5CYYA

Structure of the c-terminal domains of dipz from mycobacterium tuberculosis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
333
structure length
333
Chain Sequence
TGTEIREQLNLGGIVNAQNAQLSNCSDGAAQLESCGTAPDLKGITGWLNTPGNKPIDLKSLRGKVVLIDFWAYSCINCQRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAKGAANLGISYPIALDNNYATWTNYRNRYWPAEYLIDATGTVRHIKFGEGDYNVTETLVRQLLNDAKPGVKLPQPSSTTTPDLTPRAALTPETYFGVGKVVNYGGGGAYDEGSAVFDYPPSLAANSFALRGRWALDYQGATSDGNDAAIKLNYHAKDVYIVVGGTGTLTVVRDGKPATLPISGPPTTHQVVAGYRLASETLEVRPSKGLQVFSFTYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the ectodomain of the electron transporter Rv2874 from Mycobacterium tuberculosis reveals a thioredoxin-like domain combined with a carbohydrate-binding module.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Membrane protein
molecule keywords Protein DipZ
total genus 91
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF17991 Thioredoxin_10 Thioredoxin like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5cyyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5cyyA01
2X8CA 2YFUA 4LQRA 3GTUA 3TKSC 2LV3A 2VOCA 3DMLA 4MJAA 5A5KA 4OWYA 4ZZ5A 3LSZA 4XCSA 5JCUA 1FOVA 2VCWA 2OKXA 4PNFA 1UY1A 1QGVA 5D73A 1EOGA 4P00B 1SU9A 5KN2A 2VCBA 2E33A 3LORA 5CRWA 3ACFA 3IK9A 4NHWA 4ISDA 3EYTA 2H01A 4IVFA 2AV4A 3QPMA 2H66A 3HJPA 5G1KA 3WNLA 3VK9A 4PXOA 4WF5A 5IJRA 5C7GA 3CSIA 1X9WB 2LRTA 2HSYA 2GT5A 1JZ6A 4TR0A 1X9MB 4MGSA 4Z2AA 1TG7A 2RM6A 3F63A 1T00A 2H30A 2O89A 2HLSA 2PVQA 2EIRA 2V32A 3LQ7A 4P08A 4MZWA 4O32A 1LU4A 4PF1A 2CA8A 4E8EA 3LPGA 1SENA 2YWMA 3V1WA 4OMDA 4OMCA 4DXSA 1UYXA 4LLRA 4XRDA 3HNMA 4ZBAA 2L9LA 4MA9A 3HOBA 3P6BA 2VCVA 2CV4A 4EO3A 3VDAA 4L0UA 5JWOB 3BGAA 1F6MC 1PX3A 3ZIVA 5HXMA 3UEMA 2IJYA 2HE3A 2ON7A 1PD21 4K0GA 1S3AA 2DCJA 5IYYA 2L6DA 4IKHA 1KGYA 2YJ7A 1YF0A 2H0GA 3C8XA 2WYSA 5DQ0A 1VF4A 1I5GA 1A2JA 4OZOA 1OKDA 3FZ4A 4I97A 2LRNA 3RBTA 1X9SB 3TKSA 1TRUA 2GVPA 2IFQB 3E9JB 4DEJA 5DJLA 5IM9A 4MJBA 3F6FA 3C7FA 3IAM2 3E0UA 4XRAA 1XVWA 2M46A 3F3QA 2KLXA 4N0ZA 1QFNA 1H4OA 3GDBA 2IWTA 2JSZA 3ZIJA 3HD5A 2HZEB 2FNOA 3BJ5A 1GUIA 2N5AA 4JKLA 3BBYA 4KDYA 3HDCA 3W8SA 1SKSB 1K3OA 2ZEYA 3CQOA 1MD4A 1A24A 1DE1A 1O59A 3ACGA 1SJ6A 1U88A 3KM6A 4MP4A 4MF6A 2MMZA 2EIOA 3CMIA 1OVNA 2VLVA 2A2SA 1ULOA 4HDEA 4NPBA 16GSA 4EDZA 1YKAA 3D4MA 4QB1A 1ON4A 1UWWA 5DN2A 3I6AA 2GS3A 2LNSA 3EMXA 5IIZA 2EIEA 2HXKA 1FO5A 3T09A 2PU9C 4A41A 2IPAA 2Y64A 4IUGA 3KIJA 3UARA 1WOUA 5IHRA 4TR3A 2W94A 1XXUA 2OJLA 3FHKA 3ME7A 2VOTA 4DUVA 3H4KA 2X8HA 2GZZA 4QX1A 1GOFA 4A6OA 1GSDA 2LJKA 3WGEA 3ZMLA 5ID2B 2DJKA 4QB2A 2V6OA 4GLTA 5ECPB 4GSTA 4TTGA 3D3AA 4MDCA 2ZEXA 3L4NA 2F8AA 4NMUA 3VPTA 2QC7A 2WB9A 2LW8A 2OA7A 1UC7A 4K7IA 1PKWA 1XNTA 1B8XA 1GSUA 3FEUA 2W95A 2GQLA 4K2DA 4DEVA 3VD3A 1EP8A 3Q19A 1A0FA 3HYPA 5CRDA 3L0HA 3F9UA 4TR1B 2W46A 3IDAA 1C72A 4TW5A 4AJ7A 2V72A 1XZOA 2K9FA 3NOFA 3E1F1 2LS6A 3ZLPA 4CUCA 1W9TA 3UMAA 1UYYA 17GSA 3ZRDA 4HS1A 1Y6EA 3T2PA 3TCOA 1GUMA 3L9VA 2I9HA 1OYJA 2V6KA 1OC9B 2P0GA 2HNLA 4TXOB 3DECA 4KE3A 1GSQA 2VR4A 1WKYA 4KSOA 3CSJA 2XBQA 1F9MA 3GM8A 2ON5A 2J1RA 5CO3A 3K4DA 3CIHA 2F9SA 3QAVA 4MCUA 3ZYWA 3KMNA 4FYCA 4IP1A 2H71A 2YP6A 2VZOA 4HG6B 2VL9A 4EKZA 3UESA 5B8AA 2WO2A 3DYMA 3U37A 3RHCA 2IMFA 3APQA 5KN0A 4MJEA 1M99A 2YB7A 2I3YA 2LTKA 13GSA 3J7Yk 2Y6HA 3L9SA 4LA1A 2C3TA 2WQ8A 3TKPA 2AB6A 4OD7A 4W50A 1Q98A 1O8XA 2MBSA 1O8SA 2RM5A 2VQUA 2WZ9A 2JADA 2L59A 2TRCP 3ABZA 2AHEA 2C4XA 2A4VA 2DMLA 3GKMA 2CDOA 3W5MA 4JE1A 1EUTA 4EDYA 3CSHA 2VZUA 4KCEA 2VZPA 4CU7A 3A2VA 3FZ5A 3CZUA 4ID0A 2MBTA 4BXSV 1Z5YE 1S3DA 5IFTA 4J2FA 4PQ1A 3KP8A 3UNPA 1WMJA 3T0AA 1XOBA 4V2NA 1W9WA 5B4XA 4L5LA 2P5QA 1OAZA 1KEXA 3TKRA 3C1RA 1CZTA 5HPOA 2VZTA 3IBHA 1ZMAA 3IA1A 2WDUA 3HVSA 3GH9A 5EVOA 3LXZA 1TXXA 2IIYA 1DYOA 3WD6A 3C7EA 4P02B 1UMHA 3M8NA 5FWGA 3VD5A 2OBKA 1K3YA 2LEGA 1X5DA 3N9JA 4PQHA 4LKSA 2WO3A 1WJKA 3GFKA 3LYPA 2H72A 3LYKA 1A8LA 2YV9A 18GSA 1TDIA 4QX2A 2YFZA 2NVLA 3A22A 3W8JA 1GUKA 5DDLA 2H75A 4ZL7A 2B4KA 3WF1A 3UIWA 4QL7A 3T0BA 2H73A 4J57E 1GWCA 1RW1A 5COHA 3VWXA 3TDGA 2VMCA 4KDXA 5EPFA 3D5JA 5B4NA 3Q74A 5DQYA 3EVIA 5FHIA 2KOKA 3M9KA 3VD4A 2W5FA 4WR5A 2X10A 2CX3A 2VCZA 3LJRA 2E2GA 4ZXEA 1O8WA 3HJRA 5J9BA 1NAEA 3M9JA 1G0TA 1PMHX 5E59A 3G7IA 2FUG2 2J1UA 1Z3EA 4GXZA 2GQMA 2LQQA 1DUGA 2VZ1A 2GSSA 4DSQA 1XPWA 2AYTA 4WKWA 2J1AA 3WF0A 2ES7A 3EB7A 1KTEA 3IPZA 3GX0A 1TKDB 5IQYA 3ED3A 4ET7A 1V57A 5D9VA 4XUQA 19GSA 4JKMA 4OUEA 3CTFA 1OC9A 4Q5FA 4TXOA 1Y25A 1OKTA 4GWRA 4LHSA 5G5FA 2ORZA 2WABA 3H79A 1VF1A 4EF0A 3QCPA 1YQ1A 2Y6LA 3K4ZA 4XUTA 4LL4B 1JZ5A 2WAAA 3DWVA 1T7PB 1JLWA 4QX3A 2VCAA 3UAPA 2VM1A 3D0ZA 4IELA 4POLA 4UAPA 2IFQA 2JZRA 11GSA 3NIVA 3IOSA 1TW9A 3C8EA 1WIKA 1OH4A 2GDRA 1CQHA 4ACSA 2AUVA 5C70A 1W9SA 3JCML 1UZ0A 2JKXA 2HZEA 1ERUA 3RHBA 3OGVA 3HNYM 1GSSA 2B7KA 5JWQB 5IPHA 2O7KA 3P8WA 4DXTA 1SG3A 4ECJA 1G7EA 1V98A 3BD2A 3UVTA 4CHSA 2RIIA 1GTIA 1GMMA 3D4TA 3VPQA 1M7TA 1NSWA 6GSVA 1XW9A 1SL2B 2J1TA 3FY7A 5JR2A 2G0FA 3F4TA 4TRXA 3EU4A 2L57A 2VO4A 2KP1A 4MH3A 1UY2A 1Z6MA 4CUBA 4WBJA 1O8PA 5IMDA 2KD7A 3HXSA 1K12A 3G7YA 4OFTA 3GA4A 4MK3A 1BAYA 4G2EA 1GRXA 1FVKA 2B3SA 2VQTA 3GHAA 5DALA 3A3TA 4GSSA 3BCIA 2X09A 2BZDA 3TGZA 4EXJA 3RAZA 3I2IA 2VCQA 3JXSA 3QFBC 5A1AA 4EC0A 2W87A 3GUSA 5IMAA 1ZL9A 2OBIA 4Q5QA 4JEDA 3L78A 1H6XA 1SK2A 3ECQA 3WQBA 1V40A 4ECCA 5GAPD 3KEBA 2VZRA 1HD2A 1XWCA 2VLTA 1AIUA 1NUKA 1JHJA 5CZKA 4OFNA 4LPLA 4IHUA 3F3RA 2VM2A 1PMJX 5C00A 3IHQA 2GSRA 4XS4B 1ZYQB 2X64A 1O73A 4POKA 4KMQA 5JXIA 1OC8A 3TRXA 3G7JA 4CUAA 5DBQA 1J9BA 4YQVA 3LWAA 1JU4A 4AAXA 1TI3A 3A7QA 2VL2C 1M2DA 4RYDA 3DVWA 2CVKA 3D21A 2WAOA 4MOAA 4IBPA 1ZCPA 3GX8A 3UBKA 3R2QA 2R37A 1M9AA 3TUEA 5J4UA 3SBCA 1W89A 1UXZA 3T0DA 2J23A 5HR2A 3LFLA 3ZFLA 3P7XA 2E26A 3K4AA 4OMVA 5D9XA 3A5WA 1GL8A 5LA1A 1SL1B 4PT6A 4G10A 1J83A 1K0OA 4MLYA 2K6VA 3WF2A 3A21A 1BG5A 2REMA 5B7CA 4RI6A 2H1GA 2QGVA 1AQVA 5B6NA 3PUHA 5JXGA 2H74A 4P5YA 1XOAA 4CW9A 2H8LA 1HYUA 2P5RA 2W3JA 4A45A 2V1MA 2QQJA 1YQ2A 2NDOA 2H1AA 4NXIA 1XWBA 3W6GA 1Z6NA 2RUFA 4H86A 4HZ4A 2XQXA 5HQPA 2H19A 4QB6A 2W1UA 4MH2A 2RLIA 3HA9A 4I6XA 3BOAA 5G31A 4IP6A 1W0NA 3GURA 4AJ6A 1GUHA 1ZGNA 4KW6A 5F07A 2DJ3A 2MZCA 3DRNA 1KBNA 2IMDA 3UBLA 1A23A 3TJGA 4HU9A 1MDIA 3WSOA 3DGQA 3C7GA 1PMTA 1GSYA 4QQ7A 2CDPA 3RDWA 2MMNA 4M4RA 1K0DA 3EE2A 1EUUA 2MMAA 2PERA 2VMDA 5HFGA 1PX7A 4Q5RA 3HJMA 4BK4A 2N5FA 2W92A 5G1LA 2HYXA 3HN3A 3I43A 2Y8KA 2LSTA 3GV1A 2K18A 1SD8A 2K8VA 4AGSA 3OG2A 3RPNA 1GLPA 4GQCA 3O76A 3IAPA 1S3CA 3UL3A 1XIYA 4HJ2A 1K3LA 4RQXA 3K46A 4XUPA 3HJOA 1EEMA 2N5BA 4F2IA 4PX1A 5ECNB 4FYUA 2D2ZA 3FHQA 3L9UA 4P3YB 2OACA 2RUEA 3FZ9A 4V2LA 4GTUA 2DLXA 4XUNA 4CVUA 3VLNA 1OE7A 5GSSA 3KTBA 2E31A 3WF4A 1GQPA 2EICA 3KXOA 2DIYA 2R5GA 3LQCA 4ML1A 2ORXA 4JHZA 1NHYA 3IR4A 3WNMA 2J1VA 3ZZXA 5HFKA 2VTFA 2PWJA 2FA4A 4I2TA 3LG6A 2H0IA 5HR3A 3GSTA 4JX0A 5LCZA 1O6JA 3GN3A 3DIEA 1CX1A 1EP7A 3IC4A 3GNJA 4X0XA 1R64A 4X43A 2W1WA 3ZM8A 5IMFA 4MF5A 5HR0A 2L6CA 2YOIA 4MO3M 5EJZB 2V5DA 4HQSA 5G30A 3VFIA 3FZAA 3KD0A 4NHZA 1YF1A 4XS6A 1X5CA 1OC3A 5AIVA 3NZNA 3HKRA 4KUNA 1PKZA 5C71A 3GKNA 2YWIA 3LXTA 2CQ9A 3D22A 3PUIA 2BBAA 4KX4A 4ZL9A 1RQMA 1Z7PA 1ZOFA 3QMXA 2RV9A 1HQOA 2CX4A 3CBUA 4WEYA 4RN5A 1GTUA 1O7UA 4V1Ag 1GNYA 1E2YA 1W8NA 4ILFA 5ECHB 3ZFBA 1AQWA 3DYOA 1UMIA 1MDJA 1PRXA 2WZEA 2ZUPA 1QK8A 3W5NA 1FG4A 4HJMA 3CRTA 1PGTA 3HHVA 3VD9A 5F05A 2A2RA 3I2JA 3T2OA 2FA8A 3PH9A 5J1XA 2QSIA 2ZCTA 3I2GA 2CZ2A 2LUSA 3GRXA 4RUVA 2VAFA 3GL3A 3PR8A 3VDBA 3GGLA 1YEXA 2HI7A 2GQKA 3H1NA 1TI1A 4YQUA 4ECIA 1CZSA 4DXRA 4KI5M 5DAKB 2VL3A 3F4SA 1JFUA 2RJ2A 1K0MA 1THXA 4ZIJA 1M2BA 3WNNA 5D93A 4TR4A 1GNEA 3ZITA 1BYEA 3TJBA 2DDUA 1TVGA 3TJJA 4QDSA 2E32A 3HPNA 3WNPA 3I2FA 1WE0A 1JLVA 3HNBM 5B6MA 5FT3A 1F2EA 1BHGA 2M72A 2AAWA 5IMVA 2H0HA 4JZQA 2DJJA 2B7JA 1MEKA 1JZ7A 1MTCA 2QQIA 1NHOA 2LJAA 1RK4A 2VMEA 1VGLA 3P1IA 2HZFA 2GZYA 3C7MA 5CRHA 1U87A 2QQMA 4L0PA 1XPVA 2BGPA 4OFMA 2FWGA 3ACHA 3ZTLA 2C9KA 2YANA 2R7EB 5IPGA 5I0DA 4IN0A 3I2HA 3U6VA 1SK0A 4UOJA 1F3AA 2GTUA 3IIIA 1AQXA 4A3ZA 1ERWA 1XW5A 5JUVA 5ECQB 2CAIA 6GSXA 4FO5A 1F37A 3BCKA 3QR6A 4GWJA 5JMOA 1EOHA 4K0NA 4XS4A 4BA7A 1OE8A 1JZ8A 4HQZA 2PMTA 4Q5NA 1V2AA 1VRSD 1T8EB 5DJMA 1TK8B 5JXJA 1FW1A 2JE8A 5J9CA 4BWQA 2L4QA 3PGTA 1UY0A 4KDUA 4QL9A 4YAVA 2FGXA 4V2MA 3J7HA 3O6TA 3MBWA 3ZVJD 1I5PA 2H70A 3WGXA 2FHEA 3KJYA 1WCQA 1EV4A 3SKJE 3NNGA 3IV4A 1UYZA 1WRYA 4MABA 2R4VA 2CAQA 5ENUA 1FHEA 3WT1A 1MDKA 3OGSA 4MZCA 3ERWA 4BPYA 2OKAA 3KGKA 3CTGA 3EINA 2W47A 1EWXA 2VZVA 4DSRA 1TP9A 1DSBA 4XIHA 2IL3A 2B5XA 3IAQA 3C7HA 3HY2A 1F4HA 4DUWA 2WO1A 4XURA 5A4UA 1QUWA 1ACVA 8GSSA 2EIDA 2HSHA 4L5OA 1TTZA 2XPDA 3KTLA 2E0QA 3TRQA 2IN3A 4O7HA 2B6MA 3LEIA 1SL0B 4ZBBA 1JZOA 5CRGA 4ECBA 1R4WA 5ECRB 1K0NA 3HZ4A 4HI7A 3K8NA 4YQMA 1ST9A 1TRVA 2YCDA 4OO4A 3MNGA 1GH2A 4XUOA 3NRUA 2X99A 5ECMB 2TRXA 2J9HA 5D9TA 2XBIA 2WN3A 3FR6A 4JU5A 4JBBA 4XTSA 3ERFA 5DAKA 2JD9A 2H6YA 4WXTA 2YV7A 4IW9A 3VWWA 3I97A 1IYHA 3C1SA 1LBKA 5KEJA 2GSQA 5G04L 1GSFA 1SYXA 5G2ZA 5GSTA 4BJ0A 3C7OA 3I3EA 5IMZA 4KGIA 4HU7A 4TOPA 3TB2A 5JXHA 4EL1A 2VD1A 4BVYA 1M2AA 5DCGA 3WGDA 1ABAA 1J84A 1QQ2A 1UX7A 2VIMA 4PGTA 2G2QA 1T2XA 1XFLA 2KP2A 2C0EA 4ZILA 1AW9A 2QQOA 3VURA 2VM9A 4YPJA 2V2GA 1PL1A 2YN1A 5ID2A 1R7HA 3CXGA 1JYWA 1GOGA 4FI9A 2PBJA 4ZBDA 2GGTA 2FWHA 4X1UA 3F2ZA 1H75A 2FD3A 1NW2A 2Y6GA 3UETA 1MD3A 2DIZA 3AY8A 2JU5A 2J1EA 2PUKC 4K7NA 4XS1A 3FHAA 1F4AA 2H1DA 2FWFA 4MPGA 5F8BA 3KMOA 2B1LA 3EC3A 3EMPA 4AG4A 7GSSA 5LA0A 1HNAA 3GIXA 3VD7A 4AJ8A 1CQGA 4F9ZA 2XONA 3ERGA 2VZSA 1OF3A 5DMYA 2XHFA 2YG0A 3VWVA 1GNWA 1K0BA 3TJFA 3M3MA 2J1SA 1R26A 3QDNA 1TOFA 1JZ3A 3MUY1 2EIBA 2LJRA 5LCWL 2O87A 3UVHA 1THOA 5JCWA 2WGRA 14GSA 5AGYA 2PPTA 5L71A 4N30A 1PL2A 1MPXA 1DP0A 1B4PA 4ZB8A 1IYIA 3GH6A 4D8MA 2Y6KA 3K75B 3I9V2 2YJHA 4MF7A 4LMWA 3J7Yb 2W91A 4XHMA 2WJUA 3FRCA 3H93A 2P31A 3ISOA 1ILOA 1W4VA 2IMIA 1W8OA 4W8JA 2FCHA 4TVEA 1AAZA 3FR9A 4KWUA 1VF3A 5EIYB 1O81A 1WP0A 2WFCA 4L8EA 6GSWA 5EL8A 4OYUA 6GSUA 1PQNA 4QDQA 1H6YA 3PINA 5JCGA 22GSA 2DSAA 2GSTA 5DPNA 5CAXA 2YWOA 2VCTA 1ERTA 3FR3A 3ZVJA 4EE0A 2ZEWA 5FUIA 4MZBA 3I3BA 4JRRA 1GP1A 1V9WA 1JZDA 2W9XA 4GZ9A 4OO5A 3M1GA 4I8BA 5JWRB 3I3DA 2XC2A 4IGJA 2QQNA 4N10A 2YNXA 2DJ0A 3N5OA 2HRFA 2IMKA 3QD9A 5ELGA 1EGOA 2DBCA 4G19A 4BL7A 1O85A 3DYPA 2BTOT 4JR6A 4POMA 1GOHA 1XWKA 4ZB9A 3MSZA 1FB6A 5A4VA 3DEXA 2IMEA 1I9DA 1PN9A 2OE1A 3E3EA 1M0UA 2B1KA 2XPEA 20GSA 2VCCA 2NTOA 3A2XA 3HVVA 1T3BA 4V1Ap 2XOMA 3ZMKA 5LD0A 1EGRA 2B5EA 1CZVA 2EIQA 10GSA 1K0CA 2ALBA 3OR5A 2DJ1A 2DC5A 4OCFA 4ZZ8A 5LNKe 4CU6A 4KH7A 2DCKA 5DQSA 4ARYA 1JZ4A 5G05L 1SKWB 3ETPA 4ZL8A 3CKHA 5F7UA 1G7OA 4DVCA 4QDRA 3SEPA 4MPFA 4K8MA 2C0FA 1K0AA 1JYNA 2Z9SA 4QAWA 1Q4JA 2H76A 4HOJA 4HUAA 3EYPA 2W1SA 2C8UA 1J0FA 4PUAA 4MADA 1US3A 2LKUA 3LEFA 1OD3A 3NQHA 2RVAA 1LNSA 5IOXA 4KAEA 4N11A 5J3RA 5HFIA 4I5QA 3TOUA 1R5PA 2NBSA 2OE0A 3VDCA 4HZ2A 4DEQA 5J41A 3G9BA 3AC0A 1K42A 3MUZ1 2HFDA 2LNTA 5ECKB 2E2MA 1WWJA 2KUCA 1G6YA 5GAND 1A8YA 4KSMA 1OF4A 2C26A 3SWLA 1SKRB 4CDOA 4O5RA 1K45A 3GMFA 1G6WA 5AISA 3A2WA 1EZKA 3DKSA 1AC1A 4KCAA 2YC4A 4FYBA 3D6IA 1HNBA 4QX0A 3DD3A 1M9BA 3VWUA 4K1FA 2JDAA 3FW2A 3GSSA 2WUHA 1JU3A 2VJXA 4E8CA 5ECSA 4WETA 5CYYA 3HVXA 2F8FA 5IO2A 2QBXA 4NAXA 2QQKA 3WEZA 4F0BA 3I69A 4F0CA 1XWGA 3P2AA 1BEDA 2J22A 3LEGA 4EVMA 3WYWA 1TK0B 4LL1B 5B8BA 3IB3A 2H6ZA 2I1UA 3P90A 1XVQA 5CNWA 2VMFA 2KHPA 2VZ3A 1XC6A 1T4ZA 3WT2A 1CIYA 2BERA 1YDKA 2M80A 1K3IA 1DBYA 1U3AA 2H6XA 4KB3A 4YH2A 2I4AA 4TXWA 2QKEA 2VD0A 3RPPA 3S9FA 3IE3A 3IAS2 5F0GA 2R6KA 1AXDA 3GKKA 5CREA 1T1VA 3F0IA 9GSSA 2HLEA 2TIRA 1BJXA 2VL4A 4POBA 2B9VA 2WULA 2ZEZA 3DXBA 3EWLA 1Z7RA 3BN6A 1X0RA 2GLRA 4K7OA 1ML6A 4CU8A 3ACIA 1B48A 1SHWB 4E8DA 3US3A 3GXUA 2C1YA 2HRNA 1PX6A 3QFAC 4PQIA 3CRUA 2BGOA 4KA0A 2C4JA 1TJDA 3KH7A 2QQLA 5DALB 3OBAA 2VCXA 2OE3A 2JSYA 2YPMA 3THDA 3O3TA 2VZQA 4XVHA 3UJ1A 2I81A 4IJIA 3TRPA 1AUCA 3HCZA 2E7PA 4NV5A 1D7PM 12GSA 2PN8A 1YJ6A 4TXVA 2JL4A 3FL7A 3OEAA 5LA2A 2C3NA 4JKKA 4GQFA 2WS2A 4JR4A 2MMOA 5D96A 2DMMA 3TKSE 4PUFC 2LRCA 2JACA 3ZREA 2VUPA 4G9HA 2C0DA 2H1BA 1FVJA 1B9YC 1J08A 1P8JA 3FKFA 2J7MA 4RQRA 4O92A 5ECIB 5J5NA 5G5EA 1TK5B 1IQDC 3WF3A 1A2MA 1U6TA 2WRTA 2PQSA 3LPFA 2CT6A 4D0QA 3WNKA 2F51A 5ABRA 2XHNA 1ZZYA 1YZXA 3F8UA 1FB0A 2W1QA 3U5RE 1EEJA 6GSYA 4YAPA 3THCA 3EURA 3WNOA 3KH9A 5GZZB 1OT5A 4Z7XA 4K6XA 2WDBA 1XNAA 2C80A 1VF2A 1DLCA 1RYYA 6GSTA 2NPBA 3CDZB 3NJXA 1A0RP 1USBA 4FH8A 5AN1A 1L7QA 2F3MA 2WZ8A 2R3XA 3MWHA 4LMVA 2WN2A 4ARXA 4F82A 1A2LA 1QXHA 1JYXA 1B4QA 1JZ2A 4N0VA 2CVDA 2VLUA 4GCIA 1XWAA 4BVXA 1PSQA 1KNGA 1Z9HA 4E8HA 3VI5A 4DSSA 3HEIA 3I2KA 1SK1A 5EJ1B 1EV9A 4I2UA 2AJQB 3GL5A 1URMA 2BMXA 3FN9A 1E6BA 2JZTA 2L5OA 2C3QA 3ZL5A 1PX4A 3T2QA 4A42A 2YZHA 3T08A 4GSNA 4ULXA 4D73B 4MGQA 5IFPA 3IDVA 1LJRA 2B5YA 4F03A 1JZRA 2BJXA 4PURA 5AIXA 3A23A 2O8VB 1UY4A 1UVZA 5INYA 1BX9A 1KEBA 2ZNMA 2VL2A 3CZJA 3GTUB 4PQQA 2CVBA 1YY7A 4GF0A 4ZB6A 4NWYA 5ELAA 3MO4A 5D8IA 4NV2A 2DJ2A 1YKCA 4CU9A 2HT9A 4IQAA 4TKYA 1GTAA 2ID4A 5ECLB 1N2AA 5DVBA 3OEBA 3C71A 4EUYA 1V58A 3OGRA 4GRFA 3TOTA 1FAAA 6GSSA 2L5LA 1HNCA 1YEPA 4DUXA 4J56E 5KN3A 5ECOB 5A4WA 2WBKA 2Z4FA 2WCIA 1W99A 1GSEA 2C0GA 3CMGA 1SJIA 4K9ZA 1JHBA 1SD9A 1US2A 1UN2A 2GT6A 3MV11 2X8GA 4TR1A 2MYGA 2FY6A 1XBSA 1HN1A 3GYKA 3MAKA 1JYVA 3NJVA 3QAWA 5IO0A 4A44A 1T4YA 3HZ8A 4ZY9A 5HR1A 1JZWA 3EU3A 2FWEA 1NM3A 3MDKA 5H5QA 1BQ7A 1TU7A 4BK5A 2VC9A 1GLQA 4QPWA 3UOMA 1PA3A 5IOWA 3ME8A 1TU8A 1SJZA 1XW6A 1JI6A 3IXRA 2YC2A 4WF4A 2YZUA 2JZSA 1TRSA 3IK7A 3MV01 1QMVA 1U3IA 3SKVA 1B9XC 2K8SA 5H5RA 4MJCA 3LEKA 3DVXA 2L4CA 3DYRA 2Y6JA 4IS0A 4A4AA 1GU3A 1NKGA 2R2JA 4ML6A 1ZYEA 3APSA 3FK8A 3Q6OA 1X5EA 4W4ZA 4BWSA 2FLSA 2O85A 5KN1A 1TRWA 4TN8A 1F3BA 3OB8A 5DCHA 3QAGA 2YWNA 3TKQA 1SDDB 4MMMA 2LQOA 2PVOC 3F4RA 3IRAA 4XZUG 3VI7A 4HEA2 1L7RA 3C73A 5EY6A 2PGTA 3SEEA 1XCCA 3KCMA 4BDVB 4FIWA 3CYNA 2V4VA 3APOA 4IJ3A 2VO5A 2CZ3A 2ZXQA 2LS5A 4GWIA 2GZPA 1GULA 5F06A 3FYGA 4ZXGA 3GKXA 4OCEA 5C04A 4DSSB 4WBRD 3M0FA 1R5AA 3F6DA 1GTBA 4L0WA 1DE2A 4M4PA 3Q18A 4WR4A 3LE0A 2EC4A 1UA5A 5CP1A 2V41A 1UXXX 3TJKA 1SYRA 1WPIA 3QOUA 4RI7A 1ERVA 4IQ1A 4D73A 3H8QA 1N8JA 4AF2A 4UI9L 5E4WA 1ULPA 5IMCA 5H5SA 3K77A 2X05A 3LGCA 1NX9A 4KNDA 5D9WA 2OADA 4PNGA 1UY3A 3KP9A 3KZQA
chains in the Genus database with same CATH superfamily
3GTUA 1LOFC 1V6IA 2YV8A 4AZZA 3VDDA 4MJAA 4OWYA 1FOVA 2VCWA 3AP7A 3POIA 1S3RA 4LIUA 4PNFA 4CDUA 3JB8A 3LDKA 1EOGA 4P00B 5KN2A 1SFPA 2E33A 2VCBA 4XJ8A 4EE2A 5CRWA 4GKXA 4OUMA 4NJ4A 4F83A 2IWGB 4PXOA 2CWMA 4M3CF 3SMHA 2ZGOA 4HT1T 1FATA 2B42B 4WZFA 1JBCA 1JZ6A 1X9MB 2VUCA 4USSA 2C6SA 2QA1A 3OOXA 2UY9A 2UWCA 5FZCA 4MGIE 5D2AA 1LU4A 2HEWF 1RITA 1UCXA 3WD5A 1SENA 2YWMA 4OMDA 4OMCA 1UYXA 2HWC2 3HNMA 1W6NA 4MA9A 2VCVA 2CV4A 1MS8A 3RZGA 4EO3A 4Q4Y1 3QD6A 2B7YA 2L6DA 5I0RA 1UU4A 2H0GA 3HQXA 2A71A 1APNA 1VF4A 1UPSA 2LRNA 2GU9A 2IFQB 1ZZ8A 1QJX1 3E9JB 2DUPA 5DJLA 4ZHNA 4EN6B 1AR61 3IAM2 3V56A 4XRAA 2M46A 1B35A 4HPKB 5K7PA 5DAWA 1H4OA 3GDBA 2JSZA 3ZIJA 1RUJ3 4YW6A 3ST7A 1XNCA 1GUIA 1YIFA 4KDYA 1B35C 3NSTA 1SLCA 1HRI2 3HDCA 4XE9A 4YZ4A 2ZEYA 1O59A 4MNNA 1U88A 3KM6A 2MMZA 3WXPA 3CMIA 2NLRA 2DU0A 2B39A 1RUG2 4NPBA 1U12A 3H8UA 3D4MA 2GS3A 3J9SA 1HQWA 2HXKA 1OLME 2D6NA 2PU9C 3WDYA 3ZFEA 5IHRA 3OYWB 1XXUA 4RHV1 3FHKA 4FOYA 3VKMA 4QX1A 5A70A 2ZGSA 3ZMLA 4QB2A 5ECPB 4MDCA 2F8AA 3VPTA 4ES8A 2WB9A 5IK4A 5FJHA 5T5PA 2OA7A 2VMHA 2GC0A 3NO8A 4UFJA 4S2FA 1XNTA 3RZLA 4KWLA 2W95A 2ZGKA 2AH2A 4DEVA 3LEMA 4PLNA 4TR1B 3DL3A 2LS6A 2VNRA 5A6XA 1RIRA 3N35A 1OPMA 3TCOA 5JSOA 4CPBD 5J98B 2I9HA 2V6KA 1OC9B 2P0GA 1HJGA 3DECA 5K4LA 2DCYA 5K0UA 1F9MA 1Q8SA 3GM8A 1OA4A 1GZCA 1OFSA 2E6VA 3PUSA 3K4DA 2DURA 5FZ3A 1ZM1A 5E89A 5A3LA 1JUHA 2Z79A 2ZX0A 2H71A 2AACA 3QH7A 3QOPA 3ZDSA 1KS4A 1NE4A 3UESA 5KN0A 1M99A 5HCBA 4ZS3A 1S1AA 5FPAA 1H2KA 13GSA 3J7Yk 4CY6A 5CB7A 1QH6A 2AB6A 3A0NA 4W50A 2ARAA 1Q98A 4YARA 2L59A 4IV3A 2AHEA 3MIGA 1OOPB 2CDOA 3W5MA 1EUTA 2VZUA 1F5JA 2XJTA 5APAA 5IFTA 1O7FA 5C9AB 2HWF1 1VBA2 3GJAA 3AX4A 1W9WA 2BTVC 5B4XA 2TBVA 4L5LA 4OHVA 5FPUA 3TKRA 5HPOA 1ZMAA 4A2UA 1MQTB 4N43B 5GLZA 3WD6A 3C7EA 1Q8QA 1KXGA 4AI8A 3KV4A 1K3YA 2WO3A 1WJKA 1UPIA 5FTTC 3LYKA 2YV9A 18GSA 2XLAA 1NLSA 5DDLA 5FZEA 1VPHA 2B4KA 1W6OB 4GMP1 3T0BA 2H73A 3VWXA 3TDGA 5B4NA 4Q4W2 3B94A 3ZYIB 3M9KA 4WR5A 2Q8DA 2X10A 2CX3A 4M0HA 2AUYA 1F5FA 3RMXA 4NAOA 3E5UA 5J9BA 3M9JA 2P1BA 2HWD1 1V9U1 4YZ2A 2FUG2 3TEYA 1JOPA 4M00A 5A7NA 1Z3EA 4GXZA 2GSSA 2DVDA 5E1RA 1TME1 2WNUC 4WKWA 2ES7A 1MQTC 2BVVA 2RMU2 3IPZA 5I0SA 3S5AA 4UW3A 5IQYA 1HRI3 5LEKA 5D9VA 2Q0AA 4XUQA 4J1XA 3RMYA 4YG6A 5JIUA 5FZ0A 1K5MA 4Z2UA 1D4M2 4ICYA 4HSJA 3S57A 1YQ1A 3AZWA 1DQ4A 2Y6LA 3K4ZA 3FX3A 1JZ5A 2WAAA 3UGFA 5JLVA 2ZX4A 1PO12 4LNVA 4QX3A 3ZSKA 2IFQA 2DYCA 4JGZA 1C57A 5ERLA 3IOSA 5HCHA 3BYWA 4W65A 1WIKA 4HPKA 3KMHA 1OC1A 4BQYA 1UOGA 4AEDB 1CJPA 1VMHA 4GALA 2A4HA 3RHBA 3HNYM 1GSSA 4WM7A 4O65A 5JWQB 3NJZA 3H8RA 1NCRA 4DXTA 3ZFGB 4H2AA 4ECJA 1YLLA 1YRZA 3D4TA 1BEV2 3VPQA 3ORJA 1NSWA 6GSVA 2J1TA 3FY7A 3VZLA 3TAYA 3F4TA 1W9FA 1RUI1 2WYFA 2KP1A 2R1DA 4MH3A 1Z6MA 4CUBA 4Y20B 4M3CB 3UV9A 4CYDA 3ZFEB 2MHFA 3G7YA 1WCUA 2OYZA 4YVSC 2VQTA 3GHAA 1FNYA 2VW2A 3A3TA 1RUC3 2X09A 1LOFA 5FAXA 3TGZA 3RZZA 4OHYA 2JG9A 4EC0A 4L11A 3QFBC 2ZAAA 5IMAA 1ND2C 2OBIA 4JEDA 5DUWA 2PXJA 2JECA 2VZRA 1XWCA 4JTNA 1WMDA 2D3SA 1NUKA 1JHJA 5CZKA 1RC6A 2P2KA 2VM2A 1PMJX 3AYEA 1PGSA 4XS4B 2Q1MA 2X64A 1O73A 1OC8A 1VIWB 2RS52 5FYIA 3GJBA 4L99A 4YQVA 1ZRCA 4UFHA 4BPZA 1RUD3 1BBT1 1M2DA 4RYDA 1OH3A 3D21A 2YPDA 4P9YA 3AMNA 4IBPA 5FRAA 1H2LA 4OI4A 4COWA 3KV6A 5F2SA 3SBCA 4IEQA 3T0DA 4XF4A 3PURA 3K4AA 2VNOA 5J09A 2WS92 1EV11 1LTEA 5A33A 1SL1B 4YSFA 1AYN1 5CKQA 3WP4A 3POJA 3MPBA 1AQVA 5B6NA 2UZ8A 1RTVA 3JB4C 4Q4V1 1ND2B 1XOAA 3HT1A 2P5RA 3FMWA 2P34A 4A45A 2V1MA 1W8TA 1YQ2A 2ZGPA 5FYBA 4C0HA 4XTMA 2XQXA 5D1IA 2H19A 1V9U2 4QB6A 4MH2A 1RHI1 2RLIA 3HA9A 2YROA 4I6XA 4E2QA 3M7AA 1E57A 2C9AA 1W0NA 4AJ6A 1ZGNA 1GSLA 2QQUA 4QKNA 4HOOA 2MZCA 3UBLA 1A23A 1MDIA 3C7GA 1GSYA 2R073 2CDPA 1U5YA 4YVWB 4AVSA 1PX7A 2HYXA 3G7DA 1C8M1 2LSTA 1CGPA 3GV1A 5CFCA 2K18A 5T5JA 1SD8A 5LBCA 4AGSA 3OG2A 3O1RA 1AR62 2W08A 4RA0A 3UL3A 4RQXA 3AFKA 5FY0A 3HJOA 1H8TA 4D6RA 4CXXA 1BMV2 4V2LA 2BOJA 5GSSA 1WW6A 5T3NA 2BQPA 2EICA 1IS6A 1Q3EA 1W8HA 2YDEA 3VHOA 2DIYA 2R5GA 3HR9A 2HWB3 2ORXA 3MGUA 4JHZA 5C3SA 4NPLA 3GYDA 3WNMA 2J1VA 1SPPB 3ZZXA 1PZ8A 1BLZA 2FA4A 2H0IA 2ZGRA 5JI7A 1HB3A 1W6PB 5BV6A 4G0IA 5LCZA 3IC4A 2MEV3 5BUVA 3ZM8A 1BZWA 3VKNA 3TYJA 5AFBA 5HR0A 4MLOA 1H0BA 3BKZA 3PDQA 1QXRA 5EJZB 4MSVA 4NHZA 1YF1A 3I59B 1S0EA 4WBBA 1ND3C 1F15A 1PKZA 4GMP0 4B4QA 2YWIA 5DZEA 3D22A 3PUIA 2BBAA 4KX4A 4ZL9A 1COV2 1HQOA 2WNVC 4WEYA 3U1XA 4BIOA 1U5XA 1Z7S2 2A5ZA 3H7JA 2WZEA 3W5NA 4HJMA 2ET7A 3CRTA 3G6JB 3I2JA 4HZFA 4IEYA 1NCRB 3PR8A 2QQVA 3GGLA 2QDNA 4NHYA 5BNOC 3TNPB 4YYOA 4ECIA 1QGLA 4DXRA 4UF0B 2IZWA 4KI5M 2VL3A 4RD7A 1JYCA 1FXZA 1M3IA 1K0MA 4SLIA 3ZXAC 3WNNA 3SISA 3ZITA 2DDUA 4A7ZA 3TJJA 2XJUA 5GZDA 5CAZA 4NWVA 3HPNA 5FY4A 2R49A 5FUPA 3HNBM 1S2BA 1JODA 1TMF2 1A8DA 1BHGA 2M72A 4BXFA 4I3PA 4YLZA 1YXWA 1RUD1 1CR7A 3AL6A 1RK4A 1MS5A 3VBSA 4PBPA 3C7MA 4MXVA 5CRHA 3NWKA 4L0PA 3Q8BA 4XBNA 4CDWC 3O1MA 3IZOA 2R7EB 3ENRA 5CU1A 4IN0A 1S0IA 1GP5A 3USSA 3DKQA 2CAIA 1YFUA 1F37A 3BCKA 4GWJA 1SBEA 3D0SA 4XS4A 4BA7A 2JDHA 2VXJA 2IXKA 4HQZA 1S0CA 1V2AA 2BFUS 2L4QA 1UY0A 2IXJA 4KDUA 4GULA 5H9QA 1TE1B 3J7HA 4AQ2A 3WGXA 2H70A 1EV4A 4R4XA 2D6LX 3IV4A 3BOPA 1WRYA 4JTOA 4QPIB 5ENUA 4GQ7A 4JDOA 1ND3B 4L9BA 1C8M2 4MZCA 4CSWA 4QHZA 2K9ZA 3CTGA 3KGKA 1VALA 1KS5A 5IT6A 4BQ1A 2VZVA 4RS5A 4OHXA 4QD2A 5L19A 2XXZA 2A6VA 1F4HA 2WO1A 5A4UA 4LOTA 1ACVA 1WLTA 5A7WA 3L2YA 2ARCA 1ND2A 2ZGMA 1DGWA 2IN3A 3T30A 4O7HA 1RUNA 1RINA 3SCHA 2Y0OA 4ECBA 1X9TA 4HI7A 3K8NA 4UT5A 1ST9A 2D43A 3QLQA 1RUG1 4M3CE 4AEJA 5ECMB 2TRXA 5D9TA 2XBIA 1FOHA 3MW4A 2VOVA 3FR6A 3THPA 3ERFA 4GMP3 4PIZA 2WA4A 3FMGA 4CCNA 4RQPC 4D7SA 1YWKA 1IYHA 5IVBA 3QH6A 2GSQA 1N1YA 2Y0IA 1GNHA 2HH9A 5M0TA 3VZKA 2RS53 4FP3A 3WGDA 1ABAA 1J84A 1QQ2A 1UX7A 3VL8A 5IWFA 1V6MA 2QQOA 4G3YC 3ZXGA 5JDBA 1DQ5A 1MACA 2VM9A 4IE0A 5ID2A 1R7HA 2R043 1JYWA 4ZBDA 2GGTA 4B3NA 2VVEA 1PIV3 1H75A 1RXGA 2FD3A 3UETA 4CEWA 2JU5A 5IVEA 2PAMA 1F4AA 2FWFA 4I2OA 3EMPA 4QXCA 1Y7BA 1CQGA 4F9ZA 2XONA 2DF7A 4EJRA 3VWVA 1OHFA 1PM4A 3TJFA 3M3MA 2ADDA 3QDNA 3BALA 4AL9A 4N8MA 1OLMA 2LJRA 2O87A 3UVHA 5JCWA 14GSA 3RDIA 4MHRA 1ACCA 2HJIA 2DBIA 2ZZQA 1GWMA 1MPXA 3RI9A 1DP0A 1IYIA 5F5AA 1COV1 1FV2A 2GSYA 2QNKA 1YFYA 3VBHC 3J7Yb 3GCWA 3BOWA 4BHPA 2KM2A 2G4IA 2BGCA 1W8OA 4W8JA 2FCHA 4FTSA 2R0CA 5LZ6A 1H1MA 2JXAA 3JBG1 1PK6C 5FK8A 4NMIA 3DEMA 4I0AA 4PQ9A 3MIFA 4KL1A 4O61A 1V0AA 1YNAA 1NOVA 2Q5TA 4G0KA 4QPGB 2WFCA 2ZGNA 4XFHA 2DFCA 3SCFA 4OYUA 5FOJB 1H6YA 4FPFA 22GSA 3ILFA 5DPNA 4ONUA 3ZMNA 5GJ6A 3FR3A 4EE0A 4V2WA 4FP2A 4XJAA 5L9RA 1ULCA 3I3BA 3UL2A 2W9XA 4GZ9A 5D8AB 5A32B 1UKGA 4IGJA 1OFNA 1C5IA 2QQNA 2R16A 3IN9A 2IMKA 3QD9A 2Q8EA 4G19A 2BU9A 2BTOT 4POMA 1UYPA 1XWKA 4ZB9A 5A7SA 3DEXA 2IMEA 1I9DA 4BIKA 2OE1A 3AP5A 2B1KA 3WQ7A 5LASA 3V0BA 2PLV2 1W6OA 2WZR2 1T3BA 4LULA 3ZMKA 1CZVA 5CVRA 2EIQA 3OR5A 3K3OA 3JU9A 3AMHA 4OI0A 2GMMA 3WY6A 1X8MA 4PI0A 5LNKe 4KH7A 1QF3A 3AKTA 1JZ4A 5HCFA 4I0BA 3ETPA 1HXS3 3CKHA 2ZGUA 4DVCA 3WW3A 1X82A 5FO9B 5DABA 4NE9A 1HX6A 2C0FA 2DKIA 4QAWA 2H76A 3ZN4A 1N3PA 3HQUA 3CU7A 2W1SA 2C8UA 1J0FA 5HCAA 4URTA 4LKFA 1US3A 2LKUA 2CV6A 3QCWA 2V73A 2ZTNA 4KAEA 1IPJA 5DXDA 5HFIA 4CP2A 1R5PA 1Y9GA 2OE0A 2O1QA 4HLTA 4HZ2A 4Q0UA 1CWPA 5ECKB 4OQ9A 2GH8A 3U07A 1WWJA 1CONA 2ZABA 1VRH1 4BZ4A 2BWAA 2W39A 2PHXA 1FX5A 1K45A 4AOCA 3GMFA 3VKFC 2JIGA 1AC1A 4FYBA 4GAZA 4AEDA 4RS5B 4K1FA 4META 1EPZA 4LT5A 2JDAA 5FZIA 5ECSA 1QKQA 3BI3A 3HVXA 2PHRA 3VL9A 3ZFGA 5A7PA 2YBKA 4QQ2A 4I0WB 3WW1A 5FQ0A 1AHSA 1XWGA 3P2AA 3LEGA 1TK0B 2H6ZA 5BPXA 1XVQA 2X4AA 3Q8AA 4MVTA 3WT2A 2BERA 1K3IA 2WFF1 4KB3A 4M3CA 2I4AA 2QKEA 1HRI1 5J7MA 2VD0A 3RPPA 3IE3A 5F0GA 3GKKA 4YFZA 4XF3A 9GSSA 1OURA 5DAPA 3LDBA 1UZYA 1YYNA 4N9HA 2B9VA 2JWPA 3SHRA 3IPVA 4PDWB 4IESA 4K7OA 4CU8A 4R9BA 4GD4A 1SHWB 2R071 4A7YA 2HRNA 2RS51 5LW9A 1HB4A 1VBA1 3ALQA 1TJDA 5DALB 1Y4WA 2VCXA 1Q8OA 2YPMA 3VBSC 4GWMA 4KBBA 4BCUA 4YW7A 2NP0A 12GSA 5TSWA 1HRV3 4XJUA 3HD8B 4XF9A 2GC3A 4RFT0 2C3NA 4GQFA 1DZRA 2VQAA 4JR4A 2MMOA 4PUFC 2BNMA 4G9HA 1XXNA 2XHKA 1A8MA 5H9RA 3O0XA 5I93A 1HB2A 2J7MA 3HN1A 1GYKA 1XNDA 1TK5B 1OVPA 2WLQA 4P9LA 1ZZYA 2B46X 6GSYA 5E16A 4LOSA 1VF2A 3AP9A 4CCCA 2PHTA 3KF5A 4Z2WA 1R093 1H8TC 2WN2A 1QY4A 2YGLA 4O9GA 4EWAA 5CFDA 1ZA7A 2A6ZA 4N0VA 1XSQA 1ZYBA 2VLUA 4GCIA 2DCTA 1XWAA 4LKEA 1PSQA 1KNGA 4DSSA 3I2KA 3ZSJA 1AJKA 4LBQA 2AJQB 3WDTA 3FN9A 2L5OA 2JZTA 1PX4A 3T08A 4GSNA 4ULXA 4MGQA 3LA7A 5IFPA 4AFMA 2B5YA 4F03A 4Y22A 5A32A 2BJXA 4PURA 2PLV3 3A23A 3LA3A 1UY4A 5GZFA 1MZFA 1QXPA 2A3YA 1KEBA 2ZNMA 2VL2A 1J3PA 4YWAA 5FZDA 3CZJA 5CFCB 1XNKA 2IFWA 1WA6X 3AZYA 4ZB6A 4FPCA 1FPN2 1WW4A 3MO4A 4NROA 4UW4A 3ZX7A 4CDXA 1DU3D 5FP3A 4NV2A 1CESA 1ZRRA 1ZBE2 4TKYA 1GTAA 1OA2A 1V58A 3TOTA 2JDKA 1NY72 4QX8A 1Q5OA 3WG2A 2L5LA 4J56E 2KR2A 5ECOB 4C90A 2Z4FA 4CCLA 4Q1RA 1GSEA 3CMGA 3HQRA 2X8GA 2FY6A 3NAPB 4BISA 4QQLA 1JYVA 3WV6A 2WA3A 1W6PA 2FZ2A 2A3WA 3ZYBA 3EU3A 4KF9A 1MR5A 2VC9A 1SLBA 3ME8A 4UFLA 1YFXA 2HEYF 1JI6A 3ZXFA 2JZSA 1QMVA 4Q0SA 3HT2A 4XFAA 4LBNA 1ALYA 3GCXA 4MJCA 3DVXA 1VAMA 2CU5A 4AVCA 1RMU1 2L4CA 4LMFA 4FPLA 2CHHA 5IVYA 4KU8A 2R2JA 1ZYEA 4P9WA 4WVVA 1WCSA 1X5EA 4W4ZA 1HJFA 2FLSA 4NIGA 2O85A 1TRWA 3B9IA 5DCHA 2YWNA 5K0UB 2TNFA 3P3PA 1SDDB 4MMMA 3F4RA 3IRAA 1ZREA 5HI0A 1C1LA 4XZUG 1ULFA 3SEEA 2HRAA 1W3XA 4FIWA 2PMWB 2V4VA 2VO5A 2CZ3A 4HN1A 2Z42A 5KBFA 3FYGA 5F06A 5C04A 4RGAA 3M0FA 1R5AA 3KVBA 4HKWA 1S0GA 4M4PA 3SCGA 4OI2A 5KHHA 4AF9A 3QOUA 1CPNA 3DV8A 4CP1A 4XFCA 1G9CA 2A70A 4IQ1A 4J6GA 5E4WA 1ULPA 1EYBA 3K77A 3LGCA 1NX9A 4KNDA 5D9WA 3X29B 4HN0A 1UY3A 3KP9A 3KZQA 3WG4A 2LV3A 2VOCA 4PDWA 2R1BA 5A5KA 1H30A 2PA7A 3LSZA 5JCUA 1AJOA 1UY1A 5D73A 2SLIA 1I3HA 2VG9A 1SU9A 3R6SA 3LORA 3IK9A 2LALA 4IVFA 1ENSA 2AV4A 4BLJA 2Q8CA 2CYFA 4WF5A 2WWSA 4MXWA 2E51A 5IJRA 5C7GA 2D6KA 2HSYA 3GHNA 4OI1A 2XGXA 3D5OA 2F4LA 2PVQA 1UU6A 4PF1A 4E8EA 1V00A 4AYUA 2BBVA 4AVTA 4DXSA 4QPIA 4XRDA 4ZBAA 4Q4Y2 4TN7A 3BTZA 3VDAA 4L0UA 1YI9A 1F6MC 3UEMA 1PD21 5IYYA 4IKHA 1KGYA 1F9KA 1YF0A 4ITCA 3C8XA 3TNQA 2WYSA 5DQ0A 1I5GA 3FZ4A 3RBTA 3TKSA 1TRUA 2GVPA 1COV3 4Q4W1 3F6FA 2KLXA 3H3ZA 2RS12 4N0ZA 3ZSMA 3GZTB 4Q4W3 5JCTA 4I02A 5F5QA 3OUJA 2IWTA 1K5MB 3PMSA 3HD5A 2HZEB 3BJ5A 3WR0A 2RM22 1R091 2VD7A 4YM2A 3MIEA 1N1VA 3KWVA 3H8OA 3BUCA 1A24A 4JGYB 3GZUC 2WS91 4MP4A 4MF6A 4JVAA 1ULOA 2FCUA 1PGL1 1ODNA 3M1HA 4I01A 4QB1A 1UWWA 5DN2A 3I6AA 2VU9A 2K2SA 2EIEA 5FZOB 1AR93 3BPSA 4A41A 2Y64A 3D0JA 4GIQA 4IUGA 1AR91 3M2MA 3DCQA 5BYNA 1WOUA 3UARA 2OJLA 3ME7A 2VOTA 2K0GA 1GSDA 1SFNA 3OPZA 3WGEA 5ID2B 2DJKA 4GLTA 3AVRA 4TTGA 1F31A 3PVBB 3KHBA 1PGW1 3M4FA 2QC7A 2CSGA 2CWSA 3USUB 3WUCA 2BVBA 3H42B 2D7FA 2GQLA 3Q19A 2OUJA 5LA9A 3S7IA 1RUOA 4Q4V3 3HYPA 3WHTA 3KT7A 1OSGA 2JB4A 5FOBB 3L0HA 3GF6A 1FYUA 2W46A 3IDAA 4AJ7A 1XZOA 4CUCA 3UMAA 17GSA 5FXXA 3ZRDA 1H1AA 3Q8CA 1QMJA 3O1TA 3L9VA 5ANQA 4ASMB 5C33A 2IXHA 4XQ4A 1GSQA 2VR4A 3VHNA 2WRAA 4DNYA 3AYAA 4X8PA 2J1RA 4AFAA 5CO3A 3CIHA 4MCUA 3ON7A 3KMNA 4FYCA 1N1SA 4Z82A 4NVPA 1TEIA 3LSDA 2WO2A 1PO13 3U37A 2ZAHA 2VTXA 3JD73 4Y3OA 3IIAA 4O5QA 2TEPA 2C3TA 1REEA 3TKPA 1UMZA 1RVF2 3DKWA 1O8SA 2VQUA 2RG4A 3IWZA 2TRCP 3NV4A 2A4VA 2DMLA 4JE1A 3CSHA 4CU7A 3A2VA 3VBRC 5D8AA 3FJSA 1VAKA 4KGGA 3T0AA 1XOBA 5JMCA 4I3GA 3VUOA 5CNAA 5K8SA 3IA1A 2WDUA 5T5OA 1TXXA 2IIYA 4LEJA 5F39A 3VD5A 2OBKA 5FYTA 5JPNB 3ZR5A 3AJYA 5GZCA 4ZU4A 3M3IA 1W2OA 4KNCA 1A8LA 4K20A 4E2GA 4FAGA 2DFBA 1TDIA 2YFZA 2NVLA 2BEOA 3A22A 4ZL7A 3WF1A 4MYEA 4J57E 1GWCA 1RW1A 1JH5A 2RJKA 5COHA 2DKHA 5C8WA 4R9CA 4KDXA 3D5JA 2CAUA 3Q74A 2Z2SB 1POV3 1REFA 1O3SA 5E6HA 4KH9A 3LJRA 1AXZA 1LKNA 1HN0A 1NCQB 1GV9A 3ZSLA 5DUXA 4LJHA 1H1IA 1S55A 1DUGA 4DSQA 1AUYA 2ZHKA 3WP5A 3ZFFA 1XBFA 3EB7A 3FFQA 3DXTA 1CAXA 2WL1A 1VBD1 1V57A 1U5IA 5F9TA 19GSA 4OUEA 1MVQA 3SQOA 4PDWC 4TXOA 4LHSA 2O8OA 3H79A 1VF1A 3QCPA 1W2TA 4JQTA 1VBC1 5C8CA 4XUTA 1SMVA 3M3QA 4CE8A 4OCTA 1VBC2 3UAPA 2VM1A 1VBE3 4POLA 4UAPA 4GB32 1CN1A 3NL1A 1B35B 1G6NA 2GDRA 4ACSA 3TWIA 5C70A 1W9SA 4BYYA 2JKXA 2HZEA 1HB1A 3V0AB 4ZKTB 2AR6A 3OGVA 1RUI3 5BNPC 3CL1A 4HVRA 3P8WA 1GMMA 4Z07A 1S2EA 4U2AA 1M7TA 4YGCA 2ZPXA 3MEPA 3I7DA 2XVKA 2L57A 3FLRA 2VW0A 1UY2A 1N47A 1MQTA 3POBA 2D5HA 4NO4A 3HXSA 1K12A 3GA4A 4MK3A 1AF9A 1NCQC 1FVKA 3N3HA 5DALA 3JD71 5FZ1A 1E5IA 2VOXA 3BCIA 3S0MA 2VMGA 3UGHA 4IEPA 1DQ6A 2LROA 2VCQA 3WW4A 3JXSA 1ZL9A 2ZZJA 3USUA 2G9ZA 2YBSA 2C5DA 2VAUA 1ENRA 3WQBA 4NHLA 1HD2A 2VLTA 3WDVA 3OY8B 2GSRA 1ENQA 1ASJ1 1EP0A 1G9AA 4B4PA 4KMQA 3TRXA 3AXDA 4Z2TA 1WGPA 4Z1VA 1QHDA 1W3VA 1NQDA 5DBQA 3HBZA 1IS3A 3LWAA 1OKQA 1JU4A 4AAXA 1TI3A 3A7QA 4MGZE 4QQOA 2VL2C 3DVWA 1ZX5A 4IE4A 1ONAA 4QMAA 1D2SA 3GX8A 1ULEA 4IGQA 5D21A 1UXZA 2PAEA 3WCRA 3APBA 5HR2A 2A3XA 3M8LA 2RMU3 3WDXA 2QDRA 2ZMNA 2E26A 5D9XA 2XL9A 3D8CA 1W8UA 1W2UA 1J83A 1YC61 5DG1A 4RI6A 3ZXDA 1NE6A 5JXGA 1LOBA 2RDRA 1HYUA 2HYKA 4IV3B 4NXIA 4Z8BA 2QQPA 5HQPA 2W1UA 4KWKA 1QWRA 4Y5SA 5KOXA 5ABJC 2XPJA 4EZ4A 4GH4C 3ILNA 2IXIA 2Z69A 5E8AA 4KW6A 2DJ3A 2GN3A 4KGQA 2WJSA 2IMDA 1OXCA 4JRLA 4NN0A 2R0PA 1PMTA 4QQ7A 1RGSA 2MMNA 1K0DA 1EUUA 2PERA 5HFGA 3IMNA 4Q5RA 3HJMA 2N5FA 1SLIA 3HN3A 3JQWA 4Y4YA 2K8VA 2JDZA 3WNXA 3VBUB 3IAPA 4NAMA 1K3LA 4YW4A 3W20A 3FHQA 2JEMA 3ZPYA 1WZXA 4XUNA 3VLNA 1OE7A 5A7QA 2E31A 1M3JA 1UNBA 1ZZ7A 3KXOA 2A6YA 3LQCA 4ML1A 1NHYA 3IR4A 2VTFA 5FZKA 3CHXA 3GSTA 1LHOA 1EAH3 3DIEA 5FMDA 4X0XA 2VOKA 1EAH1 1LAJA 1LGNA 2XMLA 4NRMA 5IMFA 4XF0A 2OA2A 4K9SA 2L6CA 3IDEA 4PHZA 4FPEA 4DZGA 4HQSA 3O1OA 5C4WB 2YPJA 4XS6A 1OC3A 3CJIB 3H3LA 5FCCA 3AP6A 3NZNA 3MIHA 4KUNA 1LOCA 1IPKA 5CG8A 1Z7PA 2CX4A 3CBUA 1O7UA 3RNSA 4I30A 1GNYA 2BFUL 5ECHB 1REDA 3TRSB 3UT0A 3DYOA 1ZBA2 4K1YA 1MDJA 1BEV1 3I4IA 1DG6A 3PHMA 2HBTA 4DRRA 2JDYA 1VBD3 5KC5A 3H50A 3T2OA 2FA8A 5J1XA 1LU1A 1TQ5A 2RS31 3GRXA 4K1ZA 2YBPA 3GL3A 2P17A 5BNNC 2VPVA 4E4HA 4W6YA 2DBNA 4YQUA 1SBDA 2RJ2A 4AQ6A 2B8MA 1THXA 1M2BA 1GNEA 1TVGA 4QDSA 5IW0A 1J1TA 1NQJA 4BM8A 3I2FA 5JOZA 4N53A 1PFOA 5FZBA 4FPGA 5IMVA 4JZQA 2DJJA 1AVBA 4V2VA 4B4RA 1RHI2 2D3PA 3C3VA 1VGLA 4LORA 4QKFA 3IT8A 1VJ2A 4MXWB 2QQMA 1XPVA 4OFMA 1LU2A 2FWGA 3LB9A 4Q4X2 1NCRC 2LM3A 1SZBA 2KA3A 3MLLA 3I2HA 3U6VA 1F3AA 5GALA 3FBYA 1XQNA 3IIIA 4A3ZA 1ERWA 4YFWA 6GSXA 4KG8A 1RUJ2 2PFWA 3QR6A 1EOHA 4Z2RA 1DCSA 2D97A 4Q5NA 2BUKA 1T8EB 5DJMA 3KS7A 3POFA 5J9CA 4JDMA 2ENRA 2ZCWA 4XFBA 3MIDA 3T1MA 1PVXA 1I5PA 3R3EA 1OA3A 4COYA 4CTEA 4XC9A 3KCYA 1RUH1 5JAXA 5C4WC 2R4VA 1SLAA 2CAQA 1VBB1 1FHEA 1W05A 3EHKA 1YIPA 4R9DA 4AEKA 4BPYA 1HRV2 3M3CA 2DWRA 1KJLA 3ZSEA 4QX5A 4NIIA 1TP9A 2XVLA 3NKTA 2AEZA 3K51A 4NPMA 4XURA 4RS5C 2NZ9A 3KGLA 8GSSA 3ZDVA 2HSHA 1TTZA 2E0QA 3TRQA 1RUD2 1EAH2 4BA6A 1SL0B 3S7EA 2YYOA 1JZOA 5CRGA 4L97A 1R4WA 3ETQA 5ECRB 5FMCA 1UAIA 3K2OA 4AAPA 4YQMA 1TRVA 1HDKA 3MI8A 2D93A 5LB6A 4YG3A 1X9PA 3NRUA 4AVBA 1I5ZA 5FQ0B 2WN3A 4JBBA 4QGMA 2WIIB 5DAKA 1LEDA 4DB5A 4IGOA 2X8KA 3VWWA 2ZBJA 3C1SA 3VZJA 1LBKA 4QHBA 5KEJA 2JDUA 5G04L 1GSFA 3ZPOA 2QZ3A 4CP0A 3I3EA 4HU7A 4TOPA 5JXHA 4PGTA 2KP2A 3E97A 2WWJA 2ZGLA 4MGKE 2V2GA 5LY1A 1PL1A 2YN1A 4S2GA 4CEWC 5JIAA 1Z7S1 3J7LA 4FI9A 5FY5A 2PBJA 4K2XA 2D5FA 3MIBA 2H6BA 5CG9A 2DIZA 3AY8A 1WCKA 3KMOA 2B1LA 4K5SA 3EC3A 4AG4A 7GSSA 1LESA 2FDJA 3GIXA 3BTAA 1W06A 3IC8A 3BVCA 1OF3A 5DMYA 2XHFA 1G7YA 4R8HA 2BWCA 1BBT3 2JG8A 2I2SA 1QNYA 2PLV1 3LA2A 2OXBA 5LCWL 1ZRFA 1XNBA 5ABJA 3I2OA 4X4JA 3JCIA 5EJ3A 2PPTA 2GC2A 1B4PA 2EA7A 4ZB8A 4Y4RA 2OUHA 1LEMA 4DMIA 1H4GA 2W91A 3N7KA 2WJUA 1UIJA 4CCEA 3ISOA 1W4VA 2P3JA 2IMIA 4AQSA 2D6MA 3CQFA 2JB8A 4OHWA 4DO0A 1LR5A 1WP0A 3MW3A 4XZPA 4QDQA 1MZEA 2DSAA 4FBFA 1TMF3 2GSTA 1ZZ6A 4CP9A 1POV0 4LBQD 3WUDA 4BMEA 2VCTA 1ERTA 3ACLA 2VECA 4XFFA 1V9WA 3VBRA 5JSRA 3RZMA 1IQAA 2G19A 5ELGA 3DYPA 4JR6A 1GOHA 3AK0A 3MSZA 1FB6A 4LBQB 5A4VA 1PN9A 5IUQA 1D4VB 1M0UA 5A7OA 2XPEA 5F3CA 3HVVA 3VLBB 2V4AA 2B5EA 1K0CA 2P4EA 4IETA 4NHXA 2ALBA 2DC5A 4OCFA 4ZZ8A 3A4UA 4E9KA 1KITA 1S4CA 5G05L 5A3OA 4ZL8A 5CA6A 3LW9A 1YQ6A 1EV13 3SEPA 3RFRA 5GLTA 3E6DA 1BK0A 3PMEA 4XDQA 4D69A 4KWJA 3A5IA 3UJQA 3NVCA 2OIIA 5ISLA 5KHGA 1QOSA 4QKBA 2AENA 2RVAA 2VCMA 3CEWA 3H1MA 4AXOA 4FPHA 3VDCA 1K42A 1AX2A 2GAUA 2ZGQA 2KUCA 5LY2A 5A6QA 4KSMA 1OF4A 2C26A 4CDOA 1G6WA 4NHMA 2HWE1 5FZ8A 1SBFA 2R0HA 3LGRA 1HNBA 2F17A 4QX0A 3LOBA 1J3QA 3RYKA 3V0AA 2HRKA 1POV1 4RSUA 1ZYPA 1AR81 4WETA 5CYYA 2N7GA 4Y24A 2F8FA 2IXLA 5L73A 4K6BA 2QQKA 2O14A 4EN9B 3ATGA 2ZJCA 1ZA4A 5CNWA 2KHPA 4HETA 1QJU3 1XC6A 2VZ3A 3FHIB 5FZMA 3RGBA 1CIYA 2M80A 1DBYA 1GKBA 1U3AA 3RWNA 5T5LA 4YH2A 3UKVA 2G1MA 3NJYA 2R6KA 5BNOB 1T1VA 1QJX3 4LO8A 1QXJA 5FMOL 1RUI2 4G9SB 1BJXA 4R4ZA 2BNNA 3B02A 2ZEZA 3DXBA 3W9AA 1MS9A 1OBNA 1W0PA 2A6XA 4P9XA 2EXJA 2GLRA 2DTWA 1SCSA 3ACIA 4E8DA 1R082 3US3A 3WCSA 4YZ1A 4AI2A 2UY8A 4HVOA 4PQIA 3CRUA 4LTAA 2DVAA 1WBFA 2ZACA 3J8F1 5T50A 1ZNPA 5BY5A 4CA9A 4WM8C 4JGZC 2OE3A 2JSYA 2VZQA 2I81A 1W28A 2W68A 4XXPA 2R32A 4MGYE 5F37A 2E7PA 4LHNA 1AL21 3N9OA 2BDRA 1C5HA 2LRPA 3VKLA 4EROA 4IEWA 2ARBA 4CCKA 4ZPIA 3OEAA 4AVAA 2CL2A 2DMMA 3TKSE 2LRCA 2P37A 2VUPA 1J59A 2C0DA 2WNEA 5KXEA 1POQA 5ECIB 4H7LA 3B93A 1A2MA 2X5IC 2PQSA 1QDCA 4D0QA 3WNKA 2WT1A 2XHNA 3PL0A 5C5TA 3F8UA 1FB0A 2W1QA 4YAPA 5CADA 3CF6E 3EURA 2YGMA 3HIFA 1OI6A 2RS33 1XNAA 3FUOA 1SEFA 4XAEA 1RUF2 3CDZB 4XTPA 1V6LA 2RHPA 4LMVA 3D6EA 4F82A 2A2PA 2A73B 1A2LA 3I3QA 1AYM1 1B4QA 4L92A 4BIFA 4CEYA 3EQEA 5KHJA 1GR3A 4RGKA 1IG3A 4BVXA 4E8HA 3ZKYA 2JG8C 1BEV3 2VTXJ 5EJ1B 1EV9A 4I2UA 3GL5A 1R092 2BMXA 2C3QA 2MEV2 1D2QA 3ZL5A 4LHKA 3ME2A 5CKMA 3AL5A 1ZYNA 4D73B 4RFRB 5FWEA 4ATFA 1UVZA 5L9VA 2IVJA 4PQQA 1YY7A 2DVFA 4YG0A 4FFHA 3B7MA 4NWYA 3VBUA 2ZHMA 5I0UA 4CU9A 1N2AA 2WNVA 2OZJA 4Y33A 3C71A 4LK6A 1DIWA 3IDCB 4S2DA 5F2WA 1HNCA 5FYCA 5T52A 3U75A 4JV4A 1PO22 4EWDA 2CGPA 1W99A 2VUAA 2RM21 1SD9A 1US2A 2ZX1A 4COZA 2GMEA 4JGYC 3ZYRA 3GYKA 3MAKA 5BNPB 5IVCA 3NJVA 4A44A 1W2NA 2FMYA 5H5QA 1BQ7A 1LULA 1R081 1Q43A 3EO6A 2DTYA 1LODA 5ACA2 3ZLIA 3Q8EA 2VOWA 1SJZA 5KHKA 4WF4A 1AZDA 4V1PA 1TRSA 1F8VA 1U3IA 3SKVA 1B9XC 5H5RA 2GNMA 4O5UA 1YCIA 3NW4A 2VVDA 4A4AA 1GU3A 3APSA 1GQGA 3Q6OA 4L2NA 5LBFA 4BWSA 4UXAA 5LRRA 2P3IA 4CDXC 3TN91 1F3BA 3OB8A 1RJ8A 3ZXLA 2XWBB 3PIGA 2JDPA 1V6JA 3C73A 2PGTA 1VMJA 1CAVB 1XCCA 4HANA 4IJ3A 4QHOA 4GWIA 4ES9A 2GMPA 4AEMA 3ZIXA 2GZPA 5DUUA 3GKXA 4AFCA 4OCEA 4WBRD 3EPTA 4L0WA 5FXZA 3Q18A 1KJRA 1W0OA 5CP1A 4BH9A 1UXXX 2UWAA 1VR3A 3JZVA 4RI7A 3ZFFC 4AF2A 2JD4A 4UI9L 1W8ZA 3MLJA 5IMCA 1ENXA 3ZYGA 2OADA 4O9EA 3AJZA 3UGGA 5J3UA 4LQRA 1DGWX 3DMLA 4ZZ5A 2OKXA 2EVXA 3ZYJB 1JW6A 5DZGA 2C0ZA 1QGVA 2VNGA 4IE6A 5FPLA 2YC0A 5F5CA 1ZZ9A 3ACFA 2HWC1 4NHWA 3EYTA 5FLJA 2QE3A 2H01A 3QPMA 3HJPA 3VK9A 5FY9A 4NRPA 3ZXJA 3CSIA 1X9WB 2LRTA 4TR0A 4HXCA 2BV4A 4ZU5A 4UW6A 1RUE3 3ROUA 4ZS2A 1TG7A 2RM6A 1T00A 2H30A 3WOGA 4BWOA 2O89A 3J26N 4BOWA 5HV0A 1H9PA 1J1LA 2EIRA 2V32A 4H14A 4P08A 2CA8A 2I45A 3LPGA 4NHKA 5LK7B 4EWEA 4F8AA 3P6BA 4JAAA 3K3NA 3N9QA 4XIKA 3POWA 3ZIVA 5HXMA 4HVQA 2ON7A 4Q2FA 1OKOA 1S3AA 1PM7A 2DCJA 1CVNA 1OPOA 2YJ7A 4AGRA 1O3QA 3DPRA 1BMV1 2GDFA 1QJY3 4EYUA 4OZOA 4NOTA 1X9SB 1MS3A 3OGJA 4YW5A 1XU1A 1IPSA 3RS6A 4XMAA 5IM9A 4INDA 4YVSA 3E0UA 2KXLA 5KWRA 3F3QA 1Q56A 4N90A 1JOBA 2FNOA 2N5AA 2V5YA 5C8CB 5FLIA 1O4YA 2HBUA 4YW1A 1SKSB 1MD4A 1RUC2 1DE1A 4JC1A 1HXS1 4H55A 1YI7A 5E88A 2EIOA 1OVNA 2VLVA 3KM5A 3OPWA 4HDEA 4JRAA 16GSA 4EDZA 5FPBA 4Q0VA 1YKAA 2K46A 1YJLA 3EMXA 1ZZCA 5IIZA 4XBQA 1QOOA 3T09A 3KSCA 5IVFA 2IPAA 3LSEA 3KIJA 5GKAC 4TR3A 2W94A 5HBAA 5FY7A 4DUVA 1OOPC 2X8HA 1GOFA 2LJKA 4LXLA 4GSTA 1LOGA 1O4ZA 1W6MA 5EV7A 3VDDB 4BQ5A 3L4NA 3PNAA 3GNEA 2WNVB 4BVYB 1UC7A 4CDUB 4QWNA 4K7IA 1PKWA 4AHYA 4XACA 3FEUA 2WSUA 2HWD3 5FPVA 4K7JA 1N1TA 1Y9QA 5FPZA 5CRDA 3AKPA 1C72A 4LO4B 4QU1A 2V72A 2NN8A 1RUF3 3RZJA 2HSMA 3ZLPA 4HS1A 1Y6EA 3OSDA 3L9JT 2OVUA 1OYJA 1DDLA 2EIGA 3AM2A 5AVAA 2HNLA 4WVWA 4KE3A 1WKYA 4KSOA 3CSJA 4Q26A 4Q0QA 2ON5A 4OLLA 4SBVA 3ZYWA 5EQUA 4NRQA 4IP1A 4CZSA 2X49A 2YP6A 4HG6B 2WQ4A 2VL9A 4EKZA 3DYMA 2VQ0A 3RHCA 2IMFA 4MJEA 2YB7A 2LTKA 4K3UA 2Y6HA 3L9SA 4LA1A 1DHKB 2WQ8A 4OD7A 1O8XA 5JOYA 5EZWA 2MBSA 4S2HA 2EXHA 3ABZA 2C4XA 2B45X 3GKMA 5KXBA 3KZ4C 1RUJ1 5JSPA 4EDYA 5FP7A 4ID0A 3ILRA 3BIEA 4J2FA 4DIQA 4PQ1A 3T4VA 4RR3B 1YHFA 3VB9A 4V2NA 1N3QA 1STMA 4QXBA 1RXFA 2P5QA 1DYPA 3UKNA 5A80A 3ZXEA 1QOTA 4CCJA 3GH9A 4Y20A 1ZRDA 5EVOA 3V0BB 2VNVA 1DYOA 4L8QA 1UMHA 3PU8A 5A6YA 1RUH2 3E6BA 2LEGA 1X5DA 1RUE1 3Q8FA 2QFEA 3LYPA 1JXNA 3IMMA 1UD1A 2UU8A 5F3GA 3ZVXA 3WZ1A 2FHRA 1QQP3 1GWKA 4GKYA 5DG2A 1QDOA 5T55A 4LKDA 2H75A 1TNFA 1S0FA 5CFCC 1J3RA 3UIWA 3OJBA 3I49A 4QL7A 4LE4A 2VMCA 2RS13 5EPFA 1VE0A 2PN5A 4COUA 1DGRN 3PTRB 1HQLA 3EVIA 1TMF1 5FHIA 1YQ8A 2W5FA 3SC7X 1N3OA 3HWJA 4ZXEA 3HJRA 3MDPA 3RZHA 3OTFA 1G0TA 1PMHX 1UIKA 1UOFA 3G7IA 1YFWA 2J1UA 2GQMA 2LQQA 4X6RB 1FT9A 1A78A 1QIQA 2GP5A 3J7MA 3WF0A 1AXKA 1KTEA 1AYM3 2OS2A 1TKDB 4DQAA 2FCVA 1AR92 3KCCA 4FQZA 3PU3A 3CTFA 1OC9A 1FAYA 4Q5FA 4HK9A 4GWRA 1OKTA 1MEC2 1ASJ3 2WABA 3H7YA 1WLDA 4CCOA 3DPRB 4ASLA 4LL4B 4Y5TA 1T7PB 1KD7A 3R4UA 2VCAA 3R4SA 11GSA 3NIVA 4XCBA 1TW9A 1G86A 4IGPA 5J36A 1ASJ2 1OH4A 5H9SA 5C5UA 5C6CA 1CQHA 2AUVA 1ERUA 3CJIA 3O14A 3NKGA 2YZ4A 2B7KA 3W58A 2PHLA 5C3PA 1SG3A 2CGNA 2Y38A 1G7EA 2ZMLA 1V98A 3BD2A 4CHSA 2RIIA 1GTIA 1OMIA 1SL2B 5JR2A 1VP6A 4Q0PA 3EU4A 4YKFA 2VO4A 3IPVB 1RMU2 4N43A 1NT0A 4YVWA 2FQPA 3FLTA 2KD7A 2ZHLA 5CISA 1BAYA 2JE9A 1OQDA 5FYUA 2B3SA 1BJQA 3AKSA 1LJ7A 4GSSA 1WD3A 2BZDA 5C8CC 4QGLA 2XWJB 4NWWA 2YHJA 4XJ9A 2HWF3 3RAZA 3I2IA 4Q4Y3 3CJXA 2W87A 4CDUC 3GUSA 4Q5QA 1H8TB 2R0GA 4HKLA 1H6XA 3BIWE 1SK2A 3FUQA 3AZZA 2TUNA 3JBG2 2YMZA 4C0BA 5AC93 1AIUA 4A5PA 4LPLA 4IHUA 3F3RA 3IHQA 5JZGA 4LA2A 1H2MA 5JXIA 2QZ2A 3OF1A 5DZFA 2WKKA 2HWB2 3H1YA 3AVSA 2HWB1 3MPPG 3PTYA 3ZO0B 1BYHA 2FZ1A 4QM9A 2O0OA 1BBT2 4MOAA 2XLGA 2R37A 1M9AA 4IE7A 4UFMA 3TUEA 4EIQA 1W89A 3OUHA 3ZFEC 4E4DX 3LFLA 1G8WA 1OLQA 3L2HA 1FOD2 3P7XA 4OMVA 4LK7A 1AYN2 3PUAA 3A5WA 1GL8A 4RQPB 5LA1A 2Y26A 4PT6A 2YU1A 4G10A 3T1LA 4LO7A 5EPAA 1C28A 1R1A3 4GA9A 3A21A 4JGZB 1BG5A 2REMA 4BVXB 2QGVA 3PUHA 4H3WA 3ZMOA 4P5YA 4CW9A 1VMFA 2H1AA 1AYM2 2QJVA 2NMNA 3W6GA 1Z6NA 5ACA1 4HZ4A 4WM7B 1QQP2 4Y22B 5ACA3 3S5QA 1DZQA 3BOAA 1O5UA 2CAVA 1AL22 1I6XA 3GURA 1BKZA 1GUHA 4CY8A 3DXUA 2FBEA 3MF6A 3EMRA 1KBNA 4JDNA 5JVVA 1VAVA 4CDQA 4NUBA 4HU9A 1OQ1A 3KT1A 4BQXA 4M4RA 3EE2A 1VBB2 2MMAA 2VMDA 2JDMA 1DZTA 4BK4A 5JOXA 4FPYA 2V09A 1VRH2 1FPN1 2YU2A 3GHMA 2CNAA 1VBE2 1O91A 4LO6B 4GQCA 3KHCA 3O76A 1AR82 2PHDA 5A3NA 1S3CA 1XYNA 1XIYA 4HJ2A 2R0FA 4XUPA 3UYJA 1VBE1 2RE9A 2N5BA 4PX1A 5ECNB 4FYUA 2X29A 4P3YB 2OACA 2DVBA 2RUEA 3FZ9A 3THTA 4CVUA 1HXS2 3OBZA 3WF4A 4YNIA 3NNJA 5FKBA 2PAKA 5FZ9A 3D4KA 2R30A 4Q1PA 3WQ1A 3JD72 4FQ4A 2PWJA 4FSJA 3LG6A 5HR3A 1GICA 2GNTA 2WT0A 1JS9A 1O6JA 3GN3A 3VHPA 3K48A 3GNJA 1R64A 4X43A 1OVSA 2W1WA 1ZBA1 1ND3A 4MF5A 5JI9A 4AFDA 3VFIA 1RL3A 4U36A 1X5CA 2XR4A 4PTSA 4MGTA 1RVF3 3LXTA 3FC0A 3LWCA 5FLHA 1RQMA 3QMXA 1ZOFA 5LBEA 3NV3A 5K9YA 4RN5A 2Z5WA 3T3YA 2JE7A 1PIV2 1E2YA 1W8NA 5A3PA 3I3MA 3N9NA 1BK1A 3RYRA 5J48A 1PGTA 4IV3C 1QJEA 1DBNA 2LUSA 3GALA 4RUVA 1MS4A 5L7OA 1YEXA 1FI2A 2HI7A 3OBRA 4KU7A 2E9QA 3H1NA 1RMU3 2DUOA 1CZSA 2ATFA 3F4SA 1JFUA 1PIV1 4ZIJA 3EXUA 2D3RA 2WWUA 4FTEA 1BYEA 3TJBA 2WFF2 2E32A 3WNPA 1IHMA 1JLVA 3VBOA 4C8DA 5B6MA 2ZX3A 2AAWA 5DDJ3 2H0HA 2QQWA 2B7JA 1JZ7A 2QQIA 1NHOA 3P1IA 4N53C 5CEHA 4Q4X1 2VUDA 4ZU7A 1U87A 1R083 4HSCX 1SLLA 1C3HA 3RPQA 4IW3A 2C9KA 5IPGA 5I0DA 3LDRA 5BNNB 2HKXA 5JUVA 5ECQB 3RWKX 4I09A 2DU1A 2RM23 2A75A 3VZOA 4QXKA 1OE8A 1WCDJ 2A6WA 1SLTA 2PMTA 3WDUA 2JE8A 1S0JA 4BWQA 1WLCA 3KCXA 4QL9A 4Q5OA 2FGXA 4V2MA 3MBWA 3ZVJD 5I8TA 2XJVA 3NNGA 1S2KA 1D0HA 4QU2A 5FMOS 4W6XA 3WT1A 1MDKA 3ERWA 4HSLA 5C4WA 2W47A 4DSRA 2UWBA 4XIHA 5FBJA 4FTBA 2X53S 2B5XA 3IAQA 4D6QA 3U14A 4E4SA 4DUWA 4AI1A 4IEVA 1ZBE1 1ULDA 1QUWA 3M3OA 4L5OA 1HV0A 2XPDA 4XQWA 3ELNA 3B3QE 4LBMA 1AL23 2FDIA 5DAVA 1K0NA 5FZOA 1GZWB 1WBLA 2YCDA 3LFIA 3POSA 3KV9A 3MNGA 4OO4A 2W52A 4XUOA 4DS0A 1WW5A 5I8SA 4JU5A 4XTSA 4XFIA 2AEYA 2H6YA 4WXTA 5K0UC 2YV7A 2J42A 5FZLA 1LOEA 3I97A 2NQYA 4CDQB 3SLIA 1W6MB 5JR7B 5G2ZA 4YVWC 5IMZA 4OVEA 3TB2A 4EL1A 5FZFA 5DCGA 1G9DA 3CNAA 2BW8A 2VIMA 2G2QA 1T2XA 1XFLA 1AW9A 4TYSA 4YPJA 2EF6A 3R0RA 3CXGA 1GOGA 1CD3G 1AR73 2ZGTA 2UURA 2Y6GA 4DXZA 4IV1A 2PUKC 4COVA 4XS1A 1V6NA 4MPGA 5F8BA 4WZCA 2BPA2 2WZPP 5LA0A 1HNAA 3VD7A 4AJ8A 3ERGA 1GNWA 2J1SA 1IKPA 1TOFA 3QACA 1CAWB 1JZ3A 4H7MA 2EIBA 2WGRA 5AGYA 4FPJA 1UKRA 3KLSA 2PHUA 5SV5A 4XQDA 2ZKLA 4D8MA 2Y6KA 3LF7A 3K75B 1OUXA 1XJAA 2RR12 4F7ZA 4LMWA 3FRCA 3H93A 2P31A 2WFF3 2IVIB 2VULA 1LENA 3RJRA 2RDQA 2RDSA 1O3RA 3UJOA 3VBHA 1HIXA 1AAZA 1JYIA 1VF3A 4ASKA 3PVEA 2RDNA 2A7AA 1O81A 4WM8B 4WVMB 4L8EA 4URAA 3VZMA 1AXYA 5JCGA 3WG3A 3O1UA 4Q8KA 3TN92 4FFIA 1UZZA 2YWOA 5CAXA 1CIWA 2Q4SA 2ZEWA 5FUIA 2F6BA 1AR83 5KC6A 4JRRA 5CFDB 3AMPA 1JZDA 3GBWA 1MEC3 4XPVA 3M1GA 4BQ4A 2XC2A 1PMIA 4N10A 2YNXA 1NA1B 2DJ0A 1RVF1 2HRFA 2BRTA 1UL9A 1LRHA 3O0WA 3E3EA 2NTOA 2VCCA 3MLKA 3A2XA 3TOJA 10GSA 1JUIA 3IM0A 3WLUA 5KHIA 1EPWA 2DCKA 3ASIA 4XF1A 1SKWB 1W9YA 5F7UA 1G7OA 3INAA 4MPFA 4FOQA 4Y5Z0 2WLPA 4PIXA 3MYDA 2E53A 5FKCA 1JYNA 4GXLA 4LIVA 1Q4JA 1D4M1 4HOJA 4HUAA 5FR3A 5LEJA 4PUAA 4MADA 2DV9A 2OT7A 3LEFA 1WA4A 4K21A 3NQHA 5IOXA 5EYYA 1IGOA 3OUIA 4N11A 4I5QA 3TOUA 4HFSA 1URXA 5FZAA 3NAPA 4DEQA 2VBBA 3AC0A 3G9BA 5J41A 3MUZ1 2HFDA 4P9IA 1CAUB 3NV1A 1G6YA 5GAND 1A8YA 1LECA 1YO8A 1SKRB 3BPZA 1L3JA 3KV5A 5AISA 1EZKA 1U5ZA 3RQ0A 3DKSA 2IC1A 3O5SA 3OCPA 5A7WB 4XOGA 1AX1A 1NZCA 3DD3A 4CDWA 1OQEA 1M9BA 3VBFC 4E4ZA 4ORFA 2WUHA 1JU3A 1TZOA 3WEZA 4F0BA 3W21A 1BEDA 2J22A 3H8XA 1QJX2 4XCAA 2P6CA 3DGTA 2I1UA 1CPMA 2E63A 2VMFA 3I54A 1X36A 1T4ZA 4QPIC 2RR11 2H6XA 1XSRA 5AFEA 5J37A 5A6ZA 1LGBA 1OLRA 1B09A 4PLMA 4MX3A 2ZHNA 3KQ4B 3F0IA 1FOD1 5FUNA 3DPRC 1UOBA 2TIRA 2VL4A 4POBA 3EWLA 2GZWA 1Z7RA 1T6GC 5ANNA 1ML6A 1B48A 1DLLA 2C1YA 1WMXA 1PX6A 5I91A 1X50A 3QFAC 3VV1A 3N9MA 1F2NA 1QJFA 1DFQA 2IUWA 4K40A 2Y33A 1R1ZA 2QQLA 3OBAA 5EFUA 1L7LA 3THDA 4XVHA 5F3EA 1GBGA 5JZGB 3UJ1A 3TRPA 3U11A 2XUMA 1AUCA 4RGGA 4XIOA 4NV5A 1SCRA 3SITA 4YZ5A 1IS4A 2JL4A 2D40A 1UQXA 5JWPA 4JKKA 3AYCA 4GH4A 5D96A 4BQWA 2QA2A 2JACA 4FQUA 1DQ2A 3ZREA 2H1BA 2NM1A 1B9YC 3Q9OA 1J08A 4TLGA 1P8JA 1CAWA 3MICA 2IXCA 5KXDA 5J5NA 5G5EA 1RB8G 3NMBA 1U6TA 2WRTA 3LPFA 3VGIA 2F51A 5ABRA 1Z0HA 3O0VA 1YZXA 4RQPA 2Y60A 1FNZA 3U5RE 3KH9A 1OT5A 4K6XA 5FZHA 5CIRA 2WDBA 4IXLA 1DLCA 4YKGA 4PIYA 3AZVA 1A0RP 1USBA 4FH8A 5AN1A 5C3RA 2F3MA 5AC91 4OFGA 3MZHA 3N7MA 1JYXA 4WM8A 4WVMA 1JZ2A 2EALA 2CVDA 1DGRA 1MVEA 4EQVA 4QX7A 3AFGA 1Z9HA 4BL7B 4MG2A 1SK1A 1VBB3 1URMA 3S6PA 1E6BA 4EZHA 3HVNA 2OPWA 4A42A 2RMU1 2HWD2 3IDVA 1KFXL 3I2DA 1JZRA 1BCXA 4IEZA 3GTUB 1QJY2 1V9U3 2H0VA 2QVSB 4GF0A 5ELAA 1Z78A 1RUH3 3ZOIA 3D82A 2HT9A 4IQAA 2XG3A 4CXYA 4Q27A 2HWE3 2VH9A 5DVBA 4EUYA 3OGRA 4GRFA 1PZ7A 1ZZBA 1PK6B 4XAAA 5JPMB 6GSSA 1YEPA 4DUXA 3OD4A 1XU2A 2WNOA 4FFGA 2ZKNA 2WBKA 4GB31 2C0GA 1SJIA 2P3YA 4K9ZA 1XG8A 4Y1UA 1PGW2 1H2NA 3MV11 5J96B 2MPFA 1XBSA 4XILA 5IO0A 1T4YA 4ZY9A 5HR1A 4Q4V2 1JZWA 2FWEA 2RS11 1NM3A 1FMD1 3FFZA 1WLWA 4BK5A 3M3EA 4QPWA 1HKDA 2GNBA 1IKQA 2WFPA 1JYTA 4D6SA 1YJKA 4HK8A 1TU8A 4IE5A 3BTXA 3IXRA 4E2SA 1V6OA 2MEV1 1Z7S3 3MV01 2K8SA 1CAUA 1KFUL 5IATA 3VDDC 4ZXKA 3DYRA 1W03A 5FP8A 1NKGA 3WHUA 1FMD2 4YGBA 3ZN6A 4TN8A 3QAGA 3TKQA 4CDWB 2LQOA 4AI0A 3P5BA 3ZN5A 1O6UA 5EY6A 2EAAA <