5CYYA

Structure of the c-terminal domains of dipz from mycobacterium tuberculosis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
333
structure length
333
Chain Sequence
b'TGTEIREQLNLGGIVNAQNAQLSNCSDGAAQLESCGTAPDLKGITGWLNTPGNKPIDLKSLRGKVVLIDFWAYSCINCQRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAKGAANLGISYPIALDNNYATWTNYRNRYWPAEYLIDATGTVRHIKFGEGDYNVTETLVRQLLNDAKPGVKLPQPSSTTTPDLTPRAALTPETYFGVGKVVNYGGGGAYDEGSAVFDYPPSLAANSFALRGRWALDYQGATSDGNDAAIKLNYHAKDVYIVVGGTGTLTVVRDGKPATLPISGPPTTHQVVAGYRLASETLEVRPSKGLQVFSFTYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein DipZ
publication title Structure of the ectodomain of the electron transporter Rv2874 from Mycobacterium tuberculosis reveals a thioredoxin-like domain combined with a carbohydrate-binding module.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Membrane protein
total genus 91
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF17991 Thioredoxin_10 Thioredoxin like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5cyyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5cyyA01
1XVQA 5HFGA 4IGJA 2YC2A 4OD7A 4PUFC 1CIYA 4HS1A 4E8EA 4Q5NA 3U37A 1XW6A 3QPMA 3RAZA 1Z7PA 2EIOA 1AC1A 1J9BA 3QAWA 2J1VA 2H74A 3T08A 1X5EA 1Y25A 5CRGA 4ZB8A 3VI5A 2TRCP 2X64A 3O3TA 1W99A 4KI5M 2K8VA 2R4VA 1UN2A 5AISA 2WULA 2H8LA 4FI9A 3JCML 5LA0A 1SD8A 2X05A 5CZKA 3KXOA 3VD5A 4HU9A 3D3AA 2GQMA 2VZOA 1WJKA 2KUCA 4D73B 2C0GA 4WXTA 2H30A 4FYUA 1ERTA 3LGCA 1WRYA 1E2YA 2FA4A 4NHZA 3OGSA 4QDSA 2YN1A 2LRCA 4HJMA 5DCHA 2CDOA 1TW9A 4PT6A 5IO0A 1PKZA 2PQSA 2I81A 3UIWA 3LE0A 5ECIB 4A44A 2LV3A 4KCEA 1FB0A 3HZ8A 2V2GA 3T0AA 3IK9A 3HOBA 3PUHA 3ZRDA 3ERFA 4OCFA 3QFBC 5J1XA 2K6VA 2WAAA 3HHVA 2E7PA 2W91A 1FAAA 4XUPA 2VCVA 4IQ1A 3BN6A 1JLVA 2KLXA 1OC3A 5D73A 3KM6A 2YFZA 5EVOA 1A24A 5JCUA 4K9ZA 4MO3M 4G2EA 2K8SA 2QQMA 4ARYA 2PU9C 3KZQA 5DVBA 2VMFA 4AJ7A 4MZBA 3F4SA 1CZSA 3J7HA 4XRDA 2QQOA 1YKCA 2L4CA 1TRWA 2ID4A 3EMPA 4ZY9A 1T8EB 3O76A 1ZOFA 2H0HA 1NHOA 2V4VA 3GM8A 5ENUA 1JYWA 3F8UA 1JZWA 4KB3A 3CRUA 2IMIA 4O32A 2BBAA 3K4DA 3GNJA 2RM6A 5L71A 3OGRA 2VMCA 2BTOT 2XPEA 3I3BA 4ISDA 1PN9A 1GSQA 1I5PA 3DRNA 3GMFA 3WNMA 1HNBA 1PMHX 1WMJA 2P31A 4ZBDA 2L5LA 1XBSA 4POBA 4KMQA 5HXMA 2B7JA 1EV4A 3D6IA 2VL2A 1PX4A 4JZQA 1ST9A 4OFNA 2YZHA 3WSOA 4CUBA 3WNLA 3LYPA 4ZB9A 3SKVA 1KTEA 3APSA 3EVIA 5HFKA 1EEJA 3I2JA 2V72A 1GTIA 3D21A 3C1RA 2FY6A 4TR3A 3C8EA 2WO1A 1UY4A 4MZCA 4XURA 4KW6A 1K3YA 1A23A 3G7JA 3TKRA 5GAPD 1WP0A 2C3TA 2VCZA 2FLSA 1SU9A 1OKTA 4N30A 1XWAA 3FN9A 2DLXA 2H01A 10GSA 3H1NA 4QL7A 4OYUA 2AUVA 4ECCA 4JX0A 3ERGA 3FW2A 4TR1B 1QK8A 1TRUA 13GSA 2X99A 1M2AA 5G2ZA 1U87A 1DE1A 4XS6A 4YAPA 2FWGA 4HI7A 5D9VA 4XUTA 2W1UA 5ID2B 2BGPA 4EC0A 4QPWA 5INYA 2AV4A 3ZMKA 1FVKA 1K3OA 4POLA 4JR4A 1OD3A 1ERWA 1I9DA 3VDCA 5DPNA 1V9WA 1FO5A 1M99A 1DLCA 2CVKA 1CZVA 2DJKA 2PPTA 1AQXA 1G7EA 3IAS2 1ZZYA 2GDRA 3LEFA 1EOHA 2VCQA 1TK8B 2IJYA 3VWVA 3FY7A 2KOKA 2XOMA 3GRXA 3ECQA 1UVZA 3EYTA 1TI3A 3FK8A 3H79A 2Z4FA 3CTFA 3IPZA 1NM3A 4PF1A 4IJIA 2VCXA 3TRXA 1JI6A 3DVWA 1TG7A 3TJKA 2C3NA 2B1LA 2IFQA 2WS2A 1E6BA 2RVAA 4WBRD 1JFUA 2HRNA 4MGSA 2H66A 1YY7A 3T09A 4O92A 4MPGA 1UY2A 5DJMA 12GSA 3A22A 2VD0A 1QUWA 4IN0A 3DXBA 5KN0A 3I43A 2HZEA 2H1DA 1L7QA 1K0BA 3BBYA 4V1Ap 3WF0A 4IELA 1F3BA 2FHEA 4DEJA 4XS4A 2O7KA 1Z3EA 1PMJX 1FW1A 2J1EA 2G2QA 3MUZ1 2OBKA 4HEA2 16GSA 3QAVA 4JE1A 1EOGA 4XUQA 1GSFA 5LCZA 1K0DA 5IMZA 4QL9A 2YCDA 2OADA 3HNYM 1HNCA 1V57A 1F37A 4ZILA 3TKSE 3DMLA 4PGTA 1AXDA 1GSEA 3SBCA 3IHQA 1FOVA 1TOFA 1LNSA 2J22A 4I97A 4MZWA 3K4AA 4RYDA 1ACVA 2WN3A 3C1SA 2QQIA 4GZ9A 3LEGA 3F4TA 3E1F1 4YAVA 3K4ZA 5B4NA 3FL7A 4OMCA 3ACHA 1VF3A 5LA1A 1R7HA 1XW5A 3KH7A 2F9SA 5IFPA 2F8FA 2B5XA 2O87A 1UX7A 2W9XA 2A4VA 4K7OA 4W8JA 1FG4A 1O73A 1AQWA 2BZDA 2ZNMA 3NJVA 1UA5A 4BXSV 1MDKA 1F4HA 1B4PA 3KP8A 3TKSA 1ZCPA 5A4UA 1XC6A 3RHBA 5B4XA 4N10A 2LS5A 3I9V2 2K18A 3UARA 2ON7A 3HCZA 2RLIA 3MDKA 4PQQA 2JD9A 1YZXA 2QQJA 1W8OA 1JU3A 4XZUG 3UEMA 1OC9B 1V2AA 1VGLA 1K42A 2IMDA 4EO3A 1ERVA 1K0OA 2H70A 3LWAA 4DEQA 5KN2A 4JRRA 3UVHA 2JZSA 1K3IA 3ZFBA 1O59A 4IHUA 4NAXA 3C73A 3DIEA 3TOTA 3UL3A 3RDWA 3VWUA 3GIXA 1R26A 3CKHA 1UYXA 2EIDA 4QX3A 2WRTA 2OE0A 1JLWA 5HR0A 4O5RA 2H19A 3C7OA 2O89A 1AIUA 4ZXGA 1OE7A 3L78A 3CIHA 4I2TA 4GSNA 3IDVA 6GSVA 2E33A 1BAYA 1GH2A 4GWIA 4N0ZA 1GNWA 2JZRA 4FH8A 4LL1B 4WF4A 1W9TA 5HQPA 3QOUA 4RQXA 2OE1A 2B4KA 4GXZA 3V1WA 4CU8A 3DEXA 4ILFA 1O8WA 3ZIJA 3GN3A 1EUTA 4E8HA 3QR6A 4UOJA 3HYPA 3ZYWA 4XCSA 1Q98A 3WT2A 2CDPA 1SYRA 3MWHA 1UY3A 4BDVB 2A2SA 3T2QA 1R4WA 3CSIA 3WYWA 1O85A 5I0DA 4CU6A 1WIKA 2OE3A 4MDCA 3HVXA 4L0WA 4BJ0A 2I1UA 1SL1B 1MTCA 4OFMA 5E59A 3UNPA 1JZOA 2ES7A 2CT6A 2WQ8A 3T2OA 2C26A 2VZRA 3TRPA 1XCCA 5AIXA 1MDIA 3W6GA 2VM2A 4WKWA 2C8UA 1J0FA 3SKJE 3F2ZA 5JWRB 5IJRA 5FHIA 1RK4A 3M9JA 4OZOA 4NPBA 5IMDA 3VFIA 4CW9A 4GRFA 4X43A 1GSYA 2JSYA 3Q74A 1GLPA 1PA3A 4WR4A 4LL4B 3FR9A 2HI7A 4ML6A 2F3MA 4FYCA 1X9SB 1Z6MA 3ISOA 1GMMA 3CMGA 2WN2A 3UJ1A 2IMKA 1S3CA 3IV4A 4V2NA 2YNXA 3HD5A 4JKKA 3OGVA 3GA4A 1IYIA 2YANA 4EE0A 6GSUA 4F82A 4F2IA 3J7Yk 2HFDA 4WR5A 2JSZA 1URMA 1DUGA 5F7UA 5G1LA 3GURA 1DSBA 5D9TA 3KH9A 4D73A 1SK0A 2ZXQA 2R3XA 1G6YA 1ZL9A 4NHWA 1HQOA 2XHFA 4MLYA 1SL0B 3CZUA 1EGOA 1SJIA 2CVBA 1RW1A 4EVMA 1BQ7A 3W8JA 2WZEA 1VF1A 4XIHA 1W9WA 2H71A 4WBJA 4BK5A 4TW5A 4DXTA 4N0VA 1HN1A 1Z5YE 3P7XA 3M1GA 3ME7A 3HNMA 2N5AA 2X10A 5DDLA 1SKWB 1A0RP 1K0NA 3I2GA 5DQSA 4YQUA 3MBWA 1JZ5A 1L7RA 2F51A 2ZUPA 4MJBA 1R5AA 4YH2A 1O6JA 5D8IA 5LNKe 1MDJA 3LG6A 1SENA 3VI7A 3VLNA 4L5OA 4KUNA 4JKLA 2GQLA 5EPFA 3TDGA 4O7HA 4F0BA 3F9UA 3HN3A 4ZXEA 2DC5A 3ZFLA 2LKUA 1GNEA 3GGLA 2V6KA 2VL4A 1PMTA 4XUNA 1GU3A 4CUCA 2VZPA 1W9SA 3ERWA 1N2AA 3JXSA 2HZFA 4TVEA 1DYOA 2DMMA 4ARXA 4HZ2A 1HD2A 3SEPA 2H1AA 4BA7A 3EB7A 1QXHA 5COHA 2PGTA 4K2DA 1USBA 3J7Yb 2J7MA 3A7QA 2CZ2A 2QQKA 5IIZA 4LMWA 6GSWA 3ABZA 1O8XA 2EIRA 1PRXA 4MADA 6GSTA 4KX4A 3G7YA 4I8BA 5CRHA 1ZGNA 2ZCTA 1EUUA 5IQYA 3CYNA 2HXKA 5CREA 2VL2C 5ECHB 1SD9A 4PNGA 2PVOC 3M3MA 5D93A 1GTUA 4V2LA 4A3ZA 3F0IA 2QBXA 3VD3A 4ZL9A 5G31A 3WGEA 1X9WB 3KJYA 4RN5A 2VO4A 4HU7A 2VMEA 1EGRA 4YQMA 1VRSD 3HY2A 4LMVA 3P2AA 3OG2A 2J9HA 3MSZA 4BVXA 3SWLA 4A4AA 1GNYA 1TI1A 3DYRA 4GLTA 4GQFA 4WF5A 1D7PM 3GDBA 3W8SA 3VWWA 3DYOA 4KSMA 1TU8A 1NX9A 4EKZA 4TR1A 4LA1A 3HKRA 3U6VA 4DXSA 2H1BA 2OBIA 4OCEA 2VOTA 5CYYA 1QFNA 2DJ0A 4PQ1A 3KMOA 1CQGA 2B3SA 4Z7XA 4OFTA 5ID2A 2YV7A 1V40A 5A4VA 3BJ5A 4OWYA 3MO4A 1XVWA 4OMDA 1T1VA 2KP2A 4V1Ag 4JBBA 3WEZA 5C7GA 4MP4A 2P5RA 2C0DA 3IR4A 4K7IA 5HPOA 4HG6B 1UC7A 5JXIA 3EC3A 1B9XC 5ECSA 2EICA 1S3AA 3LSZA 5A5KA 2WJUA 1ON4A 1TJDA 4EF0A 3HJMA 4KDXA 1XIYA 4PXOA 3SEEA 5J9CA 4XRAA 2PBJA 2RUEA 1O8SA 3LXTA 4CU7A 1N8JA 4XTSA 4QB1A 2XBIA 3D4MA 4D8MA 3G9BA 1V58A 3E3EA 2VQTA 4KA0A 4BK4A 3EE2A 2QQLA 5G1KA 3PR8A 2X09A 5G05L 2YB7A 3MUY1 2VZUA 3ED3A 3H8QA 4E8DA 4HOJA 1XNAA 2D2ZA 1W0NA 1JYNA 4WEYA 4KGIA 1W8NA 4TXVA 5GAND 1M0UA 4K1FA 2RV9A 2O8VB 1QQ2A 5D96A 1GQPA 2LJKA 3D5JA 4JKMA 1X5DA 4P3YB 1GLQA 2REMA 3HEIA 4NV2A 4TXWA 2CVDA 2B7KA 2V32A 3H4KA 3TKPA 2X8GA 2VL3A 5B8BA 3GKXA 3GTUB 3M9KA 3NOFA 6GSXA 1US2A 3C8XA 2P0GA 2C0EA 3FKFA 2JZTA 3K46A 4QX1A 5EJ1B 2V6OA 2GVPA 2GSRA 3QFAC 4DXRA 3F6DA 3WF4A 2CAIA 4RUVA 2LNTA 1BEDA 2GSSA 2WO3A 4L5LA 1YJ6A 3A2XA 5ECMB 4GTUA 3P6BA 4DSSB 5EJZB 2AHEA 2KHPA 2EIBA 1QGVA 3FR3A 4I2UA 2VCTA 2NDOA 2GGTA 1SHWB 4DUVA 4JU5A 3NZNA 1GUMA 3TKSC 4MA9A 4UI9L 5LA2A 1FHEA 3W5NA 5DN2A 3TCOA 2XBQA 4MPFA 2E2MA 3IXRA 2VZQA 1KBNA 1J08A 1YEXA 2VUPA 2W1QA 2LTKA 5J9BA 1BYEA 3S9FA 4EDZA 1OC9A 2YV9A 2A2RA 2YWIA 3LQ7A 3E9JB 5LCWL 5A1AA 1UXXX 3WF3A 2JE8A 4TXOB 4L0UA 4XUOA 1P8JA 2W3JA 1UY0A 3TJJA 4F9ZA 3CMIA 5DMYA 4K6XA 2GTUA 2QC7A 2FWEA 4EL1A 2IMFA 3QCPA 5HR2A 4DSRA 2L6CA 3IK7A 4NXIA 3BD2A 9GSSA 2YZUA 5IMCA 2MZCA 2PUKC 3UOMA 3IA1A 2LS6A 1EZKA 1A2JA 1WPIA 1NW2A 2H76A 3C7MA 3GYKA 4KNDA 3D4TA 3O6TA 3CSHA 2WBKA 2V1MA 1G0TA 3LORA 5HR3A 20GSA 3CXGA 4ZL7A 4MJCA 4K7NA 4HQZA 4MF5A 3FZ9A 1TRVA 2C1YA 3THCA 1ABAA 2B6MA 3NIVA 4ZBAA 2M46A 1A0FA 2H73A 5AN1A 4MJEA 2J1AA 2WDUA 5DALB 5D9WA 1A8LA 1XOAA 3LPFA 1NHYA 4IP6A 2JDAA 1WWJA 3UMAA 3U5RE 2W95A 2Y6HA 3CSJA 4MH3A 1O81A 4CHSA 7GSSA 3FZ5A 3WNPA 1EWXA 3HVSA 3WNOA 3W5MA 5FT3A 3KIJA 3IDAA 3A23A 2F8AA 4PX1A 2W1WA 5IOWA 1UYYA 2GS3A 3US3A 2WO2A 2QSIA 4IQAA 3UBLA 4MCUA 2ZEXA 3FEUA 4RI7A 1PGTA 4HZ4A 2PVQA 1EEMA 4J2FA 3C7EA 1PX3A 3P1IA 4KWUA 4FYBA 3VDAA 4HDEA 4KH7A 3FZAA 1G7OA 3F3RA 5G5FA 2DJ2A 2DJJA 5ABRA 5C70A 5B8AA 1SKSB 3D0ZA 2VQUA 2IPAA 1JZ6A 5DCGA 3OR5A 1JHBA 1YEPA 1LU4A 1YF1A 5CNWA 3FHKA 4FIWA 5FUIA 5DQ0A 3HJPA 1A2MA 4G19A 3HA9A 3UAPA 4OUEA 1XWCA 14GSA 4K0GA 5DJLA 2R6KA 3PINA 5F8BA 2VZTA 5JR2A 1K0CA 3LXZA 4ECJA 5IPGA 1XNTA 3HNBM 4ACSA 2LJRA 1UMHA 4CVUA 2HSYA 3ZREA 2YWOA 1GOGA 1KEXA 2DSAA 4E8CA 1GL8A 3LFLA 1WKYA 4XVHA 1R5PA 3GSTA 5JWQB 1F2EA 1JZ8A 1AAZA 5C04A 4A45A 2CV4A 3LEKA 1TKDB 4A41A 5DAKB 3WT1A 1VF2A 5G04L 3L4NA 3DYMA 1YKAA 2MMZA 3Q6OA 2J23A 2Y64A 2LRNA 1BJXA 1XZOA 1KNGA 2VM1A 2R37A 2L5OA 3IAM2 4LLRA 1XFLA 4H86A 5IM9A 3RPNA 2E26A 2VMDA 4NWYA 3K77A 2B1KA 2ZEWA 2GT5A 3OB8A 2JL4A 2H1GA 3Q18A 5IMFA 4TTGA 2WZ9A 2VTFA 5JXHA 4J56E 4BL7A 1EP7A 3DVXA 3RHCA 2FCHA 1GOFA 3HJRA 1TP9A 5F0GA 4CDOA 2VLTA 4YPJA 1U88A 1OYJA 4MMMA 4YQVA 2VCCA 2L59A 2YFUA 1GTBA 2VAFA 2EIEA 2O85A 5JCWA 2HYXA 3A2VA 3IB3A 1AW9A 3DGQA 2N5FA 2XQXA 2MMAA 1X9MB 22GSA 3ZTLA 3KP9A 5LD0A 3VDBA 1XWGA 2LQOA 1I5GA 2M72A 3M0FA 3CDZB 2WABA 2W92A 5JXGA 4BPYA 2JACA 3L9SA 1GP1A 4IKHA 4J57E 3RPPA 3IC4A 3EINA 1ILOA 3ZM8A 2GQKA 3ACIA 3ME8A 5J41A 2RUFA 4KAEA 3I2FA 1JYVA 1THOA 5JMOA 2CAQA 3KGKA 4N11A 1BHGA 3VPQA 1PX7A 4WETA 2E2GA 1EP8A 1SJ6A 3T2PA 2GSTA 5KEJA 3NQHA 4P5YA 1B48A 2V5DA 3NNGA 3GH6A 3A2WA 1M7TA 2RIIA 1K0AA 2BGOA 3FZ4A 4GCIA 1DBYA 3WNKA 1GSSA 1H6YA 2QQNA 3GKKA 2WDBA 1ZYEA 4ZIJA 3F63A 2W94A 5AIVA 4ID0A 4QQ7A 4JEDA 1OVNA 5ECLB 4QB2A 5GSTA 4LPLA 3FYGA 3GSSA 4ZZ5A 2XONA 5JWOB 2Y6JA 3GXUA 1BG5A 3C7GA 5GZZB 1FB6A 4XHMA 3AC0A 1T7PB 3T0BA 1KGYA 3DD3A 2J1SA 1SL2B 4KDYA 3KCMA 1GSDA 2VM9A 4MF6A 3WGDA 1AQVA 3CBUA 5IPHA 2MMOA 4IJ3A 4I6XA 5J3RA 1B8XA 3CZJA 4IS0A 3F3QA 3OEAA 1M9AA 2BMXA 3GUSA 5KN3A 2W1SA 5DBQA 5H5QA 5JCGA 5CRWA 2DBCA 4IUGA 1Z7RA 3IE3A 4MOAA 4KCAA 2AAWA 1OKDA 2YWNA 2NTOA 5A4WA 1MPXA 1XWBA 2CZ3A 5HR1A 3DYPA 4P08A 1TVGA 2HRFA 4GQCA 4ULXA 3BGAA 3ZVJA 2IWTA 3AY8A 3QD9A 4ZBBA 3UVTA 4PNFA 2LSTA 1XXUA 3WGXA 1FVJA 1GWCA 4F03A 1GTAA 2J1TA 4NV5A 5IHRA 2VJXA 2MBTA 4NMUA 4DEVA 3BCIA 3M8NA 6GSSA 3MNGA 3DKSA 5H5RA 3IAPA 3WNNA 2HLSA 2VL9A 3ZZXA 1GULA 5F05A 1T4ZA 1NKGA 1Y6EA 2R5GA 4POKA 5CO3A 2DCJA 3QMXA 3EMXA 2PN8A 2I3YA 3F4RA 1NAEA 2IL3A 4OO4A 3BCKA 2YG0A 1LBKA 5ECPB 3LQCA 3GTUA 2C4XA 2XPDA 3IAQA 3GH9A 4ZZ8A 1T00A 1OT5A 3N9JA 1XW9A 3D22A 2YJHA 2J1RA 3TB2A 2OJLA 2GZPA 4TR4A 5G30A 2NBSA 2Y6GA 3GFKA 3I69A 2JKXA 1K45A 4PQHA 3PH9A 3ACGA 2VD1A 2BJXA 2M80A 1JU4A 4FO5A 2VOCA 1NUKA 1SG3A 2GZYA 3HPNA 1XWKA 2WYSA 4DSSA 2Y6LA 3NRUA 1F6MC 2PWJA 5J4UA 4TOPA 5B6MA 3L9VA 1H6XA 1GOHA 2OA7A 1F9MA 2AYTA 2QKEA 5B7CA 2VZ1A 3P8WA 3WQBA 4G9HA 4CU9A 2C3QA 3CQOA 4Q5FA 3TJBA 1DP0A 1XPVA 1BX9A 2K9FA 4MH2A 2H6ZA 2H6YA 1IQDC 3KTLA 3E0UA 2CX3A 3GKNA 1JZRA 4KDUA 2PMTA 5IFTA 1ZMAA 4K0NA 1B4QA 1ULPA 4RQRA 2R7EB 4JHZA 3QAGA 3H93A 3DWVA 1F4AA 3ETPA 1JZ7A 4PURA 4TXOA 4EDYA 2DJ1A 2MMNA 3DECA 2B5YA 3IRAA 1HYUA 1US3A 3EURA 3VURA 2W46A 5GSSA 4W50A 4QAWA 2L6DA 4M4PA 4V2MA 4EXJA 3EWLA 4QB6A 4QX0A 4MF7A 1SKRB 3ZITA 4CUAA 2L9LA 5CP1A 5C00A 4GSTA 2P5QA 2J1UA 2W5FA 1O7UA 3TKQA 2JU5A 2VR4A 2CX4A 2L4QA 1SJZA 4EUYA 2YWMA 3P90A 2VZ3A 4HUAA 2C9KA 4AGSA 1YF0A 4GF0A 3TGZA 2H0GA 4TRXA 4P02B 4K8MA 2GLRA 3APOA 3VK9A 1Q4JA 1G6WA 4IP1A 1PQNA 3QDNA 1UZ0A 1KEBA 3I97A 1T2XA 1PKWA 5DQYA 5DALA 5D9XA 3GV1A 3F6FA 3OEBA 1TDIA 1OC8A 4AAXA 3NJXA 2WAOA 2G0FA 4M4RA 1U3AA 3RBTA 1UXZA 1PSQA 2FD3A 4JR6A 4KE3A 2N5BA 3WD6A 1TRSA 3ZIVA 1YQ1A 3TJFA 1U3IA 3I2KA 4LKSA 5H5SA 3I3EA 1MD3A 5ELGA 3GX8A 1K0MA 3KMNA 4X1UA 4DVCA 1RYYA 3VD7A 2I4AA 2VO5A 3IIIA 2HNLA 2KP1A 3N5OA 1TK0B 2H72A 1EV9A 1OAZA 5IMVA 1Z9HA 1CZTA 1SDDB 1T4YA 2HSHA 4BVYA 4TKYA 2IIYA 3K75B 3EYPA 4QDQA 1C72A 1UMIA 2HE3A 5ECQB 2Y8KA 4QDRA 5ECKB 2V41A 2HT9A 1IYHA 2VCWA 1VF4A 3EU3A 2WGRA 3KD0A 3C71A 3TRQA 3CRTA 3GX0A 5B6NA 3GKMA 4AJ6A 2HLEA 2YJ7A 1JZ4A 3LJRA 5CAXA 1CQHA 4UAPA 3WF2A 5F07A 3HDCA 2DDUA 2YC4A 3A3TA 4DSQA 1W4VA 4MJAA 1M9BA 1MEKA 2AB6A 1YDKA 5G5EA 4D0QA 2FUG2 4AG4A 5J5NA 4LQRA 5EY6A 4L0PA 3KTBA 2WUHA 3ZVJD 3HXSA 1QMVA 3BOAA 4P00B 4PUAA 2LUSA 5KN1A 5EL8A 4OO5A 3ZL5A 5EIYB 3PGTA 4Q5RA 1Z6NA 2IMEA 2DIYA 1M2BA 1ULOA 2C4JA 3OBAA 2YP6A 4G10A 5FWGA 2L57A 5DAKA 1XPWA 2EIQA 2TIRA 2ZEZA 2IFQB 1TK5B 1YQ2A 2DCKA 5HFIA 2E31A 2ORXA 1V98A 4TN8A 1UYZA 2DMLA 3MAKA 5ECRB 3Q19A 2WCIA 3C7FA 2I9HA 1JZDA 1S3DA 4GSSA 1OF3A 1PD21 3I6AA 1JZ2A 5ECNB 1WOUA 5IO2A 1J83A 2HZEB 2BERA 3IOSA 1TXXA 11GSA 4ECIA 5F06A 2YPMA 2LRTA 2ON5A 3I3DA 2LQQA 2ALBA 4AF2A 2CQ9A 1OH4A 4XS4B 2KD7A 1LJRA 4HJ2A 3HZ4A 1THXA 2EC4A 2LJAA 4BWQA 3VPTA 2XC2A 4AJ8A 1ERUA 2ZEYA 5JXJA 3FRCA 3T0DA 4ECBA 5ELAA 2H0IA 1UY1A 1R64A 4A6OA 3A21A 17GSA 3GL3A 4Q5QA 2FGXA 2DIZA 1X5CA 2NPBA 2OKXA 1TTZA 2VLVA 2VCBA 2X8HA 1O8PA 2X8CA 1GUKA 3FHQA 2VIMA 4IBPA 2FWFA 1GUHA 5AGYA 2B5EA 2RM5A 2GZZA 3FR6A 1HNAA 1T3BA 3HVVA 6GSYA 4W4ZA 4RI6A 2AJQB 4ML1A 5E4WA 5IOXA 2OKAA 1GUIA 3VWXA 1JHJA 5IMAA 1RQMA 4A42A 1B9YC 2MBSA 4ET7A 2C0FA 3UBKA 3UESA 1F3AA 3L0HA 4TR0A 2WFCA 4XS1A 8GSSA 2H75A 2ORZA 3ZLPA 2OACA 4ZB6A 2W87A 2LNSA 2WZ8A 4IVFA 3I2IA 2VLUA 3VD4A 2IN3A 4GWJA 1NSWA 1SK2A 2TRXA 1A2LA 3ACFA 4F0CA 1J84A 1A8YA 3MV01 2R2JA 2FNOA 1WCQA 4PQIA 1H75A 3UETA 3TJGA 1TU7A 2GSQA 1GRXA 1PX6A 2LEGA 1AUCA 2CA8A 1PL2A 3MV11 18GSA 2Y6KA 4KSOA 2VZSA 3APQA 3G7IA 1UWWA 3C7HA 3GHAA 4DUWA 2B9VA 3TOUA 3LPGA 2GT6A 3I2HA 1SYXA 4OMVA 19GSA 3THDA 4I5QA 1PL1A 3K8NA 2NVLA 2XHNA 2E32A 3LEIA 2JADA 3KEBA 4QX2A 3CTGA 2VZVA 1H4OA 1SK1A 3WF1A 4X0XA 1M2DA 1JYXA 1ML6A 1OF4A 2PERA 3IBHA 4LHSA 4MGQA 1U6TA 4DUXA 3PUIA 3HJOA 4Z2AA 4HQSA 2DJ3A 2FA8A 1W89A 2C80A 3FHAA 1WE0A 3ZMLA 2LW8A 1MD4A 5IYYA 2YOIA 2VCAA 5CRDA 4L8EA 3A5WA 3VD9A 1GSUA 1K12A 4ZL8A 3R2QA 2MYGA 1ZYQB 4BWSA 2E0QA 2WB9A 4GWRA 2H6XA 2FWHA 5C71A 4MK3A 4IW9A 2QGVA 5ECOB 3GL5A 2W47A 2VC9A 1JZ3A 1DE2A 1X0RA 1XOBA 2Z9SA 3L9UA 4MABA 3LYKA 1CX1A 3EU4A 4POMA 1OE8A 2RJ2A 1K3LA 3TUEA 5JUVA
chains in the Genus database with same CATH superfamily
4I02A 1AL23 2YC2A 4HS1A 4Q5NA 1XW6A 3AMPA 4NOTA 4N53A 3VBRB 5TSWA 1C8M3 4CEWB 2RG4A 2TRCP 4S2DA 5EHDA 3O3TA 2Z79A 1W99A 2R4VA 1UN2A 4YG6A 3AMQA 4FI9A 5B2GB 4PLMA 4UFKA 1TME3 4IE6A 1VALA 5CZKA 3VBHC 1X8MA 5ABJC 4D73B 2VOVA 3LGCA 1WRYA 1MVEA 2FA4A 4NHZA 4IEYA 3WW2A 5I8TA 2LRCA 4HJMA 3R05A 5DCHA 1VP6A 3WCSA 3LE0A 2TBVA 4BMEA 3I8TA 1DQ4A 4ZU5A 5DG1A 1BYHA 1K5MC 1FB0A 3ZFFC 3WUCA 3HOBA 1X82A 3PUHA 3QFBC 4GMP0 2WZPP 3ELNA 2W91A 1FAAA 1RIRA 3WINE 2KLXA 2A6VA 3KM6A 2YFZA 3CO2A 3WVJA 5JCUA 4K9ZA 2OX0A 5I8SA 2QQMA 5BNQA 5DVBA 2JD4A 2SBAA 4W6WA 4MZBA 1CZSA 4XRDA 1YKCA 5GM0A 2ID4A 3LD8A 3PVEA 1NHOA 2V4VA 4IEUA 3GM8A 2O1QA 4XDQA 4IEPA 2YBPA 1JZWA 2GP3A 3CRUA 3P5BA 5FJKA 2RM6A 3OGRA 2VMCA 2BTOT 1PN9A 4FQUA 4QXHA 2P31A 4ZBDA 4GMP3 3JBG2 1XBSA 4KWJA 4POBA 1OURA 2B7JA 2VL2A 4UWDA 5KOXA 5F32A 2PHLA 1IZ3A 4TN7A 4HSJA 3SKVA 5BNOC 3F95A 4TR3A 1UY4A 4ATEA 3S7EA 4MZCA 2NMNA 1OC1A 1C1LA 4BVXB 1WP0A 5GAPD 4COUA 3WG4A 2FLSA 1SU9A 1XNBA 1LOGA 4BH9A 4UF0B 2AUVA 4META 4TR1B 1QK8A 4SBVA 4HSCX 1U87A 5FO8B 1DE1A 1YFXA 4YAPA 2GP5A 4K40A 3R4UA 3K2OA 3ZMKA 3AMMA 2GZWA 5J7MA 1ERWA 1I9DA 4CPBA 3AL5A 5DPNA 1ENRA 2CVKA 1CZVA 4PIZA 2GDRA 3IHGA 2BOIA 3ECQA 3ZXGA 3CTFA 1O5UA 1W6QB 1NM3A 3AYAA 3TRXA 4HN0A 4TLGA 3DVWA 2X5IB 1BKZA 1BJQA 3QH6A 2C1FA 1JFUA 4MGSA 3T09A 1F9KA 4MPGA 1MS9A 5A6YA 5DJMA 12GSA 3A22A 1QQP2 3FUQA 3DXBA 4ASLA 1PFOA 4LHLA 3BBYA 4QGNA 3AM2A 2DYCA 4BLIA 2O7KA 1Z3EA 1FW1A 1U5ZA 1RGSA 16GSA 3OPZA 5CFCA 4JE1A 4NO4A 2SLIA 4YVSC 4QL9A 2YCDA 2KA3A 1HNCA 3VBOB 1V57A 4ZILA 5LB6A 1G86A 1GZTA 1R1ZA 5JOZA 1W06A 2HWC2 1LNSA 2CTVA 1N47A 4LA2A 4MZWA 3C1SA 2FDHA 4XC9A 4GZ9A 4FOVA 2WNUC 3K4ZA 1RUC2 4Y1YA 3ACHA 4IV1A 4G9SB 1CESA 3KH7A 2F9SA 3VL9A 2F8FA 1YHFA 2O87A 2DVAA 2W9XA 2ZNMA 4BXSV 2NP0A 3LB9A 3TKSA 1XC6A 5FZDA 3I9V2 4NHLA 2K18A 1NCQC 3U10A 4CDWB 4XZUG 4V2VA 1CX4A 2IMDA 1K0OA 4O5UA 3C3VA 3NAPC 5KN2A 4LA3A 2D98A 4K5RA 2JZSA 2VXJA 3TOTA 3RDWA 1V0AA 2FMDA 3GIXA 3CKHA 5EJ3A 5JOXA 1VB4A 1YRZA 1CPNA 4OQ8A 1JLWA 2H19A 3MEPA 1AIUA 1TMF3 4I2TA 4HPKB 2E33A 1BAYA 1GH2A 2WR9A 5J48A 3N9PA 3POGA 2JZRA 4WF4A 1VMHA 4GXZA 4CU8A 3DEXA 3GN3A 3HQRA 1DHKB 1PO11 1DF0A 4L2NA 3ZXFA 3HYPA 3CL1A 2BQPA 3OPWA 3ZYWA 1DQ6A 1MS3A 5SV5A 5ACA3 2CDPA 1SYRA 4BDVB 1R4WA 4AQSA 1RHI1 4K5SA 5I0DA 4MDCA 3RMYA 5A3TA 1W6NA 4N7IA 2I1UA 3PUSA 4K9SA 4URAA 2XPJA 5A1LA 2ES7A 2WQ8A 3JUUA 2C26A 3T2OA 1H30A 1MDIA 2C8UA 3BALA 3SKJE 2QDNA 4CW9A 4X43A 3ZSLA 4YW3A 1PN0A 2HI7A 4V1PA 4R52A 5CFDA 1X9SB 1GMMA 1J3QA 3UJ1A 3D0JA 3IV4A 5FZ4A 5AFEA 4JKKA 1BCXA 1EPWA 1IYIA 2LUWA 1A8DA 5LW9A 1XBFA 1PIV2 5FWJA 4F82A 3J7Yk 2HFDA 1DCSA 2JSZA 1N1VA 2R061 5FY0A 3KH9A 5KHGA 5A3MA 2R3XA 3BU0A 1WUVA 1ZL9A 1SJIA 4UW5A 5SV8A 1RW1A 2DFCA 3W8JA 1W04A 5LEKA 5CG9A 2WT1A 1QIQA 4DXTA 3USUB 4Q2FA 2X10A 5FUPA 3MBWA 2UWAA 3VL8A 2F51A 4YVWB 2CL2A 1IGOA 1IG0A 3LG6A 3A0NA 3VLNA 4KUNA 2GQLA 2FCVA 2A71A 4DRVA 4F0BA 4UT5A 2D3PA 3ZFLA 3VBSB 4EV0A 2V6KA 2VL4A 1QXRA 3U11A 1GU3A 3GALA 1RXFA 4ZS2A 4ATFA 2HZFA 3SQOA 1H2KA 1XU1A 3SEPA 1QXHA 3RVHA 2PGTA 1OLMA 3H8RA 3A7QA 2GNDA 3QCWA 2CZ2A 2QQKA 4LMWA 4FFHA 3ABZA 4AVTA 3S0MA 2CV6A 4Q4Y2 5FLJA 5FKCA 2UURA 1HRV2 5JIAA 4C91A 3MIHA 2CSGA 4KX4A 1UN1A 1XB9A 3NL1A 2OW4A 1OQ1A 2XJQA 1SD9A 4LBKA 2RDRA 3SISA 1GTUA 2HWB2 4K20A 4A3ZA 1Z0HA 2VVEA 1EYBA 3JBG3 3KJYA 1MS4A 1DZQA 5FPBA 2VMEA 1EGRA 4N90A 1NQDA 1RMU1 1VRH1 4TSVA 3P2AA 4C0BA 1UD1A 3J7MA 3OG2A 2Y34A 4A4AA 5FMDA 1G6NA 4WF5A 2EXKA 4KSMA 2A5ZA 5LBCA 1CR7A 2JIJA 3P3PA 5JR7B 2H1BA 4GIQA 3WUDA 1RUNA 4BIOA 4XPVA 4PQ1A 1CQGA 2B3SA 3KV9A 4OFTA 5ID2A 4OWYA 1VJ2A 3AJYA 5F6KA 4V1Ag 2HWF1 2P5RA 2C0DA 3IR4A 1GKBA 3OYWB 3W9AA 4JAAA 1FAYA 4HG6B 1IS5A 1B9XC 1S3AA 1VBA1 3IDCB 4EF0A 1XIYA 5JMCA 4XBLA 1O3TA 5JPNB 5J9CA 1H8TC 3LXTA 4XTSA 4FPEA 2XBIA 2Q30A 5FZBA 4XDPA 2ARAA 3E3EA 4LUMA 4KA0A 4UYBA 1S3RA 3MUY1 3ED3A 3H3UA 2EVXA 5J3UA 4WEYA 4KGIA 3O1VA 2PFWA 3N7LA 4XJUA 1AR82 4DRRA 5FZMA 4JKMA 4P3YB 4IGQA 3WG2A 5T54A 1D2QA 2VVFA 3IDEA 4B29A 4N9HA 2BTVC 2CVDA 2B7KA 4X4JA 3H4KA 4QKBA 3AYDA 3GHMA 2VL3A 1JHNA 3PL0A 3DPRA 3GKXA 3AKRA 1AJOA 3NOFA 1YIFA 1VMFA 3LA7A 5F5IA 5L19A 4QX1A 4UBHA 1CAXA 3QFAC 4DXRA 1QU0A 3IPVA 2R042 2CAIA 2LNTA 4FPOB 4LBNA 2W68A 4Y5SA 4DSSB 2EIBA 1WLCA 4BA6A 1QGVA 4AI2A 2OT7A 2RS12 1YWKA 1PO22 4RR3A 2NDOA 3ZKUA 3FHIB 3ZN6B 1SHWB 5LBFA 4JU5A 4GH4B 1GUMA 3POFA 1XSQA 1RUC3 3W5NA 2VZQA 2W1QA 2LTKA 5J9BA 5GZDA 5T5JA 4EDZA 5FOBB 2YWIA 3E9JB 3ZMOA 3WF3A 1P8JA 2W3JA 4XF9A 1UY0A 3TJJA 4F9ZA 2JWPA 3BIWE 3J9SA 4B7EA 2GTUA 2FWEA 3TWIA 3BD2A 9GSSA 5EV7A 5IMCA 3IT8A 3ILFA 1S0EA 3IA1A 1ZM1A 2OA2A 1BBT2 4PDWB 2P5BA 3RZGA 2ZKLA 2WA4A 2PN5A 5D1IA 3ZSJA 5HR3A 4D7SA 2JDKA 1XNKA 20GSA 3AFKA 4L99A 4WM8B 4IDZA 4MF5A 1WW5A 3FX3A 1EAH3 4I2OA 2B6MA 4ZBAA 2WSVA 1A0FA 5L7OB 3APBA 1ODMA 2WDUA 5BNNB 5FZFA 3VLBB 2YY1A 1GP5A 4IP6A 2JDAA 4BQXA 1O81A 5DUVA 5KXCA 4PLOA 2F8AA 2W1WA 5IOWA 2GS3A 3US3A 1LHWA 2WO2A 4IQAA 3UBLA 1B35B 4RI7A 4HZ4A 4BVYB 2QUOA 4XQWA 3C7EA 3C2UA 3VBRC 3P1IA 2FDJA 1UCXA 1G7OA 4KBZA 3F3RA 5G5FA 4HOOA 5A3LA 1AHSA 5FXZA 2IPAA 4XAEA 4A2UA 5H9SA 1HJGA 1WLDA 4WVWA 1CAWB 1YEPA 4WZFA 1LU4A 3RYRA 4LKDA 5DQ0A 2FCTA 1YJLA 4G19A 3HA9A 4D7YA 14GSA 3PINA 2VZTA 1K0CA 2CY6A 5IPGA 3OSDA 1PIV3 5DAWA 4FPJA 2YWOA 5J36A 3U4SA 4NHKA 4YFZA 1C5IA 1ASJ2 4DY3A 1LODA 4XVHA 1R5PA 1F2EA 1NLQA 2DU1A 1NYWA 2X4AA 4BQWA 2CV4A 1VRBA 1GWKA 5DAKB 3L4NA 3DYMA 4LIUA 2LRNA 1ULDA 1XZOA 5LA9A 4MLOA 5F8PA 2L5OA 1XFLA 1OSGA 4NWYA 2ZEWA 4F83A 1ZBE1 3WDXA 4G3YC 1DGRA 4O65A 4BQ4A 2JKBA 1LULA 2RM23 5EQUA 4YWAA 1EP7A 2RMU3 1RUE3 1GOFA 3HJRA 1TP9A 5F0GA 3O12A 2YFUA 2Q8DA 2VAFA 1W6MA 3A2VA 3N35A 3DGQA 1X9MB 2WNOA 3ZYHA 3VDBA 2LQOA 4A6SA 1XE7A 4B7KA 1OQEA 3CDZB 4LUKA 2WABA 2BEOA 5FZ0A 4BPYA 5DDJ2 4AAPA 5FZ3A 3RPPA 3VN4A 2CNAA 4JGZB 4Q4V3 1QQP1 1ILOA 2GQKA 3ME8A 3OD0A 4WBBA 2YXSA 3NJZA 4Q4Y3 2OQ6A 2V5YA 4AHWA 2YC0A 1OQDA 2CAQA 1AYM3 2B46X 4YW7A 5KEJA 1VBC3 4Y1UA 2V5DA 1GYKA 2QZ2A 2BGCA 5EP9A 1K0AA 4R9DA 2HEVF 3WNKA 3POEA 4GKXA 1ZYEA 1FNZA 2LALA 1OPOA 3ZYPA 5AIVA 1G7YA 2JG8B 5ECLB 5GSTA 2HWC1 3AP5A 1MQTC 3FYGA 2XONA 2ZJCA 5JWOB 3NNMA 3GXUA 4RGGA 3NNLA 3BTAA 3RG0A 2HWE2 3AC0A 3LOBA 1KGYA 5C5TA 1SL2B 1GSDA 3AL6A 5IPHA 1ZZCA 4IJ3A 3DV8A 4IS0A 1OOPB 3GUSA 1GFF2 3AKTA 1VMJA 3BPZA 4TLFA 1W2TA 1OKDA 2NTOA 2VECA 5IVBA 2CZ3A 3WW1A 1QXPA 2HRFA 2X5IC 3ZVJA 3NNFA 4QX8A 2IWTA 3AY8A 4ZBBA 3OY8A 1LHUA 3WGXA 1ONAA 2EXIA 2WL1A 4NV5A 4YG0A 3VKLA 2EXHA 1QHDA 5FPLA 6GSSA 4AI0A 2IVIB 4BZ4A 3MNGA 4DPNA 3PMEA 1WCSA 3ZIWA 1D0HA 5F05A 1NKGA 4POKA 5CO3A 2DCJA 3QMXA 3F4RA 2I3YA 2QJVA 3VKOA 2JJ6A 1JOBA 4N53B 1W8WA 2YG0A 3ZLIA 4PI2A 4XF4A 1AR83 4Z1VA 3GTUA 5DG2A 4LE3A 2C4XA 5IVVA 3VBOC 3GH9A 3KV5A 2PHFA 1E5HA 4PF5A 5FMCA 1ZRCA 1PMIA 2D7FA 1U5XA 4FO5A 2VOCA 4IE7A 3TYJA 1APNA 2QKEA 5B7CA 3B93A 2VOWA 1AR63 3J7LA 4EN8B 4YYOA 4AHXA 1BX9A 2Y38A 2A6XA 4HVQA 1SBDA 2H6YA 4CDWC 2VXRA 1IQDC 1AR72 4USSA 1OXCA 2PMTA 1ZMAA 4LHKA 5FYIA 4I09A 2B5HA 3ETPA 1WLTA 2Q1ZB 4TXOA 1X9PA 1BMV2 2MMNA 3DECA 4B4PA 2GAUA 4MV2A 1US3A 5GSSA 2B42B 4JGYA 2AENA 2W2IA 4QB6A 1A34A 4MF7A 2W39A 2JDZA 5C00A 4GWMA 1DGWX 2VMHA 4AOCA 2LROA 2P1BA 5LK5A 2B45X 1V6JA 3TKQA 2VR4A 2L4QA 1SJZA 5EZWA 1KRIA 4EUYA 2VZ3A 2PYTA 4GF0A 2H0GA 4TRXA 1DDLA 4P02B 4K8MA 4CDQA 3VK9A 1Q4JA 1G6WA 1YYNA 5F1RA 2BFUL 3DF0A 1PKWA 5DQYA 3GV1A 1OC8A 1W8UA 4K7JA 1I6XA 2G0FA 4EYUA 2G1MA 5IVYA 1UXZA 3WD5A 4W6XA 2FD3A 3WD6A 1YQ1A 1OLQA 4LKSA 3N3HA 5FJHA 3WG1A 1K0MA 3KMNA 4DVCA 3IIIA 1TK0B 1EV9A 1LU1A 1Z9HA 3I7DA 1SDDB 1QDOA 4I30A 5FMOS 2HSHA 4AXOA 1YCIA 3QACA 2V41A 5HXVA 1DQ2A 3N9QA 4A7KA 1VAKA 3EU3A 1POV3 3KD0A 3CRTA 3GKMA 4Q4Y1 2YJ7A 1HRV1 2EXJA 3LJRA 2MEV3 1CQHA 4GJZA 5F07A 3A5IA 2YC4A 1UX6A 3A3TA 4MJAA 1MEKA 1YDKA 2HWB1 2RDNA 3GJAA 4AG4A 5J5NA 4L0PA 1J59A 4CA9A 4U36A 3AMNA 1QMVA 4OI0A 2ADDA 3WZ1A 3EMRA 4D6SA 4B8EA 3PGTA 5A7WA 2IMEA 2ARBA 4KU8A 1ULOA 3MYDA 4G10A 1QJX2 5FWGA 2EIQA 2TIRA 1TK5B 5HFIA 4TN8A 2I9HA 4X8PA 4MSVA 4AR2A 2KXLA 1OF3A 4GJYA 4RHV3 1JZ2A 5ECNB 1WOUA 5IO2A 1ODNA 4ECIA 1AUYA 1PHMA 2ON5A 2LQQA 2HRAA 2ALBA 3VBSC 2CQ9A 1OH4A 5C8WA 5A3OA 3I4IA 3HZ4A 2EC4A 5CFCB 4AJ8A 3FRCA 5ELAA 2H0IA 4COVA 1SFYA 4IGPA 2PELA 3BOPA 2VLVA 4Q1PA 2X8CA 3FHQA 1QXJA 1GZCA 1Q8VA 2GH8A 4NVPA 1CAVA 2RM5A 4DS0A 4LTAA 1HNAA 3D6EA 4AGVA 5K0UA 5LZ6A 1JYIA 4W4ZA 2AJQB 1KD7A 1FMD3 5IOXA 2BNOA 1JHJA 3TN92 5IMAA 4IV1B 1RQMA 2G19A 3OJBA 2MBSA 1JODA 4LMFA 4ET7A 2VNRA 3I2DA 3I3MA 1RJ7A 2ORZA 3ZLPA 1POQA 1NXD1 4ZB6A 4MGKE 1H1MA 3VZKA 2C9AA 3S30A 1RUG3 4IVFA 1XRUA 3IZOA 4A3XA 3VKNA 4F0CA 5DZGA 1A8YA 3MV01 4B3NA 1UMZA 3RFRA 4PQIA 1H75A 2QA2A 2R041 1QNWA 3TJGA 5BPXA 2LEGA 1PL2A 18GSA 3S5QA 3BODA 3ZSMA 5JSOA 2RS11 1PO21 4BQ1A 5CKNA 3WQ1A 4I5QA 4N43A 2XHNA 2HWE3 3LEIA 4CRQA 4OHZA 4QX2A 3CTGA 1SK1A 1AF9A 2IUWA 3USSA 1U6TA 4WVVA 2GC1A 4Z92B 2DCTA 1VBB2 4FTSA 5KXBA 1IPJA 1MR5A 3E6CC 2FA8A 4GB31 2QQVA 4LORA 4DB5A 3UK9A 1MD4A 1W6NB 4IV3A 4XXPA 5IYYA 2VCAA 1GSUA 1K12A 3UGGA 3R2QA 4ICYA 2WB9A 2PA7A 4DIQA 2FWHA 1R1A1 4MK3A 1O5LA 2QQWA 3KWVA 4Z2WA 1BBT1 1XOBA 3E6BA 3LYKA 1AX2A 1OE8A 1JN2P 1DQ0A 3TUEA 5JUVA 2WLQA 3KB5A 4BYYA 1XVQA 5HFGA 1OLME 4IGJA 4E8EA 1AR92 5CFDB 2HEYF 4K8FA 4E2QA 4MGIE 1FT9A 2H74A 3H1YA 1X5EA 1Y25A 3VI5A 4LOTA 4AHYA 4Q1RA 2X64A 1W6OA 2VNVA 2K8VA 4C1XA 2WULA 2BRTA 3BPSA 2X29A 5C4WA 3JCML 3KHBA 1SD8A 4CP0A 1MEC1 1M3IA 3D3AA 2H30A 4FYUA 2B39A 1V9U3 3MFCA 4YGBA 1H1AA 3SMHA 4GH4C 4XFGA 2YN1A 3SC7X 1TW9A 5JPMB 3LAGA 5ECIB 4A44A 4KCEA 3HZ8A 3T0AA 4IEWA 2UU8A 4YW2A 4XZPA 2VW2A 3ERFA 4OCFA 4EJRA 5J1XA 5ANQA 5FXXA 2K6VA 5CIRA 3RDIA 1AXZA 1VBD1 3HHVA 2IFRA 2ERFA 2E7PA 1LHNA 3TB0A 5T5PA 3MW4A 2P3IA 3BN6A 5CADA 3SNMA 1JLVA 1OC3A 1IQAA 3THTA 1YNAA 4HVOA 4LO8A 4PDWC 4NIGA 5KWRA 4Z82A 1YFWA 3LA2A 4DQAA 2YGLA 4O61A 4Y4YA 1CJDA 2K9ZA 3ZPYA 4AVBA 1ASJ1 1TRWA 3EMPA 5JWPA 3O76A 4WM8C 1YXWA 4MVTA 2D93A 4CY8A 4KB3A 3RI9A 4O32A 3VB9A 3K4DA 5L7OC 2MHFA 2WYFA 5FUNA 4KWKA 4ISDA 5L9RA 5CBLA 4O7XA 2XL9A 5FZLA 1HNBA 1WMJA 2XXZA 4C90A 1W03A 4KMQA 5HXMA 1LOFC 2VMIA 1ST9A 1ZZ9A 4OFNA 4IEXA 3ZO0B 3WSOA 3N7MA 2F17A 4CCOA 1ZZ8A 4CUBA 3LYPA 4ZB9A 3APSA 1K5JA 3I2JA 2PXJA 2V72A 4XACA 1GTIA 2WO1A 3H7YA 1B35C 2H0VA 2XDVA 3JB8A 1XNDA 3OUIA 3TKRA 2VCZA 4XF3A 5KBFA 3H1WA 2DVDA 3MI8A 1NCRA 1OKTA 4N30A 1XWAA 2DLXA 2VVDA 3ZYFA 2WQZC 4FQ4A 5FRAA 2VOXA 2DFBA 2XMLA 5DDJ1 2FWGA 2LRPA 4HI7A 2OVUA 4XUTA 5FBJA 3HVDA 2W1UA 5ID2B 4FTEA 4EC0A 2AV4A 4KNCA 1FVKA 1DU3D 4POLA 1MS8A 1F5FA 4MZUA 2JDUA 4QGLA 1CQ9A 4YLZA 2DJKA 2PPTA 1AQXA 3ZDVA 1ZZYA 2BUKA 3LEFA 2VCQA 1Q8SA 3FY7A 2KOKA 2XOMA 3N9OA 3SH3A 1NT0A 3FK8A 5LRRA 1WMDA 4RGAA 3IPZA 4IJIA 4PF1A 4EZHA 5J96B 1E6BA 2RVAA 2HRNA 1YY7A 5BNOA 4O92A 5DABA 3JZVA 3AZVA 3KS7A 3A4UA 3MYXA 2VD0A 4QKFA 3H3ZA 5IWFA 2K2SA 2BOJA 4M00A 2HWE1 5KN0A 2E51A 3FUOA 4YFWA 3WF0A 4AEKA 4N8MA 4IELA 1F3BA 4DEJA 4H14A 4XS4A 2Y6FA 3FBMA 5CA6A 2G2QA 2J1EA 4Y22A 2UYAA 3MUZ1 5CKMA 2J42A 3DPRB 3PJYA 1EOGA 1UPSA 3J7NA 3UKVA 4L8QA 5GLUA 4M3CA 5A32A 2OADA 4XE9A 2PAMA 4QXKA 3MICA 1I1EA 3DMLA 1CAXB 3IPVB 4UFHA 1GSEA 3U78A 4RYDA 1ACVA 1YQ8A 2A7AA 1QJY2 3VHPA 4YAVA 4JGZC 2I74A 5B4NA 3FL7A 1WZXA 4OMCA 5IVCA 1LEDA 1R7HA 2V4AA 4RR3B 4XQ4A 3KLSA 1PGL2 4D94A 2B5XA 3H1MA 1EV12 1F8VA 1O73A 1AQWA 4RD7A 4EIQA 1UA5A 3TN93 1REEA 4ZKTB 1ZCPA 3MIXA 2LS5A 3HCZA 4NPMA 1W8OA 1PK6A 4J6GA 2G4IA 4EO3A 2H70A 3LWAA 3JD73 2JG8C 1BEV1 5HBAA 1NQJA 1SCSA 1O59A 4IHUA 3AFGA 2AH2A 1ZRDA 5GZEA 4NAXA 3C73A 1LHVA 2YPDA 4Y4RA 1UYXA 2C6SA 2EIDA 3OF1A 3C7OA 2H6CA 1OE7A 3CIHA 3IDVA 4N0ZA 1GNWA 3HD8B 5HQPA 1OOPC 2CYFA 2OE1A 4AVVA 4ILFA 4XBNA 4ZHNA 1AR71 1EPZA 1JUHA 2ZHMA 1JYCA 4RGKA 1AVBA 4E8HA 4JQRA 4UOJA 3SH4A 1Q98A 3WT2A 4F3JA 1Q8PA 1UY3A 4DFSA 1PGW2 3T2QA 1SLTA 4PIXA 3CSIA 1BMV1 1Q8OA 5FK7A 3ZXDA 5FPVA 1VBB3 4L0WA 5E59A 1QJU2 1JZOA 2XB6C 3TRPA 5FYMA 1RUH2 1XE8A 4C0HA 4WKWA 1J0FA 5JWRB 4E4SA 5FHIA 3M9JA 4XCAA 5LK7B 4NPBA 1OVPA 2JSYA 1PA3A 4UFMA 4N53C 4ML6A 2F3MA 3ISOA 5KC6A 3CMGA 1DGRN 2IMKA 4V2NA 2BBVA 5E1RA 4W6YA 1AR93 3GA4A 3N36A 2FDFA 2BVBA 2GMEA 1JXNA 4F2IA 3EQEA 3PTRB 3DEMA 3N9MA 1W9YA 5D9TA 3PVNA 4XFAA 4Z2UA 3M1HA 1O4TA 3ST7A 2H6BA 1OUXA 1HQOA 1WBLA 3SH5A 1EGOA 2AREA 2CVBA 2WZEA 4FOYA 4Y24A 4BQ3A 1YIPA 4XIHA 4WBJA 1ZZ7A 2VQAA 3HT1A 1HN1A 3ATGA 1YI9A 3V64A 3ME7A 2CGOA 2D44A 4AZZA 3LDKA 3I2GA 3LIGA 4JQTA 1VE0A 4S2HA 3NJYA 2BWCA 4Y1XA 4YH2A 1MDJA 3OBRA 3JQWA 1SENA 3JQXA 4AEJA 4L5OA 4JKLA 2Y0IA 2VBBA 3JB4C 2Q8CA 3TDGA 3HN3A 4ZXEA 3DKQA 1WA4A 1GNEA 4CUCA 2ET1A 3ERWA 3WHTA 3KCCA 1UKRA 1W6MB 1DYOA 3NV4A 4XQDA 5L9VA 5FY8A 1QJX1 5H9RA 5BMUA 4QGMA 4P5HA 1R093 3O14A 1MZ6A 3CJIA 5FY7A 2NZ9A 3WHUA 3CYNA 2HXKA 5ECHB 2VL2C 1XSRA 5DAQA 4PNGA 2AACA 1SACA 2XVGA 5FPXA 4ZL9A 1H8VA 3WGEA 1RUJ3 4FPCA 3T4HB 2VO4A 3B01A 2FQPA 3E5XA 1VRSD 1V6NA 3GBFA 4LMVA 3MW3A 2P3JA 2XLAA 5JZGC 3VBUC 1PNFA 1OKQA 1GNYA 5JAXA 3ZN5A 1D7PM 3GDBA 4EROA 1O91A 1ULGA 2XLGA 4Q8KA 4EKZA 3U6VA 4MGZE 2WO7A 4QXCA 2BJSA 1V40A 2HWD2 3MO4A 1XVWA 2KP2A 5K4LA 5C7GA 3PDQA 4J1WA 2PMWB 4NHMA 3ON7A 4Q4W2 5T52A 3DUIA 4QKDA 3HBKA 4QMAA 2A4HA 4IEQA 3ZXAC 2P3KA 4Q0UA 4KDXA 1COV3 1OVSA 3INAA 2ZX4A 2RUEA 1O8SA 4CU7A 5GLTA 1V58A 3THPA 3OY8B 2XKOA 3EE2A 1TZOA 5G05L 5IAXA 2R0HA 2Q8EA 4CCJA 4HOJA 1XNAA 3M3IA 2JICA 3NW4A 4K1FA 2O0OA 2RV9A 2ZGNA 5D96A 4WVZA 3HEIA 2REMA 1BQPA 4NV2A 5CFCC 4XJ8A 1AX1A 3KCXA 2V32A 1VIWB 3TKPA 4OULA 3GTUB 4BOWA 3C8XA 2R073 1VBB1 1D2SA 4YGEA 1C3HA 5EJ1B 3O1SA 2V6OA 2GVPA 1REFA 4Q27A 2ZX3A 5L36A 4EIPA 5ISLA 3CJXA 2VUDA 1ZRIA 1HRI3 4AHZA 2JG9A 4AFMA 1YJ6A 3A2XA 5AC93 1HV0A 4IV1C 1Q3EA 2XVLA 1W2UA 4FOQA 3SXWA 5I0SA 5A7QA 4EE2A 1H8TA 1WMXA 3TKSC 2ILMA 1FHEA 4XJWA 3TCOA 5I0RA 4Q0PA 1J08A 1AR91 3GZAA 5E6HA 2VUPA 5FP7A 3S9FA 1OC9A 3MPBA 1NLRA 2A2RA 2DUPA 1WBFA 4TXOB 2DCZA 3CMIA 2VBDA 4E9KA 1Y3TA 5DMYA 1J1TA 4K6XA 4BU2A 2IMFA 4LEJA 3QCPA 5HR2A 3WV6A 1S2EA 1MVQA 4JGYB 3RGBA 2WFPA 3SITA 4QQHA 4LO5B 3T4VA 1WWYA 4R9CA 1EZKA 4HZFA 1A2JA 2H76A 1BVVA 3C7MA 2XLFA 4CXWA 4KNDA 3O6TA 2CWSA 1EP0A 1G0TA 3NWKA 3DN7A 3UKNA 3CXGA 4LNVA 4K7NA 3HN1A 2F6BA 4CDQB 3THCA 2M46A 3VHRA 4O5QA 5AN1A 4MJEA 1ZA7A 2J1AA 3LW9A 3LPFA 1UNBA 3B5LB 4KG8A 4WM7A 1YJKA 3U5RE 2W95A 5IUQA 1SQ4A 3WNPA 5JVVA 1N3PA 3WNOA 2E9QA 3IDAA 4EWDA 1QJU3 4PX1A 3ZKYA 3EPTA 1OHFA 1RUD2 2YBSA 4XF1A 4MCUA 1PGTA 5CFDC 3KGLA 1W05A 1UZWA 2PVQA 2WWSA 2YDEA 1JOPA 3R0RA 4FYBA 3RYKA 4ZU7A 3VDAA 2OYZA 2DJJA 1SKSB 1JZ6A 1RMU2 1A8MA 4CCDA 4EZ4A 4RA0A 1JHBA 2QCSB 3FHKA 3AZWA 5FUIA 3HJPA 3ZR6A 1ND2A 4ES9A 4OUEA 4E4DX 5FREA 4AL9A 4WZCA 3BIEA 2R6KA 1ZBA2 3V65A 5F8BA 5JR2A 1IS4A 3LOIA 3HNBM 1UMHA 5K9YA 4FAHA 1GOGA 4HT1T 1KEXA 4NRPA 2DTWA 5JWQB 5A7WB 3GJBA 1JZ8A 4A45A 4HKWA 3LEKA 3VZNA 1TKDB 2CHHA 2BNNA 3DCQA 3M2MA 2MMZA 2J23A 1H4HA 2VM1A 3AX4A 1T6GC 3VZMA 2E26A 2VMDA 2B1KA 1VBA2 3B9IA 3OB8A 3T30A 5IMFA 1N1YA 4P9XA 2WZ9A 4NHYA 2VTFA 4J56E 3RHCA 4GWNA 4YZ3A 4YPJA 2FDIA 4YQVA 5BV6A 1GTBA 4MXVA 3LFMA 5JCWA 2WFF2 2HYXA 5JSRA 3IB3A 2N5FA 2DVGA 2ADEA 3KP9A 1RINA 5F39A 1CAVB 4PHZA 1H1IA 5K0UB 2JACA 3L9SA 5JLVA 1GP1A 3ZSEA 1QOOA 1S0GA 1RUOA 4XHXA 1GWLA 3EINA 3ZM8A 3ACIA 5EWSA 1ENQA 1NLSA 4Q29A 2RUFA 4KAEA 4BB3A 1THOA 2ZTNA 2IXKA 1BHGA 2DKIA 4DNYA 2JEMA 4PQ9A 1IHMA 1KXGA 3ILRA 1B48A 2G9FA 3HVNA 1M7TA 1GP4A 2ZMLA 1BLZA 3FZ4A 1GSSA 3M3OA 4ZIJA 2W94A 4NIHA 4ID0A 4GA9A 1UIKA 4QQ7A 3BYWA 3WQ7A 3H7JA 4EN6B 3TEWA 1YLLA 1QJY1 4EWEA 4KDYA 2VM9A 1PGL1 4HL0A 4JDMA 5A7OA 4CCMA 5FLHA 1EV11 2MMOA 4N43B 4I6XA 5J3RA 1B8XA 4JCKA 3CZJA 1GICA 3OEAA 2GN7A 3P3NA 5KN3A 4CUGA 2W1SA 5DBQA 3QBQA 5CEHA 2DBCA 4KCAA 1UZZA 1MPXA 3GHNA 1SDWA 3RYPA 4GQCA 5E16A 4TWTA 5KXEA 2ZZQA 5FZ9A 4IV3B 3QD9A 4NJ4A 4QPGA 2LSTA 5FR3A 4F03A 1HIXA 3J8F2 4LO4B 5IHRA 4FP3A 2MBTA 4DEVA 3BCIA 3M8NA 1LR5A 3NNJA 5H5RA 3WNNA 2VL9A 3ZZXA 3HMYA 1GULA 1PO13 1SFNA 1MQTA 3DPRC 2IL3A 1DG6A 1JTZX 3BCKA 2IWGB 3HAGA 4COYA 2XPDA 1RHI3 1T00A 1OT5A 2BWAA 3N9JA 3D22A 1AL0G 3R3EA 2YJHA 3NSTA 5FCCA 3TB2A 2OJLA 1D0GA 2OUHA 2IXIA 1W6OB 2NBSA 1KJRA 2Y6GA 1NG0A 2FZ1A 3GFKA 3I69A 1PGW1 5FMOL 1CJPA 5C4WB 2V09A 5LBEA 1JU4A 1SG3A 1QJU1 3HPNA 3CHXA 2WYSA 1TEIA 4RR3C 1RUH1 2PWJA 5J4UA 4J1XA 1W6PA 1GOHA 2OA7A 4XFCA 3WQBA 2X8KA 2VW1A 3CQOA 4Q5FA 1RUI2 1DP0A 2P6HA 1VLNA 2H6ZA 4QQPA 1JZRA 3VBFA 2ARXA 2GC2A 1VBE2 1ULPA 5HV0A 1HN0A 3UJQA 2QE3A 3B3QE 3FC0A 3H93A 2VY0A 3WCRA 5D2AA 2R063 3KT4A 3MIDA 2B5YA 1HYUA 1UL9A 2WWJA 1N1SA 3VUOA 1IPKA 3VURA 2W46A 1YC61 3IMNA 4W50A 3RZZA 4M4PA 3J4UH 1AX0A 4CCLA 1SZBA 3ZITA 2P3YA 4CUAA 2L9LA 3LWCA 1UW8A 3IC8A 4GSTA 3D0SA 2J1UA 3PNAA 4LO7A 2JU5A 1ZBE2 4SLIA 1YUDA 1UF2C 3P90A 4IEVA 2BP6A 4Y3OA 2DKHA 1QWRA 1R082 1PQNA 3KZ4C 1OA3A 3QDNA 1KEBA 3RPQA 3ZFGA 3NO8A 3OEBA 4FBFA 2ATFA 4AAXA 3FWEA 4NROA 3RZJA 1U0AA 4XCBA 5LEJA 5FAXA 5K8SA 1ZYBA 4JR6A 2WINB 1TRSA 2ZABA 3I2KA 5ELGA 4M3CE 2LM3A 3VD7A 2VO5A 3N5OA 2HNLA 1WMFA 4NHXA 1S0IA 1CZTA 1IOAA 2E7QA 5EYYA 2ZGMA 1NCRB 4TKYA 3EYPA 4QDQA 5ECQB 5ECKB 3DXTA 4H7LA 4XBQA 2D6OX 4IE4A 2WQ4A 3C71A 3S7IA 5B6NA 4FPYA 4UAPA 1O7FA 4N9IA 2IFWA 1L3JA 3BTXA 1S0DA 3PVOA 3HDCA 3LCPA 4XF0A 3EJKA 2DDUA 2GU9A 1S55A 2Z2SB 5DAVA 3RMXA 1M9BA 5A7NA 1RMU3 1SBEA 1Y4WA 5G5EA 2FUG2 3AYEA 1VRH3 3QH7A 1L7LA 5DAPA 5D8AA 1WCDJ 3KTBA 4YZ1A 1XJAA 2G9GA 3ZVJD 3HXSA 4PUAA 5EL8A 3ZL5A 4L92A 4QX7A 1Z6NA 1HB3A 4XJ9A 3OBAA 2VOKA 3FLTA 1YQ2A 3U4XA 5BNOB 3C7FA 4CEYA 1JZDA 2QVSB 3UKTA 1REDA 1S3DA 1AYN2 5IT6A 5C5UA 2RR12 5E8AA 5I0TA 5LRSA 2HWF3 2ET7A 4Y5TA 5LBBA 3IOSA 4GKYA 4XTPA 3UT0A 5F06A 1LOCA 2NM1A 3I3DA 2HWD1 3TAYA 4XS4B 4O9GA 1LJRA 1VBA3 4Y22B 2ZMKA 4D6RA 3WG3A 2LJAA 4QPIA 4XAAA 3HQUA 5JXJA 2R16A 2RS32 3T0DA 17GSA 4YZ5A 4M3CB 2FGXA 4Q4W1 2DIZA 5A32B 2NPBA 4EQVA 2WT2A 4YSFA 1PM4A 2VIMA 1FI2A 2FWFA 2VBPA 2WSUA 1S1AA 5M0TA 2GZZA 2RHPA 1LOAA 1XE0A 5E4WA 1G9DA 1GUIA 1WMEA 1ZRRA 2XJTA 2R0PA 1NA1A 4A42A 1KQRA 1B9YC 2C0FA 4BPZA 3UBKA 4TR0A 2WFCA 8GSSA 2H75A 2NQYA 2D6PA 2OACA 3ZXJA 4FCAA 4EN9B 2EIGA 2A3XA 1PK6B 3VD4A 4GWJA 2IN3A 4S2FA 2TRXA 3ACFA 1J84A 3CEWA 2R2JA 2ZGSA 2GSQA 1GRXA 4QQOA 1AUCA 1JS9A 1GQHA 4OHWA 2VZSA 3APQA 3G7IA 3ZXKA 1DQ5A 3C7HA 1SLAA 3OOXA 3DXUA 5DUXA 4IE5A 2A70A 4DUWA 1XNCA 3UGFA 4OMVA 3MLJA 2Q0AA 1PL1A 2XG3A 2E32A 4AEDA 3AP9A 3PPUA 1ML6A 2PERA 4LHSA 4LLOA 4Z2AA 3I2OA 4HQSA 4FP2A 3IIAA 4BXFA 1OKOA 3ZMLA 1HJFA 2UWCA 2JDPA 4L8EA 4QKNA 2MYGA 4BWSA 5EFUA 5GLVA 3GL5A 1OA4A 1DE2A 3L9UA 4K21A 1ZZ6A 1ULCA 2RJ2A 4H3WA 5FPAA 3J8F3 3L9JT 4OD7A 4PUFC 1CIYA 3U37A 5BNPA 3RAZA 1Z7PA 2EIOA 1AC1A 1J9BA 5IATA 3QAWA 2J1VA 2OPWA 3T08A 4RQPA 4KI5M 5FWEA 2WA3A 4LBLA 1Y9MA 2H8LA 5LA0A 1DBNA 2DBNA 3E6DA 1WJKA 1FOD2 2C0GA 4WXTA 2OQ7A 3OGSA 4QDSA 3AP7A 1RUD1 2CDOA 1WW7A 1QNYA 5IO0A 2ZA9A 2I81A 3UIWA 5I93A 4LT5A 4I01A 2VNGA 2LV3A 5AFBA 4CSWA 4BQYA 5GLZA 1SBFA 1KJLA 5C8CA 5LWBA 2XHKA 1ST8A 1C8M2 5A6ZA 2CGNA 4NAMA 4FPFA 3I49A 2VCVA 1X9TA 4B4QA 3H9AA 4BMBA 3G6JB 2D97A 1CGPA 5D73A 1U5IA 4JGYC 1A24A 4OHYA 2XGXA 2A6ZA 4G2EA 2K8SA 1WCKA 5IVFA 1TME2 1ZBA1 4ARYA 2PLV1 2PU9C 4LK6A 1I3HA 4FOWA 1G9CA 1C28A 5A3UA 4AJ7A 1DYPA 1M06G 3F4SA 5GLWA 5FYHA 2QQOA 1RITA 2PHWA 1SLIA 4ZY9A 1ZOFA 1YQ5A 1STMA 1JYWA 4QXBA 1TNFA 4CDQC 2ZGLA 1QOSA 2BBAA 3GNJA 1W8ZA 1ZBE3 2XPEA 5LASA 4QWNA 5BUVA 3CJIB 3GMFA 1PMHX 1Z7S2 2L5LA 5A3NA 4KF9A 4K3UA 1KDMA 1E57A 1R083 3D6IA 4ZU4A 1LENA 3SCGA 5FV3A 5LY2A 3BVCA 4OUMA 3WNLA 3ASIA 5A33A 5HFKA 1EEJA 1J58A 4IXLA 3C1RA 2FY6A 4LBMA 3C8EA 1MZ5A 1QMJA 1LHOA 2XWBB 1K3YA 3G7JA 2WFF1 2C3TA 3H1NA 2GALA 4QL7A 4ECCA 3MLLA 4JX0A 1QQP3 3FW2A 4FPLA 1XG8A 5C33A 1W2AX 13GSA 2X49A 2X99A 1M2AA 5G2ZA 4XS6A 1JMUB 2VH9A 2BGPA 5INYA 1K3OA 2A6WA 1OD3A 4ITCA 1WA6X 2XVKA 2RDSA 5FBZA 1UOGA 1DLCA 3MIEA 2E6VA 3UJOA 3IAS2 4QM9A 3AZZA 1EOHA 1TK8B 2IJYA 2HWC3 4YARA 3FFZA 1UVZA 3EYTA 3H79A 2Z4FA 1LOFA 2VCXA 1JI6A 2C3NA 2B1LA 2D3RA 4WBRD 2QA1A 1UY2A 4HXCA 1NE4A 1QUWA 4EN0A 4IN0A 1MS5A 1PVC2 4RFT0 2HZEA 1SFPA 3K3NA 1K0BA 4GB32 4V1Ap 4BM8A 2FHEA 2N7GA 5T3NA 1PMJX 1DGLA 1Q5OA 4TYSA 1PZ7A 4AW7A 3QAVA 4CYDA 3GZEA 2GNMA 1GSFA 2BNMA 1R1A2 5EPAA 2R0GA 5C9AA 1UIJA 3HNYM 4V2WA 3ZYRA 4PGTA 1AXDA 4XIOA 2RS33 3NV1A 3SBCA 5K0UC 1DGWA 2JG9B 3IHQA 1FOVA 2AZ5A 2J22A 4I97A 5FLIA 3RSJA 4XW3A 3WP5A 2WT0A 3LEGA 4IEZA 2GDFA 3KF5A 3J8F1 4JVAA 1XW5A 4QT6A 3WQ0A 2A4VA 4K7OA 1H8TB 2C24A 2WZR1 1TE1B 2HBTA 2UY9A 1B4PA 5T5OA 4N10A 1ZZBA 1MEC2 5HCFA 1YZXA 2QQJA 3DGTA 1JU3A 1ACCA 1KDKA 1OC9B 1V2AA 1A3KA 1VGLA 1KFUL 2XBO2 1WD3A 2Y26A 3VWUA 2AUYA 3ILNA 1R26A 3LDRA 4QX3A 3GYDA 2WRTA 2EF6A 5HR0A 4CEWC 2O89A 4K6BA 2P2KA 4N43C 1VBD2 3ROUA 5GZCA 4GWIA 3MF6A 1SLBA 4FH8A 4LL1B 1QJEA 4Q4X1 1W9TA 3QOUA 1RUI1 2B4KA 1BK0A 1O8WA 2JDMA 3ZIJA 5F2SA 1AXYA 1QGLA 2JB8A 1EUTA 2IZWA 4Q5OA 1VBE1 2R0FA 2IXCA 4BE3A 3MWHA 4IV3C 3WYWA 1O85A 2OE3A 4WM7B 4BJ0A 1SL1B 1MTCA 4OFMA 2CT6A 1ZA4A 1XCCA 1YI7A 3JU9A 1KS5A 4NIAA 4IQPA 2VM2A 3F2ZA 1RK4A 3ZFEA 4OZOA 3OGJA 3VFIA 3KQ4B 4GRFA 1GSYA 3Q74A 3O0WA 1H9PA 4LL4B 3FR9A 1XYNA 2EAAA 3O5SA 2I2SA 3MFAA 2WN2A 3H8UA 4ISQA 4ZXKA 1S3CA 3GCXA 5FP8A 2YNXA 4OUSA 4U2AA 1R081 1H4GA 3OGVA 2YANA 4EE0A 1LCLA 5C4WC 4XETA 5ACA2 3CF6E 1ND2B 4CDXB 4DO0A 5G1LA 2EAKA 1DSBA 1SK0A 2ZXQA 4XDOA 3CNAA 2XHFA 5FY1A 1SL0B 2P34A 4BQ5A 2KM2A 1BQ7A 2DCYA 2H71A 4BK5A 2XKPA 3MF9A 4N0VA 3M1GA 2DBIA 2N5AA 5DDLA 1SKWB 1K0NA 1HRV3 4YQUA 4C1WA 5IK5A 4AVSA 3O1RA 1R5AA 3Q9OA 1O6JA 3N9NA 4IGOA 2HWB3 4Y26A 1ZREA 5EPFA 3M3EA 2B9UA 4IERA 3L2YA 1PMTA 2VUCA 2DUOA 3FBYA 2VZPA 1W9SA 1XQNA 2VU9A 3JXSA 2OZ6A 4TVEA 4HZ2A 1HD2A 2H1AA 4BA7A 3EB7A 5COHA 1USBA 2J7MA 5IIZA 6GSWA 3IBMA 4DOUA 3RNSA 4MADA 1PRXA 6GSTA 1DZTA 1GR3A 1AYN1 3S57A 3G7YA 4I8BA 5CRHA 1UOJA 3R6SA 2RR11 2VCMA 3VDDA 3M3MA 4V2LA 3O7OA 3F0IA 3MDPA 2QBXA 1Z7S3 3Q8BA 4RN5A 1KITA 4AVAA 5C3QA 1HLCA 2RS31 4PIYA 1NCRC 1ND3A 5F5CA 4YM0A 3DYRA 4GLTA 4LITA 2ES3A 5A3WA 3PUQA 3W8SA 3VWWA 3DYOA 4E4ZA 4WVMA 4CY6A 3HKRA 3POBA 2ZOEB 3U07A 3V0BA 1GZWA 2OBIA 4OCEA 5CYYA 2DJ0A 3KMOA 1XU2A 2R30A 4Z7XA 4F8AA 2CGPA 2YV7A 1HX6A 4LJHA 1BEV2 2Q4SA 2A6YA 5FYBA 1JBCA 2Q8OA 4MP4A 4K7IA 1B09A 5HPOA 5JXIA 4RS5A 5ECSA 1GLHA 2UYBA 2WJUA 1ON4A 5JI9A 1TJDA 4YM2A 4PXOA 3SEEA 2R043 1H9WA 1IPSA 1MZEA 5FYUA 1N8JA 1A78A 4QB1A 1FOHA 4BIFA 3D4MA 3G9BA 4NPRA 3O1MA 4QPGB 2GNTA 5G1KA 3PR8A 4MYEA 2YB7A 2RS13 2VZUA 1PO23 4AWDA 1WD4A 1W0NA 4AVCA 2FZ2A 1W8NA 2IXLA 4TXVA 5GAND 5JZGA 1M0UA 3VBUA 2UWBA 1PVC3 1MQTB 4XFHA 1LOEA 1XOYA 4GB33 4JHTA 3M9KA 2VUJA 2DVBA 3PTYA 2FDGA 2Q5TA 4MX3A 2P0GA 2C0EA 1UAIA 2JZTA 3N9LA 3K46A 2GSRA 3PLQA 3F6DA 3NKGA 3MPPG 1R1A3 1J1LA 5GJ6A 1FPN2 1BEDA 4L5LA 5ECMB 1BBT3 4GTUA 2AHEA 2KHPA 4KL1A 4DMIA 2VCTA 1W6PB 2GGTA 1BXHA 1OA2A 4DUVA 3DL3A 4UI9L 5LA2A 3NMBA 5DN2A 2XBQA 4MPFA 2E2MA 3IXRA 1RJ8A 1NZIA 1QF3A 1PK6C 1YQ6A 3GF6A 3VBFB 3KVBA 2MPFA 2YV9A 5LCWL 2A73B 2VE1A 2WNVA 3PJQA 1MEC3 1Z78A 4XUOA 1MACA 5CAZA 4PBOA 4LK7A 3ME2A 5FIXA 5KXDA 5IW0A 2QC7A 4EL1A 2QDRA 4Q0QA 4YW5A 2XBO3 4CDUA 3CU7A 1E5IA 4NXIA 2JXAA 2MZCA 1FOD1 2ZGRA 2PUKC 4MUVA 3VZLA 5DZEA 3LGRA 1ZYNA 1U5YA 5KHIA 4R9BA 4RFRB 3AZYA 3GYKA 3D4TA 1CAUA 3CSHA 3PMSA 2WBKA 2V1MA 3WX5A 1JH5A 2D43A 4KGQA 4RL7A 4ZL7A 3RZHA 4MJCA 4HQZA 2R6QA 5CKQA 1VBD3 4XIKA 1AL21 3FZ9A 2BU9A 3U75A 2C1YA 1ABAA 2H73A 1W8HA 3H50A 3PURA 3ZFGB 1UZYA 1C8M1 5C3PA 1XOAA 2TEPA 3QOPA 1NHYA 4X6QB 2K46A 1WWJA 3UMAA 2Y6HA 4MH3A 3LDBA 4QU2A 4CHSA 2E7AA 2VW0A 3FZ5A 1EWXA 3W5MA 3KIJA 1TME1 1ASJ3 3LSDA 1F2NA 4YVWC 3MHZA 1UYYA 1GWMA 2Y60A 2QSIA 3FEUA 5APAA 4UW4A 3VV1A 1EEMA 4FPGA 4AF9A 1PX3A 4KWUA 5I0UA 2HEWF 4Z07A 5F5AA 4HDEA 4KH7A 3FZAA 3ES4A 3KT1A 5T5LA 5C70A 5B8AA 3D0ZA 2VQUA 4E2SA 5DCGA 1RVF2 2YU2A 4IW3A 1EAH2 3M8LA 4KBBA 4ASMB 4NWVA 1WGPA 4M3CF 1S0FA 1Z7S1 5JDBA 1XWCA 4K0GA 2B8MA 4ECJA 5D8AB 3V0AA 1H2NA 2LJRA 4CVUA 3OCPA 2HSYA 3POYA 2DSAA 1GL8A 4YZ4A 1WCUA 3LFLA 4D3WA 3CQFA 3RJ2X 2FHRA 5C04A 3WT1A 4HK8A 1HQLA 4KWLA 3JCIA 1VF2A 1YKAA 3Q6OA 2Y64A 5DDJ3 1W2OA 1GANA 1KFXL 4QHZA 2R37A 3IN9A 3IAM2 4CEYB 4IEOA 1HKDA 3GBWA 3FLRA 2XUEA 3K77A 2GT5A 1PNGA 2O14A 1C5HA 1KS4A 2H1GA 2YBKA 4IE0A 4BISA 3N7JA 5FY9A 4BL7A 4GMP1 4FTBA 3I3QA 4QPIB 2FCHA 1OBNA 2VLTA 1SPPA 1U88A 5H9QA 2VCCA 2PTMA 1LESA 2EIEA 1F15A 1CPMA 1ULEA 2D6KA 2XQXA 2MMAA 1PM7A 22GSA 3ZTLA 5LD0A 2XJRA 3WDVA 1XWGA 2W08A 1I5GA 4KU7A 2M72A 4AFBA 3M0FA 3CJIC 4J57E 1NA1B 1N3QA 1PVC1 5I91A 5J41A 5A80A 3I2FA 2ZBJA 4P9GA 1X36A 2OZJA 5JMOA 3VPQA 4WETA 1I9RA 1SJ6A 5DXDA 2ZHKA 2GSTA 1NZCA 4YNIA 5FYTA 2RM22 4QU1A 2RIIA 3LSEA 2RMU2 2E53A 4GCIA 1RUE2 1H6YA 2QQNA 3TNQA 4BWOA 3F63A 1VAMA 1QH6A 4JEDA 1RUF2 4QB2A 4ZZ5A 4QPYA 3WP6A 3D4KA 1BG5A 4XOGA 3C7GA 1FB6A 4Y1ZA 4XHMA 3T0BA 3WLUA 3KV6A 3DD3A 2J1SA 2AEYA 3WGDA 1AQVA 3CBUA 4LBQA 4Q4V2 3X29B 4AEDB 4FFGA 1ZVFA 3B94A 5FYSA 5FY5A 1M9AA 3K48A 1AYM2 5CRWA 1BEV3 3IE3A 1QKQA 4MOAA 4OI1A 1VBC2 4ONUA 5A4WA 4R8HA 1C8NA 1XWBA 5HR1A 3DYPA 2XBO1 2VG9A 3S6PA 5I8YA 2UZ8A 4ULXA 3BGAA 5J37A 4A7ZA 5FYVA 4YW1A 4DZGA 4PNFA 1XXUA 3ALQA 5AVAA 1GWCA 2FMYA 5GKAC 3MIGA 3WDWA 2PAKA 3OPTA 2RS52 3IAPA 2NYYA 1AR73 1XYOA 1DYKA 1Y6EA 5BNPB 5GALA 4K1YA 1CONA 5F37A 2WLPA 5ECPB 3LQCA 3IAQA 3VGIA 4ZZ8A 4ORFA 1S4CA 1XW9A 2J1RA 4NMIA 4OHVA 2Z42A 4RQPB 4TR4A 1DQ1A 2JG9C 1OPMA 1K45A 4LULA 3PH9A 2BJXA 2M80A 2YZ4A 3PU8A 5FZHA 4NRMA 4PI0A 5L9BA 1NUKA 5FQ0A 3VBHA 5ABJA 2Y6LA 3NRUA 3IWZA 1WW4A 4MXWA 1FPN3 4TOPA 4K8RB 1H6XA 2VZ1A 5BNNC 4KGGA 1QEXA 4JTNA 4G9HA 1MS1A 3TJBA 3GNEA 2K9FA 4G4FA 1TMF1 3KTLA 3WY6A 2CX3A 1IKQA 3LEMA 5C8CB 3GKNA 1K5MA 5E89A 1IS3A 4AI3A 5IFTA 4K0NA 3ZFFA 4FVVA 1F4AA 4E27A 1JZ7A 1W8FA 1DIWA 4EDYA 4LE4A 4LBOA 5ACA1 1UYPA 1YFUA 4NIIA 3EURA 1WW6A 1OD5A 4QAWA 2L6DA 1HB2A 4V2MA 2HBUA 4EXJA 4XJAA 1V6OA 3EWLA 2WJSA 3OBTA 4JTOA 1YO8A 4JRAA 3QD6A 1OFNA 2TUNA 4R4ZA 5CP1A 4JRLA 3ZXEA 2P5QA 4P14A 2W5FA 1OFSA 4FT8A 2FDKA 2YUEA 4PCRA 1E5SA 1AR62 4AGSA 3POWA 5FZ6A 1YF0A 2P37A 4AGGA 2GLRA 3APOA 3ZVXA 2GN3A 2CWMA 2JDHA 2RDQA 3B9CA 5DALA 4WM7C 3F6FA 4CP9A 4H7MA 1YFYA 4M4RA 3RBTA 2XWJB 2VUAA 4GXLA 2N5BA 3ZIVA 1U3IA 5A33B 5H5SA 3I3EA 1MD3A 4X1UA 3ZX7A 1SMVA 1RYYA 4YRDA 2I4AA 3T1LA 1SEFA 1OAZA 5IMVA 2BW8A 3EO6A 2PHUA 1QJX3 5ERLA 2XR4A 1T4YA 3SLIA 2IIYA 2OUJA 2DVFA 2K0GA 1RB8G 1UMIA 3TEZA 4QHOA 2FD8A 2WGRA 3O0VA 4I0AA 3AP4A 5FZ7A 3GX0A 2HLEA 1HXS2 4OHXA 2VAUA 5CAXA 4ISRA 2X53S 3KM5A 3WF2A 1ND2C 3PHMA 4AEMA 4CDXC 1W4VA 2AB6A 1RVF3 3ZIXA 3KVAA 4AI9A 4CTEA 4LHNA 5EY6A 3B7MA 2OIIA 4H2AA 4G0LA 2LUSA 5KN1A 4N7UA 1DLLA 2E63A 5EIYB 4Q5RA 2QQPA 2YP6A 1SLLA 3KT7A 3H42B 4HFSA 2L57A 4BQ2A 4AQ2A 1VB2A 2DCKA 4M0NA 3AB0A 2E31A 1V98A 2WCIA 3FZ3A 2JIGA 4GSSA 3I6AA 4LR4A 4K1ZA 2HZEB 2BERA 11GSA 4YKGA 5DUWA 2YPMA 2MEV2 2LRTA 1HV1A 4AF2A 4HJ2A 3Q8CA 1H2MA 3I59A 3VPTA 4E4HA 4ECBA 5C9AB 2OKXA 3JBG1 4YVSA 2X8HA 5CB7A 1Y9GA 1Y43B 5AGYA 2B5EA 2Q1FA 5IK8A 1UO9A 3HVVA 4ML1A 2ZHNA 4XFFA 2EA7A 4NPLA 2WNUA 4YKFA 1NOVA 3RS6A 2CAVA 1S0BA 2ZX0A 4RHV2 5D21A 4L9BA 3L0HA 1MZFA 3O0XA 2W87A 1QY4A 4AGRA 1XXNA 5FZIA 2LNSA 3I2IA 1NCQA 2VLUA 3HBZA 4EN7B 1NSWA 4P9YA 3AZXA 2FBEA 1QH7A 1JOJA 4Y20A 1WCQA 3NAPA 2W0XA 3AJZA 3UETA 1TU7A 2YROA 1PX6A 1FPN1 2CA8A 1CN1A 4KSOA 3M7AA 2F4LA 5FZCA 3Q8EA 1RUF3 3LKJA 1LGNA 2B9VA 2O8QA 3TOUA 1FMD2 2PHDA 4PTSA 2GT6A 1SYXA 19GSA 3HWJA 3K8NA 2NVLA 1LOBA 4YGCA 2JADA 4IL7A 1H4OA 2XUMA 3WF1A 1JYXA 3W58A 1OF4A 4HSLA 3IBHA 1LTEA 1W9FA 4DUXA 1UZVA 5FZKA 1RUG2 2C80A 2I45A 3FHAA 2UY8A 2JX9A 1WE0A 1EY2A 3KQRA 2XJVA 4QPGC 1FV3A 2LW8A 2NMOA 2PHTA 5HCAA 3CLPA 5CRDA 3A5WA 3VD9A 4ZL8A 1QOTA 2E0QA 2H6XA 4D7TA 4Q0VA 5ECOB 5FKBA 1JZ3A 2W47A 3E5QA