5CYYA

Structure of the c-terminal domains of dipz from mycobacterium tuberculosis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
333
structure length
333
Chain Sequence
TGTEIREQLNLGGIVNAQNAQLSNCSDGAAQLESCGTAPDLKGITGWLNTPGNKPIDLKSLRGKVVLIDFWAYSCINCQRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAKGAANLGISYPIALDNNYATWTNYRNRYWPAEYLIDATGTVRHIKFGEGDYNVTETLVRQLLNDAKPGVKLPQPSSTTTPDLTPRAALTPETYFGVGKVVNYGGGGAYDEGSAVFDYPPSLAANSFALRGRWALDYQGATSDGNDAAIKLNYHAKDVYIVVGGTGTLTVVRDGKPATLPISGPPTTHQVVAGYRLASETLEVRPSKGLQVFSFTYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the ectodomain of the electron transporter Rv2874 from Mycobacterium tuberculosis reveals a thioredoxin-like domain combined with a carbohydrate-binding module.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Membrane protein
molecule keywords Protein DipZ
total genus 91
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF17991 Thioredoxin_10 Thioredoxin like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5cyyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5cyyA01
5AGYA 6GSSA 1Z5YE 2JADA 4PGTA 2XHFA 3HJMA 1GTAA 5IIZA 3KD0A 5DMYA 14GSA 3GSTA 3KZQA 3HVSA 1BJXA 4X1UA 3ZM8A 4IQAA 2HZEA 1Z7PA 1CZVA 1X0RA 5AIXA 1FB6A 4ECBA 4LMWA 3L9VA 4PNFA 5COHA 1S3AA 4CHSA 3ABZA 3GSSA 2GQKA 3F63A 2MBSA 2CDOA 1B48A 2FNOA 5KN2A 3A21A 1G0TA 3F6DA 1TTZA 2YJHA 2I9HA 4O7HA 2BGOA 1TP9A 2C3NA 4ML6A 4A45A 3FZAA 3WSOA 1SD8A 4DSQA 3UOMA 2B5EA 3SBCA 3IDAA 1AC1A 3FRCA 1Z7RA 2N5FA 2VOTA 1X9SB 1UMIA 1GUHA 1W89A 3CMIA 5HR2A 3CBUA 1TI1A 5D96A 2WO1A 3KH9A 3KM6A 3HD5A 3HVXA 2GQLA 1W9TA 3H79A 1J0FA 1K3YA 3WQBA 2BZDA 1T1VA 3F9UA 5DQ0A 3UEMA 2VUPA 3NRUA 5IPGA 4JE1A 5HFIA 5G2ZA 1EP7A 2GT6A 2YZUA 3HYPA 2DJ1A 1AAZA 4TXVA 1XW5A 2I81A 3WEZA 4EF0A 4JKMA 4TW5A 4K1FA 4D0QA 4IQ1A 5KN0A 1UY1A 3DYRA 1OH4A 2A2SA 3NQHA 2O89A 2R5GA 4DEVA 3ZYWA 4D73A 1DSBA 4KSMA 2J1AA 2PPTA 3G7JA 5FT3A 4IHUA 12GSA 2H75A 3VD9A 3OBAA 3EINA 1A2LA 2MMNA 3CSHA 2H8LA 2VZUA 5ECKB 2PU9C 4Z2AA 2ES7A 5EJZB 5DAKB 2JSZA 1GSEA 4HZ2A 2IMIA 1ERVA 4YPJA 1G7OA 1UY0A 2VMCA 4KWUA 2H70A 1O81A 1YEXA 2L9LA 3WGEA 3VWVA 4ZBAA 3HJOA 2B1KA 4F0CA 4MH3A 3A3TA 1K45A 2XONA 2GZPA 1F9MA 2H66A 3GM8A 2VJXA 1PSQA 2OBIA 1DP0A 3FZ4A 4ARYA 2CVKA 1TI3A 2PWJA 5G31A 3LYKA 3P8WA 3DVWA 3LXZA 1A24A 2WZ8A 5B4XA 4MJAA 3GTUB 3H1NA 2BERA 1ERWA 5AIVA 1Q4JA 3LEKA 4HEA2 1FHEA 2QQJA 3GIXA 5HQPA 2V6OA 3FY7A 4W50A 3UESA 3VD7A 3EC3A 4GF0A 1XWCA 4KUNA 3IE3A 2HT9A 5IMAA 3F4RA 1H6YA 1EEJA 2W46A 1YKAA 2PVOC 2RUFA 3UL3A 5KN3A 4POLA 5CP1A 5D9TA 3D22A 2LV3A 1GTUA 17GSA 1J83A 3IAPA 2HI7A 1R7HA 2G2QA 4PQHA 3IDVA 4Q5RA 2EIBA 3K4DA 2H73A 3UARA 4V1Ap 2IMFA 4KI5M 5ECOB 5IOWA 2OACA 5JXHA 2WCIA 5DALB 2YWIA 3H8QA 1RYYA 4DEJA 4YQVA 3R2QA 11GSA 5FHIA 2DDUA 2QKEA 3DYOA 5E4WA 1TU8A 3P6BA 1RK4A 2J1VA 5ECIB 5J5NA 3HJRA 4ISDA 4A3ZA 1ZCPA 2LKUA 3NOFA 1EGRA 1W0NA 4E8DA 1O85A 5B8BA 3W6GA 5G5FA 1JLVA 1ZOFA 1DYOA 4LLRA 3K75B 1BEDA 3K4AA 3GGLA 4DXTA 2GT5A 2L4QA 4WF4A 2Y6JA 1PKZA 1Z9HA 1ERUA 2H1GA 5IMZA 2E33A 2C26A 2CT6A 2IJYA 1KBNA 5F06A 1M9AA 4KDUA 4UOJA 3GURA 2PUKC 1BHGA 1XOBA 4TR1A 3D4MA 2K9FA 3DGQA 2VZ3A 2GZZA 4ZBBA 2M46A 1OAZA 5ECHB 1GMMA 4EKZA 2YJ7A 4MPFA 3ZITA 2H1BA 4ML1A 2L6DA 5JXJA 3N5OA 4MGSA 1V2AA 1KEXA 2VCTA 2VO5A 3RAZA 4FH8A 4TR3A 1O8PA 5L71A 5DDLA 2IMKA 2HSHA 3KCMA 3QD9A 4YQMA 3BBYA 4AAXA 4GSSA 1PX4A 3THCA 2FA4A 2HYXA 20GSA 5IO0A 2IMDA 5A4VA 4FIWA 5J3RA 2VZRA 2VLTA 3HXSA 2ZUPA 5C7GA 5JXGA 3N9JA 2H71A 4BA7A 4A42A 4EO3A 3US3A 2W1WA 3ZRDA 5CRGA 1SKSB 2ORZA 4LKSA 2IN3A 5EIYB 4XS6A 1I9DA 3TJKA 2ID4A 1UYYA 3I6AA 1A0RP 3VDAA 4IW9A 1LBKA 4DXSA 2VLVA 1ACVA 2WGRA 4IUGA 4ZILA 5LA0A 3MBWA 3J7Yk 4MLYA 4JZQA 3EMPA 2C0GA 2VCWA 2Y6LA 2NDOA 1UYZA 4HS1A 4K7IA 4H86A 1MDKA 1XVQA 5IHRA 3L9SA 4RUVA 1T3BA 1OD3A 5IPHA 1MDJA 5DQYA 3KIJA 4MF5A 1EV9A 1T4YA 4ZB9A 5IMCA 1CZSA 2AV4A 1SL1B 4TR1B 5IM9A 3ZIJA 4RQXA 3CRUA 1GH2A 2NPBA 1DBYA 4HDEA 3C1SA 3WNMA 4EXJA 5DJMA 2YZHA 1SL2B 5IFTA 1OF4A 4JHZA 4RYDA 1ZGNA 4QL7A 1FOVA 2C3TA 2JKXA 1JZ2A 1YDKA 3LQ7A 2VZ1A 1GTBA 5HFKA 2WUHA 5ID2B 1AQWA 1GUMA 2M80A 3PUHA 2O8VB 4DUXA 3O6TA 1GOHA 4MADA 1SENA 3EU4A 2LJRA 3W5NA 2YANA 2H74A 2WAAA 1D7PM 1SKWB 2TRXA 2R6KA 1SJIA 4G19A 2K6VA 1JZWA 2J1TA 4GCIA 5HPOA 9GSSA 1NX9A 2GS3A 2KP1A 3UJ1A 1VGLA 1ZYEA 3OR5A 3EU3A 1GSQA 4LQRA 1F4AA 2EIOA 5LA1A 2Y6HA 2IL3A 2H19A 4GRFA 3KH7A 4NAXA 1GU3A 3D3AA 2YWMA 4CU6A 3ACGA 4MA9A 2YCDA 1SK2A 2DMLA 1B4PA 1R64A 1G6WA 4QL9A 4PT6A 2C3QA 3VI7A 2OA7A 4XTSA 1JZ8A 2V72A 3RDWA 3HZ8A 2XPDA 4POKA 2WB9A 1ZYQB 2WDBA 2RLIA 5HR1A 4LA1A 4G10A 3ACIA 3FHAA 3LYPA 3NZNA 1AIUA 2DIZA 1US2A 1XPVA 1CIYA 1PMJX 1OC9A 2N5AA 1TRVA 2H1DA 3VPQA 3LG6A 4MZWA 3MV11 2KD7A 3FKFA 2Y8KA 1ML6A 2EC4A 2K8VA 4F0BA 4NV5A 6GSVA 2VCBA 3IK7A 5JWQB 2HNLA 2F3MA 4HZ4A 1TW9A 4QDQA 4XS4A 4XURA 4K0GA 3GDBA 1N8JA 4YH2A 4PURA 4TXWA 5C71A 2VZSA 5ECSA 2JSYA 7GSSA 2PN8A 3VD4A 4M4RA 2BTOT 4F82A 2V41A 1USBA 1IYHA 3ECQA 3QFAC 1FVKA 1M2DA 3EYPA 1DUGA 1HNCA 2YOIA 4PQQA 3SKVA 3APOA 5IMVA 2X05A 3T2OA 3FR6A 4TR0A 2R2JA 4JRRA 2QQNA 4A4AA 3ZFLA 3ERGA 4EUYA 3QCPA 1A23A 3GX0A 1RQMA 3ZLPA 4NV2A 2I4AA 2DSAA 1E2YA 1O59A 4MZCA 2XOMA 1K3LA 2VTFA 4NHWA 1F2EA 2KOKA 4YAPA 1UZ0A 3EMXA 4CW9A 5DCHA 4PUFC 2LJKA 2GTUA 2AAWA 4ZIJA 2V32A 3DD3A 4J2FA 5ECPB 4V2LA 4OCFA 1XWGA 2HLEA 5HR3A 2VCVA 1YY7A 3IAQA 1JU4A 3EE2A 4XVHA 1I5PA 4MJCA 1XWKA 1QMVA 2LS6A 2IMEA 1X9WB 3T0DA 3GH9A 4N11A 2YC4A 10GSA 2LEGA 1YZXA 4I97A 2RJ2A 2K18A 3M9JA 1S3DA 2LS5A 1WJKA 1PX6A 4CU8A 3GNJA 3DRNA 2LNTA 1R26A 4CU9A 5KEJA 3WNPA 2YN1A 3I69A 2FCHA 1XW6A 2LW8A 3RBTA 1SYRA 2LRCA 1HYUA 3LPFA 3HNYM 3VD3A 2X8CA 4HOJA 1WWJA 1O7UA 4IS0A 2DCKA 1XIYA 1R4WA 1ABAA 2VZTA 4OUEA 4D8MA 2VLUA 2VCQA 4J56E 3ED3A 2H30A 3IC4A 3W8SA 4MGQA 2YP6A 5E59A 4TRXA 3I2GA 2YPMA 2XHNA 3LORA 3KMNA 4BVXA 2CVBA 4HU7A 1K0OA 3TDGA 5B7CA 1OVNA 4KSOA 4IBPA 4XHMA 1W9WA 4KAEA 4BWQA 3LE0A 1JYXA 5ECRB 2W92A 2XPEA 4ECIA 5LCWL 5ECQB 3DEXA 5F07A 3VI5A 3OG2A 5H5QA 3VURA 1ST9A 2M72A 2VD0A 1BYEA 3GN3A 5IQYA 2V1MA 2E7PA 1XNAA 4NPBA 4AF2A 2JZRA 2B7KA 2WJUA 2Y6GA 1PGTA 2GSSA 4OYUA 3DMLA 1XOAA 5B8AA 4CUCA 2L5OA 4GTUA 4QPWA 4ZXEA 1NM3A 2VZPA 3O3TA 2RVAA 2GSQA 1PX3A 2QQOA 5ECMB 1A8LA 2X99A 3CTGA 1R5AA 5HXMA 3GV1A 2JE8A 3ZVJD 1OC8A 4AJ7A 5C04A 3PH9A 3WF0A 2PQSA 1XZOA 3LQCA 4GQFA 1W99A 2C4JA 1TOFA 4JEDA 4GQCA 2J22A 3I3DA 2VM1A 1YKCA 3E3EA 2JZTA 2B9VA 4KA0A 1CQGA 4Q5NA 4OO4A 1YJ6A 3WT2A 1M9BA 2FY6A 4L8EA 2V5DA 1GSFA 2LQOA 4POBA 1XC6A 1JLWA 4O5RA 3W5MA 5CRHA 4F2IA 4PQ1A 1HD2A 2HRFA 2XC2A 2H76A 5CYYA 2VMFA 3T08A 2WQ8A 1WMJA 3LEIA 1S3CA 1P8JA 3GKNA 2WS2A 2MMZA 3EWLA 2Y6KA 2O85A 4FYBA 4WBJA 4GSNA 4EE0A 3BOAA 3BN6A 3ZZXA 4E8CA 3EB7A 2J7MA 3V1WA 1CX1A 5GSTA 3TKSC 3TRXA 3A5WA 4KGIA 1VF2A 1UN2A 2LQQA 4IELA 1WCQA 1GP1A 4XIHA 3ETPA 3AC0A 4DVCA 2HRNA 1OC3A 4QX3A 1MPXA 3SEEA 1EUUA 3E0UA 1PRXA 3HHVA 2H01A 2VR4A 1K0CA 1OT5A 3Q19A 3MO4A 1F4HA 3ISOA 1THXA 2CQ9A 3M3MA 2TRCP 2H0HA 4DXRA 1GWCA 5D9VA 3CTFA 1JI6A 5J41A 3K46A 2H6YA 1LNSA 3WD6A 2V2GA 4BPYA 4XUQA 1US3A 1M7TA 1O8SA 3L0HA 5CRWA 3WNNA 2DC5A 1TRWA 2AB6A 4OMCA 4BWSA 5IYYA 1U87A 5H5RA 1T8EB 1G6YA 3D0ZA 4X0XA 4HU9A 4MABA 1HQOA 4F9ZA 2FWEA 3KP8A 3KEBA 5LNKe 1PD21 3Q74A 3I2KA 3P1IA 3HDCA 1DLCA 3PR8A 3BCKA 1OC9B 2MBTA 1QUWA 1K12A 1V57A 3UVTA 1OE7A 2FLSA 3I3BA 3DKSA 3HEIA 1ON4A 4JKKA 2IIYA 5JUVA 4YAVA 1TKDB 2H72A 2VCXA 1YF1A 3WYWA 3RHCA 3A2VA 1JZ5A 3TJGA 3KXOA 4BL7A 4GWJA 4FYUA 2JL4A 1SK0A 1K0BA 4N10A 3WNLA 1GSDA 1YF0A 1VF3A 2P5QA 4BK5A 1DE2A 1GNEA 2H1AA 2MZCA 2VL3A 4E8HA 5DN2A 1JZOA 2W1UA 4NWYA 5LA2A 3TRPA 3KTLA 2Z4FA 2LSTA 3G9BA 2E2GA 2VL2C 2L4CA 3MV01 1M2AA 3D4TA 1K42A 3UNPA 2Y64A 5G1KA 3C7MA 1SK1A 3CSIA 3TJBA 4MF6A 3M9KA 3G7YA 3IPZA 3ZMKA 4MK3A 4MJBA 2XQXA 5D9WA 4CVUA 3P2AA 3WGXA 2R3XA 1GLQA 3ZIVA 1IQDC 1EUTA 1T2XA 2FHEA 4OWYA 3FEUA 1SG3A 4KE3A 5DAKA 2QQMA 1K0MA 3EURA 4WXTA 4TTGA 1PA3A 2C0FA 2FWHA 1RW1A 4POMA 4XS4B 3LEFA 3KTBA 2VZQA 3TB2A 4BK4A 4D73B 1QK8A 4P3YB 3CZUA 4AJ6A 4QAWA 3LPGA 1FAAA 4WR5A 5IMDA 2WDUA 3HA9A 4L5LA 3DIEA 4ZL7A 5JCWA 1NHOA 4DUWA 5D73A 1NW2A 2E0QA 3ZL5A 1XW9A 1TRUA 3MWHA 3QMXA 5EPFA 4P08A 2HZEB 3QAVA 4PX1A 1T4ZA 4IP6A 2O87A 2B3SA 4RN5A 3OB8A 2ZEWA 4OMVA 5JWOB 3I2IA 5C00A 1VRSD 3HN3A 3TJJA 3DYMA 2C0DA 3GHAA 1TDIA 2PERA 2CDPA 3J7Yb 1B4QA 2DCJA 1EEMA 2F9SA 4OCEA 5J9BA 3QAWA 2PMTA 5D93A 2JACA 3KGKA 2CZ2A 2W47A 2MYGA 3CKHA 1BAYA 2X8HA 2C9KA 3L9UA 2L59A 1FVJA 3HPNA 1OE8A 4TR4A 1LJRA 2L57A 1CQHA 4MF7A 3ZREA 4Q5QA 3L78A 4WBRD 1QQ2A 3I9V2 4HJ2A 2QBXA 4LL1B 2GSTA 2J1UA 1TXXA 3EYTA 3FL7A 4CDOA 2WFCA 3LSZA 4KMQA 2X09A 1UYXA 1OKDA 4EDYA 3ME7A 3OGSA 4DSSB 1NUKA 3F4SA 4FYCA 2NVLA 4OMDA 5F05A 1EZKA 2HFDA 3I2JA 2A4VA 3GFKA 1PL1A 3APSA 1H75A 4ZXGA 2QQLA 2VMEA 3TKRA 2VIMA 2JZSA 1C72A 2L5LA 3D21A 1N2AA 3HNMA 3T0AA 2VOCA 3I2FA 5EVOA 2WZEA 3IAM2 2W9XA 4A6OA 2VD1A 3QPMA 4RI6A 2WN3A 3ACHA 5DQSA 4K7OA 4FI9A 3TCOA 2ZCTA 2O7KA 5H5SA 4XRDA 2DLXA 3IBHA 5CZKA 4K9ZA 1X5EA 2JU5A 3WT1A 2VM9A 4BJ0A 1Y6EA 5ECNB 2E32A 2WABA 3RPPA 2X10A 1W8OA 2LUSA 1TG7A 2WN2A 1UC7A 4N0ZA 2VZVA 1ULOA 3GUSA 3GXUA 2B6MA 2WO3A 3QFBC 4K0NA 1A2JA 1SJ6A 2GVPA 4TOPA 1FO5A 4MH2A 1T7PB 4K2DA 2WO2A 4QB6A 1F3AA 1NSWA 5AISA 1K0NA 2WULA 3G7IA 3CRTA 3TOUA 3U5RE 3ERFA 3C7GA 2WAOA 3TKSE 1GUKA 3F3RA 3WF4A 2YWOA 3K8NA 1UY4A 3C7OA 3K4ZA 4LHSA 1GSSA 4IGJA 3VDBA 1F37A 2IWTA 3IHQA 3HJPA 2QQIA 4WETA 5J9CA 3UBLA 1KGYA 1W4VA 3FK8A 4WR4A 3VD5A 2BMXA 3IXRA 2CV4A 4KCAA 5F0GA 1WKYA 4TXOA 2VCAA 3BJ5A 3Q6OA 4J57E 1WP0A 3QDNA 3CXGA 2ZNMA 3T09A 2LRTA 1F3BA 1MEKA 4OFMA 5ABRA 3GYKA 3OGRA 3VWXA 2YWNA 3KJYA 3VWUA 4EVMA 1V98A 3QOUA 2G0FA 2RV9A 1TK0B 4KNDA 3SEPA 5I0DA 1F6MC 3JCML 3RPNA 4G2EA 2L6CA 4MPGA 2HE3A 2W91A 1V58A 3I2HA 2DJJA 3GA4A 1ZMAA 1H6XA 1OKTA 1SHWB 1IYIA 4AG4A 4IJIA 1ZL9A 4GWIA 2H0GA 2B5XA 3GKXA 1GUIA 3TKPA 2F8AA 2I3YA 3CSJA 3FW2A 1A2MA 1JZDA 4KW6A 4EC0A 4LL4B 2FUG2 4W8JA 5A4WA 1XVWA 3KMOA 3I43A 4QX2A 5LCZA 1TU7A 1UWWA 1XWAA 3HVVA 3A7QA 1NKGA 1W9SA 2ZEZA 5KN1A 3TUEA 2E2MA 1GNYA 3TKQA 5G1LA 3ZTLA 1XPWA 4HJMA 2BBAA 4I5QA 2FA8A 1SD9A 1BG5A 4L5OA 2OKAA 4L0WA 4PUAA 1GSYA 1Q98A 4RQRA 1PMHX 1GRXA 4QX0A 1UY3A 1KTEA 3VWWA 3PGTA 1L7QA 4GZ9A 1M99A 1YEPA 4MDCA 4MOAA 2YV9A 3LGCA 3SWLA 1J9BA 5CNWA 3DXBA 2J1RA 1X5DA 1B8XA 3IRAA 3PUIA 4N0VA 4E8EA 1QGVA 2P31A 1ZZYA 2CA8A 3NJXA 4MP4A 3VLNA 3F2ZA 3A22A 1ERTA 2WZ9A 5CO3A 2QQKA 3GKKA 3VFIA 1J84A 4HG6B 1GOFA 5JCUA 3FN9A 6GSYA 5GAND 1X9MB 3F6FA 2BGPA 2YFUA 2P5RA 3HZ4A 4OD7A 1TRSA 3J7HA 2E31A 1V40A 4JKLA 1UXZA 3BCIA 4V2NA 1W8NA 3C73A 2VCCA 1K3OA 1M2BA 3T2QA 3FYGA 2WBKA 4X43A 2HLSA 5DJLA 1PL2A 1UMHA 1AXDA 4CUBA 4K7NA 5ID2A 1XNTA 1FG4A 5JR2A 4QDRA 1SKRB 1YQ1A 2X8GA 4XUOA 2B1LA 2VZOA 2FWFA 3DVXA 1U3AA 1SU9A 4WKWA 1GQPA 3TRQA 2QSIA 4BDVB 1MDIA 1T00A 2GDRA 5INYA 1NHYA 5GSSA 6GSXA 18GSA 4ULXA 1BX9A 5G30A 5CAXA 2AUVA 2XBIA 1SJZA 2HSYA 3GL5A 1K0AA 2VL4A 2E26A 3QR6A 1B9XC 3C8EA 1SYXA 3GH6A 3HOBA 4ZBDA 3O76A 2N5BA 1THOA 1CZTA 4WF5A 5IJRA 2OE0A 1U88A 3H4KA 3OEBA 3GTUA 5JXIA 2W5FA 1KEBA 1VF4A 3UVHA 2KHPA 1XBSA 4ACSA 3ME8A 2VO4A 3WF3A 4P02B 2BJXA 4TXOB 2C8UA 3MUZ1 2OE3A 4OO5A 2B7JA 4M4PA 1UXXX 3WNOA 5EL8A 3JXSA 4HQZA 5GZZB 3TKSA 5ELAA 3LWAA 1TJDA 3DECA 3C7EA 4ZZ5A 1ILOA 5DPNA 3EVIA 1WRYA 3M1GA 3CZJA 1JFUA 2IFQB 5G5EA 1GL8A 5CREA 2CX3A 1O8XA 3HKRA 3A23A 3FHQA 3U37A 1TVGA 1JU3A 2RUEA 3E9JB 4DUVA 2RM5A 2X64A 2AJQB 2H6ZA 3UETA 1LU4A 3GL3A 2W87A 3NJVA 4I6XA 2XBQA 3CQOA 1GSUA 2B5YA 3HY2A 5G04L 2J9HA 4ZB6A 4PNGA 3FZ5A 1WE0A 2EIEA 2VL2A 2LTKA 3OGVA 3FR3A 3TGZA 1EOHA 4QB1A 1Z6NA 2EIQA 3SKJE 2MMAA 3LEGA 4IVFA 3C8XA 8GSSA 4EL1A 3PINA 4XZUG 2ON7A 3CMGA 2GGTA 3VDCA 4V2MA 4A44A 19GSA 2W3JA 2CZ3A 1JZRA 4TVEA 1JZ6A 5JCGA 4LPLA 2W95A 3I3EA 4DSRA 4PQIA 1HNBA 4KDYA 2VAFA 4GLTA 2CAQA 1J08A 1EOGA 6GSWA 5F8BA 3E1F1 4DEQA 2FD3A 1AUCA 4IKHA 1PN9A 4L0PA 3WF2A 3IK9A 5JWRB 1DE1A 5A1AA 5J1XA 5F7UA 2KLXA 2C1YA 1FB0A 3FHKA 1XFLA 3F4TA 1XWBA 3A2WA 5B4NA 3MDKA 2PBJA 4UAPA 1X5CA 1ULPA 5IFPA 4P5YA 5DCGA 3MNGA 1PQNA 2H0IA 3IAS2 2VMDA 4KCEA 4N30A 2W1SA 4V1Ag 2KUCA 6GSTA 2HXKA 4ARXA 2VL9A 3M8NA 5D9XA 1E6BA 3IOSA 3MSZA 2LNSA 2B4KA 4MJEA 5D8IA 1GTIA 1YQ2A 4ZZ8A 4XCSA 4XUNA 3C71A 4OZOA 2PGTA 1JYVA 1JYWA 3F8UA 1B9YC 2RIIA 4RI7A 1OF3A 1EP8A 1QFNA 1BQ7A 2DJ0A 16GSA 4KX4A 4EDZA 4A41A 1JYNA 4ID0A 1SDDB 3IA1A 1OYJA 2J1EA 1V9WA 1WIKA 1AW9A 4HI7A 4ILFA 1Z6MA 3ZVJA 4BVYA 1A8YA 2RM6A 13GSA 2GLRA 1U6TA 4QQ7A 1JHBA 3U6VA 2FWGA 3GRXA 4FO5A 3RHBA 4AGSA 3HCZA 3CYNA 1NAEA 2K8SA 2VQTA 3FZ9A 3Q18A 2FGXA 5ECLB 2YFZA 4ET7A 1Z3EA 1QXHA 1HNAA 2R4VA 2R37A 4KDXA 1EV4A 2J1SA 2DIYA 2YNXA 3T0BA 4NXIA 4XS1A 2DMMA 3D6IA 1GLPA 5DALA 3AY8A 4XRAA 2V4VA 3P90A 1Y25A 2DJKA 5LD0A 4ZL8A 1K0DA 2P0GA 1HN1A 3CDZB 3L4NA 1EGOA 2J23A 4O32A 2ZEYA 4UI9L 5EJ1B 1MD4A 4JR6A 3ZMLA 2D2ZA 5CRDA 1WPIA 4K6XA 2R7EB 3F3QA 3VPTA 4OFTA 2OE1A 2DJ2A 2VM2A 2QC7A 4AJ8A 6GSUA 2CAIA 1U3IA 4G9HA 2IFQA 4L0UA 3IIIA 3H93A 2EICA 2ORXA 4OFNA 4KH7A 2GQMA 1AQVA 2F8FA 4WEYA 3C7HA 2LJAA 4MZBA 5C70A 2ZEXA 2QGVA 2YG0A 3MUY1 3ZFBA 2JDAA 3NNGA 2ON5A 5EY6A 1UVZA 2CX4A 4ECCA 5FUIA 1GNWA 1K3IA 4TKYA 1AQXA 2YC2A 5HFGA 1PMTA 4PF1A 3IR4A 1L7RA 1O8WA 3ERWA 4K8MA 4YQUA 2OADA 4JBBA 3T2PA 1URMA 4GXZA 4JX0A 2GSRA 3NIVA 4QB2A 4QDSA 2DJ3A 3UBKA 4MCUA 5FWGA 4O92A 3K77A 4TN8A 2JD9A 4XUTA 2GZYA 2OKXA 3UIWA 2PVQA 4CUAA 5JMOA 3ACFA 1UY2A 1MTCA 2EIRA 4KB3A 3LJRA 2A2RA 4XUPA 5IMFA 5ENUA 2H6XA 1SL0B 5AN1A 2W1QA 4ZL9A 2W94A 1A0FA 3C1RA 1H4OA 3FR9A 5G05L 2Z9SA 1UA5A 4QX1A 5J4UA 5DBQA 4GWRA 3VK9A 1FW1A 2F51A 5B6MA 5GAPD 4IP1A 4P00B 3BGAA 2VC9A 4JR4A 1M0UA 1PKWA 4Q5FA 2OBKA 4BXSV 4LMVA 3C7FA 4I2TA 1MD3A 3CIHA 1KNGA 3S9FA 4DSSA 3THDA 5B6NA 4HQSA 3D5JA 3WNKA 4NMUA 3GKMA 3QAGA 3GX8A 1GULA 1EWXA 3MAKA 3WF1A 1JZ3A 2WYSA 3IV4A 1GOGA 5IOXA 5A4UA 2ZXQA 1JZ7A 4Z7XA 4HUAA 22GSA 3TJFA 4IJ3A 2VQUA 2AYTA 2AHEA 3TOTA 3HNBM 1O73A 4W4ZA 3WGDA 2C80A 4MMMA 3W8JA 2C0EA 3LFLA 3A2XA 5ELGA 4I8BA 2HZFA 1VF1A 2YB7A 4GSTA 3DYPA 2YV7A 3GMFA 1JHJA 1JZ4A 4MO3M 5HR0A 1WOUA 5DVBA 3F0IA 3DWVA 1R5PA 2C4XA 1O6JA 2KP2A 3LXTA 2CVDA 3M0FA 2NBSA 3P7XA 2LRNA 3OEAA 5A5KA 1G7EA 1UX7A 5IO2A 2V6KA 3UMAA 4ZY9A 1XXUA 3IB3A 4ECJA 4PXOA 4ZB8A 4F03A 4NHZA 2NTOA 1TK5B 2EIDA 1XCCA 3UAPA 4CU7A 3APQA 3I97A 3BD2A 4JU5A 2DBCA 1TK8B 4I2UA 2VCZA 3KP9A 2WRTA 1I5GA 2TIRA 2OJLA 2ALBA 2I1UA 1PX7A 2IPAA 4IN0A 2MMOA 2REMA
chains in the Genus database with same CATH superfamily
1Y9GA 6GSSA 2JADA 2XHFA 1GTAA 5F5CA 3BYWA 4X1UA 3ZM8A 4ES8A 3I3MA 4PNFA 5COHA 1IS6A 3ABZA 3KT4A 5GZCA 3GSSA 1KQRA 5A1LA 4K2XA 1HV0A 2CDOA 3D4KA 3TN92 5FPXA 2I07B 1SFYA 3SCHA 2RM22 3LIGA 2HEYF 3AMNA 4DSQA 2BP6A 4AI1A 4DZGA 2B5EA 3SBCA 4ISQA 1Z7RA 2VOTA 4Q0QA 1GUHA 3CMIA 5HR2A 1AR81 5D96A 5KXCA 1N3OA 3KH9A 3KM6A 1WCSA 2ZX4A 4E2GA 4C0BA 2GQLA 3DF0A 4N9HA 1J0FA 1K3YA 3WQBA 1T1VA 5DQ0A 3DN7A 2X8KA 4Q5OA 4LIUA 2BTVC 5CADA 1PZ8A 2GC3A 4AFDA 4KU8A 1K5MA 1J3PA 1AAZA 4JQRA 4FOYA 1OD5A 4TXVA 1XW5A 3ME2A 3WEZA 4K1FA 4IQ1A 1UY1A 1ZX5A 5EYXA 3NQHA 5LBFA 5FP9A 4D73A 2H6BA 1VBD3 3V0AA 1AYM3 2XLGA 2VZUA 3MHZA 1S0IA 4Z2AA 2JSZA 4HZ2A 1RUNA 2H70A 4FXGB 5LZ6A 3HJOA 5FMBA 2XONA 1Y9MA 3MI8A 2VNVA 3ZFFC 2VJXA 1OC1A 4CEWB 4ARYA 1KJRA 2PWJA 2GNDA 4S2HA 3DUIA 3LYKA 3P8WA 5G31A 2GNTA 3DVWA 5CBLA 5B4XA 2QFEA 2ZA9A 1WCKA 2YY1A 4CCCA 2BVVA 2V6OA 2BQPA 5A7WA 3DV8A 4AEDC 1XWCA 3R4UA 1ONAA 1EEJA 3UL3A 3OOXA 1SBFA 3MPPG 2HI7A 1WLCA 1OPMA 2G2QA 3B3QE 1I6XA 3ZXLA 4BA6A 1C8M2 3UARA 4QHOA 4RR3C 5JXHA 2WCIA 5DALB 2Y38A 4DEJA 4YQVA 4G4FA 1RUH3 4HONA 5E4WA 2PHWA 2HWD2 3ZMNA 5J5NA 3HJRA 1BMV1 4A3ZA 2RMU3 4ORFA 1CD3G 4YKGA 5JI9A 3AL6A 3W6GA 3WQ7A 1QH6A 4MXWA 1DYOA 3HIFA 3K4AA 2WFF3 4DXTA 1CPMA 5FZAA 3ELNA 1Z9HA 5IMZA 2ADEA 2IJYA 5IWFA 1D4M3 4LHKA 4XAEA 1ZRRA 2RS31 1RUG3 1M9AA 4UOJA 4YFWA 2PUKC 4Q1PA 1WCDJ 3WP3A 2VE1A 1Q56A 4FXKB 1LRHA 4Q26A 2YJ7A 4MPFA 1ZBA1 4OLLA 3ZITA 2P3IA 4ML1A 2L6DA 3N7MA 4MGSA 2VCTA 5I0UA 4FH8A 3WLUA 1O8PA 1CJDA 1G8WA 2HSHA 2IMKA 2XWJB 4AAXA 3U14A 2HYXA 2IMDA 3BCWA 2VZRA 2F4PA 5A3UA 2XKPA 1OQDA 3N9JA 3RZGA 3ZRDA 4EN9B 2ORZA 4LKSA 2IN3A 4PDWB 3OBTA 3VDAA 2VLVA 3POEA 3NMBA 4IUGA 4Z82A 1W2AX 3KB5A 2RR13 4IEWA 4JZQA 4NRPA 2VCWA 4MGIE 4K7IA 2JDHA 3PUSA 4RUVA 1T3BA 1OD3A 2HRAA 5IPHA 4ZB9A 1CZSA 5L19A 4FPOB 3WNXA 2QQVA 5IM9A 4PI0A 2NPBA 1C8M3 4JDOA 1HB3A 4AI9A 3MDPA 4RYDA 4QL7A 4DINB 3N36A 2C3TA 1YEWA 4BLJA 1QMJA 1GTBA 5D8AC 3VZLA 1GUMA 5FMOL 2O8VB 3ZN6A 4QKBA 1SENA 4MGYE 1CPNA 1XSRA 2YANA 1RUF3 4YW7A 5A32B 1U5IA 4FQZA 4QM8A 3OBZA 2YPJA 4AI8A 4I0AA 2KP1A 1PK6A 1W6MB 2K2SA 4A2UA 1GSQA 3AKRA 1ZRCA 2EIOA 4Q0PA 4QU2A 1HB4A 2H19A 3FX3A 3MLLA 4NAXA 3B01A 2GMEA 4DY5A 5HV4A 1SK2A 1B4PA 1DQ2A 4JQTA 1G6WA 4RQPA 3VI7A 2OA7A 2GH8A 4XTSA 2XPDA 1STMA 4POKA 2NPIA 1BVP1 1NXMA 1EAH2 2W08A 4G10A 2VGDA 3LYPA 3FHAA 2DTWA 4M0HA 4S2FA 4LIVA 1RHI1 1S0JA 3VHPA 3ZSEA 2KD7A 3M8LA 4NV5A 1G7YA 5EQUA 2ZAAA 1WMFA 5L9BA 3TEYA 1QOSA 1TW9A 4QDQA 4MXVA 4CPBA 3GDBA 4PURA 1V6IA 2DYCA 4TXWA 1F2NA 4Y5TA 4M4RA 2BTOT 2OZJA 4UT5A 2HYKA 3JBG1 1GKBA 1VE0A 1IYHA 3EYPA 2YMZA 1DUGA 1HNCA 5IMVA 4Y1YA 2X05A 3T2OA 4TR0A 2BVBA 4R4XA 4JRRA 1W8HA 2WZPP 3ZFLA 3GX0A 5AVAA 4GKXA 1WGPA 1I5ZA 3ZLPA 2DSAA 2IXKA 1RL3A 2KOKA 1UZ0A 5C3PA 2BRTA 1G86A 3DD3A 4V2LA 4ZU4A 2P17A 1POV3 2YC4A 1REDA 1YZXA 4K5RA 3M9JA 1S3DA 2XJPA 1QU0A 3BOWA 1PX6A 1PO13 2LNTA 1R26A 3WNPA 2LW8A 1BBT3 2LRCA 1J1LA 2ZX0A 1VMJA 3AVSA 4HLTA 2JKBA 3ZFFA 1AJKA 3VGIA 1XIYA 4CDUA 1R4WA 4QKNA 4Y20B 1O5LA 2G1MA 2VLUA 2VCQA 3AYCA 3ED3A 4KGGA 4FTEA 2ZACA 1O4ZA 5FMOS 4N9IA 2YU2A 4TRXA 2YPMA 2XHNA 1A78A 3KMNA 4KGQA 1WW6A 2CVBA 4CP9A 4KSOA 4XHMA 1W9WA 3LE0A 2W92A 3HAGA 5DDJ1 2XPEA 5LCWL 3DEXA 5EFUA 5F07A 3VI5A 1DYPA 1W6OB 1BCXA 2EXHA 1ST9A 4AEJA 1DQ4A 2VD0A 3GN3A 5IQYA 1XNAA 4NPBA 1KRIA 2JZRA 2Y6GA 2Q0AA 4OYUA 3TEZA 2D6LX 1AR73 3WG4A 4XDOA 2VULA 3CLPA 1NM3A 1YJKA 4GULA 1JOJA 3S6PA 4AGRA 2X99A 4LBOA 2R1DA 5HXMA 1E5IA 3GV1A 3ZVJD 5H9PA 2PQSA 1XZOA 3LQCA 1JN2P 1DYKA 2FDKA 3KVBA 1HKDA 2VM1A 3JBG3 1ZRDA 1YKCA 3E3EA 5HV0A 4KA0A 3WT2A 4QM9A 2V5DA 2FZ1A 1GSFA 2LQOA 1XC6A 3VL9A 1JLWA 5CRHA 2QVSB 4PQ1A 2HRFA 4YG3A 5DG2A 1QJU3 2WQ8A 3LEIA 1PIV3 2Y26A 2WS2A 2MMZA 2Y6KA 1WA4A 4Y4YA 5J96B 4EE0A 1N1TA 3BN6A 3ZZXA 4MH0E 2E7AA 4YVSA 3A5WA 3ZOIA 2G9ZA 1UN2A 1V6JA 1IGOA 4FTBA 2DUOA 1WCQA 3WW2A 2VUDA 3ASIA 3NKTA 1W8ZA 4QD2A 4AE2A 4L99A 3K3OA 2XJQA 4LE4A 5SV8A 1OC3A 1HW5A 4BISA 1MPXA 4M3CA 1EUUA 3E0UA 4N7UA 2AEZA 1XE7A 1OT5A 3ISOA 2CQ9A 3M3MA 1PFOA 5C4WA 2JXAA 1LNSA 3Q8CA 1KFUL 4QQOA 3BPSA 4BPYA 1V00A 1US3A 1YI7A 4ASKA 1M7TA 1JUHA 3B02A 5CRWA 3WNNA 4BWSA 4WM7A 4TYSA 1W8TA 4HU9A 3FBMA 2FWEA 1PO23 3KEBA 3DKWA 3A4UA 1SLBA 4IEQA 1JBCA 2ZGTA 3PURA 4UW4A 2IXCA 4I09A 5IAXA 1O3TA 1D0GA 3HQRA 3RWKX 2QA2A 3IPVB 1OC9B 2QZ3A 3UKNA 3KT1A 3WQ0A 1OE7A 4IXLA 1EPZA 1DGLA 1S0CA 1AX0A 2YU1A 2IIYA 5JUVA 1TKDB 2WSUA 1AJOA 3QACA 5IK7A 4FYUA 1ACCA 2ERFA 2PHLA 1K0BA 2RR11 1VF3A 4P5HA 3KLSA 5FWJA 3TRPA 1PZ9A 2E2GA 2L4CA 3UNPA 3WXPA 1SK1A 3G7YA 1JYCA 4MK3A 4MJBA 4Z2WA 1OFNA 2XQXA 1BQPA 2WO7A 4CVUA 4L8QA 2R3XA 3WV6A 1EUTA 4Q4V2 3LB9A 3FEUA 1SG3A 4KE3A 5DAKA 5APAA 4BQWA 1X33A 2FWHA 3B9IA 1RW1A 3IMNA 3KTBA 2LUWA 3TB2A 4BK4A 1YFUA 2IWGB 4H3WA 4OQ8A 4CUGA 3HA9A 5JCWA 1NHOA 2E0QA 4GJZA 3ZL5A 2ZCWA 1TRUA 2X53S 3RZZA 2QE3A 1FNYA 3OB8A 1WBLA 2D3RA 5LWBA 3ZSKA 4UW6A 3TYJA 5I0SA 3GHAA 1XYOA 3J7Yb 2WNVC 4OCEA 1KDKA 4HZFA 5D93A 2JACA 1RUD2 2RMU1 5GZDA 1FMD1 2L59A 2LM3A 2R072 2ZX3A 1RJ8A 3ZREA 4Q5QA 3WT3A 1QQ2A 4ISRA 4LL1B 2ADDA 2JJ6A 1UYXA 3ME7A 3OGSA 4FYCA 5LK5A 4OMDA 4LLFA 5D2AA 2NVLA 2Q30A 2NP0A 1EZKA 2Q5TA 2B45X 3NJYA 1LULA 4J1XA 2D6PA 1PL1A 1R1A1 3OD0A 3APSA 1UPIA 3TKRA 2VIMA 3O1RA 3S5QA 2LROA 1BLZA 3T0AA 4O61A 2VOCA 1WCUA 3IAM2 2Y33A 4OQ9A 2VD1A 4RI6A 2XDVA 5DQSA 3ILNA 2ZCTA 2DLXA 5CZKA 4K9ZA 1X5EA 4BJ0A 1Y6EA 4B7KA 2HWE1 3RPPA 1UKRA 2LUSA 1TG7A 3KS7A 4RGKA 3O0XA 3GUSA 3GXUA 3QFBC 1SJ6A 3U4SA 4BQ1A 2FQPA 2GP3A 1V6KA 3M2MA 1FO5A 1RXFA 3VBHA 5A3NA 1K0NA 3NJZA 3WINE 3C7GA 5AC92 2WAOA 1J1TA 3K8NA 4FOVA 3K4ZA 3VDBA 1F37A 4U2AA 5J9CA 2DVAA 1AZDA 2D98A 3GBGA 3KV5A 2CV4A 5F1RA 3N3HA 1WKYA 4CA9A 1LGNA 3BJ5A 2EA7A 1ZNPA 4XFIA 4XMIA 5FXWA 1F3BA 4OFMA 3LKJA 1CAVB 3VWXA 4HSCX 4XQ4A 4OCTA 2YWNA 3R3EA 3VWUA 1VB2A 1TK0B 4KNDA 5BNPB 3HQXA 1F6MC 1AR93 3I2HA 1H6XA 1SPPB 1OKTA 1SHWB 1L3JA 3KV9A 5FZOA 3ZYFA 3AYDA 2HWB3 1MVQA 2I3YA 4FPHA 4KW6A 3CJIA 1K5MC 4N53A 2WT2A 2XQRA 1NCQC 4PIYA 3I43A 1TU7A 1UWWA 3LA3A 3HVVA 3A7QA 1RUD1 2E2MA 5C3OA 1GNYA 2BBAA 2XJVA 3ZFGB 2W52A 4IV1A 3FUOA 1S1AA 5LEJA 5FZ7A 4SBVA 3VWWA 1D4VB 3S7IA 3BU7A 3MIFA 4MDCA 4MOAA 4XJWA 5CNWA 2J1RA 1X5DA 3IRAA 3PUIA 1FPN2 1NLRA 2CGPA 4N0VA 1DQ0A 1QGVA 1U5ZA 4LO8A 1ZZYA 5F3EA 4RD7A 4BZ4A 4MP4A 3VLNA 4QX5A 4MUVA 1R082 4OHVA 5EZWA 2SBAA 1J84A 1OLRA 2Q8DA 4AHYA 1MS3A 2O8OA 1W6MA 4NHKA 3H0OA 4TN7A 4DRVA 3BTYA 3JD71 1UXZA 3BCIA 4V2NA 1W8NA 2YDEA 2Z79A 1NLQA 1V70A 4QPYA 2GP5A 1RMU3 2VCCA 2E7TA 4OVEA 3T2QA 5H9QA 1UMHA 4CUBA 5JLVA 4XF9A 1H1MA 3V65A 2TBVA 2CWSA 1RUE1 3DVXA 1U3AA 2JG9A 4MSVA 3AX4A 2GDRA 2O8QA 3ZX7A 5GSSA 4ULXA 1AX2A 3PVEA 5G30A 4WM8B 2XBIA 4BH9A 3OYWA 4NIGA 3GL5A 1B9XC 1JH5A 2N5BA 1THOA 1LOCA 1I1EA 2VQ0A 1CAVA 1MS4A 2BWAA 4M3CF 1U88A 4GMP3 4AK3A 1KEBA 3KQ4B 2VO4A 3WF3A 2GDFA 1BEV2 2V4AA 3VDDC 1D0HA 2BFUL 3WNOA 3TKSA 2AENA 1BK0A 3H3LA 1TJDA 3OSDA 1O4TA 2BEOA 3C7EA 4ZZ5A 3AYAA 3CZJA 4LNVA 4EWAA 4G0LA 3IDCB 2R0HA 2BOJA 4Q8KA 2R041 1JU3A 2RUEA 2RM5A 2R071 2H6ZA 3NJVA 4EN0A 3URFA 1GSUA 2B5YA 1PNFA 4YKFA 3FR3A 5C4WB 3CJXA 1Z6NA 4EL1A 2PLV3 2ON7A 5F5QA 4A44A 1ND3B 5GKAC 5DAPA 2WC2A 1COV2 1JZRA 1F31A 2HEVF 3ZYGA 3ZKYA 5JCGA 2W95A 5LBEA 4EWDA 3DXUA 2P34A 3LAGA 2CAQA 1ALYA 4E2SA 6GSWA 3FJSA 4S2DA 1E5HA 1ULEA 5FYMA 2E6VA 4MNNA 4LEJA 4YVSB 4YGDA 2C1YA 4JC1A 5CKMA 4AZZA 4LBQA 1XFLA 3F4TA 1LHOA 4JV4A 5FJKA 1X5CA 1ULPA 1ZYBA 5IFPA 1PO12 4AI3A 4MGKE 1IKPA 2W1SA 5FZKA 2PHDA 3Q8EA 2WA3A 2VNOA 4ARXA 5ANNA 1E6BA 3IOSA 2PLV1 4XCSA 4XUNA 3C71A 3IM0A 2ATFA 4OZOA 2PGTA 3UK9A 3OUIA 4RI7A 1ZBE1 2PXJA 4CYDA 5CKNA 1GWKA 2DJ0A 4QXBA 5FLHA 4GALA 4A41A 3VDDB 5ACA1 1JYNA 1OYJA 2J1EA 1WIKA 1PVXA 3ZVJA 5A1FA 4BVYA 1A8YA 2RM6A 5J37A 2R0GA 13GSA 1QJZA 1U6TA 1FNZA 5I0RA 4QQ7A 5AFBA 1QIQA 2XJRA 3CYNA 1NAEA 3FZ9A 2YFZA 3TOJA 3H1MA 2R4VA 4RA0A 4Z2UA 1F5FA 2YNXA 2XUMA 3T0BA 5T54A 3USUA 2V4VA 3O1TA 1M3JA 2DJKA 3ZFGC 4ZL8A 1TQ5A 2J42A 3L4NA 1EGOA 5E6HA 2J23A 4UI9L 5EJ1B 3VKMA 2Y0OA 4OFTA 5DUUA 4IV1B 4AJ8A 3J8F3 3UGHA 2CAIA 4G9HA 2GU9A 4IESA 4L0UA 3RS6A 2BPA2 4OFNA 4KH7A 1B35A 3KGLA 1AQVA 4LORA 3R05A 4WEYA 3C7HA 1GNZA 4CSWA 2LJAA 4MZBA 2X29A 4Y3OA 3ZFBA 2ON5A 1SPPA 1W04A 5FUIA 1GNWA 1NY71 1S0GA 4AXOA 2YC2A 4NJ4A 4YM3A 3IR4A 5FJHA 1V6NA 3KV6A 4WZFA 3IPVA 4K8MA 2OADA 2PYTA 1QJY2 3T2PA 4Q4Y3 5EJ3A 3H1WA 4JX0A 2GSRA 3R0RA 4CCNA 1W6NB 5FWGA 1GP4A 2VOXA 4BL7B 4TN8A 2OKXA 1EPWA 2JWPA 2PVQA 4AQ6A 4RFT0 4B7EA 1UY2A 4LKEA 4KB3A 2A2RA 5ENUA 1ZA4A 2H6XA 4MYEA 5FMDA 2Y34A 2W94A 1XNKA 1NE6A 2K9ZA 2YGLA 5F2SA 4BWOA 4F8AA 3FR9A 5FRAA 4XBLA 4HANA 5FUPA 2RS53 1PN0A 2XJUA 3WG1A 1DBNA 2TUNA 4CZSA 5BNOA 1W6QB 4IP1A 4XQDA 1PKWA 2XBO2 1R091 3C7FA 4I2TA 1KNGA 1TZOA 1QHDA 2HWB1 4HQSA 4ATFA 3D5JA 3WNKA 3GKMA 3WF1A 3IV4A 4MG2A 2A7AA 3O0WA 3JZVA 1ULDA 2ZXQA 1JZ7A 4Z7XA 2RDSA 4EV0A 4HBNA 1R092 2AYTA 4LK7A 2DWRA 3W8JA 3EO6A 5ELGA 1UAIA 1VBA3 2RG4A 3LIHA 4MO3M 1AR61 5FO9B 2C4XA 4FBFA 1O6JA 1GV9A 2LRNA 5AC91 3PU8A 3ZLIA 2HWD3 3UMAA 4ZY9A 3EQEA 3IB3A 3S7EA 2RS51 1ZBE2 4NHZA 4CY6A 5L9RA 1C4RA 5BNOC 1XCCA 1O3RA 1F9KA 1HN0A 2P37A 4GB31 4O9EA 2ZGLA 3ORJA 2VY0A 2WRTA 1B35C 1W03A 2TIRA 4YGCA 4YGBA 2OJLA 2ALBA 1PX7A 4AVBA 4DOUA 3LSEA 2G9GA 1RUG2 4YQUA 4JTOA 4Q4Y1 3NAPC 5DMYA 2HWE3 14GSA 4XF1A 3TRSB 3HVSA 5FBJA 1QNYA 1GLHA 3AP9A 5DAQA 2HZEA 1CZVA 5AIXA 4CHSA 3L9JT 2BOIA 3F63A 4ZPIA 4NHMA 1RUG1 2RS33 1B48A 5BNPC 3F6DA 3N9NA 5CFDB 2RS52 1W28A 1SD8A 3UOMA 3FRCA 1VR3A 1H8VA 3THPA 1CESA 3CBUA 4MLOA 2WO1A 4HSJA 1AL0G 3HD5A 3HVXA 1BKZA 3KZ4C 3FMWA 3KF5A 5A33A 1W9TA 2F17A 3JB8A 2BZDA 3NRUA 3VBFA 5IPGA 2ZS6B 5HFIA 2JX9A 2BU9A 2GT6A 3JB4C 3AXDA 1E57A 3K2OA 5IATA 3DKQA 5DUVA 4TW5A 5JZGC 4D0QA 1OH4A 4V2WA 2A2SA 4GAZA 3AFGA 2R5GA 5FPUA 4DY3A 4KSMA 2B8MA 2PPTA 5FT3A 4XETA 1A2LA 3OBAA 3CSHA 1UOFA 5ECKB 1OMIA 2ES7A 3AKSA 2JG9B 1RUC1 1R1A2 1GSEA 2I74A 2CV6A 2IMIA 2D6KA 4XF4A 1DGRN 1UY0A 1H8TC 2VMCA 3RQ0A 1O81A 1YEXA 3WGEA 2CWMA 1MZ5A 4MH3A 1RVF2 5FYBA 3A3TA 1K45A 2GZPA 1GNHA 4BQ2A 2ET7A 5FP8A 4AQTA 3J9SA 3LXZA 4MJAA 1Q4JA 3LEKA 2CGNA 4HEA2 1UZZA 5HQPA 4QPIB 3FY7A 3NKGA 3ZXKA 1OSGA 2ZMKA 3E5UA 5IMAA 3F4RA 2W46A 3OUHA 2PVOC 5LBCA 2YUEA 5KN3A 4M00A 5CP1A 1X36A 1VMFA 5D9TA 1LOEA 3IAPA 1GYKA 2PHUA 4Q5RA 2HSMA 3PMEA 1HRV3 2ZGRA 4V1Ap 1Z0HA 2IMFA 3WDXA 1OHFA 1H2LA 4KI5M 4QXKA 1CGPA 5IOWA 4OI0A 5FZMA 1RYYA 1KXGA 4KBBA 11GSA 5FHIA 5A6ZA 4WZCA 3WUCA 3N9LA 2EALA 4PLNA 1FOD3 1ZCPA 3NOFA 1EGRA 4E8DA 4EN7B 1O85A 2MNGA 1JLVA 1ZOFA 2FDGA 2R042 2C1FA 1BEDA 1VAMA 4WF4A 1VBE1 2E33A 4JCKA 2CT6A 5CB7A 4PF5A 3Q8AA 1CAXB 5F06A 1XG8A 4XCBA 4BMEA 3ZXFA 1LODA 2K9FA 1UD1A 1BEV1 2FDIA 5L36A 3UGFA 2GZZA 4ZBBA 1OAZA 1VIWB 4EKZA 4TWTA 4YG6A 4LOTA 2YV8A 4LXLA 1KS5A 3DXTA 1KEXA 3RAZA 4FPCA 4TR3A 1R1A3 3AYEA 4YVWA 1MQTA 3QD9A 3N7JA 4CEWC 20GSA 3O1UA 2C6SA 2DFBA 1JMUB 4FIWA 1QOOA 5C7GA 1QXPA 1Q8OA 5JXGA 2H71A 1UCXA 4A42A 1SKSB 1EAH1 5EIYB 1UYYA 1IPJA 2PMWB 3CF6E 2WZR3 1PK6C 4IW9A 4AEDB 2WGRA 5BNOB 1RUI2 2RDRA 3M1HA 3GCXA 1IQAA 1PGSA 3I59B 4AVCA 2PHFA 1RVF1 2W0XA 1IG3A 4IDZA 1IOAA 5F3GA 4H86A 1MDKA 2XXZA 5IHRA 2VBPA 1LESA 4IEZA 1T4YA 4HOOA 4HPKB 1BMV2 2AV4A 1SL1B 3M3QA 3VKFC 4RQXA 1Q8PA 3CRUA 1YHFA 2MPFA 5C6CA 5A3TA 1GH2A 1X9PA 4FPKA 5IFTA 1ZGNA 1FOVA 2VZ1A 1QJY1 5FXZA 3O6TA 1GOHA 4MADA 1MS5A 4JDNA 3EU4A 1QKQA 4XJ8A 4LBNA 3W5NA 2H74A 2WAAA 1SKWB 3TAYA 2TRXA 1UF2C 5FY4A 2UY8A 1SJIA 1C8NA 5HPOA 5I8YA 1ZYEA 3PVBB 3EU3A 4GA9A 5J98B 2AC1A 2IL3A 3SC7X 1W9FA 3JU9A 3D3AA 1MZ6A 5EWSA 1VBE2 3RDWA 1RINA 5FAXA 3LEMA 1ZYQB 5FY9A 5HR1A 4LA1A 1VBB2 1US2A 1CIYA 4BQXA 5IVVA 1TRVA 2N5AA 4NVPA 3LG6A 3FKFA 2IC1A 1VAVA 1ULGA 1ML6A 3VHOA 6GSVA 1PO11 3ZN4A 1H8TB 4AI0A 4HZ4A 2G4IA 4XURA 4YH2A 1FPN1 2VZSA 4QXCA 1QGLA 2WZR2 3RDIA 3AKPA 4A5PA 4OHYA 5DDJ2 4F82A 3TB0A 1D2QA 4YVSC 1FVKA 2A73B 5M0TA 3SKVA 3FR6A 4M3CE 2QQNA 3ZMOA 5C5UA 1RQMA 5FR3A 1XNBA 4K1ZA 1WA6X 2I4AA 1O59A 1EY2A 1K3LA 2XVGA 1F2EA 1HRI2 4YAPA 4CW9A 4PUFC 2LJKA 2GTUA 2AAWA 4X8PA 2ZZQA 3V0AB 1PK6B 2V32A 4LMFA 2ZGOA 4OCFA 5HR3A 3UKTA 1YRZA 3NAPA 3EE2A 5IVCA 4XF0A 4RQPC 10GSA 2XVLA 1KJLA 1YQ6A 1OKOA 2LS5A 4CU8A 3GNJA 2Z42A 5EV7A 1V0AA 2YN1A 3I69A 5JSRA 1UOJA 4CE8A 1SYRA 5A6XA 3N7LA 3VD3A 2X8CA 4HOJA 1ZRFA 3U1XA 2JDKA 4IS0A 2DCKA 4LT5A 4MGTA 4COUA 5JPNB 2D5FA 1UL9A 1G9AA 2AYHA 4PCRA 3IC4A 3W8SA 4MGQA 3LOIA 1AUYA 4GH4C 4HMZA 1VBE3 3VZMA 1K0OA 3TDGA 2A1XA 4KL1A 5B7CA 2IVJA 4AEDA 3D82A 2D6NA 2A6WA 1GZCA 1JYXA 2HWC2 4ICYA 5H5QA 3VURA 4Q4V3 4OHWA 1BYEA 2V1MA 2E7PA 4KF9A 4LBKA 1H9WA 2BNMA 2B7KA 4JRLA 5A33B 2GSSA 3DMLA 4NHXA 1XOAA 2RS13 4CUCA 3CBNA 3FLPA 1HB2A 2JB8A 4NMIA 4ZXEA 2VZPA 3HR9A 5FOBB 2QQOA 3NW4A 5DDJ3 5DAVA 2YGMA 4Q8LA 2JE8A 1A8MA 3WF0A 5T52A 1W39A 2C24A 1CIWA 1TOFA 3P5BA 4FFHA 4GQCA 2JZTA 1AYN2 5KXBA 4Q5NA 4POBA 4XIKA 1OQ1A 5KHGA 4F2IA 4B1MA 1NA1C 2H76A 4IEOA 5BXXA 1WMJA 2R073 5GZFA 4W65A 2O85A 4FYBA 1V6LA 4B29A 4GSNA 3BOAA 4E8CA 5HCBA 4BOWA 1CX1A 3TKSC 4KGIA 4Y4RA 2LQQA 4IELA 5IVJA 3EPTA 3MF6A 4F3JA 2JECA 1NXD1 3AC0A 4DVCA 1WW7A 4AHXA 1W6OA 5ABJC 4QX3A 3SEEA 4WVMB 3AZWA 3HHVA 4GH4B 2DVDA 3EBRA 4FOWA 1THXA 4EWEA 2UWAA 4RS5B 4Q4W2 5L7OB 2XBO1 4QPIA 1VBA2 5FP7A 4XFHA 4RHV3 1YFWA 1PVC3 3L0HA 5FZGA 4BCUA 4OMCA 2A6ZA 3QBQA 3D0ZA 2CY6A 3P3PA 4MABA 1HQOA 4X0XA 5FPBA 3ZFFB 3PUAA 4AWDA 3KP8A 5LNKe 1PD21 3Q74A 4CEWA 3I2KA 4LBLA 1LHNA 3BCKA 4BB3A 1QUWA 3IMMA 1UIKA 3W9AA 5FCCA 1VMHA 4JKKA 5FY0A 3OPTA 1ST8A 4CP9B 1ENQA 1LOAA 4QKFA 4P9LA 1QY4A 4GWJA 5A7PA 2GNBA 2JL4A 1SK0A 5E16A 2TNFA 1GSDA 5I8SA 2PELA 4BK5A 1DE2A 1RIRA 4QX8A 4E8HA 1PM4A 1WW4A 1JZOA 3PNAA 4Y20A 3KTLA 2LSTA 1NY72 2VL2C 1M2AA 1GFF2 4GB33 4QPGC 5FXVA 2GMMA 1BYHA 3CSIA 3TJBA 3IPZA 1PIV1 4D7TA 2Q1MA 5D9WA 3ZIVA 2FHEA 1Z7S3 3CQFA 2D5HA 4GH4A 2XWBB 4CPBD 4WXTA 4N53C 4Q0SA 2QJVA 2C0FA 3NVCA 4POMA 3WW1A 4FOQA 1FV2A 3PL0A 4AJ6A 4NE9A 5DUXA 2FDHA 4WR5A 2JEMA 3WHTA 2DV9A 5JOZA 5D73A 3ZYPA 1NYWA 4K6BA 3AKQA 4RS5C 5EPFA 2IXJA 2HZEB 5HI0A 4PX1A 1T4ZA 4AEKA 5FO7B 1POV0 3I2IA 5C00A 1QEXA 3L2HA 4AOCA 3LOBA 3IHGA 2WJSA 1MACA 4AL9A 1B4QA 3RJ2X 3PHMA 2MYGA 1HRV1 2XPJA 2C9KA 1QQP1 3L9UA 2G9FA 1FVJA 3RNSA 3WDYA 4TR4A 4YW1A 1LJRA 5DZGA 2QKDA 4OHXA 5DABA 1IPSA 4XF3A 4WBRD 2OYZA 2QBXA 2GSTA 2J1UA 1WLWA 5F2WA 1NQJA 4XC9A 4CDOA 2WFCA 5AFEA 1OKDA 4DSSB 1LHVA 2W2IA 3KT7A 5F05A 4KH9A 1A6CA 1WUVA 2A4VA 3GF6A 1H75A 2QQLA 4FO9A 4GD4A 1CAUB 1HXS2 4KNCA 1YLLA 4A7YA 3DGTA 3HNMA 2XVKA 2HJIA 3I2FA 3BOPA 5C5TA 1R081 3OTFA 3QPMA 3MEPA 3PLQA 4XPVA 4K7OA 4FI9A 1SBDA 1N3QA 1KD7A 2JU5A 3WT1A 4P9JA 5ECNB 2E32A 4YZ3A 5KHHA 4N0ZA 1POV1 2VZVA 3H7JA 4HVOA 3TNQA 3EHKA 2WO3A 4E4HA 2GVPA 2KR2A 4IEPA 2ZKLA 1T7PB 4K2DA 4QB6A 1NSWA 1GP5A 4Y5Z0 5A3MA 1I3HA 3D8CA 3TOUA 4XHXA 5KXDA 3J8F1 1O3SA 2YWOA 1UY4A 4BQ5A 1RTVA 2WS91 4Z2RA 5T5PA 3RG0A 3IHQA 2QQIA 4WETA 2VTXA 1RUH1 1W4VA 5C3RA 3FK8A 2Z2SB 4XJUA 1DIWA 3IXRA 5F0GA 5FZDA 4TXOA 2VCAA 2QZ2A 4JGYB 4J57E 3QDNA 3FMGA 2LRTA 1MEKA 1W6NA 2B46X 3ZN5A 4XCAA 1KS4A 3KJYA 4EVMA 5F9TA 4WM8A 2G0FA 5FYUA 4O5QA 2O1QA 5L7OC 3JCML 4G2EA 2L6CA 4FFIA 4MPGA 3WOGA 2OXBA 1IYIA 1ZZ9A 4WVZA 1S55A 4GWIA 1ZL9A 2B5XA 3GKXA 2WKKA 1RJ7A 3X29B 3CSJA 1SLLA 1DZTA 5KXEA 1A2MA 1JZDA 3VN4A 1W6PB 5LY1A 4EC0A 3OGGA 1S2EA 5A4WA 1LEDA 5LCZA 3AZYA 1XWAA 2YXSA 1NKGA 1W9SA 3PUQA 1NCRB 4CCKA 3TKQA 3ZTLA 4HJMA 2FA8A 3BTXA 5CG8A 1NA1A 5C9AA 1OVSA 1ZYPA 2WNVB 4C91A 1AYN3 1IZ3A 1GSYA 1GRXA 4QX0A 4Y26A 1KTEA 5E8AA 4GZ9A 1YEPA 4S2GA 1RUF2 2YV9A 5JVVA 3RZKA 3DXBA 1B8XA 2UWCA 5FYIA 2RE9A 2CA8A 4D7SA 1FT9A 3NJXA 4K5SA 4FPYA 4BQ3A 4L97A 5FY7A 5KR7A 2WSVA 3A22A 5D1IA 4XFGA 1C57A 3K3NA 5JCTA 4FTSA 3GKKA 4HG6B 1GOFA 4IEYA 5JCUA 4INDA 3VHNA 1VBA1 2BGPA 4OD7A 3HZ4A 1LKNA 5I0TA 4JKLA 1QQP2 2NMOA 4O65A 4GKYA 1MEC3 3ZFEB 4C8DA 3FYGA 1YCIA 2HEWF 1UOBA 1NQDA 5A7SA 1XNTA 5IK5A 2HBTA 2GN3A 3ZSMA 1H2KA 3ST7A 2X8GA 2FWFA 2VZOA 5FPVA 2QSIA 4BDVB 1MDIA 1T00A 4HSLA 2RMU2 5INYA 6GSXA 18GSA 3RYKA 2FDFA 1BX9A 3ZYHA 2OZ6A 4NIDA 1K0AA 2E26A 4XAAA 2EXIA 1SYXA 2WS93 3GH6A 3HOBA 4LO6B 3O76A 5BV6A 1D4M2 5JXIA 2YROA 2W5FA 3AP6A 2A6XA 4XE9A 1XBSA 5T5OA 5LW9A 3ME8A 2OT7A 1K5MB 4P02B 3ZPOA 4AF9A 4ITCA 1CX4A 4M4PA 1GSLA 5A80A 3JXSA 4HQZA 3GJBA 4BYYA 3LWAA 1H1AA 1OOPA 5F5AA 3DECA 5DPNA 3VBRB 4N7IA 1O8XA 1VBC2 3FHQA 3U37A 4YZ4A 3E9JB 2AJQB 2X64A 5KHKA 1RUE3 4Q0UA 1LU4A 3GL3A 4I6XA 1VAKA 2XBQA 3MIBA 4AAPA 3RYRA 2UYAA 4ZB6A 4PNGA 1OFSA 4R9CA 1WE0A 2EIEA 5FY1A 2LTKA 3H3UA 3OGVA 2Q1ZB 4JDMA 3SHRA 8GSSA 2EXJA 4XZUG 2GGTA 3VDCA 4V2MA 3PIJA 4TVEA 5FPAA 4XEZA 4LPLA 3I3EA 4PQIA 1HNBA 4KDYA 4D6RA 4RHV1 2RR12 2ZHNA 1TME3 1J08A 1EOGA 3SQOA 4IKHA 4L0PA 2VMHA 3IK9A 2XBO3 1DE1A 3UJOA 4K7JA 5J1XA 5F7UA 4DFSA 2KLXA 2QTWB 3FHKA 1M4WA 5FZBA 4YSFA 2SLIA 2PBJA 5DCGA 1CAWB 2JG8A 1XQNA 1LGCA 2B42B 1GBGA 4KCEA 4N30A 1G9FA 2HXKA 5A3OA 3MSZA 1ODNA 2LNSA 3RZMA 2B4KA 4MJEA 5D8IA 1C1FA 4ZZ8A 3NNMA 1JYVA 2RIIA 1QDCA 3BU0A 1WW5A 4W6WA 1HLCA 2OPWA 1OF3A 2R16A 1EP8A 4QGNA 2WIIB 4LOSA 4DB5A 1C28A 4IEXA 4ILFA 5A3PA 1BBT1 3GHNA 2I45A 4P9YA 3VKNA 1PGW1 3U6VA 1ZZBA 2K8SA 2VQTA 3Q18A 2FGXA 1Z3EA 4X6QB 4KDXA 1NOVA 2DIYA 3MFAA 2WNUA 5HCHA 3KMHA 3D6IA 1URXA 3P90A 5JZGA 1ND3C 1S0BA 3CDZB 1RC6A 1A34A 3VUOA 2ZEYA 5IVFA 1QXRA 3ZMLA 2RS32 5CRDA 4K6XA 4AFMA 1KFXL 2R7EB 4Q4V1 2QC7A 1ENSA 1CR7A 4I2OA 2WL1A 4C90A 3IIIA 2ORXA 3KCCA 3ZKUA 4KWKA 1UW8A 3KVAA 1NA1B 2D3SA 5HXVA 2YG0A 4ECCA 5EY6A 1UVZA 3OF1A 4TKYA 1H2MA 1AQXA 1EP0A 4H14A 4PF1A 1OA3A 4BIOA 3P3NA 3TWIA 4KQ7A 4NOTA 5I93A 1U0AA 1MS0A 4Z2TA 4AVAA 3SLIA 3NIVA 2DJ3A 1RHI3 4YW2A 4B4RA 4O92A 4D69A 2OX0A 4MHRA 3FBYA 1MTCA 4G0KA 1SL0B 4GIQA 2W1QA 4LKDA 1D2SA 3TEXA 1H4OA 2VH9A 1YXWA 5G05L 4H7MA 1S0FA 4GWRA 2PA7A 3J26N 1I9RA 3W59A 1T6GC 3VK9A 5B6MA 3RZJA 5BNPA 4P00B 1CN1A 3BGAA 2VC9A 2ETEA 4EZ4A 4Q5FA 4H2AA 2PN5A 2OBKA 4BXSV 4FT8A 3S9FA 4MV2A 1WLDA 2OA2A 1NZIA 1JYIA 5B6NA 1RUF1 2C0ZA 1GULA 2UYBA 1JZ3A 1GOGA 2ZGQA 4YVWB 3EMRA 4LBJA 22GSA 5GLUA 4IJ3A 2Q4SA 4BVXB 2QCSB 1NT0A 2AHEA 4H55A 1O73A 2C80A 4MMMA 1SFNA 1HJGA 1FX5A 3LFLA 3A2XA 3DYPA 5KWRA 3T2TA 3SH3A 1TEIA 4XXAA 1WOUA 5DVBA 3POWA 2WT0A 3LXTA 4FVVA 3SCFA 2CVDA 2AR6A 4UF0B 4WVWA 3P7XA 4YM0A 3E6DA 3GZEA 3BODA 3OEAA 1UX7A 5A70A 3J7LA 3ES1A 1O4YA 2NTOA 4Q29A 3POGA 3T1LA 3UAPA 5FXXA 3APQA 2PAMA 3TN93 4EZHA 3KP9A 3ZO0B 1REEA 4BE3A 5J3UA 1I5GA 2XLFA 2O0OA 3VZJA 5A6QA 2IVIB 1Z5YE 5C8CA 5IIZA 4U36A 1AL21 3KD0A 3ROUA 1PM7A 3D5OA 1WMDA 3MICA 3KZQA 1BJXA 4XOGA 4Y24A 5FLJA 4IQAA 1X50A 3M7AA 5T3NA 1X0RA 2QQWA 1FB6A 1TE1B 1MS1A 3VBOA 3WDUA 4YRDA 2GQKA 2MBSA 3BTZA 2FNOA 5KN2A 3A21A 2PAEA 1TTZA 2YJHA 3ATGA 2BGOA 4ML6A 2VW2A 3FZAA 3WSOA 1AC1A 5GLZA 4COWA 1UMIA 4AHWA 5CKQA 1CWPA 5F6LB 4LE3A 1JW6A 3F9UA 3UEMA 5K0UC 4JE1A 4COYA 4IV3B 5G2ZA 2HWF3 3UV9A 3HMYA 1YNAA 1AR82 4YFZA 1CQ9A 3WG2A 2HWF1 2JDMA 5BUVA 4EF0A 5KN0A 1UNBA 3AK0A 3DYRA 2EF6A 5T50A 2O89A 4DEVA 3QLQA 1DSBA 2WNVA 4IHUA 12GSA 2H75A 3APBA 1Y4WA 4L9BA 5DAKB 3U11A 4SLIA 4KWUA 1ZZ8A 4R9BA 2BNNA 2PFWA 1NCRC 3VWVA 2B1KA 2ARBA 4F0CA 4R9AA 1WMEA 1ZYNA 2H66A 4QWNA 1PSQA 2OBIA 3FZ4A 2CVKA 1TI3A 4ASMB 3NSTA 4ASLA 3H1NA 1QWRA 4WM7B 1ERWA 2RHPA 5FV3A 5DAWA 1FHEA 1HRI1 4DRRA 1EV12 4EJRA 3GIXA 5JSPA 4GF0A 4JTNA 4KUNA 3IZOA 1YKAA 3EJKA 4POLA 3D22A 2LV3A 1J83A 1QXJA 2N7GA 1R7HA 4PQHA 5CG9A 3K4DA 1FYUA 1AR71 2H73A 3VBFB 5ECOB 4W6YA 4JGYC 2WWJA 1YQ8A 2YWIA 4Q1RA 1NE4A 4R4ZA 2GALA 5E88A 2DDUA 3DYOA 3FLRA 3P6BA 4CDQA 3I3QA 5IW0A 1LU2A 2LKUA 2D97A 1W0NA 4IERA 4BIFA 4IV3C 2ZGUA 2WINB 2UY9A 2GT5A 2L4QA 4HK9A 3JQWA 4YG0A 1LOGA 1PKZA 3IDEA 2W39A 1GZWA 3CL1A 1KBNA 5KOXA 2JDNA 3H3ZA 1AR83 5JIAA 4KDUA 1UIJA 2ARAA 3AZXA 1XOBA 4TR1A 4UFLA 5CISA 5FKBA 3I49A 2VZ3A 4WVVA 2M46A 1BBT2 2HBUA 5FQ0B 4HXCA 3ZVXA 3NNFA 5JXJA 4PTSA 2VO5A 2WZR1 3E6BA 5L71A 3M3EA 3KCMA 3BBYA 4GSSA 1PX4A 3THCA 3GZUC 5IO0A 1UX6A 5J3RA 1U5YA 4UW5A 2Q8CA 3OBRA 5C3SA 2ZGMA 4EO3A 4FQ4A 3U4XA 3US3A 2R49A 3LF7A 5CRGA 3HWJA 4LBQB 2ID4A 2UWBA 3I6AA 3GBFA 1A0RP 3OY8A 1QF3A 4O7XA 1MEC2 3U75A 1LBKA 2VUCA 4HN0A 4DXSA 4G0IA 5LA0A 3MBWA 1RHI2 4MLYA 2V73A 4FFGA 2Q1FA 3N35A 3EMPA 1F15A 2NDOA 1UYZA 1F8VA 4HS1A 1BEV3 5DZFA 4V1PA 3L9SA 4QKDA 1MDJA 3KIJA 4MF5A 4AYUA 1EV9A 4BHPA 1PO21 2DVFA 4XTMA 1OVPA 2HWC1 2A2PA 4TR1B 2Q8EA 5D8AB 2YYOA 3KCYA 2XHKA 5JIUA 4NPMA 1DBYA 3V56A 3WNMA 2NMNA 5BNNB 1SL2B 4WM7C 1OF4A 4JHZA 1GZWB 5FZIA 2JKXA 1JZ2A 1YDKA 3LQ7A 5ID2B 1AQWA 2M80A 3PUHA 4DUXA 2G19A 3OD4A 4XJZA 5GZGA 4RGGA 2RS12 4XDPA 5ABJB 5EP9A 4CDQB 4QHBA 5A7OA 3DCQA 4G19A 4GCIA 2ZTNA 5IT6A 1VGLA 5FYYA 3OR5A 3UL2A 1F4AA 4UXAA 1V9U1 1COV1 5IK8A 2IFRA 5FZHA 4GRFA 1VBC3 1LOFA 4GWMA 3QOPA 2YCDA 2DMLA 1R64A 2AEYA 4XJ9A 3K48A 1RUJ3 3HT2A 4PT6A 2C3QA 4AFAA 1JZ8A 5F37A 2V72A 4JZRA 2RLIA 1OOPC 5SV5A 1W8UA 2DIZA 1H2NA 1PMJX 1DU3D 5CVRA 2H1DA 3VPQA 4NHYA 4MZWA 3MV11 2R32A 2D6OX 2EC4A 1TME2 3LDBA 1W2OA 2VCBA 5JWQB 2ZOEB 4WBBA 5K8SA 1WWYA 1HQWA 1DQ5A 1N3PA 3I8TA 1N8JA 5C71A 4IE4A 4J6GA 3RGBA 3D6EA 3ECQA 1A8DA 4PQQA 3APOA 4XHBA 4CDWA 4EUYA 3QCPA 3B7MA 1A23A 3FC0A 3S57A 3PIGA 3OYWB 4NV2A 1MVEA 4MZCA 4UW3A 1FOHA 5AVPA 5ACA2 3HBKA 3EMXA 1PVC2 5LRRA 4JHTA 4J2FA 2HLEA 2VCVA 3IAQA 4B8EA 1I5PA 1XWKA 1QMVA 2LS6A 1X9WB 3GH9A 1WD3A 2LEGA 4I97A 1VRBA 2K18A 1BJQA 1G9CA 1HV1A 3DRNA 5KEJA 2FCHA 1Y9QA 4Q4W1 1EYBA 1XU1A 3O1OA 3HNYM 2AUYA 4MVTA 3GZTB 1WWJA 2FMDA 1O7UA 4UFIA 2A6YA 1ABAA 2VZTA 4FPEA 4OUEA 1AXYA 4J56E 1LHWA 1SDWA 1Q8QA 4MX3A 5C9AC 4Y33A 3LORA 4BVXA 4BM8A 1TMF1 3PJYA 4HU7A 2WFF1 4URTA 3O7OA 1OVNA 4JGZA 4HPKA 3SITA 3SH4A 4KAEA 1BK1A 5ECRB 2VNRA 2PHTA 2DCTA 3NV3A 1HIXA 1ASJ1 3JBG2 3RYPA 4AGGA 4BQ4A 2M72A 3S5AA 4AF2A 4YWAA 2WJUA 1PGTA 4ATEA 1K5JA 2P6CA 2VW1A 2A4HA 1RUC2 1V6OA 4QPWA 3O3TA 1R1ZA 2RVAA 4TLFA 2GSQA 1PX3A 4META 1M3IA 4PLOA 3WDTA 3NAPB 3CTGA 3HQUA 5C04A 3PH9A 4GQFA 3I7DA 2C4JA 4JEDA 1U5XA 2J22A 4CEYA 4YM1A 1B09A 4OO4A 4K3UA 4L8EA 1SFPA 4O5RA 2RJKA 4QQHA 5ACA3 5CFDC 4XFBA 1ODMA 4IE5A 2JICA 1HD2A 2AH2A 5IVEA 3T08A 2P5BA 1S3CA 3OJBA 5FYHA 2WT1A 3GYDA 3GKNA 3EWLA 1DF0A 4WBJA 3AM2A 2JDUA 2QUOA 2YC0A 3V1WA 2MEV3 5GSTA 1VF2A 2XGXA 4D3WA 5JPMB 2BV4A 1J59A 3ETPA 3VBRA 1OH3A 3ZPYA 2RM23 3PVOA 3AP5A 2HRNA 4YGEA 4WM8C 5DXDA 4XXPA 3JD72 3L2YA 1PRXA 2H01A 1QJX3 4NIIA 3Q19A 3MO4A 4EN8B 4LTAA 2TRCP 1RUI1 5GLVA 5D9VA 1SEFA 3WD6A 3RMXA 4FAHA 1GP6A 1QNWA 4MXWB 4XUQA 3WZ1A 3LWCA 3H1YA 5J48A 3ES4A 2R1BA 1TRWA 2AB6A 3ZFGA 1Q8SA 1WZXA 5A7QA 2BJSA 3PVNA 1G6YA 4F9ZA 4IQPA 2DUQA 1PZ7A 5L73A 4HT1T 1OOPB 3FFQA 3V0BB 1VBD2 3O14A 3AXEA 3UVTA 3WD5A 3DPRC 1X9TA 2FLSA 4OI4A 1ON4A 4C1WA 4P9XA 4YAVA 2A5ZA 2VG9A 2VCXA 1IS4A 1YF1A 3RHCA 3WYWA 3J8F2 3A2VA 2DCZA 5DUWA 1JZ5A 3C3VA 4HKWA 2JG9C 1N1YA 4N10A 2XJTA 4IEUA 2P5QA 1GNEA 2H1AA 2DU0A 2W1UA 5JI7A 2QQPA 2GN7A 3IWZA 4DNYA 3MV01 2X49A 3D4TA 3MIDA 2DFCA 1W0OA 4CCMA 1VLNA 2JDPA 3RVHA 1ZZ6A 1O5UA 5G1KA 1KDMA 3C7MA 2VW0A 5LY2A 1ZBA3 3M9KA 3ZMKA 1DZQA 3UT0A 3P2AA 3WGXA 1GLQA 1T2XA 5BY5A 4QPIC 2QQMA 5IK4A 2E53A 3EURA 4TTGA 4I0WB 3VBHB 1ND2A 4XS4B 4AQSA 1WBFA 4NIAA 4D73B 3LPGA 4OZXA 3DIEA 4ZL7A 1NW2A 1GANA 3IN9A 4YW4A 1JXNA 3EXUA 1XW9A 5FDBA 3QMXA 3QAVA 4DS0A 5H9RA 2O87A 5JMCA 2ZEWA 2BUKA 5FYCA 3HN3A 1BVVA 2ZHKA 3I59A 3LDKA 3TJJA 2C0DA 4E4DX 3HVDA 4P9GA 2DCJA 1EEMA 2NQYA 5DZEA 3KGKA 2CZ2A 4I30A 3CKHA 1BAYA 2XKOA 1NG0A 2CTVA 5C9AB 4XW3A 3S0MA 1OKQA 1CAXA 4JGYA 3L78A 4HJ2A 1TXXA 3EYTA 2OS2A 3LSZA 4KMQA 2X09A 4XILA 1AL22 1NUKA 3F4SA 3LCPA 4IGQA 2VBBA 2HFDA 5FZ9A 1GWLA 1M06G 3I2JA 2VMEA 3POBA 1RUD3 1EV13 3D21A 2GC1A 3NNLA 4ZU7A 2WZEA 3MLJA 2XJSA 3N7KA 2W9XA 4A6OA 1WMXA 4HETA 2R043 4UFHA 3QCWA 5E1RA 4LBMA 4UFJA 1W2TA 3IBHA 2WS92 2XH6A 2HKXA 2VM9A 2WQZC 2WABA 5I8TA 2X10A 1W8OA 1XRUA 1JODA 2WN2A 1UC7A 1RUJ1 3VL8A 5FZ4A 4K0NA 1YQ5A 3OGJA 4YLZA 4A6SA 2WO2A 3M3IA 1F3AA 5AISA 2WULA 3G7IA 1V9U3 3U5RE 3NV1A 3TKSE 1GUKA 5FKCA 2ZMLA 3WF4A 3C7OA 4LHSA 1GSSA 4IGJA 4EE2A 4LHNA 2B7YA 5FP4A 4OHZA 4WR4A 5FOJB 5F32A 2BMXA 3AP4A 4BLIA 4QPGB 1SCRA 3O5SA 2ZBJA 4E4SA 1BZWA 2OPKA 3VBFC 2R061 3CXGA 2YHJA 3T09A 3ACLA 3GYKA 4X8NA 3F95A 2RV9A 3LFMA 2VXJA 3SEPA 4CDQC 4EYUA 4DPNA 4D6QA 2HE3A 1QJFA 2W91A 3GA4A 2DJJA 5FWEA 2ZJCA 4Q2FA 4OFGA 1S2BA 3TKPA 5T55A 3VBUB 2ZGSA 2VXRA 3VB9A 3FW2A 2A3WA 1AXKA 2FUG2 4NN0A 1YQCA 4W8JA 5HBAA 1FXZA 4CXYA 4QX2A 1S0DA 1MS8A 4WV8A 2R0FA 5K7PA 1XPWA 4I5QA 4L2NA 5C8CC 4N8MA 3WY6A 1TNFA 5FZ8A 1ZA7A 3WR0A 1UY3A 1JTZX 2VUAA 3GALA 3PGTA 1M99A 3CO2A 3LGCA 4AR2A 3SWLA 1J9BA 1UO9A 5JAXA 3VZOA 4K21A 4E8EA 2P31A 1UN1A 4M3CB 4EQVA 1MR5A 4IW3A 3F2ZA 1OUSA 3AFKA 1ERTA 1NCRA 1YIFA 5EPAA 4RQPB 3RFRA 3FN9A 1LCLA 4URAA 3PDQA 3F6FA 2YFUA 1NCQA 2P5RA 2WNOA 1ND2B 5H9SA 1K3OA 4IEVA 1M2BA 2WBKA 1FPN3 5DJLA 1PL2A 2VBDA 4YW6A 4K7NA 5ID2A 5LATA 1O91A 4LLOA 5JR2A 3KWVA 1CONA 2WRAA 1YQ1A 4XUOA 4ZXKA 1SU9A 1GQPA 4XDQA 1FOD2 1NHYA 3MIXA 2D40A 2H0VA 3U10A 2DKHA 2AUVA 4XQWA 5C3QA 1N1VA 1RUJ2 3QR6A 2WYFA 4OULA 1HJFA 4PQ9A 4IETA 3MYDA 4WF5A 3FWEA 2JE7A 2P3JA 3FFZA 3GTUA 4RR3B 2JIJA 3USUB 3BTAA 1VF4A 3UVHA 2KHPA 1RXGA 1LAJA 3VBRC 2BJXA 2C8UA 4WVMA 1OPOA 4EROA 4OO5A 3KGZA 2B7JA 1UXXX 5FTTC 5EL8A 2AREA 2CU5A 2XLAA 1UPSA 1HRI3 3ZYRA 5C8CB 1OI6A 3Q9OA 4NWWA 1QDOA 4AGVA 4AVVA 3M1GA 4I01A 1GL8A 5CREA 1XXNA 5C4WC 2XR4A 1YO8A 3HKRA 3A23A 5GZEA 1TVGA 3UETA 4MGZE 3HVNA 3T30A 5FO8B 5G04L 2J9HA 2P3YA 4KBZA 2VL2A 2QQUA 2WNEA 2X5IA 4I02A 3C8XA 3CMGA 19GSA 4AFCA 5CU1A 2Y60A 2CZ3A 2EVXA 2R0PA 1JS9A 4DSRA 5F8PA 4H7LA 4TLGA 1VRH3 2VAFA 4GLTA 4Z07A 3MLKA 3RPQA 3E1F1 1OBNA 1X82A 2A6VA 3VZNA 1PN9A 3WDWA 3WF2A 5JOXA 5JWRB 4HVRA 3AZVA 3WUDA 1FB0A 1W9YA 4LULA 1UU6A 1WD4A 3RMYA 3A2WA 5B4NA 2PLV2 4ZS2A 3MDKA 4PDWC 4UAPA 4Y1ZA 1EAH3 1W06A 2GZWA 1PIV2 2H0IA 3IAS2 2BDRA 3OPWA 2VMDA 4ZKTB 3JCIA 4V1Ag 5GM0A 2KUCA 1UMZA 4CDUB 1MZFA 3AVRA 1AR92 3ETQA 4UF0A 4PBPA 2WR9A 1GTIA 1YQ2A 1UOGA 4CEYB 5KBFA 1SACA 2FD8A 2BBVA 2HWB2 1JYWA 3F8UA 1B9YC 1LB2A 3ITQA 1QFNA 16GSA 1ZM1A 4RGAA 4EDZA 4ID0A 1SDDB 3AL5A 1V9WA 1AW9A 3AZZA 1Z6MA 1A3KA 4C0HA 4IL7A 4FP2A 2GLRA 3U78A 2JIGA 1Y7BA 1EV11 4MHUA 3POFA 3GRXA 4FO5A 4AGSA 3HCZA 1AR62 1W8WA 5ECLB 4LK6A 1RUC3 1VP6A 1HNAA 3UKVA 3VDDA 2R37A 2J1SA 1PO22 1VBB3 4JGZB 1FOD1 4NXIA 1H9PA 2DMMA 2XB6C 1RUOA 2P4EA 5DALA 3T4VA 2B9UA 1G9BA 3AY8A 4XRAA 3WVJA 4FQUA 1Y25A 5LD0A 1K0DA 3BUCA 2P0GA 1HN1A 2B5HA 3R4DB 3MF9A 2FCTA 2EXKA 4O32A 1MD4A 4NO4A 1WPIA 4Y1VA 3F3QA 2VM2A 3OPZA 6GSUA 1QJY3 1U3IA 1UKGA 2OQ7A 2JE9A 3H93A 4Y1XA 5A7WB 4IE7A 2NYYA 1AXZA 2R30A 2HRKA 2F8FA 3NL1A 5F39A 5C70A 1SLIA 1FMD2 5ANQA 2JDAA 2CX4A 2OUJA 2DCYA 5FREA 4RHV2 1PMTA 4A7KA 3A5IA 2HWF2 4YW3A 1X8MA 1BXHA 1XYNA 1RVF3 4COZA 3AP7A 4K40A 1O8WA 2KXLA 4JBBA 1SZBA 2FDJA 4GXZA 3VLBB 5GALA 3H8UA 4QB2A 4QDSA 5FZOB 4MCUA 3N9QA 5L9VA 3K77A 2JD9A 1DFQA 4KU7A 4XUTA 5CNAA 2UU8A 4CUAA 5JMOA 1QJX2 5A3LA 2ILMA 3ZXAC 3LJRA 5IMFA 3B5LB 4QHZA 3IIAA 3QD6A 5AN1A 4ZL9A 3ILFA 4QPGA 1A0FA 3BPZA 3C1RA 3H8RA 1DGWA 5BPXA 1UA5A 4DXZA 1H4GA 4QX1A 2F51A 3ENRA 4PLMA 2OW4A 4LMVA 4IGOA 1MD3A 5K4LA 3AKTA 3THDA 2HWD1 3NV4A 2YZ4A 3QAGA 4GB32 2YPDA 1OA2A 1VRH1 2DURA 2WYSA 2VCMA 3BI3A 3O1SA 5A4UA 3TJFA 2D6MA 1IKQA 1ASJ2 3TOTA 3HNBM 4QT6A 4W4ZA 3WGDA 3FUQA 2P1BA 5LA9A 1X7NA 1Q8VA 4I8BA 5FPLA 1VF1A 2YB7A 4RFRB 4Z8BA 5C33A 2AACA 1V6MA 2YV7A 5HR0A 1VJ2A 4FFFA 3F0IA 3DWVA 2R063 2WWUA 2KP2A 2RJLA 1FI2A 2V6KA 4CCLA 4ECJA 1ZBA2 4LA3A 1GR3A 5FIXA 1R093 3LD8A 3I97A 1ZREA 4E2QA 5A6YA 3BD2A 4JU5A 4I2UA 3UYJA 2CSGA 3J7MA 2JB4A 3HD8B 2IPAA 2RM21 2MMOA 3KCXA 2REMA 5AGYA 3N9MA 3ZYBA 4PGTA 1HB1A 3HJMA 1SLCA 3VBHC 2IXLA 4GXLA 3GSTA 4PIXA 1LHUA <