5CYYA

Structure of the c-terminal domains of dipz from mycobacterium tuberculosis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
333
structure length
333
Chain Sequence
TGTEIREQLNLGGIVNAQNAQLSNCSDGAAQLESCGTAPDLKGITGWLNTPGNKPIDLKSLRGKVVLIDFWAYSCINCQRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAKGAANLGISYPIALDNNYATWTNYRNRYWPAEYLIDATGTVRHIKFGEGDYNVTETLVRQLLNDAKPGVKLPQPSSTTTPDLTPRAALTPETYFGVGKVVNYGGGGAYDEGSAVFDYPPSLAANSFALRGRWALDYQGATSDGNDAAIKLNYHAKDVYIVVGGTGTLTVVRDGKPATLPISGPPTTHQVVAGYRLASETLEVRPSKGLQVFSFTYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein DipZ
publication title Structure of the ectodomain of the electron transporter Rv2874 from Mycobacterium tuberculosis reveals a thioredoxin-like domain combined with a carbohydrate-binding module.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Membrane protein
total genus 91
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF17991 Thioredoxin_10 Thioredoxin like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5cyyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5cyyA01
2I4AA 2VL2A 1ULPA 2VCVA 2IFQA 3CXGA 3GKNA 2F51A 3GGLA 3RBTA 1UZ0A 3ZFBA 5E59A 4IBPA 2GVPA 1UA5A 3LE0A 3KXOA 4MH3A 4I2TA 2HRFA 3G7YA 6GSUA 2G2QA 4JE1A 2X05A 2M80A 1Q98A 1TP9A 3KGKA 2LRNA 4ZB6A 1WPIA 5AGYA 3W8JA 5HFGA 2Z4FA 4ARYA 1SDDB 4M4RA 4V2MA 1PSQA 3L0HA 4EUYA 5AIVA 2RUFA 2WFCA 3BJ5A 2WO1A 1WKYA 3F3QA 2PU9C 4MPFA 5LA0A 5IYYA 4D73A 4V2NA 4CU6A 2DJ0A 4RUVA 1HNAA 5HPOA 2VJXA 2IMDA 3H79A 4KA0A 4MGSA 1YY7A 1V58A 4JRRA 1FOVA 3ACIA 4GQCA 4KGIA 4POKA 2W87A 1JZWA 3M9JA 4HQZA 4W50A 1GNEA 14GSA 4K7OA 5D96A 1L7QA 3LPFA 3TJKA 1CZTA 2H66A 22GSA 2AB6A 4AF2A 1SK0A 3BCIA 2W9XA 3IRAA 3I2FA 4G10A 3HNYM 4XUNA 3A2VA 4HOJA 4K0GA 5AISA 6GSSA 1E6BA 1Z9HA 4XVHA 4MLYA 4Q5NA 5HR1A 2XOMA 1M2DA 3HNMA 2GSRA 2GQLA 2VCWA 3GL3A 4O5RA 2VCQA 1SYXA 2P0GA 2FLSA 2RUEA 4K7IA 1O8XA 4HJMA 5FHIA 1G7EA 2J1UA 2B3SA 1LNSA 1EOHA 3LFLA 3NIVA 4KB3A 2WYSA 2CX4A 4IN0A 1OF4A 2R6KA 3T08A 3U37A 4EE0A 1PD21 4KW6A 1R26A 2GSQA 5C71A 2JL4A 1CIYA 4GWRA 2VZOA 1SU9A 4Q5FA 5IHRA 3F4RA 4AJ8A 1YZXA 2VZUA 1C72A 4ULXA 2ZEZA 1I5GA 3THCA 2PUKC 4OWYA 2ZXQA 3TOUA 1K42A 1Z7PA 5LA1A 3KP9A 2YZHA 1FAAA 5H5QA 1AIUA 3VD7A 3DKSA 5A4UA 3CMGA 1HNCA 3DVWA 4MADA 1K0AA 6GSWA 5FWGA 3BBYA 3T09A 2MMAA 2PBJA 1X9WB 4TXVA 1GL8A 5J9BA 1TU8A 2ZCTA 2V32A 3GYKA 2EC4A 4LMVA 4NXIA 2V41A 4XUPA 3KCMA 1TJDA 3I97A 1AC1A 1P8JA 1MD4A 3I2JA 4XTSA 4FIWA 3SEEA 2W1QA 2JKXA 4BL7A 2OA7A 4GRFA 4N0VA 3KIJA 2ES7A 5EJZB 3FY7A 5JCUA 4F82A 3A22A 2WCIA 2HFDA 2FD3A 2ID4A 3FR6A 4YQUA 5G2ZA 5ECKB 3IK9A 2ON7A 3LSZA 2B7KA 3WSOA 1TK8B 2FCHA 5KN0A 2VZVA 1H4OA 1GH2A 4CUCA 2FGXA 1OH4A 2NBSA 5ECOB 2CA8A 3WD6A 2W95A 3CKHA 1GSUA 1EP8A 1PMJX 2EIBA 1BG5A 3KMOA 2JD9A 3OGRA 2I81A 2L6CA 2YN1A 1XBSA 2VOTA 3DD3A 4MJBA 3GNJA 4QQ7A 3CZUA 2VOCA 3M0FA 4MF5A 1X5DA 3IDVA 1GSEA 2B5XA 4E8EA 2XHNA 3T2QA 3FRCA 4GF0A 1G7OA 3EINA 1QQ2A 5CYYA 1A24A 2VL3A 3BCKA 4ILFA 1ZL9A 3G7JA 2C80A 2VZ1A 1OF3A 3P2AA 4JR6A 5GAPD 1B48A 1FB0A 3IHQA 1SHWB 3L78A 5LCZA 5G5EA 1B4QA 2DMLA 2J1RA 11GSA 5J1XA 3D22A 3NJXA 4QPWA 2LRTA 1ZYQB 2CVBA 2O89A 4GWIA 1XWKA 1SYRA 4N30A 3HNBM 2XONA 1U3IA 2HYXA 3QAVA 3GRXA 3EMXA 3LWAA 1V98A 5CZKA 3TRXA 1VGLA 3KTBA 4XUQA 4WF4A 2A4VA 3HVVA 1Y25A 3LJRA 5ECSA 2B9VA 2VMEA 2GS3A 5F06A 3ZVJA 4HU7A 4LMWA 4W4ZA 4JX0A 2CVKA 5IMAA 1M9AA 1W8OA 1X5EA 1ULOA 1Z6NA 2H1GA 3CSHA 3ZIVA 1JHJA 3ZYWA 1BHGA 1UXXX 4MJCA 3RPNA 2V6OA 3ED3A 4Q5RA 1J0FA 3ETPA 2H6YA 3KJYA 3VPQA 3ERGA 4IJIA 1X9MB 4XURA 2FA8A 3DIEA 5IO2A 1G0TA 4ECJA 1KEBA 2WN3A 5JXJA 4P08A 2ZEYA 2B7JA 1S3AA 3F6FA 3QPMA 2YCDA 5GZZB 3HJRA 1SJIA 4MJEA 4ARXA 1DYOA 3IK7A 2PQSA 2DJ1A 2CAQA 3I69A 3DGQA 4PXOA 1KTEA 2BTOT 1V9WA 2V1MA 3VFIA 3TJFA 5LA2A 2C0EA 2H8LA 3D5JA 5CRWA 5AN1A 2W94A 4K8MA 5ECLB 5IO0A 4P3YB 4J2FA 2DBCA 3TGZA 3W8SA 1XWBA 1QXHA 1K12A 5F0GA 3FHQA 1TU7A 1T4ZA 5ELAA 2OBIA 2C4JA 1S3DA 2P5RA 4OFMA 5B8AA 3NQHA 3GL5A 1A0RP 5EJ1B 1K0OA 1Q4JA 4JBBA 4PX1A 4ECIA 4NHZA 2RVAA 4K2DA 2LKUA 4CUAA 1OC9B 3WT2A 1SL0B 4OUEA 2QQIA 2IN3A 4IS0A 2CZ2A 5DCHA 2LRCA 1L7RA 4XS1A 3TKSE 2LJAA 4A3ZA 5GSTA 3TRPA 4DSRA 4BPYA 4H86A 1JHBA 1B9XC 3C7EA 1M2AA 2LW8A 1NSWA 1F4AA 2VZPA 3OBAA 4HU9A 3T0AA 18GSA 2R37A 3UAPA 1R5PA 2RJ2A 2FHEA 1UX7A 1GLQA 2HLSA 3LEIA 2H1AA 4TRXA 1PA3A 1YF1A 4PNFA 2WZEA 4QX0A 2OADA 2LQQA 2M46A 2WN2A 5L71A 3QAGA 3LQCA 4QB1A 1MDKA 3EYTA 2HLEA 1XVQA 4N0ZA 3AY8A 1WJKA 3D6IA 2OE1A 2VQTA 5ELGA 1GSDA 2CVDA 1AUCA 1NAEA 2OE3A 3Q18A 3LGCA 5I0DA 2HZEA 2X10A 2JADA 5DQ0A 2DCKA 3HKRA 2GZPA 2H72A 4L5OA 4OZOA 5HFIA 4QX3A 1A2MA 1IYIA 4MK3A 2C1YA 5ECPB 2PVQA 1EEJA 3WNOA 4ZBBA 4P00B 5IMDA 4EC0A 1ERUA 2DJKA 3CDZB 4XRAA 4ECCA 1O8WA 5CAXA 3UVTA 4MJAA 2C9KA 3A2WA 4JR4A 2FUG2 2VCAA 5EVOA 3K4ZA 4XIHA 5DN2A 1HYUA 1ZCPA 4N11A 1URMA 2C26A 3I2IA 2YB7A 2VCCA 3I43A 3EE2A 1MD3A 5D9XA 3TKRA 1NUKA 1M2BA 1UYXA 3QCPA 4DSSB 3MV01 3LORA 5DQYA 3F6DA 4TW5A 3I2KA 1JU3A 2I9HA 3DVXA 5IMFA 4ZZ5A 2DSAA 1EUUA 1OE8A 3K46A 2KP2A 1K3LA 3C8XA 1TRUA 4OMVA 4MP4A 4FH8A 4O92A 3K75B 2B5EA 4WKWA 3Q19A 2YWNA 2W92A 4TR1B 1US3A 3OEBA 1GUMA 5G1KA 2VM2A 2K8SA 2W91A 3A7QA 3QD9A 5B8BA 1DP0A 1UVZA 2WO3A 3VDAA 13GSA 3IOSA 2GLRA 2WO2A 3ZTLA 2EIDA 2QSIA 3GX8A 1WWJA 1TI3A 1TK5B 1NHYA 2KLXA 2TRCP 4Z2AA 3GN3A 4WBJA 3HDCA 4I2UA 1F2EA 3I6AA 2D2ZA 5DJMA 3P1IA 3C1RA 3F2ZA 3OR5A 1Z6MA 4TOPA 2HNLA 5H5RA 3ERWA 1GTIA 2C3QA 3BD2A 2EIQA 7GSSA 2Y6JA 4GXZA 3F3RA 2K6VA 3KM6A 1YEXA 1UMHA 4LA1A 3WF0A 2HE3A 3I2GA 4KCEA 3VWWA 3UOMA 2J1SA 3HJOA 3QAWA 3IDAA 4GSSA 4OCEA 1T7PB 2DCJA 2DJ2A 3ACHA 1UWWA 2VMDA 2VM1A 5DPNA 2KD7A 1PN9A 1UY0A 2OKXA 4RQXA 4IP1A 4GSNA 2YWOA 4ZL7A 3GUSA 2ZEXA 5JCGA 3HXSA 1BEDA 4KDYA 9GSSA 2L6DA 3KTLA 4EDYA 3KZQA 2IMEA 1TRWA 3CQOA 1PX4A 4TXWA 2VLVA 2C0FA 3VD3A 3F4SA 4LLRA 1YDKA 4IHUA 1QFNA 2ZUPA 4F9ZA 3ZREA 2L4CA 3FZAA 3F4TA 4EO3A 4POBA 1THXA 3C7FA 1F37A 3LXZA 2TRXA 4IGJA 4J56E 6GSVA 2LS5A 5ID2A 1FHEA 1GUIA 4IW9A 2GSTA 5A4VA 2DIZA 1JLWA 1ST9A 3GXUA 4GQFA 2PWJA 2L9LA 1YKCA 2VMFA 5A4WA 4KI5M 3FEUA 2VLUA 3F63A 1ZGNA 2GZYA 2NPBA 4QDRA 3HD5A 3OB8A 3EVIA 3QFAC 5J4UA 3VWXA 2EICA 2WUHA 4LKSA 4O32A 2YV9A 1XPVA 3A2XA 3W5NA 5F7UA 1Z7RA 3US3A 1DBYA 1EV9A 1K0DA 2VL4A 4MCUA 3GV1A 3L9UA 2P5QA 2J7MA 2KUCA 1JU4A 4G9HA 2BZDA 4CHSA 5B6NA 3EWLA 2WBKA 4DVCA 3D3AA 5ID2B 4DUWA 2VQUA 5LCWL 1W9WA 5LNKe 4Z7XA 3KD0A 8GSSA 2N5FA 1AQVA 5F8BA 3QDNA 2X99A 2Y6GA 1V2AA 2N5BA 5C04A 4ET7A 5JUVA 4MF6A 1GOHA 2YPMA 4AJ7A 3C7MA 1SG3A 2VD0A 1THOA 2FY6A 2QQMA 5AIXA 2YC4A 2H0IA 1AXDA 1SENA 2VCTA 1K0CA 2C0GA 3VLNA 1QK8A 5FT3A 1K45A 3QMXA 3LPGA 2Y8KA 3J7Yb 5B4NA 2BJXA 4ZBAA 3WF2A 1FO5A 3D0ZA 1XWGA 3TKQA 1F4HA 1SD9A 1MEKA 1QGVA 3HY2A 1JYXA 1UXZA 3MV11 4M4PA 3GKXA 4WEYA 2W46A 3ERFA 3CZJA 1ZZYA 3M1GA 3VI7A 4TVEA 1KNGA 1OD3A 1YQ2A 3IBHA 2Y6HA 5CNWA 1CQGA 4LQRA 3EYPA 2JACA 3GMFA 2G0FA 1PX6A 1RYYA 1FVKA 3I9V2 1R4WA 3FYGA 5IOXA 1S3CA 4OYUA 4LPLA 1H6XA 1WMJA 2WRTA 1V40A 3JCML 3H1NA 2OKAA 2VD1A 4YQMA 2AV4A 3Q74A 4PF1A 2GQMA 1J83A 3G7IA 3P7XA 4X43A 1PMTA 4EXJA 2HSYA 1UY2A 2WGRA 3IA1A 1JZRA 1EWXA 2H74A 4EL1A 2I3YA 1JZ4A 1NX9A 3D21A 4K7NA 4XCSA 1PL2A 3EB7A 1IQDC 2WZ8A 2LQOA 3FW2A 3DECA 3K8NA 4PUAA 20GSA 1GTBA 2WS2A 1VF1A 4W8JA 3MUY1 5D93A 1ML6A 2CZ3A 2LEGA 3GDBA 2XBQA 4XS6A 4G19A 2R4VA 3H8QA 4HDEA 4IVFA 2V6KA 1X0RA 2YG0A 4QX2A 2VUPA 4QL9A 4K6XA 2X8HA 3P90A 4EKZA 2H76A 2C4XA 19GSA 4OFTA 1TRVA 1GU3A 4IQ1A 4KDXA 3HZ4A 2YNXA 2JZSA 1TK0B 4DXRA 5CP1A 3WYWA 2Y6LA 4V1Ag 4E8CA 1EEMA 3ZMLA 4F0CA 2YFZA 2DC5A 4PGTA 5IPGA 1U87A 1US2A 5JR2A 3BGAA 4DUXA 4ZIJA 1D7PM 2GT5A 3PR8A 4FYUA 1B8XA 4HQSA 5FUIA 2C3NA 3PGTA 3KH7A 1QMVA 4HEA2 2B1KA 4KNDA 5HFKA 2VCXA 3GH6A 4BK4A 3FHKA 4NV5A 4QAWA 2J22A 5JMOA 2YZUA 3HOBA 3GM8A 3EMPA 2VZTA 3THDA 4XUOA 5EL8A 1JYVA 1SK2A 2K8VA 3IAM2 2K9FA 1NM3A 2FWFA 2RV9A 3VI5A 3FL7A 3W6GA 5DQSA 4BJ0A 4L8EA 4JZQA 3TDGA 2JSYA 2PPTA 5J5NA 2MZCA 2H19A 3O6TA 2OBKA 3IB3A 3NOFA 1UC7A 2CT6A 4CW9A 2VCBA 4TXOB 4ZZ8A 1GUHA 1OVNA 4PQ1A 2RLIA 3CRUA 2MBSA 4D0QA 2GGTA 4MDCA 3PINA 4IJ3A 2J1VA 4ZBDA 4O7HA 3FHAA 3TKSA 1EZKA 3WF4A 1OC9A 1W8NA 4TR4A 3J7Yk 2VLTA 1ABAA 3VURA 2C0DA 3TUEA 4POLA 1KGYA 4MGQA 1XNTA 4XUTA 4HS1A 1K3IA 1ERWA 3C1SA 1OKTA 1CQHA 3GH9A 1UY1A 2YOIA 2QQJA 3IXRA 3GSTA 4ZXEA 4ISDA 1TTZA 1O6JA 5G5FA 2WZ9A 2E26A 5DAKA 4GSTA 4ZILA 2VIMA 3HJPA 3K4AA 1SKSB 4X1UA 3WF1A 17GSA 1VRSD 2WDUA 1G6WA 2HT9A 2IIYA 3P8WA 3HVSA 1SK1A 2QQOA 1DSBA 1JZ5A 2XQXA 5ECQB 3C7HA 2F8FA 2H73A 4PT6A 2REMA 5IMCA 3ME7A 1XCCA 1O59A 1O81A 4L0UA 1EUTA 5IJRA 4QDSA 4HI7A 3K4DA 3IR4A 3N5OA 1UY3A 1F3BA 2V4VA 3DMLA 2R5GA 5IIZA 4ID0A 2LJKA 3WGDA 5IQYA 3O76A 1XWCA 1SL1B 4EDZA 5CREA 3H4KA 1N8JA 1GSSA 5DAKB 5GSSA 4IKHA 1MDJA 1WP0A 1GSYA 2V72A 2BGOA 3HJMA 2CDOA 5G05L 5HQPA 1RW1A 1EV4A 1U6TA 1J08A 3OG2A 1FW1A 3IV4A 1H75A 3LQ7A 4NPBA 2H01A 3IE3A 4P5YA 4NV2A 4JHZA 2HI7A 1VF2A 3E3EA 3UMAA 2ZEWA 1JZ3A 1NKGA 3SWLA 1JYNA 4BA7A 5DMYA 3FR3A 1OT5A 3MWHA 4GZ9A 2V5DA 4DSSA 3CSJA 2IL3A 2ZNMA 2BGPA 3CRTA 1SKWB 1O8SA 3L4NA 3WNKA 3FZ4A 2B4KA 3UBLA 3S9FA 5ENUA 5D9TA 2WB9A 4CU9A 3TB2A 2H30A 1FVJA 2KOKA 1W9TA 4TR1A 1YKAA 4WBRD 1I9DA 1WIKA 3GHAA 5DALA 4KWUA 1UYYA 2GSSA 2XC2A 3MBWA 4JKMA 2IWTA 1K3OA 2EIOA 3UESA 2YJ7A 4V2LA 3F8UA 2J1EA 4KCAA 1GRXA 3A3TA 2NDOA 4PQQA 1OAZA 1OC8A 5J9CA 4CU8A 2VO4A 3F0IA 2P31A 3HZ8A 5IPHA 1W89A 5F05A 2EIRA 1M99A 4FYCA 1BX9A 5IMZA 3OGSA 1XZOA 3IPZA 3WGEA 1X9SB 2LTKA 1LBKA 4DEVA 4BVYA 4LHSA 2VC9A 1JLVA 3A5WA 3APQA 5INYA 1W9SA 3V1WA 1JI6A 2IMKA 4JU5A 5DALB 2VCZA 4K9ZA 4F2IA 3IIIA 2BERA 4MA9A 4RN5A 3G9BA 1O85A 1ZYEA 4KAEA 5DCGA 1GNYA 3CIHA 5G31A 4XZUG 4K0NA 5LD0A 2ORXA 5CO3A 1OKDA 5GAND 2E31A 4IQAA 4TKYA 2JSZA 2H75A 1FG4A 4I8BA 1XW9A 4QL7A 3I2HA 2GZZA 1J84A 3GSSA 1F6MC 4PQIA 2HXKA 2H6XA 3WNMA 4XHMA 4LL1B 1XXUA 2XPEA 4J57E 5COHA 1SJZA 3VD9A 1GOFA 4A45A 2J23A 3VWVA 2QQLA 1JZ7A 2IMIA 3QOUA 1JZ2A 1PX3A 1BQ7A 2RM5A 1O7UA 1SD8A 1TVGA 5EIYB 3DRNA 1EGRA 5H5SA 1EGOA 2X8CA 4JEDA 2WAAA 3ECQA 2OACA 2JE8A 4OD7A 4WF5A 5HR2A 1M7TA 4GTUA 1GSFA 3VD4A 1JZ6A 5IFTA 5HR0A 4NMUA 1R64A 2LNSA 3HVXA 16GSA 5J3RA 3KMNA 3R2QA 2YP6A 1WE0A 3LG6A 1BJXA 2J9HA 3WNNA 2O7KA 3LEFA 1TXXA 3WNPA 3GTUB 3AC0A 3WF3A 3CTFA 1TRSA 3TJJA 3SKJE 1GNWA 4BXSV 5JWRB 1JFUA 3I3EA 5A5KA 1U3AA 5HXMA 3HN3A 4DEJA 5F07A 2VZRA 2J1AA 5JXHA 1PX7A 2FWEA 3TOTA 3P6BA 1T1VA 4BWQA 1ERTA 5B4XA 1GWCA 2H1BA 3IAPA 1ZOFA 3M8NA 1A8LA 2XPDA 3VDBA 2IFQB 3ZVJD 1PKWA 3RAZA 2DJJA 3O3TA 3WNLA 2L5OA 3PUHA 1HD2A 1JYWA 4POMA 3FN9A 2E33A 6GSTA 1XNAA 4X0XA 2ALBA 2JDAA 4KUNA 4ZXGA 6GSXA 2L4QA 4UAPA 3KP8A 5KN2A 4AG4A 4K1FA 3APSA 4XRDA 2LV3A 3JXSA 4QDQA 1GTUA 2X64A 3UJ1A 4ZL9A 1T8EB 4NAXA 2CAIA 1EP7A 2PVOC 3GURA 2Y64A 4AAXA 3T0DA 1QUWA 2F8AA 2IJYA 4L5LA 4MZWA 2WQ8A 1SKRB 3MNGA 4JKLA 3APOA 3ZITA 4FYBA 4MMMA 4I5QA 5ECNB 3L9SA 2B5YA 5IMVA 2RIIA 2ON5A 5EPFA 3U5RE 3C7OA 4D73B 3Q6OA 1GTAA 3I3DA 5JXIA 2VO5A 4RQRA 1TW9A 2DMMA 4OCFA 1A8YA 5ABRA 1A0FA 4YH2A 2J1TA 2XHFA 4DXSA 3WT1A 4OO4A 3HHVA 2VZ3A 3RPPA 2AHEA 4FO5A 1MPXA 4IP6A 2W1WA 3K77A 2QQNA 3UBKA 2E0QA 1H6YA 4CDOA 2YWMA 1J9BA 4WETA 1ZMAA 2EIEA 2B6MA 5CRDA 2CDPA 4HG6B 3RHCA 1UMIA 2VAFA 2N5AA 4KMQA 3UL3A 4DSQA 1TKDB 1DE2A 3ZM8A 5G04L 3C8EA 1R7HA 1A2JA 5D73A 5KN3A 1AW9A 2TIRA 3TCOA 2IMFA 3FZ9A 5CRGA 2W47A 2JU5A 2R7EB 3RHBA 5JXGA 2QKEA 4ZB9A 3J7HA 3NNGA 1OC3A 2X09A 3E9JB 4KE3A 2C8UA 3LXTA 1LJRA 4MF7A 4HJ2A 4EF0A 1K0BA 2M72A 4WR5A 3HYPA 1XW6A 2QGVA 4GLTA 3LYKA 3CYNA 3LEGA 2X8GA 4TR3A 2HSHA 1G6YA 3L9VA 4YAPA 1JZOA 3UEMA 3VWUA 2CX3A 2VTFA 3E1F1 1F9MA 4YQVA 2GDRA 1A23A 3KH9A 1CZVA 4YPJA 4BDVB 2E2GA 3DYPA 1WRYA 5IOWA 1U88A 2L57A 4CUBA 4UOJA 2H0GA 3MO4A 3BN6A 1DLCA 4RI7A 1N2AA 2DJ3A 4MZCA 1OE7A 2HZFA 1NW2A 3EC3A 3MUZ1 3ACFA 1BAYA 4ACSA 1XVWA 4TR0A 1O73A 1ON4A 2IPAA 2VM9A 4NWYA 4ZB8A 2ORZA 5ECIB 5B6MA 4CVUA 5KN1A 3IAQA 1DE1A 1XC6A 2H70A 4N10A 3PUIA 1ILOA 1XWAA 2H71A 4UI9L 1XW5A 2O8VB 1LU4A 2GT6A 4IELA 4PURA 3ZFLA 4GCIA 4TXOA 3TKSC 4I6XA 4L0WA 3HPNA 1M0UA 1O8PA 1NHOA 2FWGA 2PGTA 3GIXA 2A2RA 2W1SA 1E2YA 2YC2A 4DUVA 4BVXA 2MMNA 4KH7A 4LL4B 4KSOA 3VPTA 5C7GA 4MABA 5DDLA 3SBCA 2W5FA 3GKMA 2F9SA 1GMMA 1W99A 3ZLPA 2WULA 3CBUA 3ZRDA 2LS6A 2DDUA 4Q5QA 2GQKA 1RQMA 3ZZXA 2R2JA 1XPWA 5ECMB 2DIYA 4V1Ap 4BWSA 5G1LA 3RDWA 1K3YA 3UETA 2LSTA 5JWOB 3ME8A 2CV4A 2E32A 1W4VA 3FKFA 1WOUA 2RM6A 5EY6A 2BMXA 2LJRA 1V57A 4L0PA 2A2SA 5C70A 4OFNA 1T4YA 4G2EA 4DEQA 3NRUA 1A2LA 4KDUA 3N9JA 4ML6A 1GSQA 3HA9A 3EU4A 3T2OA 4BK5A 1FB6A 5C00A 5D9WA 3CMIA 2AAWA 1PL1A 1PQNA 1B4PA 2Y6KA 2B1LA 5CRHA 1ACVA 4P02B 4CU7A 2O85A 2YV7A 1PGTA 1K0MA 3VD5A 1GOGA 2QBXA 4MPGA 4HZ4A 4ZL8A 1OYJA 2YFUA 3VDCA 3UNPA 3FR9A 2R3XA 4D8MA 1AQXA 3SEPA 3IC4A 2MBTA 2VR4A 1VF3A 10GSA 4AGSA 3GA4A 1T00A 5D9VA 3TKPA 12GSA 2L5LA 4NHWA 5D8IA 4MOAA 3DYRA 1F3AA 3D4TA 4MO3M 5IFPA 1Y6EA 1SJ6A 1CZSA 4XS4A 2WDBA 1HNBA 1MDIA 3MSZA 2FA4A 1YF0A 3T2PA 2OE0A 1DUGA 2E2MA 6GSYA 2PN8A 1TDIA 5A1AA 3OGVA 3GKKA 3U6VA 4TTGA 1WCQA 2LUSA 3A23A 4DXTA 1B9YC 4KX4A 2AYTA 5IM9A 1YJ6A 2YJHA 2MMZA 3TRQA 1VF4A 2Z9SA 4FI9A 2KP1A 4AJ6A 2MYGA 3ZIJA 2K18A 2PMTA 2KHPA 4WXTA 4F03A 2W1UA 1KEXA 2AUVA 2PERA 1UYZA 3C71A 1SL2B 2H6ZA 2V2GA 3WEZA 2HRNA 4RYDA 5E4WA 3M9KA 4JKKA 2YWIA 1X5CA 2W3JA 1XIYA 3UVHA 3DYOA 2OJLA 3SKVA 4XS4B 1M9BA 4HUAA 3QR6A 1Z5YE 3DEXA 4YAVA 2CQ9A 5ECRB 3GFKA 4A41A 4A42A 3WGXA 3CSIA 3EURA 4A4AA 4OO5A 2VZSA 4KSMA 5JCWA 3MAKA 2AJQB 3TJBA 3W5MA 1AAZA 4E8HA 1XOAA 1T3BA 1GLPA 4ECBA 3ACGA 1GP1A 3VK9A 1MTCA 4MZBA 3DYMA 3ZL5A 3DWVA 1R5AA 3A21A 4PUFC 3GX0A 3D4MA 3C7GA 3EU3A 4PNGA 2E7PA 4TN8A 1XFLA 4ZY9A 5B7CA 2WJUA 4GWJA 1I5PA 2MMOA 4RI6A 1W0NA 4A44A 1GQPA 5J41A 2VMCA 4OMCA 5KEJA 2NVLA 3T0BA 1YEPA 2L59A 5JWQB 1TI1A 5DVBA 3ZMKA 1IYHA 1PKZA 4QB2A 1GUKA 1YQ1A 2DLXA 1TG7A 2I1UA 2JZRA 3I3BA 3BOAA 2FWHA 4WR4A 2JZTA 3F9UA 3WQBA 1BYEA 5DBQA 2HZEB 1USBA 2QQKA 1HQOA 3MDKA 1AQWA 2YANA 5DJLA 3UARA 2VL2C 1JZDA 5ECHB 2FNOA 4A6OA 5HR3A 1HN1A 3HCZA 3E0UA 2VL9A 1ERVA 3OEAA 4QB6A 1T2XA 2LNTA 2QC7A 4IUGA 3M3MA 4I97A 1PMHX 2O87A 4QX1A 1CX1A 1EOGA 2XBIA 2WAOA 3KEBA 3CTGA 3QFBC 1PRXA 5G30A 4F0BA 3H93A 4E8DA 3HEIA 4MH2A 1JZ8A 3DXBA 3ABZA 2C3TA 3GTUA 1Z3EA 2F3MA 1RK4A 2BBAA 2VZQA 4EVMA 4ML1A 3NZNA 2WABA 4OMDA 3FZ5A 3LYPA 3PH9A 3C73A 1K0NA 2H1DA 3ISOA 2H0HA 3UIWA 3NJVA 3FK8A 1UN2A 2GTUA 2NTOA 3IAS2 4HZ2A 1GULA 1XOBA 1TOFA 3TJGA 3LEKA 1KBNA 4PQHA 1UY4A
chains in the Genus database with same CATH superfamily
3RG0A 3KV5A 2VL2A 1ULPA 4EYUA 2PLV2 4QWNA 1VMHA 3RBTA 1Y3TA 5IVCA 2GVPA 1RUG1 2ZGLA 5FPXA 1W2NA 3KXOA 1YIPA 1GNZA 3AZXA 2Q8EA 1X9PA 4JE1A 3VKOA 1Q98A 4XFHA 1WPIA 3W8JA 1XNKA 3H3UA 3MIHA 3LAGA 3IBMA 3BTYA 3L0HA 2CYFA 2Z2SB 4EUYA 5AIVA 5CFCC 2WFCA 5FLJA 4XJWA 2BFUS 2WNVB 1WKYA 3ZPYA 2YGLA 3NWKA 5L9VA 2IMDA 4ASKA 2BQPA 1YY7A 1NLQA 1V58A 4GQCA 1A8MA 4KGIA 2DURA 3J7LA 2PAEA 1Q8SA 3EMRA 5FYCA 1UZZA 4DO0A 4XCBA 4K7OA 3BUCA 5BRTA 1L7QA 3LPFA 4KU8A 4M3CF 1PVC1 2VVFA 5J98B 4AF2A 1I3HA 4CEYC 3IRAA 3JCIA 3RWNA 2QTWB 3JB4C 1LOEA 2YPDA 3O1UA 1E6BA 4XVHA 4MLYA 2B8MA 1M2DA 3GL3A 4O5RA 1KDKA 4JDNA 1N1YA 4O5QA 1G7EA 1DG6A 5FFOC 2P3YA 2CX4A 1RUI3 3T08A 5A32B 4DQAA 4FTSA 4EE0A 3SXWA 2YZ4A 1PD21 2P5BA 2UYAA 5A3PA 4E2GA 4Y20B 4Q4V2 4GWRA 4AJ8A 3NSTA 5FKCA 4CEYA 4ULXA 4Q4Y3 1I5GA 3BPZA 4OWYA 1H1AA 1K42A 2WLQA 4IETA 1WLDA 1O4TA 4DFSA 1QEXA 3N9LA 3DKSA 3J8F3 1HNCA 5FWGA 2LROA 1COV3 4LULA 2PBJA 1DYPA 2A73B 2V32A 5FPBA 3OUHA 3SQOA 2JXAA 3KCMA 2WQZC 1DYKA 2ZX2A 4FIWA 3SEEA 4UXAA 2W1QA 2JKXA 1W3VA 2XVGA 4IV1B 1MS5A 4GRFA 4N0VA 1UOBA 4AHWA 2A3XA 5FY1A 2WCIA 2HFDA 2PQQA 4Q0SA 5K9YA 2VXRA 4AI1A 2PELA 3IK9A 1GZWA 2B7KA 3WSOA 1TK8B 3KSCA 1H4OA 4MGTA 1GH2A 2W95A 1HQLA 2FQPA 4YZ2A 1EP8A 4FOVA 4RS5B 2IVIB 3IN9A 4Q0QA 4Y33A 4IEXA 1V70A 3WR0A 3ZSEA 5FO7B 4E8EA 2XHNA 1JXNA 4GF0A 1G7OA 5CKNA 3PJYA 4BPZA 3EO6A 2GN3A 1C5HA 3FX3A 1A24A 2E7AA 3OY8B 2VL3A 3G7JA 2C80A 1JW6A 3MF6A 1AR73 1B48A 5KHJA 3MI8A 2QDRA 3KB5A 2FD8A 1B4QA 2J1RA 5LBEA 3HT2A 2QZ2A 2WQ4A 1WMXA 4UT5A 1ZYQB 4QKBA 5JMCA 1BBT3 2VBDA 2CVBA 1Z78A 1XNBA 4C8DA 1SYRA 4PCRA 3TEWA 2JDHA 1BKZA 1OUXA 1JYCA 2PHTA 3GRXA 1V98A 5CZKA 5FMOS 2Q1FA 5FP7A 2A4VA 4AQ6A 3AVRA 1ZBE2 2B9VA 2VMEA 5ECSA 2VU9A 1W8OA 2HWC2 1Z6NA 5GLWA 3CSHA 1RVF3 3PL0A 1K5MB 1UXXX 2C24A 4K8FA 1J0FA 3ZYBA 4IQPA 3ETPA 3H1YA 4IJIA 2FA8A 4OCTA 3CL1A 3ATGA 2B7JA 5FZLA 2LUWA 3JZVA 2VMGA 4ARXA 4PIYA 2PQSA 3DGQA 1DZTA 1ND2B 2BTOT 5I0RA 1EP0A 2B42B 2C0EA 5CRWA 5AN1A 5IO0A 3HQRA 5GM0A 1K12A 3AYCA 1TU7A 4HN0A 2OBIA 2RS31 5LEKA 3DF0A 5B8AA 3D0SA 4BIKA 2XL7A 3CQFA 4OUEA 4IS0A 2CZ2A 1A8DA 3TKSE 1L7RA 4TSVA 4A3ZA 5GSTA 3ZMOA 4BPYA 4NIAA 3ZXGA 4YM1A 3APBA 3MPPG 1V0AA 1REDA 2BGCA 2VW0A 4HU9A 18GSA 2DKIA 3T1MA 2R37A 1WWYA 5LWBA 3QD6A 1HXS3 1UX7A 5EYYA 3LEIA 4AEDB 2HLSA 2W52A 1GLQA 1PA3A 4YW6A 4PLMA 5A3MA 5IWFA 1OD5A 1ZRFA 2ARCA 4QB1A 2WSVA 2VQTA 1Y9GA 1AUCA 1NAEA 2VULA 2GP5A 5T5JA 5AC91 5DQ0A 2DCKA 1SLLA 4LR4A 4ISQA 4O9GA 2PHWA 4ZBBA 4YKFA 3RZHA 4MNNA 2YHJA 2NQYA 5F2WA 1ERUA 2DJKA 4XRAA 2DVAA 4I3GA 5FZ3A 2C9KA 3A2WA 4JR4A 2FUG2 3LOIA 1NCQB 1W90A 3K4ZA 2RHPA 1UZVA 3N9QA 1URMA 3I43A 1V6NA 1ULFA 2AYHA 2K0GA 4BISA 4HVQA 4LK7A 2AREA 4BQ5A 3TKRA 4AE2A 2R041 1JU3A 2I9HA 1VBB1 5IMFA 4BQ2A 4ZZ5A 5FPZA 3HIFA 1HB4A 2WNVC 2B5EA 4WKWA 2YBPA 4QGLA 1J3QA 4XF3A 1US3A 5G1KA 5C4WB 4Z2TA 5B8BA 1DP0A 4V1PA 2WO3A 3PIGA 1NE4A 2ZGSA 2QSIA 3GX8A 3LA3A 1WWJA 4CDUB 2KLXA 3GN3A 4I2UA 4A7YA 1SBDA 3M3IA 1JN2P 3PJQA 1AYM1 2LALA 4I30A 1Z6MA 1AL21 4TOPA 2C3QA 4ICYA 1M06G 3WD5A 4JAAA 3WF0A 3I2GA 3VWWA 4IEYA 1UNBA 2QQUA 1T7PB 1QU0A 2DCJA 3ACHA 2EVXA 3ZLIA 2VM1A 3IDCB 4Q29A 2WNVA 3H1MA 4DXZA 3H8OA 4FP2A 4RQXA 1QNWA 1Q43A 4QXCA 2YWOA 4ZL7A 1RUI2 4ASLA 2DCYA 1FMD1 4MZUA 2DVBA 5JCGA 1S1AA 4KDYA 1S3RA 1EAH1 1R093 3PDQA 1UW8A 1PX4A 5ERLA 4A2UA 2C0FA 5FP9A 4XF9A 2P3JA 1HJGA 3R05A 4Q4Y2 1RUC3 2FCVA 1OPMA 2LS5A 1NY72 5ID2A 1FHEA 1GUIA 1V9U3 1ZBA1 4NIHA 2DIZA 3PVNA 1W05A 3GXUA 3ON7A 4GQFA 2L9LA 3IKWA 1X33A 2VMFA 1COV2 1VP6A 3FEUA 4MGZE 3F63A 2IWGB 2GZYA 1WW4A 2PYTA 4QDRA 2R6QA 4LIUA 3LB9A 3WW4A 4BZ4A 3QFAC 5J4UA 2IXLA 2EICA 1XPVA 2RR11 5F7UA 1BXHA 3US3A 1JOBA 1EV9A 5A32A 5LRRA 4MGYE 2J7MA 2BZDA 3K3NA 4Q4X3 5GLUA 5IAXA 2BNOA 5LCWL 3T1LA 1PZ7A 1PO11 3KD0A 3ZXJA 3PU8A 1ZA4A 1NA1A 5BNOB 2WS91 1V2AA 3ZDSA 3GALA 3H7JA 4ET7A 5JUVA 4MF6A 1RUG3 3UKNA 2CTVA 3SITA 1THOA 4BOWA 2QQMA 4FOQA 1RXFA 2YC4A 2H0IA 4RS5C 2VCTA 1J1TA 3QOPA 1BMV1 1QK8A 5FT3A 4XJ8A 2JDYA 3H7YA 1V6MA 5B4NA 3WV6A 4IE7A 1FYUA 1FO5A 3TKQA 4AVTA 4IEQA 2VOXA 5A6YA 4IV1A 3HY2A 4WEYA 5FZ4A 3K2OA 3ERFA 4JGYA 1AR72 2EIGA 4ZXKA 1KNGA 2Y6HA 3MLLA 4LQRA 4NAMA 4H7MA 4QU2A 3QLQA 1PX6A 3I9V2 2VE1A 1VB4A 4OYUA 1H6XA 2BV4A 2WRTA 4NJ4A 5L9BA 1AR91 3Q74A 2GQMA 1RXGA 4RS5A 5LBFA 4TZDA 2ZAAA 1WMDA 1DGLA 1RVF2 4I0AA 3KGLA 2I3YA 1NZCA 1JZ4A 1NX9A 4XCSA 2HWD1 3DXUA 1VALA 3EB7A 4FPLA 4Q5OA 1IQDC 1AUYA 2DFCA 2LQOA 1O3QA 3DN7A 3K8NA 2XVLA 4QPGB 5T50A 3GDBA 1ND2C 2R4VA 2XJPA 4E27A 3H8QA 4WVZA 4WBBA 2ZBJA 3H8RA 4QL9A 4QX2A 4YARA 5FY4A 2XLFA 4DINB 2X8HA 3P90A 2VTXJ 1S0IA 3VKNA 4OFTA 1AL0G 1GU3A 2R0PA 4IQ1A 1XSRA 2P34A 4E8CA 1EEMA 1RTVA 2A6WA 3AZVA 4HXCA 5FBZA 4F0CA 4PGTA 1U87A 1K5MA 1US2A 4DUXA 3PR8A 1XRUA 3ENRA 4HQSA 5FUIA 3PGTA 5APAA 4M3CE 1CAWB 2B5HA 3SCHA 1W9FA 2WRAA 5HFKA 2ZGUA 4NV5A 3EMPA 3THDA 4SLIA 5EL8A 1HXS2 1JYVA 1SK2A 4XQWA 2K9FA 1NM3A 1ND2A 2FDHA 2RV9A 4LORA 3VI5A 4AEDC 3W6GA 4L8EA 3LZZA 3TDGA 5LZ6A 1KRIA 4YNIA 3O6TA 5E16A 3NOFA 2CT6A 1U12A 4TXOB 4JTOA 1M3IA 5LEJA 3CRUA 2MBSA 3PINA 4FOWA 4UW6A 4XFFA 4LEJA 4B7KA 4POLA 3AXEA 3C1SA 4ISDA 3MFCA 4LO6B 1H8TB 5G5FA 3U07A 2WZ9A 4YZ5A 4ZILA 1NCQC 3K4AA 1SKSB 2GMMA 1VRSD 4AEDA 2WWJA 1TNRA 2IIYA 3HVSA 1SK1A 2XQXA 3ZN5A 3C7HA 2IXHA 4C0BA 1EUTA 1ZNPA 5JSPA 4HI7A 2F4LA 1UY3A 1PIV3 2AENA 2R5GA 2HWF1 3H0OA 5CNAA 5C4WC 3EJKA 4EDZA 3FBMA 3POIA 4GAZA 1N8JA 4G0LA 5L7OB 3NKGA 4YZ1A 4GB32 1MDJA 4HT1T 5CVRA 1WP0A 4CDUC 2MEV2 3T30A 1NCQA 1RINA 4L97A 1R081 4P5YA 5JDBA 1SACA 3ZYRA 4BA7A 1ZVFA 3CSJA 2ZNMA 5FZ7A 3I54A 1RUJ1 1YRZA 4AI3A 2WNUB 5KXEA 1UPIA 4BHPA 5ENUA 4XACA 1IPJA 4CU9A 1VBC2 2H30A 2KOKA 5JCTA 5DALA 3LA2A 4KWUA 2X8KA 3RMXA 1S2EA 2IWTA 1VRBA 5A3OA 3UESA 5EQUA 2Q8CA 4CDUA 2J1EA 3UKVA 3KHCA 3A3TA 3IDBB 5GLZA 2RS33 2Y33A 4CU8A 1AZDA 2P31A 2ZHLA 1W89A 1RUF2 2D3PA 4RQPB 1BX9A 3OGSA 4AEMA 1QJU1 2D6KA 1X9SB 3M3CA 4Q26A 4IEOA 4K7JA 4DEVA 4LHSA 1LGCA 3A5WA 3APQA 2HRKA 3ZYHA 4XBLA 1QJEA 1JI6A 1QY4A 4JU5A 3D82A 5FZIA 4X4JA 2BERA 4MA9A 4RN5A 2FMYA 4KAEA 3CIHA 1QXPA 3GZUC 5CO3A 1OKDA 3LOBA 4IQAA 4JZRA 4ZS3A 3DV8A 1ZM1A 2Q1MA 2XXZA 4PQIA 4Q4X2 2HXKA 4LLOA 1XXUA 2XPEA 5AC93 4BIFA 4AHZA 4BVYB 3VWVA 4XEZA 5BNOC 3KWVA 1RUG2 1O7UA 2VOWA 5I8TA 1DQ2A 2X8CA 3UT0A 3T2TA 2AEYA 3VD4A 3AZZA 1JZ6A 3ZKYA 4NMUA 5JI7A 1RUD1 3R2QA 4XJUA 1DIWA 4FVVA 1RUOA 1TXXA 1R1A1 2R043 1VBB3 4W65A 1TRSA 5DDJ2 1UPSA 2UURA 4EWAA 3WG1A 2J1AA 5JXHA 1KFUL 5BNOA 1F2NA 1T1VA 2VW2A 3Q8AA 5B4XA 1LR5A 1ZOFA 1TEIA 1A8LA 2XPDA 1QF3A 1W04A 3ZVJD 3O3TA 2L5OA 5FZCA 1AYM3 1PVC2 2OA2A 1AL23 4UF0B 6GSTA 2JDAA 2DUOA 4ZXGA 4QXKA 5KN2A 3KP8A 3LD8A 3KS7A 3UJ1A 1PK6B 1PGW1 4NAXA 2CAIA 1FXZA 1YQ5A 2V5YA 1O91A 2Y64A 3MIXA 4AAXA 3T0DA 4NRQA 2F8AA 2WQ8A 1SKRB 4BQ4A 4GH4B 2D6LX 5C5UA 1N1SA 3U5RE 3C7OA 4E2SA 2WT0A 3I3DA 2DMMA 3U11A 2J1TA 2XHFA 3A5IA 3I49A 3HHVA 2AHEA 1JS9A 2QQNA 3UBKA 2E0QA 1ZBA3 4XC9A 1ZMAA 5CRDA 2CDPA 1UMIA 3HBZA 1NYWA 4WM8B 5I91A 3UL3A 3D4KA 1TKDB 3H3ZA 1CAVB 5G04L 4QXHA 3WG2A 1A6CA 2IMFA 4QPGA 2JU5A 2R7EB 4P9GA 3GJAA 3VBFC 2XKPA 5DZFA 2HYKA 1LOFC 5A80A 3E9JB 2WZR1 3PVBB 3ZFGB 4AGRA 4HJ2A 1K0BA 1PO13 2M72A 4LKDA 2XUMA 5FP8A 1XW6A 5FWJA 4B4RA 3AZYA 2XR4A 3E1F1 3LIGA 4D6SA 2GDRA 4K6BA 3MPBA 1KJRA 3MFAA 2FDIA 1FOD1 3BN6A 4MLOA 1H8TC 3MUZ1 4ACSA 2IFWA 3LSEA 5EXOA 1O73A 1ON4A 2IPAA 2Y0OA 5A7WB 1O4YA 1DE1A 3BOWA 2H71A 4F8AA 2O8VB 1LU4A 4TXOA 4BL7B 5FZ0A 2A3YA 3O1SA 1O8PA 2FWGA 4CP0A 2YC2A 4DUVA 3VPTA 4KSOA 4MABA 5DDLA 3SBCA 5ABJB 1GMMA 5L73A 3E6BA 1AR93 3LF7A 2DDUA 1CGPA 1QH6A 4C1WA 5L7OC 4Q5QA 3TAYA 5ECMB 3M8LA 2FZ2A 2E9QA 1E5HA 3UETA 4KGGA 3ME8A 2E32A 1EPWA 4OHYA 1WOUA 2RM6A 3CNAA 4KG8A 2RM21 2HWD3 5FJKA 3GBWA 3O0XA 4DEQA 2W39A 4KDUA 3N9JA 2HEWF 2WNUC 3EU4A 3T2OA 4BK5A 2JE7A 1FB6A 3UK9A 1AR61 5C8CA 4RHV1 3CMIA 2Q5TA 1PQNA 4COUA 1KS4A 2B1LA 1CAXB 3H50A 1DQ4A 3J4UH 4E9KA 4P02B 2YV7A 1K0MA 3ZSKA 5L7OA 2CY6A 1ASJ3 1CPNA 5C9AB 4ZL8A 1OYJA 1UX6A 3SEPA 2MBTA 2VR4A 1VIWB 5D8IA 3DYRA 3KF5A 1F3AA 5IFPA 1JUHA 4WZCA 2QFEA 2OE0A 4IEZA 3SH5A 2LRPA 3THPA 1TDIA 1QOTA 3KZ4C 2GZWA 3AP4A 1F35A 3BODA 2MMZA 1ODNA 3W58A 1JH5A 3FLTA 3UGHA 1SLCA 3VZJA 1NXD1 4KH9A 2VBPA 3M2MA 1GBGA 1KEXA 2UU8A 1DF0A 2PERA 2WT2A 4LBKA 2H6ZA 2HRNA 5DAPA 5SV5A 4JKKA 2XUEA 1X5CA 1GQHA 2W3JA 5AC92 1FATA 1M9BA 4HUAA 1ONAA 1GV9A 2CQ9A 5ECRB 1AJOA 3WGXA 2DVGA 4RQPA 4A4AA 5DAXA 3TBDA 5JCWA 4IERA 4FO9A 4Q1RA 4YSFA 2RS11 3ACGA 2O1QA 4CCLA 3M3OA 5A3NA 4Z92B 4MZBA 1YO8A 1R5AA 1C8NA 3A21A 2AR6A 3D4MA 5F2SA 4MXWA 1DGWX 5J48A 4LXLA 5I93A 1W6OB 4EIPA 1KQRA 2JICA 3N9OA 1CPMA 3AM2A 2VMCA 2R042 3ZVXA 2QVSB 1RUH1 5KEJA 1VBB2 2JIJA 2P4EA 1YEPA 5E6HA 5GZFA 5DVBA 2UZ8A 4QB2A 1GUKA 4IE6A 4YGDA 1YQ1A 3CHXA 2HWF3 3I3BA 1V6OA 2ZGNA 3BOAA 5F9TA 4QHZA 1JOPA 4TLGA 1BYEA 5DBQA 3R4SA 1USBA 1HV0A 4XIKA 4SBVA 4HMZA 5FJHA 5HR3A 1AYM2 4P9JA 1SLBA 3OEAA 4KNCA 3WQ0A 5BV6A 3LDRA 1LKNA 5FQ0B 1TE1B 2P1BA 2O87A 1CX1A 4ZU5A 2P17A 1R083 2WAOA 1DFQA 3OJBA 1PRXA 3AKSA 2ARAA 4QM8A 4E8DA 1MVEA 4EQVA 2EXHA 5A7PA 4MH2A 1PK6C 2UY9A 4X8NA 4CZSA 1RUJ3 1K5JA 3GZEA 4IESA 3ZN6B 4EVMA 2BNMA 3FZ5A 3LYPA 1H9PA 3ISOA 3DL3A 3NJVA 2AH2A 1FMD2 2G9ZA 3IAS2 4GH4C 2OS2A 4LOSA 1AR81 1EAH2 5FXXA 2I2SA 5JAXA 1UY4A 3CXGA 1VR3A 5EV7A 3GKNA 4QQHA 4DOUA 1TQ5A 1GZTA 5GZDA 1UZ0A 3ZFBA 5E59A 4IEWA 1UA5A 2YC0A 3OBRA 4MH3A 1ZBA2 1QJU3 2HRFA 4OI1A 1SLTA 3LIHA 3RYPA 3AL5A 1TP9A 2TUNA 3V0BB 3M4FA 2XMLA 4HSLA 3FE5A 2PLV1 4WM8C 5DZGA 5GKAC 4ARYA 1SDDB 5IK5A 3TRSB 4V2MA 2JDZA 2RR12 1MQTA 2RUFA 2R1DA 4CDXA 2WO1A 4BLJA 5KWRA 5LA0A 1SPPB 4HPKB 4HK8A 4CU6A 5A6XA 4XW3A 1W6NA 2GMPA 5HPOA 1HNAA 2P37A 4TLFA 4KA0A 3ZFGC 3UL2A 2UWCA 3POYA 1F31A 4POKA 3M9JA 2PN5A 2WS92 14GSA 4R9CA 5D96A 3TJKA 1WD4A 5FY0A 5KHIA 4RL7A 2HEVF 5F32A 1OSGA 4WM8A 1BMV2 5AISA 1CAVA 2OYZA 1AF9A 1FPN1 1RUD3 4ZHNA 5I0SA 2P0GA 4XAEA 2FLSA 4K7IA 2Q1ZB 4HJMA 1SLAA 1R1A3 1WCDJ 2OUHA 4JCKA 4KB3A 2VAUA 3ZFGA 2BRTA 5J7MA 4MGKE 4NR1A 1B09A 5C71A 3VL8A 2JL4A 3O1MA 3ZXAC 2VZOA 4Q0VA 3A4UA 1SU9A 1YEWA 3F4RA 1AR92 2BYVE 2R32A 1C72A 2ZEZA 1XB9A 5T3NA 5GZGA 1FNYA 3QBQA 1G9BA 5LA1A 4AF9A 3KP9A 1AYN1 4AWDA 1K0AA 6GSWA 4E2QA 3BBYA 3DPRB 1X9WB 1X36A 2ZCTA 5A7WA 3RJRA 5ANNA 3ZR6A 2V41A 3F95A 2XWJB 1TJDA 2JB8A 4Q8LA 3I2JA 1W0PA 5TSWA 4BL7A 1C1LA 4HOOA 3KIJA 3FY7A 5JCUA 4F82A 3FZ3A 1HX6A 5ABJA 2EA7A 5KR7A 4YQUA 4ZKTB 5ECKB 4AI2A 3LSZA 5IVYA 5C9AC 4AVAA 3IDEA 2D5HA 3LCPA 3WD6A 5FYHA 5CKMA 3SNMA 1GSUA 2Z69A 3ZX7A 1OKQA 3R6SA 4HN1A 2L6CA 2YN1A 2VOTA 3DD3A 4MJBA 4Y1UA 4QQ7A 1PN0A 3CZUA 3M0FA 3B5LB 3T2QA 1QOSA 3EINA 1QQ2A 4NIIA 4XXPA 1H4HA 3P2AA 4QXBA 4Y5Z0 5LBCA 1FB0A 3IHQA 1SHWB 5LCZA 5G5EA 1DZQA 2WZR3 4L92A 2G19A 3U0ZA 2LRTA 4O5UA 3WW1A 1Q8QA 4N30A 2Q8DA 3JD71 4ES8A 2KM2A 3HNBM 2JG9A 4HANA 3TRXA 1VGLA 4XUQA 1Z7S3 3IT8A 2KA3A 4URTA 4BIOA 2GS3A 1W6PB 4QMAA 3ZVJA 4HU7A 4W4ZA 2TBVA 2CVKA 1JOJA 2ZPXA 1ULOA 4WM7B 1N3QA 1WMFA 1FOD3 2ZACA 3PUAA 1BHGA 5HCBA 1MZFA 3ORJA 3UKTA 4WV8A 2V6OA 3ED3A 2H6YA 3ERGA 1AXZA 3PTRB 2WL1A 2ZZJA 4P08A 2ZEYA 4QQPA 2BPA2 3VN4A 3I69A 5F3GA 4PXOA 2V1MA 3VFIA 2A2PA 4WVMB 4KF9A 4I2OA 2HWF2 3EHKA 5LASA 4J2FA 1YNAA 1XWBA 5ELAA 3FWEA 5FYBA 5CADA 2P5RA 4LO5B 4OFMA 1K0OA 5EJ1B 4ZU7A 4GMP0 3BU0A 2QQIA 3MIBA 3GBFA 3ILRA 3CBNA 3E6CC 2BW8A 4K5SA 2OQ6A 1ZRRA 1WCKA 1R082 2G1MA 2UWAA 1W6OA 1JHBA 5J37A 2RM23 3GHNA 1NSWA 1F4AA 2VZPA 4ZONA 4OI0A 1RUJ2 1AVBA 2RJ2A 1TME3 5SV8A 2H1AA 3IMMA 4BCUA 1YF1A 1AR63 2WN2A 4RHV3 1UF2C 2R30A 3LQCA 3B7MA 3R4DB 1MDKA 2Y34A 3EYTA 1XVQA 4N0ZA 3AY8A 1WJKA 3PLQA 1GSDA 2OE3A 4YVSA 4LK6A 1DQ0A 4N9HA 2OT7A 2JADA 3S57A 3S5AA 3N3HA 5HFIA 1IYIA 2D6OX 2V4AA 4OQ8A 2VUCA 2JG8B 4YW5A 1EEJA 4HFSA 5DUXA 3FUOA 5F3EA 2Y38A 4IEUA 3SC7X 5A6QA 3UVTA 5H9SA 4K3UA 2VCAA 3OTFA 3NV1A 4UYBA 4XIHA 5DN2A 4N11A 1HQWA 1UL9A 1LJ7A 2W2IA 1MZ5A 1O3RA 2YB7A 4MHUA 1MD3A 1UYXA 5IVFA 3F6DA 1H2MA 4TW5A 4Y1ZA 4BWOA 2GMEA 2DSAA 1EUUA 1OE8A 2KP2A 1K3LA 2VNVA 4FH8A 4O92A 4NHYA 2YWNA 1WBFA 4FOYA 4Z8BA 1OKOA 3OD4A 13GSA 2WO2A 2E7QA 2GC0A 4CE8A 4FPGA 1TK5B 3VHNA 1UMZA 1NHYA 5F5CA 4P9YA 2FZ1A 1URXA 2D2ZA 4FFFA 5DAWA 1QQP1 3C1RA 3F2ZA 4K8RB 2RS13 3BD2A 4YG3A 4GXZA 1UMHA 3UOMA 2J1SA 1RUD2 3H8UA 4AI0A 2VNGA 2VOKA 1OOPA 2VMDA 4Z07A 4CDQC 5ACA2 3POWA 4ES9A 1D4M2 1PN9A 1SPPA 1RUH3 1G9AA 4IP1A 1W2OA 2NLRA 4G0KA 1QHDA 3GUSA 5T54A 3O5SA 2XJUA 1LOCA 1BEDA 9GSSA 1WBLA 4AR2A 3KTLA 2PHUA 4XQDA 5FZBA 3E6DA 3VZLA 3POJA 2VOVA 2IMEA 5KHHA 3KZQA 3CQOA 2XJVA 1O6UA 5KOWA 3M70A 3F4SA 1QFNA 3FZAA 3F4TA 1BEV1 4EO3A 4POBA 3AP7A 3A0KA 3LXZA 4IGJA 6GSVA 5FZOB 4K40A 1ST9A 4FAHA 3N36A 4RGAA 2ZHKA 5A4WA 2ZGRA 4KI5M 3DPRC 1PGW2 1ZGNA 4HVRA 3MIDA 3HD5A 1FV3A 3VWXA 2WUHA 2WSUA 4AEJA 4QQ2A 1DBYA 4MCUA 2QCSB 3L9UA 2BOIA 2BU9A 3ES4A 4G9HA 1WCUA 1UKGA 1AR83 2WBKA 4DVCA 3V64A 1VPHA 8GSSA 3QDNA 2Y6GA 5C04A 4S2HA 1G86A 5FV3A 2YPMA 1SG3A 5I0UA 5BNNB 2VD0A 3I2OA 3TB0A 4XTMA 4Y22B 4OHWA 3D6EA 1SENA 3H1WA 2BP6A 3CEWA 1CWPA 3QMXA 5DXDA 4YM0A 2A5ZA 4EIQA 1SQ4A 2Y8KA 2PLV3 1GFF2 1LU1A 2E63A 5GLTA 2UYBA 2YPJA 2W46A 3CZJA 1JYTA 1ZZYA 4V2WA 3M1GA 3VI7A 4B4QA 3OCPA 4UWDA 1OD3A 3IBHA 2NM1A 2WR9A 5FZ9A 1RYYA 4UW3A 2WZR2 2D44A 1R4WA 5IOXA 1S3CA 5HI0A 2XLAA 5CFCB 1WLCA 2VD1A 5LW9A 2ZX3A 1J83A 3RFRA 4UBGA 4X43A 2XJTA 4XQ4A 3URFA 2WGRA 1CONA 5JOYA 1HDKA 2CGPA 1H30A 1FOD2 2EALA 1EWXA 4FPEA 3HQUA 4WM7C 2H74A 4EL1A 4QU1A 1FPN3 2BJSA 3D21A 4FFHA 1YFXA 4OUSA 3J9SA 5I0TA 2IFRA 4OLLA 1ZRCA 2WZ8A 1ZRDA 2FDGA 3POEA 3DECA 20GSA 4AFCA 2WS2A 3MUY1 4CA9A 5D93A 1ML6A 3LEMA 2LEGA 2WO7A 4YWAA 1REEA 2XBQA 2JENA 4G19A 2B39A 4IVFA 1MS4A 1X0RA 4HKOA 1UKRA 4K6XA 1OQ1A 4EKZA 3VL9A 3WQ1A 3RDIA 4CRQA 4CCKA 2C4XA 19GSA 2A6ZA 4KDXA 4FAGA 5LY1A 1G9FA 1TK0B 4V1Ag 2NYYA 4WM7A 4M3CB 3LA7A 3N7JA 3KT7A 3W59A 1AYN3 2DUQA 4FQ4A 1B8XA 1R1ZA 2VTXA 3KLSA 4KNDA 1DQ6A 2VCXA 3GH6A 4XBNA 1Z0HA 4BK4A 2RM22 5FDBA 4QAWA 2J22A 3HOBA 4YRDA 1LEDA 5FYYA 1W8ZA 2K8VA 2WT1A 2FWFA 2G4IA 1AR62 4N43B 4BJ0A 4WVMA 4JZQA 3OUIA 2JSYA 2PPTA 5J5NA 4MX3A 2MZCA 3R3EA 2ZX1A 3NL1A 2OBKA 1UC7A 3SH3A 3UGFA 3ELNA 4ZZ8A 1GUHA 3WX5A 3RSJA 3MICA 4MDCA 2J1VA 3TKSA 1ENXA 3WF4A 5A3UA 1W8NA 2JG8C 1ABAA 5JPMB 3VURA 3GYDA 5D8AC 1KGYA 2HBUA 4XUTA 4HS1A 1ERWA 1OKTA 3FFZA 1PGSA 4XJAA 4ZXEA 3ZFEB 5J09A 1QKQA 1DLLA 2QJVA 2VIMA 3HJPA 5BMUA 4FPCA 5F6KA 3WF1A 2WDUA 2QQOA 1DSBA 2GP3A 5FY9A 5CAZA 3USSA 4XDQA 1OFSA 5IJRA 4QDSA 2P2KA 3IR4A 4CCMA 2GN7A 3WGDA 3O76A 2O14A 1XWCA 1SL1B 2JG8A 3SHRA 5CREA 1GSSA 1RL3A 3JD73 5DAKB 5A1FA 5GSSA 3VBOB 2V72A 2BGOA 3UJQA 1LHVA 1XE7A 3HJMA 3PVEA 2ADDA 4XYXA 5KHGA 1EV4A 3IV4A 2HI7A 3E3EA 1VF2A 3GCWA 3UMAA 1JYNA 5DMYA 1N1TA 4GB31 1MS8A 2IL3A 3IPVB 3CRTA 1SKWB 2CGNA 4AVSA 2DCTA 2NZ9A 3FZ4A 3UBLA 4KWKA 3OPZA 4M0HA 4LOTA 1RIRA 1RUH2 2WB9A 4RR3B 2BNNA 3TB2A 4NMIA 4O7XA 3POBA 1WIKA 4AYUA 2GSSA 1KS5A 1W28A 4D3WA 1IQAA 2EIOA 4QHBA 5CISA 4KCAA 1GRXA 5F5IA 4PQQA 2X5IB 3F0IA 1VBC1 2Y60A 5FO8B 1S55A 2CWSA 3CF6E 4F3JA 1M99A 2SBAA 3VBRB 4FYCA 1W8UA 3WGEA 3SCFA 4Q27A 2LTKA 1LBKA 3JB8A 4BU2A 2VC9A 4FPYA 1W9SA 3KF3A 1GP6A 3S0MA 4LA3A 3NNLA 3MF9A 3VZOA 3VKLA 3R0RA 3WY6A 2VCZA 2OPWA 4K9ZA 3Q9OA 2OX0A 4F2IA 3G9BA 5G31A 4K0NA 2ORXA 5GAND 4TKYA 4FPOB 1VE0A 1FG4A 2H75A 4I8BA 4R9BA 4XCAA 2GC2A 4PI2A 1QGLA 1LCLA 3GSSA 1F6MC 4P5HA 3THTA 5FZ1A 3B02A 2HJIA 4D7YA 4XHMA 4LL1B 4N90A 1ZRIA 1SJZA 1OI6A 3VD9A 4TWTA 1XQNA 1D2QA 4GJYA 1BQ7A 1PFOA 5FZOA 2TNFA 2Q4SA 4LKFA 1EGRA 2C6SA 4R52A 2C5DA 5HV4A 3ECQA 5C3OA 2OACA 4OD7A 4WF5A 4CCOA 2RDQA 5HR0A 1Q3EA 3HVXA 4MHRA 16GSA 5J3RA 3H42B 3KMNA 2GNBA 4LBQA 2J9HA 3WNNA 3LEFA 4L11A 4AVVA 1C8M2 4JC1A 3CTFA 1BVVA 5FZ8A 4D7TA 1HB1A 1GNWA 2VVDA 3POSA 1JFUA 2F6BA 5A5KA 5HXMA 3HN3A 1YHFA 1RITA 1QH7A 3HWJA 5CA6A 3WOGA 4XDPA 1WW5A 3IAPA 3M8NA 3KCYA 3PUHA 5BNNA 1SFPA 5DDJ1 4Y22A 2E33A 2OVUA 3GF6A 4CYDA 2ALBA 4EN8B 6GSXA 4UAPA 4AG4A 3APSA 3T4HB 2BFUL 2LV3A 4YZ4A 2X64A 1H1MA 1WA4A 1FPN2 2OZ6A 4X6QB 4IW3A 1W2TA 3LFIA 4HKWA 4XOGA 2CAVA 1CJDA 3LWCA 3O0WA 2X4AA 1H4GA 1YYNA 4CXXA 1J1LA 3ZITA 2QA2A 4I5QA 2D98A 2RIIA 5DG1A 5EPFA 2R071 4ATFA 1GTAA 5CFCA 4S2DA 5ABRA 1PHMA 4YH2A 3AFGA 3WT1A 1BEV3 4OO4A 2VZ3A 1V6JA 4MG2A 1J9BA 3UV9A 1AYN2 4HL0A 3BKZA 4MVTA 3DKWA 1QJY1 4DSQA 1OURA 4XZPA 1LHUA 3C8EA 1R7HA 4F7ZA 1A2JA 5KN3A 2YV8A 1AW9A 3TCOA 3FZ9A 5CRGA 3BI3A 1OC3A 2Q8OA 3GCXA 3T3YA 4N43C 3CJIC 2C8UA 1UOJA 5M0TA 3B00A 1FNZA 4YYOA 2RDSA 4A6SA 3ZYPA 3IWZA 3U4XA 2ZGOA 1YI7A 2QGVA 4GLTA 3LEGA 2X8GA 2HSHA 1G6YA 1JZOA 3N9PA 5C8WA 3I3QA 4M3CA 2ZHNA 2XG3A 1CAUA 4R4XA 4YQVA 4Z2UA 3VV1A 2ET7A 2E2GA 1WRYA 5IOWA 1W03A 2ETEA 2DBIA 1DLCA 3ZFEC 4QX8A 1N2AA 2HZFA 5A3LA 4HLTA 3BPSA 4Q4W2 4JRLA 3ZYJB 3VBUB 4TR0A 1W8TA 3V65A 3WUDA 3TOJA 1PZ9A 4FCAA 3KGZA 2A70A 4NHLA 3ZYFA 4N43A 5KN1A 4FT8A 4D6QA 5KHKA 1B35C 3KMHA 5FYSA 4UI9L 1YC61 1CR7A 2GAUA 4I6XA 5FPAA 4L0WA 1M0UA 2PGTA 2W1SA 4BVXA 2I74A 4KH7A 4LL4B 5C7GA 3FC0A 1YFUA 4P9IA 2F9SA 4KQ7A 1W99A 2RS51 4K1ZA 3ZLPA 2HWE1 3JD72 1O4ZA 2LS6A 4K21A 2GQKA 2R2JA 3VBOC 1DQ1A 3ZFEA 1CQ9A 3ZPOA 2BWCA 1TMF1 1W4VA 4XDOA 2D43A 2ZA9A 1V57A 2R0FA 1L3JA 2ZMKA 2A2SA 5C70A 4OFNA 1A2LA 4ML6A 2C1FA 5DG2A 1OA3A 2IC1A 5C00A 1F8VA 5DUWA 2AAWA 4RR3C 4AHYA 2Y6KA 5IVVA 5CRHA 1S0EA 2O0OA 1ACVA 3WUCA 5FMOL 1PGTA 3I7DA 3KT1A 5FCCA 3VD5A 3W20A 3AZWA 4YG0A 4HZ4A 3VBOA 2D6MA 3UNPA 3FR9A 1PNGA 3NW4A 1AQXA 5H9QA 1VF3A 3NO8A 4TN7A 3VBHB 5D9VA 3TKPA 2X5IC 4GD4A 2WC2A 3ZFFC 3VBRC 1CZSA 2CSGA 4JRAA 4E4SA 4CCNA 6GSYA 4JGZB 5FXWA 4TTGA 2DVDA 3TYJA 4KX4A 1YJ6A 1VRH2 3L2YA 3TRQA 1VF4A 2D6PA 2R0GA 3FMGA 1HW5A 1XYOA 2MYGA 3ZIJA 2GH8A 2PMTA 4AAPA 4EWEA 4WXTA 4F03A 2AUVA 1SCSA 1UYZA 3PTYA 1SL2B 4RYDA 5E4WA 3M9KA 1NZIA 3AYAA 3EBRA 1XIYA 3UVHA 2OJLA 3SKVA 3VLBB 4XS4B 3QR6A 3DEXA 5CBLA 4WVWA 3GFKA 3VHOA 3NAPB 3VBRA 2VZSA 5BNPB 1BK1A 4KSMA 4XBQA 4N9IA 1HRV1 2AJQB 1MS0A 3TJBA 5FBJA 2DUPA 3WP5A 1DU3D 4ECBA 3VK9A 3P5BA 1YLLA 5FTTC 5FR3A 1PGL1 1TNFA 4PUFC 2VY0A 1OA4A 4PNGA 2E7PA 4Q0UA 3MIGA 3K48A 2WJUA 2FHRA 4GWJA 2MMOA 5FPVA 2RJKA 4OMCA 2L59A 3ZSJA 5JPNB 2W68A 1SEFA 1S0FA 2DLXA 4J1XA 1TG7A 5LBBA 4PTSA 2JZRA 1AXYA 2JZTA 4COYA 3F9UA 3WQBA 4F83A 1CJPA 2PMWB 5GZCA 3MLJA 2QQKA 2YBKA 1HQOA 3MDKA 1AQWA 4NRPA 1UN1A 1G7YA 1MEC1 3UARA 2ZGPA 1JZDA 5ECHB 5BY5A 4A6OA 3NJYA 1QQP2 1HN1A 5FPLA 1NOVA 3ZXEA 4NO4A 4XE9A 5EP9A 4IUGA 2XH6A 3M3MA 4M01A 2XBIA 5JIAA 4OZXA 4F0BA 2VNOA 1IZ3A 4GB33 2BBAA 1BZWA 2VZQA 2MEV3 4MH0E 4ML1A 3NZNA 3C73A 1K0NA 3UIWA 4LO8A 3PMEA 1U5YA 3TJGA 3LEKA 1IG0A 2I4AA 4P9WA 5CB7A 1XNDA 4U36A 3GGLA 1BEV2 1VBC3 4IBPA 5B2GB 2FCUA 2Y26A 3LE0A 1Y43B 3WZ1A 4I2TA 1ZZCA 3G7YA 6GSUA 2G2QA 2X05A 2M80A 4CP9B 3D0JA 4ZB6A 3O1OA 4L2NA 2Z4FA 3OGJA 3B3QE 4M4RA 1RUF3 3BJ5A 1MR5A 1HB3A 3F3QA 2PU9C 4V2NA 2DJ0A 4RUVA 3RNSA 4MGSA 5ANQA 3J8F1 4JRRA 1JBCA 3ACIA 2OXBA 1QNYA 2W87A 1JZWA 4HQZA 3MEPA 4W50A 3ST7A 22GSA 1NE6A 1SK0A 3TEZA 2W9XA 4DRRA 1CX4A 4Y20A 3I2FA 4G10A 2WWUA 4YKGA 4XUNA 3MIFA 3A2VA 1DZRA 4K0GA 6GSSA 5FZGA 4Q5NA 2XOMA 1Q8VA 2GSRA 2GQLA 3QCWA 3VBUC 1SYXA 4NROA 2RUEA 5D1IA 4INDA 5A33B 3JUUA 1GLHA 3S5QA 2B3SA 2OIIA 1EOHA 3LFLA 2WYSA 3O1VA 3ALQA 4NWWA 5IW0A 1LGBA 1UD1A 1VB2A 3B01A 1R26A 2GSQA 5A7NA 4AFAA 3M3EA 1OLQA 1ZZ6A 2PHXA 1UU6A 4Q5FA 3VZMA 1HN0A 1PO22 5LATA 2D97A 5DDJ3 2PUKC 1QJX1 4DS0A 4YFZA 3TOUA 2BEOA 3ZSMA 2ZMLA 5H5QA 3OGGA 1RB8G 3VD7A 3TEYA 3CMGA 3DVWA 2D40A 3VBUA 2YROA 5FYMA 5L36A 4P9XA 1D2SA 1X50A 2MMAA 1OQDA 5JZGB 3GYKA 2EC4A 4LMVA 4NXIA 4FTBA 1QJFA 3ZYGA 4XUPA 1PVC3 1MD4A 1MZ6A 4YG6A 2YUEA 2OA7A 2I07B 3HN1A 2ES7A 4JV4A 5EJZB 3A22A 1A3KA 1ULDA 2VGDA 4FQZA 2FD3A 1I1EA 2ID4A 4R4ZA 4BM8A 3OY8A 2YBSA 2VZVA 3MLKA 2R1BA 4CUCA 2FGXA 5ECOB 2CU5A 3BVCA 5DAVA 2PHRA 3V0AB 3VBHC 1PMJX 1BG5A 3KMOA 2JD9A 3AMPA 3OBTA 4LHNA 2DF7A 4E4HA 1W9YA 3HR9A 1X5DA 3IDVA 1GSEA 3FRCA 4JGZC 2VD7A 2XJRA 2VXJA 4ILFA 1GZWB 3NV4A 2VZ1A 1OF3A 4DY3A 5FXZA 5GAPD 4JR6A 3LKJA 3L78A 2DKHA 4GKXA 2MHFA 2DMLA 1DDLA 4MYEA 5J1XA 2X49A 3D22A 3NJXA 3TN91 3SCGA 3GHMA 3LGRA 3MW3A 1W6MB 2O89A 4GWIA 1XWKA 1LOGA 3VBHA 1U3IA 2HYXA 3QAVA 3VBFB 2HRAA 4ZU4A 3KTBA 3NAPC 4QD2A 4WF4A 3LJRA 5BNPC 5F06A 1GR3A 4JX0A 1M9AA 3UGGA 3ZIVA 1JHJA 3J7NA 5EJ3A 4EN7B 1GWKA 4Q5RA 4CSWA 1ZA7A 3VPQA 1X9MB 3DIEA 4AW7A 5IO2A 1KEBA 2WN3A 3LDBA 3VHPA 1S3AA 3F6FA 2YCDA 5GZZB 2ZABA 5AFBA 4LHLA 1SJIA 1DYOA 4G4FA 3WDVA 1V9WA 3ZKUA 4YM3A 2DWRA 5LA2A 3CJXA 2WNOA 2W94A 4M00A 4K8MA 1NT0A 2C9AA 2HSMA 4QGNA 2DBCA 3TGZA 3W8SA 5F0GA 2D7FA 3FHQA 2RS53 3B93A 2HWE3 2C4JA 4L9BA 5BNPA 3AFKA 3NQHA 3GL5A 1A0RP 1Q4JA 4PX1A 4NHZA 1KJLA 2LKUA 4K2DA 3D8CA 3WT2A 1SL0B 1PNFA 2IN3A 2DTWA 5DCHA 1SDWA 2LRCA 2LJAA 3HD8B 2AUYA 4DSRA 3MIEA 1ODMA 4NIGA 4H86A 4OI2A 1B9XC 2J42A 2LW8A 4OFGA 5FK7A 3OBAA 3T0AA 2DV9A 3UAPA 2DU0A 4TRXA 1Q8OA 4PNFA 1RC6A 4YW7A 2WZEA 4QX0A 4OQ9A 2OADA 1HV1A 2LQQA 1JYIA 1Y4WA 5FZEA 1H1IA 3D6IA 4B7EA 3RPQA 2XWBB 2BVVA 3LGCA 2ARXA 2X10A 1IS3A 4NE9A 2H72A 4OZOA 1HB2A 3BU7A 4MK3A 1A2MA 1DGRA 2C1YA 5ECPB 4OHVA 3B9IA 2WFF1 1HJFA 3WNOA 5FZDA 2D3SA 2Z42A 4EC0A 2A1XA 3CDZB 5C3PA 1O8WA 3FFQA 5C4WA 2GALA 5CAXA 2FMDA 5EVOA 4UFIA 1ZCPA 5CG8A 3LFMA 3I2IA 4WVVA 5D9XA 1N3OA 2WLPA 5FWEA 1M2BA 3QCPA 3MV01 2R16A 3LORA 2VCMA 3KCXA 3I2KA 3AKPA 4HONA 1C5IA 1ENSA 3ZXDA 1TRUA 4OMVA 1LULA 4MP4A 3K75B 1V9U1 4TR1B 3HBKA 2VM2A 2K8SA 2W91A 2CAUA 3A7QA 5JSRA 3VZNA 1UVZA 3IOSA 4YVWB 4AFMA 1XSQA 3ZTLA 2EIDA 1YI9A 5K8SA 3D5OA 2PHFA 2TRCP 4Z2AA 5C6CA 4WBJA 3HDCA 1F2EA 3I6AA 5DJMA 2ZGMA 3WCRA 4YW2A 1HRV3 3WDWA 4E4DX 3X29B 3ERWA 1GTIA 2A6VA 2EIQA 2Y6JA 3WDXA 1YEXA 3HJOA 3QAWA 4Q0PA 1GICA 4TYSA 4Z82A 4NPRA 5DPNA 1OHFA 4EN6B 2KD7A 1Y9MA 4GSNA 3HQXA 2P3KA 3E5XA 5FUNA 2ET1A 1E5IA 2WNEA 2L6DA 4JQRA 4EDYA 4DNYA 4TXWA 5ACA1 5FREA 4NN0A 1D4M1 3VD3A 3WLUA 4IHUA 3ZREA 1MEC3 2JDKA 1THXA 3C7FA 2NPIA 3M3QA 5T5LA 1F37A 1EYBA 2B7YA 4X8PA 1VLNA 1JLWA 4JDMA 2PWJA 2KR2A 1SZBA 4AVBA 3O1PA 4FBFA 5A33A 2VLUA 1JUIA 3PURA 5JZGC 3EVIA 2JEMA 4O32A 3K51A 1NLSA 3W5NA 1CIWA 1K0DA 2VL4A 5CIRA 3L2HA 1JU4A 4FXKB 4IE4A 2R072 5A3WA 3D3AA 5ID2B 4DUWA 3RZLA 4XHBA 1W9WA 1BYHA 5H9RA 4Z7XA 4Z2RA 5F8BA 1SLIA 1OFNA 2N5BA 3AX4A 4D94A 4IGPA 4FTEA 1MS1A 4ZPIA 4AJ7A 1FMD3 1XE0A 4XTPA 4B1LA 1EAH3 2C0GA 3VLNA 3U4SA 2D3RA 3LPGA 5JZGA 5EHDA 1QJY2 4HKLA 2BJXA 2B45X 4ZBAA 3WF2A 3D0ZA 1XWGA 1F4HA 4AXOA 1OQEA 1QGVA 1JYXA 3MV11 1UIJA 4AHXA 2B46X 4K9SA 1NA1B 1UQXA 4TVEA 4GULA 5BUVA 5CNWA 3MDPA 1CQGA 3GMFA 2A4HA 2G0FA 3WVJA 1FVKA 4PDWB 1OVSA 2Z79A 5HV0A 2MNGA 1C4RA 1LENA 2O8QA 2WFPA 1V40A 3JCML 1UZYA 2OKAA 3IM0A 2RR13 4GKYA 4LNVA 4PF1A 3V0AA 4GXLA 3P7XA 3I4IA 1PMTA 2HSYA 1UY2A 4HZFA 3BIEA 3HVNA 3IA1A 3SISA 1S0DA 3MYDA 5JOWA 4JGYB 1KD7A 3PUQA 1J3RA 1PL2A 1W3XA 2WS93 5T5OA 3V56A 2QQVA 1YUDA 5HXVA 1BQPA 5FMCA 5F3IA 3JU9A 4PUAA 1GANA 1CAWA 2ZGTA 4W8JA 2CV6A 4K1YA 2FBEA 1ULGA 2QA1A 4XS6A 1W6MA 1LB2A 3KQ4B 2E6VA 2VUPA 2V09A 3VBFA 2H76A 2RS52 2HWE2 4Y4RA 1LOFA 4FPFA 4PI0A 2JZSA 5KXBA 5HCAA 5CP1A 2RDNA 2Y6LA 1QJX3 2YFZA 5JR2A 4OULA 1TMF2 4LO4B 4KL1A 2C3NA 5F6LB 3KH7A 3AMHA 1PIV1 1QMVA 4P9LA 2B1KA 4XXAA 4I09A 1F5FA 2YZUA 2VQ0A 1S0JA 3SLIA 1HRI1 4XUOA 1H0BA 1ZX5A 3IAM2 3BOPA 2VH9A 1IG3A 3FL7A 1H8TA 5FZKA 1HIXA 4LA2A 4R9AA 5HBAA 3IB3A 5IVEA 4CW9A 2VCBA 2JJ6A 3AL6A 5FP3A 1VMFA 3NV2A 1OVNA 1UAIA 1H2KA 4K2XA 1OC1A 1S2KA 4IJ3A 3JBG1 1LOAA 4ZBDA 4NVPA 3FHAA 1IPSA 4AGGA 4TR4A 3J7Yk 2VLTA 5IK7A 2C0DA 1L7LA 3QH7A 1CQHA 2IXCA 5LY2A 1UY1A 5EWSA 2PHLA 3MW2A 5FZAA 2OPKA 4GIQA 2E26A 3AMMA 5HCHA 3KQRA 2VQAA 5KBFA 17GSA 1RHI1 1T6BX 1XU1A 1G6WA 2HT9A 5ECQB 2F8FA 2H73A 2REMA 3ME7A 1ENRA 1A78A 4L0UA 4W6WA 4HBNA 2BVBA 1REFA 4XFGA 3N5OA 4UFKA 3TN93 1F3BA 2V4VA 1WW6A 1XYPA 2RDRA 5FYIA 3PVOA 2D6NA 2WNUA 5IIZA 3WP6A 4ID0A 2BWAA 3B69A 4YVWC 1N47A 1UCXA 2PFWA 1X8MA 4XAAA 2WIIB 1GSYA 4RGGA 3BYWA 1YQ8A 3NVCA 1HRV2 2R0CA 2CDOA 5J36A 2NN8A 2HWB1 1U6TA 1J08A 3OG2A 1WMEA 1FW1A 2PAKA 2VMHA 4ATEA 1YFYA 1PGL2 2H01A 4JHZA 3SWLA 2ZEWA 3NMBA 1NKGA 1JZ3A 4YM2A 3FR3A 1OT5A 2V5DA 3VBSB 4UFMA 1D0GA 1W2UA 1OLME 3L4NA 2XVKA 2B4KA 4AK3A 4MGIE 5A7QA 1O3SA 1VBD1 4TR1A 4NIDA 4WBRD 3GHAA 2A7AA 2V73A 1UYYA 2XC2A 4JKMA 1H2LA 4YVWA 2Y6FA 3F8UA 4XILA 3VGIA 1EY2A 3TNQA 4JDOA 2NDOA 2XDVA 3ASIA 1OAZA 1BVP1 1MEC2 5DAQA 2VO4A 3HZ8A 5LK5A 5F05A 3FMWA 2EIRA 3R4UA 5IMZA 1XZOA 3IPZA 1WD3A 3AP5A 1LU2A 4KU7A 3S7EA 4BVYA 2QUOA 1JLVA 3V1WA 5IK4A 2IMKA 5DALB 2ZX4A 5A7SA 2YY1A 4G0IA 3WDUA 1ZYEA 5DCGA 2BUKA 2VG9A 2JSZA 2QZ3A 4QL7A 3I2HA 2VW1A 3AP9A 1DQ5A 5E89A 2R061 1V6LA 3BALA 3WNMA 4I0BA 4J57E 1GOFA 4A45A 4MV2A 4I3PA 3RS6A 2WFF3 2IMIA 3DUIA 1JZ2A 3KCCA 4U2AA 2RE9A 4EN9B 5H5SA 1EGOA 5F3CA 4GWMA 2ZJCA 4NPLA 3TNPB 1M7TA 3OBZA 1BK0A 4GTUA 2H0VA 5IFTA 2K46A 4XF4A 2YU1A 1AX1A 1WE0A 1BJXA 1FV2A 3WDTA 5IVBA 4UF0A 4EZHA 5FIXA 3AC0A 4XFBA 3WF3A 3TJJA 1U5ZA 3HAGA 1NA1C 3SKJE 4BXSV 5JWRB 1PK6A 5C33A 1U3AA 1AX2A 3IHGA 1GKBA 4DEJA 5FRAA 5JI9A 1PX7A 4R9DA 3J8F2 3TOTA 1QDCA 3KM5A 5JOZA 4PDWC 2H1BA 5DZEA 4A3XA 1OA2A 1C8M1 2IFQB 3RAZA 3IMNA 3FUQA 3GNEA 4GH4A 1HD2A 2OQ7A 3FN9A 2BOJA 3KHBA 4O65A 1XNAA 4HSJA 1F15A 2GH2A 4EROA 4IV1C 1LOBA 4KUNA 4IEPA 2LTNA 4JGYC 3JXSA 1GTUA 1V6KA 3OF1A 4ZL9A 1T8EB 5GLVA 4YGBA 3W21A 2PVOC 3GURA 1J58A 3LW9A 4Y5TA 2NMNA 1QUWA 1HLCA 2IJYA 4MZWA 3AKTA 3RMYA 4JKLA 1X8EA 1POV1 3WHTA 1AX0A 5ECNB 4MMMA 3L9SA 4PDWA 4D73B 4PF5A 4AI9A 1JTZX 1ZREA 2VO5A 4RQRA 1TW9A 4HSCX 4CDQB 4OCFA 5AVAA 4ASMB 1A8YA 3AKQA 5ACA3 4KBBA 1ZZBA 1D4M3 4QPYA 3RPPA 4XETA 4FO5A 1MPXA 3IC8A 2W1WA 5IATA 3K77A 1I9RA 1QJX2 4XF0A 3PHMA 4CEWB 1H6YA 2YWMA 4WETA 4LUKA 3I8TA 2EIEA 2B6MA 1W8FA 1PZ8A 2XJSA 4HG6B 3RHCA 1VMJA 1I6XA 4H3WA 4Y1VA 1Q8PA 4AFBA 1DE2A 3ZM8A 3AYEA 5D73A 1BBT2 4ISRA 4B29A 2TIRA 1XE8A 3ROUA 2W47A 1C1FA 3RHBA 2QKEA 3J7HA 2CWMA 1LEMA 4D69A 2OZJA 4PJYA 3EXUA 4N8MA 3LXTA 4WR5A 1K5MC 1U5XA 4M0NA 4FSJA 3CYNA 1NLRA 3L9VA 1APNA 3UEMA 3VWUA 2CX3A 4NRMA 2VTFA 3ZXKA 4NHMA 3KH9A 3DYPA 2L57A 3RZZA 2H0GA 4RI7A 1GP4A 4MZCA 1OE7A 1NW2A 1XBFA 3EC3A 1BAYA 1XVWA 5AFEA 5KC5A 3E5UA 1ASJ1 2VM9A 4NWYA 4NOTA 4ZB8A 2HBTA 4CXWA 2ORZA 4CVUA 3IAQA 2H70A 2JDMA 2QQWA 5DUUA 4CY8A 3M7AA 3PUIA 1ILOA 3RI9A 5KOXA 1XW5A 4IELA 2DBNA 2GT6A 4PURA 1NHOA 4Q4W1 3TN92 5FZMA 3KV4A 2MMNA 1MS3A 4GMP1 2WJSA 4B4PA 1LAJA 1Q56A 4YLZA 3CBUA 4A5PA 3ZRDA 1JODA 1SBFA 5T52A 4FP3A 4YW1A 1Q5OA 3ZZXA 1CAXA 1UO9A 1XPWA 4COZA 2K9ZA 4R8HA 3PPUA 1BLZA 2DFBA 3RDWA 2CV4A 3FKFA 5C9AA 1UU5A 2A75A 5EY6A 2BMXA 4I0WB 3AK0A 4L0PA 4B1MA 4BQ1A 5ISLA 3K3OA 1YFWA 4W6XA 3B94A 5HCFA 3VBSC 3I2DA 1J3PA 3HA9A 4Y1YA 1MZEA 2ZCWA 1E5SA 1X9TA 4O9EA 4FXGB 4CU7A 1F5JA 1X82A 2O85A 3AMQA 3GZTB 3FLPA 4MPGA 4JTNA 1NQDA 3VDCA 4D8MA 3IC4A 3ILNA 2WYFA 5BXXA 3WNXA 5FYUA 1T00A 4CDWB 2L5LA 4BQXA 3D4TA 4NUBA 3N35A 4DZGA 1Y6EA 3DGTA 2WDBA 1HNBA 1MDIA 3MSZA 1YF0A 1WUVA 4DPNA 5C8CB 2E2MA 3VBSA 2PN8A 3TEXA 1FX5A 3B9CA 5A1AA 5IUQA 3GKKA 2VUJA 3U6VA 1WCQA 3G7DA 2LUSA 3A23A 1B9YC 4HETA 2HKXA 3KD4A 3WHUA 3RRDA 1HRI3 5KXDA 2Z9SA 4CY6A 2KHPA 1QIQA 5C5TA 3C2UA 2IVJA 5LRSA 4DB5A 1QWRA 2R0HA 2JDUA 1UOFA 5FYZA 1VRH1 4BQWA 2XGXA 3JBG3 4YAVA 1GQGA 3U14A 2WFF2 2ZX0A 4A41A 4MXVA 4COWA 3EURA 3LSDA 3MAKA 3W5MA 1AAZA 3SMHA 1S4CA 3RZKA 4E8HA 1XOAA 1T3BA 1GLPA 1MTCA 1IKPA 1BJQA 3DWVA 3DYMA 5CEHA 2O8OA 3E97A 3GX0A 4BQYA 4K5RA 1R092 1RHI3 1POQA 5D8AB 3PIJA 3OYWB 2Q0AA 4ZY9A 5B7CA 4GWNA 4RI6A 2EXKA 5FQ0A 4OI4A 2NVLA 3T0BA 1O7FA 3FJSA 1RUC2 5FUPA 1TI1A 4NHXA 3AXDA 3O12A 1PKZA 1V9U2 2I1UA 5F39A 4BMBA 3ZN6A 3BTXA 2HZEB 5J3UA 1OXCA 1WW7A 3USUB 2YANA 4LT5A 5DJLA 4MXWB 3HCZA 3E0UA 4LBOA 2KXLA 2VL9A 4QB6A 1ENQA 2LNTA 1RUE1