1SL0B

Ternary 3' complex of t7 dna polymerase with a dna primer/template containing a disordered cis-syn thymine dimer on the template and an incoming nucleotide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
105
structure length
105
Chain Sequence
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/electron transport/dna
molecule keywords 5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*GP*
publication title Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 21
structure length 105
sequence length 105
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1sl0B00
2LRTA 4EVMA 1XWGA 2I3YA 4BWQA 3QAVA 5AIVA 2H30A 1PSQA 1BEDA 3KMOA 2YZUA 4PQIA 3HZ8A 3Q19A 2GT6A 4I2UA 1VRSD 4KSMA 4F82A 1PL2A 1V57A 4PUAA 4MF5A 3HA9A 1BQ7A 2C0GA 3TDGA 5EY6A 3GL3A 5JWQB 3VFIA 2ON5A 4QQ7A 2HFDA 3HCZA 2WRTA 6GSVA 3QMXA 1F37A 4N10A 1WOUA 4WETA 1TU7A 3IA1A 2VCWA 1ZOFA 2PGTA 1TDIA 1MDJA 1TRVA 2CA8A 1SK2A 1A2LA 3TKSA 3UARA 3DYRA 1HD2A 2K18A 1YF0A 2DJ2A 3WGDA 2A2RA 5INYA 1OKTA 2EC4A 2LQQA 1TU8A 2YP6A 5ECRB 2PERA 4HJMA 1XWBA 1KBNA 1V98A 2RM5A 2MMNA 2ES7A 2VL3A 5GZZB 4Q5FA 2B5XA 4KE3A 4ZL8A 2YWNA 6GSSA 5ECOB 3HY2A 1G7EA 3M9JA 4G2EA 3I9V2 1PN9A 1WWJA 2DC5A 3BCKA 5D9VA 4PXOA 2K8SA 1OC9B 1SYRA 1QXHA 5L71A 5GSSA 3IBHA 3HDCA 1EWXA 3IAM2 4IELA 5J4UA 4PGTA 3TKSC 1JLWA 2OJLA 2GQMA 2F8AA 1SK0A 3TRXA 2XBQA 4NMUA 5F06A 4DSQA 3CMIA 5CP1A 4Q5NA 3H93A 2CX3A 1R4WA 3ME8A 3I43A 1W89A 4NHZA 1AUCA 1TOFA 2HSHA 1WJKA 1F6MC 3DRNA 4KDUA 1J08A 2IN3A 2R4VA 4JR6A 1EOGA 1PD21 3KZQA 2JADA 2JZSA 3LFLA 1DE2A 4K6XA 3VLNA 3ZFBA 2H6YA 3HZ4A 2GZZA 3QCPA 3KP9A 3TOUA 3IK7A 4IBPA 2E0QA 2PVOC 3KGKA 1KEBA 1GTAA 5KN0A 3G7YA 4HJ2A 1YQ1A 3WT1A 1ZGNA 4WXTA 3M0FA 5DQSA 3IXRA 3ZZXA 5CRGA 4MH3A 1GP1A 4MA9A 5ID2B 2FWGA 1Q4JA 2VCTA 2FGXA 2IJYA 4L0UA 1O73A 2N5AA 11GSA 1GSQA 3QAWA 5KN2A 5D9XA 4IQ1A 5ENUA 1SL0B 2P5RA 2I9HA 3GHAA 2WFCA 3L4NA 5LCZA 4MABA 2R5GA 4IN0A 4RQRA 2MZCA 2IMEA 5J41A 1AC1A 1XWKA 1BAYA 3D21A 4KUNA 2HZFA 2O7KA 3TKPA 1T1VA 1PKZA 3VWVA 1M2BA 1TRUA 4ZL7A 2CX4A 2B1KA 3HJMA 3DEXA 2JZTA 3GTUB 4MPGA 3K8NA 2L4CA 4FO5A 1JZRA 4YQVA 3TJBA 2MMAA 3KIJA 1HQOA 4MCUA 1SJIA 2HYXA 1AIUA 3VK9A 4V2NA 2YJ7A 5A4WA 4FIWA 1DSBA 2A2SA 1WPIA 4GCIA 3FK8A 2P0GA 1ERTA 3TCOA 2FWEA 4PX1A 2X8HA 4I8BA 2YWMA 3KH9A 1TRWA 4EXJA 4KH7A 1M99A 2XPDA 2LV3A 3LSZA 4ML6A 1THOA 3HJOA 5FT3A 4HOJA 1SYXA 4MZBA 3ZYWA 1K0OA 3Q18A 2L6CA 1YEPA 2C0FA 1MDIA 2LJRA 2H1DA 1PX6A 4KX4A 4PNGA 3DVWA 1RK4A 1YY7A 3CRUA 1XWCA 1AQVA 5DDLA 1U3AA 2L4QA 4MJEA 2H0HA 2DIYA 1H4OA 4DVCA 3HD5A 4OFMA 3ERWA 4YQMA 3VWWA 1ACVA 5C04A 1XBSA 5B7CA 5DAKB 2VL9A 4KB3A 3DIEA 3QDNA 4N0ZA 3UMAA 1XOAA 1ZYEA 3HYPA 2RM6A 3DWVA 3CTGA 2WB9A 19GSA 2H75A 4OD7A 4F03A 5EPFA 2LNSA 1FO5A 3APOA 5DJMA 1G6YA 5COHA 1PKWA 2DJ0A 4IKHA 3H79A 1N8JA 1BJXA 4XIHA 4AGSA 3C1RA 3WT2A 2X99A 1JZOA 2GGTA 3Q6OA 5HQPA 2B5EA 2V32A 1FVJA 2H70A 2C1YA 4GRFA 3G7IA 5IMAA 4OCEA 1K0MA 2C3TA 2PU9C 4DSSB 1GUHA 1XW9A 1N2AA 4ZIJA 4BA7A 4XRAA 4ZILA 4L0WA 5CRHA 1VGLA 2VD0A 1QMVA 1ML6A 2RUFA 3UVTA 3CSIA 1SKRB 3F6FA 1ON4A 3HJPA 3U5RE 5E59A 4CHSA 3QR6A 3RHCA 5LD0A 4WF5A 2NDOA 1GSFA 1R26A 4IS0A 1PMTA 2EIOA 2IMIA 1YJ6A 4BVYA 1BYEA 2LEGA 4QL9A 2DJJA 4PNFA 1K0DA 1A2JA 5GSTA 5IO0A 1Y25A 1SU9A 1OE8A 1XPVA 4CW9A 3RDWA 3R2QA 4EF0A 4DEJA 3Q74A 2FY6A 3L9UA 2QC7A 4Z7XA 4BWSA 5IOWA 1Z6NA 3ZTLA 2RIIA 1U88A 5JWOB 2YWOA 1PRXA 2VUPA 4MH2A 5KN3A 4NAXA 4HU9A 2L5OA 5HFIA 3BBYA 3UVHA 2DJ1A 3F0IA 4FYBA 4ZL9A 3FEUA 2GZPA 2HZEA 3D22A 3ERFA 2PMTA 5KN1A 1XFLA 3D4TA 4NV5A 4PQ1A 5H5RA 2CT6A 5JCGA 1CQHA 1A0RP 2IMFA 1PGTA 3GA4A 1F2EA 1NSWA 2NTOA 5IMVA 5E4WA 3EINA 4FYUA 3WYWA 2R37A 3D0ZA 1Z7RA 4LMWA 1SD9A 2YNXA 3EMPA 2DMMA 3GYKA 5GAND 4RUVA 2KLXA 2PVQA 5J9BA 3W8SA 4NHWA 3IPZA 2I81A 5DCHA 2CVDA 1MD4A 4E8EA 5CAXA 2ALBA 3TOTA 2IMKA 3F6DA 3E9JB 3G9BA 3FW2A 3FR6A 4WR5A 1DBYA 1AQWA 4X1UA 2B7KA 2I1UA 3GFKA 3D5JA 3GSSA 4AJ8A 2O8VB 2YWIA 5AISA 4F0CA 1O81A 1KTEA 2E7PA 2K9FA 4J57E 2C3NA 2M72A 3TKRA 3WD6A 1GSSA 3DMLA 4D73A 4K7OA 5D73A 3TUEA 3GKKA 4IVFA 3A5WA 2IFQA 2VM1A 1AQXA 3EMXA 1ERUA 4OFTA 3TJJA 1K0AA 4G19A 2YV7A 3KD0A 3RPNA 4MZWA 4I97A 3IOSA 1QUWA 6GSXA 3BCIA 2OBIA 3F4RA 2ZUPA 5IPHA 3QPMA 3TKQA 4OFNA 4EKZA 3LGCA 3M9KA 3EC3A 2PPTA 2LNTA 2C3QA 4KA0A 3IV4A 1SL2B 4NPBA 1TRSA 1Q98A 1T7PB 2AV4A 4ISDA 1WIKA 4K0GA 4TR1A 3EURA 4AJ7A 1ERVA 2QGVA 3CSHA 3ZLPA 5ABRA 4BVXA 4OCFA 4E8HA 4K1FA 3KM6A 2VM2A 1OE7A 3P2AA 2EIQA 1G7OA 2Z9SA 2CAQA 4O7HA 4L8EA 5D8IA 2C8UA 3EYTA 2L59A 2RUEA 5CNWA 2AHEA 4MDCA 3VURA 2GSTA 4I5QA 5DJLA 4GTUA 3F3QA 2OADA 3A3TA 2J9HA 4POLA 2F9SA 2H76A 2VO4A 2H6ZA 1X9MB 2OACA 2GT5A 3QFBC 4HI7A 5H5QA 3BJ5A 5CRWA 3PINA 3GH6A 1F3BA 2WJUA 3P7XA 4JBBA 5IQYA 2GS3A 1AW9A 2DIZA 3O76A 1GTBA 5DQYA 4YQUA 10GSA 4KNDA 1A24A 2IIYA 5F0GA 3LYPA 1MEKA 2HT9A 3KH7A 4GWRA 3HKRA 2YZHA 1EV4A 2K6VA 3A2VA 3DD3A 1OKDA 5ECNB 2PBJA 5ECPB 4KDYA 5J5NA 1X5CA 3CSJA 1EGRA 2JSYA 5D96A 1AXDA 4XS4B 3TJFA 3SBCA 2LRCA 4IGJA 4ULXA 4EL1A 3EWLA 5G1KA 3W6GA 5DALA 4V2LA 1RW1A 4YAVA 2DBCA 5G2ZA 5IMZA 4POKA 1SK1A 4G10A 1TK5B 2NPBA 2JU5A 4AJ6A 2C80A 2X8GA 2YJHA 4JE1A 3ZFLA 4K9ZA 3P90A 9GSSA 4LL1B 2DJKA 1J9BA 2B7JA 1C72A 4H86A 2FLSA 3MSZA 2QSIA 4LMVA 1EP8A 3QAGA 4HUAA 3VPQA 4O5RA 4J2FA 3HHVA 1EV9A 1MD3A 3RHBA 3SWLA 1V58A 4TRXA 5IIZA 1XIYA 5ECKB 4MF7A 4POBA 1SKSB 1Z3EA 2O89A 4KSOA 4KGIA 4ZXGA 3EE2A 1PA3A 2EIRA 3UBKA 3VWXA 1WP0A 4NXIA 2AB6A 3RPPA 22GSA 3PGTA 2KOKA 3MNGA 1LBKA 8GSSA 1GSYA 16GSA 3W8JA 3N5OA 4V1Ap 5CO3A 1O8WA 2WGRA 4ZBDA 3VPTA 1O85A 3C1SA 2KP2A 3KTLA 3RBTA 2FA8A 3H1NA 1K3YA 2LQOA 1B4QA 1R5PA 5D9WA 1XZOA 2VL2A 4MJAA 2H6XA 2L57A 3KEBA 5DCGA 2R6KA 3UJ1A 2E2GA 3HVXA 4TN8A 1PQNA 2G0FA 1I9DA 4YH2A 4YAPA 5EL8A 4V2MA 1X5DA 4LA1A 2DLXA 3M1GA 2H1AA 1QQ2A 2HSYA 4HQSA 1M7TA 2VLTA 1FOVA 4JU5A 1UN2A 1YF1A 2H73A 5AN1A 4DSRA 1ZZYA 3WGEA 1ST9A 1XCCA 2JL4A 3CRTA 5A4UA 2PN8A 4RI7A 3QOUA 4MZCA 5IM9A 2YANA 3N9JA 5IOXA 7GSSA 2GQLA 5D93A 4ACSA 4EUYA 5D9TA 2VIMA 5ECHB 4KCEA 4ECIA 3EVIA 2REMA 3FZ9A 1VF2A 1M9BA 2OA7A 1VF4A 4GSSA 4MPFA 3EU3A 3CBUA 2YPMA 1ZCPA 5HFKA 5CYYA 1R7HA 5JWRB 4MF6A 2GQKA 4IP6A 3E0UA 3D6IA 1FAAA 4JZQA 3ZIJA 6GSUA 1V9WA 5KEJA 3GH9A 2CV4A 1A8LA 3L78A 3TB2A 1YZXA 1PX7A 4WKWA 3ZMLA 1FHEA 2FA4A 3IDVA 3VI7A 3NIVA 1U87A 4EDYA 2V2GA 3FR9A 1S3AA 3F3RA 3UBLA 2DSAA 5EVOA 1EP7A 1OAZA 3L9SA 2NVLA 2DMLA 1U3IA 4GXZA 4Q5QA 4X43A 2M80A 5HR1A 4JR4A 1OYJA 4MJCA 2FWFA 1GL8A 3L0HA 2M46A 1LU4A 2WS2A 1X9WB 3LXZA 3VWUA 1U6TA 3US3A 3P8WA 1LJRA 2VCXA 3F4SA 5F05A 4ZBBA 5B8AA 3PR8A 1V40A 1T3BA 2D2ZA 5FWGA 1GNWA 2VD1A 4WF4A 2XPEA 5IPGA 1G6WA 2R3XA 1TXXA 2WZ9A 3HVSA 5G5FA 1VF1A 5LNKe 17GSA 1VF3A 1GSUA 3LJRA 3EU4A 4TXOA 4GQFA 4Q5RA 3GUSA 2TRCP 1QFNA 4PUFC 4L5OA 4OMVA 1B9YC 1HNCA 2VLUA 3IR4A 2OBKA 2KP1A 4K7IA 1A2MA 3GSTA 3CTFA 2GSSA 5ECIB 2GSQA 3J7Yb 2IL3A 2OKAA 4NV2A 2O85A 1TK0B 2WDUA 3GMFA 4PQHA 2GTUA 1SD8A 1O8XA 3LXTA 2DJ3A 2F51A 3UEMA 3JCML 2MBTA 3A2WA 1K0NA 1M2AA 3LEFA 4WEYA 1OC3A 3C7MA 2HZEB 2N5BA 5ELGA 3HXSA 1JZWA 4EE0A 2MMOA 3TJKA 2LS5A 3APSA 3KJYA 5F8BA 5AIXA 4MMMA 2QKEA 2H01A 4X0XA 3L9VA 1USBA 2K8VA 4N30A 1JFUA 2GSRA 3TGZA 3CYNA 3LQ7A 5AGYA 4XS1A 4GF0A 4KW6A 2YN1A 2E2MA 1ZL9A 4K0NA 5IMFA 1M0UA 1TI3A 4XTSA 4O92A 2LJKA 4GQCA 1EOHA 1YKCA 4POMA 1FVKA 5G31A 1ZYQB 4HDEA 1XVWA 1V2AA 2IPAA 4L5LA 4PURA 1XXUA 1Z6MA 5A4VA 3C73A 2FD3A 1TTZA 4GSNA 20GSA 1YDKA 2AAWA 2B3SA 2MBSA 1FB0A 3M8NA 2TIRA 3UAPA 4XRDA 4F0BA 3GKNA 3O3TA 3I69A 1YKAA 1GSEA 4MLYA 2AUVA 3DGQA 3UL3A 4D73B 1OVNA 2YCDA 4KCAA 3ZIVA 1OC9A 14GSA 2CAIA 2IFQB 2V1MA 3ISOA 3ZITA 2YOIA 1GTUA 3H8QA 3QD9A 4WBRD 2FWHA 2V41A 3TKSE 1NHOA 2V6KA 1A8YA 5HFGA 5IMDA 2IWTA 1Z7PA 1MDKA 2H19A 1WRYA 3TRQA 1QGVA 2OE3A 3FZ5A 5CRDA 1HNAA 1W4VA 3KMNA 2BJXA 4TVEA 4ML1A 2H1GA 5IO2A 5CREA 3TJGA 3FR3A 1RQMA 1M9AA 4IJIA 2H74A 2A4VA 1A23A 3FRCA 4TR1B 2H0GA 1WE0A 2JSZA 3MWHA 4GLTA 2BMXA 2JACA 5HR0A 4EC0A 5B6MA 1X9SB 1TW9A 3CXGA 3VI5A 5IMCA 2B6MA 4HZ4A 2CVBA 2VOCA 2FHEA 2GVPA 2YV9A 1GRXA 2GDRA 1K0CA 1X0RA 1GLQA 3FHKA 1O7UA 18GSA 3GURA 1TP9A 4XS4A 3U6VA 2MYGA 5ID2A 4G9HA 1Z5YE 1S3DA 4IW9A 3ZVJD 4WR4A 5G5EA 1K3LA 3GIXA 4JEDA 1K0BA 2MMZA 3ME7A 1S3CA 3C71A 2AYTA 1E2YA 2KHPA 3IAS2 2XBIA 1HNBA 3APQA 5C00A 1JZDA 1TI1A 1BG5A 2ZNMA 3E3EA 4WBJA 3GRXA 4LLRA 1GLPA 4TW5A 4NWYA 5JCUA 4JRRA 1JHBA 3GTUA 5HR2A 1GULA 1JLVA 2I4AA 5DVBA 2HNLA 5ECQB 3FZAA 3PH9A 3QFAC 2V6OA 2XC2A 4XS6A 4F2IA 3DVXA 3GKXA 2X64A 2HXKA 3WGXA 5B8BA 1B48A 4HZ2A 1OC8A 1PL1A 3MAKA 2BTOT 4RI6A 5DBQA 1T8EB 1GSDA 1YEXA 2P31A 2TRXA 1UC7A 4OWYA 3OR5A 4O32A 4AF2A 3ZREA 1B9XC 5DALB 5GAPD 2VCQA 3ED3A 1FB6A 1GWCA 3FY7A 1SENA 3ERGA 3IK9A 2C4JA 6GSWA 1R5AA 2N5FA 3KCMA 3GX0A 4TR0A 5A5KA 4MP4A 2HRNA 4ZB6A 4HU7A 3KTBA 4I2TA 3LWAA 3RAZA 4HQZA 1NM3A 1KNGA 1Z9HA 3F9UA 3IC4A 1T4YA 4ZB8A 4ZB9A 1DE1A 3GKMA 4V1Ag 4P3YB 1GUKA 2RLIA 2B5YA 1T00A 3C8EA 1GH2A 4HEA2 2VCVA 1ILOA 1IYHA 4ID0A 4XCSA 2G2QA 4TOPA 4TKYA 1DUGA 3UIWA 5ECMB 1URMA 5G1LA 1FW1A 3D4MA 3LG6A 4TR3A 2WULA 5DAKA 6GSYA 1MTCA 1SL1B 1XVQA 1XWAA 3NZNA 2HI7A 1M2DA 4RQXA 2H71A 3NOFA 1F9MA 3HVVA 1GUMA 3G7JA 4K7NA 1F3AA 5H5SA 1XOBA 4N0VA 1CQGA 2CVKA 1EEJA 4IQAA 1B8XA 5ELAA 2GLRA 2LUSA 2CZ3A 3ZRDA 2H0IA 5FHIA 3AY8A 3I6AA 2FNOA 3BD2A 1T4ZA 1TJDA 13GSA 5HR3A 1SKWB 1TKDB 2LTKA 2O87A 2IMDA 4DSSA 4ILFA 2JZRA 2VL2C 2F8FA 4FYCA 4FH8A 2X8CA 1A0FA 4OO4A 2HLSA 1ERWA 2H66A 4ECCA 1WMJA 3ZL5A 4K2DA 3GL5A 3J7Yk 2WCIA 5ECLB 1UVZA 4I6XA 3GX8A 3FZ4A 2LRNA 2HE3A 2ON7A 1QK8A 3M3MA 1X5EA 1Y6EA 3F4TA 1NHYA 3UOMA 2P5QA 4ZBAA 3ZVJA 5JCWA 4TR4A 4CDOA 4GSTA 4HS1A 4MK3A 4F9ZA 3IRAA 1BX9A 5J3RA 2AJQB 1XW5A 4N11A 5F07A 2L5LA 2H8LA 3A2XA 1FG4A 1J0FA 3BOAA 1SJZA 3FYGA 4MJBA 1O6JA 4IP1A 12GSA 1EZKA 2VLVA 3DKSA 3H4KA 2L6DA 3GV1A 3IHQA 2OE0A 5G30A 4BL7A 1GNEA 1NW2A 5J9CA 1EEMA 3MDKA 3O6TA 3ZMKA 3FKFA 2B1LA 2KUCA 3KXOA 2H1BA 2VCZA 4QL7A 1B4PA 4TXVA 1I5GA 3LYKA 1EGOA 1HYUA 3F8UA 1G0TA 1XW6A 3V1WA 4BPYA 2C0EA 3S9FA 2LSTA 4KDXA 3TRPA 4EDZA 2FCHA 1TK8B 3IE3A 2GZYA 4KAEA 2NBSA 2C0DA 5ECSA 2OE1A 1SJ6A 4IJ3A 2CZ2A 1H75A 2ZCTA 2R2JA 4J56E 4XHMA 2VAFA 1K3OA 4TXOB 1IYIA 3KP8A 1ABAA 4LL4B 5B6NA 2FUG2 3GNJA 3F63A 2LJAA 2H72A 4OO5A 6GSTA 4IHUA 4ECJA 2CQ9A 2F3MA 2PWJA 2LKUA 2PUKC 2HRFA 2J23A 3GN3A 4EO3A 3LORA 4ECBA 1AAZA 1E6BA 1ZMAA 3DXBA 2XHFA 1THXA 1UA5A 4K8MA 1GTIA
chains in the Genus database with same CATH superfamily
2LRTA 4EVMA 1XWGA 2I3YA 4BWQA 3QAVA 5AIVA 2H30A 1PSQA 1BEDA 3KMOA 2YZUA 4PQIA 3HZ8A 3Q19A 2GT6A 4I2UA 1VRSD 4KSMA 4F82A 1PL2A 1V57A 4PUAA 4MF5A 3HA9A 1BQ7A 2C0GA 3TDGA 5EY6A 3GL3A 5JWQB 3VFIA 2ON5A 4QQ7A 2HFDA 3HCZA 2WRTA 6GSVA 3QMXA 1F37A 4N10A 1WOUA 4WETA 4CY6A 1TU7A 3IA1A 2VCWA 1ZOFA 2PGTA 1TDIA 1MDJA 1TRVA 2CA8A 1SK2A 1A2LA 3TKSA 3UARA 3DYRA 1HD2A 2K18A 1YF0A 2DJ2A 3WGDA 2A2RA 5INYA 1OKTA 2EC4A 2LQQA 1TU8A 2YP6A 5ECRB 2PERA 4HJMA 1XWBA 1KBNA 1V98A 2RM5A 2MMNA 2ES7A 3FMWA 2VL3A 1ZYNA 4G0LA 5GZZB 4Q5FA 2B5XA 4KE3A 4ZL8A 2YWNA 6GSSA 5ECOB 3HY2A 1G7EA 3M9JA 4G2EA 4O5QA 4Z2TA 3I9V2 1PN9A 1WWJA 2DC5A 3BCKA 5D9VA 4PXOA 2K8SA 1OC9B 1SYRA 1QXHA 5L71A 5GSSA 3IBHA 3HDCA 1EWXA 3IAM2 4IELA 5J4UA 4PGTA 3TKSC 1JLWA 2OJLA 2GQMA 2F8AA 1SK0A 3TRXA 2XBQA 4NMUA 5F06A 4DSQA 3CMIA 5CP1A 4Q5NA 3H93A 2CX3A 1R4WA 3ME8A 3I43A 1W89A 4NHZA 1AUCA 1TOFA 2HSHA 1WJKA 1F6MC 3DRNA 2R0GA 4KDUA 1J08A 2IN3A 2R4VA 4JR6A 1EOGA 1PD21 3KZQA 2JADA 2JZSA 3LFLA 1DE2A 4K6XA 3VLNA 3ZFBA 2H6YA 5KOXA 3HZ4A 2GZZA 3QCPA 3KP9A 3TOUA 3IK7A 4IBPA 2E0QA 2PVOC 3KGKA 1KEBA 1GTAA 5KN0A 3G7YA 4HJ2A 1YQ1A 3WT1A 1ZGNA 4WXTA 3M0FA 5DQSA 3IXRA 3ZZXA 5CRGA 4MH3A 1GP1A 4MA9A 5ID2B 2FWGA 1Q4JA 2VCTA 2FGXA 2IJYA 4L0UA 1O73A 2N5AA 11GSA 1GSQA 3QAWA 5KN2A 5D9XA 4IQ1A 5ENUA 1SL0B 2P5RA 2I9HA 3GHAA 2WFCA 2A4HA 3L4NA 5LCZA 4MABA 2R5GA 4IN0A 4RQRA 2MZCA 2IMEA 5J41A 1AC1A 1XWKA 1BAYA 3D21A 4KUNA 2HZFA 2O7KA 3TKPA 1T1VA 1PKZA 3VWVA 1M2BA 1TRUA 4Z2UA 4ZL7A 2CX4A 2B1KA 3HJMA 3DEXA 2JZTA 3GTUB 4MPGA 3K8NA 2L4CA 4FO5A 1JZRA 4YQVA 3TJBA 2MMAA 3KIJA 1HQOA 4MCUA 1SJIA 2HYXA 1AIUA 3VK9A 4V2NA 2YJ7A 5A4WA 4FIWA 1DSBA 2A2SA 1WPIA 4GCIA 3FK8A 2P0GA 1ERTA 3TCOA 2FWEA 4PX1A 2X8HA 4I8BA 2YWMA 3KH9A 1TRWA 4EXJA 4KH7A 1M99A 2XPDA 2LV3A 3LSZA 4ML6A 1THOA 3HJOA 5FT3A 4HOJA 1SYXA 4MZBA 3ZYWA 4K2XA 4EIPA 1K0OA 3Q18A 2L6CA 5BRTA 1YEPA 2C0FA 1MDIA 2LJRA 2H1DA 1PX6A 4KX4A 4PNGA 3DVWA 2R0CA 1RK4A 1YY7A 3CRUA 1M3IA 1XWCA 1AQVA 5DDLA 1U3AA 2L4QA 4MJEA 2H0HA 2DIYA 1H4OA 4DVCA 3HD5A 4OFMA 3ERWA 4YQMA 3VWWA 1ACVA 5C04A 1XBSA 5B7CA 5DAKB 2VL9A 4KB3A 1M3JA 3DIEA 3QDNA 4N0ZA 3UMAA 1XOAA 1ZYEA 3HYPA 2RM6A 3DWVA 3CTGA 2WB9A 19GSA 2H75A 4OD7A 4F03A 5EPFA 2LNSA 1FO5A 4EIQA 3APOA 5DJMA 1G6YA 5COHA 1PKWA 2DJ0A 4IKHA 3H79A 1N8JA 1BJXA 4XIHA 4AGSA 3C1RA 3WT2A 2X99A 1JZOA 2GGTA 3Q6OA 5HQPA 2B5EA 2V32A 1FVJA 2H70A 2C1YA 4GRFA 3G7IA 5IMAA 4OCEA 2HRKA 1K0MA 2C3TA 2PU9C 4DSSB 1GUHA 1XW9A 1N2AA 4ZIJA 4BA7A 4XRAA 4ZILA 4L0WA 4MNNA 5CRHA 1VGLA 2VD0A 1QMVA 1ML6A 2RUFA 3UVTA 3CSIA 5BMUA 1SKRB 3F6FA 1ON4A 3HJPA 3U5RE 5E59A 4CHSA 3QR6A 3RHCA 5LD0A 4WF5A 2NDOA 1GSFA 1R26A 4IS0A 1PMTA 2EIOA 2IMIA 1YJ6A 4BVYA 1BYEA 2LEGA 4QL9A 2DJJA 4PNFA 1K0DA 1A2JA 5GSTA 5IO0A 1Y25A 2X49A 1SU9A 1OE8A 1XPVA 4CW9A 3RDWA 3R2QA 4EF0A 4DEJA 3Q74A 4K5RA 2FY6A 3L9UA 2QC7A 4Z7XA 4BWSA 5IOWA 1Z6NA 3ZTLA 2RIIA 1U88A 5JWOB 2YWOA 1PRXA 2VUPA 4MH2A 5KN3A 4NAXA 1S3RA 4HU9A 2L5OA 5HFIA 3BBYA 3UVHA 2DJ1A 3F0IA 4FYBA 4ZL9A 3FEUA 2GZPA 4BL7B 2HZEA 3D22A 3ERFA 2PMTA 5KN1A 1XFLA 3D4TA 4NV5A 4PQ1A 5H5RA 2CT6A 5JCGA 1CQHA 2X4AA 1A0RP 2IMFA 3MYDA 1PGTA 3GA4A 1F2EA 1NSWA 2NTOA 5IMVA 5E4WA 3EINA 4FYUA 3WYWA 2R37A 3D0ZA 1Z7RA 3IHGA 4LMWA 1SD9A 2YNXA 3EMPA 2DMMA 3GYKA 5GAND 4RUVA 2KLXA 2PVQA 5J9BA 3W8SA 4NHWA 3IPZA 2I81A 5DCHA 2CVDA 1MD4A 4E8EA 5CAXA 2ALBA 3TOTA 2IMKA 3F6DA 3E9JB 3G9BA 4K5SA 3FW2A 3FR6A 4WR5A 1DBYA 1AQWA 4X1UA 2B7KA 2I1UA 3GFKA 3D5JA 3GSSA 4AJ8A 2O8VB 2YWIA 5AISA 4F0CA 1O81A 1KTEA 2E7PA 2K9FA 4J57E 2C3NA 2M72A 3TKRA 3WD6A 1GSSA 3DMLA 4D73A 4K7OA 3CQFA 5D73A 3TUEA 3GKKA 4IVFA 3A5WA 2DKHA 2IFQA 2VM1A 1AQXA 3EMXA 1ERUA 4OFTA 3TJJA 1K0AA 4G19A 2YV7A 3KD0A 3RPNA 4MZWA 4I97A 3IOSA 1QUWA 6GSXA 3BCIA 2OBIA 3F4RA 2ZUPA 5IPHA 3QPMA 3TKQA 4OFNA 4EKZA 3LGCA 3M9KA 3EC3A 2PPTA 2LNTA 2C3QA 4KA0A 3IV4A 4FQUA 1SL2B 4NPBA 1TRSA 1Q98A 1T7PB 2AV4A 4ISDA 1WIKA 4K0GA 4TR1A 3EURA 4AJ7A 1ERVA 2QGVA 3CSHA 3ZLPA 5ABRA 4BVXA 4OCFA 4E8HA 4K1FA 3KM6A 2VM2A 1OE7A 3P2AA 2EIQA 1G7OA 2Z9SA 2CAQA 4O7HA 4L8EA 5D8IA 2C8UA 3EYTA 2L59A 2RUEA 5CNWA 2AHEA 4MDCA 3VURA 2GSTA 4I5QA 4YKFA 5DJLA 4GTUA 3F3QA 2OADA 3A3TA 2J9HA 4POLA 2F9SA 2R0PA 2H76A 2VO4A 2H6ZA 1X9MB 2OACA 2GT5A 3QFBC 4HI7A 5H5QA 3BJ5A 5CRWA 3PINA 3GH6A 1F3BA 2WJUA 3P7XA 4JBBA 5IQYA 2GS3A 1AW9A 2DIZA 3O76A 1GTBA 5DQYA 4YQUA 10GSA 4KNDA 1A24A 2IIYA 5F0GA 3LYPA 1MEKA 2HT9A 3KH7A 4GWRA 3HKRA 2YZHA 1EV4A 2K6VA 1FOHA 3A2VA 3DD3A 1OKDA 5ECNB 2PBJA 4PTSA 5ECPB 4KDYA 5J5NA 1X5CA 3CSJA 1EGRA 2JSYA 5D96A 1AXDA 4XS4B 3TJFA 3SBCA 2LRCA 4IGJA 4ULXA 4EL1A 3EWLA 5G1KA 3W6GA 3R3EA 5DALA 4V2LA 1RW1A 4YAVA 2DBCA 5G2ZA 5IMZA 4POKA 1SK1A 4G10A 1TK5B 2NPBA 2JU5A 4AJ6A 2C80A 1PFOA 2X8GA 2YJHA 4JE1A 3ZFLA 4K9ZA 3P90A 9GSSA 3MIXA 4LL1B 2DJKA 1J9BA 2B7JA 4USSA 1C72A 4H86A 2HRAA 2FLSA 3MSZA 2QSIA 4LMVA 1EP8A 3QAGA 4HUAA 3VPQA 4O5RA 4J2FA 3HHVA 1EV9A 1MD3A 3RHBA 3SWLA 1V58A 4TRXA 5IIZA 1XIYA 5ECKB 4MF7A 4POBA 1SKSB 1Z3EA 2O89A 4KSOA 4KGIA 4ZXGA 3EE2A 1PA3A 2EIRA 3UBKA 3VWXA 1WP0A 4NXIA 2AB6A 3RPPA 22GSA 3PGTA 2KOKA 3MNGA 1LBKA 8GSSA 1GSYA 16GSA 3W8JA 3N5OA 4V1Ap 5CO3A 1O8WA 2WGRA 4ZBDA 3VPTA 1O85A 3C1SA 2KP2A 3KTLA 3RBTA 2FA8A 3H1NA 1K3YA 2LQOA 1B4QA 1R5PA 5D9WA 1XZOA 2VL2A 4MJAA 2H6XA 2L57A 3KEBA 5DCGA 2R6KA 3UJ1A 2E2GA 3HVXA 4TN8A 1PQNA 2G0FA 1I9DA 4YH2A 4YAPA 5EL8A 4V2MA 1X5DA 4LA1A 2DLXA 3M1GA 2H1AA 1QQ2A 2HSYA 4HQSA 1M7TA 2VLTA 1FOVA 4JU5A 1UN2A 1YF1A 2H73A 5AN1A 4DSRA 1ZZYA 3WGEA 1ST9A 1XCCA 2JL4A 3CRTA 5A4UA 2PN8A 4RI7A 3QOUA 4MZCA 5IM9A 2YANA 3N9JA 5IOXA 7GSSA 2GQLA 5D93A 4ACSA 4A5PA 4EUYA 5D9TA 2VIMA 5ECHB 4KCEA 4ECIA 3EVIA 2REMA 3FZ9A 1VF2A 1M9BA 4CY8A 2OA7A 1VF4A 4GSSA 4MPFA 3EU3A 3CBUA 2YPMA 1ZCPA 5HFKA 5CYYA 1R7HA 5JWRB 4MF6A 2GQKA 4IP6A 3E0UA 3D6IA 1FAAA 4JZQA 3ZIJA 6GSUA 1V9WA 5KEJA 3GH9A 2CV4A 1A8LA 3L78A 3TB2A 1YZXA 1PX7A 4WKWA 3ZMLA 1FHEA 2FA4A 3IDVA 3VI7A 3NIVA 1U87A 4X4JA 4EDYA 2V2GA 4KF9A 3FR9A 1S3AA 3F3RA 3UBLA 2DSAA 5EVOA 1EP7A 1OAZA 3L9SA 2NVLA 2DMLA 1U3IA 4GXZA 4Q5QA 4X43A 2M80A 5HR1A 4BIKA 5KOWA 4JR4A 1OYJA 4MJCA 2FWFA 1GL8A 3L0HA 2M46A 1LU4A 2WS2A 1X9WB 3LXZA 3PPUA 3VWUA 1U6TA 3US3A 3P8WA 1LJRA 2VCXA 3F4SA 5F05A 4ZBBA 5B8AA 3PR8A 1V40A 1PN0A 1T3BA 2D2ZA 5FWGA 1GNWA 2VD1A 4WF4A 2HSMA 2XPEA 5IPGA 1G6WA 2R3XA 1TXXA 2WZ9A 3HVSA 5G5FA 1VF1A 5LNKe 17GSA 1VF3A 1GSUA 3LJRA 3EU4A 4TXOA 4GQFA 4Q5RA 3GUSA 2TRCP 1QFNA 4PUFC 4L5OA 4OMVA 1B9YC 1HNCA 2VLUA 3IR4A 2OBKA 2KP1A 4BVYB 4K7IA 1A2MA 3GSTA 3CTFA 2GSSA 5ECIB 2GSQA 3J7Yb 2IL3A 2OKAA 4NV2A 2O85A 1TK0B 2WDUA 3GMFA 4PQHA 2GTUA 1SD8A 1O8XA 3LXTA 2DJ3A 2F51A 3UEMA 3JCML 2MBTA 3HVNA 3A2WA 1K0NA 1M2AA 3LEFA 3A5IA 4WEYA 1OC3A 3C7MA 2HZEB 2N5BA 5ELGA 3HXSA 1JZWA 4EE0A 2MMOA 3EPTA 3TJKA 2LS5A 3APSA 3KJYA 5F8BA 5AIXA 4MMMA 2QKEA 2H01A 4X0XA 3L9VA 1USBA 2K8VA 4N30A 1JFUA 2GSRA 4G0KA 3TGZA 3CYNA 3LQ7A 5AGYA 4XS1A 4GF0A 4KW6A 2YN1A 2E2MA 1ZL9A 4K0NA 5IMFA 2QA1A 1M0UA 1TI3A 4XTSA 4O92A 2LJKA 4GQCA 1EOHA 1YKCA 4POMA 1FVKA 5G31A 1ZYQB 4HDEA 1XVWA 1V2AA 2IPAA 4L5LA 4O5UA 4PURA 1XXUA 1Z6MA 2QA2A 5A4VA 3C73A 2FD3A 1TTZA 4GSNA 20GSA 1YDKA 2AAWA 2B3SA 2MBSA 4YKGA 1FB0A 3M8NA 2TIRA 1XG8A 3UAPA 4XRDA 4F0BA 3GKNA 3O3TA 3I69A 1YKAA 1GSEA 4MLYA 2AUVA 3DGQA 3UL3A 4D73B 1OVNA 2YCDA 4KCAA 3ZIVA 1OC9A 14GSA 2CAIA 2IFQB 2V1MA 3ISOA 3ZITA 2YOIA 1GTUA 3H8QA 3QD9A 4WBRD 2FWHA 2V41A 3TKSE 1NHOA 2V6KA 1A8YA 5HFGA 5IMDA 2IWTA 1Z7PA 1MDKA 2H19A 1WRYA 3TRQA 1QGVA 2OE3A 3FZ5A 5CRDA 1HNAA 1W4VA 3KMNA 2BJXA 4TVEA 4ML1A 2H1GA 5IO2A 5CREA 3TJGA 3FR3A 1RQMA 1M9AA 4IJIA 2H74A 2A4VA 1A23A 3FRCA 4TR1B 2H0GA 1WE0A 2JSZA 3MWHA 4GLTA 2BMXA 2JACA 4BVXB 5HR0A 4EC0A 5B6MA 1X9SB 1TW9A 3CXGA 3VI5A 5IMCA 2B6MA 4HZ4A 2CVBA 2VOCA 2FHEA 2GVPA 2YV9A 1GRXA 2GDRA 1K0CA 1X0RA 1GLQA 3FHKA 1O7UA 18GSA 3GURA 1TP9A 4XS4A 3U6VA 2MYGA 5ID2A 4G9HA 1Z5YE 1S3DA 4IW9A 3ZVJD 4WR4A 5G5EA 2DKIA 1K3LA 3GIXA 4JEDA 1K0BA 2MMZA 3ME7A 1S3CA 3C71A 2AYTA 1E2YA 2KHPA 3IAS2 2XBIA 1HNBA 3APQA 5C00A 1JZDA 1TI1A 1BG5A 2ZNMA 3E3EA 4WBJA 3GRXA 4LLRA 1GLPA 4TW5A 4NWYA 5JCUA 4JRRA 1JHBA 3GTUA 5HR2A 1GULA 1JLVA 2I4AA 5DVBA 2HNLA 5ECQB 3FZAA 3PH9A 3QFAC 2V6OA 2XC2A 4XS6A 4F2IA 3DVXA 3GKXA 2X64A 2HXKA 3WGXA 5B8BA 1B48A 4HZ2A 1OC8A 1PL1A 3MAKA 2BTOT 4RI6A 5DBQA 1T8EB 1GSDA 1YEXA 2P31A 2TRXA 1UC7A 4OWYA 3OR5A 4O32A 4AF2A 3ZREA 1B9XC 5DALB 5GAPD 2VCQA 3ED3A 1FB6A 1GWCA 1ZYPA 3FY7A 1SENA 3ERGA 3IK9A 2C4JA 6GSWA 1R5AA 2N5FA 3KCMA 3GX0A 4TR0A 5A5KA 4MP4A 2HRNA 4ZB6A 4HU7A 3KTBA 4I2TA 3LWAA 3RAZA 4HQZA 1NM3A 1KNGA 1Z9HA 3F9UA 3IC4A 1T4YA 4ZB8A 4ZB9A 1DE1A 3GKMA 4V1Ag 4P3YB 1GUKA 2RLIA 2B5YA 1T00A 3C8EA 1GH2A 4HEA2 2VCVA 1ILOA 1IYHA 4ID0A 4XCSA 2G2QA 4TOPA 4TKYA 1DUGA 3UIWA 5ECMB 1URMA 5G1LA 4G0IA 1FW1A 3D4MA 3LG6A 4TR3A 2WULA 5DAKA 6GSYA 1MTCA 1SL1B 1XVQA 1XWAA 3NZNA 2HI7A 1M2DA 4RQXA 2H71A 3NOFA 1F9MA 3HVVA 1GUMA 3G7JA 4K7NA 1F3AA 5H5SA 1XOBA 4N0VA 1CQGA 2CVKA 1EEJA 4IQAA 1B8XA 5ELAA 4ICYA 2GLRA 2LUSA 2CZ3A 3ZRDA 2H0IA 5FHIA 3AY8A 3I6AA 2FNOA 3BD2A 1T4ZA 1TJDA 3LW9A 13GSA 5HR3A 1SKWB 1TKDB 2LTKA 2O87A 2IMDA 4DSSA 4ILFA 2JZRA 2VL2C 2F8FA 4FYCA 4FH8A 4Z2RA 2X8CA 1A0FA 4OO4A 2HLSA 1ERWA 2H66A 4ECCA 1WMJA 3ZL5A 4K2DA 3GL5A 3J7Yk 2WCIA 5ECLB 1UVZA 4I6XA 3GX8A 3FZ4A 2LRNA 2HE3A 2ON7A 1QK8A 3M3MA 1X5EA 1Y6EA 3F4TA 1NHYA 3UOMA 2P5QA 4ZBAA 3ZVJA 5JCWA 4TR4A 4CDOA 4GSTA 4HS1A 4MK3A 4F9ZA 3IRAA 1BX9A 5J3RA 2AJQB 1XW5A 4N11A 5F07A 2L5LA 2H8LA 2A2PA 3A2XA 1FG4A 1J0FA 3BOAA 1SJZA 3FYGA 4MJBA 1O6JA 4IP1A 12GSA 1EZKA 2VLVA 2UZ8A 3DKSA 3H4KA 2L6DA 3GV1A 3IHQA 2OE0A 5G30A 4BL7A 1GNEA 1NW2A 5J9CA 1EEMA 3MDKA 3O6TA 3ZMKA 3FKFA 2B1LA 2KUCA 3KXOA 2H1BA 2VCZA 4QL7A 1B4PA 4TXVA 1I5GA 3LYKA 1EGOA 1HYUA 3F8UA 1G0TA 1XW6A 3V1WA 4BPYA 2C0EA 3S9FA 2LSTA 4KDXA 3TRPA 4EDZA 2FCHA 1TK8B 3IE3A 2GZYA 4KAEA 2NBSA 2C0DA 5ECSA 2OE1A 1SJ6A 3IC8A 4IJ3A 2CZ2A 1H75A 2ZCTA 2R2JA 4J56E 4XHMA 2VAFA 1K3OA 4TXOB 1IYIA 3KP8A 1ABAA 4LL4B 5B6NA 2FUG2 3GNJA 3F63A 2LJAA 2H72A 4OO5A 6GSTA 4IHUA 4ECJA 2CQ9A 2F3MA 2PWJA 2LKUA 2PUKC 2HRFA 2J23A 3GN3A 4EO3A 3LORA 4ECBA 1AAZA 1E6BA 4HSCX 1ZMAA 3DXBA 2XHFA 1THXA 1UA5A 4K8MA 1GTIA
chains in the Genus database with same CATH topology
2LRTA 4EVMA 1XWGA 2I3YA 4BWQA 3QAVA 5AIVA 2H30A 1PSQA 1BEDA 3KMOA 2YZUA 4PQIA 3HZ8A 3Q19A 2GT6A 4I2UA 1VRSD 4KSMA 4F82A 1PL2A 1V57A 4PUAA 4MF5A 3HA9A 1BQ7A 2C0GA 3TDGA 5EY6A 3GL3A 5JWQB 3VFIA 2ON5A 4QQ7A 2HFDA 3HCZA 2WRTA 6GSVA 3QMXA 1F37A 4N10A 1WOUA 4WETA 4CY6A 1TU7A 3IA1A 2VCWA 1ZOFA 2PGTA 1TDIA 1MDJA 1TRVA 2CA8A 1SK2A 1A2LA 3TKSA 3UARA 3DYRA 1HD2A 2K18A 1YF0A 2DJ2A 3WGDA 2A2RA 5INYA 1OKTA 2EC4A 2LQQA 1TU8A 2YP6A 5ECRB 2PERA 4HJMA 1XWBA 1KBNA 1V98A 2RM5A 2MMNA 2ES7A 3FMWA 2VL3A 1ZYNA 4G0LA 5GZZB 4Q5FA 2B5XA 4KE3A 4ZL8A 2YWNA 6GSSA 5ECOB 3HY2A 1G7EA 3M9JA 4G2EA 4O5QA 4Z2TA 3I9V2 1PN9A 1WWJA 2DC5A 3BCKA 5D9VA 4PXOA 2K8SA 1OC9B 1SYRA 1QXHA 5L71A 5GSSA 3IBHA 3HDCA 1EWXA 3IAM2 4IELA 5J4UA 4PGTA 3TKSC 1JLWA 2OJLA 2GQMA 2F8AA 1SK0A 3TRXA 2XBQA 4NMUA 5F06A 4DSQA 3CMIA 5CP1A 4Q5NA 3H93A 2CX3A 1R4WA 3ME8A 3I43A 1W89A 4NHZA 1AUCA 1TOFA 2HSHA 1WJKA 1F6MC 3DRNA 2R0GA 4KDUA 1J08A 2IN3A 2R4VA 4JR6A 1EOGA 1PD21 3KZQA 2JADA 2JZSA 3LFLA 1DE2A 4K6XA 3VLNA 3ZFBA 2H6YA 5KOXA 3HZ4A 2GZZA 3QCPA 3KP9A 3TOUA 3IK7A 4IBPA 2E0QA 2PVOC 3KGKA 1KEBA 1GTAA 5KN0A 3G7YA 4HJ2A 1YQ1A 3WT1A 1ZGNA 4WXTA 3M0FA 5DQSA 3IXRA 3ZZXA 5CRGA 4MH3A 1GP1A 4MA9A 5ID2B 2FWGA 1Q4JA 2VCTA 2FGXA 2IJYA 4L0UA 1O73A 2N5AA 11GSA 1GSQA 3QAWA 5KN2A 5D9XA 4IQ1A 5ENUA 1SL0B 2P5RA 2I9HA 3GHAA 2WFCA 2A4HA 3L4NA 5LCZA 4MABA 2R5GA 4IN0A 4RQRA 2MZCA 2IMEA 5J41A 1AC1A 1XWKA 1BAYA 3D21A 4KUNA 2HZFA 2O7KA 3TKPA 1T1VA 1PKZA 3VWVA 1M2BA 1TRUA 4Z2UA 4ZL7A 2CX4A 2B1KA 3HJMA 3DEXA 2JZTA 3GTUB 4MPGA 3K8NA 2L4CA 4FO5A 1JZRA 4YQVA 3TJBA 2MMAA 3KIJA 1HQOA 4MCUA 1SJIA 2HYXA 1AIUA 3VK9A 4V2NA 2YJ7A 5A4WA 4FIWA 1DSBA 2A2SA 1WPIA 4GCIA 3FK8A 2P0GA 1ERTA 3TCOA 2FWEA 4PX1A 2X8HA 4I8BA 2YWMA 3KH9A 1TRWA 4EXJA 4KH7A 1M99A 2XPDA 2LV3A 3LSZA 4ML6A 1THOA 3HJOA 5FT3A 4HOJA 1SYXA 4MZBA 3ZYWA 4K2XA 4EIPA 1K0OA 3Q18A 2L6CA 5BRTA 1YEPA 2C0FA 1MDIA 2LJRA 2H1DA 1PX6A 4KX4A 4PNGA 3DVWA 2R0CA 1RK4A 1YY7A 3CRUA 1XWCA 1AQVA 5DDLA 1U3AA 2L4QA 4MJEA 2H0HA 2DIYA 1H4OA 4DVCA 3HD5A 4OFMA 3ERWA 4YQMA 3VWWA 1ACVA 5C04A 1XBSA 5B7CA 5DAKB 2VL9A 4KB3A 3DIEA 3QDNA 4N0ZA 3UMAA 1XOAA 1ZYEA 3HYPA 2RM6A 3DWVA 3CTGA 2WB9A 19GSA 2H75A 4OD7A 4F03A 5EPFA 2LNSA 1FO5A 4EIQA 3APOA 5DJMA 1G6YA 5COHA 1PKWA 2DJ0A 4IKHA 3H79A 1N8JA 1BJXA 4XIHA 4AGSA 3C1RA 3WT2A 2X99A 1JZOA 2GGTA 3Q6OA 5HQPA 2B5EA 2V32A 1FVJA 2H70A 2C1YA 4GRFA 3G7IA 5IMAA 4OCEA 2HRKA 1K0MA 2C3TA 2PU9C 4DSSB 1GUHA 1XW9A 1N2AA 4ZIJA 4BA7A 4XRAA 4ZILA 4L0WA 4MNNA 5CRHA 1VGLA 2VD0A 1QMVA 1ML6A 2RUFA 3UVTA 3CSIA 5BMUA 1SKRB 3F6FA 1ON4A 3HJPA 3U5RE 5E59A 4CHSA 3QR6A 3RHCA 5LD0A 4WF5A 2NDOA 1GSFA 1R26A 4IS0A 1PMTA 2EIOA 2IMIA 1YJ6A 4BVYA 1BYEA 2LEGA 4QL9A 2DJJA 4PNFA 1K0DA 1A2JA 5GSTA 5IO0A 1Y25A 2X49A 1SU9A 1OE8A 1XPVA 4CW9A 3RDWA 3R2QA 4EF0A 4DEJA 3Q74A 4K5RA 2FY6A 3L9UA 2QC7A 4Z7XA 4BWSA 5IOWA 1Z6NA 3ZTLA 2RIIA 1U88A 5JWOB 2YWOA 1PRXA 2VUPA 4MH2A 5KN3A 4NAXA 4HU9A 2L5OA 5HFIA 3BBYA 3UVHA 2DJ1A 3F0IA 4FYBA 4ZL9A 3FEUA 2GZPA 4BL7B 2HZEA 3D22A 3ERFA 2PMTA 5KN1A 1XFLA 3D4TA 4NV5A 4PQ1A 5H5RA 2CT6A 5JCGA 1CQHA 2X4AA 1A0RP 2IMFA 3MYDA 1PGTA 3GA4A 1F2EA 1NSWA 2NTOA 5IMVA 5E4WA 3EINA 4FYUA 3WYWA 2R37A 3D0ZA 1Z7RA 3IHGA 4LMWA 1SD9A 2YNXA 3EMPA 2DMMA 3GYKA 5GAND 4RUVA 2KLXA 2PVQA 5J9BA 3W8SA 4NHWA 3IPZA 2I81A 5DCHA 2CVDA 1MD4A 4E8EA 5CAXA 2ALBA 3TOTA 2IMKA 3F6DA 3E9JB 3G9BA 4K5SA 3FW2A 3FR6A 4WR5A 1DBYA 1AQWA 4X1UA 2B7KA 2I1UA 3GFKA 3D5JA 3GSSA 4AJ8A 2O8VB 2YWIA 5AISA 4F0CA 1O81A 1KTEA 2E7PA 2K9FA 4J57E 2C3NA 2M72A 3TKRA 3WD6A 1GSSA 3DMLA 4D73A 4K7OA 5D73A 3TUEA 3GKKA 4IVFA 3A5WA 2DKHA 2IFQA 2VM1A 1AQXA 3EMXA 1ERUA 4OFTA 3TJJA 1K0AA 4G19A 2YV7A 3KD0A 3RPNA 4MZWA 4I97A 3IOSA 1QUWA 6GSXA 3BCIA 2OBIA 3F4RA 2ZUPA 5IPHA 3QPMA 3TKQA 4OFNA 4EKZA 3LGCA 3M9KA 3EC3A 2PPTA 2LNTA 2C3QA 4KA0A 3IV4A 4FQUA 1SL2B 4NPBA 1TRSA 1Q98A 1T7PB 2AV4A 4ISDA 1WIKA 4K0GA 4TR1A 3EURA 4AJ7A 1ERVA 2QGVA 3CSHA 3ZLPA 5ABRA 4BVXA 4OCFA 4E8HA 4K1FA 3KM6A 2VM2A 1OE7A 3P2AA 2EIQA 1G7OA 2Z9SA 2CAQA 4O7HA 4L8EA 5D8IA 2C8UA 3EYTA 2L59A 2RUEA 5CNWA 2AHEA 4MDCA 3VURA 2GSTA 4I5QA 4YKFA 5DJLA 4GTUA 3F3QA 2OADA 3A3TA 2J9HA 4POLA 2F9SA 2R0PA 2H76A 2VO4A 2H6ZA 1X9MB 2OACA 2GT5A 3QFBC 4HI7A 5H5QA 3BJ5A 5CRWA 3PINA 3GH6A 1F3BA 2WJUA 3P7XA 4JBBA 5IQYA 2GS3A 1AW9A 2DIZA 3O76A 1GTBA 5DQYA 4YQUA 10GSA 4KNDA 1A24A 2IIYA 5F0GA 3LYPA 1MEKA 2HT9A 3KH7A 4GWRA 3HKRA 2YZHA 1EV4A 2K6VA 1FOHA 3A2VA 3DD3A 1OKDA 5ECNB 2PBJA 4PTSA 5ECPB 4KDYA 5J5NA 1X5CA 3CSJA 1EGRA 2JSYA 5D96A 1AXDA 4XS4B 3TJFA 3SBCA 2LRCA 4IGJA 4ULXA 4EL1A 3EWLA 5G1KA 3W6GA 3R3EA 5DALA 4V2LA 1RW1A 4YAVA 2DBCA 5G2ZA 5IMZA 4POKA 1SK1A 4G10A 1TK5B 2NPBA 2JU5A 4AJ6A 2C80A 2X8GA 2YJHA 4JE1A 3ZFLA 4K9ZA 3P90A 9GSSA 3MIXA 4LL1B 2DJKA 1J9BA 2B7JA 4USSA 1C72A 4H86A 2HRAA 2FLSA 3MSZA 2QSIA 4LMVA 1EP8A 3QAGA 4HUAA 3VPQA 4O5RA 4J2FA 3HHVA 1EV9A 1MD3A 3RHBA 3SWLA 1V58A 4TRXA 5IIZA 1XIYA 5ECKB 4MF7A 4POBA 1SKSB 1Z3EA 2O89A 4KSOA 4KGIA 4ZXGA 3EE2A 1PA3A 2EIRA 3UBKA 3VWXA 1WP0A 4NXIA 2AB6A 3RPPA 22GSA 3PGTA 2KOKA 3MNGA 1LBKA 8GSSA 1GSYA 16GSA 3W8JA 3N5OA 4V1Ap 5CO3A 1O8WA 2WGRA 4ZBDA 3VPTA 1O85A 3C1SA 2KP2A 3KTLA 3RBTA 2FA8A 3H1NA 1K3YA 2LQOA 1B4QA 1R5PA 5D9WA 1XZOA 2VL2A 4MJAA 2H6XA 2L57A 3KEBA 5DCGA 2R6KA 3UJ1A 2E2GA 3HVXA 4TN8A 1PQNA 2G0FA 1I9DA 4YH2A 4YAPA 5EL8A 4V2MA 1X5DA 4LA1A 2DLXA 3M1GA 2H1AA 1QQ2A 2HSYA 4HQSA 1M7TA 2VLTA 1FOVA 4JU5A 1UN2A 1YF1A 2H73A 5AN1A 4DSRA 1ZZYA 3WGEA 1ST9A 1XCCA 2JL4A 3CRTA 5A4UA 2PN8A 4RI7A 3QOUA 4MZCA 5IM9A 2YANA 3N9JA 5IOXA 7GSSA 2GQLA 5D93A 4ACSA 4A5PA 4EUYA 5D9TA 2VIMA 5ECHB 4KCEA 4ECIA 3EVIA 2REMA 3FZ9A 1VF2A 1M9BA 4CY8A 2OA7A 1VF4A 4GSSA 4MPFA 3EU3A 3CBUA 2YPMA 1ZCPA 5HFKA 5CYYA 1R7HA 5JWRB 4MF6A 2GQKA 4IP6A 3E0UA 3D6IA 1FAAA 4JZQA 3ZIJA 6GSUA 1V9WA 5KEJA 3GH9A 2CV4A 1A8LA 3L78A 3TB2A 1YZXA 1PX7A 4WKWA 3ZMLA 1FHEA 2FA4A 3IDVA 3VI7A 3NIVA 1U87A 4X4JA 4EDYA 2V2GA 4KF9A 3FR9A 1S3AA 3F3RA 3UBLA 2DSAA 5EVOA 1EP7A 1OAZA 3L9SA 2NVLA 2DMLA 1U3IA 4GXZA 4Q5QA 4X43A 2M80A 5HR1A 5KOWA 4JR4A 1OYJA 4MJCA 2FWFA 1GL8A 3L0HA 2M46A 1LU4A 2WS2A 1X9WB 3LXZA 3PPUA 3VWUA 1U6TA 3US3A 3P8WA 1LJRA 2VCXA 3F4SA 5F05A 4ZBBA 5B8AA 3PR8A 1V40A 1PN0A 1T3BA 2D2ZA 5FWGA 1GNWA 2VD1A 4WF4A 2HSMA 2XPEA 5IPGA 1G6WA 2R3XA 1TXXA 2WZ9A 3HVSA 5G5FA 1VF1A 5LNKe 17GSA 1VF3A 1GSUA 3LJRA 3EU4A 4TXOA 4GQFA 4Q5RA 3GUSA 2TRCP 1QFNA 4PUFC 4L5OA 4OMVA 1B9YC 1HNCA 2VLUA 3IR4A 2OBKA 2KP1A 4BVYB 4K7IA 1A2MA 3GSTA 3CTFA 2GSSA 5ECIB 2GSQA 3J7Yb 2IL3A 2OKAA 4NV2A 2O85A 1TK0B 2WDUA 3GMFA 4PQHA 2GTUA 1SD8A 1O8XA 3LXTA 2DJ3A 2F51A 3UEMA 3JCML 2MBTA 3A2WA 1K0NA 1M2AA 3LEFA 3A5IA 4WEYA 1OC3A 3C7MA 2HZEB 2N5BA 5ELGA 3HXSA 1JZWA 4EE0A 2MMOA 3EPTA 3TJKA 2LS5A 3APSA 3KJYA 5F8BA 5AIXA 4MMMA 2QKEA 2H01A 4X0XA 3L9VA 1USBA 2K8VA 4N30A 1JFUA 2GSRA 4G0KA 3TGZA 3CYNA 3LQ7A 5AGYA 4XS1A 4GF0A 4KW6A 2YN1A 2E2MA 1ZL9A 4K0NA 5IMFA 2QA1A 1M0UA 1TI3A 4XTSA 4O92A 2LJKA 4GQCA 1EOHA 1YKCA 4POMA 1FVKA 5G31A 1ZYQB 4HDEA 1XVWA 1V2AA 2IPAA 4L5LA 4O5UA 4PURA 1XXUA 1Z6MA 2QA2A 5A4VA 3C73A 2FD3A 1TTZA 4GSNA 20GSA 1YDKA 2AAWA 2B3SA 2MBSA 4YKGA 1FB0A 3M8NA 2TIRA 3UAPA 4XRDA 4F0BA 3GKNA 3O3TA 3I69A 1YKAA 1GSEA 4MLYA 2AUVA 3DGQA 3UL3A 4D73B 1OVNA 2YCDA 4KCAA 3ZIVA 1OC9A 14GSA 2CAIA 2IFQB 2V1MA 3ISOA 3ZITA 2YOIA 1GTUA 3H8QA 3QD9A 4WBRD 2FWHA 2V41A 3TKSE 1NHOA 2V6KA 1A8YA 5HFGA 5IMDA 2IWTA 1Z7PA 1MDKA 2H19A 1WRYA 3TRQA 1QGVA 2OE3A 3FZ5A 5CRDA 1HNAA 1W4VA 3KMNA 2BJXA 4TVEA 4ML1A 2H1GA 5IO2A 5CREA 3TJGA 3FR3A 1RQMA 1M9AA 4IJIA 2H74A 2A4VA 1A23A 3FRCA 4TR1B 2H0GA 1WE0A 2JSZA 3MWHA 4GLTA 2BMXA 2JACA 4BVXB 5HR0A 4EC0A 5B6MA 1X9SB 1TW9A 3CXGA 3VI5A 5IMCA 2B6MA 4HZ4A 2CVBA 2VOCA 2FHEA 2GVPA 2YV9A 1GRXA 2GDRA 1K0CA 1X0RA 1GLQA 3FHKA 1O7UA 18GSA 3GURA 1TP9A 4XS4A 3U6VA 2MYGA 5ID2A 4G9HA 1Z5YE 1S3DA 4IW9A 3ZVJD 4WR4A 5G5EA 2DKIA 1K3LA 3GIXA 4JEDA 1K0BA 2MMZA 3ME7A 1S3CA 3C71A 2AYTA 1E2YA 2KHPA 3IAS2 2XBIA 1HNBA 3APQA 5C00A 1JZDA 1TI1A 1BG5A 2ZNMA 3E3EA 4WBJA 3GRXA 4LLRA 1GLPA 4TW5A 4NWYA 5JCUA 4JRRA 1JHBA 3GTUA 5HR2A 1GULA 1JLVA 2I4AA 5DVBA 2HNLA 5ECQB 3FZAA 3PH9A 3QFAC 2V6OA 2XC2A 4XS6A 4F2IA 3DVXA 3GKXA 2X64A 2HXKA 3WGXA 5B8BA 1B48A 4HZ2A 1OC8A 1PL1A 3MAKA 2BTOT 4RI6A 5DBQA 1T8EB 1GSDA 1YEXA 2P31A 2TRXA 1UC7A 4OWYA 3OR5A 4O32A 4AF2A 3ZREA 1B9XC 5DALB 5GAPD 2VCQA 3ED3A 1FB6A 1GWCA 1ZYPA 3FY7A 1SENA 3ERGA 3IK9A 2C4JA 6GSWA 1R5AA 2N5FA 3KCMA 3GX0A 4TR0A 5A5KA 4MP4A 2HRNA 4ZB6A 4HU7A 3KTBA 4I2TA 3LWAA 3RAZA 4HQZA 1NM3A 1KNGA 1Z9HA 3F9UA 3IC4A 1T4YA 4ZB8A 4ZB9A 1DE1A 3GKMA 4V1Ag 4P3YB 1GUKA 2RLIA 2B5YA 1T00A 3C8EA 1GH2A 4HEA2 2VCVA 1ILOA 1IYHA 4ID0A 4XCSA 2G2QA 4TOPA 4TKYA 1DUGA 3UIWA 5ECMB 1URMA 5G1LA 4G0IA 1FW1A 3D4MA 3LG6A 4TR3A 2WULA 5DAKA 6GSYA 1MTCA 1SL1B 1XVQA 1XWAA 3NZNA 2HI7A 1M2DA 4RQXA 2H71A 3NOFA 1F9MA 3HVVA 1GUMA 3G7JA 4K7NA 1F3AA 5H5SA 1XOBA 4N0VA 1CQGA 2CVKA 1EEJA 4IQAA 1B8XA 5ELAA 4ICYA 2GLRA 2LUSA 2CZ3A 3ZRDA 2H0IA 5FHIA 3AY8A 3I6AA 2FNOA 3BD2A 1T4ZA 1TJDA 3LW9A 13GSA 5HR3A 1SKWB 1TKDB 2LTKA 2O87A 2IMDA 4DSSA 4ILFA 2JZRA 2VL2C 2F8FA 4FYCA 4FH8A 4Z2RA 2X8CA 1A0FA 4OO4A 2HLSA 1ERWA 2H66A 4ECCA 1WMJA 3ZL5A 4K2DA 3GL5A 3J7Yk 2WCIA 5ECLB 1UVZA 4I6XA 3GX8A 3FZ4A 2LRNA 2HE3A 2ON7A 1QK8A 3M3MA 1X5EA 1Y6EA 3F4TA 1NHYA 3UOMA 2P5QA 4ZBAA 3ZVJA 5JCWA 4TR4A 4CDOA 4GSTA 4HS1A 4MK3A 4F9ZA 3IRAA 1BX9A 5J3RA 2AJQB 1XW5A 4N11A 5F07A 2L5LA 2H8LA 2A2PA 3A2XA 1FG4A 1J0FA 3BOAA 1SJZA 3FYGA 4MJBA 1O6JA 4IP1A 12GSA 1EZKA 2VLVA 2UZ8A 3DKSA 3H4KA 2L6DA 3GV1A 3IHQA 2OE0A 5G30A 4BL7A 1GNEA 1NW2A 5J9CA 1EEMA 3MDKA 3O6TA 3ZMKA 3FKFA 2B1LA 2KUCA 3KXOA 2H1BA 2VCZA 4QL7A 1B4PA 4TXVA 1I5GA 3LYKA 1EGOA 1HYUA 3F8UA 1G0TA 1XW6A 3V1WA 4BPYA 2C0EA 3S9FA 2LSTA 4KDXA 3TRPA 4EDZA 2FCHA 1TK8B 3IE3A 2GZYA 4KAEA 2NBSA 2C0DA 5ECSA 2OE1A 1SJ6A 3IC8A 4IJ3A 2CZ2A 1H75A 2ZCTA 2R2JA 4J56E 4XHMA 2VAFA 1K3OA 4TXOB 1IYIA 3KP8A 1ABAA 4LL4B 5B6NA 2FUG2 3GNJA 3F63A 2LJAA 2H72A 4OO5A 6GSTA 4IHUA 4ECJA 2CQ9A 2F3MA 2PWJA 2LKUA 2PUKC 2HRFA 2J23A 3GN3A 4EO3A 3LORA 4ECBA 1AAZA 1E6BA 1ZMAA 3DXBA 2XHFA 1THXA 1UA5A 4K8MA 1GTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRT A;  4EVM A;  1XWG A;  2I3Y A;  4BWQ A;  3QAV A;  5AIV A;  2H30 A;  1PSQ A;  1BED A;  3KMO A;  2YZU A;  4PQI A;  3HZ8 A;  3Q19 A;  2GT6 A;  4I2U A;  1VRS D;  4KSM A;  4F82 A;  1PL2 A;  1V57 A;  4PUA A;  4MF5 A;  3HA9 A;  1BQ7 A;  2C0G A;  3TDG A;  5EY6 A;  3GL3 A;  5JWQ B;  3VFI A;  2ON5 A;  4QQ7 A;  2HFD A;  3HCZ A;  2WRT A;  6GSV A;  3QMX A;  1F37 A;  4N10 A;  1WOU A;  4WET A;  1TU7 A;  3IA1 A;  2VCW A;  1ZOF A;  2PGT A;  1TDI A;  1MDJ A;  1TRV A;  2CA8 A;  1SK2 A;  1A2L A;  3TKS A;  3UAR A;  3DYR A;  1HD2 A;  2K18 A;  1YF0 A;  2DJ2 A;  3WGD A;  2A2R A;  5INY A;  1OKT A;  2EC4 A;  2LQQ A;  1TU8 A;  2YP6 A;  5ECR B;  2PER A;  4HJM A;  1XWB A;  1KBN A;  1V98 A;  2RM5 A;  2MMN A;  2ES7 A;  2VL3 A;  5GZZ B;  4Q5F A;  2B5X A;  4KE3 A;  4ZL8 A;  2YWN A;  6GSS A;  5ECO B;  3HY2 A;  1G7E A;  3M9J A;  4G2E A;  3I9V 2;  1PN9 A;  1WWJ A;  2DC5 A;  3BCK A;  5D9V A;  4PXO A;  2K8S A;  1OC9 B;  1SYR A;  1QXH A;  5L71 A;  5GSS A;  3IBH A;  3HDC A;  1EWX A;  3IAM 2;  4IEL A;  5J4U A;  4PGT A;  3TKS C;  1JLW A;  2OJL A;  2GQM A;  2F8A A;  1SK0 A;  3TRX A;  2XBQ A;  4NMU A;  5F06 A;  4DSQ A;  3CMI A;  5CP1 A;  4Q5N A;  3H93 A;  2CX3 A;  1R4W A;  3ME8 A;  3I43 A;  1W89 A;  4NHZ A;  1AUC A;  1TOF A;  2HSH A;  1WJK A;  1F6M C;  3DRN A;  4KDU A;  1J08 A;  2IN3 A;  2R4V A;  4JR6 A;  1EOG A;  1PD2 1;  3KZQ A;  2JAD A;  2JZS A;  3LFL A;  1DE2 A;  4K6X A;  3VLN A;  3ZFB A;  2H6Y A;  3HZ4 A;  2GZZ A;  3QCP A;  3KP9 A;  3TOU A;  3IK7 A;  4IBP A;  2E0Q A;  2PVO C;  3KGK A;  1KEB A;  1GTA A;  5KN0 A;  3G7Y A;  4HJ2 A;  1YQ1 A;  3WT1 A;  1ZGN A;  4WXT A;  3M0F A;  5DQS A;  3IXR A;  3ZZX A;  5CRG A;  4MH3 A;  1GP1 A;  4MA9 A;  5ID2 B;  2FWG A;  1Q4J A;  2VCT A;  2FGX A;  2IJY A;  4L0U A;  1O73 A;  2N5A A;  11GS A;  1GSQ A;  3QAW A;  5KN2 A;  5D9X A;  4IQ1 A;  5ENU A;  1SL0 B;  2P5R A;  2I9H A;  3GHA A;  2WFC A;  3L4N A;  5LCZ A;  4MAB A;  2R5G A;  4IN0 A;  4RQR A;  2MZC A;  2IME A;  5J41 A;  1AC1 A;  1XWK A;  1BAY A;  3D21 A;  4KUN A;  2HZF A;  2O7K A;  3TKP A;  1T1V A;  1PKZ A;  3VWV A;  1M2B A;  1TRU A;  4ZL7 A;  2CX4 A;  2B1K A;  3HJM A;  3DEX A;  2JZT A;  3GTU B;  4MPG A;  3K8N A;  2L4C A;  4FO5 A;  1JZR A;  4YQV A;  3TJB A;  2MMA A;  3KIJ A;  1HQO A;  4MCU A;  1SJI A;  2HYX A;  1AIU A;  3VK9 A;  4V2N A;  2YJ7 A;  5A4W A;  4FIW A;  1DSB A;  2A2S A;  1WPI A;  4GCI A;  3FK8 A;  2P0G A;  1ERT A;  3TCO A;  2FWE A;  4PX1 A;  2X8H A;  4I8B A;  2YWM A;  3KH9 A;  1TRW A;  4EXJ A;  4KH7 A;  1M99 A;  2XPD A;  2LV3 A;  3LSZ A;  4ML6 A;  1THO A;  3HJO A;  5FT3 A;  4HOJ A;  1SYX A;  4MZB A;  3ZYW A;  1K0O A;  3Q18 A;  2L6C A;  1YEP A;  2C0F A;  1MDI A;  2LJR A;  2H1D A;  1PX6 A;  4KX4 A;  4PNG A;  3DVW A;  1RK4 A;  1YY7 A;  3CRU A;  1XWC A;  1AQV A;  5DDL A;  1U3A A;  2L4Q A;  4MJE A;  2H0H A;  2DIY A;  1H4O A;  4DVC A;  3HD5 A;  4OFM A;  3ERW A;  4YQM A;  3VWW A;  1ACV A;  5C04 A;  1XBS A;  5B7C A;  5DAK B;  2VL9 A;  4KB3 A;  3DIE A;  3QDN A;  4N0Z A;  3UMA A;  1XOA A;  1ZYE A;  3HYP A;  2RM6 A;  3DWV A;  3CTG A;  2WB9 A;  19GS A;  2H75 A;  4OD7 A;  4F03 A;  5EPF A;  2LNS A;  1FO5 A;  3APO A;  5DJM A;  1G6Y A;  5COH A;  1PKW A;  2DJ0 A;  4IKH A;  3H79 A;  1N8J A;  1BJX A;  4XIH A;  4AGS A;  3C1R A;  3WT2 A;  2X99 A;  1JZO A;  2GGT A;  3Q6O A;  5HQP A;  2B5E A;  2V32 A;  1FVJ A;  2H70 A;  2C1Y A;  4GRF A;  3G7I A;  5IMA A;  4OCE A;  1K0M A;  2C3T A;  2PU9 C;  4DSS B;  1GUH A;  1XW9 A;  1N2A A;  4ZIJ A;  4BA7 A;  4XRA A;  4ZIL A;  4L0W A;  5CRH A;  1VGL A;  2VD0 A;  1QMV A;  1ML6 A;  2RUF A;  3UVT A;  3CSI A;  1SKR B;  3F6F A;  1ON4 A;  3HJP A;  3U5R E;  5E59 A;  4CHS A;  3QR6 A;  3RHC A;  5LD0 A;  4WF5 A;  2NDO A;  1GSF A;  1R26 A;  4IS0 A;  1PMT A;  2EIO A;  2IMI A;  1YJ6 A;  4BVY A;  1BYE A;  2LEG A;  4QL9 A;  2DJJ A;  4PNF A;  1K0D A;  1A2J A;  5GST A;  5IO0 A;  1Y25 A;  1SU9 A;  1OE8 A;  1XPV A;  4CW9 A;  3RDW A;  3R2Q A;  4EF0 A;  4DEJ A;  3Q74 A;  2FY6 A;  3L9U A;  2QC7 A;  4Z7X A;  4BWS A;  5IOW A;  1Z6N A;  3ZTL A;  2RII A;  1U88 A;  5JWO B;  2YWO A;  1PRX A;  2VUP A;  4MH2 A;  5KN3 A;  4NAX A;  4HU9 A;  2L5O A;  5HFI A;  3BBY A;  3UVH A;  2DJ1 A;  3F0I A;  4FYB A;  4ZL9 A;  3FEU A;  2GZP A;  2HZE A;  3D22 A;  3ERF A;  2PMT A;  5KN1 A;  1XFL A;  3D4T A;  4NV5 A;  4PQ1 A;  5H5R A;  2CT6 A;  5JCG A;  1CQH A;  1A0R P;  2IMF A;  1PGT A;  3GA4 A;  1F2E A;  1NSW A;  2NTO A;  5IMV A;  5E4W A;  3EIN A;  4FYU A;  3WYW A;  2R37 A;  3D0Z A;  1Z7R A;  4LMW A;  1SD9 A;  2YNX A;  3EMP A;  2DMM A;  3GYK A;  5GAN D;  4RUV A;  2KLX A;  2PVQ A;  5J9B A;  3W8S A;  4NHW A;  3IPZ A;  2I81 A;  5DCH A;  2CVD A;  1MD4 A;  4E8E A;  5CAX A;  2ALB A;  3TOT A;  2IMK A;  3F6D A;  3E9J B;  3G9B A;  3FW2 A;  3FR6 A;  4WR5 A;  1DBY A;  1AQW A;  4X1U A;  2B7K A;  2I1U A;  3GFK A;  3D5J A;  3GSS A;  4AJ8 A;  2O8V B;  2YWI A;  5AIS A;  4F0C A;  1O81 A;  1KTE A;  2E7P A;  2K9F A;  4J57 E;  2C3N A;  2M72 A;  3TKR A;  3WD6 A;  1GSS A;  3DML A;  4D73 A;  4K7O A;  5D73 A;  3TUE A;  3GKK A;  4IVF A;  3A5W A;  2IFQ A;  2VM1 A;  1AQX A;  3EMX A;  1ERU A;  4OFT A;  3TJJ A;  1K0A A;  4G19 A;  2YV7 A;  3KD0 A;  3RPN A;  4MZW A;  4I97 A;  3IOS A;  1QUW A;  6GSX A;  3BCI A;  2OBI A;  3F4R A;  2ZUP A;  5IPH A;  3QPM A;  3TKQ A;  4OFN A;  4EKZ A;  3LGC A;  3M9K A;  3EC3 A;  2PPT A;  2LNT A;  2C3Q A;  4KA0 A;  3IV4 A;  1SL2 B;  4NPB A;  1TRS A;  1Q98 A;  1T7P B;  2AV4 A;  4ISD A;  1WIK A;  4K0G A;  4TR1 A;  3EUR A;  4AJ7 A;  1ERV A;  2QGV A;  3CSH A;  3ZLP A;  5ABR A;  4BVX A;  4OCF A;  4E8H A;  4K1F A;  3KM6 A;  2VM2 A;  1OE7 A;  3P2A A;  2EIQ A;  1G7O A;  2Z9S A;  2CAQ A;  4O7H A;  4L8E A;  5D8I A;  2C8U A;  3EYT A;  2L59 A;  2RUE A;  5CNW A;  2AHE A;  4MDC A;  3VUR A;  2GST A;  4I5Q A;  5DJL A;  4GTU A;  3F3Q A;  2OAD A;  3A3T A;  2J9H A;  4POL A;  2F9S A;  2H76 A;  2VO4 A;  2H6Z A;  1X9M B;  2OAC A;  2GT5 A;  3QFB C;  4HI7 A;  5H5Q A;  3BJ5 A;  5CRW A;  3PIN A;  3GH6 A;  1F3B A;  2WJU A;  3P7X A;  4JBB A;  5IQY A;  2GS3 A;  1AW9 A;  2DIZ A;  3O76 A;  1GTB A;  5DQY A;  4YQU A;  10GS A;  4KND A;  1A24 A;  2IIY A;  5F0G A;  3LYP A;  1MEK A;  2HT9 A;  3KH7 A;  4GWR A;  3HKR A;  2YZH A;  1EV4 A;  2K6V A;  3A2V A;  3DD3 A;  1OKD A;  5ECN B;  2PBJ A;  5ECP B;  4KDY A;  5J5N A;  1X5C A;  3CSJ A;  1EGR A;  2JSY A;  5D96 A;  1AXD A;  4XS4 B;  3TJF A;  3SBC A;  2LRC A;  4IGJ A;  4ULX A;  4EL1 A;  3EWL A;  5G1K A;  3W6G A;  5DAL A;  4V2L A;  1RW1 A;  4YAV A;  2DBC A;  5G2Z A;  5IMZ A;  4POK A;  1SK1 A;  4G10 A;  1TK5 B;  2NPB A;  2JU5 A;  4AJ6 A;  2C80 A;  2X8G A;  2YJH A;  4JE1 A;  3ZFL A;  4K9Z A;  3P90 A;  9GSS A;  4LL1 B;  2DJK A;  1J9B A;  2B7J A;  1C72 A;  4H86 A;  2FLS A;  3MSZ A;  2QSI A;  4LMV A;  1EP8 A;  3QAG A;  4HUA A;  3VPQ A;  4O5R A;  4J2F A;  3HHV A;  1EV9 A;  1MD3 A;  3RHB A;  3SWL A;  1V58 A;  4TRX A;  5IIZ A;  1XIY A;  5ECK B;  4MF7 A;  4POB A;  1SKS B;  1Z3E A;  2O89 A;  4KSO A;  4KGI A;  4ZXG A;  3EE2 A;  1PA3 A;  2EIR A;  3UBK A;  3VWX A;  1WP0 A;  4NXI A;  2AB6 A;  3RPP A;  22GS A;  3PGT A;  2KOK A;  3MNG A;  1LBK A;  8GSS A;  1GSY A;  16GS A;  3W8J A;  3N5O A;  4V1A p;  5CO3 A;  1O8W A;  2WGR A;  4ZBD A;  3VPT A;  1O85 A;  3C1S A;  2KP2 A;  3KTL A;  3RBT A;  2FA8 A;  3H1N A;  1K3Y A;  2LQO A;  1B4Q A;  1R5P A;  5D9W A;  1XZO A;  2VL2 A;  4MJA A;  2H6X A;  2L57 A;  3KEB A;  5DCG A;  2R6K A;  3UJ1 A;  2E2G A;  3HVX A;  4TN8 A;  1PQN A;  2G0F A;  1I9D A;  4YH2 A;  4YAP A;  5EL8 A;  4V2M A;  1X5D A;  4LA1 A;  2DLX A;  3M1G A;  2H1A A;  1QQ2 A;  2HSY A;  4HQS A;  1M7T A;  2VLT A;  1FOV A;  4JU5 A;  1UN2 A;  1YF1 A;  2H73 A;  5AN1 A;  4DSR A;  1ZZY A;  3WGE A;  1ST9 A;  1XCC A;  2JL4 A;  3CRT A;  5A4U A;  2PN8 A;  4RI7 A;  3QOU A;  4MZC A;  5IM9 A;  2YAN A;  3N9J A;  5IOX A;  7GSS A;  2GQL A;  5D93 A;  4ACS A;  4EUY A;  5D9T A;  2VIM A;  5ECH B;  4KCE A;  4ECI A;  3EVI A;  2REM A;  3FZ9 A;  1VF2 A;  1M9B A;  2OA7 A;  1VF4 A;  4GSS A;  4MPF A;  3EU3 A;  3CBU A;  2YPM A;  1ZCP A;  5HFK A;  5CYY A;  1R7H A;  5JWR B;  4MF6 A;  2GQK A;  4IP6 A;  3E0U A;  3D6I A;  1FAA A;  4JZQ A;  3ZIJ A;  6GSU A;  1V9W A;  5KEJ A;  3GH9 A;  2CV4 A;  1A8L A;  3L78 A;  3TB2 A;  1YZX A;  1PX7 A;  4WKW A;  3ZML A;  1FHE A;  2FA4 A;  3IDV A;  3VI7 A;  3NIV A;  1U87 A;  4EDY A;  2V2G A;  3FR9 A;  1S3A A;  3F3R A;  3UBL A;  2DSA A;  5EVO A;  1EP7 A;  1OAZ A;  3L9S A;  2NVL A;  2DML A;  1U3I A;  4GXZ A;  4Q5Q A;  4X43 A;  2M80 A;  5HR1 A;  4JR4 A;  1OYJ A;  4MJC A;  2FWF A;  1GL8 A;  3L0H A;  2M46 A;  1LU4 A;  2WS2 A;  1X9W B;  3LXZ A;  3VWU A;  1U6T A;  3US3 A;  3P8W A;  1LJR A;  2VCX A;  3F4S A;  5F05 A;  4ZBB A;  5B8A A;  3PR8 A;  1V40 A;  1T3B A;  2D2Z A;  5FWG A;  1GNW A;  2VD1 A;  4WF4 A;  2XPE A;  5IPG A;  1G6W A;  2R3X A;  1TXX A;  2WZ9 A;  3HVS A;  5G5F A;  1VF1 A;  5LNK e;  17GS A;  1VF3 A;  1GSU A;  3LJR A;  3EU4 A;  4TXO A;  4GQF A;  4Q5R A;  3GUS A;  2TRC P;  1QFN A;  4PUF C;  4L5O A;  4OMV A;  1B9Y C;  1HNC A;  2VLU A;  3IR4 A;  2OBK A;  2KP1 A;  4K7I A;  1A2M A;  3GST A;  3CTF A;  2GSS A;  5ECI B;  2GSQ A;  3J7Y b;  2IL3 A;  2OKA A;  4NV2 A;  2O85 A;  1TK0 B;  2WDU A;  3GMF A;  4PQH A;  2GTU A;  1SD8 A;  1O8X A;  3LXT A;  2DJ3 A;  2F51 A;  3UEM A;  3JCM L;  2MBT A;  3A2W A;  1K0N A;  1M2A A;  3LEF A;  4WEY A;  1OC3 A;  3C7M A;  2HZE B;  2N5B A;  5ELG A;  3HXS A;  1JZW A;  4EE0 A;  2MMO A;  3TJK A;  2LS5 A;  3APS A;  3KJY A;  5F8B A;  5AIX A;  4MMM A;  2QKE A;  2H01 A;  4X0X A;  3L9V A;  1USB A;  2K8V A;  4N30 A;  1JFU A;  2GSR A;  3TGZ A;  3CYN A;  3LQ7 A;  5AGY A;  4XS1 A;  4GF0 A;  4KW6 A;  2YN1 A;  2E2M A;  1ZL9 A;  4K0N A;  5IMF A;  1M0U A;  1TI3 A;  4XTS A;  4O92 A;  2LJK A;  4GQC A;  1EOH A;  1YKC A;  4POM A;  1FVK A;  5G31 A;  1ZYQ B;  4HDE A;  1XVW A;  1V2A A;  2IPA A;  4L5L A;  4PUR A;  1XXU A;  1Z6M A;  5A4V A;  3C73 A;  2FD3 A;  1TTZ A;  4GSN A;  20GS A;  1YDK A;  2AAW A;  2B3S A;  2MBS A;  1FB0 A;  3M8N A;  2TIR A;  3UAP A;  4XRD A;  4F0B A;  3GKN A;  3O3T A;  3I69 A;  1YKA A;  1GSE A;  4MLY A;  2AUV A;  3DGQ A;  3UL3 A;  4D73 B;  1OVN A;  2YCD A;  4KCA A;  3ZIV A;  1OC9 A;  14GS A;  2CAI A;  2IFQ B;  2V1M A;  3ISO A;  3ZIT A;  2YOI A;  1GTU A;  3H8Q A;  3QD9 A;  4WBR D;  2FWH A;  2V41 A;  3TKS E;  1NHO A;  2V6K A;  1A8Y A;  5HFG A;  5IMD A;  2IWT A;  1Z7P A;  1MDK A;  2H19 A;  1WRY A;  3TRQ A;  1QGV A;  2OE3 A;  3FZ5 A;  5CRD A;  1HNA A;  1W4V A;  3KMN A;  2BJX A;  4TVE A;  4ML1 A;  2H1G A;  5IO2 A;  5CRE A;  3TJG A;  3FR3 A;  1RQM A;  1M9A A;  4IJI A;  2H74 A;  2A4V A;  1A23 A;  3FRC A;  4TR1 B;  2H0G A;  1WE0 A;  2JSZ A;  3MWH A;  4GLT A;  2BMX A;  2JAC A;  5HR0 A;  4EC0 A;  5B6M A;  1X9S B;  1TW9 A;  3CXG A;  3VI5 A;  5IMC A;  2B6M A;  4HZ4 A;  2CVB A;  2VOC A;  2FHE A;  2GVP A;  2YV9 A;  1GRX A;  2GDR A;  1K0C A;  1X0R A;  1GLQ A;  3FHK A;  1O7U A;  18GS A;  3GUR A;  1TP9 A;  4XS4 A;  3U6V A;  2MYG A;  5ID2 A;  4G9H A;  1Z5Y E;  1S3D A;  4IW9 A;  3ZVJ D;  4WR4 A;  5G5E A;  1K3L A;  3GIX A;  4JED A;  1K0B A;  2MMZ A;  3ME7 A;  1S3C A;  3C71 A;  2AYT A;  1E2Y A;  2KHP A;  3IAS 2;  2XBI A;  1HNB A;  3APQ A;  5C00 A;  1JZD A;  1TI1 A;  1BG5 A;  2ZNM A;  3E3E A;  4WBJ A;  3GRX A;  4LLR A;  1GLP A;  4TW5 A;  4NWY A;  5JCU A;  4JRR A;  1JHB A;  3GTU A;  5HR2 A;  1GUL A;  1JLV A;  2I4A A;  5DVB A;  2HNL A;  5ECQ B;  3FZA A;  3PH9 A;  3QFA C;  2V6O A;  2XC2 A;  4XS6 A;  4F2I A;  3DVX A;  3GKX A;  2X64 A;  2HXK A;  3WGX A;  5B8B A;  1B48 A;  4HZ2 A;  1OC8 A;  1PL1 A;  3MAK A;  2BTO T;  4RI6 A;  5DBQ A;  1T8E B;  1GSD A;  1YEX A;  2P31 A;  2TRX A;  1UC7 A;  4OWY A;  3OR5 A;  4O32 A;  4AF2 A;  3ZRE A;  1B9X C;  5DAL B;  5GAP D;  2VCQ A;  3ED3 A;  1FB6 A;  1GWC A;  3FY7 A;  1SEN A;  3ERG A;  3IK9 A;  2C4J A;  6GSW A;  1R5A A;  2N5F A;  3KCM A;  3GX0 A;  4TR0 A;  5A5K A;  4MP4 A;  2HRN A;  4ZB6 A;  4HU7 A;  3KTB A;  4I2T A;  3LWA A;  3RAZ A;  4HQZ A;  1NM3 A;  1KNG A;  1Z9H A;  3F9U A;  3IC4 A;  1T4Y A;  4ZB8 A;  4ZB9 A;  1DE1 A;  3GKM A;  4V1A g;  4P3Y B;  1GUK A;  2RLI A;  2B5Y A;  1T00 A;  3C8E A;  1GH2 A;  4HEA 2;  2VCV A;  1ILO A;  1IYH A;  4ID0 A;  4XCS A;  2G2Q A;  4TOP A;  4TKY A;  1DUG A;  3UIW A;  5ECM B;  1URM A;  5G1L A;  1FW1 A;  3D4M A;  3LG6 A;  4TR3 A;  2WUL A;  5DAK A;  6GSY A;  1MTC A;  1SL1 B;  1XVQ A;  1XWA A;  3NZN A;  2HI7 A;  1M2D A;  4RQX A;  2H71 A;  3NOF A;  1F9M A;  3HVV A;  1GUM A;  3G7J A;  4K7N A;  1F3A A;  5H5S A;  1XOB A;  4N0V A;  1CQG A;  2CVK A;  1EEJ A;  4IQA A;  1B8X A;  5ELA A;  2GLR A;  2LUS A;  2CZ3 A;  3ZRD A;  2H0I A;  5FHI A;  3AY8 A;  3I6A A;  2FNO A;  3BD2 A;  1T4Z A;  1TJD A;  13GS A;  5HR3 A;  1SKW B;  1TKD B;  2LTK A;  2O87 A;  2IMD A;  4DSS A;  4ILF A;  2JZR A;  2VL2 C;  2F8F A;  4FYC A;  4FH8 A;  2X8C A;  1A0F A;  4OO4 A;  2HLS A;  1ERW A;  2H66 A;  4ECC A;  1WMJ A;  3ZL5 A;  4K2D A;  3GL5 A;  3J7Y k;  2WCI A;  5ECL B;  1UVZ A;  4I6X A;  3GX8 A;  3FZ4 A;  2LRN A;  2HE3 A;  2ON7 A;  1QK8 A;  3M3M A;  1X5E A;  1Y6E A;  3F4T A;  1NHY A;  3UOM A;  2P5Q A;  4ZBA A;  3ZVJ A;  5JCW A;  4TR4 A;  4CDO A;  4GST A;  4HS1 A;  4MK3 A;  4F9Z A;  3IRA A;  1BX9 A;  5J3R A;  2AJQ B;  1XW5 A;  4N11 A;  5F07 A;  2L5L A;  2H8L A;  3A2X A;  1FG4 A;  1J0F A;  3BOA A;  1SJZ A;  3FYG A;  4MJB A;  1O6J A;  4IP1 A;  12GS A;  1EZK A;  2VLV A;  3DKS A;  3H4K A;  2L6D A;  3GV1 A;  3IHQ A;  2OE0 A;  5G30 A;  4BL7 A;  1GNE A;  1NW2 A;  5J9C A;  1EEM A;  3MDK A;  3O6T A;  3ZMK A;  3FKF A;  2B1L A;  2KUC A;  3KXO A;  2H1B A;  2VCZ A;  4QL7 A;  1B4P A;  4TXV A;  1I5G A;  3LYK A;  1EGO A;  1HYU A;  3F8U A;  1G0T A;  1XW6 A;  3V1W A;  4BPY A;  2C0E A;  3S9F A;  2LST A;  4KDX A;  3TRP A;  4EDZ A;  2FCH A;  1TK8 B;  3IE3 A;  2GZY A;  4KAE A;  2NBS A;  2C0D A;  5ECS A;  2OE1 A;  1SJ6 A;  4IJ3 A;  2CZ2 A;  1H75 A;  2ZCT A;  2R2J A;  4J56 E;  4XHM A;  2VAF A;  1K3O A;  4TXO B;  1IYI A;  3KP8 A;  1ABA A;  4LL4 B;  5B6N A;  2FUG 2;  3GNJ A;  3F63 A;  2LJA A;  2H72 A;  4OO5 A;  6GST A;  4IHU A;  4ECJ A;  2CQ9 A;  2F3M A;  2PWJ A;  2LKU A;  2PUK C;  2HRF A;  2J23 A;  3GN3 A;  4EO3 A;  3LOR A;  4ECB A;  1AAZ A;  1E6B A;  1ZMA A;  3DXB A;  2XHF A;  1THX A;  1UA5 A;  4K8M A;  1GTI A; 
#chains in the Genus database with same CATH topology
 2LRT A;  4EVM A;  1XWG A;  2I3Y A;  4BWQ A;  3QAV A;  5AIV A;  2H30 A;  1PSQ A;  1BED A;  3KMO A;  2YZU A;  4PQI A;  3HZ8 A;  3Q19 A;  2GT6 A;  4I2U A;  1VRS D;  4KSM A;  4F82 A;  1PL2 A;  1V57 A;  4PUA A;  4MF5 A;  3HA9 A;  1BQ7 A;  2C0G A;  3TDG A;  5EY6 A;  3GL3 A;  5JWQ B;  3VFI A;  2ON5 A;  4QQ7 A;  2HFD A;  3HCZ A;  2WRT A;  6GSV A;  3QMX A;  1F37 A;  4N10 A;  1WOU A;  4WET A;  4CY6 A;  1TU7 A;  3IA1 A;  2VCW A;  1ZOF A;  2PGT A;  1TDI A;  1MDJ A;  1TRV A;  2CA8 A;  1SK2 A;  1A2L A;  3TKS A;  3UAR A;  3DYR A;  1HD2 A;  2K18 A;  1YF0 A;  2DJ2 A;  3WGD A;  2A2R A;  5INY A;  1OKT A;  2EC4 A;  2LQQ A;  1TU8 A;  2YP6 A;  5ECR B;  2PER A;  4HJM A;  1XWB A;  1KBN A;  1V98 A;  2RM5 A;  2MMN A;  2ES7 A;  3FMW A;  2VL3 A;  1ZYN A;  4G0L A;  5GZZ B;  4Q5F A;  2B5X A;  4KE3 A;  4ZL8 A;  2YWN A;  6GSS A;  5ECO B;  3HY2 A;  1G7E A;  3M9J A;  4G2E A;  4O5Q A;  4Z2T A;  3I9V 2;  1PN9 A;  1WWJ A;  2DC5 A;  3BCK A;  5D9V A;  4PXO A;  2K8S A;  1OC9 B;  1SYR A;  1QXH A;  5L71 A;  5GSS A;  3IBH A;  3HDC A;  1EWX A;  3IAM 2;  4IEL A;  5J4U A;  4PGT A;  3TKS C;  1JLW A;  2OJL A;  2GQM A;  2F8A A;  1SK0 A;  3TRX A;  2XBQ A;  4NMU A;  5F06 A;  4DSQ A;  3CMI A;  5CP1 A;  4Q5N A;  3H93 A;  2CX3 A;  1R4W A;  3ME8 A;  3I43 A;  1W89 A;  4NHZ A;  1AUC A;  1TOF A;  2HSH A;  1WJK A;  1F6M C;  3DRN A;  2R0G A;  4KDU A;  1J08 A;  2IN3 A;  2R4V A;  4JR6 A;  1EOG A;  1PD2 1;  3KZQ A;  2JAD A;  2JZS A;  3LFL A;  1DE2 A;  4K6X A;  3VLN A;  3ZFB A;  2H6Y A;  5KOX A;  3HZ4 A;  2GZZ A;  3QCP A;  3KP9 A;  3TOU A;  3IK7 A;  4IBP A;  2E0Q A;  2PVO C;  3KGK A;  1KEB A;  1GTA A;  5KN0 A;  3G7Y A;  4HJ2 A;  1YQ1 A;  3WT1 A;  1ZGN A;  4WXT A;  3M0F A;  5DQS A;  3IXR A;  3ZZX A;  5CRG A;  4MH3 A;  1GP1 A;  4MA9 A;  5ID2 B;  2FWG A;  1Q4J A;  2VCT A;  2FGX A;  2IJY A;  4L0U A;  1O73 A;  2N5A A;  11GS A;  1GSQ A;  3QAW A;  5KN2 A;  5D9X A;  4IQ1 A;  5ENU A;  1SL0 B;  2P5R A;  2I9H A;  3GHA A;  2WFC A;  2A4H A;  3L4N A;  5LCZ A;  4MAB A;  2R5G A;  4IN0 A;  4RQR A;  2MZC A;  2IME A;  5J41 A;  1AC1 A;  1XWK A;  1BAY A;  3D21 A;  4KUN A;  2HZF A;  2O7K A;  3TKP A;  1T1V A;  1PKZ A;  3VWV A;  1M2B A;  1TRU A;  4Z2U A;  4ZL7 A;  2CX4 A;  2B1K A;  3HJM A;  3DEX A;  2JZT A;  3GTU B;  4MPG A;  3K8N A;  2L4C A;  4FO5 A;  1JZR A;  4YQV A;  3TJB A;  2MMA A;  3KIJ A;  1HQO A;  4MCU A;  1SJI A;  2HYX A;  1AIU A;  3VK9 A;  4V2N A;  2YJ7 A;  5A4W A;  4FIW A;  1DSB A;  2A2S A;  1WPI A;  4GCI A;  3FK8 A;  2P0G A;  1ERT A;  3TCO A;  2FWE A;  4PX1 A;  2X8H A;  4I8B A;  2YWM A;  3KH9 A;  1TRW A;  4EXJ A;  4KH7 A;  1M99 A;  2XPD A;  2LV3 A;  3LSZ A;  4ML6 A;  1THO A;  3HJO A;  5FT3 A;  4HOJ A;  1SYX A;  4MZB A;  3ZYW A;  4K2X A;  4EIP A;  1K0O A;  3Q18 A;  2L6C A;  5BRT A;  1YEP A;  2C0F A;  1MDI A;  2LJR A;  2H1D A;  1PX6 A;  4KX4 A;  4PNG A;  3DVW A;  2R0C A;  1RK4 A;  1YY7 A;  3CRU A;  1M3I A;  1XWC A;  1AQV A;  5DDL A;  1U3A A;  2L4Q A;  4MJE A;  2H0H A;  2DIY A;  1H4O A;  4DVC A;  3HD5 A;  4OFM A;  3ERW A;  4YQM A;  3VWW A;  1ACV A;  5C04 A;  1XBS A;  5B7C A;  5DAK B;  2VL9 A;  4KB3 A;  1M3J A;  3DIE A;  3QDN A;  4N0Z A;  3UMA A;  1XOA A;  1ZYE A;  3HYP A;  2RM6 A;  3DWV A;  3CTG A;  2WB9 A;  19GS A;  2H75 A;  4OD7 A;  4F03 A;  5EPF A;  2LNS A;  1FO5 A;  4EIQ A;  3APO A;  5DJM A;  1G6Y A;  5COH A;  1PKW A;  2DJ0 A;  4IKH A;  3H79 A;  1N8J A;  1BJX A;  4XIH A;  4AGS A;  3C1R A;  3WT2 A;  2X99 A;  1JZO A;  2GGT A;  3Q6O A;  5HQP A;  2B5E A;  2V32 A;  1FVJ A;  2H70 A;  2C1Y A;  4GRF A;  3G7I A;  5IMA A;  4OCE A;  2HRK A;  1K0M A;  2C3T A;  2PU9 C;  4DSS B;  1GUH A;  1XW9 A;  1N2A A;  4ZIJ A;  4BA7 A;  4XRA A;  4ZIL A;  4L0W A;  4MNN A;  5CRH A;  1VGL A;  2VD0 A;  1QMV A;  1ML6 A;  2RUF A;  3UVT A;  3CSI A;  5BMU A;  1SKR B;  3F6F A;  1ON4 A;  3HJP A;  3U5R E;  5E59 A;  4CHS A;  3QR6 A;  3RHC A;  5LD0 A;  4WF5 A;  2NDO A;  1GSF A;  1R26 A;  4IS0 A;  1PMT A;  2EIO A;  2IMI A;  1YJ6 A;  4BVY A;  1BYE A;  2LEG A;  4QL9 A;  2DJJ A;  4PNF A;  1K0D A;  1A2J A;  5GST A;  5IO0 A;  1Y25 A;  2X49 A;  1SU9 A;  1OE8 A;  1XPV A;  4CW9 A;  3RDW A;  3R2Q A;  4EF0 A;  4DEJ A;  3Q74 A;  4K5R A;  2FY6 A;  3L9U A;  2QC7 A;  4Z7X A;  4BWS A;  5IOW A;  1Z6N A;  3ZTL A;  2RII A;  1U88 A;  5JWO B;  2YWO A;  1PRX A;  2VUP A;  4MH2 A;  5KN3 A;  4NAX A;  1S3R A;  4HU9 A;  2L5O A;  5HFI A;  3BBY A;  3UVH A;  2DJ1 A;  3F0I A;  4FYB A;  4ZL9 A;  3FEU A;  2GZP A;  4BL7 B;  2HZE A;  3D22 A;  3ERF A;  2PMT A;  5KN1 A;  1XFL A;  3D4T A;  4NV5 A;  4PQ1 A;  5H5R A;  2CT6 A;  5JCG A;  1CQH A;  2X4A A;  1A0R P;  2IMF A;  3MYD A;  1PGT A;  3GA4 A;  1F2E A;  1NSW A;  2NTO A;  5IMV A;  5E4W A;  3EIN A;  4FYU A;  3WYW A;  2R37 A;  3D0Z A;  1Z7R A;  3IHG A;  4LMW A;  1SD9 A;  2YNX A;  3EMP A;  2DMM A;  3GYK A;  5GAN D;  4RUV A;  2KLX A;  2PVQ A;  5J9B A;  3W8S A;  4NHW A;  3IPZ A;  2I81 A;  5DCH A;  2CVD A;  1MD4 A;  4E8E A;  5CAX A;  2ALB A;  3TOT A;  2IMK A;  3F6D A;  3E9J B;  3G9B A;  4K5S A;  3FW2 A;  3FR6 A;  4WR5 A;  1DBY A;  1AQW A;  4X1U A;  2B7K A;  2I1U A;  3GFK A;  3D5J A;  3GSS A;  4AJ8 A;  2O8V B;  2YWI A;  5AIS A;  4F0C A;  1O81 A;  1KTE A;  2E7P A;  2K9F A;  4J57 E;  2C3N A;  2M72 A;  3TKR A;  3WD6 A;  1GSS A;  3DML A;  4D73 A;  4K7O A;  3CQF A;  5D73 A;  3TUE A;  3GKK A;  4IVF A;  3A5W A;  2DKH A;  2IFQ A;  2VM1 A;  1AQX A;  3EMX A;  1ERU A;  4OFT A;  3TJJ A;  1K0A A;  4G19 A;  2YV7 A;  3KD0 A;  3RPN A;  4MZW A;  4I97 A;  3IOS A;  1QUW A;  6GSX A;  3BCI A;  2OBI A;  3F4R A;  2ZUP A;  5IPH A;  3QPM A;  3TKQ A;  4OFN A;  4EKZ A;  3LGC A;  3M9K A;  3EC3 A;  2PPT A;  2LNT A;  2C3Q A;  4KA0 A;  3IV4 A;  4FQU A;  1SL2 B;  4NPB A;  1TRS A;  1Q98 A;  1T7P B;  2AV4 A;  4ISD A;  1WIK A;  4K0G A;  4TR1 A;  3EUR A;  4AJ7 A;  1ERV A;  2QGV A;  3CSH A;  3ZLP A;  5ABR A;  4BVX A;  4OCF A;  4E8H A;  4K1F A;  3KM6 A;  2VM2 A;  1OE7 A;  3P2A A;  2EIQ A;  1G7O A;  2Z9S A;  2CAQ A;  4O7H A;  4L8E A;  5D8I A;  2C8U A;  3EYT A;  2L59 A;  2RUE A;  5CNW A;  2AHE A;  4MDC A;  3VUR A;  2GST A;  4I5Q A;  4YKF A;  5DJL A;  4GTU A;  3F3Q A;  2OAD A;  3A3T A;  2J9H A;  4POL A;  2F9S A;  2R0P A;  2H76 A;  2VO4 A;  2H6Z A;  1X9M B;  2OAC A;  2GT5 A;  3QFB C;  4HI7 A;  5H5Q A;  3BJ5 A;  5CRW A;  3PIN A;  3GH6 A;  1F3B A;  2WJU A;  3P7X A;  4JBB A;  5IQY A;  2GS3 A;  1AW9 A;  2DIZ A;  3O76 A;  1GTB A;  5DQY A;  4YQU A;  10GS A;  4KND A;  1A24 A;  2IIY A;  5F0G A;  3LYP A;  1MEK A;  2HT9 A;  3KH7 A;  4GWR A;  3HKR A;  2YZH A;  1EV4 A;  2K6V A;  1FOH A;  3A2V A;  3DD3 A;  1OKD A;  5ECN B;  2PBJ A;  4PTS A;  5ECP B;  4KDY A;  5J5N A;  1X5C A;  3CSJ A;  1EGR A;  2JSY A;  5D96 A;  1AXD A;  4XS4 B;  3TJF A;  3SBC A;  2LRC A;  4IGJ A;  4ULX A;  4EL1 A;  3EWL A;  5G1K A;  3W6G A;  3R3E A;  5DAL A;  4V2L A;  1RW1 A;  4YAV A;  2DBC A;  5G2Z A;  5IMZ A;  4POK A;  1SK1 A;  4G10 A;  1TK5 B;  2NPB A;  2JU5 A;  4AJ6 A;  2C80 A;  1PFO A;  2X8G A;  2YJH A;  4JE1 A;  3ZFL A;  4K9Z A;  3P90 A;  9GSS A;  3MIX A;  4LL1 B;  2DJK A;  1J9B A;  2B7J A;  4USS A;  1C72 A;  4H86 A;  2HRA A;  2FLS A;  3MSZ A;  2QSI A;  4LMV A;  1EP8 A;  3QAG A;  4HUA A;  3VPQ A;  4O5R A;  4J2F A;  3HHV A;  1EV9 A;  1MD3 A;  3RHB A;  3SWL A;  1V58 A;  4TRX A;  5IIZ A;  1XIY A;  5ECK B;  4MF7 A;  4POB A;  1SKS B;  1Z3E A;  2O89 A;  4KSO A;  4KGI A;  4ZXG A;  3EE2 A;  1PA3 A;  2EIR A;  3UBK A;  3VWX A;  1WP0 A;  4NXI A;  2AB6 A;  3RPP A;  22GS A;  3PGT A;  2KOK A;  3MNG A;  1LBK A;  8GSS A;  1GSY A;  16GS A;  3W8J A;  3N5O A;  4V1A p;  5CO3 A;  1O8W A;  2WGR A;  4ZBD A;  3VPT A;  1O85 A;  3C1S A;  2KP2 A;  3KTL A;  3RBT A;  2FA8 A;  3H1N A;  1K3Y A;  2LQO A;  1B4Q A;  1R5P A;  5D9W A;  1XZO A;  2VL2 A;  4MJA A;  2H6X A;  2L57 A;  3KEB A;  5DCG A;  2R6K A;  3UJ1 A;  2E2G A;  3HVX A;  4TN8 A;  1PQN A;  2G0F A;  1I9D A;  4YH2 A;  4YAP A;  5EL8 A;  4V2M A;  1X5D A;  4LA1 A;  2DLX A;  3M1G A;  2H1A A;  1QQ2 A;  2HSY A;  4HQS A;  1M7T A;  2VLT A;  1FOV A;  4JU5 A;  1UN2 A;  1YF1 A;  2H73 A;  5AN1 A;  4DSR A;  1ZZY A;  3WGE A;  1ST9 A;  1XCC A;  2JL4 A;  3CRT A;  5A4U A;  2PN8 A;  4RI7 A;  3QOU A;  4MZC A;  5IM9 A;  2YAN A;  3N9J A;  5IOX A;  7GSS A;  2GQL A;  5D93 A;  4ACS A;  4A5P A;  4EUY A;  5D9T A;  2VIM A;  5ECH B;  4KCE A;  4ECI A;  3EVI A;  2REM A;  3FZ9 A;  1VF2 A;  1M9B A;  4CY8 A;  2OA7 A;  1VF4 A;  4GSS A;  4MPF A;  3EU3 A;  3CBU A;  2YPM A;  1ZCP A;  5HFK A;  5CYY A;  1R7H A;  5JWR B;  4MF6 A;  2GQK A;  4IP6 A;  3E0U A;  3D6I A;  1FAA A;  4JZQ A;  3ZIJ A;  6GSU A;  1V9W A;  5KEJ A;  3GH9 A;  2CV4 A;  1A8L A;  3L78 A;  3TB2 A;  1YZX A;  1PX7 A;  4WKW A;  3ZML A;  1FHE A;  2FA4 A;  3IDV A;  3VI7 A;  3NIV A;  1U87 A;  4X4J A;  4EDY A;  2V2G A;  4KF9 A;  3FR9 A;  1S3A A;  3F3R A;  3UBL A;  2DSA A;  5EVO A;  1EP7 A;  1OAZ A;  3L9S A;  2NVL A;  2DML A;  1U3I A;  4GXZ A;  4Q5Q A;  4X43 A;  2M80 A;  5HR1 A;  4BIK A;  5KOW A;  4JR4 A;  1OYJ A;  4MJC A;  2FWF A;  1GL8 A;  3L0H A;  2M46 A;  1LU4 A;  2WS2 A;  1X9W B;  3LXZ A;  3PPU A;  3VWU A;  1U6T A;  3US3 A;  3P8W A;  1LJR A;  2VCX A;  3F4S A;  5F05 A;  4ZBB A;  5B8A A;  3PR8 A;  1V40 A;  1PN0 A;  1T3B A;  2D2Z A;  5FWG A;  1GNW A;  2VD1 A;  4WF4 A;  2HSM A;  2XPE A;  5IPG A;  1G6W A;  2R3X A;  1TXX A;  2WZ9 A;  3HVS A;  5G5F A;  1VF1 A;  5LNK e;  17GS A;  1VF3 A;  1GSU A;  3LJR A;  3EU4 A;  4TXO A;  4GQF A;  4Q5R A;  3GUS A;  2TRC P;  1QFN A;  4PUF C;  4L5O A;  4OMV A;  1B9Y C;  1HNC A;  2VLU A;  3IR4 A;  2OBK A;  2KP1 A;  4BVY B;  4K7I A;  1A2M A;  3GST A;  3CTF A;  2GSS A;  5ECI B;  2GSQ A;  3J7Y b;  2IL3 A;  2OKA A;  4NV2 A;  2O85 A;  1TK0 B;  2WDU A;  3GMF A;  4PQH A;  2GTU A;  1SD8 A;  1O8X A;  3LXT A;  2DJ3 A;  2F51 A;  3UEM A;  3JCM L;  2MBT A;  3HVN A;  3A2W A;  1K0N A;  1M2A A;  3LEF A;  3A5I A;  4WEY A;  1OC3 A;  3C7M A;  2HZE B;  2N5B A;  5ELG A;  3HXS A;  1JZW A;  4EE0 A;  2MMO A;  3EPT A;  3TJK A;  2LS5 A;  3APS A;  3KJY A;  5F8B A;  5AIX A;  4MMM A;  2QKE A;  2H01 A;  4X0X A;  3L9V A;  1USB A;  2K8V A;  4N30 A;  1JFU A;  2GSR A;  4G0K A;  3TGZ A;  3CYN A;  3LQ7 A;  5AGY A;  4XS1 A;  4GF0 A;  4KW6 A;  2YN1 A;  2E2M A;  1ZL9 A;  4K0N A;  5IMF A;  2QA1 A;  1M0U A;  1TI3 A;  4XTS A;  4O92 A;  2LJK A;  4GQC A;  1EOH A;  1YKC A;  4POM A;  1FVK A;  5G31 A;  1ZYQ B;  4HDE A;  1XVW A;  1V2A A;  2IPA A;  4L5L A;  4O5U A;  4PUR A;  1XXU A;  1Z6M A;  2QA2 A;  5A4V A;  3C73 A;  2FD3 A;  1TTZ A;  4GSN A;  20GS A;  1YDK A;  2AAW A;  2B3S A;  2MBS A;  4YKG A;  1FB0 A;  3M8N A;  2TIR A;  1XG8 A;  3UAP A;  4XRD A;  4F0B A;  3GKN A;  3O3T A;  3I69 A;  1YKA A;  1GSE A;  4MLY A;  2AUV A;  3DGQ A;  3UL3 A;  4D73 B;  1OVN A;  2YCD A;  4KCA A;  3ZIV A;  1OC9 A;  14GS A;  2CAI A;  2IFQ B;  2V1M A;  3ISO A;  3ZIT A;  2YOI A;  1GTU A;  3H8Q A;  3QD9 A;  4WBR D;  2FWH A;  2V41 A;  3TKS E;  1NHO A;  2V6K A;  1A8Y A;  5HFG A;  5IMD A;  2IWT A;  1Z7P A;  1MDK A;  2H19 A;  1WRY A;  3TRQ A;  1QGV A;  2OE3 A;  3FZ5 A;  5CRD A;  1HNA A;  1W4V A;  3KMN A;  2BJX A;  4TVE A;  4ML1 A;  2H1G A;  5IO2 A;  5CRE A;  3TJG A;  3FR3 A;  1RQM A;  1M9A A;  4IJI A;  2H74 A;  2A4V A;  1A23 A;  3FRC A;  4TR1 B;  2H0G A;  1WE0 A;  2JSZ A;  3MWH A;  4GLT A;  2BMX A;  2JAC A;  4BVX B;  5HR0 A;  4EC0 A;  5B6M A;  1X9S B;  1TW9 A;  3CXG A;  3VI5 A;  5IMC A;  2B6M A;  4HZ4 A;  2CVB A;  2VOC A;  2FHE A;  2GVP A;  2YV9 A;  1GRX A;  2GDR A;  1K0C A;  1X0R A;  1GLQ A;  3FHK A;  1O7U A;  18GS A;  3GUR A;  1TP9 A;  4XS4 A;  3U6V A;  2MYG A;  5ID2 A;  4G9H A;  1Z5Y E;  1S3D A;  4IW9 A;  3ZVJ D;  4WR4 A;  5G5E A;  2DKI A;  1K3L A;  3GIX A;  4JED A;  1K0B A;  2MMZ A;  3ME7 A;  1S3C A;  3C71 A;  2AYT A;  1E2Y A;  2KHP A;  3IAS 2;  2XBI A;  1HNB A;  3APQ A;  5C00 A;  1JZD A;  1TI1 A;  1BG5 A;  2ZNM A;  3E3E A;  4WBJ A;  3GRX A;  4LLR A;  1GLP A;  4TW5 A;  4NWY A;  5JCU A;  4JRR A;  1JHB A;  3GTU A;  5HR2 A;  1GUL A;  1JLV A;  2I4A A;  5DVB A;  2HNL A;  5ECQ B;  3FZA A;  3PH9 A;  3QFA C;  2V6O A;  2XC2 A;  4XS6 A;  4F2I A;  3DVX A;  3GKX A;  2X64 A;  2HXK A;  3WGX A;  5B8B A;  1B48 A;  4HZ2 A;  1OC8 A;  1PL1 A;  3MAK A;  2BTO T;  4RI6 A;  5DBQ A;  1T8E B;  1GSD A;  1YEX A;  2P31 A;  2TRX A;  1UC7 A;  4OWY A;  3OR5 A;  4O32 A;  4AF2 A;  3ZRE A;  1B9X C;  5DAL B;  5GAP D;  2VCQ A;  3ED3 A;  1FB6 A;  1GWC A;  1ZYP A;  3FY7 A;  1SEN A;  3ERG A;  3IK9 A;  2C4J A;  6GSW A;  1R5A A;  2N5F A;  3KCM A;  3GX0 A;  4TR0 A;  5A5K A;  4MP4 A;  2HRN A;  4ZB6 A;  4HU7 A;  3KTB A;  4I2T A;  3LWA A;  3RAZ A;  4HQZ A;  1NM3 A;  1KNG A;  1Z9H A;  3F9U A;  3IC4 A;  1T4Y A;  4ZB8 A;  4ZB9 A;  1DE1 A;  3GKM A;  4V1A g;  4P3Y B;  1GUK A;  2RLI A;  2B5Y A;  1T00 A;  3C8E A;  1GH2 A;  4HEA 2;  2VCV A;  1ILO A;  1IYH A;  4ID0 A;  4XCS A;  2G2Q A;  4TOP A;  4TKY A;  1DUG A;  3UIW A;  5ECM B;  1URM A;  5G1L A;  4G0I A;  1FW1 A;  3D4M A;  3LG6 A;  4TR3 A;  2WUL A;  5DAK A;  6GSY A;  1MTC A;  1SL1 B;  1XVQ A;  1XWA A;  3NZN A;  2HI7 A;  1M2D A;  4RQX A;  2H71 A;  3NOF A;  1F9M A;  3HVV A;  1GUM A;  3G7J A;  4K7N A;  1F3A A;  5H5S A;  1XOB A;  4N0V A;  1CQG A;  2CVK A;  1EEJ A;  4IQA A;  1B8X A;  5ELA A;  4ICY A;  2GLR A;  2LUS A;  2CZ3 A;  3ZRD A;  2H0I A;  5FHI A;  3AY8 A;  3I6A A;  2FNO A;  3BD2 A;  1T4Z A;  1TJD A;  3LW9 A;  13GS A;  5HR3 A;  1SKW B;  1TKD B;  2LTK A;  2O87 A;  2IMD A;  4DSS A;  4ILF A;  2JZR A;  2VL2 C;  2F8F A;  4FYC A;  4FH8 A;  4Z2R A;  2X8C A;  1A0F A;  4OO4 A;  2HLS A;  1ERW A;  2H66 A;  4ECC A;  1WMJ A;  3ZL5 A;  4K2D A;  3GL5 A;  3J7Y k;  2WCI A;  5ECL B;  1UVZ A;  4I6X A;  3GX8 A;  3FZ4 A;  2LRN A;  2HE3 A;  2ON7 A;  1QK8 A;  3M3M A;  1X5E A;  1Y6E A;  3F4T A;  1NHY A;  3UOM A;  2P5Q A;  4ZBA A;  3ZVJ A;  5JCW A;  4TR4 A;  4CDO A;  4GST A;  4HS1 A;  4MK3 A;  4F9Z A;  3IRA A;  1BX9 A;  5J3R A;  2AJQ B;  1XW5 A;  4N11 A;  5F07 A;  2L5L A;  2H8L A;  2A2P A;  3A2X A;  1FG4 A;  1J0F A;  3BOA A;  1SJZ A;  3FYG A;  4MJB A;  1O6J A;  4IP1 A;  12GS A;  1EZK A;  2VLV A;  2UZ8 A;  3DKS A;  3H4K A;  2L6D A;  3GV1 A;  3IHQ A;  2OE0 A;  5G30 A;  4BL7 A;  1GNE A;  1NW2 A;  5J9C A;  1EEM A;  3MDK A;  3O6T A;  3ZMK A;  3FKF A;  2B1L A;  2KUC A;  3KXO A;  2H1B A;  2VCZ A;  4QL7 A;  1B4P A;  4TXV A;  1I5G A;  3LYK A;  1EGO A;  1HYU A;  3F8U A;  1G0T A;  1XW6 A;  3V1W A;  4BPY A;  2C0E A;  3S9F A;  2LST A;  4KDX A;  3TRP A;  4EDZ A;  2FCH A;  1TK8 B;  3IE3 A;  2GZY A;  4KAE A;  2NBS A;  2C0D A;  5ECS A;  2OE1 A;  1SJ6 A;  3IC8 A;  4IJ3 A;  2CZ2 A;  1H75 A;  2ZCT A;  2R2J A;  4J56 E;  4XHM A;  2VAF A;  1K3O A;  4TXO B;  1IYI A;  3KP8 A;  1ABA A;  4LL4 B;  5B6N A;  2FUG 2;  3GNJ A;  3F63 A;  2LJA A;  2H72 A;  4OO5 A;  6GST A;  4IHU A;  4ECJ A;  2CQ9 A;  2F3M A;  2PWJ A;  2LKU A;  2PUK C;  2HRF A;  2J23 A;  3GN3 A;  4EO3 A;  3LOR A;  4ECB A;  1AAZ A;  1E6B A;  4HSC X;  1ZMA A;  3DXB A;  2XHF A;  1THX A;  1UA5 A;  4K8M A;  1GTI A; 
#chains in the Genus database with same CATH homology
 2LRT A;  4EVM A;  1XWG A;  2I3Y A;  4BWQ A;  3QAV A;  5AIV A;  2H30 A;  1PSQ A;  1BED A;  3KMO A;  2YZU A;  4PQI A;  3HZ8 A;  3Q19 A;  2GT6 A;  4I2U A;  1VRS D;  4KSM A;  4F82 A;  1PL2 A;  1V57 A;  4PUA A;  4MF5 A;  3HA9 A;  1BQ7 A;  2C0G A;  3TDG A;  5EY6 A;  3GL3 A;  5JWQ B;  3VFI A;  2ON5 A;  4QQ7 A;  2HFD A;  3HCZ A;  2WRT A;  6GSV A;  3QMX A;  1F37 A;  4N10 A;  1WOU A;  4WET A;  4CY6 A;  1TU7 A;  3IA1 A;  2VCW A;  1ZOF A;  2PGT A;  1TDI A;  1MDJ A;  1TRV A;  2CA8 A;  1SK2 A;  1A2L A;  3TKS A;  3UAR A;  3DYR A;  1HD2 A;  2K18 A;  1YF0 A;  2DJ2 A;  3WGD A;  2A2R A;  5INY A;  1OKT A;  2EC4 A;  2LQQ A;  1TU8 A;  2YP6 A;  5ECR B;  2PER A;  4HJM A;  1XWB A;  1KBN A;  1V98 A;  2RM5 A;  2MMN A;  2ES7 A;  3FMW A;  2VL3 A;  1ZYN A;  4G0L A;  5GZZ B;  4Q5F A;  2B5X A;  4KE3 A;  4ZL8 A;  2YWN A;  6GSS A;  5ECO B;  3HY2 A;  1G7E A;  3M9J A;  4G2E A;  4O5Q A;  4Z2T A;  3I9V 2;  1PN9 A;  1WWJ A;  2DC5 A;  3BCK A;  5D9V A;  4PXO A;  2K8S A;  1OC9 B;  1SYR A;  1QXH A;  5L71 A;  5GSS A;  3IBH A;  3HDC A;  1EWX A;  3IAM 2;  4IEL A;  5J4U A;  4PGT A;  3TKS C;  1JLW A;  2OJL A;  2GQM A;  2F8A A;  1SK0 A;  3TRX A;  2XBQ A;  4NMU A;  5F06 A;  4DSQ A;  3CMI A;  5CP1 A;  4Q5N A;  3H93 A;  2CX3 A;  1R4W A;  3ME8 A;  3I43 A;  1W89 A;  4NHZ A;  1AUC A;  1TOF A;  2HSH A;  1WJK A;  1F6M C;  3DRN A;  2R0G A;  4KDU A;  1J08 A;  2IN3 A;  2R4V A;  4JR6 A;  1EOG A;  1PD2 1;  3KZQ A;  2JAD A;  2JZS A;  3LFL A;  1DE2 A;  4K6X A;  3VLN A;  3ZFB A;  2H6Y A;  5KOX A;  3HZ4 A;  2GZZ A;  3QCP A;  3KP9 A;  3TOU A;  3IK7 A;  4IBP A;  2E0Q A;  2PVO C;  3KGK A;  1KEB A;  1GTA A;  5KN0 A;  3G7Y A;  4HJ2 A;  1YQ1 A;  3WT1 A;  1ZGN A;  4WXT A;  3M0F A;  5DQS A;  3IXR A;  3ZZX A;  5CRG A;  4MH3 A;  1GP1 A;  4MA9 A;  5ID2 B;  2FWG A;  1Q4J A;  2VCT A;  2FGX A;  2IJY A;  4L0U A;  1O73 A;  2N5A A;  11GS A;  1GSQ A;  3QAW A;  5KN2 A;  5D9X A;  4IQ1 A;  5ENU A;  1SL0 B;  2P5R A;  2I9H A;  3GHA A;  2WFC A;  2A4H A;  3L4N A;  5LCZ A;  4MAB A;  2R5G A;  4IN0 A;  4RQR A;  2MZC A;  2IME A;  5J41 A;  1AC1 A;  1XWK A;  1BAY A;  3D21 A;  4KUN A;  2HZF A;  2O7K A;  3TKP A;  1T1V A;  1PKZ A;  3VWV A;  1M2B A;  1TRU A;  4Z2U A;  4ZL7 A;  2CX4 A;  2B1K A;  3HJM A;  3DEX A;  2JZT A;  3GTU B;  4MPG A;  3K8N A;  2L4C A;  4FO5 A;  1JZR A;  4YQV A;  3TJB A;  2MMA A;  3KIJ A;  1HQO A;  4MCU A;  1SJI A;  2HYX A;  1AIU A;  3VK9 A;  4V2N A;  2YJ7 A;  5A4W A;  4FIW A;  1DSB A;  2A2S A;  1WPI A;  4GCI A;  3FK8 A;  2P0G A;  1ERT A;  3TCO A;  2FWE A;  4PX1 A;  2X8H A;  4I8B A;  2YWM A;  3KH9 A;  1TRW A;  4EXJ A;  4KH7 A;  1M99 A;  2XPD A;  2LV3 A;  3LSZ A;  4ML6 A;  1THO A;  3HJO A;  5FT3 A;  4HOJ A;  1SYX A;  4MZB A;  3ZYW A;  4K2X A;  4EIP A;  1K0O A;  3Q18 A;  2L6C A;  5BRT A;  1YEP A;  2C0F A;  1MDI A;  2LJR A;  2H1D A;  1PX6 A;  4KX4 A;  4PNG A;  3DVW A;  2R0C A;  1RK4 A;  1YY7 A;  3CRU A;  1XWC A;  1AQV A;  5DDL A;  1U3A A;  2L4Q A;  4MJE A;  2H0H A;  2DIY A;  1H4O A;  4DVC A;  3HD5 A;  4OFM A;  3ERW A;  4YQM A;  3VWW A;  1ACV A;  5C04 A;  1XBS A;  5B7C A;  5DAK B;  2VL9 A;  4KB3 A;  3DIE A;  3QDN A;  4N0Z A;  3UMA A;  1XOA A;  1ZYE A;  3HYP A;  2RM6 A;  3DWV A;  3CTG A;  2WB9 A;  19GS A;  2H75 A;  4OD7 A;  4F03 A;  5EPF A;  2LNS A;  1FO5 A;  4EIQ A;  3APO A;  5DJM A;  1G6Y A;  5COH A;  1PKW A;  2DJ0 A;  4IKH A;  3H79 A;  1N8J A;  1BJX A;  4XIH A;  4AGS A;  3C1R A;  3WT2 A;  2X99 A;  1JZO A;  2GGT A;  3Q6O A;  5HQP A;  2B5E A;  2V32 A;  1FVJ A;  2H70 A;  2C1Y A;  4GRF A;  3G7I A;  5IMA A;  4OCE A;  2HRK A;  1K0M A;  2C3T A;  2PU9 C;  4DSS B;  1GUH A;  1XW9 A;  1N2A A;  4ZIJ A;  4BA7 A;  4XRA A;  4ZIL A;  4L0W A;  4MNN A;  5CRH A;  1VGL A;  2VD0 A;  1QMV A;  1ML6 A;  2RUF A;  3UVT A;  3CSI A;  5BMU A;  1SKR B;  3F6F A;  1ON4 A;  3HJP A;  3U5R E;  5E59 A;  4CHS A;  3QR6 A;  3RHC A;  5LD0 A;  4WF5 A;  2NDO A;  1GSF A;  1R26 A;  4IS0 A;  1PMT A;  2EIO A;  2IMI A;  1YJ6 A;  4BVY A;  1BYE A;  2LEG A;  4QL9 A;  2DJJ A;  4PNF A;  1K0D A;  1A2J A;  5GST A;  5IO0 A;  1Y25 A;  2X49 A;  1SU9 A;  1OE8 A;  1XPV A;  4CW9 A;  3RDW A;  3R2Q A;  4EF0 A;  4DEJ A;  3Q74 A;  4K5R A;  2FY6 A;  3L9U A;  2QC7 A;  4Z7X A;  4BWS A;  5IOW A;  1Z6N A;  3ZTL A;  2RII A;  1U88 A;  5JWO B;  2YWO A;  1PRX A;  2VUP A;  4MH2 A;  5KN3 A;  4NAX A;  4HU9 A;  2L5O A;  5HFI A;  3BBY A;  3UVH A;  2DJ1 A;  3F0I A;  4FYB A;  4ZL9 A;  3FEU A;  2GZP A;  4BL7 B;  2HZE A;  3D22 A;  3ERF A;  2PMT A;  5KN1 A;  1XFL A;  3D4T A;  4NV5 A;  4PQ1 A;  5H5R A;  2CT6 A;  5JCG A;  1CQH A;  2X4A A;  1A0R P;  2IMF A;  3MYD A;  1PGT A;  3GA4 A;  1F2E A;  1NSW A;  2NTO A;  5IMV A;  5E4W A;  3EIN A;  4FYU A;  3WYW A;  2R37 A;  3D0Z A;  1Z7R A;  3IHG A;  4LMW A;  1SD9 A;  2YNX A;  3EMP A;  2DMM A;  3GYK A;  5GAN D;  4RUV A;  2KLX A;  2PVQ A;  5J9B A;  3W8S A;  4NHW A;  3IPZ A;  2I81 A;  5DCH A;  2CVD A;  1MD4 A;  4E8E A;  5CAX A;  2ALB A;  3TOT A;  2IMK A;  3F6D A;  3E9J B;  3G9B A;  4K5S A;  3FW2 A;  3FR6 A;  4WR5 A;  1DBY A;  1AQW A;  4X1U A;  2B7K A;  2I1U A;  3GFK A;  3D5J A;  3GSS A;  4AJ8 A;  2O8V B;  2YWI A;  5AIS A;  4F0C A;  1O81 A;  1KTE A;  2E7P A;  2K9F A;  4J57 E;  2C3N A;  2M72 A;  3TKR A;  3WD6 A;  1GSS A;  3DML A;  4D73 A;  4K7O A;  5D73 A;  3TUE A;  3GKK A;  4IVF A;  3A5W A;  2DKH A;  2IFQ A;  2VM1 A;  1AQX A;  3EMX A;  1ERU A;  4OFT A;  3TJJ A;  1K0A A;  4G19 A;  2YV7 A;  3KD0 A;  3RPN A;  4MZW A;  4I97 A;  3IOS A;  1QUW A;  6GSX A;  3BCI A;  2OBI A;  3F4R A;  2ZUP A;  5IPH A;  3QPM A;  3TKQ A;  4OFN A;  4EKZ A;  3LGC A;  3M9K A;  3EC3 A;  2PPT A;  2LNT A;  2C3Q A;  4KA0 A;  3IV4 A;  4FQU A;  1SL2 B;  4NPB A;  1TRS A;  1Q98 A;  1T7P B;  2AV4 A;  4ISD A;  1WIK A;  4K0G A;  4TR1 A;  3EUR A;  4AJ7 A;  1ERV A;  2QGV A;  3CSH A;  3ZLP A;  5ABR A;  4BVX A;  4OCF A;  4E8H A;  4K1F A;  3KM6 A;  2VM2 A;  1OE7 A;  3P2A A;  2EIQ A;  1G7O A;  2Z9S A;  2CAQ A;  4O7H A;  4L8E A;  5D8I A;  2C8U A;  3EYT A;  2L59 A;  2RUE A;  5CNW A;  2AHE A;  4MDC A;  3VUR A;  2GST A;  4I5Q A;  4YKF A;  5DJL A;  4GTU A;  3F3Q A;  2OAD A;  3A3T A;  2J9H A;  4POL A;  2F9S A;  2R0P A;  2H76 A;  2VO4 A;  2H6Z A;  1X9M B;  2OAC A;  2GT5 A;  3QFB C;  4HI7 A;  5H5Q A;  3BJ5 A;  5CRW A;  3PIN A;  3GH6 A;  1F3B A;  2WJU A;  3P7X A;  4JBB A;  5IQY A;  2GS3 A;  1AW9 A;  2DIZ A;  3O76 A;  1GTB A;  5DQY A;  4YQU A;  10GS A;  4KND A;  1A24 A;  2IIY A;  5F0G A;  3LYP A;  1MEK A;  2HT9 A;  3KH7 A;  4GWR A;  3HKR A;  2YZH A;  1EV4 A;  2K6V A;  1FOH A;  3A2V A;  3DD3 A;  1OKD A;  5ECN B;  2PBJ A;  4PTS A;  5ECP B;  4KDY A;  5J5N A;  1X5C A;  3CSJ A;  1EGR A;  2JSY A;  5D96 A;  1AXD A;  4XS4 B;  3TJF A;  3SBC A;  2LRC A;  4IGJ A;  4ULX A;  4EL1 A;  3EWL A;  5G1K A;  3W6G A;  3R3E A;  5DAL A;  4V2L A;  1RW1 A;  4YAV A;  2DBC A;  5G2Z A;  5IMZ A;  4POK A;  1SK1 A;  4G10 A;  1TK5 B;  2NPB A;  2JU5 A;  4AJ6 A;  2C80 A;  2X8G A;  2YJH A;  4JE1 A;  3ZFL A;  4K9Z A;  3P90 A;  9GSS A;  3MIX A;  4LL1 B;  2DJK A;  1J9B A;  2B7J A;  4USS A;  1C72 A;  4H86 A;  2HRA A;  2FLS A;  3MSZ A;  2QSI A;  4LMV A;  1EP8 A;  3QAG A;  4HUA A;  3VPQ A;  4O5R A;  4J2F A;  3HHV A;  1EV9 A;  1MD3 A;  3RHB A;  3SWL A;  1V58 A;  4TRX A;  5IIZ A;  1XIY A;  5ECK B;  4MF7 A;  4POB A;  1SKS B;  1Z3E A;  2O89 A;  4KSO A;  4KGI A;  4ZXG A;  3EE2 A;  1PA3 A;  2EIR A;  3UBK A;  3VWX A;  1WP0 A;  4NXI A;  2AB6 A;  3RPP A;  22GS A;  3PGT A;  2KOK A;  3MNG A;  1LBK A;  8GSS A;  1GSY A;  16GS A;  3W8J A;  3N5O A;  4V1A p;  5CO3 A;  1O8W A;  2WGR A;  4ZBD A;  3VPT A;  1O85 A;  3C1S A;  2KP2 A;  3KTL A;  3RBT A;  2FA8 A;  3H1N A;  1K3Y A;  2LQO A;  1B4Q A;  1R5P A;  5D9W A;  1XZO A;  2VL2 A;  4MJA A;  2H6X A;  2L57 A;  3KEB A;  5DCG A;  2R6K A;  3UJ1 A;  2E2G A;  3HVX A;  4TN8 A;  1PQN A;  2G0F A;  1I9D A;  4YH2 A;  4YAP A;  5EL8 A;  4V2M A;  1X5D A;  4LA1 A;  2DLX A;  3M1G A;  2H1A A;  1QQ2 A;  2HSY A;  4HQS A;  1M7T A;  2VLT A;  1FOV A;  4JU5 A;  1UN2 A;  1YF1 A;  2H73 A;  5AN1 A;  4DSR A;  1ZZY A;  3WGE A;  1ST9 A;  1XCC A;  2JL4 A;  3CRT A;  5A4U A;  2PN8 A;  4RI7 A;  3QOU A;  4MZC A;  5IM9 A;  2YAN A;  3N9J A;  5IOX A;  7GSS A;  2GQL A;  5D93 A;  4ACS A;  4A5P A;  4EUY A;  5D9T A;  2VIM A;  5ECH B;  4KCE A;  4ECI A;  3EVI A;  2REM A;  3FZ9 A;  1VF2 A;  1M9B A;  4CY8 A;  2OA7 A;  1VF4 A;  4GSS A;  4MPF A;  3EU3 A;  3CBU A;  2YPM A;  1ZCP A;  5HFK A;  5CYY A;  1R7H A;  5JWR B;  4MF6 A;  2GQK A;  4IP6 A;  3E0U A;  3D6I A;  1FAA A;  4JZQ A;  3ZIJ A;  6GSU A;  1V9W A;  5KEJ A;  3GH9 A;  2CV4 A;  1A8L A;  3L78 A;  3TB2 A;  1YZX A;  1PX7 A;  4WKW A;  3ZML A;  1FHE A;  2FA4 A;  3IDV A;  3VI7 A;  3NIV A;  1U87 A;  4X4J A;  4EDY A;  2V2G A;  4KF9 A;  3FR9 A;  1S3A A;  3F3R A;  3UBL A;  2DSA A;  5EVO A;  1EP7 A;  1OAZ A;  3L9S A;  2NVL A;  2DML A;  1U3I A;  4GXZ A;  4Q5Q A;  4X43 A;  2M80 A;  5HR1 A;  5KOW A;  4JR4 A;  1OYJ A;  4MJC A;  2FWF A;  1GL8 A;  3L0H A;  2M46 A;  1LU4 A;  2WS2 A;  1X9W B;  3LXZ A;  3PPU A;  3VWU A;  1U6T A;  3US3 A;  3P8W A;  1LJR A;  2VCX A;  3F4S A;  5F05 A;  4ZBB A;  5B8A A;  3PR8 A;  1V40 A;  1PN0 A;  1T3B A;  2D2Z A;  5FWG A;  1GNW A;  2VD1 A;  4WF4 A;  2HSM A;  2XPE A;  5IPG A;  1G6W A;  2R3X A;  1TXX A;  2WZ9 A;  3HVS A;  5G5F A;  1VF1 A;  5LNK e;  17GS A;  1VF3 A;  1GSU A;  3LJR A;  3EU4 A;  4TXO A;  4GQF A;  4Q5R A;  3GUS A;  2TRC P;  1QFN A;  4PUF C;  4L5O A;  4OMV A;  1B9Y C;  1HNC A;  2VLU A;  3IR4 A;  2OBK A;  2KP1 A;  4BVY B;  4K7I A;  1A2M A;  3GST A;  3CTF A;  2GSS A;  5ECI B;  2GSQ A;  3J7Y b;  2IL3 A;  2OKA A;  4NV2 A;  2O85 A;  1TK0 B;  2WDU A;  3GMF A;  4PQH A;  2GTU A;  1SD8 A;  1O8X A;  3LXT A;  2DJ3 A;  2F51 A;  3UEM A;  3JCM L;  2MBT A;  3A2W A;  1K0N A;  1M2A A;  3LEF A;  3A5I A;  4WEY A;  1OC3 A;  3C7M A;  2HZE B;  2N5B A;  5ELG A;  3HXS A;  1JZW A;  4EE0 A;  2MMO A;  3EPT A;  3TJK A;  2LS5 A;  3APS A;  3KJY A;  5F8B A;  5AIX A;  4MMM A;  2QKE A;  2H01 A;  4X0X A;  3L9V A;  1USB A;  2K8V A;  4N30 A;  1JFU A;  2GSR A;  4G0K A;  3TGZ A;  3CYN A;  3LQ7 A;  5AGY A;  4XS1 A;  4GF0 A;  4KW6 A;  2YN1 A;  2E2M A;  1ZL9 A;  4K0N A;  5IMF A;  2QA1 A;  1M0U A;  1TI3 A;  4XTS A;  4O92 A;  2LJK A;  4GQC A;  1EOH A;  1YKC A;  4POM A;  1FVK A;  5G31 A;  1ZYQ B;  4HDE A;  1XVW A;  1V2A A;  2IPA A;  4L5L A;  4O5U A;  4PUR A;  1XXU A;  1Z6M A;  2QA2 A;  5A4V A;  3C73 A;  2FD3 A;  1TTZ A;  4GSN A;  20GS A;  1YDK A;  2AAW A;  2B3S A;  2MBS A;  4YKG A;  1FB0 A;  3M8N A;  2TIR A;  3UAP A;  4XRD A;  4F0B A;  3GKN A;  3O3T A;  3I69 A;  1YKA A;  1GSE A;  4MLY A;  2AUV A;  3DGQ A;  3UL3 A;  4D73 B;  1OVN A;  2YCD A;  4KCA A;  3ZIV A;  1OC9 A;  14GS A;  2CAI A;  2IFQ B;  2V1M A;  3ISO A;  3ZIT A;  2YOI A;  1GTU A;  3H8Q A;  3QD9 A;  4WBR D;  2FWH A;  2V41 A;  3TKS E;  1NHO A;  2V6K A;  1A8Y A;  5HFG A;  5IMD A;  2IWT A;  1Z7P A;  1MDK A;  2H19 A;  1WRY A;  3TRQ A;  1QGV A;  2OE3 A;  3FZ5 A;  5CRD A;  1HNA A;  1W4V A;  3KMN A;  2BJX A;  4TVE A;  4ML1 A;  2H1G A;  5IO2 A;  5CRE A;  3TJG A;  3FR3 A;  1RQM A;  1M9A A;  4IJI A;  2H74 A;  2A4V A;  1A23 A;  3FRC A;  4TR1 B;  2H0G A;  1WE0 A;  2JSZ A;  3MWH A;  4GLT A;  2BMX A;  2JAC A;  4BVX B;  5HR0 A;  4EC0 A;  5B6M A;  1X9S B;  1TW9 A;  3CXG A;  3VI5 A;  5IMC A;  2B6M A;  4HZ4 A;  2CVB A;  2VOC A;  2FHE A;  2GVP A;  2YV9 A;  1GRX A;  2GDR A;  1K0C A;  1X0R A;  1GLQ A;  3FHK A;  1O7U A;  18GS A;  3GUR A;  1TP9 A;  4XS4 A;  3U6V A;  2MYG A;  5ID2 A;  4G9H A;  1Z5Y E;  1S3D A;  4IW9 A;  3ZVJ D;  4WR4 A;  5G5E A;  2DKI A;  1K3L A;  3GIX A;  4JED A;  1K0B A;  2MMZ A;  3ME7 A;  1S3C A;  3C71 A;  2AYT A;  1E2Y A;  2KHP A;  3IAS 2;  2XBI A;  1HNB A;  3APQ A;  5C00 A;  1JZD A;  1TI1 A;  1BG5 A;  2ZNM A;  3E3E A;  4WBJ A;  3GRX A;  4LLR A;  1GLP A;  4TW5 A;  4NWY A;  5JCU A;  4JRR A;  1JHB A;  3GTU A;  5HR2 A;  1GUL A;  1JLV A;  2I4A A;  5DVB A;  2HNL A;  5ECQ B;  3FZA A;  3PH9 A;  3QFA C;  2V6O A;  2XC2 A;  4XS6 A;  4F2I A;  3DVX A;  3GKX A;  2X64 A;  2HXK A;  3WGX A;  5B8B A;  1B48 A;  4HZ2 A;  1OC8 A;  1PL1 A;  3MAK A;  2BTO T;  4RI6 A;  5DBQ A;  1T8E B;  1GSD A;  1YEX A;  2P31 A;  2TRX A;  1UC7 A;  4OWY A;  3OR5 A;  4O32 A;  4AF2 A;  3ZRE A;  1B9X C;  5DAL B;  5GAP D;  2VCQ A;  3ED3 A;  1FB6 A;  1GWC A;  1ZYP A;  3FY7 A;  1SEN A;  3ERG A;  3IK9 A;  2C4J A;  6GSW A;  1R5A A;  2N5F A;  3KCM A;  3GX0 A;  4TR0 A;  5A5K A;  4MP4 A;  2HRN A;  4ZB6 A;  4HU7 A;  3KTB A;  4I2T A;  3LWA A;  3RAZ A;  4HQZ A;  1NM3 A;  1KNG A;  1Z9H A;  3F9U A;  3IC4 A;  1T4Y A;  4ZB8 A;  4ZB9 A;  1DE1 A;  3GKM A;  4V1A g;  4P3Y B;  1GUK A;  2RLI A;  2B5Y A;  1T00 A;  3C8E A;  1GH2 A;  4HEA 2;  2VCV A;  1ILO A;  1IYH A;  4ID0 A;  4XCS A;  2G2Q A;  4TOP A;  4TKY A;  1DUG A;  3UIW A;  5ECM B;  1URM A;  5G1L A;  4G0I A;  1FW1 A;  3D4M A;  3LG6 A;  4TR3 A;  2WUL A;  5DAK A;  6GSY A;  1MTC A;  1SL1 B;  1XVQ A;  1XWA A;  3NZN A;  2HI7 A;  1M2D A;  4RQX A;  2H71 A;  3NOF A;  1F9M A;  3HVV A;  1GUM A;  3G7J A;  4K7N A;  1F3A A;  5H5S A;  1XOB A;  4N0V A;  1CQG A;  2CVK A;  1EEJ A;  4IQA A;  1B8X A;  5ELA A;  4ICY A;  2GLR A;  2LUS A;  2CZ3 A;  3ZRD A;  2H0I A;  5FHI A;  3AY8 A;  3I6A A;  2FNO A;  3BD2 A;  1T4Z A;  1TJD A;  3LW9 A;  13GS A;  5HR3 A;  1SKW B;  1TKD B;  2LTK A;  2O87 A;  2IMD A;  4DSS A;  4ILF A;  2JZR A;  2VL2 C;  2F8F A;  4FYC A;  4FH8 A;  4Z2R A;  2X8C A;  1A0F A;  4OO4 A;  2HLS A;  1ERW A;  2H66 A;  4ECC A;  1WMJ A;  3ZL5 A;  4K2D A;  3GL5 A;  3J7Y k;  2WCI A;  5ECL B;  1UVZ A;  4I6X A;  3GX8 A;  3FZ4 A;  2LRN A;  2HE3 A;  2ON7 A;  1QK8 A;  3M3M A;  1X5E A;  1Y6E A;  3F4T A;  1NHY A;  3UOM A;  2P5Q A;  4ZBA A;  3ZVJ A;  5JCW A;  4TR4 A;  4CDO A;  4GST A;  4HS1 A;  4MK3 A;  4F9Z A;  3IRA A;  1BX9 A;  5J3R A;  2AJQ B;  1XW5 A;  4N11 A;  5F07 A;  2L5L A;  2H8L A;  2A2P A;  3A2X A;  1FG4 A;  1J0F A;  3BOA A;  1SJZ A;  3FYG A;  4MJB A;  1O6J A;  4IP1 A;  12GS A;  1EZK A;  2VLV A;  2UZ8 A;  3DKS A;  3H4K A;  2L6D A;  3GV1 A;  3IHQ A;  2OE0 A;  5G30 A;  4BL7 A;  1GNE A;  1NW2 A;  5J9C A;  1EEM A;  3MDK A;  3O6T A;  3ZMK A;  3FKF A;  2B1L A;  2KUC A;  3KXO A;  2H1B A;  2VCZ A;  4QL7 A;  1B4P A;  4TXV A;  1I5G A;  3LYK A;  1EGO A;  1HYU A;  3F8U A;  1G0T A;  1XW6 A;  3V1W A;  4BPY A;  2C0E A;  3S9F A;  2LST A;  4KDX A;  3TRP A;  4EDZ A;  2FCH A;  1TK8 B;  3IE3 A;  2GZY A;  4KAE A;  2NBS A;  2C0D A;  5ECS A;  2OE1 A;  1SJ6 A;  3IC8 A;  4IJ3 A;  2CZ2 A;  1H75 A;  2ZCT A;  2R2J A;  4J56 E;  4XHM A;  2VAF A;  1K3O A;  4TXO B;  1IYI A;  3KP8 A;  1ABA A;  4LL4 B;  5B6N A;  2FUG 2;  3GNJ A;  3F63 A;  2LJA A;  2H72 A;  4OO5 A;  6GST A;  4IHU A;  4ECJ A;  2CQ9 A;  2F3M A;  2PWJ A;  2LKU A;  2PUK C;  2HRF A;  2J23 A;  3GN3 A;  4EO3 A;  3LOR A;  4ECB A;  1AAZ A;  1E6B A;  1ZMA A;  3DXB A;  2XHF A;  1THX A;  1UA5 A;  4K8M A;  1GTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...