5CYYA

Structure of the c-terminal domains of dipz from mycobacterium tuberculosis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
333
structure length
333
Chain Sequence
TGTEIREQLNLGGIVNAQNAQLSNCSDGAAQLESCGTAPDLKGITGWLNTPGNKPIDLKSLRGKVVLIDFWAYSCINCQRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAKGAANLGISYPIALDNNYATWTNYRNRYWPAEYLIDATGTVRHIKFGEGDYNVTETLVRQLLNDAKPGVKLPQPSSTTTPDLTPRAALTPETYFGVGKVVNYGGGGAYDEGSAVFDYPPSLAANSFALRGRWALDYQGATSDGNDAAIKLNYHAKDVYIVVGGTGTLTVVRDGKPATLPISGPPTTHQVVAGYRLASETLEVRPSKGLQVFSFTYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein DipZ
publication title Structure of the ectodomain of the electron transporter Rv2874 from Mycobacterium tuberculosis reveals a thioredoxin-like domain combined with a carbohydrate-binding module.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Membrane protein
total genus 91
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF17991 Thioredoxin_10 Thioredoxin like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5cyyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5cyyA01
5EJ1B 4Z7XA 4TVEA 2VD0A 1GWCA 2J22A 3T0DA 2RV9A 3MUZ1 1O85A 3HVVA 1PL2A 2VQUA 3NNGA 3TKRA 5EIYB 4UAPA 1U87A 2CX4A 1F6MC 1OKDA 2OADA 2K8VA 1QK8A 1SK0A 2VD1A 2VLTA 4RUVA 5ECPB 2HLSA 2LUSA 2QGVA 1ZZYA 3O76A 3I97A 1K3LA 4DUXA 5E59A 4CHSA 1EWXA 4YAVA 4JR6A 3TUEA 3LYKA 2VOCA 3W8JA 3CTGA 4MCUA 3UBKA 1WCQA 2P0GA 2P31A 2XOMA 1QMVA 2WYSA 3TRXA 1Y25A 2VCWA 2WO3A 4MDCA 2AB6A 5JWQB 4ISDA 3W8SA 1R26A 4N10A 2YPMA 4EUYA 2JZTA 5F05A 1B48A 4P08A 1GSUA 5F0GA 3ERWA 1Q4JA 2RM6A 1O6JA 3HNBM 3ZL5A 4PF1A 1F9MA 2FA4A 1R4WA 3EWLA 2LRCA 2JACA 5ELGA 2DIZA 1T3BA 5IMZA 3HXSA 4K1FA 1R64A 4WR4A 1YQ1A 1TRVA 4KSMA 2GQKA 1PMHX 5DAKB 4WETA 2IN3A 2YWOA 4FYCA 2CX3A 3GV1A 2HYXA 2V4VA 1EGOA 2GGTA 1ACVA 4ZBBA 2Y8KA 1TKDB 1YDKA 3GKMA 2GT6A 2K9FA 4NHZA 2J1VA 1O73A 5G5FA 2H30A 1VGLA 3VI7A 3T0BA 4KGIA 2C0FA 4MJBA 3T2PA 1CZSA 4GQFA 1PGTA 1F4HA 1EEJA 4LQRA 2B3SA 2WZ8A 3NJVA 2LJRA 1B4QA 4RN5A 2MMOA 3WGEA 3HJOA 1O81A 3E0UA 3F3RA 5DQSA 3CKHA 2KLXA 2W1WA 5C00A 1JZ8A 4LLRA 4CW9A 5AIXA 3HZ4A 3I3BA 2YWIA 5B6NA 3IIIA 4G9HA 1IYIA 3DXBA 1DBYA 2GSTA 3C7EA 2C1YA 3ZIVA 3QD9A 4ECJA 3HY2A 5ECOB 2I9HA 2WQ8A 3HNYM 3IC4A 5ECRB 3VD7A 2EIRA 4OMCA 2HSHA 2B4KA 12GSA 5JCWA 1BYEA 2VL2A 3VWWA 4XURA 2YWMA 1V98A 3CRTA 3UJ1A 13GSA 3TDGA 2OKXA 3FW2A 4CU8A 2VCZA 3J7Yk 2NDOA 2H6ZA 4BA7A 1FAAA 3IRAA 5HFIA 5ABRA 2N5FA 2JKXA 3M0FA 3WGDA 2BMXA 2H0IA 1MD4A 3W5NA 4PQIA 2Y6KA 1JI6A 1V2AA 1PN9A 5F8BA 1P8JA 5G05L 3D4TA 3KTBA 2MMZA 2H72A 4O5RA 4AF2A 1TK0B 4H86A 2E31A 2LQOA 1PD21 4O92A 1SG3A 2F51A 3KD0A 3EU3A 3DYPA 1XW9A 3LEGA 1GOGA 2DBCA 4KDYA 4M4PA 3MO4A 3GURA 1CQHA 3ISOA 5ECLB 2GSRA 3QR6A 4IP6A 3E1F1 1HNAA 1L7RA 2KP1A 3CRUA 4XUTA 2B7KA 1ZMAA 1UYXA 5B8AA 2Z4FA 2OBKA 3I2FA 1MTCA 4XVHA 1M0UA 4TR4A 5CREA 2WULA 5EPFA 1EUUA 4ILFA 5KN2A 1WMJA 4ECIA 4N30A 4I97A 1BQ7A 3GX8A 5C70A 1SJZA 2FGXA 3LYPA 4WF5A 1GRXA 22GSA 1THOA 7GSSA 5DN2A 1I5GA 1TOFA 1WP0A 2FWHA 4FH8A 3C71A 5IO0A 1XZOA 3C7OA 2JZSA 5J9CA 6GSUA 2B5EA 1MDIA 3FR9A 4I8BA 1SL1B 4XUNA 4NV2A 2VZUA 3ZYWA 4JU5A 2YZUA 3A3TA 4K6XA 4TR0A 1XIYA 4PURA 3D22A 1A2MA 3OGRA 4ZBDA 4PNGA 5H5RA 1X0RA 4ECBA 3PUHA 1A2JA 4GCIA 1X5DA 1TRWA 5ECMB 3M3MA 2E33A 4EO3A 3WF2A 1G0TA 3EVIA 1XW5A 3EURA 3F8UA 4GRFA 4BL7A 2IFQB 2FCHA 5IMDA 5IMFA 1XPVA 4KB3A 1JFUA 3LXTA 3VD5A 5ELAA 4KE3A 1W99A 4FO5A 1HQOA 2HSYA 4HZ2A 4L5OA 1CZTA 1KTEA 4LPLA 1AUCA 2DJ0A 1MPXA 2DLXA 4E8HA 3W5MA 2X8GA 4LA1A 5ECKB 2XHFA 1XFLA 1T4YA 2Y6JA 1BAYA 1F37A 3VDBA 2VCVA 3F2ZA 2PN8A 2CVKA 4QX2A 4JKLA 2JADA 4ZZ8A 1VRSD 2E2GA 3CQOA 1OF4A 1WIKA 4MF6A 3G7JA 1Z9HA 3ZTLA 5E4WA 14GSA 2YV9A 1X9WB 1A2LA 4UI9L 3GIXA 2X10A 3MNGA 2JD9A 3CXGA 3HA9A 1FB6A 2IMDA 2DMMA 4QX3A 4CUBA 2C0EA 5JXJA 4E8DA 3GSSA 4JZQA 3M8NA 2P5QA 3OB8A 4HI7A 3LG6A 4A4AA 2D2ZA 4YQVA 4N0ZA 4V1Ag 1KNGA 5J9BA 4GWRA 1NX9A 3C1RA 3H8QA 3O6TA 1ABAA 4ZBAA 6GSWA 4PNFA 1G7OA 1GNEA 4JHZA 3K4AA 1EP8A 2DC5A 5CP1A 1UYZA 4DEQA 1XNTA 1ERUA 1RK4A 1GUKA 1CX1A 1TRUA 5DVBA 3OBAA 5D96A 1V58A 3T0AA 1A8LA 4WEYA 17GSA 2H1DA 4DSRA 4QPWA 4K2DA 4WBJA 3M9KA 1SDDB 2VZRA 1X5EA 4RQXA 4IQ1A 2OE1A 2H1GA 3FYGA 2HZEB 1OT5A 2I3YA 3WNOA 4TR1A 1OVNA 4GTUA 3ZFLA 4TXOA 5GSSA 4MZBA 3ETPA 1E2YA 2KUCA 4OO5A 4G10A 2H74A 1A0FA 2WUHA 4BJ0A 1M2BA 3SEEA 5AN1A 1G6WA 3DD3A 4QB1A 2VLUA 3L78A 4TXWA 1Z7RA 5H5SA 1PMJX 3UVHA 5FUIA 2DSAA 2R37A 3CTFA 2XBIA 3KXOA 1ML6A 2QC7A 3HKRA 4GSNA 2JSZA 2YV7A 3C7FA 2L5OA 2GSSA 3ZITA 3LEKA 3QCPA 1W9WA 3NRUA 4A45A 2VM1A 4J57E 4BK4A 3ZM8A 2LS5A 11GSA 4DXTA 3PGTA 3K4DA 5J1XA 1X5CA 2R6KA 5IIZA 2L57A 2ZEXA 4TN8A 3NQHA 3UAPA 3VFIA 3SKJE 4PQQA 1VF2A 1K0AA 1SU9A 1WRYA 2HLEA 3T08A 3WNMA 2QSIA 4AJ6A 4CU6A 4P3YB 2AUVA 2A2RA 2W94A 1W8OA 1JLWA 2HZFA 3CSJA 1UXZA 4MABA 5IM9A 3W6GA 4HQZA 2LJAA 2C8UA 2K6VA 4ZB6A 4I6XA 3IAQA 1XWGA 1PX7A 5DALB 2L6DA 4FYBA 2QKEA 5D9TA 6GSVA 5D9VA 1JU3A 3FEUA 2HI7A 3DVXA 1BX9A 1GSFA 1Z3EA 5JWOB 1J08A 5J41A 3A23A 2W87A 1M9AA 2MMAA 1SENA 3P6BA 5LA2A 3L0HA 2QQLA 1PKWA 2CVDA 1JZ4A 2IMEA 5KEJA 1Y6EA 3LGCA 3GL5A 1PL1A 3FKFA 2WCIA 2J1SA 1T2XA 2MZCA 3ZREA 3OGVA 1JZWA 2W5FA 4DXSA 8GSSA 3PR8A 3I3EA 4M4RA 2WAAA 4PGTA 4XUQA 2XONA 3T2OA 3O3TA 3GYKA 5KN0A 4JE1A 1FW1A 1WE0A 2IWTA 3VI5A 3THCA 4BDVB 3ERGA 4MA9A 3VD3A 2W92A 5JXGA 1TJDA 2VZVA 1QFNA 2C4JA 2CT6A 3LE0A 1NSWA 5IFTA 2HFDA 3WT1A 4QL9A 2DMLA 3HDCA 5ECSA 6GSTA 3KZQA 4KSOA 4EC0A 4MGSA 1GSSA 1MD3A 2VCTA 3KH9A 4WXTA 2W1UA 4DXRA 2EIQA 4DUVA 5A4WA 2KHPA 2VL4A 4AJ8A 2R4VA 3FR3A 3KH7A 4KAEA 1XVWA 1M2AA 5CO3A 1DYOA 2VCBA 3Q18A 4V2NA 3FY7A 1T4ZA 3IOSA 1UMHA 3R2QA 3HN3A 2ZUPA 3C8EA 3EYPA 3UARA 1JZRA 4LHSA 4RQRA 3BN6A 2WJUA 4MP4A 3DYRA 2ZXQA 4F0CA 5A5KA 5C04A 5C7GA 5JUVA 3IB3A 3GXUA 1DUGA 1XWCA 3LWAA 1Z6NA 1JZ2A 4A42A 2WO2A 4A41A 3I2JA 3ZZXA 2WN3A 1ZYQB 3ACFA 2WAOA 5A4UA 3WEZA 4XUOA 4ZIJA 2VZSA 2N5AA 5DQ0A 1TVGA 1K0BA 4ZL9A 4ZL8A 1K0MA 2DJ2A 5I0DA 2IIYA 3SEPA 2VZTA 1EV9A 1W8NA 5IMVA 3JXSA 3D5JA 1FVKA 4V1Ap 2XHNA 1WPIA 3EE2A 1GUMA 4GLTA 4WF4A 2VAFA 1WWJA 2C3QA 4DSQA 2JZRA 1O8PA 1OC9B 1NHYA 4BPYA 5GZZB 2BJXA 5ECQB 5LCWL 3GH9A 4XS4B 2VCAA 5CAXA 5KN3A 3IXRA 5DAKA 2MYGA 1TG7A 1DE1A 3LFLA 3FHQA 3GL3A 4ZXEA 3VD9A 2ZNMA 2K8SA 1UY3A 2G2QA 3WF4A 5G30A 5C71A 1SL2B 1K3OA 1AQVA 2JDAA 1MDKA 4KMQA 1K0NA 2C0DA 4RI7A 1V40A 3VURA 2FNOA 2CAQA 1TDIA 3LORA 5ID2B 4KCAA 2M80A 4QDQA 4OZOA 2GZPA 4HEA2 3KMNA 4FYUA 3H1NA 2N5BA 1U6TA 3G7IA 4YQUA 2HT9A 2QQIA 2CDPA 1JYXA 4DSSB 1YKAA 3G7YA 3HCZA 5DMYA 5B4NA 1B8XA 1IQDC 3GX0A 4ARXA 4IVFA 1WOUA 4OFNA 4RYDA 3PH9A 2PVQA 4NMUA 1V9WA 3MV11 4DEVA 5A4VA 3QMXA 1OKTA 3CYNA 1JYVA 3TKPA 5EVOA 1U3AA 1YQ2A 2CQ9A 4ZILA 4TTGA 4ML6A 1A0RP 4KA0A 5LA0A 3GA4A 3VLNA 2J1RA 2ZCTA 2WDUA 1GNWA 3Q19A 2YWNA 2YFZA 3TOTA 5G1LA 5H5QA 4MK3A 4QQ7A 1OH4A 1HNCA 2ZEWA 4MGQA 1SYXA 1X9MB 3HHVA 3C1SA 4BVYA 2DJ1A 3U37A 1T1VA 2W95A 3P2AA 3WF0A 1EGRA 3NJXA 4MADA 3ACIA 3UBLA 2ORXA 3BCKA 4ECCA 2R2JA 5D9XA 2A2SA 2H6YA 1GMMA 2LRNA 1U3IA 1XOBA 1UVZA 3APOA 3VWXA 1O8SA 3KTLA 3TOUA 1NM3A 5B8BA 4F03A 3EB7A 2V6OA 1TK8B 3GSTA 3K4ZA 2GZZA 5DQYA 2Y6HA 4POKA 1SKWB 1GSYA 2VO4A 3KIJA 3EMXA 3WSOA 1NUKA 10GSA 4JKKA 2KD7A 2VZOA 1LBKA 1OYJA 3UVTA 3JCML 1PX4A 4L8EA 1KEBA 2VCQA 3MUY1 2VM2A 1JZ5A 2W91A 3IR4A 4ZB9A 4DVCA 1OE8A 4ULXA 3T09A 3BBYA 1UYYA 3OG2A 1XVQA 5LD0A 4L0PA 2DJ3A 1AIUA 2PPTA 4HDEA 2GSQA 3ME8A 4MH3A 3PUIA 4GWJA 4MJEA 2WABA 4IKHA 4F82A 1GLPA 3HVXA 4HJMA 1EV4A 5J4UA 4PUAA 3ABZA 5CRWA 2IMFA 2DIYA 1CQGA 3HJMA 2H71A 3P1IA 1XWKA 5IO2A 3HOBA 2HE3A 5G5EA 1TU8A 4Q5FA 4MPFA 2LV3A 4JEDA 1XC6A 3HJRA 4TOPA 4X1UA 1SK1A 2CAIA 3WNKA 2TRCP 3P90A 3K46A 2O89A 2X09A 1ULOA 16GSA 2ZEYA 3THDA 3F4SA 2AHEA 4IN0A 4XHMA 2ID4A 1GQPA 3BJ5A 1AQWA 2JSYA 1ERWA 1JYWA 5IOXA 3ZMKA 3WYWA 4OWYA 3IE3A 4MF5A 2IFQA 3CSIA 5GSTA 3J7HA 2I1UA 2A4VA 2QQNA 1GOHA 2YJHA 4ET7A 4EXJA 5HFKA 2YG0A 2OJLA 4BWQA 1YEXA 1KEXA 2PUKC 4XUPA 5DBQA 3IAS2 3GKXA 1EP7A 2WN2A 1T7PB 1W4VA 3DMLA 3CSHA 3GUSA 3GFKA 2MBSA 3ME7A 2WRTA 4G19A 1OD3A 1B9XC 1RYYA 1I5PA 2VMDA 2EIDA 4D73B 2GS3A 2I4AA 3SBCA 4TW5A 4YQMA 2CDOA 1A24A 4FIWA 3L9SA 3QAWA 4YAPA 1PQNA 1SJIA 1T00A 1UMIA 1D7PM 4KDXA 1DE2A 3IA1A 1GTAA 1JHJA 4ZZ5A 4D73A 1OAZA 2VZ1A 2WZEA 4K7NA 2RIIA 3ZRDA 4LL4B 1GH2A 3VDCA 3N9JA 4KWUA 1WJKA 2IPAA 3TKSE 3TJJA 3APQA 2OE3A 4HU9A 3ZLPA 2FA8A 3IPZA 4QAWA 1T8EB 2YN1A 4MZWA 3LJRA 2VC9A 4OO4A 2FLSA 1JLVA 2B6MA 3I9V2 3VPQA 2VLVA 2J23A 1W0NA 2BGPA 4IHUA 2YC2A 2GVPA 2HNLA 2OKAA 2LRTA 2O7KA 2YNXA 4OD7A 2E2MA 5GAPD 1F2EA 3QPMA 3GM8A 4F2IA 1YZXA 4L0WA 3U6VA 4LMWA 3GNJA 2AAWA 4KUNA 2PQSA 2WB9A 3ERFA 2YFUA 4LMVA 4O7HA 3VPTA 1ZOFA 4POMA 2DJKA 5HPOA 5IYYA 5LA1A 1XPWA 2HZEA 5L71A 3M9JA 2V32A 2BBAA 1QUWA 1TW9A 4K8MA 4XCSA 1A8YA 1Z6MA 4K9ZA 3FZAA 4L0UA 4QB6A 1OC3A 2H0GA 1J83A 3GTUB 1VF1A 1SD8A 1O59A 1S3CA 4I2UA 2XQXA 3C7MA 4GSTA 3I2HA 3OGSA 2H66A 3C73A 3MWHA 1R5AA 1PSQA 1L7QA 3VDAA 1NKGA 4Q5RA 5EJZB 5JR2A 1PRXA 2BGOA 1ZYEA 3WT2A 2O87A 1G7EA 5HQPA 2L9LA 4TKYA 2J1TA 3Q6OA 4Q5QA 1A23A 2WZ9A 1DLCA 1AXDA 4G2EA 3GN3A 4JKMA 2WO1A 4A44A 1O7UA 1TRSA 3KJYA 5D9WA 5CRHA 3LPGA 3A2VA 4GXZA 2NTOA 2V41A 1BG5A 2PMTA 2R5GA 4KCEA 3TRPA 3RBTA 3ZFBA 5HR1A 2MMNA 5D8IA 2XPEA 2XPDA 2FWFA 3L9VA 5EY6A 3DKSA 4ML1A 2R3XA 1H4OA 1HN1A 4J2FA 3VD4A 1GSEA 6GSYA 2QBXA 3QFBC 5DALA 3IV4A 5D93A 1S3AA 2JE8A 2YB7A 2B9VA 2YOIA 2IJYA 3S9FA 2CVBA 3D6IA 5FWGA 4HOJA 4IUGA 2LS6A 3HNMA 2WGRA 2VOTA 4GZ9A 2E7PA 3E3EA 4OMDA 3HEIA 1ILOA 3FZ5A 3C7HA 5FHIA 3NZNA 5IMCA 3TKSC 2H6XA 1JZDA 3K77A 1OF3A 3CZJA 3F3QA 1CZVA 5B7CA 3TKSA 1UY2A 4ACSA 1JYNA 3FZ4A 3MBWA 3D0ZA 2DCJA 1GTIA 3HD5A 2VCXA 1KGYA 4K0GA 3I43A 4EKZA 2C4XA 3ED3A 4K7OA 3I69A 1GTBA 4I2TA 3LQCA 1UWWA 2ZEZA 2X05A 2DJJA 2V1MA 1W9TA 2GQLA 3I3DA 1QGVA 4E8EA 3IDAA 1GULA 4TR3A 2CA8A 3LPFA 3I2IA 1UN2A 2KP2A 3KMOA 4XZUG 5B6MA 1M9BA 5IJRA 4QDSA 1GSQA 1AAZA 1TTZA 4POLA 5F7UA 3QOUA 1GL8A 3ZVJA 2RUEA 5CRGA 1O8XA 3K75B 5LCZA 2GZYA 5IPHA 4KDUA 4F9ZA 4GF0A 1VF3A 2GLRA 3APSA 5JMOA 1Q98A 1PKZA 2EICA 4CUCA 1M2DA 1HD2A 3WQBA 20GSA 2L59A 1NW2A 1V57A 3FL7A 3F6FA 1JZOA 4W8JA 1TI1A 2B5XA 2BZDA 1YF0A 3IAM2 3EYTA 3SWLA 3C8XA 5AIVA 2TRXA 3HJPA 4Q5NA 3DIEA 2IMIA 2VIMA 2L4CA 3GKNA 2OBIA 2RLIA 3KP9A 1KBNA 2CZ3A 3GH6A 2G0FA 4ID0A 4IGJA 2J7MA 2Y6GA 5IHRA 3U5RE 4ZXGA 4RI6A 1BJXA 2F3MA 4OFMA 2PVOC 5G2ZA 1TP9A 3EINA 2O85A 5GAND 2X99A 2C26A 4GQCA 3RPNA 2O8VB 4CU9A 4XTSA 3V1WA 2AV4A 3WNNA 3LEFA 3DEXA 1J9BA 6GSSA 1OC9A 1DSBA 4MMMA 3WF3A 3J7Yb 2K18A 1UC7A 4WBRD 2YCDA 4BWSA 6GSXA 3Q74A 1PA3A 2MBTA 1XCCA 4XS4A 1S3DA 3MSZA 4WR5A 5IQYA 5F06A 1QQ2A 2FWEA 4TXVA 2VQTA 3MAKA 2ON7A 2XC2A 4V2MA 4JX0A 2VM9A 4PX1A 2M72A 3F0IA 2C9KA 2ALBA 3QFAC 2B1LA 2J1UA 3LEIA 5ID2A 1B9YC 1MEKA 1GLQA 4NWYA 4IJIA 2EIBA 3C7GA 5IOWA 3I6AA 4DSSA 2OA7A 3VWVA 4A6OA 2XBQA 1C72A 2LNTA 5J5NA 5HFGA 3ACHA 4XRAA 3E9JB 2FY6A 3K8NA 4D0QA 1JZ7A 2VL2C 3FN9A 1GNYA 3UL3A 3AC0A 1SJ6A 4ZY9A 4W4ZA 2DDUA 3WNLA 3ACGA 1N8JA 2P5RA 2YANA 3P8WA 4P02B 4ARYA 2CZ2A 1N2AA 2Z9SA 3D4MA 4HJ2A 1HNBA 3OEAA 2VTFA 1HYUA 2H75A 1YF1A 1K0DA 2C3NA 4YPJA 2ES7A 2LTKA 1THXA 5FT3A 4D8MA 1UY0A 2VZQA 2PBJA 4IS0A 2VMFA 5DCGA 2PU9C 4UOJA 2VZPA 4QL7A 5J3RA 3GMFA 1K12A 4NV5A 4AGSA 4PQ1A 2QQMA 3A22A 5CZKA 3BGAA 3TJBA 4BXSV 1ZL9A 3UIWA 4GWIA 2LKUA 4JRRA 4IBPA 2H1BA 1K45A 1SHWB 2W9XA 3MV01 2NBSA 1JZ3A 1FG4A 1ERVA 1XWBA 3F63A 5ENUA 2F9SA 2IMKA 4NXIA 4AAXA 1CIYA 2VMCA 4IW9A 1GP1A 1AC1A 3US3A 4LL1B 3GHAA 4MLYA 2H70A 1M7TA 2OE0A 1U88A 4W50A 1URMA 2YZHA 3ZMLA 4EDYA 5ECHB 2NPBA 4KH7A 3UMAA 3L4NA 2DCKA 2WS2A 1FVJA 1Z7PA 2W1QA 1UZ0A 1M99A 2B7JA 1R5PA 2QQOA 1X9SB 3D3AA 1PX6A 1SK2A 2HRNA 2VL3A 4N11A 3RHBA 2EC4A 5DCHA 1PMTA 1J0FA 1H75A 3EMPA 4EDZA 5LNKe 5HR0A 2V72A 1YEPA 2IL3A 1FOVA 1K0OA 1DP0A 4NHWA 3MDKA 4TRXA 3BOAA 3SKVA 2EIEA 2HRFA 2C3TA 3FHAA 2VJXA 5IPGA 2FD3A 5G31A 3G9BA 4HUAA 3EU4A 1G6YA 4MO3M 4MPGA 1JHBA 3HYPA 3VK9A 1ON4A 1RQMA 1BEDA 4XRDA 1FB0A 2H01A 2L4QA 3UETA 2VL9A 2C0GA 2X8HA 1FO5A 4PXOA 4DUWA 3TJKA 1AW9A 2WFCA 4IELA 3OR5A 4OCEA 4EVMA 2OACA 1GU3A 3QAGA 4PQHA 5JWRB 1AQXA 4P5YA 1US3A 1QXHA 1VF4A 1YY7A 4LKSA 4FI9A 3N5OA 2AYTA 4A3ZA 1K42A 2GDRA 2H73A 4HS1A 1ULPA 1OE7A 3IBHA 3TGZA 4ZB8A 4IQAA 1TK5B 1I9DA 2H19A 4JBBA 3DRNA 3HVSA 4K0NA 4XIHA 2X64A 2PERA 2F8AA 1GOFA 4HZ4A 1SKSB 4N0VA 5B4XA 1F3BA 1FHEA 2E0QA 3KEBA 1XXUA 3ZIJA 9GSSA 2W1SA 2C80A 2LEGA 3IK9A 4CUAA 2FHEA 3DGQA 4HU7A 2J9HA 2B1KA 2VUPA 2J1AA 3LXZA 3RDWA 4PT6A 5AGYA 1OC8A 2LJKA 1YJ6A 2FWGA 2V2GA 2PWJA 3GDBA 4WKWA 5DJLA 3EC3A 2X8CA 3FZ9A 4HG6B 1NHOA 3WNPA 3HZ8A 1J84A 1E6BA 5CNWA 1ERTA 4KNDA 5JXHA 2V5DA 1B4PA 3ZVJD 4BVXA 3LSZA 3FRCA 3CZUA 1W9SA 3GRXA 5IMAA 1UX7A 3CBUA 3FR6A 4GSSA 4X0XA 4BK5A 3CIHA 3UESA 4YH2A 4OCFA 3CMIA 5D73A 3TB2A 5INYA 1EOGA 2VCCA 4XS1A 2LNSA 3F6DA 2WDBA 5HR2A 1K0CA 2YJ7A 3KM6A 1Z5YE 1O8WA 2ON5A 18GSA 4DEJA 1YKCA 3H4KA 4CDOA 1TU7A 4L5LA 3KGKA 1K3YA 4NAXA 5JCUA 2PGTA 2TIRA 4TR1B 5COHA 2VZ3A 3QAVA 5CRDA 2I81A 2AJQB 5IFPA 4TXOB 3DYMA 3CMGA 4V2LA 5G1KA 1F3AA 4CU7A 5CYYA 1TI3A 4EE0A 2M46A 3F4TA 2R7EB 1NAEA 4MZCA 5ECIB 3NOFA 3WGXA 1XOAA 1GTUA 3KP8A 1MDJA 2F8FA 4F0BA 2RVAA 4MJAA 3VWUA 1F4AA 3IAPA 2H8LA 2RM5A 5G04L 1TXXA 3CDZB 2CV4A 2LQQA 2Y64A 2H1AA 3H93A 4E8CA 4MF7A 2L5LA 3F9UA 2BTOT 1XBSA 4EF0A 1UXXX 1H6YA 2YC4A 1EZKA 4ZL7A 4X43A 4XS6A 3IDVA 4MH2A 3L9UA 2LW8A 5JCGA 2RJ2A 2VR4A 2H0HA 3AY8A 5AISA 5HR3A 4J56E 1USBA 3GTUA 5JXIA 2BERA 4AG4A 3TKQA 1ST9A 1GSDA 3M1GA 3DVWA 1EOHA 3F4RA 2REMA 4O32A 2JL4A 4HQSA 3NIVA 4JR4A 3TCOA 1W89A 2J1EA 2YP6A 4KI5M 2E26A 4QDRA 2RUFA 3LQ7A 1ZCPA 1H6XA 3A2WA 2E32A 1GUHA 4OUEA 3D21A 4PUFC 1XW6A 5F07A 3QDNA 3UEMA 1R7HA 3HPNA 4QB2A 3UNPA 3A2XA 2Y6LA 5HXMA 4NPBA 4AJ7A 4QX1A 1SL0B 4QX0A 4OYUA 3DECA 3P7XA 4K7IA 1SD9A 5A1AA 3I2KA 4EL1A 4POBA 2GT5A 3IK7A 1GUIA 2WBKA 1XNAA 4KX4A 1K3IA 3WD6A 5KN1A 2W46A 3A21A 5ECNB 2FUG2 4MOAA 3H79A 1ZGNA 3TJGA 1WKYA 4CVUA 3GKKA 1UY1A 3FHKA 3BD2A 4IP1A 1UA5A 2NVLA 2L6CA 2VO5A 2EIOA 3TJFA 3KCMA 1SKRB 1XWAA 3FK8A 3T2QA 3RHCA 4KW6A 3RAZA 2KOKA 3BCIA 2H76A 2QQJA 3TRQA 1SYRA 3A5WA 2W3JA 5DDLA 1LJRA 2GTUA 2QQKA 5EL8A 1RW1A 3PINA 4IJ3A 2W47A 3UOMA 2ORZA 5DPNA 5DJMA 2JU5A 2V6KA 2VMEA 3WF1A 4OMVA 3I2GA 2GQMA 1IYHA 1LNSA 3A7QA 1EEMA 3GGLA 3ECQA 4P00B 3OEBA 1UY4A 2HXKA 1LU4A 1JZ6A 3RPPA 4OFTA 4Z2AA 2LSTA 3DWVA 4MJCA 19GSA 2B5YA 3IHQA 4I5QA 1BHGA 3DYOA 1US2A 1JU4A 1EUTA 1PX3A
chains in the Genus database with same CATH superfamily
1LGCA 5EJ1B 4QPIB 4OI0A 3RMYA 3T0DA 2BTVC 3HVVA 4I0AA 2JG9C 4UAPA 1U87A 5LBCA 4QX5A 4QT6A 3O1VA 2OADA 1OSGA 5JIAA 3D8CA 1NQJA 3AMMA 1ZZYA 3KWVA 3O76A 1K3LA 4UFIA 2JWPA 4YAVA 4JR6A 4YVSA 2WT1A 3ZYIB 5FQ0B 1X8MA 2XJTA 3UBKA 1WCQA 1OPMA 1RXFA 5FZHA 4EV0A 2EAKA 3FWEA 2ZABA 4Y26A 4NRPA 4EUYA 2JZTA 4RGAA 5LBBA 5I8SA 1AUYA 2RM6A 3VBHC 5J7MA 1O6JA 3ZL5A 4PF1A 1F9MA 1R4WA 2LRCA 2JACA 1XOYA 2DIZA 5IMZA 4XZPA 1LOFC 4LORA 1YQ1A 2GQKA 4WETA 4FYCA 1TME3 1EGOA 4XFAA 4ZBBA 5BV6A 3ZFFA 5JSOA 4NHZA 3SNMA 1PVC1 1DF0A 2H30A 2HWF2 5GZFA 3T0BA 4KGIA 1PGSA 5F5CA 1PGTA 1F4HA 1EEJA 4LQRA 3QLQA 3WGEA 2E9QA 3E0UA 3VN4A 5DQSA 3ZYRA 5FV3A 3CKHA 2W1WA 5C00A 3D5OA 1NA1A 3I3BA 1S4CA 5A7OA 2WFPA 2JDUA 3AP6A 3DXBA 1DBYA 4Y5TA 1CIWA 2C1YA 4DIQA 4IEVA 5ECOB 3LKJA 3VD7A 3RWNA 4OMCA 2HSHA 3RI9A 1BYEA 3VWWA 3GCXA 4UFHA 1NZIA 3M8LA 2YWMA 13GSA 5CEHA 2HWB3 4HVQA 1LEDA 4L9BA 2JKXA 2UWCA 3M0FA 5ANNA 5FZBA 3W5NA 1VAMA 4ASMB 5G05L 3FX3A 3D4TA 4NIGA 4GJYA 4Q4W1 3NAPC 3BTAA 1HRI2 2H72A 4AF2A 3U78A 1TK0B 1OLMA 4H86A 2R043 1PD21 4TLGA 1SG3A 2OUJA 1XW9A 4CSWA 2GSRA 2XHKA 4O9GA 3WINE 3B3QE 4NIIA 5B8AA 3I2FA 2WULA 4ECIA 4N30A 2D43A 4I97A 1SJZA 1SBEA 5JI9A 1THOA 3DXUA 1WP0A 3RJ2X 5FFOC 1EV11 2B5EA 3MFCA 1GP6A 2W2IA 2LRPA 3FR9A 1SL1B 3UGGA 2PHXA 4XUNA 3ZYWA 2YZUA 2WS92 4K6XA 5BNOC 1Y4WA 4PQ9A 2ZX0A 5A32B 3GZUC 3OGRA 2ZGRA 2RDSA 3VUOA 5H5RA 1X0RA 4ECBA 1LRHA 4GCIA 1X5DA 1LHVA 1QH7A 2V09A 1EPWA 2RG4A 4BL7A 1SCSA 2IFQB 3U07A 1Z7S2 3NV1A 4ZPIA 2WNUB 4OUSA 4CEYC 1QJU3 5KXCA 5LASA 4KE3A 4XDQA 2HSYA 1OLQA 1CZTA 4EYUA 1ULGA 5I8YA 1DQ5A 5A3UA 4QPGC 3L9JT 2ET1A 2CSGA 3GZEA 4LPLA 1AUCA 1MS9A 2DJ0A 4E8HA 3AFKA 2A3YA 3B93A 3MIFA 4IV1C 4ZS3A 2YXSA 4BQ3A 1BAYA 3KQRA 5BNNC 2VCVA 5FMOS 4P9JA 4MHUA 1MS0A 4PDWB 2UU8A 2JADA 4D6RA 4FAHA 3ZSEA 4ISQA 5JCTA 1Z9HA 5E4WA 2JB4A 3GIXA 2X10A 3BOPA 4IETA 2QFEA 3QH7A 4QX3A 5JXJA 1GZCA 3M8NA 3H8UA 2P5QA 1FPN1 1DQ6A 2R49A 4MUVA 2QA2A 1KNGA 4IV3A 4ZBAA 1PVXA 3IMNA 1NLSA 2CGPA 2GAUA 3K4AA 1EP8A 1UYZA 4DEQA 1XNTA 1NY72 1RK4A 5D96A 2OT7A 2QQVA 4MSVA 4XJUA 4WEYA 4JGZC 2H1DA 4DSRA 2W52A 2VCMA 4XFGA 1S3RA 3M9KA 1SDDB 4RQXA 2H1GA 1GLHA 5GLTA 1YYNA 1OVNA 2IFRA 1D0HA 4TXOA 5GSSA 4YW4A 4OO5A 4XF3A 2H74A 5AN1A 4QB1A 3L78A 1XBFA 1Z7RA 3CTFA 1LGBA 4GKXA 5FY1A 4GSNA 4AI1A 1ODMA 2YV7A 3C7FA 1W6OB 4P9IA 4GMP3 3RZJA 5IVCA 4H2AA 1X5CA 4TN8A 1C8M1 1RUE2 4OVEA 1FPN3 1BQPA 4CEWC 4J25A 4AJ6A 1JYTA 1MVQA 4IE4A 4P3YB 4RS5C 5BY5A 2A2RA 4LJHA 1JLWA 2GMPA 1UXZA 1J1LA 2RR11 4OQ8A 5IM9A 3A5IA 4HQZA 2LJAA 4I6XA 4I3GA 3WT3A 4FQUA 4AHWA 4CZSA 1H2MA 3IDEA 1PX7A 2WNOA 4LBMA 4CDXC 2QKEA 6GSVA 5D9VA 1IPKA 1J08A 1MEC2 1UKGA 4UXAA 2Q30A 3P6BA 4QKFA 1UZYA 1PKWA 2CVDA 5KEJA 5FR3A 4YM2A 5FY7A 3LGCA 3GL5A 2WCIA 3KMHA 5F5QA 1VBE1 2BWCA 3JD72 4HMZA 1LENA 2P2KA 4XF4A 3BOWA 3FFZA 1X33A 1U5ZA 4PIYA 3PR8A 3G6JB 1F15A 2Y26A 3FE5A 1XNCA 3O3TA 4W6XA 3LD8A 4XQ4A 4N90A 1WE0A 5H9RA 1TMF1 5GZGA 1TJDA 1HJFA 1IGOA 2JICA 1OXCA 6GSTA 3CF6E 1J58A 1GSSA 5FJKA 2VCTA 2EIQA 4MXWB 5A4WA 1VBB1 3JCIA 4YW7A 1DYOA 3VHPA 4BQ2A 3R2QA 3C8EA 1JZRA 1QJX1 4MP4A 5A5KA 5JUVA 3H1YA 4NPRA 3S7EA 5DUUA 5D2AA 1UU6A 1VBD1 4A42A 1D2QA 2WO2A 4M3CA 1AYM1 1Z78A 3RZKA 5ACA3 2WAOA 2ENRA 1TVGA 4ONUA 3VZKA 3VDDC 5HV0A 4YZ4A 2XVKA 1WMFA 3SEPA 4BLJA 4Q8KA 2EVXA 2XHNA 2V5YA 2VAFA 2C3QA 1NHYA 1AL22 5GZZB 2ZMKA 2BNNA 4NHKA 1YIPA 4Z8BA 1PVC2 1SBFA 1TMF3 5CAXA 1FV2A 1C5HA 3IXRA 4LT5A 4NJ4A 1DE1A 1S0JA 1ZZBA 3FHQA 1G9CA 4XTMA 2ATFA 2ZNMA 2GN7A 5IVYA 3GNEA 1UX6A 1MDKA 2MPFA 2C0DA 3E5XA 3D0JA 3OYWB 5KWRA 1TDIA 1OUSA 3KT1A 5ID2B 1G86A 1VBB3 4HEA2 1JYCA 4F83A 4YQUA 2QQIA 3ZVXA 1JYXA 1YKAA 3G7YA 3HCZA 5DZGA 3PIJA 4N43B 2JDKA 1WOUA 2JDMA 4RYDA 1QJX3 4JDOA 4NMUA 3MV11 1UIJA 2WZR1 4LBNA 4TTGA 1RUF1 2DUOA 4Y1XA 4LMFA 5A7WA 3GA4A 2ZCTA 4GH4A 2WDUA 4Y3OA 1GNWA 3J7NA 2YFZA 1GWLA 5L7OA 5H5QA 4CPBD 2ZEWA 3DPRA 3C1SA 4Z1VA 1D4M2 4KL1A 4Z2WA 3NJXA 1FOHA 2GZWA 4UF0A 4ECCA 5FZKA 5D9XA 4EZ4A 1LTEA 2A2SA 3U11A 3KHCA 3VWXA 3VBOB 4YNIA 3D82A 3H42B 2V6OA 3K4ZA 5DAXA 4POKA 3MIGA 3JU9A 3ZYBA 2PAEA 2HWF3 4JKKA 1LBKA 2PLV2 1EV12 3KZ4C 4L8EA 1RIRA 1KEBA 2VCQA 2VM2A 2WQZC 1XRUA 2W91A 4DVCA 3IWZA 5JLVA 5FOBB 2ZZJA 4L0PA 1AIUA 2GSQA 3ME8A 4MH3A 4FO9A 1W2UA 2WABA 1GLPA 2KA3A 4V2VA 5J4UA 3MW2A 4Q4X1 5C9AA 3WG4A 5FKCA 2JXAA 4DPNA 2H71A 3P1IA 1AZDA 5IO2A 2HE3A 5BPXA 1CPNA 2XJUA 1CAXB 2ZCWA 1XC6A 3ZYHA 3HJRA 4K2XA 4H14A 5JIUA 4X1UA 3FZ3A 3K46A 4XXAA 3VZLA 1POV1 4KWKA 2ID4A 1GQPA 3BJ5A 1ERWA 1JYWA 4NWVA 4OWYA 3PL0A 4PHZA 5GSTA 3DCQA 2I1UA 1XE7A 2A4VA 2DBIA 2OJLA 2CU5A 1KEXA 3ZSMA 3IAS2 3TOJA 1OI6A 1EP7A 3RSJA 4EJRA 1YQ5A 1W6NB 1W4VA 5KR7A 4ITCA 5FZLA 3NW4A 1QHDA 1OD3A 1FNYA 1B9XC 1PFOA 1M4WA 1I5PA 3WVJA 5FZMA 1W6NA 3L9SA 1PQNA 1OC1A 1S2BA 1DE2A 1JHJA 4ZZ5A 4BVXB 4PBPA 4E4ZA 3ZRDA 4XACA 4LL4B 1GH2A 2WS93 4HU9A 2OE3A 3RZGA 4HKWA 2Q8OA 4FOWA 4MGZE 3GBWA 4EQVA 2VC9A 4QU1A 3VGIA 1W0NA 4K6BA 1S2EA 4NE9A 2E2MA 2PAKA 3AZYA 3QPMA 4L0WA 1W2AX 1SDWA 2DWRA 4WM7C 3T2TA 4XBNA 2DV9A 3H3ZA 3ENRA 5DUXA 5IYYA 4AR2A 5FZGA 2HZEA 5L71A 3M9JA 1TW9A 4I0BA 5J36A 5L9VA 3BTZA 4PCRA 4L0UA 1DGLA 2VVEA 4AWDA 2J42A 2HH9A 3BTXA 2Y60A 4QB6A 1OC3A 4UW5A 2DTWA 1F31A 2Y38A 5IVVA 2XQXA 2C9AA 4GSTA 2AZ5A 2H66A 4KNCA 3MWHA 4S2GA 1R5AA 1NKGA 1C8M2 3AXEA 1YFYA 3KV5A 1XU1A 4GAZA 2QA1A 4YG6A 2CAUA 2GALA 4L11A 2RDQA 2VNVA 5HQPA 3LA7A 3Q6OA 4Q5QA 1J59A 2RR12 2WZ9A 3GN3A 4JKMA 3SH4A 1E5HA 3WG2A 4BLIA 3A2VA 5FP4A 4E27A 1W9FA 3J8F2 4OQ9A 3RZHA 5HR1A 4AVCA 2MMNA 3PU3A 2FWFA 3PJYA 5FYTA 1UYPA 1PK6B 4AL9A 3IV4A 5D93A 2YB7A 4JZRA 2YOIA 1NXMA 4Y22B 1PK6A 4BPZA 4Q0QA 4YLZA 1VBA2 4QM9A 2VPVA 3IPVA 1XNDA 2Y0OA 3FZ5A 3C7HA 5FHIA 3NZNA 5IMCA 3TKSC 3K77A 3HQXA 1OF3A 1QKQA 4XHXA 5FKBA 1CZVA 4O7XA 3N7JA 4HN0A 4JRAA 3EBRA 1NE6A 1GTIA 2VCXA 3PHMA 1KGYA 4K0GA 4UYBA 3SISA 2C4XA 5C8CC 4K7OA 1GTBA 3N9PA 5A3OA 1F8VA 2V1MA 2Z42A 3I3DA 1QGVA 4E8EA 4TR3A 2NLRA 3ZFGB 3H1MA 3LCPA 5LZ6A 4IE0A 3RYRA 3P3NA 1GL8A 3ZVJA 3ZFEA 2VOXA 3KF3A 2ET7A 2GZYA 4LLFA 4DMIA 4IXLA 4K8FA 5JMOA 4BOWA 1AX1A 4YVSC 1VBD2 1PKZA 3N35A 1H4HA 1OFSA 1F5FA 1QEXA 4XF9A 3WQBA 3GHNA 5DAWA 20GSA 2P37A 2B5XA 1MEC3 1F2NA 3ON7A 4QM8A 3C8XA 5AIVA 2TRXA 1GP5A 2VIMA 2JE7A 4OHYA 4LOSA 1RUI2 3KP9A 3W21A 1ULDA 5C3SA 2CZ3A 3VBFC 2Y6GA 1BJXA 3JD73 2WRAA 4OFMA 3I54A 2P6HA 5FPBA 4DO0A 5FYZA 3DEMA 1VRH1 5GAND 2X99A 5FZIA 4CU9A 1COV3 4FTEA 3LEFA 6GSSA 4FFFA 1EPZA 4AEDC 1OC9A 1V6LA 1A78A 2YCDA 4KU8A 3IZOA 4JQRA 5CFDC 4PTSA 1PA3A 2MBTA 3OBTA 5JPMB 1VPHA 5IQYA 1ZBE3 3SQOA 2VQTA 4AGGA 4YWAA 4O5QA 4JX0A 1AXKA 2C9KA 2ALBA 5HCHA 4WV8A 3TYJA 5A3PA 4KWJA 3LEIA 2JG8A 1NA1C 5CAZA 4AQ2A 3WZ1A 4DSSA 2OZ6A 3VWVA 1XJAA 2OA2A 2XBQA 2LNTA 2R32A 5F1RA 2PHUA 4FPCA 2QTWB 3ZYFA 5HFGA 3HAGA 3ACHA 2ZGQA 3E9JB 3K8NA 1XYPA 4D0QA 3SCHA 5JOZA 3FN9A 4Q0SA 2X5IC 3GZAA 3BTYA 1VR3A 4P02B 4XIOA 4ARYA 4N9IA 1HNBA 1FI2A 1YF1A 3ES4A 4FPYA 2C3NA 2LTKA 1THXA 4M3CF 3NSTA 5CFCC 5FREA 2VBBA 4A7ZA 4ASKA 4AGSA 2B45X 5CZKA 2Q8DA 1VRH3 4BXSV 4GWIA 4XFCA 4LO6B 4JRRA 1NZCA 4XPVA 4R9CA 3MV01 2NBSA 4CCKA 1JZ3A 1FG4A 4N53C 4XCAA 1XWBA 3UT0A 3ROUA 1CIYA 5LWBA 1GP1A 3B7MA 2QCSB 4KU7A 5ABJB 1RC6A 3HVDA 2ZKLA 1NE4A 2FDHA 4W50A 2YZHA 2UWBA 3B01A 3UMAA 3L4NA 2XGXA 2DCKA 1Z7PA 2XXZA 3AZZA 4CUGA 4MGYE 1R5PA 1SK2A 2BV4A 3OOXA 5DCHA 5IUQA 2BYVE 5HR0A 2V72A 1YEPA 2IL3A 1H1AA 4AI8A 4NHWA 1CGPA 3SKVA 2EIEA 2HRFA 5FBZA 4Q4V3 1B35C 4HUAA 3HN1A 5K0UA 3H8OA 4MPGA 3VK9A 1SLCA 1BEDA 1FB0A 1D4M3 3UETA 2X8HA 3N7LA 4DUWA 2A6XA 1AW9A 3RI8A 3OR5A 4KGGA 2OACA 2RS31 4HSJA 2KM2A 2A6ZA 3CL1A 2ZAAA 2R1DA 1W8UA 4W65A 2EALA 1SLLA 2MEV3 2AYTA 4A3ZA 4HS1A 5E88A 4CDWC 3TGZA 3KV6A 1C57A 4IQAA 5GKAC 1TK5B 2RM22 1I9DA 1D2SA 5FY9A 3RGBA 1KDKA 3IKWA 2PLV3 1Q8SA 1FHEA 4MGKE 2E0QA 3IN9A 4HLTA 3ZIJA 2W1SA 3AKPA 1NCQB 2FHEA 1BZWA 4AQ6A 5GLZA 3J7MA 3LXZA 3OY8B 1PO13 2VG9A 4PT6A 5AGYA 5LRRA 1OC8A 1YJ6A 2GP5A 2FWGA 3GDBA 4FPFA 4WKWA 1F9KA 1VAVA 3FZ9A 4HG6B 4CDQC 1E6BA 4LBQD 5JXHA 3N9QA 1BMV1 4IV3C 4MH0E 1N47A 3CZUA 3RRDA 1UX7A 1XSRA 3UESA 4YH2A 2XUEA 4OCFA 5D73A 4XS1A 4BIFA 2LNSA 5HR2A 1K0CA 3KM6A 5FYMA 5EJ3A 18GSA 1C1LA 1STMA 2GDFA 5FP7A 4DEJA 3H4KA 5FXWA 5JPNB 2G4IA 2Z2SB 5LK7B 3CJIB 3KGKA 5JCUA 1H8TC 4NAXA 4TR1B 1M06G 2AYHA 3QAVA 1LCLA 2VUDA 3DYMA 5J48A 1GR3A 3E5QA 2D40A 1FV3A 5CYYA 4QX7A 3S7IA 1DGWA 1JYIA 3ZXAC 4XOGA 3WGXA 1O4YA 4COWA 1GTUA 3KP8A 3AVRA 1YQ6A 5I91A 3CDZB 2LQQA 2DURA 2FMYA 2Y64A 4MF7A 1X9PA 3F9UA 2BTOT 2E7AA 3L9UA 3OBZA 3AY8A 1RMU3 4J56E 4RQPB 1VRBA 2P17A 1C1FA 4CP9A 3TKQA 1RITA 4QQ2A 4QU2A 3TCOA 1H9WA 4P9YA 2YP6A 4QDRA 4MGIE 3A2WA 4XBQA 5CKQA 3Q8EA 3A2XA 4AJ7A 3P7XA 4EL1A 2GT5A 1AR63 5KN1A 1LHNA 3A21A 5ECNB 3BU0A 3H79A 2R062 1ZGNA 3T1MA 4XJZA 1PZ8A 2NVLA 2VO5A 2EIOA 1SKRB 1KRIA 1XWAA 4CY6A 2KOKA 4DXZA 1Z0HA 1SYRA 1QNYA 2YGLA 3LSEA 5DDLA 1IHMA 1RW1A 3BALA 3PINA 3UOMA 4HT1T 2JU5A 5FZ8A 3B00A 1BVVA 4LHKA 2F4LA 5FZOA 5IWFA 3ZXFA 4ICYA 5CG9A 3WHTA 1G9FA 2I07B 4C91A 1LOEA 1MS8A 4OFTA 4Z2AA 2GNMA 4FP2A 3IHQA 1BHGA 5G30A 4Z7XA 4TVEA 2VD0A 2JG9B 3TKRA 4R9BA 3NVCA 1F6MC 5FLIA 1QK8A 1GZWB 5FO7B 1IPSA 4JHTA 3WCRA 5FMBA 2GNBA 3I97A 5E59A 4DUXA 3VHNA 3J8F3 1EWXA 3WHUA 1MZFA 1UCXA 1HB2A 4FQ4A 4NPLA 3D6EA 2WO7A 1OQDA 1WCKA 2XOMA 2FMDA 4BB3A 3QH6A 1Y25A 2QVSB 2ZA9A 4QD2A 1AR93 4LKEA 2P3YA 4ZONA 2WO3A 4MDCA 2HYKA 4P08A 5KHIA 3P5BA 1GSUA 1Q4JA 3IMMA 3H7YA 3FLPA 1VMJA 3HNBM 3ETQA 1JN2P 2FA4A 3EWLA 3VBHA 1ND2A 1R64A 1DIWA 1TRVA 1Q8PA 1PMHX 2C0ZA 1LOFA 1SEFA 4Q0UA 3GV1A 2HYXA 3I4IA 3MIDA 2FQPA 2GP3A 3OPTA 2Y8KA 5D8AC 3TEZA 3Q8AA 5DAPA 3B69A 1CQ9A 2ZHKA 1YDKA 1W03A 1O73A 4X6QB 2EXHA 1CZSA 1SCRA 4GQFA 4LHLA 5A7QA 3GHMA 2WZ8A 1B4QA 1QIQA 2WIIB 1XNKA 1ZYBA 5AC93 3MEPA 3CO2A 3F3RA 1Y43B 2KLXA 1XE8A 3HZ4A 4PBOA 1ULEA 3IIIA 3O5SA 2ZKNA 2GSTA 3ZIVA 2I2SA 1SLIA 3HY2A 3W58A 3HNYM 1CJPA 1EAH1 5ECRB 2EIRA 2B4KA 2P5BA 2H0BA 1V98A 3HWJA 3POBA 3TDGA 3O0XA 2VCZA 1LHWA 3ZXEA 2YBSA 1M3JA 2CWSA 2H6ZA 1RHI3 3IRAA 2BGCA 4IEPA 3WW2A 1VB2A 3NAPB 4PQIA 2Y6KA 1V2AA 4EN8B 1P8JA 1WBLA 2BWAA 4HBNA 3ZN6B 4O5RA 3ZMNA 4WM8B 2F51A 3KD0A 3LEGA 2DBCA 4KDYA 4M4PA 2YYOA 1CQHA 3ISOA 5ECLB 2G1MA 3UGFA 2E6VA 1FMD1 2EF6A 4IP6A 1MS1A 1DHKB 2B8MA 3ELNA 4BCUA 1ZMAA 1O91A 4Q0PA 5KXEA 1AJOA 2Z4FA 3J7LA 4XVHA 1POV0 1M0UA 3WW1A 4TR4A 4EN0A 5CU1A 3GX8A 3EHKA 4LTAA 3U10A 4WF5A 4FPOB 22GSA 3FMWA 2A1XA 3ORJA 5DXDA 1I5GA 4FH8A 5FZ0A 3C71A 4YM0A 2JZSA 5J9CA 1MDIA 2BOJA 2VVFA 1VB4A 5BNOB 5K9YA 4A3XA 4XXPA 2VZUA 4BZ4A 5J37A 4Q4Y2 3A3TA 1EAH3 1XIYA 5A3LA 2QQWA 1OA4A 1E5SA 3TN91 4ZBDA 5FZ6A 4PNGA 1OQEA 1ZZ8A 4EIQA 3U0ZA 1WW6A 3LB9A 4BXFA 3M3QA 5IVEA 3M3MA 4Y1UA 4EO3A 3WF2A 1XW5A 2RS32 1GKBA 4GRFA 4CEYB 1IS3A 4EN6B 4I09A 3WQ0A 2FCHA 4BMBA 1XPVA 1JFUA 3LXTA 4EN9B 3W59A 1HQOA 4U2AA 4HZ2A 3L2YA 1KTEA 1W04A 3T4VA 3VKNA 4IV1B 3IC8A 4ORFA 3SH3A 1CAVB 5BNNB 4QPGA 1QOSA 1WCDJ 2XHFA 2JDNA 1T4YA 1DQ4A 5FYSA 3USUA 3F2ZA 1N1VA 2HWC3 5GZEA 3LWCA 1VRSD 3H8XA 1GWKA 1WCUA 2A73B 1BYHA 1A2LA 3OUIA 5C4WA 1QOOA 5T50A 4ZS2A 2C0EA 4E8DA 1ND3B 5JZGB 4YKFA 3OB8A 3LG6A 2D2ZA 5J9BA 1NX9A 3C1RA 3H8QA 4JGYB 1ABAA 2DFBA 4PNFA 4YKGA 1G7OA 1GNEA 1PGW2 4A2UA 3THTA 1GUKA 2IZWA 4CPBA 1MR5A 3T0AA 2RMU3 2CYFA 2P34A 4QPWA 5FYUA 3R4SA 4WBJA 4HSCX 4JGZA 1WW5A 2VZRA 2OE1A 1LU1A 3AKSA 1S0BA 4PLOA 4MLOA 3ZFLA 2BEOA 4AI9A 3ETPA 1E2YA 2KUCA 1A0FA 2WUHA 4BJ0A 4YVWC 5GLVA 3VBUB 5FZCA 5H5SA 5T3NA 3RS6A 5KHGA 1GSLA 2RM23 1R093 3PLQA 2DCZA 1YQCA 2QC7A 2ZGPA 2NQYA 1IS6A 2L5OA 5I0TA 3JBG1 1NG0A 2VM1A 3WXPA 5FYVA 11GSA 5EQUA 4DXTA 4PLMA 2ILMA 3PUSA 3I59A 3K4DA 5J1XA 3TEWA 2R6KA 1S0EA 3ZOIA 2P3IA 2FDGA 1VF2A 4PQQA 3SKJE 3VFIA 4RS5B 1K0AA 3BU7A 4FFIA 2WFF1 3NO8A 2QSIA 4CU6A 1PO22 1AJKA 4MYEA 5F5IA 2AUVA 5GZCA 4CEWA 4S2FA 2HZFA 1HJGA 1E5IA 3H7JA 1G9AA 4MGTA 1ZRDA 3W6GA 5J96B 4RS5A 2C8UA 4ZB6A 2A75A 1DGRA 2HSMA 5DALB 2L6DA 2V4AA 1EYBA 1HRV3 4LR4A 3FEUA 2HI7A 1Z3EA 2GNTA 4AW7A 4CDXA 1YFUA 3M2MA 2W87A 3U4SA 4K8RB 2VUCA 1K5MC 3L0HA 2QQLA 1RTVA 3A0NA 5KC6A 1Y6EA 2VNRA 3ZMOA 2VW2A 4S2HA 4XUQA 3GYKA 2YZ4A 5KN0A 2G9ZA 2ZX1A 2BP6A 2IWTA 1S55A 4BDVB 3ERGA 4MA9A 1OOPC 2W92A 5L19A 3MFAA 4YZ2A 3B02A 3LE0A 1NSWA 1ZRRA 4QPIC 4QL9A 1WW4A 3KZQA 4EC0A 4CP1A 1MD3A 3UKVA 3RZZA 5F3IA 1FXZA 4DUVA 2KHPA 2VL4A 4A6SA 4AJ8A 2WFF3 1IQAA 1ZBA1 3KH7A 4AEKA 1OURA 5CO3A 2IXCA 1UMHA 4DFSA 3UARA 4LHSA 3DYRA 1GYKA 5C04A 3KM5A 3POWA 3IB3A 4CDUA 5JVVA 3VKLA 2R063 1DUGA 4XIKA 1V00A 4JDMA 1Z6NA 3I2JA 5KHKA 2LROA 4LKDA 3VDDB 4BYYA 3WEZA 5A4UA 3PPUA 2N5AA 2H0VA 5DQ0A 5LB6A 4ZL9A 4ZL8A 2IIYA 3NNLA 1EV9A 1W8NA 5CKMA 2B5HA 3SLIA 3R0RA 5EYYA 4V1Ap 5FYBA 1WPIA 5FP8A 2O8OA 3PDQA 4D7YA 4GLTA 4DSQA 1O8PA 1HDKA 2PN5A 1MQTB 3HMYA 1DGRN 4FFGA 3GH9A 4XS4B 5KN3A 2OQ6A 3DN7A 5DAKA 4MVTA 2K8SA 2G2QA 3WF4A 2HWE3 5C71A 1SL2B 1K3OA 2JDAA 5FYIA 3ZSJA 4BWOA 1V40A 2XBO2 3LORA 1QNWA 2HEVF 3DV8A 4BE3A 2R0CA 3M3IA 3ES1A 3FFQA 2N5BA 3ZR5A 2JG8C 2R1BA 5FPVA 3GX0A 4K20A 1SQ4A 1V9WA 5FLHA 1GZ9A 4NHLA 1OKTA 3CYNA 1JYVA 3ZPYA 4CXYA 2HWD2 2Z79A 5FZDA 1U3AA 2CQ9A 4ZILA 4FSJA 4LEJA 1A0RP 4QKBA 3VLNA 2CAVA 2H6BA 2J1RA 2AACA 5G1LA 4MK3A 2IXKA 3HHVA 2UURA 5FXXA 2GC0A 2W95A 4HPKA 2DVFA 3AYDA 4HVRA 2AC1A 3E6DA 1VLNA 2H6YA 1FMD2 3O12A 2LRNA 2VGDA 4YYOA 1U3IA 4KWLA 4XFFA 4CA9A 3APOA 1U0AA 3EB7A 3AKTA 4YG0A 2GZZA 5DQYA 2Y6HA 1SKWB 1ENRA 5A80A 1BBT1 2VO4A 3KIJA 1JOBA 3EMXA 2P4EA 3PUQA 4TYSA 1REEA 1IKPA 3V0BB 1W8WA 4XAAA 1IKQA 4P9GA 5BNPA 3BBYA 3I49A 1UYYA 1W6QA 2X53S 1XVQA 2VMIA 4GWJA 2KR2A 2LALA 2Q1MA 3U4XA 4PUAA 2HBTA 2DIYA 5FZ1A 4HETA 1CQGA 1QJFA 2A6VA 3HJMA 5FZ3A 2ZX3A 1W6PA 4K40A 5GJ6A 3SCFA 4JEDA 1SFNA 3OPWA 4B7EA 3LDBA 3WNKA 4W6WA 1RUH1 1QQP1 4JVAA 2ZEYA 3THDA 4KGQA 3F4SA 4XHMA 1WBFA 2OW4A 2WNUC 2XLFA 2ZS6B 5IAXA 5LY2A 3O1OA 3PMSA 3CSIA 4ZU5A 3BKZA 4F8AA 4EXJA 5HFKA 4PI0A 3U75A 5KOWA 3LOIA 1YEXA 3I3MA 4XUPA 2ZHLA 2YDEA 3GKXA 2JEMA 2JJ6A 2FHRA 3GFKA 4D69A 4PDWC 2WRTA 4G19A 2VOVA 4DINB 2EIDA 4D73B 1FOD1 2I4AA 3AL6A 4TW5A 4Z2RA 1A24A 4NHMA 3QAWA 5BYNA 1W8HA 1SJIA 2CWMA 2ZHMA 3HIFA 1V6OA 4D73A 3AMHA 1O4ZA 1XB9A 5FLJA 3N9LA 1WJKA 3APQA 3R05A 2UWAA 1T8EB 4MZWA 1W6MB 3LJRA 5E89A 3KV9A 4OO4A 2FLSA 4Q1PA 3ZX7A 2IUWA 3O7OA 2BVBA 2J23A 5GZDA 2BGPA 4RHV3 4IHUA 1UU4A 2LRTA 4WM7B 1YZXA 3U6VA 4HVOA 4LMWA 4CCOA 1SPPA 2AAWA 1JUHA 2WB9A 3ERFA 2YFUA 4B3NA 4KF9A 4LMVA 4O7HA 4POMA 1AR71 5IK4A 1DQ1A 4WVMB 4XJ8A 5LA1A 5FBJA 1AX2A 3LAGA 2R073 1QUWA 4C0HA 2Q8EA 1QJY3 3B5LB 1UW8A 4Q2FA 3FZAA 2G9FA 1GICA 1AX0A 4GB31 3C2UA 1J83A 2H0GA 3GTUB 1VF1A 5KOXA 1S3CA 5FP3A 4OUMA 3OGSA 5BRTA 2C1FA 1FOD3 3FUOA 5A33A 5F6LB 1AR83 1R081 3AMNA 3H3UA 2BGOA 1ZYEA 3WT2A 2O87A 3VBRB 2J1TA 4Y1VA 4NIDA 1DLCA 2WO1A 1O7UA 2RS13 2UY8A 2NTOA 3SXWA 1LGNA 2V41A 1BG5A 2R5GA 1AXZA 2XPDA 2JDPA 3L2HA 5EY6A 1V9U3 2R3XA 1RVF2 4IE5A 1YI9A 4J2FA 3VD4A 3QFBC 3Q8FA 2JE8A 2IJYA 3WG3A 4S2DA 3PVNA 3BIWE 3D6IA 2LS6A 4LIVA 4M00A 4GZ9A 3E3EA 4R9DA 2A3WA 2VOWA 3CZJA 2Q4SA 3PUAA 3TKSA 1UY2A 5FPLA 1JYNA 3UK9A 3FZ4A 3MBWA 4GB33 2W0XA 2DCJA 1GZTA 3D0ZA 2JX9A 4EKZA 3I43A 3ED3A 4I2TA 1UO9A 4URAA 5C8CA 1TME1 2RDNA 4P14A 2PFWA 2QNKA 3LPFA 3I2IA 1UN2A 5EPAA 2KP2A 1UMZA 5FAXA 3KMOA 4NMIA 2NPIA 5IJRA 4NRMA 3ZXJA 4LBQA 3MIBA 1RUJ2 1UPIA 4EWDA 5CRGA 2ZGUA 1AXYA 3K75B 1PO23 3BPSA 1HB4A 4YVSB 2ZGKA 4F9ZA 2GLRA 2AENA 4LBOA 3ZSLA 5E6HA 2GN3A 4WVZA 1UOFA 4Q5OA 2VECA 5EHDA 4NHXA 1NW2A 3FL7A 4W8JA 1TI1A 2BZDA 3IAM2 1CAUA 1SACA 3TEYA 3HJPA 1S1AA 4Q5NA 2DKHA 4RGKA 3POEA 3GKNA 2HWB1 2OBIA 1W3VA 2PELA 2G0FA 4ID0A 4ZXGA 4RI6A 4OHWA 3OTFA 1N1TA 1NLQA 2F3MA 3VBFA 1R1A2 1ND2C 4D3WA 5G2ZA 4GQCA 4UW6A 2A70A 4AEMA 3RPNA 3EXUA 4LO7A 2R041 3ZFFB 1UQXA 2TNFA 2AV4A 3KCCA 1WUVA 5CFDB 3WF3A 2K18A 1UC7A 1JXNA 4WBRD 1PIV2 5A6YA 4BWSA 4AEDA 6GSXA 1XCCA 5CFDA 3ZO0B 4GD4A 4V2MA 5H9PA 3WOGA 1OHFA 1WGPA 3CLPA 1NA1B 3AZWA 4EWAA 1OMIA 2VBDA 3I2OA 1MEKA 1GLQA 4N43C 4IJIA 1ODNA 3URFA 3C7GA 1KXGA 1RUG3 4A6OA 2ZMNA 4QMAA 4XRAA 3MPPG 2FY6A 3ASIA 1GNYA 3UL3A 3AC0A 2DDUA 3WNLA 2P5RA 2CZ2A 1N2AA 3D4MA 2X5IA 3OEAA 5JOYA 1K0DA 1H1IA 4GWMA 4YPJA 2ES7A 3VKMA 5FT3A 4IS0A 4YRDA 4OI4A 2PU9C 3T1LA 1WD3A 4UWDA 3A22A 5CFCA 2ES3A 1YLLA 4LK7A 4PF5A 3VLBB 2TEPA 1K45A 3RZMA 1QJU1 1BBT2 2W9XA 1DBNA 2WNVA 3VBOC 5L9RA 5TSWA 5LA9A 2RS52 2WZPP 5ENUA 2F9SA 4NXIA 4PLNA 4N53A 2DUPA 5H9QA 1ZRIA 3AZXA 1AC1A 5F2WA 4LL1B 3GHAA 2XBO3 1DU3D 2H70A 2PHFA 1U88A 3KGZA 1RUD2 5ECHB 2WLPA 5DABA 3LA3A 1M99A 2VXRA 2HRNA 2VL3A 4AI0A 3RHBA 4OI1A 3KT7A 2B42B 3EMPA 4FPEA 4EDZA 4HKLA 3ZXGA 1ZYPA 3BYWA 1BKZA 1JS9A 1DP0A 5CG8A 1B35B 1KDMA 4COYA 1JUIA 3AKQA 1RUH2 5APAA 1QQP2 2UYBA 3EU4A 4BL7B 1G6YA 1VBC3 3HYPA 1B35A 2XG3A 1W90A 2VL9A 3GALA 1I6XA 3PIGA 4YZ5A 4OCEA 2VMGA 1U5IA 1AQXA 2IVIB 3RDIA 3TWIA 4CDWB 1VF4A 1RXGA 4FI9A 4QXHA 2H73A 5SV8A 3IBHA 4ZB8A 2IXHA 4M0HA 5LY1A 1AYN2 2H19A 1WA6X 4CDWA 4XIHA 2PERA 4QPYA 2F8AA 1J3PA 2PHLA 3PNAA 5B4XA 5A1FA 1MS5A 3ITQA 3KEBA 1XXUA 1FX5A 3WLUA 3IK9A 2C80A 2LEGA 2BOIA 1BK0A 4GMP1 2GMMA 4HU7A 2B1KA 5FCCA 3N9MA 5C4WC 4E9KA 5FZ4A 1Y9MA 1HXS2 5FZ7A 5GLWA 2QZ3A 3EC3A 2X8CA 4IV3B 4RR3C 1W39A 4KNDA 1W28A 1UIKA 4Q27A 3FRCA 3E97A 3T30A 4CDQA 1W9SA 4P9WA 3CBUA 3TB2A 3CIHA 3LIHA 4GQ7A 4YM3A 3APBA 2ZPXA 2VAUA 4BQ5A 2YU2A 1O8WA 5CNAA 4O5UA 1JOPA 4Y20A 1FATA 1TU7A 1BEV1 3NKGA 5LEKA 2ZX2A 1AR72 2PGTA 3NV3A 2EA7A 2YROA 5CRDA 2I81A 1H8TA 4TXOB 3CMGA 4XQDA 4V2LA 1IS5A 3INAA 1DZQA 1TI3A 4EE0A 4JCKA 3J4UH 3ZKUA 1KFUL 2DFCA 4OLLA 2C24A 2F8FA 2B9UA 4MJAA 4Q8LA 3VWUA 4IGOA 3IAPA 2PAMA 1S0IA 4QGLA 5G04L 1TXXA 5F32A 4GKYA 2VW1A 1R1ZA 3WUCA 3E6BA 1R082 4AQSA 1XBSA 2YC4A 4ZL7A 4XS6A 1WCSA 3IDVA 1G6NA 4MH2A 2RJ2A 2VR4A 2D44A 1RUC3 3DXTA 5D21A 4NPMA 2BERA 4AG4A 3AKRA 3ACLA 3AMPA 2REMA 1BXHA 4IEZA 4JR4A 2J1EA 5KHHA 3IIAA 3LQ7A 4RFT0 2E32A 4AEJA 1S0CA 4E2QA 4NPBA 4QX1A 4XFBA 4O9EA 1GWMA 4QX0A 4OYUA 1SD9A 3H8RA 5LATA 1AHSA 1GUIA 4K5SA 3O1UA 4KX4A 3IDCB 5FDBA 1WKYA 5A3MA 4IP1A 1BEV3 1UA5A 1S0FA 3KD4A 1O3RA 4UFMA 3RHCA 1XYNA 3VZMA 4BQXA 3MIHA 2H76A 2ZAHA 1S0GA 2QQJA 5ACA1 3A5WA 1CPMA 2QQKA 4D7TA 4E2GA 4IJ3A 2W47A 4OULA 5DPNA 1IPJA 4URTA 2XL7A 3WF1A 2VMEA 2ETEA 5DDJ2 3A7QA 1EEMA 3GGLA 3ECQA 1TME2 2JIGA 4P00B 3HR9A 1UY4A 4MJCA 19GSA 1H4GA 1GV9A 3RJRA 3DYOA 1QXJA 1GWCA 4C1XA 2J22A 3ZFGC 2VH9A 4FOVA 5EIYB 5FUPA 2VOKA 1OA3A 1OKDA 4D7SA 2XDVA 2K8VA 1SK0A 1OLME 4RUVA 5KXBA 4XDOA 4ES9A 5A6ZA 2LUSA 1ASJ3 5IATA 3O1PA 4LBKA 3CQFA 2XUMA 3RYPA 3TUEA 4HSLA 2VULA 3Q8CA 4CDUC 3LYKA 2OZJA 4M3CB 5FJHA 3W8JA 1ZRCA 2ZGTA 4MCUA 1RVF3 2P31A 2P0GA 3O14A 1SBDA 5A6QA 2VCWA 2O0OA 3TEXA 2AB6A 3D0SA 4MX3A 1R26A 2YPMA 2XB6C 4ISRA 1B48A 2PQQA 3ERWA 2ZMLA 2R042 3KLSA 5ELGA 1WLDA 4WR4A 1QJEA 4DNYA 5D8AB 2IN3A 1HV0A 2Z69A 4META 2HRAA 2V4VA 1ACVA 2CTVA 4XABA 3DF0A 1CR7A 1YWKA 5D8AA 5IK7A 2J1VA 5G5FA 1VGLA 3VI7A 2C0FA 4ZU7A 4MJBA 3T2PA 2AEZA 3GJAA 3NJVA 2HWF1 1SLTA 2MMOA 3WW3A 1O81A 2DUQA 2BPA2 1O5LA 1JZ8A 2X49A 4LLRA 4CW9A 5AIXA 3AVSA 5LBFA 1OA2A 5EWSA 2YWIA 3KF5A 3VHRA 3C7EA 4ECJA 3K2OA 5A7WB 3IC4A 2OS2A 4KG0A 4GH4B 3ZXDA 12GSA 5JCWA 5L7OB 1UKRA 3DUIA 1EP0A 3CRTA 2VUAA 3DPRB 4CU8A 5AVAA 2YPDA 5FZEA 4TLFA 5GLUA 1KFXL 1FAAA 1XQNA 4QXCA 5HFIA 3ZIWA 2VBPA 2N5FA 4UF0B 2BMXA 4EROA 4Q4W2 2Q0AA 4Z2TA 3WV6A 4HXCA 3JB8A 1R1A3 2MMZA 3PTYA 4O92A 4K21A 1HRI1 1UZZA 3EU3A 1GOGA 2VQAA 4LKFA 4L2NA 3E1F1 1PIV3 1L7RA 4XUTA 1UYXA 2LM3A 4NRQA 2OBKA 2BDRA 5ABJC 1VJ2A 5CREA 5EPFA 4CXWA 5KN2A 1WMJA 1TZOA 3IBMA 5HI0A 2FGXA 2FDFA 3LYPA 1GRXA 4LULA 3WP6A 5BNPC 7GSSA 1TOFA 1UPSA 1LEMA 2XJSA 4NAOA 5EYXA 6GSUA 4GWNA 4I8BA 4FOQA 5C9AB 1D0GA 1HN0A 1JHNA 1YNAA 1NCRA 4AI2A 4NV2A 4JU5A 4TR0A 4PURA 3Q8BA 3D22A 1A2MA 3SC7X 3SCGA 3LOBA 3KS7A 3VKFC 2WS91 3B9CA 1X36A 3PUHA 1A2JA 5L9BA 2ARAA 1TRWA 5HV4A 2BFUL 5ECMB 4HL0A 1H1MA 3BI3A 2E33A 1G0TA 4FBFA 3EURA 3F8UA 5IMFA 4KB3A 3ZR6A 4QHOA 4XJAA 3VD5A 3MYDA 4FO5A 2R6QA 3MIEA 4L5OA 1HRI3 3ZN5A 2D3SA 2DBNA 1SFYA 1WLCA 1ZM1A 4FPGA 1MPXA 1LOGA 5FXZA 4LA1A 2BRTA 2PN8A 4JKLA 4ZZ8A 2E2GA 3CQOA 4CXXA 3IT8A 1WIKA 4MF6A 4TZDA 3AYEA 1NCQC 1RUD3 3BODA 2YV9A 14GSA 4UI9L 2W08A 1HX6A 2XL9A 3CXGA 3V0AA 3HA9A 1FB6A 1FPN2 2IMDA 4NVPA 1XE0A 1S2KA 3GSSA 4K7JA 1Q43A 4HI7A 4A4AA 1DZRA 4N0ZA 4V1Ag 1WLWA 2KXLA 3O6TA 5FY0A 3R6SA 1DQ2A 2DC5A 1IOAA 1ERUA 1T6BX 1YCIA 1CX1A 5DVBA 3OBAA 4AGVA 4YFZA 1V58A 3AK0A 3CJIC 2CGOA 4WVVA 1X5EA 4OI2A 1PZ9A 2CHHA 2HZEB 1OT5A 2I3YA 1Z7S3 5H9SA 2Q5TA 2O1QA 4BU2A 4MZBA 2HBUA 4G10A 2VUJA 3SEEA 4Y5Z0 2P6CA 3DD3A 2DVAA 2VLUA 4EIPA 1PMJX 4YVWA 3UVHA 2DSAA 2BFUS 2R37A 3A4UA 4I02A 1ML6A 2ERFA 3AJZA 2JSZA 3LFIA 4M3CE 2GSSA 3ZITA 3HQUA 3QCPA 1W9WA 2FDJA 3NRUA 4BH9A 3ZM8A 1N3QA 3PGTA 4XMIA 4CY8A 2L57A 3PU8A 2ZEXA 1HXS3 3NQHA 4DRVA 5KHJA 4B4RA 3WNMA 2QE3A 3T08A 1HB3A 2OPKA 1RUE1 4ATFA 2W94A 1W8OA 4UT5A 4NHYA 3CSJA 4MABA 3MLJA 1V70A 1UU5A 3TB0A 4IEWA 2TUNA 3K3NA 2OIIA 1JU3A 3DVXA 3NL1A 1GSFA 1YC61 2NZ9A 4IEYA 5T55A 3S57A 1ACCA 1SENA 3R3EA 1MEC1 2Q1FA 2BU9A 2IFWA 5IVJA 1JZ4A 3MW4A 3IPVB 1VBE2 2GSYA 1K5MA 1CN1A 4YFWA 3FKFA 2C5DA 2D97A 1T2XA 1PMIA 4Q26A 3ZREA 4AFMA 1JZWA 2W5FA 2ZGNA 8GSSA 4M4RA 4PGTA 3JD71 2XONA 1TMF2 4XC9A 4AVBA 4QXBA 4GULA 3THCA 4XBLA 5JXGA 2XWBB 1A8MA 1COV1 4RSUA 1W0OA 3OD0A 1OOPA 5IFTA 4FFHA 2ZJCA 1M3IA 2HFDA 1Q8VA 3WT1A 2YC0A 1VBB2 4QPIA 3ZFEB 3KH9A 1ZBE1 4DXRA 5FK7A 1U5XA 2A6YA 3FLTA 4AHZA 2R4VA 3FR3A 4KAEA 4BQWA 1RUE3 3KSCA 3NNMA 1QJX2 4V2NA 3FY7A 3HN3A 3EYPA 5F39A 5JWPA 3BN6A 2WJUA 4J1WA 5F3GA 4GA9A 1OVPA 2ZHNA 3RWKX 2A6WA 4FVVA 1AF9A 1AYM2 1WMXA 2D6NA 5FQ0A 2EXIA 3ZZXA 1ZYQB 3ACFA 4XUOA 2D7FA 4ZIJA 3IHGA 2VZSA 1K0BA 1K0MA 4QXKA 2DJ2A 5I0DA 3NNFA 3JXSA 3D5JA 3HQRA 4HOOA 4IEOA 3ZLIA 3WG1A 3OSDA 5DDJ3 4BQ1A 2YGMA 1OC9B 4BPYA 4QQPA 4Y5SA 2BJXA 5LCWL 3MYXA 1AL21 1TG7A 3LFLA 3WW4A 4ZXEA 3VD9A 1UY3A 2AEYA 4Z82A 5A3WA 4KMQA 4RI7A 2FNOA 2CAQA 4JRLA 4KCAA 2BW8A 2JG8B 2GZPA 3H1NA 2HT9A 1DG6A 1Y7BA 4AVVA 4NWWA 2CDPA 4DSSB 2QDNA 1IQDC 4XE9A 4ARXA 4OFNA 2PVQA 2WZR2 2ZBJA 3VZJA 2D3PA 5C5TA 5A4VA 3QMXA 1RUF2 4GXLA 3TKPA 1N3OA 4FCAA 4BVYB 3W20A 3K3OA 3S6PA 5LA0A 2XKPA 2WWSA 2YWNA 5FMOL 3TOTA 2WQ4A 4QQ7A 2ARBA 1G9DA 1SYXA 5FXVA 4Q4V1 4BVYA 1N3PA 1T1VA 3P2AA 3WF0A 4MADA 4DS0A 3UBLA 1D4M1 4B1LA 2R2JA 4R52A 5IW0A 1JOJA 3K51A 3E5UA 1GMMA 4WM8C 1XOBA 2WNVC 5FPAA 4F03A 1AL23 1TK8B 4LOTA 2BUKA 1PVC3 1HLCA 1QMJA 2MEV1 1GFF2 1GSYA 1KITA 1ONAA 3WUDA 3U14A 2A3XA 2HJIA 10GSA 4BIKA 2VZOA 5LRSA 3UVTA 1Y3TA 2IXLA 3JCML 3FMGA 1LOCA 2YPJA 3MUY1 2PLV1 1ENQA 3M3OA 3IR4A 4ZB9A 1OE8A 3T09A 2D6OX 5K4LA 1G7YA 1B09A 5AFEA 3OG2A 4KQ7A 5LD0A 1QDOA 2JECA 5JSPA 2PPTA 1PO11 2GMEA 4MJEA 4IKHA 4Q4X2 5FO9B 4UFJA 3HVXA 4HJMA 1W3XA 5CRWA 2IMFA 3O0VA 5K0UB 2VMHA 4AI3A 1XWKA 4ES8A 3HOBA 5G5EA 5A32A 4Q5FA 4MPFA 2LV3A 4GMP0 4TOPA 4EE2A 4IL7A 4LBLA 1SK1A 2CAIA 4Q4W3 2O89A 4FAGA 1AQWA 2JSYA 2YY1A 3ZMKA 3WYWA 3IE3A 2D6PA 2IFQA 4XJWA 4CCCA 3J7HA 2WNUA 1X9TA 4LUKA 2QQNA 5GALA 1CAWB 3QCWA 1ENXA 2PUKC 4LA3A 1DDLA 4QGMA 1CAWA 5EFUA 2D5HA 3DMLA 3GUSA 1ZA4A 2IC1A 5A3TA 3SITA 3ZDSA 3HD8B 2OPWA 4YGEA 4QGNA 3MDPA 4PDWA 3HT2A 1EV13 4FIWA 1RMU1 3ILFA 2W39A 1CD3G 1UMIA 4GJZA 4KDXA 4XMAA 2GNDA 3DL3A 5JI7A 5T5OA 1MS4A 1OAZA 2VZ1A 1ND3C 2Y33A 5JZGC 3RNSA 3VHOA 1UN1A 1ALYA 1W9YA 1VMHA 4KWUA 2IPAA 3JUUA 4JGYC 4BQ4A 1OKOA 3ZLPA 2YN1A 3FBMA 1ZYNA 2B6MA 3VPQA 1AR61 4XCBA 2HNLA 5IK5A 2O7KA 5E1RA 5GAPD 1F2EA 5DG2A 1LHUA 4KUNA 2AREA 2I74A 4FT8A 3VPTA 1A3KA 4XJ9A 1VP6A 2DJKA 2B7YA 1XPWA 2BBAA 3OCPA 4K8MA 4IEUA 1OKQA 3VBUC 3V56A 1GBGA 1L3JA 2LTNA 4FP3A 1MZEA 4I2UA 5FRAA 4CP9B 1LU2A 4G0LA 3I2HA 4AFCA 1XSQA 3NJYA 4NROA 4DZGA 1L7QA 5I93A 1QH6A 1W6OA 4MV2A 1J3RA 1UL9A 4Q5RA 2VD7A 5FPXA 4R4ZA 1JBCA 3H3LA 1REDA 1G7EA 3DKWA 1A23A 4A44A 2ZOEB 1YHFA 4A5PA 3KJYA 1C8NA 4P9XA 4YGCA 2UYAA 5CRHA 2PMTA 3TRPA 3ZFBA 3PVOA 5D8IA 3O1MA 3DKSA 3J8F1 4ML1A 1H4OA 2QQUA 1X7NA 2JE9A 2QBXA 1S3AA 1LULA 2Q8CA 4XF1A 4DQAA 2BNMA 2CVBA 1AR91 5FWGA 3HNMA 5FZOB 4TWTA 1RB8G 5K7PA 1QDCA 2BJSA 4EN7B 4MHRA 1VBA1 4X6RB 3F3QA 4N7UA 1MZ5A 1COV2 4ACSA 2GH2A 4DRRA 5J09A 5I0UA 3I69A 2Y34A 3LQCA 5T54A 2ZEZA 1ZBE2 2X05A 2DJJA 1W9TA 2GQLA 1K5JA 5CVRA 1GULA 5FIXA 2CA8A 5F5AA 1C8M3 5B6MA 1O6UA 1W0PA 4QDSA 1AAZA 4CP0A 1TTZA 4POLA 3I8TA 1PHMA 3QOUA 4MXVA 4BHPA 4AOCA 5LCZA 2RR13 5IPHA 4KDUA 4GF0A 4MXWA 5AC91 1YEWA 5BMUA 2JKBA 2UZ8A 5FTTC 2EICA 3QOPA 5FK8A 4CUCA 4R9AA 4E4SA 2OVUA 2PA7A 1V57A 2TBVA 1BVP1 4FOYA 2DCTA 4XILA 1YF0A 3EYTA 4LITA 3DIEA 4LA2A 2L4CA 4I0WB 3UKNA 2RLIA 3RMXA 3WDWA 1VBE3 5AVPA 1KBNA 3GH6A 1RHI1 1XNBA 3VBHB 5IT6A 1ND2B 1RUI1 1VRH2 1Y9QA 4H7LA 2PVOC 1VBA3 4IQPA 3T4HB 1TP9A 2O85A 2C26A 3KVBA 3FLRA 3MZHA 2O8VB 3H1WA 4XTSA 1GNZA 3WNNA 5T5PA 1MQTC 4UW4A 1J9BA 4UBHA 1DSBA 4MMMA 4LUMA 3H50A 4YSFA 2GC3A 4NO4A 1S3DA 3MSZA 3RVHA 1RJ7A 2FWEA 4NAMA 4TXVA 3MAKA 2ON7A 5B2GB 4IERA 2XC2A 2XJVA 2VM9A 5J3UA 2M72A 3F0IA 4Z92B 4C8DA 4YZ1A 3OYWA 3T3YA 3AXDA 2J1UA 3RFRA 5ID2A 1LESA 1B9YC 5F2SA 4NWYA 5ANQA 5C8WA 1HQNA 1XXNA 3LEMA 4B29A 4N43A 1LOBA 1VBD3 1C72A 5J5NA 4JQTA 1AYM3 1DFQA 1QF3A 2YMZA 1O3QA 4Q4V2 1SJ6A 3FUQA 4W4ZA 5DZEA 1N8JA 3ACGA 3P8WA 2Z9SA 1HYUA 3I3QA 4FTSA 2NYYA 2G19A 2GC2A 4OHXA 3VB9A 3UV9A 3OD4A 4D8MA 2VZQA 2PBJA 5DCGA 1RUI3 2VZPA 5C6CA 4BISA 1K12A 5A7SA 4Z2UA 1QU0A 4NV5A 5GM0A 4PQ1A 1LAJA 1YI7A 3TJBA 3UIWA 2EAAA 2A7AA 2LKUA 4IBPA 2H1BA 1FNZA 1SHWB 2MEV2 4U36A 5KC5A 1WD4A 1ERVA 5DG1A 1APNA 3F63A 2IXJA 5LBEA 3VBOA 4AAXA 1LHOA 2VMCA 4IW9A 3US3A 2XJPA 1VIWB 4XAEA 2QKDA 5A1LA 2HWC1 1V6MA 5BNQA 1URMA 1PO12 2DTYA 2NPBA 4Y24A 4KH7A 2XKOA 1FVJA 1DYKA 2B7JA 1X9SB 2QQOA 2NM1A 2WZR3 3NV4A 2PYTA 2EC4A 1PMTA 1J0FA 1NCRC 5LNKe 3JB4C 1RUF3 3HBZA 4IEQA 3MDKA 2RJKA 3BOAA 4PIXA 2YBPA 2C3TA 2VJXA 5IPGA 1ZZ9A 3G9BA 2IWGB 1Q56A 3MIXA 1JHBA 1LECA 3M4FA 4MNNA 1ON4A 1RQMA 1YJKA 4XRDA 1FO5A 2C0GA 3GCWA 1CAXA 2RMU1 2CL2A 4J6GA 4PXOA 3ZXLA 3TJKA 1UNBA 3VL8A 3VZNA 1GU3A 2VXJA 4PQHA 2ZGLA 4RA0A 1US3A 4QPGB 2X4AA 1QXHA 1YY7A 3A0KA 1K42A 3USUB 1ULPA 1OE7A 2BBVA 3AP4A 3WDUA 4JBBA 3DRNA 4COZA 4JC1A 3HVSA 2X64A 1BCXA 4HZ4A 1GOFA 3RG0A 5JMCA 1DQ0A 1RMU2 4N0VA 2RM21 3NJZA 2OYZA 1LJ7A 1R091 1LODA 1TEIA 3OJBA 9GSSA 2CNAA 5C4WB 4CUAA 2J9HA 1PNGA 4G0KA 4V2WA 3ZYJB 2HKXA 5IVBA 4RR3B 2LJKA 2JDHA 3GBFA 5JOXA 3J9SA 1SFPA 5C3RA 1BMV2 3HZ8A 1J84A 1OLRA 1ERTA 1CVNA 2R0FA 3POJA 4Q4X3 5C3PA 3CJXA 3ALQA 2V5DA 1B4PA 4BVXA 4RR3A 3GRXA 1AR62 3FR6A 5INYA 1EOGA 1BK1A 3F6DA 2WDBA 4JAAA 1Q5OA 1Z5YE 2ON5A 1SLBA 5JSRA 4MZUA 1YKCA 4CDOA 4JGZB 4W6YA 1POV3 1HRV1 3SMHA 5CA6A 5COHA 2VZ3A 4MZCA 3NOFA 3POSA 1ZA7A 2WNEA 1I9RA 5ISLA 4F0BA 2RVAA 1CONA 1W2TA 2H8LA 1W06A 4OFGA 2AR6A 3H93A 4E8CA 2C6SA 4QKNA 4ZHNA 1EZKA 3HVNA 1RJ8A 1Q3EA 3RPQA 1USBA 3VBSC 3I59B 3BUCA 5JXIA 3KHBA 4EZHA 2VTXJ 1POQA 1GSDA 3M1GA 1EOHA 3F4RA 4O32A 1WZXA 3VBRC 3WNXA 4KI5M 3KT4A 2DU0A 4A7YA 4CEWB 4OUEA 3D21A 4PUFC 1XW6A 5F07A 5F37A 1VAKA 1R7HA 2Y6LA 3IDBB 4G0IA 3DECA 4K7IA 1CWPA 2DF7A 5A1AA 3I2KA 4POBA 1YFXA 3IK7A 3UKTA 4CDXB 1XNAA 3BCWA 2W46A 2FUG2 3W9AA 2CV6A 4KG8A 3EMRA 1UY1A 1AR92 3FHKA 4B8EA 1H2KA 3LDKA 2L6CA 2R061 5IVFA 3AYAA 5LW9A 2JB8A 3FK8A 3AB0A 4L99A 3RAZA 3GJBA 5I8TA 3EQEA 4IW3A 3I7DA 2A71A 1LJRA 5EL8A 3SH5A 4Y22A 2ORZA 5DJMA 3VV1A 5T5JA 4OMVA 4OHVA 2O8QA 1LNSA 3KVAA 3OEBA 2HXKA 1LU4A 4H55A 3RPPA 1KJRA 3DWVA 4Z07A 1FAYA 1C28A 3TJGA 3O0WA 1EUTA 2F6BA 1PX3A 4LE3A 2RV9A 1OH3A 3MUZ1 1O85A 4XF0A 1PL2A 2VQUA 3NNGA 4Y1ZA 5AC92 2HWE1 2CX4A 3ZFGA 2NP0A 1E5RA 2VD1A 2VLTA 5FWEA 5ECPB 2HLSA 4O65A 2QGVA 5C33A 3MW3A 3S30A 5A70A 4CDUB 4CHSA 3WDXA 3ZYPA 3ZKYA 1CJDA 2VOCA 4CCNA 3CTGA 2BNOA