1MPXA 3IBHA 2P31A 4FIWA 2L5LA 4MF5A 3UEMA 3DVWA 4PNGA 3VD5A 3H79A 1Z5YE 4FYUA 5H5RA 2VL2A 8GSSA 4ZB8A 2YWNA 2ID4A 2PMTA 3OGRA 1TRWA 3TKQA 3CZJA 2PGTA 2YFZA 4QB2A 3FN9A 1LNSA 2IJYA 2GDRA 2RUEA 5JCGA 2B4KA 4CUBA 2WZ8A 3VD9A 1BJXA 2FD3A 3TJKA 4POBA 1UXXX 2KLXA 4K9ZA 1GH2A 2YJHA 1WPIA 1JU3A 4KWUA 3GKNA 2N5AA 2JSYA 1UY0A 1SD9A 2YJ7A 3VPQA 9GSSA 1J08A 3GURA 1KNGA 4NHWA 3VWXA 3HNMA 1OD3A 1ZL9A 3DYRA 5FT3A 5B4NA 2P0GA 4V2MA 4EC0A 2DCJA 2IIYA 1M99A 2HLSA 4OFNA 4IQ1A 4HJMA 5ID2B 4ML1A 3WQBA 4EDZA 2VJXA 2ZUPA 5J9BA 2HZEA 2V6OA 4TN8A 4NMUA 5IMFA 3ECQA 4BJ0A 2PERA 4YAVA 1XNTA 2WO3A 3BN6A 3CTGA 5FHIA 2YCDA 3BD2A 13GSA 3GX8A 1YY7A 4X0XA 3HY2A 2VTFA 1FVKA 2V2GA 4K8MA 5IPGA 1UYXA 2R7EB 2X10A 1DE1A 2H19A 1WRYA 3I3EA 4DUVA 2GGTA 1GSDA 2VZTA 2QQMA 1G6YA 2W1UA 4K7NA 2H1AA 1PX7A 3RPPA 1RK4A 3DGQA 3MUY1 4YQMA 4HJ2A 4PURA 5J4UA 4IGJA 3GL5A 2CVKA 1TK5B 3I2HA 3M1GA 1GQPA 1US3A 1O81A 1X5CA 3ZRDA 4OO5A 3VI7A 2QC7A 1MDIA 2VCVA 2Y6GA 5JXHA 1W8OA 1TOFA 2REMA 3APQA 1W9SA 2GS3A 1GRXA 2W1SA 3WT2A 1JZWA 4TR0A 2WUHA 3GKKA 3TRXA 10GSA 2Z4FA 3FY7A 4GRFA 4CDOA 2H73A 5JXJA 1JZ8A 2WFCA 3NIVA 3ERWA 2VZ1A 1XIYA 3K75B 4A42A 4GZ9A 4KDUA 1SL1B 3IE3A 2IL3A 1TKDB 4XUQA 4KCAA 1GSFA 2Y64A 3D5JA 3LG6A 4QX1A 5B7CA 4OO4A 4F0BA 2G2QA 1Q4JA 4MZCA 3FZ9A 1THOA 3H8QA 3DKSA 3DYOA 1RQMA 2MYGA 3WGEA 2B3SA 1A2LA 1XWBA 1B9YC 1BYEA 2VLTA 3WSOA 3VD7A 1O7UA 4MP4A 1MDKA 1Z6NA 1J84A 3OEAA 1ERUA 2DSAA 2VO5A 2HZFA 3EYPA 3HVVA 4ZL9A 2L4QA 4POMA 2N5BA 4BL7A 4QX3A 1XBSA 3CSIA 3HJMA 3ZL5A 3EU4A 1JHBA 2Y6HA 3TRPA 1WKYA 1GMMA 3K46A 1ZOFA 4ZB6A 3KEBA 4JEDA 5JR2A 3KMOA 2YN1A 2A4VA 5HQPA 1CZTA 3U5RE 4MADA 2H1DA 2R37A 3EMPA 2C26A 3MBWA 1TU8A 3ZFLA 2CAIA 2W46A 2O7KA 3FR3A 3GH9A 3KP8A 4A44A 4K6XA 2G0FA 3QAWA 1K0CA 2QQIA 3WNLA 2W91A 4HU9A 2M80A 4MZBA 3QCPA 2VCAA 3T0DA 4W8JA 1EOGA 2H0IA 2H71A 4OWYA 4ECCA 2LSTA 4LLRA 2E2MA 2WN3A 4KGIA 4QL9A 1EWXA 2ZEZA 3WNPA 1WMJA 1F4AA 3TGZA 3FW2A 4K2DA 3P1IA 2VC9A 2F3MA 1XWGA 2F9SA 4I6XA 1GOFA 3UIWA 4IBPA 2L59A 2YWIA 3E9JB 2H70A 2LKUA 6GSUA 3WGXA 3IHQA 2PWJA 2FA8A 4L0WA 1KEBA 5DMYA 2VCWA 5DAKA 3LXTA 3P6BA 2IMKA 3GIXA 4JBBA 2VL4A 3T2PA 4OCEA 4XUNA 2VCXA 3GV1A 4BDVB 3GNJA 1YDKA 17GSA 1DUGA 1TRUA 2MZCA 5AIVA 4AF2A 3ZM8A 1JYXA 2IMEA 4KAEA 2CDOA 4AJ8A 1OT5A 5FWGA 6GSVA 5ECPB 2CZ2A 2OKAA 2HZEB 2C9KA 2XQXA 3IAPA 1M2AA 1XW9A 1CZVA 2YC2A 5D9VA 1UMIA 1T8EB 1M9BA 2Y6KA 5F0GA 22GSA 1B48A 1L7QA 4F2IA 3CRUA 5A4VA 2B5YA 4TKYA 4A3ZA 4ARXA 4LQRA 3CBUA 4UI9L 5H5SA 4ZB9A 5IMCA 1WIKA 4OD7A 1UY1A 2V4VA 2JSZA 5HFIA 1XC6A 4BWQA 1K0DA 3A21A 3HPNA 3A7QA 4HDEA 5AN1A 2XPEA 3JCML 1NM3A 4QB1A 3KP9A 1TU7A 2JZRA 4GCIA 1XWKA 3U6VA 1PN9A 3C7OA 2FCHA 1F9MA 3IC4A 4UAPA 3I3DA 1SJIA 2H74A 1PMJX 3J7HA 2B9VA 1FOVA 1ML6A 3M0FA 6GSSA 5IOXA 1JLVA 3HVXA 2CDPA 4IQAA 3MSZA 1W8NA 3GDBA 3IXRA 4D0QA 1AW9A 3IK9A 4TR1A 3EWLA 3GKXA 3GHAA 2J22A 2DJ1A 3AY8A 5DCGA 2ON5A 3Q74A 3K8NA 2HE3A 5EY6A 3FZAA 1OVNA 3WF2A 1OE7A 1DP0A 3ERFA 3VWUA 1NHOA 5G5FA 1C72A 3LEFA 2L6CA 1G7OA 3T2OA 3GXUA 2DC5A 5IMVA 3F2ZA 1JFUA 2I1UA 3GSSA 4ECJA 5GAND 1H4OA 2QGVA 1W4VA 4ZBDA 2VQUA 2C8UA 3LPGA 4G10A 1F2EA 1CIYA 5B6MA 1TK0B 3A2XA 2NDOA 5EJ1B 4RN5A 2V41A 3EINA 1YEPA 4NV2A 3SEPA 3ME7A 2F8AA 3ZIVA 4P5YA 3G7IA 3IOSA 3RDWA 3DMLA 4CUAA 1PX3A 1SJ6A 1TTZA 3LEKA 1GL8A 5LNKe 2X05A 5A1AA 1YF1A 3DWVA 5F7UA 2FWFA 1GTIA 5JWRB 4M4PA 3A2WA 5EL8A 2DJ3A 2O87A 3TCOA 2CA8A 3KXOA 4PQQA 2W95A 2DBCA 3GRXA 4PUAA 1Z3EA 3F6DA 4WF5A 1WWJA 4NHZA 2WYSA 2WB9A 4EXJA 2PU9C 5CRHA 4WF4A 3P2AA 2WULA 2CVBA 2W1QA 4IUGA 3ZTLA 1B4PA 4BVYA 1OAZA 2C4JA 1SK1A 4KW6A 1B9XC 3G9BA 4KE3A 1D7PM 1SG3A 3IAS2 1H75A 3D21A 1K0OA 3RBTA 3QMXA 2VZRA 2WCIA 3ZZXA 3W5MA 2TIRA 1YKCA 5ENUA 5CRWA 1EEJA 2VZSA 1QMVA 3ETPA 2EIRA 3KTBA 1Z7PA 3KIJA 3MDKA 3K4ZA 4EKZA 1ERTA 2VMEA 2QQJA 1YEXA 3EVIA 4A45A 3M9JA 5CZKA 2OJLA 1ZYEA 2VOTA 5DAKB 2WQ8A 2CX3A 4N0VA 4XZUG 2IWTA 3GA4A 1SKSB 5DQSA 3NJVA 3ABZA 4CW9A 2AHEA 3J7Yk 4MGSA 3O6TA 1EP7A 1CX1A 3QFAC 2VR4A 2P5QA 2X8CA 1Q98A 1TRSA 5CRDA 2X8GA 5HFKA 2H1BA 2FGXA 5IM9A 2NVLA 5DJLA 3PINA 4V1Ap 3NJXA 3OEBA 5IIZA 3E3EA 4HZ2A 5CREA 2LJAA 1K3LA 1GSSA 1VGLA 2VLUA 4GSSA 4GTUA 3VLNA 2X64A 5HXMA 1UYYA 3KH7A 4J57E 4TR3A 4TXWA 11GSA 4MDCA 4TTGA 3R2QA 3VDBA 2GZPA 3BJ5A 3RHBA 1A2MA 1JZDA 1X9SB 1U6TA 3D4MA 2B7JA 2GT5A 1AUCA 1YZXA 2PBJA 3H93A 3HA9A 2BBAA 5G1LA 1BEDA 4CU6A 2VLVA 3I2GA 2J23A 5CRGA 2H6ZA 2VQTA 4OMDA 3HNBM 4HQSA 2V5DA 2KHPA 2RUFA 2DJKA 1PKZA 1U88A 2VM1A 3C73A 1GNEA 2WDBA 2R3XA 2GVPA 2H1GA 2ZXQA 4NPBA 1XWCA 1MD3A 3TB2A 3LE0A 4G9HA 1IYHA 2ALBA 3Q18A 5C70A 4RYDA 1R4WA 1O8XA 4IHUA 5IQYA 1I5PA 3KJYA 1SKWB 1AC1A 4K7OA 3EURA 3TKSE 5J3RA 3W6GA 1PL2A 4A41A 2L9LA 4PQHA 5G2ZA 5CO3A 4ZZ5A 3F4SA 1UY4A 1MTCA 4FH8A 4OFTA 3UVHA 3WF1A 4GF0A 4IELA 5IO2A 4BVXA 2HT9A 5KN0A 4I97A 3DXBA 3BBYA 5B8BA 1U3IA 3SBCA 2LV3A 3F8UA 2FNOA 4PUFC 1V2AA 2H0GA 4KSOA 1H6YA 2HRFA 4TR1B 4QDRA 2RIIA 5G04L 2CV4A 1LBKA 4DUWA 2HLEA 5D9XA 1UX7A 5DPNA 1E2YA 1B8XA 1X0RA 1EEMA 3GTUA 1F4HA 4ET7A 3KZQA 2MBSA 3TKSC 2QSIA 2VCTA 4XRDA 1F3BA 4EF0A 5IO0A 5IJRA 1GSQA 3K77A 2ORZA 1FVJA 2DLXA 1T2XA 1QFNA 4LL1B 2JL4A 2RJ2A 1TRVA 4MPGA 2H0HA 3FRCA 2J1EA 2MMNA 4MJCA 2LRTA 1NAEA 1XNAA 2FWHA 1UN2A 3IRAA 3I9V2 2J7MA 1JZOA 4MJAA 4H86A 3CKHA 2HXKA 2YG0A 1JZRA 4DXRA 2W87A 1EGRA 5DALA 3CZUA 4KI5M 3F4RA 2O89A 4HQZA 1W9TA 4ZXGA 2O8VB 4AJ6A 2C0GA 3E0UA 5A4UA 3TKSA 4ZL7A 1KBNA 1YQ2A 18GSA 1F6MC 1X9MB 2HNLA 4K1FA 4CHSA 1JZ5A 4OFMA 1URMA 1UYZA 3FKFA 2WDUA 3OB8A 2L4CA 4XTSA
chains in the Genus database with same CATH superfamily
4D7SA 1OF3A 1K3OA 3CJIC 2O85A 4JKKA 3KHCA 3RVHA 1O85A 3J8F1 4K9SA 4N53A 3H3ZA 5CAXA 5FZMA 4MH3A 2HYXA 4M3CA 3GYKA 5F32A 4OYUA 1FW1A 4GJYA 5CFDA 1E5HA 1GUIA 2WWUA 3TRQA 3AVSA 4PDWB 4OFGA 4R9DA 5FPBA 3KF5A 1YFYA 1P8JA 1A8LA 4XFBA 1N3PA 5DUUA 2DVFA 4A2UA 1NG0A 5DAWA 1S0DA 4CEYA 4KH9A 2WAAA 1RJ7A 4V1PA 4ML6A 4LA2A 2WSVA 2YWMA 3H7JA 2A6WA 1V9WA 2AAWA 1HNAA 4JR4A 2XJUA 3NNJA 4IE7A 4AR2A 1PGW1 1OQDA 3B5LB 1XVWA 4EDYA 3KT7A 1AYM1 1N3QA 3VBRB 1CPNA 1RUH1 1D4M2 2W0XA 5C8WA 1XPVA 4G0KA 2PELA 2R30A 1FO5A 4YFZA 4HG6B 5H9SA 3SMHA 1PA3A 4KUNA 4H55A 3OBTA 2GNTA 1IQDC 5E4WA 1O8SA 3S7IA 5A3LA 5FAXA 4AW7A 3O76A 4DS0A 1LOFA 2OPWA 1OD5A 3CXGA 3OY8A 5A7SA 3JD73 3MGUA 1W8TA 3NZNA 5HR0A 2DBIA 4HFSA 5J98B 3QD9A 3T30A 2CYFA 4YW2A 3GN3A 2YZHA 1ZRCA 1NX9A 3ZXJA 1OXCA 3GTUB 1H1MA 2AUVA 2QKEA 4HONA 2RDQA 3CNAA 3OGSA 4AHYA 4ILFA 3VHOA 4MX3A 4GLTA 1ENRA 4KGGA 5FMOL 1XYPA 3L9JT 4IE5A 5G05L 4NRMA 1G7EA 4ARYA 5F2WA 2Y60A 4JAAA 4GWJA 3VBHB 4XDPA 2X8HA 4IN0A 4TYSA 3NNLA 2VZOA 5EHDA 12GSA 1VRSD 1SYRA 1IPJA 5JOWA 4D6RA 1WJKA 1OPOA 1HN1A 5IVVA 1MVEA 4YQUA 1R7HA 3OUJA 5LBBA 2PN5A 4J2FA 4TN7A 4P9YA 2WZR3 2PLV2 4W65A 3AZVA 5JI9A 4CPBA 3U4SA 3ZREA 1ZBA1 4ZU7A 4X8NA 5A3MA 2P34A 1I9RA 1JZ4A 2BVBA 3TKPA 2E32A 4QPIA 4NV5A 5FDBA 3RZMA 2WWJA 2XONA 2ZAAA 4ZHNA 2PYTA 4LHKA 3UOMA 5FZIA 2VCCA 3FWEA 1UKRA 2QE3A 1CQGA 2N5FA 1W89A 2YGMA 1NA1C 2XJSA 4ZL8A 3F9UA 1E5RA 4COVA 2BNOA 5FP7A 1SENA 16GSA 5IK5A 4W6YA 1YQ1A 4AHXA 4WKWA 5ANNA 2C3QA 3DYMA 4Q4V1 1K3YA 3TDGA 2HWE1 3U4XA 1S0JA 1Y4WA 4OHYA 2GSQA 3O7OA 4LHSA 2BGCA 4BU2A 2ZGSA 1V6KA 3C8XA 2WFF1 1ASJ1 2FQPA 1WWYA 5DUWA 3PVEA 4JHZA 4GQCA 3GM8A 5SV8A 1BXHA 2Y6FA 4PNFA 5ECHB 1ALYA 4NAMA 6GSXA 1MS8A 3M3QA 3AP7A 3FEUA 5EZWA 4IQPA 3VBFB 3N9QA 5L19A 4CA9A 4CEWC 2X5IC 4KL1A 2BGOA 1OLMA 1HIXA 1RUE3 5I8YA 3BOWA 4PGTA 3IPZA 4CDQC 4RFT0 3L9VA 1RMU3 3MIXA 4IXLA 1IS3A 4H7MA 2LM3A 1I9DA 1WCKA 4MF7A 3ZXGA 2LRNA 5CYYA 5CU1A 4GWNA 3NKTA 3LSEA 1XWAA 5LA2A 3KT4A 4MGTA 3H9AA 5AVAA 1UD1A 2E0QA 3I3MA 3EU3A 2VCZA 3TJFA 4CDXB 3VDDC 2TRXA 2M72A 4N7UA 2WNVA 1SZBA 3V0BA 1ZYQB 1WCDJ 4NR1A 3MF9A 3EMXA 5ACA2 3UK9A 5IVFA 5A3OA 3IDEA 3MYXA 3T08A 2BTOT 2UURA 4QU1A 1Z9HA 4IE4A 4BWSA 2WBKA 2DUQA 1OYJA 2L5OA 3SKJE 4K21A 4LK7A 4HKOA 4GWRA 4RS5B 5JCTA 2Q4SA 2XBIA 3KV5A 1N1VA 3GNEA 4EE2A 2GN3A 1QGLA 5K4LA 2LNSA 5CG8A 3D8CA 4I3GA 3ZYHA 3E1F1 4IEPA 5C7GA 4BQ2A 2JD4A 1DGLA 2CZ3A 4L8EA 3D6IA 2ZHLA 1AR82 1PM7A 3WCRA 3IC8A 1FMD2 2I07B 4Q2FA 5IYYA 5FZ6A 1PZ7A 3E5XA 1MS3A 2H75A 1NUKA 3KGLA 4CVUA 2BQPA 5I0RA 1O5LA 1NCQB 4M3CF 4X6RB 3RAZA 4LL4B 2QQOA 1PGTA 2J1SA 3IM0A 1TP9A 2XLGA 4TOPA 3IDBB 1ND3A 4QKDA 4LE4A 3ACIA 4KG8A 5EP9A 2HWD2 2DVAA 2YBKA 3POWA 3SEEA 4I0AA 2ERFA 5A6YA 1JUHA 2EIGA 3GBWA 3J8F3 4RQPA 2FUG2 4M00A 2LUWA 4WM8C 4AEKA 3QAGA 3R0RA 2I3YA 4ZZ8A 1S2EA 3ZVJA 2WNOA 3TOUA 4BA7A 1VB2A 4CCEA 3HIFA 3O0VA 1SCSA 3PVNA 1UIJA 4UYBA 2WGRA 4K1YA 4I2TA 3U78A 5C8CA 3T09A 1ULEA 4ATFA 4IV3A 1HYUA 1S2KA 1A24A 2B7YA 4GSTA 4XBLA 1OKTA 4QX8A 5J41A 4B1MA 4CDUA 4RQRA 1GR3A 4ID0A 3UBKA 2YXSA 2VAFA 4IGOA 1ENXA 3SWLA 2YPMA 3LAGA 4HKWA 3DIEA 4LNVA 3WQ1A 3LSZA 3W8SA 2PVOC 3WNMA 3M3MA 4P9LA 1A34A 3MFCA 2ARXA 5KHHA 3TYJA 5J9CA 1RUH3 2WKKA 2VOCA 3NKGA 14GSA 1QXHA 1OFNA 1J83A 2RM5A 4O9EA 2R6QA 4RR3B 5FZ7A 4BWOA 5ECSA 4XUOA 1OUXA 4TRXA 2R062 4BMEA 2P37A 1CQHA 1CAUA 2KXLA 3LA2A 2ZTNA 1QOTA 4KNDA 5ECOB 2GQKA 5IFPA 4JKMA 5K0UC 2YB7A 3BGAA 2D97A 3WYWA 1LJRA 3IKWA 2H30A 4TW5A 1PX6A 4JC1A 1ERWA 4CCCA 1FHEA 4XTMA 1VRH2 4JQRA 1CD3G 2JDYA 5GM0A 5JSRA 2UU8A 3ERGA 1J3PA 2GLRA 4B4PA 3IT8A 5AISA 4FPHA 4BXSV 1UPSA 3H1MA 4KMQA 3RYPA 2XUEA 1PMHX 3NW4A 2RS52 1SACA 4Q0PA 2IFQB 2VIMA 3NOFA 4EL1A 3S9FA 2L57A 1LJ7A 1DE2A 1W2NA 1T6BX 4IP1A 2RJKA 1ZNPA 1A0FA 3QPMA 4MNNA 3P3NA 3KB5A 3NQHA 2PAEA 5C5UA 2EIQA 1Z7RA 4D6QA 1PO23 4CU7A 3SXWA 1QDCA 4LA1A 1ZGNA 1BK1A 3HCZA 4CYDA 4L9BA 3PIJA 1A8DA 7GSSA 1XW5A 3CSHA 2WNUA 1FB0A 1FYUA 2ZGOA 4CCJA 3PUAA 3BCIA 3LFIA 4LKEA 4DNYA 4MMMA 3V0AB 1JH5A 4H7LA 2YFUA 3NAPC 2F51A 5KWRA 4F0CA 2RM22 1O5UA 1KD7A 3IK7A 2VUJA 4BB3A 1DBYA 2VQ0A 5GZDA 3GHMA 1GULA 3A5IA 1VAVA 3OBAA 3H42B 3UARA 3HN3A 5IK8A 4N9IA 2ZGQA 2CT6A 5F37A 3HXSA 1R1A2 2XUMA 5LCZA 2C80A 5COHA 2XKOA 6GSWA 4YM2A 4QKNA 2X8KA 3O1UA 2LUSA 4NWWA 1G9AA 1TEIA 3L4NA 2MMAA 1C1LA 5CFCB 1Q8VA 1PFOA 5HR3A 1T4ZA 3GHNA 2E53A 1ZA7A 1UXZA 4J56E 2WA4A 4YM1A 4IEYA 2A2RA 5C00A 1VBB2 4CU9A 1OC9B 1PX4A 3VZJA 4N43A 1K12A 3DEMA 2FDFA 5HPOA 3EXUA 2PAKA 3OGJA 6GSYA 3B3QE 2WABA 1OLQA 4O92A 5JIAA 5ACA3 3C3VA 4Q4V3 1ONAA 4I2UA 1GP1A 1X50A 3FMWA 2XHKA 2PN8A 2WFF3 1GOHA 4IJ3A 4F9ZA 4XQWA 2HBTA 4JU5A 1DGRA 2RMU1 3PUHA 3DCQA 5T50A 1CJPA 1SLTA 4PBOA 3A0NA 4GH4B 1UNBA 4XS4B 2BJSA 5G1KA 1LHWA 1WZXA 2TUNA 2GSRA 2ZACA 4AOCA 1FMD3 3FLRA 5DABA 4AG4A 2AJQB 5BPXA 2RE9A 3HOBA 3MWHA 4R4ZA 2W68A 4PIYA 2IVJA 3W8JA 2OQ7A 5C4WB 2PHXA 1YUDA 2XHFA 2AC1A 1PM4A 2TEPA 1VBD2 2WT1A 2XR4A 3C71A 5D8IA 4MO3M 4P02B 1SHWB 3ENRA 4IEVA 4URAA 2NQYA 2OE3A 3QACA 5BNNA 2QQWA 3ZYGA 3W20A 5I93A 2ZABA 1WOUA 3IBHA 2L5LA 4JTNA 5H5RA 2VL2A 4R8HA 3I8TA 3ZFEC 5JPMB 2PMTA 1TRWA 1QMJA 2HWC2 2R0CA 4QB2A 3UKVA 3FN9A 4AEMA 2RUEA 2PHWA 4MGYE 1PZ8A 2QJVA 2FDKA 2GH2A 4WVMB 4L97A 2FD3A 3T3YA 4RD7A 1Z7S2 4WZFA 1VPHA 4YFWA 5I8TA 3TJKA 5C3OA 2KLXA 3MPBA 4YW7A 1PNGA 1JU3A 2N5AA 1UY0A 4HKLA 2YJ7A 3VPQA 1NQJA 1KNGA 3HNMA 1OD3A 2W2IA 1ZL9A 1CAVA 1RJ8A 5H9QA 1GV9A 3TEZA 2IIYA 1M99A 2AACA 5DAXA 2HLSA 1UU5A 4OFNA 1DU3D 5J9BA 2HZEA 1QOSA 1B35C 3RNSA 3F95A 3I59B 1QJEA 3CTGA 5FHIA 4FQZA 3BD2A 13GSA 3HY2A 4BQ1A 5IPGA 1L7LA 4YG0A 1WRYA 2R063 4ASMB 1GSDA 2ES3A 3ZIXA 1W9FA 2W1UA 3B01A 3RPPA 3BPSA 1KFXL 1MZ5A 3CL1A 3MUY1 4YQMA 4HJ2A 5FQ0B 1VP6A 1GZWB 1G86A 4IGJA 4RHV2 1OQ1A 1TK5B 1D4M1 3M1GA 5FUNA 1VRH3 4OO5A 3VI7A 1W8OA 4YKFA 1W9SA 1F5FA 1PK6A 2W1SA 3WT2A 2WUHA 4PF5A 4YYOA 3ZYBA 1MS4A 5IK4A 2WINB 3NIVA 2YGLA 3K75B 4LIVA 4GZ9A 4YGCA 2ZMNA 3IE3A 2IL3A 4KF9A 4QX1A 3PVOA 1Q4JA 2Z42A 3H8QA 3ZFFA 2MYGA 5FLIA 4K1ZA 4HMZA 3WSOA 1Y43B 3O0WA 5FPLA 1MDKA 1TMF2 4WVWA 5I0UA 2A3YA 5DUVA 1AR62 4BZ4A 4ZL9A 4IV1C 1JS9A 4XXAA 2N5BA 2DV9A 3URFA 1JHBA 1RHI3 2ENRA 1FI2A 1TME2 4K6BA 1QEXA 3KEBA 3CJIA 1FOHA 3ZYIB 2ARBA 1DQ4A 3FJSA 4C8DA 4MADA 3FR3A 2BP6A 2G0FA 3QAWA 2QQIA 3WNLA 1CONA 2ZCWA 1DF0A 5FZDA 3AP4A 1LB2A 2RM23 4HPKB 2VCAA 1HX6A 3J7MA 4UBHA 4ECCA 2LSTA 3J4UH 4LLRA 1R1A3 3AXEA 4LEJA 5D1IA 3WNPA 1WMJA 3GZTB 1Y3TA 1F4AA 5ABJA 3HQUA 4K2DA 3NMBA 3R4DB 4AXOA 1DQ5A 3JBG2 4I6XA 1PVC3 2L59A 2YWIA 2H70A 1FAYA 3FFQA 3WGXA 2ZZJA 5KHIA 2PWJA 3N9NA 1XJAA 2FA8A 3WP6A 2VCWA 5DAKA 1CIWA 3LXTA 3LDBA 2WR9A 2OT7A 2KA3A 2XWJB 3AKQA 3T2PA 4YM3A 3GV1A 1W06A 1VBB3 5D8AA 3GNJA 2VY0A 2JENA 5BNQA 2MZCA 3CU7A 3JB4C 3ASIA 1ZZ6A 4YVWB 2A70A 1MR5A 4LBJA 5FYUA 6GSVA 5ECPB 5GLWA 1IS6A 3RZJA 2C9KA 3QBQA 2Y26A 3BODA 1Y9MA 3ZOIA 1T8EB 2MPFA 3S6PA 2XGXA 1B48A 1L7QA 3CRUA 4A3ZA 5IW0A 4LQRA 5H5SA 4Q4Y2 2V4VA 3S7EA 4FSJA 2AH2A 2A73B 4CY8A 1VBC2 1QJZA 4H3WA 2A6VA 3R4SA 5JLVA 4HDEA 5FBZA 1NM3A 2JZRA 4GCIA 4NHMA 2FCHA 4QQHA 2V73A 5FV3A 3IC4A 2ZPXA 4XCBA 2B9VA 1FOVA 4NIDA 1YO8A 1SLBA 1U5YA 4DRVA 3SITA 3VBSB 2A6ZA 1G8WA 1UOFA 3RZZA 3MSZA 1COV1 1W8NA 4BMBA 3IZOA 3BCWA 4FPCA 4TR1A 3EWLA 2J22A 4GA9A 5A6ZA 5DCGA 4JVAA 2EVXA 1LHOA 2FHRA 1QU0A 1NCRB 3VWUA 1NHOA 1BEV2 1C72A 3T2OA 3GXUA 3OOXA 5IMVA 5KXCA 4ZBDA 2VQUA 2C8UA 2YU2A 4NHLA 1D0HA 4LBQD 3ORJA 2DF7A 1TK0B 4QM8A 1MZ6A 4HSJA 1CR7A 2Q8EA 4RN5A 1UO9A 5LY1A 1H8TC 4BL7B 3O5SA 4YVSB 5BY5A 3LWCA 2HWC3 4YZ2A 1NE4A 2XKPA 5IUQA 3IOSA 4CUAA 1PX3A 1TTZA 4U2AA 4OUSA 5LEKA 2X05A 2ET7A 3DWVA 1RUG2 3ZLIA 5AFEA 4K7JA 2O87A 5A33A 3TCOA 3KXOA 2ZGMA 1Z3EA 3F6DA 5DUXA 5A80A 4K40A 1H2LA 3WZ1A 2OIIA 5IWFA 3B69A 2WYSA 5AFBA 2XPJA 5KHKA 2W1QA 3HR9A 2R071 2A7AA 4JV4A 4OCTA 1OAZA 1B9XC 4CDWB 3K48A 5HBAA 1X33A 4CCOA 3IAS2 3W5MA 3GCXA 2TIRA 5LASA 2EIRA 2WS92 1LRHA 3H1YA 3QLQA 2UYAA 1YEXA 5M0TA 2WA3A 3EVIA 1WA6X 2CV6A 2VW0A 1ZYEA 2VOTA 4YW6A 2WQ8A 1S3RA 4PDWA 4XZUG 3WOGA 1SKSB 2Q1FA 5IVYA 4JDOA 4XFIA 4K5SA 5JDBA 2AHEA 3J7Yk 3H1WA 4JCKA 4MGSA 3FFZA 5BNPB 1TRSA 2X8GA 2JG8B 2FGXA 3Q8EA 1S2BA 3PINA 3HBKA 4FPJA 3KT1A 4JRLA 4HZ2A 1K3LA 1LHNA 3VLNA 2RDRA 1O6UA 2R041 4TR3A 2BVVA 11GSA 1PIV2 3VDBA 2YYOA 1U6TA 1ZA4A 1W8WA 3HA9A 2BBAA 5LK5A 5CRGA 4BIOA 2H6ZA 3MLLA 4XIKA 1W8HA 3VBRA 2VU9A 4IEWA 3WT3A 3PLQA 3O1PA 1U88A 3C73A 2R3XA 5LRRA 1HB3A 2GVPA 1UMZA 2XLAA 4HSCX 1XU2A 3ES4A 1POV1 3PTRB 4G9HA 1H2KA 4IHUA 2CAVA 4K2XA 2PFWA 4MXWB 5J3RA 1PL2A 1WD4A 1BJQA 5CO3A 4ZZ5A 4FH8A 4OFTA 3WF1A 1F15A 3LKJA 2ZX3A 2HT9A 5B8BA 2VGDA 3SBCA 1VB4A 2YHJA 4UXAA 4OVEA 4KSOA 2HEVF 2VQAA 3DV8A 1LGNA 2JICA 4B1LA 5G04L 5JSPA 2CV4A 2W39A 4D94A 5DPNA 2GNMA 3GTUA 5T52A 1HLCA 2XQRA 3I3QA 4ET7A 3G6JB 2MBSA 3TKSC 1F3BA 1GSQA 2ARCA 4FP3A 2H0HA 4AQSA 4EWAA 2LRTA 1XNAA 4DXRA 2W87A 4AF9A 2OUJA 3CZUA 5JZGC 3JU9A 1JYIA 3VBHA 1REEA 3VL9A 4HQZA 1LAJA 2D44A 4CCNA 3E0UA 4N53C 3T1LA 4N8MA 1ND2B 2SLIA 1URMA 1UYZA 2XBO3 3FKFA 5CKMA 5CFDC 3AVRA 5I0DA 1L3JA 1S3CA 2AR6A 1QJX2 2LTKA 1GTBA 2JIGA 3H8OA 2V5YA 2CWMA 4CEYC 5C9AB 1SU9A 1YJLA 5F05A 4MABA 3B7MA 1LKNA 3K2OA 3ZMOA 2JDHA 3I3BA 1M9AA 1S0EA 1BQPA 2JU5A 2WSUA 4O5UA 2MNGA 3QFBC 1REDA 4L5OA 3D6EA 1CAXB 2LEGA 1DZQA 2VVFA 2GC3A 1VBC3 1WCQA 5LBEA 1V00A 1XCCA 4Y4RA 1NKGA 3AZZA 4MGQA 4XF1A 1SLAA 3HKRA 5D9TA 2OA7A 1ENQA 4AYUA 1MQTC 3TOTA 3EB7A 4WR5A 3VKOA 2DU1A 1YNAA 1LOFC 3LORA 5K7PA 4FYCA 1C5HA 1BHGA 3DPRB 3TJGA 3N7MA 4MGZE 1GWCA 4F8AA 2WIIB 2FDGA 4CE8A 4AEDB 2V72A 1HJFA 4NAXA 3LD8A 4V2LA 3ISOA 1BEV3 4BK4A 1ENSA 5A6QA 4LBLA 1FG4A 3UT0A 4ZIJA 1QJU3 3O0XA 2WO1A 3HJRA 3B02A 1QXPA 4ITCA 3WUDA 4Z2AA 3VBFA 3UKTA 5FP8A 3TNQA 3HYPA 3AMHA 4NJ4A 4LLOA 4LPLA 5BNOB 5BRTA 2VOWA 3O1MA 4KWJA 5K8SA 3N5OA 1Y6EA 4UT5A 4QXCA 3J7NA 4ACSA 4TR4A 3M4FA 4RGKA 1WW4A 3KF3A 5CG9A 4L8QA 3THCA 2D6KA 3VBOB 4HVOA 3WF0A 4KX4A 2ZAHA 3ACHA 1JXNA 2PTMA 3I2DA 3WG3A 2YPDA 4IGQA 4NROA 3WDXA 1K3IA 3HQRA 1IS5A 3CTFA 4B7KA 3QOUA 1ZZCA 3RYRA 4XEZA 5KXDA 4CDXA 4ECBA 1N47A 3LF7A 1UYPA 5B4XA 4KGQA 1COV3 1SPPB 5IATA 3OG2A 1BQ7A 1AX2A 3AKPA 5GALA 2CVDA 5CKNA 4QPIC 2Y6LA 2DVBA 1M0UA 1HDKA 5EYYA 3ZFGB 4WBRD 5A7QA 2FDJA 3RRDA 3LJRA 2LNTA 3UNPA 2VMCA 5EQUA 4RS5A 4ZXEA 3I97A 1AQVA 5FYVA 2R49A 1GSEA 2IMDA 1IKQA 4O7HA 3DRNA 2RS31 1DQ0A 4WBJA 4XHMA 4INDA 1A8YA 2VTXA 3VWWA 5LBCA 1RYYA 1OVPA 1MS9A 3EO6A 4AI3A 4DXTA 2WRAA 1JZ6A 4Y1XA 4WR4A 2VM9A 2MMOA 3UV9A 4XCSA 5KOWA 4JX0A 1YQ5A 3EQEA 3F63A 1NCQA 1TW9A 3BPZA 4X4JA 5D21A 2WS2A 3LYPA 1EV4A 1U87A 2JKXA 3M3EA 2V1MA 2XBQA 1FATA 2IFRA 2XOMA 3RZHA 4EO3A 5FYIA 2R073 1V58A 4XURA 3AYDA 3VD4A 4LUMA 3LFLA 4DSSB 5DDJ3 3A4UA 1THXA 5A3TA 1HRV3 1V6IA 1CJDA 2YV8A 2YC4A 4LMVA 5FY0A 4YW5A 3FZ4A 4XS1A 2G19A 1EY2A 3P7XA 4KQ7A 3IHGA 4HOJA 1EOHA 5LA1A 3C1SA 2WN2A 3NV4A 3AYEA 2RJLA 1JUIA 3WDVA 5HV0A 1GLQA 3VZMA 4RQXA 1MEKA 3C7EA 2FY6A 5FPUA 4LUKA 3EPTA 4Z1VA 4UF0B 3NNMA 1VE0A 5JOYA 4CP1A 3RZLA 4L0PA 4AI2A 4H14A 5BXXA 1PHMA 2QQLA 1LGBA 2CQ9A 1U0AA 1TK8B 1MS5A 3KGKA 4KA0A 2C4XA 2XPDA 1OE8A 1A3KA 3A3TA 2R043 1SFYA 1GUHA 5FFOC 3E97A 2VZPA 2GSTA 2E7AA 1TI1A 4FBFA 2VL3A 2WNVC 3M2MA 4L5LA 1J1TA 4MA9A 5F39A 4EROA 1FT9A 2H0VA 4QQ7A 4P9GA 3T0AA 4Z2WA 4IEUA 1VF3A 2ZGNA 3BOPA 5IOWA 5FKBA 1PNFA 1QY4A 4R9BA 4RR3A 2ZX2A 1Q3EA 3Q6OA 4QDQA 3KV4A 3LWAA 3CJXA 5IK7A 3WF3A 2D6MA 3O14A 1M4WA 1YQCA 4QPWA 5FZ4A 1YQ6A 1HW5A 4NRQA 4PF1A 1T4YA 5F1RA 5T5PA 1PL1A 1PO12 1O59A 1V40A 3WX5A 1Q8OA 2NLRA 5AVPA 2LJKA 3LIHA 3VV1A 2H66A 5EIYB 3CYNA 4D73B 4RGGA 2P1BA 1J9BA 2DDUA 4MHUA 3UVTA 1OA2A 3ZYFA 1TMF1 2J1UA 5KR7A 3O1OA 4DO0A 1XFLA 4MXVA 2IFQA 1CX4A 1T7PB 4MK3A 4LA3A 3IDVA 4OI1A 4QDSA 4POLA 1SMVA 3SH5A 4DXZA 4QX2A 1GNYA 1RUNA 3DECA 4QB6A 2DCKA 2QQUA 1ND3C 3W21A 4LT5A 1S0IA 3PGTA 2IXHA 4EE0A 5JMOA 4MF6A 4XIHA 4LIUA 1C4RA 4LOTA 2ZHMA 4GMP3 1EV9A 1H9PA 5G30A 4QAWA 1LOCA 1XNKA 4MOAA 2C3TA 3JB8A 3OBRA 4KWKA 4RQPC 1ZZ7A 3RS6A 4LJHA 3BIEA 1AL22 1OKQA 1C8M1 3LIGA 2BRTA 1GZCA 4IS0A 2M46A 3O3TA 1GZ9A 6GSTA 1UOBA 4NUBA 3FBYA 1F5JA 1ZBE2 5C8CC 3V0AA 2ORXA 4IV3C 3DD3A 1M3IA 4PQ1A 3TRSB 5CB7A 3VURA 2ZKLA 1S0FA 4CDUC 5LK7B 5JCUA 1SBDA 5D9WA 1FV2A 1T1VA 4Q5RA 1RUJ1 2R6KA 5HR1A 5D93A 1OVSA 4DIQA 4ES9A 3WW2A 2E9QA 2W5FA 5F9TA 3FR6A 4AL9A 2P5RA 3GYDA 1U3AA 3A23A 5J36A 3PPUA 1M7TA 1ZZBA 4YLZA 2NPBA 3W5NA 5CFCA 2LS6A 1KTEA 3POSA 4C0BA 4QX5A 2LALA 2J1RA 1O8PA 2K18A 4AGSA 3WP4A 4FPEA 1AR71 4KCEA 3M3IA 4JKLA 2ILMA 4QQLA 1OC9A 2CL2A 2K6VA 4BIKA 1C5IA 4ULXA 3UL3A 4MH2A 4IP6A 2C0DA 4UW6A 1WA4A 4XF4A 2G9ZA 1R5PA 4YQVA 2KUCA 2YROA 1O3TA 2D6OX 1W6QB 1VJ2A 5FUPA 3QR6A 2ET1A 2JB4A 5C04A 4EIPA 5FJHA 2RR13 4XRAA 3ZXFA 1X5DA 4ISRA 2EC4A 4JZRA 2WQ4A 4KB3A 1DDLA 1XNBA 1E57A 3UESA 1MD4A 2DMLA 2XDVA 3ZYRA 3NJYA 4O32A 3U37A 1AYN1 4GH4A 4XS4A 2LQOA 2TNFA 2HWF1 3ZXAC 3BTYA 3U0ZA 1SL0B 5AC93 2ZEWA 5DG2A 2GMEA 4HN0A 1BLZA 4Q4X2 4HVQA 5FY8A 1H2NA 3VKLA 2NMOA 1UWWA 1Z0HA 4HK8A 1VAMA 4OUEA 4I30A 1IGOA 5C4WA 3SNMA 4LO8A 3TB0A 1HQLA 5FXVA 2PPTA 1SJZA 4IJIA 3BALA 3FMGA 1XXNA 2QDRA 3IV4A 5FLJA 2FBEA 1J3QA 5J1XA 3I43A 2WNUC 5KN1A 2B1LA 4YNIA 3F3RA 1W8FA 3CMIA 3OD0A 2ZEXA 1FPN1 4USSA 5DG1A 2H8LA 3GBGA 4CCKA 2EXKA 2AENA 1RUG1 4OLLA 1KRIA 2TRCP 4KSMA 4XACA 3FUQA 1OSGA 5DN2A 1AJOA 2EIEA 3RZGA 1ZCPA 3C8EA 1GSUA 2PHFA 3NO8A 3PVBB 3DXUA 4XPVA 4WVMA 3DKQA 3KM5A 1OQEA 1SKRB 1O8WA 1OH4A 3WW4A 1AXKA 1W0NA 5FZAA 3KH9A 1R082 3WV6A 4YWAA 2RS33 4ZY9A 3VWVA 4R9CA 5FR3A 1OKDA 4XMAA 4E8EA 4EN9B 1ERVA 1Y25A 4LMWA 4HZFA 1SK0A 1VF4A 2HRKA 2VBDA 2CX4A 4N43C 4IKHA 3P90A 1IYIA 5KN3A 3TN91 1REFA 2YWOA 1UZYA 3BTAA 4Q29A 4G2EA 3I59A 5FO7B 3TOJA 2JXAA 1AVBA 3WDWA 2H6CA 3O1RA 4E8CA 4GKXA 1PMTA 1WW7A 1NSWA 1OF4A 2VO4A 3VKFC 3KHBA 3US3A 2HEWF 3CBNA 3PR8A 4GAZA 1OA3A 4P9XA 3HHVA 2HSHA 19GSA 5GZCA 3ZIJA 4QL7A 2KR2A 4QX0A 5FQ0A 4Q5FA 1GZWA 3JD72 1OLRA 3L2HA 5ELGA 2K2SA 3V64A 1PO13 1NXMA 1X36A 3CHXA 1DGWX 1CQ9A 3VBUB 4F82A 2R1BA 3FL7A 5DQYA 3FHKA 3LQ7A 5DAQA 2K46A 2BEOA 1JW6A 1SQ4A 2NZ9A 1XOAA 3D3AA 3J7Yb 2DJJA 3M3OA 1NQDA 5EVOA 1JZ7A 3HN1A 2AGSA 1VBE2 1EV11 2NYYA 5FZ0A 1W0OA 1V9U1 3H0OA 2V6KA 2GZZA 3ZDSA 3ME8A 2DVGA 2LS5A 5LCWL 5EXOA 4V1Ag 3EBRA 3NV2A 1F31A 3HNYM 2VD1A 4DEJA 2Q1MA 1GLPA 2C5DA 4CU8A 3KVBA 5ECRB 2WZ9A 4GXLA 1ODMA 5BNNC 4B29A 2EA7A 4Q4W1 4ZBBA 1S1AA 1SD8A 3ZSEA 4E2GA 2VL2C 1AL23 2D7FA 5FZKA 2E26A 5C6CA 3WT1A 2OBIA 2AEZA 1IHMA 2OZJA 2WZR2 4WBBA 4N90A 3MHZA 4ORFA 2MMZA 1E5IA 3PMEA 3LFMA 5I91A 2HWB1 4S2HA 2H6BA 1DBNA 4GMP0 1K5MB 3HMYA 2VVEA 3AYCA 4HPKA 2P31A 1GBGA 4FIWA 1SFPA 3RI9A 3VD5A 4PNGA 4FYUA 2P17A 1RUC3 3MIGA 5FMBA 2OA2A 5JMCA 2JDPA 4ZB8A 2YWNA 2AYHA 3CZJA 3VZKA 2B4KA 1YFUA 1QJX1 4BISA 3AL5A 5FY7A 1Y9QA 1ZZ9A 3ZSLA 4POBA 4K9ZA 2YJHA 1WPIA 3GKNA 2JSYA 1E5SA 2WNEA 4CCLA 1LEDA 3GURA 4NHWA 3IBMA 4HN1A 3ZDVA 5B4NA 2P0GA 4V2MA 4YVWA 5GLTA 4LBNA 2DCJA 2I45A 5A6XA 4HJMA 4ML1A 3AMMA 3WQBA 2Q8CA 3WP5A 2Z79A 2VJXA 2ZUPA 4TN8A 5IVJA 1C8M3 5FO9B 1WCSA 5IMFA 2GN7A 4JGYB 3BN6A 2B9UA 4K8RB 1PK6C 1ULFA 5KXBA 3WDYA 4EWDA 4K8MA 1VALA 2X10A 1DE1A 4LORA 4GWMA 2KM2A 2VZTA 3FUOA 5JOXA 4K7NA 2H1AA 1FOD1 2ZHKA 1W6PB 5J4UA 1PGSA 3VKMA 1FX5A 1RUJ3 1S0CA 3I2HA 3ZFFC 3J7LA 4I2OA 1GQPA 1US3A 1O81A 4GB31 1X5CA 5L36A 3BVCA 3ZRDA 1MDIA 2VCVA 3DL3A 5JXHA 2REMA 1RMU2 3VBSA 4OHXA 1GRXA 2O1QA 10GSA 3WNXA 3FY7A 4OQ9A 2HSMA 1OPMA 5F6LB 4TZDA 2WFCA 2AZ5A 1XIYA 4XFHA 4GQ7A 4KCAA 2Y64A 3LG6A 5F3IA 3R6SA 2G2QA 5FIXA 1NCRA 3FZ9A 3R05A 2ADDA 3DKSA 1HV1A 5JZGA 1RQMA 2B3SA 1A2LA 1B9YC 3WQ0A 3HAGA 5FXZA 1O7UA 4AFDA 1Z6NA 1J84A 3INAA 2A1XA 1ERUA 2DSAA 2VO5A 2HZFA 3G7DA 2O0OA 3LEMA 3EYPA 2L4QA 4POMA 4BL7A 4YVSA 2NMNA 4QX3A 4XF3A 3RI8A 1XBSA 3ZL5A 5FYZA 3TRPA 5LWBA 1LENA 4QGMA 5ABJC 3M3CA 4Y1UA 3VHNA 3PJYA 4WM7B 4ZB6A 4FPOB 5LY2A 4JEDA 1O7FA 5JR2A 1S4CA 2EXHA 1OOPB 2H1DA 3VL8A 1TU8A 3ZFLA 3AXDA 4A44A 1R083 5IVCA 1AYN3 4BE3A 1D2SA 4HU9A 2M80A 5FOJB 4Y33A 3QCPA 1W03A 2Q0AA 3KD4A 3SC7X 5D8AC 2H71A 4OWYA 4XBNA 4MYEA 4CDWA 4OI4A 4KGIA 2RS13 4FQ4A 2ZEZA 1HJGA 3FW2A 3P1IA 1W6OB 2VC9A 3HT2A 2F3MA 2JDUA 1GOFA 3UIWA 2WC2A 2LKUA 1GKBA 6GSUA 1WGPA 5T5OA 1NLRA 4L0WA 2QQVA 1X8MA 2RDNA 2VNRA 1MQTA 4D7YA 3P6BA 2IMKA 4URTA 1FPN3 2VL4A 4BDVB 4YZ5A 5BNPA 17GSA 3I7DA 1DUGA 1TRUA 5FYMA 4JGZC 2JG8A 3J8F2 4AFCA 1DZRA 5DZEA 4KAEA 3S57A 2DKIA 2R0HA 2D6NA 5FWGA 2CZ2A 2OKAA 1ZX5A 3IAPA 1M2AA 5D9VA 2YC2A 22GSA 2FCVA 5EFUA 4F2IA 2B5YA 1VBE3 4XQDA 2ZGTA 2MEV1 4ARXA 1PGL1 5F2SA 5IMCA 1UY1A 3ZPYA 3A21A 2ZGUA 1DLLA 5C3SA 3KP9A 1GWMA 4MXWA 3POFA 3C7OA 3C2UA 2XJRA 4LBMA 1F9MA 4UAPA 1SJIA 2H74A 4Q0QA 1WLCA 5DXDA 1KQRA 3J7HA 2IXJA 6GSSA 1PGW2 3J26N 1JLVA 3HVXA 1RUH2 2CDPA 4IQAA 1W2OA 3D0JA 4HVRA 2PXJA 3IMNA 1WW6A 3IK9A 3GHAA 5KBFA 4DFSA 2HE3A 3T4HB 5FPVA 2RDSA 1OVNA 1DP0A 2YC0A 3POYA 2L6CA 2DC5A 1QJY1 5GAND 2I1UA 4ECJA 1H4OA 1W4VA 5EV7A 1LESA 2G9FA 1CIYA 4J6GA 5B6MA 3A2XA 4EN6B 3SLIA 5FP3A 4NV2A 4QX7A 3H8XA 3WP3A 1RIRA 2F8AA 2ZA9A 3ZIVA 4QPGB 1XSRA 1GWKA 4DQAA 3RDWA 1GL8A 1BVP1 2Q8OA 5C3RA 1SFNA 1EV13 5A1AA 2WL1A 4CUGA 1BZWA 2A6XA 4PQQA 2W95A 2HJIA 1ND2A 1SBFA 3GRXA 4PUAA 4HK9A 4NHZA 2D93A 3P2AA 4PDWC 2WULA 1W28A 1WW5A 1JBCA 4NHXA 1W3VA 4BVYA 2C4JA 5FYBA 3WG1A 1PO22 3G9BA 3PUSA 3FHIB 3KLSA 1H75A 3QMXA 2GAUA 1D2QA 2VNGA 5C9AA 2VZSA 1QMVA 2CAUA 3KTBA 1Z7PA 4EKZA 5JWPA 1YFXA 4QHBA 3OYWB 1W3XA 4DY5A 4A45A 1VBA1 2OJLA 4Q8LA 3BUCA 2HWB3 1ZBA2 1CAXA 2CX3A 4PBPA 3ABZA 1K5JA 1SLIA 3VBRC 5GLVA 3O6TA 3ZSMA 1C28A 5JR7B 2VR4A 2P5QA 2JEMA 1Q98A 1OH3A 1CAWB 4ZU5A 2NVLA 5DJLA 3VZNA 4CZSA 3OEBA 5IIZA 4EYUA 4RFRB 1R093 1GSSA 2VLUA 1UYYA 4CPBD 4OI0A 1UN1A 4J57E 3HVDA 4CP9B 4TXWA 1XU1A 4MDCA 2GZPA 1X9SB 3DPRA 1ZRRA 5GZEA 1O4TA 4CU6A 2VLVA 2J23A 3N9PA 4AEDA 4K8FA 4RSUA 3HNBM 4HQSA 2DJKA 4NIHA 3SHRA 4FAHA 1PKZA 2VM1A 3ILRA 2X29A 2Z2SB 1EAH3 4NHYA 2DFCA 3EMRA 1IYHA 3Q18A 4RYDA 2D43A 2GMMA 3ZN5A 2ZGPA 3SCGA 1I5PA 1SKWB 1AC1A 4A7YA 4K7OA 3EURA 5G2ZA 1BBT1 3F4SA 1UY4A 4Q4V2 2VECA 4K5RA 4IELA 2HWE2 5KN0A 3SH4A 1U3IA 2Q5TA 5BNOA 2VNOA 3F8UA 4PUFC 1V2AA 3WD5A 2H0GA 2WFF2 2A75A 4CP0A 2HRFA 3ELNA 3VZOA 1ASJ2 3THPA 4QDRA 2NN8A 4LLFA 5HCBA 4Y20B 3VBHC 1UZZA 2HLEA 4IESA 1RUD1 2R0FA 3VBOA 4LO7A 1B8XA 1QDOA 4OZXA 4XRDA 1FOD3 4EF0A 5IO0A 3LDRA 1BMV2 5FY9A 4EN7B 2ORZA 1FVJA 1T2XA 1QFNA 5F8PA 2RJ2A 3E6DA 4MPGA 2J1EA 2GSYA 4GB33 1NAEA 2JKBA 4IERA 4X8PA 1LOEA 4EIQA 1GFF2 1RUI1 4KI5M 1SPPA 1ZRFA 1DIWA 2O89A 1XE0A 3VZLA 4YSFA 1AR93 5CBLA 4ZXGA 4AJ6A 2BWCA 4ZL7A 5GKAC 3KCCA 3ZFGA 1F6MC 1X9MB 4C1WA 3RZKA 2HNLA 3FC0A 4K1FA 4CHSA 4DY3A 4Q4X1 2WDUA 1CGPA 4ZBAA 3MLKA 3AM2A 1DSBA 2H6XA 5JXIA 2EIBA 4QU2A 4Y22B 2OVUA 3KCYA 5L7OB 4O65A 1XE8A 2YBPA 2CTVA 5JWOB 4XFAA 1DFQA 4BH9A 3JZVA 3CO2A 3F3QA 1I3HA 2QZ2A 2C9AA 3IWZA 4DEVA 3D0SA 4BM8A 2B5XA 4XFFA 4Z7XA 2RVAA 1PD21 3TNPB 2XXZA 1DQ6A 4FPYA 2A4HA 1JZ2A 3UJ1A 3DUIA 2YZUA 5E59A 2NP0A 1QQP1 4X43A 3CMGA 2EXJA 3KD0A 3A5WA 3HD8B 4PI2A 3I69A 3ZYWA 4L99A 4DSSA 1DZTA 1UOGA 2DJ0A 3ZIWA 4RUVA 5INYA 1HD2A 3FR9A 2JZTA 1IG0A 2OW4A 3O1VA 2XMLA 3WNKA 5JSOA 5KHJA 2KOKA 2OBKA 2PVQA 1TI3A 1AYM3 3TBDA 3VBFC 3G7YA 2E7QA 1YYNA 3ACLA 1XOYA 1GU3A 1VRBA 5CIRA 5D2AA 3UGGA 4A7ZA 1F37A 2B1KA 3K4AA 1T3BA 4UF0A 1HXS1 1DYKA 3RJ2X 1FB6A 2VCQA 3APOA 2OE1A 2LQQA 3T2TA 3Q9OA 2IXCA 1SK2A 4CUCA 4AEJA 5J09A 1JYWA 1TDIA 3HZ4A 2YV7A 4Q0VA 1LU4A 1A0RP 5FXXA 3OR5A 4ZPIA 2A5ZA 1YWKA 5IPHA 3GMFA 3C7HA 1DLCA 2WFPA 1AJKA 4CDXC 3GUSA 1NZIA 3JXSA 1N2AA 5E1RA 3AFKA 1KDMA 2ZGKA 2MEV3 2XH6A 4DXSA 4FO5A 1PVXA 1ULOA 4QKFA 1GTUA 1QOOA 4MGIE 3IN9A 3ZVJD 2D3PA 3LQCA 5FJKA 1PZ9A 1W05A 5FZCA 3MNGA 4NN0A 3TJBA 2F4PA 4HANA 5G5EA 1UKGA 2B5HA 2RG4A 3VB9A 3NV3A 2JZSA 1V57A 4RS5C 3WF4A 4W6XA 2DTWA 2OACA 3CQFA 4G19A 4HEA2 3VLBB 3PJQA 4ISDA 4O5QA 4AI0A 3H8RA 1RHI2 4EJRA 3NRUA 4D8MA 3N9JA 1TQ5A 4D73A 1CZSA 1XZOA 2BOIA 3N7KA 2BW8A 3I2IA 3BOAA 1MEC1 3IAM2 1ZBA3 5DJMA 4QXKA 3WNOA 4JDMA 1NCQC 4E8HA 1GUMA 2CNAA 2W92A 5ECNB 1QJY3 2X09A 4AI1A 4AVTA 2HRNA 2I9HA 3CSJA 1GQHA 1G0TA 4EV0A 3N36A 3U07A 2JG9B 1K0AA 2EAKA 3K4DA 3HBZA 1KITA 1A2JA 1G6WA 2HSYA 3A2VA 1ULCA 4JR6A 2IMIA 1NY71 1PVC2 4HI7A 1RGSA 1H8VA 3QD6A 5H5QA 4LBKA 5DVBA 1IPSA 3KMNA 4I8BA 4M0HA 2GQMA 2A3XA 1BCXA 1O3QA 4YAPA 1NW2A 5GZFA 3PTYA 4HZ4A 2EF6A 3CJIB 1OA4A 2EIDA 1XG8A 4MUVA 5ECQB 2ZCTA 1QWRA 3KGZA 3MICA 1YI9A 1HQOA 5F5QA 1ILOA 3VFIA 2E2GA 2HWE3 4CXWA 3N4MA 1HRI1 2DCTA 1RVF1 4PXOA 1PSQA 1ASJ3 3LGRA 3VI5A 5L9BA 1MZEA 4KBBA 4CCMA 2OX0A 2OADA 2D6LX 2BV4A 2UY8A 2GC2A 1VBA3 4O5RA 4CXYA 3O1SA 1BG5A 2BNNA 3PDQA 1FAAA 2AB6A 3KTLA 3C7GA 4HT1T 4O7XA 4LBQB 20GSA 3MV01 5JPNB 4DPNA 5IMAA 2XG3A 4AAXA 4R52A 1VF1A 4LULA 3H1NA 1Q56A 4FXGB 2HI7A 3H3LA 2ZMKA 4RR3C 4LHNA 2VTXJ 5CADA 2RV9A 4Z82A 5JI7A 4UBGA 3AP6A 1AXDA 2OYZA 3C1RA 1S3DA 3ROUA 2WQZC 4AI8A 1R5AA 1ULDA 1R64A 5F07A 4BK5A 5F5CA 2LJRA 2FLSA 4SBVA 4A4AA 1W6QA 2R2JA 2B6MA 1RUE1 4DVCA 1PRXA 2FWGA 3K51A 1DCSA 4I0BA 1M2BA 1RMU1 4P5HA 4L0UA 1J0FA 3HEIA 1RUF1 1SEFA 5A3NA 4NWVA 1YF0A 1I5GA 1ON4A 3ZMLA 2N7GA 1ZYPA 5DDLA 2GNBA 5G31A 2JADA 3K3NA 3N9LA 3AZYA 2Y33A 2WRTA 2VUPA 2BWAA 4QQOA 2R0PA 4DINB 2XJQA 3LOBA 4IE6A 4Y3OA 2QQNA 5HFGA 4Z2UA 2RMU2 5HXVA 1RUD3 5KEJA 4DEQA 1BX9A 2VOKA 3QOPA 4PLOA 2JB8A 1X9TA 4IL7A 2LROA 5LA0A 2R5GA 4MHRA 3F6FA 4IW9A 1QF3A 1GNWA 1S3AA 4AAPA 3ZYJB 2BZDA 1K0NA 1G6NA 1TVGA 1XYNA 3WW3A 2H72A 4AK3A 4OHZA 4GXZA 2QTWB 2ADEA 4FI9A 1RUI3 4G4FA 3AJYA 3ZXLA 3F4TA 3LSDA 3JQWA 4ZU4A 3BB6A 5F8BA 3LOIA 2IN3A 3ZFBA 5ECIB 2BUKA 1H9WA 1Z6MA 3BKZA 4YW4A 3ZVXA 2VZ3A 2VOXA 3KCMA 2K8SA 3I2KA 4CSWA 1KDKA 2TBVA 5L9VA 1XB9A 4AI9A 1U5XA 1U12A 3WDTA 1F3AA 2JACA 4AGVA 4RGAA 2H6YA 1QGVA 5CFCC 3L9UA 5ECKB 5LD0A 3HZ8A 1RW1A 2KD7A 4XHXA 5IT6A 2VW1A 3GJBA 2CHHA 3IB3A 1O91A 4Z8BA 2JE7A 2PHTA 4R4XA 2D3SA 5B2GB 5FOBB 4MJBA 1NA1B 5HI0A 2E63A 5T5LA 1LU1A 3RHCA 1SL2B 4CTEA 2YY1A 3OGVA 5JCWA 1QQP3 2VD7A 2YMZA 3I6AA 1WMFA 4UW3A 1IOAA 3MIHA 3RGBA 4HBNA 1WUVA 2J1TA 2DIYA 1J59A 2D2ZA 5CNWA 3OF1A 1D4VB 4Z2TA 4GH4C 1QH6A 3KZ4C 3UGFA 3GKMA 3VBUA 1NT0A 5J3UA 1WP0A 2EICA 2VCBA 1UX6A 4QPYA 4BLJA 3AK0A 3LEIA 2H01A 3HWJA 2BOJA 3HVNA 1LHVA 1X5EA 1HXS3 1FNZA 2VD0A 3OJBA 2R1DA 4IW3A 5GZGA 1T00A 2VAUA 5C4WC 1YXWA 2VW2A 3T0BA 4Q26A 4I5QA 4XILA 5T5JA 1OC3A 1USBA 4WEYA 4CEWB 2X5IB 3LYKA 5C5TA 1K0MA 2PLV1 3UBLA 3MW3A 3W58A 3HJPA 4CDQB 3MDPA 4META 2FMYA 1JI6A 4K0GA 1UA5A 5CKQA 4WETA 3M8LA 2VPVA 4DOUA 2ZX0A 2GDFA 2GTUA 1QJFA 4FFIA 5F5AA 4E8DA 3V65A 5ERLA 1JYNA 4UFIA 2K0GA 3U10A 2XBO2 5FZFA 4QQ2A 2W52A 1NHYA 4IVFA 4COUA 3QCWA 5DQ0A 3ON7A 2QBXA 1B09A 2DIZA 3VDDB 3MW2A 2A2SA 1K5MA 1UMHA 3SISA 4P3YB 5B6NA 1UY2A 2B45X 2NTOA 1H1AA 1U5IA 2PQQA 2WO2A 3ZN6B 2VZQA 5AIXA 1D0GA 4BCUA 1HNBA 3ST7A 2QQKA 1NZCA 4TXOB 2QUOA 4XABA 1MEC3 3MF6A 4N30A 3GZUC 4MSVA 4JGZA 5FY4A 1BYHA 1PO21 5I0SA 5H9PA 2AREA 4G0IA 2GSSA 2P3YA 3BYWA 4IETA 1XNCA 5A70A 1QUWA 3KSCA 4PLNA 3D22A 4CY6A 1SDDB 2GT6A 1UZWA 3ITQA 2WJUA 4JDNA 4XC9A 2J1AA 3TAYA 2C0ZA 2UWBA 3VPTA 1N1SA 5KHGA 2VZUA 2UWCA 4N11A 2GP5A 4Q0SA 2C3NA 3Q8CA 4MJEA 4RI6A 2JDAA 4IGPA 1UZ0A 1AAZA 2VMFA 1DGWA 4MZWA 4JGYA 4E4ZA 5FZOB 2YV9A 2BFUS 1PN0A 2VXRA 1NYWA 4F83A 1ABAA 3DEXA 1S0GA 5CEHA 4WXTA 1VMFA 5E89A 4YPJA 4OMCA 1YKAA 1QJU2 2JDNA 1UC7A 3BU0A 2ZX4A 3BTZA 4XUPA 1IS4A 4WM8B 1K45A 1W6PA 1QK8A 1HRI3 2B8MA 3MIFA 3E6BA 2NBSA 1RVF3 3GF6A 2VM2A 3G7JA 4PJYA 1OMIA 1GNHA 4TWTA 1R26A 3RMYA 1GICA 1N8JA 2R32A 2L6DA 3WG4A 1JZ3A 4D7TA 2V09A 4XW3A 5IFTA 5A7WA 2RMU3 2ZGLA 1GTAA 2QVSB 4TVEA 4MCUA 2BBVA 2WYFA 2K8VA 3F0IA 5ACA1 3GH6A 4S2GA 1H6XA 3OGGA 4S2FA 4FFFA 1FXZA 5FP9A 3RPQA 3P3PA 3GL3A 1X7NA 4W50A 3C7FA 2K9FA 4V2NA 1LULA 3ZX7A 1K42A 3MPPG 3MW4A 1COV2 2BERA 3I2FA 3E6CC 4CXXA 4PQIA 1OBNA 2GH8A 2IMFA 1BMV1 3MIDA 2OZ6A 2CAQA 5I8SA 1N1TA 1W9YA 1AR81 2IPAA 1ZMAA 1FMD1 1EZKA 5FZBA 4AGGA 4WM7A 3VN4A 3CQOA 4ECIA 4ZILA 1TNFA 3WD6A 1OOPA 1RUF3 2PHLA 4IEZA 4M4RA 1LTEA 3GGLA 3FZ5A 5K0UB 2FCUA 2B5EA 3W59A 2BMXA 2W94A 5ABRA 4PI0A 4LXLA 2AYTA 2BDRA 1STMA 2GZYA 2LW8A 1QIQA 1ACCA 4MF5A 3Q8BA 3UEMA 3DVWA 4YGEA 5E16A 2HWD1 2ZOEB 1TNRA 4NAOA 8GSSA 2A6YA 4DZGA 3GALA 3VUOA 2ID4A 3OGRA 1W6OA 1FV3A 3TKQA 2YFZA 4YVWC 1ZVFA 2IJYA 2GDRA 2WZ8A 1BJXA 1ULGA 2GC0A 4FTBA 4OHWA 2R072 2WLPA 3VHPA 4AQTA 5FCCA 1UF2C 4P9IA 1UXXX 2E51A 5DDJ2 4KWUA 4XHBA 1HRV2 4FPGA 2CWSA 9GSSA 1J08A 3LZZA 4YG3A 3VWXA 2VVDA 4Q27A 4WV8A 4IQ1A 5ID2B 4EDZA 3AP5A 2V6OA 4NMUA 1YIFA 3ECQA 4BJ0A 4MV2A 2WO3A 3VBSC 4UFKA 2YCDA 1LHUA 4AVVA 2VTFA 5A32B 1FVKA 2VUAA 2R7EB 4YZ1A 3NAPB 2ZHNA 1D4M3 3I3EA 4DUVA 2GGTA 1KJRA 4KWLA 2GP3A 2QQMA 3W9AA 1RK4A 2R042 1NCRC 3GL5A 2R061 4O9GA 2IXIA 3M7AA 2DCYA 2QC7A 2Y6GA 4OULA 4P14A 1TOFA 1WLTA 4XYXA 4EZHA 3GKKA 1EYBA 3TRXA 4CDOA 5JXJA 1JZ8A 1C8NA 2D5FA 4BXFA 2VZ1A 3MI8A 4YVSC 4A42A 4ZONA 1VRH1 5T54A 1SL1B 1H30A 3AFGA 2BNMA 1G7YA 4XUQA 1GSFA 1JOBA 3D5JA 4XOGA 5B7CA 4MZCA 5DAPA 1V6NA 2RS51 3DYOA 3WGEA 5FPAA 2ZZQA 3WLUA 2JX9A 1BYEA 4MP4A 4E2QA 3GJAA 4DMIA 2GMPA 1HV0A 2VNVA 3HVVA 3WCSA 2JDZA 3IPVB 3NWKA 4CDWC 3CSIA 4QPGA 2QCSB 1WKYA 5A7PA 4QGLA 4GD4A 3KMOA 5HQPA 3U5RE 2C26A 3ZKUA 2CAIA 2O7KA 3GH9A 3KP8A 4K6XA 1RHI1 5FREA 1K0CA 3USUB 2W91A 5IAXA 2PLV3 3DKWA 5EPAA 3T0DA 3GBFA 5FZ1A 2F6BA 3N3HA 5BNPC 2H0IA 1HQNA 2WN3A 4NPLA 2JG8C 4QL9A 1EWXA 2XB6C 2EXIA 4ES8A 2RM21 1AXZA 3AZXA 3D5OA 1VAKA 3LW9A 1MS1A 2PMWB 4R9AA 3SCFA 4IBPA 3E9JB 4E27A 1R1A1 3OYWA 1JOJA 1W04A 1PVC1 3GIXA 1IKPA 4G3YC 4XUNA 2VCXA 1VMJA 5DZFA 1YDKA 5AIVA 4AF2A 3WG2A 4UFMA 1CAWA 4FOWA 1JYXA 4LE3A 3ZFEB 4EZ4A 2IXLA 4AJ8A 1VBB1 1A6CA 4WVZA 4CP9A 5E88A 2XQXA 1GZTA 2JIJA 2Y6KA 5F0GA 3DN7A 1GSLA 4TKYA 2MHFA 4CCDA 3CBUA 1GWLA 2JSZA 5LATA 1K0DA 4QD2A 4A5PA 2CY6A 1AUYA 4XJZA 2JE9A 3HPNA 3A7QA 1YEWA 4QB1A 4DB5A 3U6VA 1URXA 3ZMNA 4XXPA 1B35B 5FTTC 2DFBA 3I3DA 1PMJX 3APBA 4P9WA 1ML6A 3M0FA 2LRPA 2CU5A 1RB8G 1UIKA 4D0QA 5BV6A 1AW9A 3GKXA 4Y20A 2DJ1A 3AY8A 2RR12 3FE5A 3Q74A 3K8NA 5EY6A 3FZAA 4N7IA 4PCRA 1VBD1 3LEFA 4OQ8A 1G7OA 1RINA 4XQ4A 5IVBA 4MG2A 2QGVA 1ND2C 2E6VA 5AC92 1C57A 5FYYA 2NDOA 5APAA 4ASLA 2VMIA 4LO4B 2V41A 1YEPA 3V56A 3ME7A 2JDKA 3DMLA 4XJAA 5C9AC 2FWFA 1GTIA 2HWC1 2CA8A 1NLSA 2CSGA 4WF5A 5J37A 4A6SA 1WWJA 3OPWA 2VULA 2PU9C 5CRHA 4WF4A 4YKGA 2CVBA 1Z7S1 2IXKA 4F7ZA 4OI2A 3ZTLA 5HV4A 1W39A 3OSDA 4IV1B 2K9ZA 2X4AA 3CF6E 4KW6A 4Y22A 2YU1A 2D3RA 4KE3A 5L7OA 2ATFA 1SG3A 3RBTA 1K0OA 2VZRA 2WCIA 3ZZXA 4B8EA 1WLWA 1AR83 1YKCA 5CRWA 1EEJA 4XDOA 5A1FA 3ETPA 2PHDA 3MDKA 4YARA 3K4ZA 2YZ4A 1ERTA 1UU4A 4GJZA 2QQJA 2PA7A 2XL7A 3DPRC 2ZMLA 4NPMA 4N0VA 5F3CA 5DQSA 3NJVA 4AEDC 2RS32 3DGTA 4CW9A 5BMUA 2Q1ZB 3QH6A 1EP7A 2XVKA 4E2SA 1CX1A 3QFAC 2X8CA 3POIA 1M3JA 4PQ9A 5IM9A 1GP4A 2HWD3 4V1Ap 1F9KA 2EAAA 2HKXA 4BA6A 3QH7A 2LJAA 4GTUA 1VGLA 4ZS2A 4UFLA 4XF0A 4PIZA 3VKNA 4RHV1 3R2QA 1OUSA 3BJ5A 4NMIA 1A2MA 1JZDA 1A78A 3D4MA 1EP0A 2B7JA 1AUCA 1YZXA 5BNOC 4NOTA 4QXHA 1POV3 4OMDA 1YFWA 1I5ZA 4LKDA 1NLQA 1DQ2A 3VGIA 1WD3A 3TWIA 2H1GA 2QNKA 2ZXQA 4NPBA 2Y0OA 1XWCA 3VBOC 1MD3A 1JMUB 3LE0A 3AB0A 4JTOA 2ALBA 5IQYA 1TE1B 4EN0A 3TKSE 4IEOA 2L9LA 1AZDA 5JVVA 1OKOA 4L2NA 2VBBA 1Q43A 3UVHA 1QNYA 5IO2A 5EJ3A 2XVLA 4I97A 5FZ3A 2FNOA 2G9GA 2JECA 1H6YA 3WHUA 1XYOA 4OUMA 3U75A 1AR61 1G9DA 3POEA 1YLLA 2RIIA 2C6SA 4Q5OA 1CN1A 1LBKA 4DUWA 4FP2A 1O3SA 5D9XA 1UX7A 1X0RA 1E2YA 1A8MA 1W6NB 1EEMA 1BVVA 1UL9A 3ZO0B 1TME1 2VCTA 3ZFGC 5IJRA 5FP4A 3K77A 4M3CE 2DU0A 1U5ZA 2DLXA 4JRAA 2JL4A 2FWHA 1F8VA 1GP6A 4J1WA 1JZOA 3BIWE 4D6SA 4BQ5A 4H86A 4MJAA 1QXRA 2HXKA 2YG0A 3NVCA 3OUHA 1HB4A 4ATEA 2D6PA 2JDMA 2P4EA 2I2SA 1Y9GA 2BYVE 3FBMA 1W9T