1SL0B

Ternary 3' complex of t7 dna polymerase with a dna primer/template containing a disordered cis-syn thymine dimer on the template and an incoming nucleotide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
105
structure length
105
Chain Sequence
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*GP*
publication title Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transferase/electron transport/dna
total genus 21
structure length 105
sequence length 105
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1sl0B00
1W89A 1OE8A 3IOSA 1U88A 3SBCA 3RPPA 1PX7A 4G2EA 1XXUA 3BCIA 5F8BA 4MJCA 3EINA 1SJZA 1ERUA 2FCHA 1MDIA 5G5EA 2L6CA 1KNGA 1YY7A 4I2TA 2C0GA 1ZCPA 4HU7A 5LD0A 4KA0A 4TXOB 2AAWA 4OO4A 1K0DA 2LRNA 1SK0A 4PUAA 1ZZYA 3TOUA 4FYUA 3HVXA 3LWAA 2VL2C 4PX1A 1NHOA 1ST9A 1JHBA 4POBA 4Q5NA 3A2WA 5FWGA 1Z3EA 2A4VA 4DSSA 3IA1A 1X9MB 5B8AA 4Q5FA 3O6TA 2HSYA 1AAZA 2DMLA 1GSYA 4TR1B 4MP4A 1GNEA 3LFLA 2CQ9A 5C00A 1XW9A 1NHYA 1TI1A 1TTZA 3F0IA 4FH8A 4NAXA 4ML1A 1M2DA 1SU9A 2FWHA 2GLRA 6GSXA 3CSJA 2E2GA 2LUSA 3GN3A 5ECKB 1MD3A 5IIZA 5AGYA 3R2QA 5DJLA 4GSSA 1XZOA 3F6FA 1DUGA 2B5EA 4K2DA 4DEJA 1PMTA 3GIXA 5IMFA 5A4VA 3FZ5A 2PWJA 3CBUA 4X43A 5HFGA 3GL3A 4TW5A 4D73B 4ZBAA 1U87A 5DALA 2L5OA 2C3TA 2FLSA 3CSHA 2DLXA 1A8LA 1Y25A 3TJBA 1B9YC 1BQ7A 1GSEA 2P5QA 3H4KA 4EDYA 1O81A 1ZYEA 5F07A 4OMVA 3I9V2 1V57A 1YEPA 1GUMA 1PL1A 4LMVA 3VWUA 5B6MA 2LQQA 2WDUA 2C4JA 5IOXA 1RK4A 1MEKA 3TJKA 2GZPA 4J2FA 1T4ZA 1V98A 3CYNA 2GSRA 1XWGA 3VURA 5D9TA 4HI7A 4ECJA 1AC1A 2F3MA 2I9HA 1AQXA 4MLYA 2WCIA 1ZGNA 1EP7A 2IJYA 5GZZB 1GP1A 1THXA 2VCWA 1K0MA 3DD3A 2H71A 2H70A 3K8NA 1ERVA 3UBKA 4IS0A 1HYUA 5DAKB 4Q5RA 3HJPA 2WB9A 4EF0A 10GSA 2JADA 4HDEA 4WKWA 4AJ8A 2OA7A 2YWNA 4BPYA 4ZB8A 2GT6A 3MDKA 2GQKA 2XBQA 4HQZA 2WZ9A 2PN8A 1C72A 2GZYA 1JLVA 3IDVA 1PQNA 2H72A 4KAEA 3D0ZA 1XW5A 6GSTA 4V1Ag 1LJRA 2HNLA 1PRXA 1EOGA 2VL3A 5ECMB 1UC7A 3C8EA 1S3CA 3D22A 3FK8A 5ECHB 4PQIA 4TXVA 3EE2A 3FKFA 1TOFA 2EIRA 2YWIA 3AY8A 4MH3A 1GLPA 2ON7A 3ZRDA 3F63A 3WT2A 4KDYA 5D9XA 1TRUA 4PNFA 4CW9A 3GUSA 3HKRA 4NWYA 1LU4A 3HA9A 2VD1A 3MWHA 1SENA 3MSZA 3GH9A 4GLTA 3RPNA 3M9JA 2DBCA 2YV7A 4E8EA 2R2JA 3ZYWA 1F3AA 3BD2A 3ED3A 2M80A 1Z7RA 1U3IA 1WMJA 1V40A 1YZXA 3M1GA 2AB6A 2H74A 3DVXA 3VWWA 3UAPA 1F2EA 2L4CA 5JCWA 1SYXA 1R5AA 2K18A 4WR5A 11GSA 2IWTA 4KUNA 5CYYA 1TK8B 1Z7PA 4DSRA 3HDCA 1SL2B 1WWJA 1X5DA 4HZ4A 1G6YA 1EOHA 3QCPA 4YH2A 3PINA 4MPFA 4WEYA 3HXSA 1XWAA 3EC3A 4IW9A 1O85A 3LXTA 4IELA 3A3TA 4MJBA 2VL9A 1K3LA 3GMFA 2H75A 1UVZA 2JZSA 4ZB9A 3UJ1A 3ZL5A 3FZAA 5CRWA 3FHKA 1SKRB 1A24A 16GSA 1F3BA 2JZTA 2CVBA 4AJ6A 2FWGA 2MMAA 4O32A 1DSBA 1A2MA 3EU3A 3KM6A 2MMNA 2YN1A 5AISA 3CSIA 4PXOA 4FYBA 3C71A 2ZUPA 2HSHA 4AGSA 3ZREA 2HT9A 2CVDA 5G1KA 1SK2A 2R3XA 3IK7A 1VF1A 1HQOA 4XRAA 3IAS2 3CMIA 2C3NA 1IYHA 1WP0A 2FD3A 4DVCA 5ENUA 2LQOA 3TKSE 2HZFA 1A0RP 4IJIA 3F4TA 1T00A 2MYGA 4N30A 5H5SA 5GAND 2HZEB 3IE3A 3QFAC 3HHVA 3ZVJD 3HYPA 2HRNA 2VCXA 2V1MA 4G10A 4DSQA 2OACA 3CRTA 3DGQA 4NHZA 3ZITA 1R4WA 5D9WA 5DCGA 2IMFA 4CHSA 4KB3A 4EVMA 3KP9A 2NPBA 3ZLPA 3KH9A 1M7TA 5EY6A 2YZHA 4PQHA 4NXIA 2H1GA 4WBJA 4EL1A 2LTKA 4TOPA 4YAPA 1I5GA 4MABA 4J57E 2LNTA 4NV5A 1HNCA 3DVWA 1FVKA 1AIUA 3CTFA 3UVTA 1WE0A 4MA9A 5A4WA 4JZQA 4AF2A 5JCGA 4ID0A 2OE1A 5JCUA 2M46A 2GS3A 3VLNA 4F0BA 2X8GA 3ZFBA 2JZRA 4MJAA 5INYA 1KTEA 3I6AA 1DBYA 4MF5A 2H01A 3ZFLA 3C1RA 1J9BA 4GCIA 5AIVA 2IFQB 4O5RA 1FB6A 1MDJA 1XWCA 5KN2A 3IK9A 5G2ZA 1GSFA 3CTGA 4I6XA 2EIQA 4MF7A 5F0GA 1RW1A 4PGTA 4BA7A 2GZZA 2DJ2A 2G2QA 4F82A 1QMVA 2CVKA 4GSTA 3NIVA 4XTSA 1GTBA 1PN9A 4NV2A 4K7OA 2XPEA 2B1LA 4TVEA 1XVWA 1T8EB 2H0GA 3H93A 3RHBA 1M2BA 3HD5A 1OAZA 3LJRA 1SD8A 3FEUA 3DXBA 4FYCA 3TJFA 1EGRA 5A4UA 3QR6A 5G5FA 3GNJA 4V1Ap 2F9SA 2VD0A 1JZDA 3L78A 2CX3A 4GQCA 1E2YA 3HZ8A 1HNAA 3Q19A 2BMXA 3ZVJA 4IQAA 3GV1A 5ECQB 2FWEA 4GRFA 4MDCA 5DALB 3KIJA 1GLQA 5CRHA 1GSDA 4EDZA 4NHWA 1DE1A 1MD4A 3TGZA 5HR2A 4MH2A 4G9HA 1SL1B 5EPFA 3WT1A 2V6KA 3QPMA 3D5JA 1EP8A 2O85A 3IR4A 2RIIA 4MZBA 4K6XA 2VAFA 2B3SA 2WFCA 3TDGA 3VPQA 4HS1A 3VWXA 1OC3A 3LORA 3OR5A 1YKAA 5IQYA 3IHQA 1WOUA 3A2VA 4K0GA 4WF5A 5JWRB 3ZIVA 5LCZA 2PVQA 2VIMA 1TU7A 3N5OA 1AW9A 2YWOA 1PD21 1PKZA 5J9BA 4GF0A 1XVQA 5D9VA 2R4VA 2DIZA 3Q74A 5G31A 4L0UA 1VF4A 2P0GA 2LS5A 2FWFA 3L4NA 3KH7A 3N9JA 2QKEA 2P31A 2LV3A 6GSWA 1FAAA 1USBA 2FA4A 1PGTA 4YQUA 4K8MA 1GSUA 4JR4A 1RQMA 3GKXA 5ABRA 2JSZA 1NM3A 5CRDA 2ALBA 2IIYA 1THOA 1VRSD 2IMDA 2KLXA 3TKSA 1FVJA 1QQ2A 3GURA 5CAXA 1JLWA 2DJ0A 2C0FA 3UIWA 1O73A 2B7JA 5CREA 5ELAA 5J4UA 1V9WA 2KHPA 4L5OA 3WGXA 4I2UA 4RUVA 3HJMA 2H66A 3FR3A 3MNGA 1YF1A 4RQRA 2NVLA 1OYJA 18GSA 4KW6A 3APQA 2FNOA 2YJ7A 4L0WA 2O7KA 4KX4A 4HOJA 4L8EA 1G0TA 2K6VA 2H8LA 5FHIA 2PMTA 3O3TA 3Q18A 2R37A 3UEMA 1J08A 2A2RA 1ZMAA 1BJXA 4YQVA 4IJ3A 5ECNB 3DYRA 1W4VA 2I4AA 1GTUA 1Z9HA 1WIKA 5GSTA 1ERTA 2K9FA 1V2AA 2LRTA 2CZ3A 2Z9SA 3KZQA 4MF6A 2CT6A 1OC9B 2H1BA 5HR0A 5CP1A 3US3A 3M8NA 2C1YA 4ILFA 2L6DA 4KCEA 5ECOB 4K7NA 2R5GA 5DBQA 4WR4A 4F9ZA 1TRVA 3VPTA 3KD0A 3P8WA 5J5NA 3DIEA 1V58A 1PL2A 2HI7A 1TKDB 3NOFA 1FB0A 2CZ2A 1ZYQB 2FY6A 2JL4A 2RUFA 3ZMKA 4BVYA 3HVSA 2J9HA 1XW6A 2H0HA 4BL7A 3GL5A 2WULA 3HZ4A 2ES7A 2H1DA 7GSSA 3D21A 4GQFA 14GSA 2DSAA 1TJDA 4IQ1A 1Q4JA 2RM5A 3W6GA 4O7HA 3HJOA 1A0FA 5AIXA 3MAKA 1R26A 4F03A 1ZL9A 3QOUA 2D2ZA 3F6DA 2H6YA 3EWLA 1LBKA 4MCUA 4LL1B 1UN2A 4HJ2A 1X0RA 1NSWA 2E7PA 4N0VA 2PERA 4EKZA 2MMZA 2L4QA 3J7Yb 4IVFA 3H8QA 4PUFC 1K3YA 3GTUA 5DQSA 4ZL8A 2VO4A 2HLSA 1B4QA 1Y6EA 2B7KA 3UL3A 1B9XC 2IMEA 2NBSA 3KGKA 4HU9A 1OC8A 1MTCA 3VI7A 3G7JA 4RI7A 3APSA 3KCMA 2B5YA 4XIHA 2C8UA 3Q6OA 3KXOA 4BVXA 5IPGA 4G19A 1XIYA 2LJAA 4FO5A 5IM9A 3E9JB 3GYKA 3G7IA 4GXZA 1X9SB 2L59A 4TR3A 3F9UA 1GRXA 3GX0A 2VLUA 2HYXA 5D73A 2VCZA 1SKSB 1YF0A 1XWKA 4QL9A 1S3DA 1Z6NA 4ECIA 3IXRA 1M99A 1T4YA 3GKNA 5IOWA 3I43A 2MBTA 4I5QA 1UA5A 3TRPA 3F3QA 2PGTA 2EC4A 2I1UA 5DCHA 3ZZXA 1SL0B 3O76A 3EU4A 2VM2A 3TJJA 2IPAA 3RAZA 5CRGA 6GSUA 5F05A 5H5QA 5ECRB 3ERFA 2LNSA 4XCSA 2HRFA 2GQLA 5IO0A 3GKMA 2XHFA 2MBSA 1G7EA 3E0UA 1AXDA 1SYRA 5GSSA 3TRXA 2RUEA 4ZL7A 2GT5A 3LXZA 2LJRA 4TKYA 3GA4A 2WS2A 3TRQA 4GSNA 4QQ7A 1QXHA 5DDLA 2HXKA 3QAWA 1M9BA 3BCKA 3FRCA 1JZRA 2LRCA 1U3AA 4HQSA 1YQ1A 3NZNA 3SWLA 4ZL9A 3TKPA 2B1KA 2RM6A 1ILOA 1S3AA 5ID2A 3UARA 1JZWA 3VI5A 1SD9A 2OKAA 4E8HA 4CDOA 1VF3A 2H30A 3TOTA 3D4TA 1BYEA 4PURA 4MJEA 5D93A 4BWQA 4XS1A 1YKCA 2YCDA 3G7YA 3GH6A 1KEBA 1AQWA 2YOIA 3QMXA 4MZWA 3LQ7A 3TJGA 3BOAA 2PPTA 3FR9A 4XS6A 2DC5A 2FHEA 2LSTA 2CAQA 2H76A 1K0AA 4ECBA 1K0NA 1Z6MA 2QSIA 2YPMA 4IBPA 2TRCP 2V32A 1JFUA 4NMUA 3ME7A 4X0XA 4EE0A 2VCVA 1YDKA 3QFBC 1DE2A 3VFIA 1QK8A 12GSA 3J7Yk 3HVVA 4ZILA 2VM1A 1ERWA 3DRNA 4O92A 3FR6A 1ABAA 3GHAA 3P2AA 3LG6A 2AYTA 4LLRA 1O7UA 3EYTA 2DJJA 4MZCA 1BEDA 4DSSB 2X8HA 2VLVA 2LJKA 3P90A 4MK3A 2L57A 2FUG2 2JACA 1G7OA 4ZB6A 5IMCA 1GH2A 4HEA2 5L71A 1H75A 3D4MA 4IP1A 4F0CA 3C1SA 3W8SA 4QL7A 1BAYA 1EV4A 2PVOC 2ZCTA 2C80A 3F4SA 4KE3A 1XOAA 4OFNA 4TRXA 5D8IA 4YAVA 1SJIA 3F3RA 1SJ6A 5ECIB 2GSTA 4V2MA 5GAPD 2K8VA 2V2GA 4H86A 4POKA 2IFQA 2H0IA 2F51A 3I69A 3EURA 2MZCA 2F8AA 1GWCA 2TRXA 3UOMA 2H73A 2VCTA 4XS4A 1PX6A 4TR0A 3L9VA 4ZBBA 4IGJA 2JU5A 1FW1A 1OKDA 2XBIA 5KN1A 3F8UA 3CRUA 3HY2A 3UVHA 1T1VA 1MDKA 4KDXA 13GSA 1FO5A 2C0EA 2VL2A 3BJ5A 3EMXA 1X9WB 1JZOA 1TRSA 3ZMLA 5DJMA 2FA8A 5IMDA 1J0FA 3RHCA 2YP6A 1EV9A 4EC0A 4JE1A 5KN3A 2JSYA 5HFKA 4MMMA 5HR1A 4RQXA 4ZXGA 5DQYA 1CQHA 3KEBA 2C3QA 5JWOB 1U6TA 1SK1A 2DMMA 6GSVA 1TP9A 2DJKA 2BTOT 4ULXA 2OADA 2K8SA 4L5LA 4TN8A 3F4RA 1GULA 1I9DA 3FW2A 3GKKA 2NDOA 3TKSC 2LEGA 5KN0A 2OBKA 5CO3A 4TXOA 3DMLA 5E4WA 5EL8A 4LL4B 4KSMA 2PU9C 2LKUA 1Q98A 4ECCA 4KNDA 1A2LA 2GGTA 2A2SA 2EIOA 4WF4A 1WRYA 1QFNA 2GQMA 4JU5A 1XPVA 2GSQA 4PNGA 1XWBA 3S9FA 1T3BA 1F37A 4KGIA 3VWVA 2CAIA 2O8VB 2PUKC 1AQVA 1EGOA 3IC4A 5ECLB 4JR6A 5ECSA 4ZIJA 3RDWA 4N10A 5HFIA 4TR1A 1TW9A 2CX4A 2OJLA 4OWYA 1B4PA 3WGEA 3BBYA 20GSA 4RI6A 3C7MA 3ZIJA 3TUEA 1TI3A 2KP2A 5ELGA 3DEXA 3IRAA 8GSSA 1K0BA 1XOBA 3DWVA 2B5XA 1M9AA 4HZ2A 2PBJA 5B8BA 3IPZA 5HR3A 1EEMA 3EVIA 4K0NA 4OD7A 4IP6A 4K7IA 1F9MA 2WJUA 2AUVA 3LYPA 2V41A 2H19A 1B48A 22GSA 3GTUB 17GSA 3P7XA 1FG4A 3GX8A 1X5EA 4IKHA 3UBLA 4D73A 1A8YA 2CA8A 6GSYA 1GSSA 3L0HA 2YWMA 4KH7A 4V2NA 4ACSA 1A23A 3A5WA 4ML6A 2KUCA 2FGXA 3L9SA 2XC2A 1EEJA 5LNKe 1TXXA 3LEFA 4TR4A 4PQ1A 3ISOA 1ML6A 3IV4A 5B7CA 2H1AA 3IAM2 2DIYA 2OE0A 1VGLA 3HCZA 3FYGA 2N5BA 3FY7A 5A5KA 1G6WA 3W8JA 2ZNMA 2AV4A 2J23A 5COHA 2V6OA 1TDIA 1FHEA 3D6IA 2QC7A 3L9UA 2XPDA 1O8XA 1EWXA 2DJ3A 5DAKA 5JWQB 1R5PA 3CXGA 1Z5YE 3GSTA 4WETA 3V1WA 3GFKA 2E0QA 2VCQA 5IO2A 3PH9A 1TRWA 2R6KA 2YJHA 5J9CA 3PGTA 3LGCA 3KTBA 3KJYA 1GNWA 2OBIA 2GSSA 1OC9A 2VUPA 1K3OA 2E2MA 3EMPA 5FT3A 4HJMA 3G9BA 2YNXA 5IMAA 1AUCA 3QDNA 2P5RA 2IMIA 2L5LA 4IHUA 1A2JA 3M0FA 4J56E 3TKQA 1OKTA 4ISDA 5EVOA 2G0FA 4KDUA 1EZKA 4POLA 3C73A 5G1LA 2MMOA 1SKWB 1VF2A 3LSZA 4I8BA 2GVPA 4EXJA 1BX9A 5CNWA 1YEXA 4MPGA 1H4OA 5ID2B 2AHEA 4IN0A 3QD9A 2F8FA 2AJQB 3M9KA 4EUYA 1N2AA 1GUHA 4OCFA 4HUAA 1R7HA 3APOA 5D96A 3KP8A 4KCAA 4AJ7A 1ZOFA 3ERGA 2QGVA 2GDRA 2X99A 2CV4A 1F6MC 2YANA 5B6NA 1OVNA 2GTUA 5IMVA 2IN3A 1PKWA 5IPHA 4FIWA 1M0UA 1PSQA 5ECPB 4WBRD 4LA1A 5J3RA 4OCEA 5AN1A 1TU8A 1WJKA 2KP1A 1HNBA 4YQMA 2KOKA 3TCOA 1XBSA 1XFLA 2DJ1A 3H1NA 5E59A 4JBBA 1GUKA 2YZUA 4XHMA 1YJ6A 2YV9A 5G30A 3PR8A 1QUWA 5KEJA 4GTUA 2REMA 1WPIA 4N0ZA 4EO3A 1B8XA 1NW2A 2HFDA 2IL3A 2M72A 1GTIA 4I97A 1K0OA 1FOVA 1ON4A 2H6ZA 2VOCA 4Q5QA 3ZTLA 1E6BA 4X1UA 3QAGA 1N8JA 2ON5A 3LYKA 1URMA 2OE3A 4N11A 3TKRA 5C04A 3DKSA 4LMWA 1IYIA 2H6XA 2X64A 3RBTA 4BWSA 4OFMA 2VLTA 4POMA 3UMAA 2N5AA 2I3YA 3GSSA 5HQPA 1ACVA 4Z7XA 2TIRA 2WRTA 5IMZA 3KMOA 3KTLA 3WD6A 4KSOA 3FZ9A 1K0CA 3ERWA 3H79A 2NTOA 1OE7A 2RLIA 5J41A 3QAVA 3E3EA 2I81A 3JCML 3TB2A 4XRDA 1BG5A 4ZBDA 1GTAA 5F06A 1PA3A 4K1FA 3VK9A 2HZEA 3ME8A 1QGVA 1GSQA 4XS4B 3FZ4A 3U6VA 1KBNA 3M3MA 2X8CA 1M2AA 4GWRA 4NPBA 19GSA 1O8WA 4F2IA 1O6JA 1XCCA 2B6MA 2IMKA 2O87A 2O89A 4P3YB 1TK5B 2WGRA 2BJXA 4OFTA 1HD2A 4V2LA 6GSSA 3GRXA 1TK0B 4JRRA 1CQGA 1T7PB 1X5CA 9GSSA 4K9ZA 3WGDA 1GL8A 4OO5A 2C0DA 5H5RA 3U5RE 3KMNA 3A2XA 3WYWA 3IBHA 2HE3A 4JEDA 4WXTA 2N5FA 5DVBA
chains in the Genus database with same CATH superfamily
1W89A 1OE8A 3IOSA 1U88A 3SBCA 3RPPA 1PX7A 4G2EA 1XXUA 3BCIA 5F8BA 4MJCA 3EINA 1SJZA 1ERUA 2FCHA 1MDIA 5G5EA 2L6CA 1KNGA 1YY7A 4I2TA 4Z2UA 2C0GA 1ZCPA 4HU7A 5LD0A 4KA0A 4TXOB 2AAWA 4OO4A 1K0DA 2LRNA 1SK0A 4PUAA 1ZZYA 3TOUA 4FYUA 3HVXA 3LWAA 2VL2C 4PX1A 1NHOA 1ST9A 1JHBA 4POBA 4Q5NA 3CQFA 3A2WA 5FWGA 1Z3EA 2A4VA 4DSSA 3IA1A 1X9MB 5B8AA 4Q5FA 3O6TA 5BMUA 2HSYA 1AAZA 2DMLA 1GSYA 4TR1B 4MP4A 1GNEA 3LFLA 2CQ9A 5C00A 1XW9A 1NHYA 1TI1A 4HSCX 1TTZA 3F0IA 4FH8A 4NAXA 4ML1A 1M2DA 1SU9A 4ICYA 2FWHA 2GLRA 6GSXA 3CSJA 2E2GA 2LUSA 3GN3A 5ECKB 1MD3A 5IIZA 5AGYA 3R2QA 5DJLA 4GSSA 1XZOA 3F6FA 1DUGA 2B5EA 4K2DA 4DEJA 1PMTA 3GIXA 5IMFA 5A4VA 3FZ5A 2PWJA 3CBUA 4X43A 5HFGA 3GL3A 4TW5A 4D73B 4ZBAA 1U87A 5DALA 2L5OA 2C3TA 2FLSA 3CSHA 2DLXA 1A8LA 1Y25A 3TJBA 1B9YC 1BQ7A 1GSEA 2P5QA 3H4KA 4EDYA 1O81A 1ZYEA 5F07A 4OMVA 2QA2A 3I9V2 1V57A 1YEPA 1GUMA 1PL1A 4LMVA 3VWUA 5B6MA 2LQQA 2WDUA 2C4JA 4BVYB 5IOXA 1RK4A 4BL7B 1MEKA 3TJKA 2GZPA 4J2FA 1T4ZA 1V98A 3CYNA 2GSRA 1XWGA 3VURA 5D9TA 4HI7A 4ECJA 1AC1A 2F3MA 2I9HA 1AQXA 4MLYA 2WCIA 1ZGNA 1EP7A 2IJYA 5GZZB 1GP1A 1THXA 2VCWA 1K0MA 3DD3A 2H71A 2H70A 3K8NA 1ERVA 3UBKA 4IS0A 1HYUA 5DAKB 4Q5RA 3HJPA 2WB9A 4EF0A 10GSA 2JADA 4HDEA 4WKWA 4AJ8A 2OA7A 2YWNA 4BPYA 4ZB8A 2GT6A 3MDKA 2GQKA 2XBQA 4HQZA 2WZ9A 2PN8A 4CY6A 1C72A 2GZYA 1JLVA 3IDVA 1PQNA 2H72A 4KAEA 3D0ZA 1XW5A 2UZ8A 6GSTA 4V1Ag 1LJRA 2HNLA 1PRXA 1EOGA 2VL3A 5ECMB 1UC7A 3C8EA 1S3CA 3D22A 3FK8A 5ECHB 4PQIA 4TXVA 3EE2A 3FKFA 1TOFA 2EIRA 2YWIA 3AY8A 4MH3A 1GLPA 2ON7A 3ZRDA 3F63A 3WT2A 4KDYA 5D9XA 1TRUA 4PNFA 4CW9A 3GUSA 3HKRA 4NWYA 4PTSA 1LU4A 3HA9A 2VD1A 3MWHA 1SENA 3MSZA 3GH9A 4GLTA 3RPNA 3M9JA 2DBCA 2YV7A 4E8EA 2R2JA 3ZYWA 1F3AA 3BD2A 3ED3A 2M80A 1Z7RA 1U3IA 1WMJA 1V40A 1YZXA 3M1GA 2AB6A 2H74A 3DVXA 3VWWA 3UAPA 1F2EA 2L4CA 5JCWA 1SYXA 1R5AA 2K18A 4WR5A 11GSA 2IWTA 4KUNA 5CYYA 1TK8B 1Z7PA 1M3JA 4DSRA 3HDCA 1SL2B 1WWJA 1X5DA 4HZ4A 1G6YA 1EOHA 3QCPA 4YH2A 4KF9A 3PINA 4MPFA 4WEYA 3HXSA 1XWAA 3EC3A 4IW9A 1O85A 3LXTA 4IELA 3A3TA 4MJBA 2VL9A 1K3LA 4O5QA 3GMFA 2H75A 1UVZA 2JZSA 4EIQA 4ZB9A 3UJ1A 3ZL5A 3FZAA 5CRWA 3FHKA 1SKRB 1A24A 16GSA 1F3BA 1ZYNA 2JZTA 2CVBA 4AJ6A 2FWGA 2MMAA 4O32A 1DSBA 1A2MA 3EU3A 3KM6A 2MMNA 2YN1A 5AISA 3CSIA 4PXOA 4FYBA 3C71A 2ZUPA 2HSHA 4AGSA 3ZREA 2HT9A 2CVDA 5G1KA 1SK2A 2R3XA 3IK7A 1VF1A 1HQOA 4XRAA 3IAS2 3CMIA 2C3NA 1IYHA 1WP0A 2FD3A 4DVCA 5ENUA 2LQOA 3TKSE 2HZFA 1A0RP 4IJIA 3F4TA 1T00A 2MYGA 4N30A 5H5SA 5GAND 2HZEB 3IE3A 3QFAC 3HHVA 3ZVJD 3HYPA 2HRNA 2VCXA 2V1MA 4G10A 4DSQA 2OACA 3CRTA 3DGQA 4NHZA 3ZITA 1R4WA 5D9WA 5DCGA 2IMFA 4CHSA 4KB3A 4EVMA 3KP9A 2NPBA 3ZLPA 3KH9A 1M7TA 5EY6A 2YZHA 4PQHA 4NXIA 4FQUA 2H1GA 4WBJA 4EL1A 2LTKA 4TOPA 4YAPA 1I5GA 4MABA 4J57E 2LNTA 4NV5A 1HNCA 3DVWA 1FVKA 1AIUA 3CTFA 3MYDA 3UVTA 1WE0A 4MA9A 5A4WA 4JZQA 4AF2A 5JCGA 4ID0A 2OE1A 5JCUA 2M46A 2GS3A 3VLNA 4F0BA 2X8GA 4K2XA 3ZFBA 2JZRA 4MJAA 5INYA 1KTEA 3I6AA 1DBYA 4MF5A 2H01A 3ZFLA 3C1RA 1J9BA 4GCIA 2HRAA 5AIVA 2IFQB 4O5RA 1FB6A 1MDJA 1XWCA 5KN2A 3IK9A 5G2ZA 1GSFA 3CTGA 4X4JA 4I6XA 2EIQA 4MF7A 5F0GA 1RW1A 4PGTA 4BA7A 2GZZA 2DJ2A 2G2QA 4F82A 1QMVA 2A4HA 2CVKA 4GSTA 3NIVA 4XTSA 1GTBA 1PN9A 4NV2A 4K7OA 2XPEA 2B1LA 4TVEA 1XVWA 1T8EB 2H0GA 3H93A 3RHBA 1M2BA 3HD5A 1OAZA 3LJRA 1SD8A 3FEUA 3DXBA 4FYCA 3TJFA 1EGRA 5A4UA 3QR6A 5G5FA 3GNJA 4V1Ap 4BIKA 2F9SA 2VD0A 1JZDA 3L78A 2CX3A 3IHGA 4GQCA 1E2YA 3HZ8A 1HNAA 3Q19A 2BMXA 3ZVJA 4IQAA 3GV1A 5ECQB 2FWEA 4GRFA 4MDCA 5DALB 3KIJA 1GLQA 5CRHA 1GSDA 4EDZA 4NHWA 1DE1A 1MD4A 3TGZA 5HR2A 4MH2A 4G9HA 1SL1B 5EPFA 3WT1A 2V6KA 3QPMA 3D5JA 1EP8A 2O85A 3IR4A 2RIIA 4MZBA 4K6XA 2VAFA 2B3SA 2WFCA 3TDGA 3VPQA 4HS1A 3VWXA 1OC3A 3LORA 1S3RA 3OR5A 1YKAA 5IQYA 3IHQA 1WOUA 3A2VA 4K0GA 4WF5A 5JWRB 3ZIVA 5LCZA 2PVQA 2VIMA 1TU7A 3N5OA 1AW9A 2YWOA 1PD21 1PKZA 1XG8A 5J9BA 4GF0A 1XVQA 5D9VA 2R4VA 2DIZA 3Q74A 5G31A 4L0UA 1VF4A 2P0GA 2LS5A 2FWFA 3L4NA 3KH7A 3N9JA 2QKEA 2P31A 2LV3A 6GSWA 1FAAA 1USBA 2FA4A 1PGTA 4YQUA 4K8MA 1GSUA 4JR4A 1RQMA 2R0PA 3GKXA 5ABRA 2JSZA 1NM3A 5CRDA 2ALBA 2IIYA 1THOA 1VRSD 2IMDA 2KLXA 3TKSA 1FVJA 1QQ2A 3GURA 5CAXA 1JLWA 2DJ0A 2R0CA 2C0FA 3UIWA 1O73A 2B7JA 5CREA 5ELAA 5J4UA 1V9WA 2KHPA 4L5OA 3WGXA 4I2UA 4RUVA 3HJMA 2H66A 3FR3A 3MNGA 1YF1A 4RQRA 2NVLA 1OYJA 18GSA 4KW6A 3APQA 2FNOA 2YJ7A 4L0WA 2O7KA 4KX4A 4HOJA 4L8EA 1G0TA 2K6VA 2H8LA 5FHIA 2PMTA 3O3TA 3Q18A 2R37A 3UEMA 1J08A 2A2RA 1ZMAA 1BJXA 4YQVA 4IJ3A 5ECNB 3DYRA 1W4VA 2I4AA 1GTUA 1Z9HA 1WIKA 5GSTA 1ERTA 2K9FA 1V2AA 2LRTA 2CZ3A 2Z9SA 3KZQA 4MF6A 2CT6A 1OC9B 2H1BA 5HR0A 5CP1A 3US3A 3M8NA 4MNNA 2C1YA 4Z2RA 4ILFA 2L6DA 2HSMA 4KCEA 5ECOB 4K7NA 2R5GA 5DBQA 4WR4A 4F9ZA 1TRVA 3VPTA 3KD0A 3P8WA 5J5NA 3DIEA 1V58A 1PL2A 2HI7A 1TKDB 3NOFA 1FB0A 1PN0A 2CZ2A 1ZYQB 2FY6A 2JL4A 2RUFA 3IC8A 3ZMKA 4BVYA 3HVSA 2J9HA 1XW6A 2H0HA 4BL7A 3GL5A 2WULA 3HZ4A 2ES7A 2H1DA 7GSSA 3D21A 4GQFA 14GSA 2DSAA 1TJDA 4IQ1A 1Q4JA 2RM5A 3W6GA 4O7HA 3HJOA 1A0FA 5AIXA 3MAKA 1R26A 4F03A 1ZL9A 3QOUA 2D2ZA 3F6DA 2H6YA 3EWLA 1LBKA 4MCUA 4LL1B 1UN2A 4HJ2A 1X0RA 1NSWA 2E7PA 4N0VA 2PERA 4EKZA 2MMZA 2L4QA 3J7Yb 4IVFA 3H8QA 4PUFC 1K3YA 3GTUA 5DQSA 4ZL8A 2VO4A 2HLSA 1B4QA 1Y6EA 2B7KA 3UL3A 1B9XC 2IMEA 2NBSA 4EIPA 3KGKA 4HU9A 1OC8A 1MTCA 3VI7A 3G7JA 4RI7A 3APSA 3KCMA 2B5YA 4XIHA 2C8UA 4K5SA 3Q6OA 3KXOA 4BVXA 5IPGA 4G19A 1XIYA 2LJAA 4FO5A 5IM9A 3E9JB 3GYKA 3G7IA 4GXZA 1X9SB 2L59A 4TR3A 3F9UA 1GRXA 3GX0A 2VLUA 2HYXA 5D73A 2VCZA 1SKSB 1YF0A 1XWKA 4QL9A 1S3DA 1Z6NA 4ECIA 3IXRA 1M99A 1T4YA 3GKNA 5IOWA 3I43A 2MBTA 4I5QA 1UA5A 3TRPA 3F3QA 2PGTA 2EC4A 2I1UA 5DCHA 3ZZXA 1SL0B 3O76A 3EU4A 2VM2A 3TJJA 2IPAA 3RAZA 5CRGA 6GSUA 5F05A 5H5QA 5ECRB 3ERFA 2LNSA 4XCSA 2HRFA 2GQLA 5IO0A 3GKMA 2XHFA 2MBSA 1G7EA 3E0UA 1AXDA 1SYRA 5GSSA 3TRXA 2RUEA 4ZL7A 2GT5A 3LXZA 2LJRA 4TKYA 3GA4A 2WS2A 3TRQA 4GSNA 4QQ7A 1QXHA 5DDLA 2HXKA 3QAWA 1M9BA 2DKIA 3BCKA 3FRCA 1JZRA 2LRCA 1U3AA 4HQSA 1YQ1A 3NZNA 3SWLA 4ZL9A 3TKPA 2B1KA 2RM6A 1ILOA 1S3AA 5ID2A 3UARA 1JZWA 2X4AA 3VI5A 1SD9A 2OKAA 4E8HA 4CDOA 1VF3A 2H30A 3TOTA 3D4TA 1BYEA 4PURA 4MJEA 5D93A 4BWQA 4XS1A 1YKCA 2YCDA 1M3IA 3G7YA 3GH6A 1KEBA 1AQWA 2YOIA 3QMXA 4MZWA 3LQ7A 3TJGA 3BOAA 2PPTA 3FR9A 4XS6A 4K5RA 2DC5A 2FHEA 2LSTA 2CAQA 2H76A 1K0AA 4ECBA 1K0NA 1Z6MA 2QSIA 2YPMA 4IBPA 2TRCP 2V32A 1JFUA 4NMUA 3ME7A 5BRTA 4X0XA 4EE0A 2VCVA 1YDKA 3QFBC 1DE2A 3VFIA 1QK8A 12GSA 3J7Yk 3HVVA 4ZILA 2VM1A 1ERWA 3DRNA 4O92A 3FR6A 4YKGA 1ABAA 3GHAA 3P2AA 3LG6A 2AYTA 4LLRA 1O7UA 3EYTA 4G0IA 2DJJA 4MZCA 1BEDA 4DSSB 2X8HA 3EPTA 2VLVA 2LJKA 3P90A 4MK3A 2L57A 2FUG2 2JACA 1G7OA 4ZB6A 5IMCA 1GH2A 4HEA2 5L71A 1H75A 3D4MA 4IP1A 4F0CA 3C1SA 2QA1A 3W8SA 4QL7A 1BAYA 1EV4A 2A2PA 2PVOC 2ZCTA 2C80A 3F4SA 4KE3A 1XOAA 4OFNA 4TRXA 5D8IA 4YAVA 1SJIA 3F3RA 3PPUA 1SJ6A 5ECIB 2GSTA 4V2MA 5GAPD 2K8VA 2V2GA 4H86A 4POKA 2IFQA 2H0IA 2F51A 3I69A 3EURA 2MZCA 2F8AA 1GWCA 2TRXA 3UOMA 2H73A 2VCTA 4XS4A 1PX6A 4TR0A 3L9VA 4ZBBA 4IGJA 2JU5A 1FW1A 1OKDA 2XBIA 5KN1A 3F8UA 3CRUA 3HY2A 3UVHA 1T1VA 1MDKA 4KDXA 13GSA 1FO5A 2C0EA 2VL2A 3BJ5A 3EMXA 1X9WB 1JZOA 1TRSA 3ZMLA 5DJMA 2FA8A 5IMDA 1J0FA 3RHCA 2YP6A 1EV9A 4EC0A 4JE1A 5KN3A 2JSYA 5HFKA 4MMMA 5HR1A 4RQXA 4ZXGA 5DQYA 1CQHA 3KEBA 2C3QA 5JWOB 1U6TA 1SK1A 2DMMA 6GSVA 1TP9A 2DJKA 2BTOT 4ULXA 2OADA 2HRKA 2K8SA 4L5LA 4TN8A 3F4RA 1GULA 1I9DA 3FW2A 3GKKA 2NDOA 3TKSC 2LEGA 5KN0A 2OBKA 5CO3A 5KOWA 4TXOA 3DMLA 5E4WA 5EL8A 4LL4B 4KSMA 2PU9C 2LKUA 1Q98A 4ECCA 4A5PA 4KNDA 1A2LA 2GGTA 2A2SA 2EIOA 4WF4A 1WRYA 1QFNA 2GQMA 4JU5A 1XPVA 4USSA 2GSQA 4CY8A 4PNGA 1XWBA 3S9FA 1T3BA 1F37A 4KGIA 3VWVA 2CAIA 2O8VB 2PUKC 1AQVA 1EGOA 3IC4A 5ECLB 4JR6A 5ECSA 4ZIJA 3RDWA 4N10A 5HFIA 4TR1A 1TW9A 2CX4A 2OJLA 4OWYA 1B4PA 3WGEA 3BBYA 20GSA 4RI6A 3C7MA 3ZIJA 3TUEA 1TI3A 2KP2A 5ELGA 3DEXA 3IRAA 8GSSA 1K0BA 1XOBA 3DWVA 2B5XA 1M9AA 4HZ2A 2PBJA 5B8BA 3IPZA 5HR3A 1EEMA 3EVIA 4K0NA 4OD7A 4IP6A 4K7IA 1F9MA 2WJUA 2AUVA 3LYPA 2V41A 2H19A 1B48A 22GSA 3GTUB 17GSA 3P7XA 1FG4A 1FOHA 3GX8A 1X5EA 4IKHA 3UBLA 4D73A 1A8YA 2CA8A 6GSYA 1GSSA 3L0HA 2YWMA 4KH7A 4V2NA 4ACSA 1A23A 3A5WA 3HVNA 2KUCA 4ML6A 2FGXA 3L9SA 2XC2A 1EEJA 5KOXA 5LNKe 1TXXA 3LEFA 4TR4A 4PQ1A 3ISOA 1ML6A 3IV4A 5B7CA 4BVXB 2H1AA 3IAM2 2DIYA 2OE0A 1VGLA 3HCZA 3FYGA 2N5BA 3FY7A 5A5KA 1G6WA 3W8JA 2ZNMA 2AV4A 3A5IA 2J23A 5COHA 2V6OA 1TDIA 1FHEA 3D6IA 2QC7A 3L9UA 2XPDA 1O8XA 3R3EA 1EWXA 2DJ3A 5DAKA 5JWQB 1R5PA 3CXGA 1Z5YE 3GSTA 4WETA 3V1WA 3GFKA 2E0QA 2VCQA 5IO2A 3PH9A 1TRWA 2R6KA 2YJHA 5J9CA 3PGTA 3LGCA 3KTBA 3KJYA 1GNWA 2OBIA 2GSSA 1OC9A 2VUPA 1K3OA 2E2MA 3EMPA 5FT3A 4HJMA 2R0GA 3G9BA 2YNXA 5IMAA 1AUCA 3QDNA 2P5RA 2IMIA 2L5LA 4IHUA 1A2JA 3M0FA 4J56E 3TKQA 1OKTA 4ISDA 5EVOA 2G0FA 4KDUA 1EZKA 4POLA 3C73A 5G1LA 2MMOA 1SKWB 1VF2A 3LSZA 4I8BA 2GVPA 4EXJA 1BX9A 5CNWA 1YEXA 4MPGA 1H4OA 5ID2B 2AHEA 4IN0A 3QD9A 2F8FA 2AJQB 3M9KA 4EUYA 1N2AA 1GUHA 4OCFA 4HUAA 1R7HA 3APOA 5D96A 3KP8A 4KCAA 4AJ7A 3FMWA 1ZOFA 3ERGA 2QGVA 2GDRA 2X99A 2CV4A 1F6MC 2YANA 5B6NA 1OVNA 2GTUA 5IMVA 2IN3A 1PKWA 3MIXA 5IPHA 4FIWA 1M0UA 1PSQA 5ECPB 4WBRD 4LA1A 5J3RA 4OCEA 3LW9A 5AN1A 1TU8A 1WJKA 2KP1A 1HNBA 4YQMA 2KOKA 3TCOA 1XBSA 1XFLA 2DJ1A 3H1NA 5E59A 4JBBA 1GUKA 2YZUA 4XHMA 1YJ6A 2YV9A 5G30A 3PR8A 1QUWA 5KEJA 4GTUA 2REMA 1WPIA 4N0ZA 4EO3A 1B8XA 1NW2A 2HFDA 2IL3A 2M72A 1GTIA 4I97A 4YKFA 1K0OA 1FOVA 1ON4A 2H6ZA 2VOCA 4Q5QA 3ZTLA 1E6BA 4G0LA 4X1UA 3QAGA 1N8JA 2ON5A 3LYKA 1URMA 2OE3A 4N11A 2DKHA 3TKRA 5C04A 3DKSA 4LMWA 1IYIA 2H6XA 2X64A 3RBTA 4BWSA 4OFMA 2VLTA 4POMA 3UMAA 2N5AA 2I3YA 3GSSA 5HQPA 1ACVA 4Z7XA 2TIRA 2WRTA 5IMZA 3KMOA 3KTLA 3WD6A 4KSOA 3FZ9A 1K0CA 3ERWA 3H79A 2NTOA 1OE7A 2RLIA 4Z2TA 5J41A 3QAVA 3E3EA 2I81A 3JCML 3TB2A 4XRDA 4O5UA 1BG5A 4ZBDA 1GTAA 1PA3A 5F06A 4K1FA 3VK9A 2HZEA 3ME8A 1QGVA 1GSQA 4XS4B 3FZ4A 3U6VA 1KBNA 3M3MA 2X8CA 1M2AA 4GWRA 4NPBA 19GSA 1O8WA 1PFOA 4F2IA 1O6JA 1XCCA 2B6MA 2IMKA 2O87A 2O89A 2X49A 4P3YB 1TK5B 2WGRA 2BJXA 4OFTA 1HD2A 4V2LA 6GSSA 3GRXA 1TK0B 4JRRA 1CQGA 1T7PB 1X5CA 9GSSA 4K9ZA 3WGDA 1GL8A 4OO5A 2C0DA 5H5RA 3U5RE 4G0KA 3KMNA 3A2XA 3WYWA 3IBHA 2HE3A 4JEDA 1ZYPA 4WXTA 2N5FA 5DVBA
chains in the Genus database with same CATH topology
1W89A 1OE8A 3IOSA 1U88A 3SBCA 3RPPA 1PX7A 4G2EA 1XXUA 3BCIA 5F8BA 4MJCA 3EINA 1SJZA 1ERUA 2FCHA 1MDIA 5G5EA 2L6CA 1KNGA 1YY7A 4I2TA 4Z2UA 2C0GA 1ZCPA 4HU7A 5LD0A 4KA0A 4TXOB 2AAWA 4OO4A 1K0DA 2LRNA 1SK0A 4PUAA 1ZZYA 3TOUA 4FYUA 3HVXA 3LWAA 2VL2C 4PX1A 1NHOA 1ST9A 1JHBA 4POBA 4Q5NA 3A2WA 5FWGA 1Z3EA 2A4VA 4DSSA 3IA1A 1X9MB 5B8AA 4Q5FA 3O6TA 5BMUA 2HSYA 1AAZA 2DMLA 1GSYA 4TR1B 4MP4A 1GNEA 3LFLA 2CQ9A 5C00A 1XW9A 1NHYA 1TI1A 1TTZA 3F0IA 4FH8A 4NAXA 4ML1A 1M2DA 1SU9A 4ICYA 2FWHA 2GLRA 6GSXA 3CSJA 2E2GA 2LUSA 3GN3A 5ECKB 1MD3A 5IIZA 5AGYA 3R2QA 5DJLA 4GSSA 1XZOA 3F6FA 1DUGA 2B5EA 4K2DA 4DEJA 1PMTA 3GIXA 5IMFA 5A4VA 3FZ5A 2PWJA 3CBUA 4X43A 5HFGA 3GL3A 4TW5A 4D73B 4ZBAA 1U87A 5DALA 2L5OA 2C3TA 2FLSA 3CSHA 2DLXA 1A8LA 1Y25A 3TJBA 1B9YC 1BQ7A 1GSEA 2P5QA 3H4KA 4EDYA 1O81A 1ZYEA 5F07A 4OMVA 2QA2A 3I9V2 1V57A 1YEPA 1GUMA 1PL1A 4LMVA 3VWUA 5B6MA 2LQQA 2WDUA 2C4JA 4BVYB 5IOXA 1RK4A 4BL7B 1MEKA 3TJKA 2GZPA 4J2FA 1T4ZA 1V98A 3CYNA 2GSRA 1XWGA 3VURA 5D9TA 4HI7A 4ECJA 1AC1A 2F3MA 2I9HA 1AQXA 4MLYA 2WCIA 1ZGNA 1EP7A 2IJYA 5GZZB 1GP1A 1THXA 2VCWA 1K0MA 3DD3A 2H71A 2H70A 3K8NA 1ERVA 3UBKA 4IS0A 1HYUA 5DAKB 4Q5RA 3HJPA 2WB9A 4EF0A 10GSA 2JADA 4HDEA 4WKWA 4AJ8A 2OA7A 2YWNA 4BPYA 4ZB8A 2GT6A 3MDKA 2GQKA 2XBQA 4HQZA 2WZ9A 2PN8A 4CY6A 1C72A 2GZYA 1JLVA 3IDVA 1PQNA 2H72A 4KAEA 3D0ZA 1XW5A 2UZ8A 6GSTA 4V1Ag 1LJRA 2HNLA 1PRXA 1EOGA 2VL3A 5ECMB 1UC7A 3C8EA 1S3CA 3D22A 3FK8A 5ECHB 4PQIA 4TXVA 3EE2A 3FKFA 1TOFA 2EIRA 2YWIA 3AY8A 4MH3A 1GLPA 2ON7A 3ZRDA 3F63A 3WT2A 4KDYA 5D9XA 1TRUA 4PNFA 4CW9A 3GUSA 3HKRA 4NWYA 4PTSA 1LU4A 3HA9A 2VD1A 3MWHA 1SENA 3MSZA 3GH9A 4GLTA 3RPNA 3M9JA 2DBCA 2YV7A 4E8EA 2R2JA 3ZYWA 1F3AA 3BD2A 3ED3A 2M80A 1Z7RA 1U3IA 1WMJA 1V40A 1YZXA 3M1GA 2AB6A 2H74A 3DVXA 3VWWA 3UAPA 1F2EA 2L4CA 5JCWA 1SYXA 1R5AA 2K18A 4WR5A 11GSA 2IWTA 4KUNA 5CYYA 1TK8B 1Z7PA 4DSRA 3HDCA 1SL2B 1WWJA 1X5DA 4HZ4A 1G6YA 1EOHA 3QCPA 4YH2A 4KF9A 3PINA 4MPFA 4WEYA 3HXSA 1XWAA 3EC3A 4IW9A 1O85A 3LXTA 4IELA 3A3TA 4MJBA 2VL9A 1K3LA 4O5QA 3GMFA 2H75A 1UVZA 2JZSA 4EIQA 4ZB9A 3UJ1A 3ZL5A 3FZAA 5CRWA 3FHKA 1SKRB 1A24A 16GSA 1F3BA 1ZYNA 2JZTA 2CVBA 4AJ6A 2FWGA 2MMAA 4O32A 1DSBA 1A2MA 3EU3A 3KM6A 2MMNA 2YN1A 5AISA 3CSIA 4PXOA 4FYBA 3C71A 2ZUPA 2HSHA 4AGSA 3ZREA 2HT9A 2CVDA 5G1KA 1SK2A 2R3XA 3IK7A 1VF1A 1HQOA 4XRAA 3IAS2 3CMIA 2C3NA 1IYHA 1WP0A 2FD3A 4DVCA 5ENUA 2LQOA 3TKSE 2HZFA 1A0RP 4IJIA 3F4TA 1T00A 2MYGA 4N30A 5H5SA 5GAND 2HZEB 3IE3A 3QFAC 3HHVA 3ZVJD 3HYPA 2HRNA 2VCXA 2V1MA 4G10A 4DSQA 2OACA 3CRTA 3DGQA 4NHZA 3ZITA 1R4WA 5D9WA 5DCGA 2IMFA 4CHSA 4KB3A 4EVMA 3KP9A 2NPBA 3ZLPA 3KH9A 1M7TA 5EY6A 2YZHA 4PQHA 4NXIA 4FQUA 2H1GA 4WBJA 4EL1A 2LTKA 4TOPA 4YAPA 1I5GA 4MABA 4J57E 2LNTA 4NV5A 1HNCA 3DVWA 1FVKA 1AIUA 3CTFA 3MYDA 3UVTA 1WE0A 4MA9A 5A4WA 4JZQA 4AF2A 5JCGA 4ID0A 2OE1A 5JCUA 2M46A 2GS3A 3VLNA 4F0BA 2X8GA 4K2XA 3ZFBA 2JZRA 4MJAA 5INYA 1KTEA 3I6AA 1DBYA 4MF5A 2H01A 3ZFLA 3C1RA 1J9BA 4GCIA 5AIVA 2HRAA 2IFQB 4O5RA 1FB6A 1MDJA 1XWCA 5KN2A 3IK9A 5G2ZA 1GSFA 3CTGA 4X4JA 4I6XA 2EIQA 4MF7A 5F0GA 1RW1A 4PGTA 4BA7A 2GZZA 2DJ2A 2G2QA 4F82A 1QMVA 2A4HA 2CVKA 4GSTA 3NIVA 4XTSA 1GTBA 1PN9A 4NV2A 4K7OA 2XPEA 2B1LA 4TVEA 1XVWA 1T8EB 2H0GA 3H93A 3RHBA 1M2BA 3HD5A 1OAZA 3LJRA 1SD8A 3FEUA 3DXBA 4FYCA 3TJFA 1EGRA 5A4UA 3QR6A 5G5FA 3GNJA 4V1Ap 2F9SA 2VD0A 1JZDA 3L78A 2CX3A 3IHGA 4GQCA 1E2YA 3HZ8A 1HNAA 3Q19A 2BMXA 3ZVJA 4IQAA 3GV1A 5ECQB 2FWEA 4GRFA 4MDCA 5DALB 3KIJA 1GLQA 5CRHA 1GSDA 4EDZA 4NHWA 1DE1A 1MD4A 3TGZA 5HR2A 4MH2A 4G9HA 1SL1B 5EPFA 3WT1A 2V6KA 3QPMA 3D5JA 1EP8A 2O85A 3IR4A 2RIIA 4MZBA 4K6XA 2VAFA 2B3SA 2WFCA 3TDGA 3VPQA 4HS1A 3VWXA 1OC3A 3LORA 3OR5A 1YKAA 5IQYA 3IHQA 1WOUA 3A2VA 4K0GA 4WF5A 5JWRB 3ZIVA 5LCZA 2PVQA 2VIMA 1TU7A 3N5OA 1AW9A 2YWOA 1PD21 1PKZA 5J9BA 4GF0A 1XVQA 5D9VA 2R4VA 2DIZA 3Q74A 5G31A 4L0UA 1VF4A 2P0GA 2LS5A 2FWFA 3L4NA 3KH7A 3N9JA 2QKEA 2P31A 2LV3A 6GSWA 1FAAA 1USBA 2FA4A 1PGTA 4YQUA 4K8MA 1GSUA 4JR4A 1RQMA 2R0PA 3GKXA 5ABRA 2JSZA 1NM3A 5CRDA 2ALBA 2IIYA 1THOA 1VRSD 2IMDA 2KLXA 3TKSA 1FVJA 1QQ2A 3GURA 5CAXA 1JLWA 2DJ0A 2R0CA 2C0FA 3UIWA 1O73A 2B7JA 5CREA 5ELAA 5J4UA 1V9WA 2KHPA 4L5OA 3WGXA 4I2UA 4RUVA 3HJMA 2H66A 3FR3A 3MNGA 1YF1A 4RQRA 2NVLA 1OYJA 18GSA 4KW6A 3APQA 2FNOA 2YJ7A 4L0WA 2O7KA 4KX4A 4HOJA 4L8EA 1G0TA 2K6VA 2H8LA 5FHIA 2PMTA 3O3TA 3Q18A 2R37A 3UEMA 1J08A 2A2RA 1ZMAA 1BJXA 4YQVA 4IJ3A 5ECNB 3DYRA 1W4VA 2I4AA 1GTUA 1Z9HA 1WIKA 5GSTA 1ERTA 2K9FA 1V2AA 2LRTA 2CZ3A 2Z9SA 3KZQA 4MF6A 2CT6A 1OC9B 2H1BA 5HR0A 5CP1A 3US3A 3M8NA 4MNNA 2C1YA 4Z2RA 4ILFA 2L6DA 2HSMA 4KCEA 5ECOB 4K7NA 2R5GA 5DBQA 4WR4A 4F9ZA 1TRVA 3VPTA 3KD0A 3P8WA 5J5NA 3DIEA 1V58A 1PL2A 2HI7A 1TKDB 3NOFA 1FB0A 1PN0A 2CZ2A 1ZYQB 2FY6A 2JL4A 2RUFA 3IC8A 3ZMKA 4BVYA 3HVSA 2J9HA 1XW6A 2H0HA 4BL7A 3GL5A 2WULA 3HZ4A 2ES7A 2H1DA 7GSSA 3D21A 4GQFA 14GSA 2DSAA 1TJDA 4IQ1A 1Q4JA 2RM5A 3W6GA 4O7HA 3HJOA 1A0FA 5AIXA 3MAKA 1R26A 4F03A 1ZL9A 3QOUA 2D2ZA 3F6DA 2H6YA 3EWLA 1LBKA 4MCUA 4LL1B 1UN2A 4HJ2A 1X0RA 1NSWA 2E7PA 4N0VA 2PERA 4EKZA 2MMZA 2L4QA 3J7Yb 4IVFA 3H8QA 4PUFC 1K3YA 3GTUA 5DQSA 4ZL8A 2VO4A 2HLSA 1B4QA 1Y6EA 2B7KA 3UL3A 1B9XC 2IMEA 2NBSA 4EIPA 3KGKA 4HU9A 1OC8A 1MTCA 3VI7A 3G7JA 4RI7A 3APSA 3KCMA 2B5YA 4XIHA 2C8UA 4K5SA 3Q6OA 3KXOA 4BVXA 5IPGA 4G19A 1XIYA 2LJAA 4FO5A 5IM9A 3E9JB 3GYKA 3G7IA 4GXZA 1X9SB 2L59A 4TR3A 3F9UA 1GRXA 3GX0A 2VLUA 2HYXA 5D73A 2VCZA 1SKSB 1YF0A 1XWKA 4QL9A 1S3DA 1Z6NA 4ECIA 3IXRA 1M99A 1T4YA 3GKNA 5IOWA 3I43A 2MBTA 4I5QA 1UA5A 3TRPA 3F3QA 2PGTA 2EC4A 2I1UA 5DCHA 3ZZXA 1SL0B 3O76A 3EU4A 2VM2A 3TJJA 2IPAA 3RAZA 5CRGA 6GSUA 5F05A 5H5QA 5ECRB 3ERFA 2LNSA 4XCSA 2HRFA 2GQLA 5IO0A 3GKMA 2XHFA 2MBSA 1G7EA 3E0UA 1AXDA 1SYRA 5GSSA 3TRXA 2RUEA 4ZL7A 2GT5A 3LXZA 2LJRA 4TKYA 3GA4A 2WS2A 3TRQA 4GSNA 4QQ7A 1QXHA 5DDLA 2HXKA 3QAWA 1M9BA 2DKIA 3BCKA 3FRCA 1JZRA 2LRCA 1U3AA 4HQSA 1YQ1A 3NZNA 3SWLA 4ZL9A 3TKPA 2B1KA 2RM6A 1ILOA 1S3AA 5ID2A 3UARA 1JZWA 2X4AA 3VI5A 1SD9A 2OKAA 4E8HA 4CDOA 1VF3A 2H30A 3TOTA 3D4TA 1BYEA 4PURA 4MJEA 5D93A 4BWQA 4XS1A 1YKCA 2YCDA 3G7YA 3GH6A 1KEBA 1AQWA 2YOIA 3QMXA 4MZWA 3LQ7A 3TJGA 3BOAA 2PPTA 3FR9A 4XS6A 4K5RA 2DC5A 2FHEA 2LSTA 2CAQA 2H76A 1K0AA 4ECBA 1K0NA 1Z6MA 2QSIA 2YPMA 4IBPA 2TRCP 2V32A 1JFUA 4NMUA 3ME7A 5BRTA 4X0XA 4EE0A 2VCVA 1YDKA 3QFBC 1DE2A 3VFIA 1QK8A 12GSA 3J7Yk 3HVVA 4ZILA 2VM1A 1ERWA 3DRNA 4O92A 3FR6A 4YKGA 1ABAA 3GHAA 3P2AA 3LG6A 2AYTA 4LLRA 1O7UA 3EYTA 4G0IA 2DJJA 4MZCA 1BEDA 4DSSB 2X8HA 3EPTA 2VLVA 2LJKA 3P90A 4MK3A 2L57A 2FUG2 2JACA 1G7OA 4ZB6A 5IMCA 1GH2A 4HEA2 5L71A 1H75A 3D4MA 4IP1A 4F0CA 3C1SA 2QA1A 3W8SA 4QL7A 1BAYA 1EV4A 2A2PA 2PVOC 2ZCTA 2C80A 3F4SA 4KE3A 1XOAA 4OFNA 4TRXA 5D8IA 4YAVA 1SJIA 3F3RA 3PPUA 1SJ6A 5ECIB 2GSTA 4V2MA 5GAPD 2K8VA 2V2GA 4H86A 4POKA 2IFQA 2H0IA 2F51A 3I69A 3EURA 2MZCA 2F8AA 1GWCA 2TRXA 3UOMA 2H73A 2VCTA 4XS4A 1PX6A 4TR0A 3L9VA 4ZBBA 4IGJA 2JU5A 1FW1A 1OKDA 2XBIA 5KN1A 3F8UA 3CRUA 3HY2A 3UVHA 1T1VA 1MDKA 4KDXA 13GSA 1FO5A 2C0EA 2VL2A 3BJ5A 3EMXA 1X9WB 1JZOA 1TRSA 3ZMLA 5DJMA 2FA8A 5IMDA 1J0FA 3RHCA 2YP6A 1EV9A 4EC0A 4JE1A 5KN3A 2JSYA 5HFKA 4MMMA 5HR1A 4RQXA 4ZXGA 5DQYA 1CQHA 3KEBA 2C3QA 5JWOB 1U6TA 1SK1A 2DMMA 6GSVA 1TP9A 2DJKA 2BTOT 4ULXA 2OADA 2HRKA 2K8SA 4L5LA 4TN8A 3F4RA 1GULA 1I9DA 3FW2A 3GKKA 2NDOA 3TKSC 2LEGA 5KN0A 2OBKA 5CO3A 5KOWA 4TXOA 3DMLA 5E4WA 5EL8A 4LL4B 4KSMA 2PU9C 2LKUA 1Q98A 4ECCA 4A5PA 4KNDA 1A2LA 2GGTA 2A2SA 2EIOA 4WF4A 1WRYA 1QFNA 2GQMA 4JU5A 1XPVA 4USSA 2GSQA 4CY8A 4PNGA 1XWBA 3S9FA 1T3BA 1F37A 4KGIA 3VWVA 2CAIA 2O8VB 2PUKC 1AQVA 1EGOA 3IC4A 5ECLB 4JR6A 5ECSA 4ZIJA 3RDWA 4N10A 5HFIA 4TR1A 1TW9A 2CX4A 2OJLA 4OWYA 1B4PA 3WGEA 3BBYA 20GSA 4RI6A 3C7MA 3ZIJA 3TUEA 1TI3A 2KP2A 5ELGA 3DEXA 3IRAA 8GSSA 1K0BA 1XOBA 3DWVA 2B5XA 1M9AA 4HZ2A 2PBJA 5B8BA 3IPZA 5HR3A 1EEMA 3EVIA 4K0NA 4OD7A 4IP6A 4K7IA 1F9MA 2WJUA 2AUVA 3LYPA 2V41A 2H19A 1B48A 22GSA 3GTUB 17GSA 3P7XA 1FG4A 1FOHA 3GX8A 1X5EA 4IKHA 3UBLA 4D73A 1A8YA 2CA8A 6GSYA 1GSSA 3L0HA 2YWMA 4KH7A 4V2NA 4ACSA 1A23A 3A5WA 4ML6A 2KUCA 2FGXA 3L9SA 2XC2A 1EEJA 5KOXA 5LNKe 1TXXA 3LEFA 4TR4A 4PQ1A 3ISOA 1ML6A 3IV4A 5B7CA 4BVXB 2H1AA 3IAM2 2DIYA 2OE0A 1VGLA 3HCZA 3FYGA 2N5BA 3FY7A 5A5KA 1G6WA 3W8JA 2ZNMA 2AV4A 3A5IA 2J23A 5COHA 2V6OA 1TDIA 1FHEA 3D6IA 2QC7A 3L9UA 2XPDA 1O8XA 3R3EA 1EWXA 2DJ3A 5DAKA 5JWQB 1R5PA 3CXGA 1Z5YE 3GSTA 4WETA 3V1WA 3GFKA 2E0QA 2VCQA 5IO2A 3PH9A 1TRWA 2R6KA 2YJHA 5J9CA 3PGTA 3LGCA 3KTBA 3KJYA 1GNWA 2OBIA 2GSSA 1OC9A 2VUPA 1K3OA 2E2MA 3EMPA 5FT3A 4HJMA 2R0GA 3G9BA 2YNXA 5IMAA 1AUCA 3QDNA 2P5RA 2IMIA 2L5LA 4IHUA 1A2JA 3M0FA 4J56E 3TKQA 1OKTA 4ISDA 5EVOA 2G0FA 4KDUA 1EZKA 4POLA 3C73A 5G1LA 2MMOA 1SKWB 1VF2A 3LSZA 4I8BA 2GVPA 4EXJA 1BX9A 5CNWA 1YEXA 4MPGA 1H4OA 5ID2B 2AHEA 4IN0A 3QD9A 2F8FA 2AJQB 3M9KA 4EUYA 1N2AA 1GUHA 4OCFA 4HUAA 1R7HA 3APOA 5D96A 3KP8A 4KCAA 4AJ7A 3FMWA 1ZOFA 3ERGA 2QGVA 2GDRA 2X99A 2CV4A 1F6MC 2YANA 5B6NA 1OVNA 2GTUA 5IMVA 2IN3A 1PKWA 3MIXA 5IPHA 4FIWA 1M0UA 1PSQA 5ECPB 4WBRD 4LA1A 5J3RA 4OCEA 3LW9A 5AN1A 1TU8A 1WJKA 2KP1A 1HNBA 4YQMA 2KOKA 3TCOA 1XBSA 1XFLA 2DJ1A 3H1NA 5E59A 4JBBA 1GUKA 2YZUA 4XHMA 1YJ6A 2YV9A 5G30A 3PR8A 1QUWA 5KEJA 4GTUA 2REMA 1WPIA 4N0ZA 4EO3A 1B8XA 1NW2A 2HFDA 2IL3A 2M72A 1GTIA 4I97A 4YKFA 1K0OA 1FOVA 1ON4A 2H6ZA 2VOCA 4Q5QA 3ZTLA 1E6BA 4G0LA 4X1UA 3QAGA 1N8JA 2ON5A 3LYKA 1URMA 2OE3A 4N11A 2DKHA 3TKRA 5C04A 3DKSA 4LMWA 1IYIA 2H6XA 2X64A 3RBTA 4BWSA 4OFMA 2VLTA 4POMA 3UMAA 2N5AA 2I3YA 3GSSA 5HQPA 1ACVA 4Z7XA 2TIRA 2WRTA 5IMZA 3KMOA 3KTLA 3WD6A 4KSOA 3FZ9A 1K0CA 3ERWA 3H79A 2NTOA 1OE7A 2RLIA 4Z2TA 5J41A 3QAVA 3E3EA 2I81A 3JCML 3TB2A 4XRDA 4O5UA 1BG5A 4ZBDA 1GTAA 1PA3A 5F06A 4K1FA 3VK9A 2HZEA 3ME8A 1QGVA 1GSQA 4XS4B 3FZ4A 3U6VA 1KBNA 3M3MA 2X8CA 1M2AA 4GWRA 4NPBA 19GSA 1O8WA 4F2IA 1O6JA 1XCCA 2B6MA 2IMKA 2O87A 2O89A 2X49A 4P3YB 1TK5B 2WGRA 2BJXA 4OFTA 1HD2A 4V2LA 6GSSA 3GRXA 1TK0B 4JRRA 1CQGA 1T7PB 1X5CA 9GSSA 4K9ZA 3WGDA 1GL8A 4OO5A 2C0DA 5H5RA 3U5RE 4G0KA 3KMNA 3A2XA 3WYWA 3IBHA 2HE3A 4JEDA 1ZYPA 4WXTA 2N5FA 5DVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W89 A;  1OE8 A;  3IOS A;  1U88 A;  3SBC A;  3RPP A;  1PX7 A;  4G2E A;  1XXU A;  3BCI A;  5F8B A;  4MJC A;  3EIN A;  1SJZ A;  1ERU A;  2FCH A;  1MDI A;  5G5E A;  2L6C A;  1KNG A;  1YY7 A;  4I2T A;  2C0G A;  1ZCP A;  4HU7 A;  5LD0 A;  4KA0 A;  4TXO B;  2AAW A;  4OO4 A;  1K0D A;  2LRN A;  1SK0 A;  4PUA A;  1ZZY A;  3TOU A;  4FYU A;  3HVX A;  3LWA A;  2VL2 C;  4PX1 A;  1NHO A;  1ST9 A;  1JHB A;  4POB A;  4Q5N A;  3A2W A;  5FWG A;  1Z3E A;  2A4V A;  4DSS A;  3IA1 A;  1X9M B;  5B8A A;  4Q5F A;  3O6T A;  2HSY A;  1AAZ A;  2DML A;  1GSY A;  4TR1 B;  4MP4 A;  1GNE A;  3LFL A;  2CQ9 A;  5C00 A;  1XW9 A;  1NHY A;  1TI1 A;  1TTZ A;  3F0I A;  4FH8 A;  4NAX A;  4ML1 A;  1M2D A;  1SU9 A;  2FWH A;  2GLR A;  6GSX A;  3CSJ A;  2E2G A;  2LUS A;  3GN3 A;  5ECK B;  1MD3 A;  5IIZ A;  5AGY A;  3R2Q A;  5DJL A;  4GSS A;  1XZO A;  3F6F A;  1DUG A;  2B5E A;  4K2D A;  4DEJ A;  1PMT A;  3GIX A;  5IMF A;  5A4V A;  3FZ5 A;  2PWJ A;  3CBU A;  4X43 A;  5HFG A;  3GL3 A;  4TW5 A;  4D73 B;  4ZBA A;  1U87 A;  5DAL A;  2L5O A;  2C3T A;  2FLS A;  3CSH A;  2DLX A;  1A8L A;  1Y25 A;  3TJB A;  1B9Y C;  1BQ7 A;  1GSE A;  2P5Q A;  3H4K A;  4EDY A;  1O81 A;  1ZYE A;  5F07 A;  4OMV A;  3I9V 2;  1V57 A;  1YEP A;  1GUM A;  1PL1 A;  4LMV A;  3VWU A;  5B6M A;  2LQQ A;  2WDU A;  2C4J A;  5IOX A;  1RK4 A;  1MEK A;  3TJK A;  2GZP A;  4J2F A;  1T4Z A;  1V98 A;  3CYN A;  2GSR A;  1XWG A;  3VUR A;  5D9T A;  4HI7 A;  4ECJ A;  1AC1 A;  2F3M A;  2I9H A;  1AQX A;  4MLY A;  2WCI A;  1ZGN A;  1EP7 A;  2IJY A;  5GZZ B;  1GP1 A;  1THX A;  2VCW A;  1K0M A;  3DD3 A;  2H71 A;  2H70 A;  3K8N A;  1ERV A;  3UBK A;  4IS0 A;  1HYU A;  5DAK B;  4Q5R A;  3HJP A;  2WB9 A;  4EF0 A;  10GS A;  2JAD A;  4HDE A;  4WKW A;  4AJ8 A;  2OA7 A;  2YWN A;  4BPY A;  4ZB8 A;  2GT6 A;  3MDK A;  2GQK A;  2XBQ A;  4HQZ A;  2WZ9 A;  2PN8 A;  1C72 A;  2GZY A;  1JLV A;  3IDV A;  1PQN A;  2H72 A;  4KAE A;  3D0Z A;  1XW5 A;  6GST A;  4V1A g;  1LJR A;  2HNL A;  1PRX A;  1EOG A;  2VL3 A;  5ECM B;  1UC7 A;  3C8E A;  1S3C A;  3D22 A;  3FK8 A;  5ECH B;  4PQI A;  4TXV A;  3EE2 A;  3FKF A;  1TOF A;  2EIR A;  2YWI A;  3AY8 A;  4MH3 A;  1GLP A;  2ON7 A;  3ZRD A;  3F63 A;  3WT2 A;  4KDY A;  5D9X A;  1TRU A;  4PNF A;  4CW9 A;  3GUS A;  3HKR A;  4NWY A;  1LU4 A;  3HA9 A;  2VD1 A;  3MWH A;  1SEN A;  3MSZ A;  3GH9 A;  4GLT A;  3RPN A;  3M9J A;  2DBC A;  2YV7 A;  4E8E A;  2R2J A;  3ZYW A;  1F3A A;  3BD2 A;  3ED3 A;  2M80 A;  1Z7R A;  1U3I A;  1WMJ A;  1V40 A;  1YZX A;  3M1G A;  2AB6 A;  2H74 A;  3DVX A;  3VWW A;  3UAP A;  1F2E A;  2L4C A;  5JCW A;  1SYX A;  1R5A A;  2K18 A;  4WR5 A;  11GS A;  2IWT A;  4KUN A;  5CYY A;  1TK8 B;  1Z7P A;  4DSR A;  3HDC A;  1SL2 B;  1WWJ A;  1X5D A;  4HZ4 A;  1G6Y A;  1EOH A;  3QCP A;  4YH2 A;  3PIN A;  4MPF A;  4WEY A;  3HXS A;  1XWA A;  3EC3 A;  4IW9 A;  1O85 A;  3LXT A;  4IEL A;  3A3T A;  4MJB A;  2VL9 A;  1K3L A;  3GMF A;  2H75 A;  1UVZ A;  2JZS A;  4ZB9 A;  3UJ1 A;  3ZL5 A;  3FZA A;  5CRW A;  3FHK A;  1SKR B;  1A24 A;  16GS A;  1F3B A;  2JZT A;  2CVB A;  4AJ6 A;  2FWG A;  2MMA A;  4O32 A;  1DSB A;  1A2M A;  3EU3 A;  3KM6 A;  2MMN A;  2YN1 A;  5AIS A;  3CSI A;  4PXO A;  4FYB A;  3C71 A;  2ZUP A;  2HSH A;  4AGS A;  3ZRE A;  2HT9 A;  2CVD A;  5G1K A;  1SK2 A;  2R3X A;  3IK7 A;  1VF1 A;  1HQO A;  4XRA A;  3IAS 2;  3CMI A;  2C3N A;  1IYH A;  1WP0 A;  2FD3 A;  4DVC A;  5ENU A;  2LQO A;  3TKS E;  2HZF A;  1A0R P;  4IJI A;  3F4T A;  1T00 A;  2MYG A;  4N30 A;  5H5S A;  5GAN D;  2HZE B;  3IE3 A;  3QFA C;  3HHV A;  3ZVJ D;  3HYP A;  2HRN A;  2VCX A;  2V1M A;  4G10 A;  4DSQ A;  2OAC A;  3CRT A;  3DGQ A;  4NHZ A;  3ZIT A;  1R4W A;  5D9W A;  5DCG A;  2IMF A;  4CHS A;  4KB3 A;  4EVM A;  3KP9 A;  2NPB A;  3ZLP A;  3KH9 A;  1M7T A;  5EY6 A;  2YZH A;  4PQH A;  4NXI A;  2H1G A;  4WBJ A;  4EL1 A;  2LTK A;  4TOP A;  4YAP A;  1I5G A;  4MAB A;  4J57 E;  2LNT A;  4NV5 A;  1HNC A;  3DVW A;  1FVK A;  1AIU A;  3CTF A;  3UVT A;  1WE0 A;  4MA9 A;  5A4W A;  4JZQ A;  4AF2 A;  5JCG A;  4ID0 A;  2OE1 A;  5JCU A;  2M46 A;  2GS3 A;  3VLN A;  4F0B A;  2X8G A;  3ZFB A;  2JZR A;  4MJA A;  5INY A;  1KTE A;  3I6A A;  1DBY A;  4MF5 A;  2H01 A;  3ZFL A;  3C1R A;  1J9B A;  4GCI A;  5AIV A;  2IFQ B;  4O5R A;  1FB6 A;  1MDJ A;  1XWC A;  5KN2 A;  3IK9 A;  5G2Z A;  1GSF A;  3CTG A;  4I6X A;  2EIQ A;  4MF7 A;  5F0G A;  1RW1 A;  4PGT A;  4BA7 A;  2GZZ A;  2DJ2 A;  2G2Q A;  4F82 A;  1QMV A;  2CVK A;  4GST A;  3NIV A;  4XTS A;  1GTB A;  1PN9 A;  4NV2 A;  4K7O A;  2XPE A;  2B1L A;  4TVE A;  1XVW A;  1T8E B;  2H0G A;  3H93 A;  3RHB A;  1M2B A;  3HD5 A;  1OAZ A;  3LJR A;  1SD8 A;  3FEU A;  3DXB A;  4FYC A;  3TJF A;  1EGR A;  5A4U A;  3QR6 A;  5G5F A;  3GNJ A;  4V1A p;  2F9S A;  2VD0 A;  1JZD A;  3L78 A;  2CX3 A;  4GQC A;  1E2Y A;  3HZ8 A;  1HNA A;  3Q19 A;  2BMX A;  3ZVJ A;  4IQA A;  3GV1 A;  5ECQ B;  2FWE A;  4GRF A;  4MDC A;  5DAL B;  3KIJ A;  1GLQ A;  5CRH A;  1GSD A;  4EDZ A;  4NHW A;  1DE1 A;  1MD4 A;  3TGZ A;  5HR2 A;  4MH2 A;  4G9H A;  1SL1 B;  5EPF A;  3WT1 A;  2V6K A;  3QPM A;  3D5J A;  1EP8 A;  2O85 A;  3IR4 A;  2RII A;  4MZB A;  4K6X A;  2VAF A;  2B3S A;  2WFC A;  3TDG A;  3VPQ A;  4HS1 A;  3VWX A;  1OC3 A;  3LOR A;  3OR5 A;  1YKA A;  5IQY A;  3IHQ A;  1WOU A;  3A2V A;  4K0G A;  4WF5 A;  5JWR B;  3ZIV A;  5LCZ A;  2PVQ A;  2VIM A;  1TU7 A;  3N5O A;  1AW9 A;  2YWO A;  1PD2 1;  1PKZ A;  5J9B A;  4GF0 A;  1XVQ A;  5D9V A;  2R4V A;  2DIZ A;  3Q74 A;  5G31 A;  4L0U A;  1VF4 A;  2P0G A;  2LS5 A;  2FWF A;  3L4N A;  3KH7 A;  3N9J A;  2QKE A;  2P31 A;  2LV3 A;  6GSW A;  1FAA A;  1USB A;  2FA4 A;  1PGT A;  4YQU A;  4K8M A;  1GSU A;  4JR4 A;  1RQM A;  3GKX A;  5ABR A;  2JSZ A;  1NM3 A;  5CRD A;  2ALB A;  2IIY A;  1THO A;  1VRS D;  2IMD A;  2KLX A;  3TKS A;  1FVJ A;  1QQ2 A;  3GUR A;  5CAX A;  1JLW A;  2DJ0 A;  2C0F A;  3UIW A;  1O73 A;  2B7J A;  5CRE A;  5ELA A;  5J4U A;  1V9W A;  2KHP A;  4L5O A;  3WGX A;  4I2U A;  4RUV A;  3HJM A;  2H66 A;  3FR3 A;  3MNG A;  1YF1 A;  4RQR A;  2NVL A;  1OYJ A;  18GS A;  4KW6 A;  3APQ A;  2FNO A;  2YJ7 A;  4L0W A;  2O7K A;  4KX4 A;  4HOJ A;  4L8E A;  1G0T A;  2K6V A;  2H8L A;  5FHI A;  2PMT A;  3O3T A;  3Q18 A;  2R37 A;  3UEM A;  1J08 A;  2A2R A;  1ZMA A;  1BJX A;  4YQV A;  4IJ3 A;  5ECN B;  3DYR A;  1W4V A;  2I4A A;  1GTU A;  1Z9H A;  1WIK A;  5GST A;  1ERT A;  2K9F A;  1V2A A;  2LRT A;  2CZ3 A;  2Z9S A;  3KZQ A;  4MF6 A;  2CT6 A;  1OC9 B;  2H1B A;  5HR0 A;  5CP1 A;  3US3 A;  3M8N A;  2C1Y A;  4ILF A;  2L6D A;  4KCE A;  5ECO B;  4K7N A;  2R5G A;  5DBQ A;  4WR4 A;  4F9Z A;  1TRV A;  3VPT A;  3KD0 A;  3P8W A;  5J5N A;  3DIE A;  1V58 A;  1PL2 A;  2HI7 A;  1TKD B;  3NOF A;  1FB0 A;  2CZ2 A;  1ZYQ B;  2FY6 A;  2JL4 A;  2RUF A;  3ZMK A;  4BVY A;  3HVS A;  2J9H A;  1XW6 A;  2H0H A;  4BL7 A;  3GL5 A;  2WUL A;  3HZ4 A;  2ES7 A;  2H1D A;  7GSS A;  3D21 A;  4GQF A;  14GS A;  2DSA A;  1TJD A;  4IQ1 A;  1Q4J A;  2RM5 A;  3W6G A;  4O7H A;  3HJO A;  1A0F A;  5AIX A;  3MAK A;  1R26 A;  4F03 A;  1ZL9 A;  3QOU A;  2D2Z A;  3F6D A;  2H6Y A;  3EWL A;  1LBK A;  4MCU A;  4LL1 B;  1UN2 A;  4HJ2 A;  1X0R A;  1NSW A;  2E7P A;  4N0V A;  2PER A;  4EKZ A;  2MMZ A;  2L4Q A;  3J7Y b;  4IVF A;  3H8Q A;  4PUF C;  1K3Y A;  3GTU A;  5DQS A;  4ZL8 A;  2VO4 A;  2HLS A;  1B4Q A;  1Y6E A;  2B7K A;  3UL3 A;  1B9X C;  2IME A;  2NBS A;  3KGK A;  4HU9 A;  1OC8 A;  1MTC A;  3VI7 A;  3G7J A;  4RI7 A;  3APS A;  3KCM A;  2B5Y A;  4XIH A;  2C8U A;  3Q6O A;  3KXO A;  4BVX A;  5IPG A;  4G19 A;  1XIY A;  2LJA A;  4FO5 A;  5IM9 A;  3E9J B;  3GYK A;  3G7I A;  4GXZ A;  1X9S B;  2L59 A;  4TR3 A;  3F9U A;  1GRX A;  3GX0 A;  2VLU A;  2HYX A;  5D73 A;  2VCZ A;  1SKS B;  1YF0 A;  1XWK A;  4QL9 A;  1S3D A;  1Z6N A;  4ECI A;  3IXR A;  1M99 A;  1T4Y A;  3GKN A;  5IOW A;  3I43 A;  2MBT A;  4I5Q A;  1UA5 A;  3TRP A;  3F3Q A;  2PGT A;  2EC4 A;  2I1U A;  5DCH A;  3ZZX A;  1SL0 B;  3O76 A;  3EU4 A;  2VM2 A;  3TJJ A;  2IPA A;  3RAZ A;  5CRG A;  6GSU A;  5F05 A;  5H5Q A;  5ECR B;  3ERF A;  2LNS A;  4XCS A;  2HRF A;  2GQL A;  5IO0 A;  3GKM A;  2XHF A;  2MBS A;  1G7E A;  3E0U A;  1AXD A;  1SYR A;  5GSS A;  3TRX A;  2RUE A;  4ZL7 A;  2GT5 A;  3LXZ A;  2LJR A;  4TKY A;  3GA4 A;  2WS2 A;  3TRQ A;  4GSN A;  4QQ7 A;  1QXH A;  5DDL A;  2HXK A;  3QAW A;  1M9B A;  3BCK A;  3FRC A;  1JZR A;  2LRC A;  1U3A A;  4HQS A;  1YQ1 A;  3NZN A;  3SWL A;  4ZL9 A;  3TKP A;  2B1K A;  2RM6 A;  1ILO A;  1S3A A;  5ID2 A;  3UAR A;  1JZW A;  3VI5 A;  1SD9 A;  2OKA A;  4E8H A;  4CDO A;  1VF3 A;  2H30 A;  3TOT A;  3D4T A;  1BYE A;  4PUR A;  4MJE A;  5D93 A;  4BWQ A;  4XS1 A;  1YKC A;  2YCD A;  3G7Y A;  3GH6 A;  1KEB A;  1AQW A;  2YOI A;  3QMX A;  4MZW A;  3LQ7 A;  3TJG A;  3BOA A;  2PPT A;  3FR9 A;  4XS6 A;  2DC5 A;  2FHE A;  2LST A;  2CAQ A;  2H76 A;  1K0A A;  4ECB A;  1K0N A;  1Z6M A;  2QSI A;  2YPM A;  4IBP A;  2TRC P;  2V32 A;  1JFU A;  4NMU A;  3ME7 A;  4X0X A;  4EE0 A;  2VCV A;  1YDK A;  3QFB C;  1DE2 A;  3VFI A;  1QK8 A;  12GS A;  3J7Y k;  3HVV A;  4ZIL A;  2VM1 A;  1ERW A;  3DRN A;  4O92 A;  3FR6 A;  1ABA A;  3GHA A;  3P2A A;  3LG6 A;  2AYT A;  4LLR A;  1O7U A;  3EYT A;  2DJJ A;  4MZC A;  1BED A;  4DSS B;  2X8H A;  2VLV A;  2LJK A;  3P90 A;  4MK3 A;  2L57 A;  2FUG 2;  2JAC A;  1G7O A;  4ZB6 A;  5IMC A;  1GH2 A;  4HEA 2;  5L71 A;  1H75 A;  3D4M A;  4IP1 A;  4F0C A;  3C1S A;  3W8S A;  4QL7 A;  1BAY A;  1EV4 A;  2PVO C;  2ZCT A;  2C80 A;  3F4S A;  4KE3 A;  1XOA A;  4OFN A;  4TRX A;  5D8I A;  4YAV A;  1SJI A;  3F3R A;  1SJ6 A;  5ECI B;  2GST A;  4V2M A;  5GAP D;  2K8V A;  2V2G A;  4H86 A;  4POK A;  2IFQ A;  2H0I A;  2F51 A;  3I69 A;  3EUR A;  2MZC A;  2F8A A;  1GWC A;  2TRX A;  3UOM A;  2H73 A;  2VCT A;  4XS4 A;  1PX6 A;  4TR0 A;  3L9V A;  4ZBB A;  4IGJ A;  2JU5 A;  1FW1 A;  1OKD A;  2XBI A;  5KN1 A;  3F8U A;  3CRU A;  3HY2 A;  3UVH A;  1T1V A;  1MDK A;  4KDX A;  13GS A;  1FO5 A;  2C0E A;  2VL2 A;  3BJ5 A;  3EMX A;  1X9W B;  1JZO A;  1TRS A;  3ZML A;  5DJM A;  2FA8 A;  5IMD A;  1J0F A;  3RHC A;  2YP6 A;  1EV9 A;  4EC0 A;  4JE1 A;  5KN3 A;  2JSY A;  5HFK A;  4MMM A;  5HR1 A;  4RQX A;  4ZXG A;  5DQY A;  1CQH A;  3KEB A;  2C3Q A;  5JWO B;  1U6T A;  1SK1 A;  2DMM A;  6GSV A;  1TP9 A;  2DJK A;  2BTO T;  4ULX A;  2OAD A;  2K8S A;  4L5L A;  4TN8 A;  3F4R A;  1GUL A;  1I9D A;  3FW2 A;  3GKK A;  2NDO A;  3TKS C;  2LEG A;  5KN0 A;  2OBK A;  5CO3 A;  4TXO A;  3DML A;  5E4W A;  5EL8 A;  4LL4 B;  4KSM A;  2PU9 C;  2LKU A;  1Q98 A;  4ECC A;  4KND A;  1A2L A;  2GGT A;  2A2S A;  2EIO A;  4WF4 A;  1WRY A;  1QFN A;  2GQM A;  4JU5 A;  1XPV A;  2GSQ A;  4PNG A;  1XWB A;  3S9F A;  1T3B A;  1F37 A;  4KGI A;  3VWV A;  2CAI A;  2O8V B;  2PUK C;  1AQV A;  1EGO A;  3IC4 A;  5ECL B;  4JR6 A;  5ECS A;  4ZIJ A;  3RDW A;  4N10 A;  5HFI A;  4TR1 A;  1TW9 A;  2CX4 A;  2OJL A;  4OWY A;  1B4P A;  3WGE A;  3BBY A;  20GS A;  4RI6 A;  3C7M A;  3ZIJ A;  3TUE A;  1TI3 A;  2KP2 A;  5ELG A;  3DEX A;  3IRA A;  8GSS A;  1K0B A;  1XOB A;  3DWV A;  2B5X A;  1M9A A;  4HZ2 A;  2PBJ A;  5B8B A;  3IPZ A;  5HR3 A;  1EEM A;  3EVI A;  4K0N A;  4OD7 A;  4IP6 A;  4K7I A;  1F9M A;  2WJU A;  2AUV A;  3LYP A;  2V41 A;  2H19 A;  1B48 A;  22GS A;  3GTU B;  17GS A;  3P7X A;  1FG4 A;  3GX8 A;  1X5E A;  4IKH A;  3UBL A;  4D73 A;  1A8Y A;  2CA8 A;  6GSY A;  1GSS A;  3L0H A;  2YWM A;  4KH7 A;  4V2N A;  4ACS A;  1A23 A;  3A5W A;  4ML6 A;  2KUC A;  2FGX A;  3L9S A;  2XC2 A;  1EEJ A;  5LNK e;  1TXX A;  3LEF A;  4TR4 A;  4PQ1 A;  3ISO A;  1ML6 A;  3IV4 A;  5B7C A;  2H1A A;  3IAM 2;  2DIY A;  2OE0 A;  1VGL A;  3HCZ A;  3FYG A;  2N5B A;  3FY7 A;  5A5K A;  1G6W A;  3W8J A;  2ZNM A;  2AV4 A;  2J23 A;  5COH A;  2V6O A;  1TDI A;  1FHE A;  3D6I A;  2QC7 A;  3L9U A;  2XPD A;  1O8X A;  1EWX A;  2DJ3 A;  5DAK A;  5JWQ B;  1R5P A;  3CXG A;  1Z5Y E;  3GST A;  4WET A;  3V1W A;  3GFK A;  2E0Q A;  2VCQ A;  5IO2 A;  3PH9 A;  1TRW A;  2R6K A;  2YJH A;  5J9C A;  3PGT A;  3LGC A;  3KTB A;  3KJY A;  1GNW A;  2OBI A;  2GSS A;  1OC9 A;  2VUP A;  1K3O A;  2E2M A;  3EMP A;  5FT3 A;  4HJM A;  3G9B A;  2YNX A;  5IMA A;  1AUC A;  3QDN A;  2P5R A;  2IMI A;  2L5L A;  4IHU A;  1A2J A;  3M0F A;  4J56 E;  3TKQ A;  1OKT A;  4ISD A;  5EVO A;  2G0F A;  4KDU A;  1EZK A;  4POL A;  3C73 A;  5G1L A;  2MMO A;  1SKW B;  1VF2 A;  3LSZ A;  4I8B A;  2GVP A;  4EXJ A;  1BX9 A;  5CNW A;  1YEX A;  4MPG A;  1H4O A;  5ID2 B;  2AHE A;  4IN0 A;  3QD9 A;  2F8F A;  2AJQ B;  3M9K A;  4EUY A;  1N2A A;  1GUH A;  4OCF A;  4HUA A;  1R7H A;  3APO A;  5D96 A;  3KP8 A;  4KCA A;  4AJ7 A;  1ZOF A;  3ERG A;  2QGV A;  2GDR A;  2X99 A;  2CV4 A;  1F6M C;  2YAN A;  5B6N A;  1OVN A;  2GTU A;  5IMV A;  2IN3 A;  1PKW A;  5IPH A;  4FIW A;  1M0U A;  1PSQ A;  5ECP B;  4WBR D;  4LA1 A;  5J3R A;  4OCE A;  5AN1 A;  1TU8 A;  1WJK A;  2KP1 A;  1HNB A;  4YQM A;  2KOK A;  3TCO A;  1XBS A;  1XFL A;  2DJ1 A;  3H1N A;  5E59 A;  4JBB A;  1GUK A;  2YZU A;  4XHM A;  1YJ6 A;  2YV9 A;  5G30 A;  3PR8 A;  1QUW A;  5KEJ A;  4GTU A;  2REM A;  1WPI A;  4N0Z A;  4EO3 A;  1B8X A;  1NW2 A;  2HFD A;  2IL3 A;  2M72 A;  1GTI A;  4I97 A;  1K0O A;  1FOV A;  1ON4 A;  2H6Z A;  2VOC A;  4Q5Q A;  3ZTL A;  1E6B A;  4X1U A;  3QAG A;  1N8J A;  2ON5 A;  3LYK A;  1URM A;  2OE3 A;  4N11 A;  3TKR A;  5C04 A;  3DKS A;  4LMW A;  1IYI A;  2H6X A;  2X64 A;  3RBT A;  4BWS A;  4OFM A;  2VLT A;  4POM A;  3UMA A;  2N5A A;  2I3Y A;  3GSS A;  5HQP A;  1ACV A;  4Z7X A;  2TIR A;  2WRT A;  5IMZ A;  3KMO A;  3KTL A;  3WD6 A;  4KSO A;  3FZ9 A;  1K0C A;  3ERW A;  3H79 A;  2NTO A;  1OE7 A;  2RLI A;  5J41 A;  3QAV A;  3E3E A;  2I81 A;  3JCM L;  3TB2 A;  4XRD A;  1BG5 A;  4ZBD A;  1GTA A;  5F06 A;  1PA3 A;  4K1F A;  3VK9 A;  2HZE A;  3ME8 A;  1QGV A;  1GSQ A;  4XS4 B;  3FZ4 A;  3U6V A;  1KBN A;  3M3M A;  2X8C A;  1M2A A;  4GWR A;  4NPB A;  19GS A;  1O8W A;  4F2I A;  1O6J A;  1XCC A;  2B6M A;  2IMK A;  2O87 A;  2O89 A;  4P3Y B;  1TK5 B;  2WGR A;  2BJX A;  4OFT A;  1HD2 A;  4V2L A;  6GSS A;  3GRX A;  1TK0 B;  4JRR A;  1CQG A;  1T7P B;  1X5C A;  9GSS A;  4K9Z A;  3WGD A;  1GL8 A;  4OO5 A;  2C0D A;  5H5R A;  3U5R E;  3KMN A;  3A2X A;  3WYW A;  3IBH A;  2HE3 A;  4JED A;  4WXT A;  2N5F A;  5DVB A; 
#chains in the Genus database with same CATH topology
 1W89 A;  1OE8 A;  3IOS A;  1U88 A;  3SBC A;  3RPP A;  1PX7 A;  4G2E A;  1XXU A;  3BCI A;  5F8B A;  4MJC A;  3EIN A;  1SJZ A;  1ERU A;  2FCH A;  1MDI A;  5G5E A;  2L6C A;  1KNG A;  1YY7 A;  4I2T A;  4Z2U A;  2C0G A;  1ZCP A;  4HU7 A;  5LD0 A;  4KA0 A;  4TXO B;  2AAW A;  4OO4 A;  1K0D A;  2LRN A;  1SK0 A;  4PUA A;  1ZZY A;  3TOU A;  4FYU A;  3HVX A;  3LWA A;  2VL2 C;  4PX1 A;  1NHO A;  1ST9 A;  1JHB A;  4POB A;  4Q5N A;  3CQF A;  3A2W A;  5FWG A;  1Z3E A;  2A4V A;  4DSS A;  3IA1 A;  1X9M B;  5B8A A;  4Q5F A;  3O6T A;  5BMU A;  2HSY A;  1AAZ A;  2DML A;  1GSY A;  4TR1 B;  4MP4 A;  1GNE A;  3LFL A;  2CQ9 A;  5C00 A;  1XW9 A;  1NHY A;  1TI1 A;  4HSC X;  1TTZ A;  3F0I A;  4FH8 A;  4NAX A;  4ML1 A;  1M2D A;  1SU9 A;  4ICY A;  2FWH A;  2GLR A;  6GSX A;  3CSJ A;  2E2G A;  2LUS A;  3GN3 A;  5ECK B;  1MD3 A;  5IIZ A;  5AGY A;  3R2Q A;  5DJL A;  4GSS A;  1XZO A;  3F6F A;  1DUG A;  2B5E A;  4K2D A;  4DEJ A;  1PMT A;  3GIX A;  5IMF A;  5A4V A;  3FZ5 A;  2PWJ A;  3CBU A;  4X43 A;  5HFG A;  3GL3 A;  4TW5 A;  4D73 B;  4ZBA A;  1U87 A;  5DAL A;  2L5O A;  2C3T A;  2FLS A;  3CSH A;  2DLX A;  1A8L A;  1Y25 A;  3TJB A;  1B9Y C;  1BQ7 A;  1GSE A;  2P5Q A;  3H4K A;  4EDY A;  1O81 A;  1ZYE A;  5F07 A;  4OMV A;  2QA2 A;  3I9V 2;  1V57 A;  1YEP A;  1GUM A;  1PL1 A;  4LMV A;  3VWU A;  5B6M A;  2LQQ A;  2WDU A;  2C4J A;  4BVY B;  5IOX A;  1RK4 A;  4BL7 B;  1MEK A;  3TJK A;  2GZP A;  4J2F A;  1T4Z A;  1V98 A;  3CYN A;  2GSR A;  1XWG A;  3VUR A;  5D9T A;  4HI7 A;  4ECJ A;  1AC1 A;  2F3M A;  2I9H A;  1AQX A;  4MLY A;  2WCI A;  1ZGN A;  1EP7 A;  2IJY A;  5GZZ B;  1GP1 A;  1THX A;  2VCW A;  1K0M A;  3DD3 A;  2H71 A;  2H70 A;  3K8N A;  1ERV A;  3UBK A;  4IS0 A;  1HYU A;  5DAK B;  4Q5R A;  3HJP A;  2WB9 A;  4EF0 A;  10GS A;  2JAD A;  4HDE A;  4WKW A;  4AJ8 A;  2OA7 A;  2YWN A;  4BPY A;  4ZB8 A;  2GT6 A;  3MDK A;  2GQK A;  2XBQ A;  4HQZ A;  2WZ9 A;  2PN8 A;  4CY6 A;  1C72 A;  2GZY A;  1JLV A;  3IDV A;  1PQN A;  2H72 A;  4KAE A;  3D0Z A;  1XW5 A;  2UZ8 A;  6GST A;  4V1A g;  1LJR A;  2HNL A;  1PRX A;  1EOG A;  2VL3 A;  5ECM B;  1UC7 A;  3C8E A;  1S3C A;  3D22 A;  3FK8 A;  5ECH B;  4PQI A;  4TXV A;  3EE2 A;  3FKF A;  1TOF A;  2EIR A;  2YWI A;  3AY8 A;  4MH3 A;  1GLP A;  2ON7 A;  3ZRD A;  3F63 A;  3WT2 A;  4KDY A;  5D9X A;  1TRU A;  4PNF A;  4CW9 A;  3GUS A;  3HKR A;  4NWY A;  4PTS A;  1LU4 A;  3HA9 A;  2VD1 A;  3MWH A;  1SEN A;  3MSZ A;  3GH9 A;  4GLT A;  3RPN A;  3M9J A;  2DBC A;  2YV7 A;  4E8E A;  2R2J A;  3ZYW A;  1F3A A;  3BD2 A;  3ED3 A;  2M80 A;  1Z7R A;  1U3I A;  1WMJ A;  1V40 A;  1YZX A;  3M1G A;  2AB6 A;  2H74 A;  3DVX A;  3VWW A;  3UAP A;  1F2E A;  2L4C A;  5JCW A;  1SYX A;  1R5A A;  2K18 A;  4WR5 A;  11GS A;  2IWT A;  4KUN A;  5CYY A;  1TK8 B;  1Z7P A;  1M3J A;  4DSR A;  3HDC A;  1SL2 B;  1WWJ A;  1X5D A;  4HZ4 A;  1G6Y A;  1EOH A;  3QCP A;  4YH2 A;  4KF9 A;  3PIN A;  4MPF A;  4WEY A;  3HXS A;  1XWA A;  3EC3 A;  4IW9 A;  1O85 A;  3LXT A;  4IEL A;  3A3T A;  4MJB A;  2VL9 A;  1K3L A;  4O5Q A;  3GMF A;  2H75 A;  1UVZ A;  2JZS A;  4EIQ A;  4ZB9 A;  3UJ1 A;  3ZL5 A;  3FZA A;  5CRW A;  3FHK A;  1SKR B;  1A24 A;  16GS A;  1F3B A;  1ZYN A;  2JZT A;  2CVB A;  4AJ6 A;  2FWG A;  2MMA A;  4O32 A;  1DSB A;  1A2M A;  3EU3 A;  3KM6 A;  2MMN A;  2YN1 A;  5AIS A;  3CSI A;  4PXO A;  4FYB A;  3C71 A;  2ZUP A;  2HSH A;  4AGS A;  3ZRE A;  2HT9 A;  2CVD A;  5G1K A;  1SK2 A;  2R3X A;  3IK7 A;  1VF1 A;  1HQO A;  4XRA A;  3IAS 2;  3CMI A;  2C3N A;  1IYH A;  1WP0 A;  2FD3 A;  4DVC A;  5ENU A;  2LQO A;  3TKS E;  2HZF A;  1A0R P;  4IJI A;  3F4T A;  1T00 A;  2MYG A;  4N30 A;  5H5S A;  5GAN D;  2HZE B;  3IE3 A;  3QFA C;  3HHV A;  3ZVJ D;  3HYP A;  2HRN A;  2VCX A;  2V1M A;  4G10 A;  4DSQ A;  2OAC A;  3CRT A;  3DGQ A;  4NHZ A;  3ZIT A;  1R4W A;  5D9W A;  5DCG A;  2IMF A;  4CHS A;  4KB3 A;  4EVM A;  3KP9 A;  2NPB A;  3ZLP A;  3KH9 A;  1M7T A;  5EY6 A;  2YZH A;  4PQH A;  4NXI A;  4FQU A;  2H1G A;  4WBJ A;  4EL1 A;  2LTK A;  4TOP A;  4YAP A;  1I5G A;  4MAB A;  4J57 E;  2LNT A;  4NV5 A;  1HNC A;  3DVW A;  1FVK A;  1AIU A;  3CTF A;  3MYD A;  3UVT A;  1WE0 A;  4MA9 A;  5A4W A;  4JZQ A;  4AF2 A;  5JCG A;  4ID0 A;  2OE1 A;  5JCU A;  2M46 A;  2GS3 A;  3VLN A;  4F0B A;  2X8G A;  4K2X A;  3ZFB A;  2JZR A;  4MJA A;  5INY A;  1KTE A;  3I6A A;  1DBY A;  4MF5 A;  2H01 A;  3ZFL A;  3C1R A;  1J9B A;  4GCI A;  2HRA A;  5AIV A;  2IFQ B;  4O5R A;  1FB6 A;  1MDJ A;  1XWC A;  5KN2 A;  3IK9 A;  5G2Z A;  1GSF A;  3CTG A;  4X4J A;  4I6X A;  2EIQ A;  4MF7 A;  5F0G A;  1RW1 A;  4PGT A;  4BA7 A;  2GZZ A;  2DJ2 A;  2G2Q A;  4F82 A;  1QMV A;  2A4H A;  2CVK A;  4GST A;  3NIV A;  4XTS A;  1GTB A;  1PN9 A;  4NV2 A;  4K7O A;  2XPE A;  2B1L A;  4TVE A;  1XVW A;  1T8E B;  2H0G A;  3H93 A;  3RHB A;  1M2B A;  3HD5 A;  1OAZ A;  3LJR A;  1SD8 A;  3FEU A;  3DXB A;  4FYC A;  3TJF A;  1EGR A;  5A4U A;  3QR6 A;  5G5F A;  3GNJ A;  4V1A p;  4BIK A;  2F9S A;  2VD0 A;  1JZD A;  3L78 A;  2CX3 A;  3IHG A;  4GQC A;  1E2Y A;  3HZ8 A;  1HNA A;  3Q19 A;  2BMX A;  3ZVJ A;  4IQA A;  3GV1 A;  5ECQ B;  2FWE A;  4GRF A;  4MDC A;  5DAL B;  3KIJ A;  1GLQ A;  5CRH A;  1GSD A;  4EDZ A;  4NHW A;  1DE1 A;  1MD4 A;  3TGZ A;  5HR2 A;  4MH2 A;  4G9H A;  1SL1 B;  5EPF A;  3WT1 A;  2V6K A;  3QPM A;  3D5J A;  1EP8 A;  2O85 A;  3IR4 A;  2RII A;  4MZB A;  4K6X A;  2VAF A;  2B3S A;  2WFC A;  3TDG A;  3VPQ A;  4HS1 A;  3VWX A;  1OC3 A;  3LOR A;  1S3R A;  3OR5 A;  1YKA A;  5IQY A;  3IHQ A;  1WOU A;  3A2V A;  4K0G A;  4WF5 A;  5JWR B;  3ZIV A;  5LCZ A;  2PVQ A;  2VIM A;  1TU7 A;  3N5O A;  1AW9 A;  2YWO A;  1PD2 1;  1PKZ A;  1XG8 A;  5J9B A;  4GF0 A;  1XVQ A;  5D9V A;  2R4V A;  2DIZ A;  3Q74 A;  5G31 A;  4L0U A;  1VF4 A;  2P0G A;  2LS5 A;  2FWF A;  3L4N A;  3KH7 A;  3N9J A;  2QKE A;  2P31 A;  2LV3 A;  6GSW A;  1FAA A;  1USB A;  2FA4 A;  1PGT A;  4YQU A;  4K8M A;  1GSU A;  4JR4 A;  1RQM A;  2R0P A;  3GKX A;  5ABR A;  2JSZ A;  1NM3 A;  5CRD A;  2ALB A;  2IIY A;  1THO A;  1VRS D;  2IMD A;  2KLX A;  3TKS A;  1FVJ A;  1QQ2 A;  3GUR A;  5CAX A;  1JLW A;  2DJ0 A;  2R0C A;  2C0F A;  3UIW A;  1O73 A;  2B7J A;  5CRE A;  5ELA A;  5J4U A;  1V9W A;  2KHP A;  4L5O A;  3WGX A;  4I2U A;  4RUV A;  3HJM A;  2H66 A;  3FR3 A;  3MNG A;  1YF1 A;  4RQR A;  2NVL A;  1OYJ A;  18GS A;  4KW6 A;  3APQ A;  2FNO A;  2YJ7 A;  4L0W A;  2O7K A;  4KX4 A;  4HOJ A;  4L8E A;  1G0T A;  2K6V A;  2H8L A;  5FHI A;  2PMT A;  3O3T A;  3Q18 A;  2R37 A;  3UEM A;  1J08 A;  2A2R A;  1ZMA A;  1BJX A;  4YQV A;  4IJ3 A;  5ECN B;  3DYR A;  1W4V A;  2I4A A;  1GTU A;  1Z9H A;  1WIK A;  5GST A;  1ERT A;  2K9F A;  1V2A A;  2LRT A;  2CZ3 A;  2Z9S A;  3KZQ A;  4MF6 A;  2CT6 A;  1OC9 B;  2H1B A;  5HR0 A;  5CP1 A;  3US3 A;  3M8N A;  4MNN A;  2C1Y A;  4Z2R A;  4ILF A;  2L6D A;  2HSM A;  4KCE A;  5ECO B;  4K7N A;  2R5G A;  5DBQ A;  4WR4 A;  4F9Z A;  1TRV A;  3VPT A;  3KD0 A;  3P8W A;  5J5N A;  3DIE A;  1V58 A;  1PL2 A;  2HI7 A;  1TKD B;  3NOF A;  1FB0 A;  1PN0 A;  2CZ2 A;  1ZYQ B;  2FY6 A;  2JL4 A;  2RUF A;  3IC8 A;  3ZMK A;  4BVY A;  3HVS A;  2J9H A;  1XW6 A;  2H0H A;  4BL7 A;  3GL5 A;  2WUL A;  3HZ4 A;  2ES7 A;  2H1D A;  7GSS A;  3D21 A;  4GQF A;  14GS A;  2DSA A;  1TJD A;  4IQ1 A;  1Q4J A;  2RM5 A;  3W6G A;  4O7H A;  3HJO A;  1A0F A;  5AIX A;  3MAK A;  1R26 A;  4F03 A;  1ZL9 A;  3QOU A;  2D2Z A;  3F6D A;  2H6Y A;  3EWL A;  1LBK A;  4MCU A;  4LL1 B;  1UN2 A;  4HJ2 A;  1X0R A;  1NSW A;  2E7P A;  4N0V A;  2PER A;  4EKZ A;  2MMZ A;  2L4Q A;  3J7Y b;  4IVF A;  3H8Q A;  4PUF C;  1K3Y A;  3GTU A;  5DQS A;  4ZL8 A;  2VO4 A;  2HLS A;  1B4Q A;  1Y6E A;  2B7K A;  3UL3 A;  1B9X C;  2IME A;  2NBS A;  4EIP A;  3KGK A;  4HU9 A;  1OC8 A;  1MTC A;  3VI7 A;  3G7J A;  4RI7 A;  3APS A;  3KCM A;  2B5Y A;  4XIH A;  2C8U A;  4K5S A;  3Q6O A;  3KXO A;  4BVX A;  5IPG A;  4G19 A;  1XIY A;  2LJA A;  4FO5 A;  5IM9 A;  3E9J B;  3GYK A;  3G7I A;  4GXZ A;  1X9S B;  2L59 A;  4TR3 A;  3F9U A;  1GRX A;  3GX0 A;  2VLU A;  2HYX A;  5D73 A;  2VCZ A;  1SKS B;  1YF0 A;  1XWK A;  4QL9 A;  1S3D A;  1Z6N A;  4ECI A;  3IXR A;  1M99 A;  1T4Y A;  3GKN A;  5IOW A;  3I43 A;  2MBT A;  4I5Q A;  1UA5 A;  3TRP A;  3F3Q A;  2PGT A;  2EC4 A;  2I1U A;  5DCH A;  3ZZX A;  1SL0 B;  3O76 A;  3EU4 A;  2VM2 A;  3TJJ A;  2IPA A;  3RAZ A;  5CRG A;  6GSU A;  5F05 A;  5H5Q A;  5ECR B;  3ERF A;  2LNS A;  4XCS A;  2HRF A;  2GQL A;  5IO0 A;  3GKM A;  2XHF A;  2MBS A;  1G7E A;  3E0U A;  1AXD A;  1SYR A;  5GSS A;  3TRX A;  2RUE A;  4ZL7 A;  2GT5 A;  3LXZ A;  2LJR A;  4TKY A;  3GA4 A;  2WS2 A;  3TRQ A;  4GSN A;  4QQ7 A;  1QXH A;  5DDL A;  2HXK A;  3QAW A;  1M9B A;  2DKI A;  3BCK A;  3FRC A;  1JZR A;  2LRC A;  1U3A A;  4HQS A;  1YQ1 A;  3NZN A;  3SWL A;  4ZL9 A;  3TKP A;  2B1K A;  2RM6 A;  1ILO A;  1S3A A;  5ID2 A;  3UAR A;  1JZW A;  2X4A A;  3VI5 A;  1SD9 A;  2OKA A;  4E8H A;  4CDO A;  1VF3 A;  2H30 A;  3TOT A;  3D4T A;  1BYE A;  4PUR A;  4MJE A;  5D93 A;  4BWQ A;  4XS1 A;  1YKC A;  2YCD A;  1M3I A;  3G7Y A;  3GH6 A;  1KEB A;  1AQW A;  2YOI A;  3QMX A;  4MZW A;  3LQ7 A;  3TJG A;  3BOA A;  2PPT A;  3FR9 A;  4XS6 A;  4K5R A;  2DC5 A;  2FHE A;  2LST A;  2CAQ A;  2H76 A;  1K0A A;  4ECB A;  1K0N A;  1Z6M A;  2QSI A;  2YPM A;  4IBP A;  2TRC P;  2V32 A;  1JFU A;  4NMU A;  3ME7 A;  5BRT A;  4X0X A;  4EE0 A;  2VCV A;  1YDK A;  3QFB C;  1DE2 A;  3VFI A;  1QK8 A;  12GS A;  3J7Y k;  3HVV A;  4ZIL A;  2VM1 A;  1ERW A;  3DRN A;  4O92 A;  3FR6 A;  4YKG A;  1ABA A;  3GHA A;  3P2A A;  3LG6 A;  2AYT A;  4LLR A;  1O7U A;  3EYT A;  4G0I A;  2DJJ A;  4MZC A;  1BED A;  4DSS B;  2X8H A;  3EPT A;  2VLV A;  2LJK A;  3P90 A;  4MK3 A;  2L57 A;  2FUG 2;  2JAC A;  1G7O A;  4ZB6 A;  5IMC A;  1GH2 A;  4HEA 2;  5L71 A;  1H75 A;  3D4M A;  4IP1 A;  4F0C A;  3C1S A;  2QA1 A;  3W8S A;  4QL7 A;  1BAY A;  1EV4 A;  2A2P A;  2PVO C;  2ZCT A;  2C80 A;  3F4S A;  4KE3 A;  1XOA A;  4OFN A;  4TRX A;  5D8I A;  4YAV A;  1SJI A;  3F3R A;  3PPU A;  1SJ6 A;  5ECI B;  2GST A;  4V2M A;  5GAP D;  2K8V A;  2V2G A;  4H86 A;  4POK A;  2IFQ A;  2H0I A;  2F51 A;  3I69 A;  3EUR A;  2MZC A;  2F8A A;  1GWC A;  2TRX A;  3UOM A;  2H73 A;  2VCT A;  4XS4 A;  1PX6 A;  4TR0 A;  3L9V A;  4ZBB A;  4IGJ A;  2JU5 A;  1FW1 A;  1OKD A;  2XBI A;  5KN1 A;  3F8U A;  3CRU A;  3HY2 A;  3UVH A;  1T1V A;  1MDK A;  4KDX A;  13GS A;  1FO5 A;  2C0E A;  2VL2 A;  3BJ5 A;  3EMX A;  1X9W B;  1JZO A;  1TRS A;  3ZML A;  5DJM A;  2FA8 A;  5IMD A;  1J0F A;  3RHC A;  2YP6 A;  1EV9 A;  4EC0 A;  4JE1 A;  5KN3 A;  2JSY A;  5HFK A;  4MMM A;  5HR1 A;  4RQX A;  4ZXG A;  5DQY A;  1CQH A;  3KEB A;  2C3Q A;  5JWO B;  1U6T A;  1SK1 A;  2DMM A;  6GSV A;  1TP9 A;  2DJK A;  2BTO T;  4ULX A;  2OAD A;  2HRK A;  2K8S A;  4L5L A;  4TN8 A;  3F4R A;  1GUL A;  1I9D A;  3FW2 A;  3GKK A;  2NDO A;  3TKS C;  2LEG A;  5KN0 A;  2OBK A;  5CO3 A;  5KOW A;  4TXO A;  3DML A;  5E4W A;  5EL8 A;  4LL4 B;  4KSM A;  2PU9 C;  2LKU A;  1Q98 A;  4ECC A;  4A5P A;  4KND A;  1A2L A;  2GGT A;  2A2S A;  2EIO A;  4WF4 A;  1WRY A;  1QFN A;  2GQM A;  4JU5 A;  1XPV A;  4USS A;  2GSQ A;  4CY8 A;  4PNG A;  1XWB A;  3S9F A;  1T3B A;  1F37 A;  4KGI A;  3VWV A;  2CAI A;  2O8V B;  2PUK C;  1AQV A;  1EGO A;  3IC4 A;  5ECL B;  4JR6 A;  5ECS A;  4ZIJ A;  3RDW A;  4N10 A;  5HFI A;  4TR1 A;  1TW9 A;  2CX4 A;  2OJL A;  4OWY A;  1B4P A;  3WGE A;  3BBY A;  20GS A;  4RI6 A;  3C7M A;  3ZIJ A;  3TUE A;  1TI3 A;  2KP2 A;  5ELG A;  3DEX A;  3IRA A;  8GSS A;  1K0B A;  1XOB A;  3DWV A;  2B5X A;  1M9A A;  4HZ2 A;  2PBJ A;  5B8B A;  3IPZ A;  5HR3 A;  1EEM A;  3EVI A;  4K0N A;  4OD7 A;  4IP6 A;  4K7I A;  1F9M A;  2WJU A;  2AUV A;  3LYP A;  2V41 A;  2H19 A;  1B48 A;  22GS A;  3GTU B;  17GS A;  3P7X A;  1FG4 A;  1FOH A;  3GX8 A;  1X5E A;  4IKH A;  3UBL A;  4D73 A;  1A8Y A;  2CA8 A;  6GSY A;  1GSS A;  3L0H A;  2YWM A;  4KH7 A;  4V2N A;  4ACS A;  1A23 A;  3A5W A;  3HVN A;  2KUC A;  4ML6 A;  2FGX A;  3L9S A;  2XC2 A;  1EEJ A;  5KOX A;  5LNK e;  1TXX A;  3LEF A;  4TR4 A;  4PQ1 A;  3ISO A;  1ML6 A;  3IV4 A;  5B7C A;  4BVX B;  2H1A A;  3IAM 2;  2DIY A;  2OE0 A;  1VGL A;  3HCZ A;  3FYG A;  2N5B A;  3FY7 A;  5A5K A;  1G6W A;  3W8J A;  2ZNM A;  2AV4 A;  3A5I A;  2J23 A;  5COH A;  2V6O A;  1TDI A;  1FHE A;  3D6I A;  2QC7 A;  3L9U A;  2XPD A;  1O8X A;  3R3E A;  1EWX A;  2DJ3 A;  5DAK A;  5JWQ B;  1R5P A;  3CXG A;  1Z5Y E;  3GST A;  4WET A;  3V1W A;  3GFK A;  2E0Q A;  2VCQ A;  5IO2 A;  3PH9 A;  1TRW A;  2R6K A;  2YJH A;  5J9C A;  3PGT A;  3LGC A;  3KTB A;  3KJY A;  1GNW A;  2OBI A;  2GSS A;  1OC9 A;  2VUP A;  1K3O A;  2E2M A;  3EMP A;  5FT3 A;  4HJM A;  2R0G A;  3G9B A;  2YNX A;  5IMA A;  1AUC A;  3QDN A;  2P5R A;  2IMI A;  2L5L A;  4IHU A;  1A2J A;  3M0F A;  4J56 E;  3TKQ A;  1OKT A;  4ISD A;  5EVO A;  2G0F A;  4KDU A;  1EZK A;  4POL A;  3C73 A;  5G1L A;  2MMO A;  1SKW B;  1VF2 A;  3LSZ A;  4I8B A;  2GVP A;  4EXJ A;  1BX9 A;  5CNW A;  1YEX A;  4MPG A;  1H4O A;  5ID2 B;  2AHE A;  4IN0 A;  3QD9 A;  2F8F A;  2AJQ B;  3M9K A;  4EUY A;  1N2A A;  1GUH A;  4OCF A;  4HUA A;  1R7H A;  3APO A;  5D96 A;  3KP8 A;  4KCA A;  4AJ7 A;  3FMW A;  1ZOF A;  3ERG A;  2QGV A;  2GDR A;  2X99 A;  2CV4 A;  1F6M C;  2YAN A;  5B6N A;  1OVN A;  2GTU A;  5IMV A;  2IN3 A;  1PKW A;  3MIX A;  5IPH A;  4FIW A;  1M0U A;  1PSQ A;  5ECP B;  4WBR D;  4LA1 A;  5J3R A;  4OCE A;  3LW9 A;  5AN1 A;  1TU8 A;  1WJK A;  2KP1 A;  1HNB A;  4YQM A;  2KOK A;  3TCO A;  1XBS A;  1XFL A;  2DJ1 A;  3H1N A;  5E59 A;  4JBB A;  1GUK A;  2YZU A;  4XHM A;  1YJ6 A;  2YV9 A;  5G30 A;  3PR8 A;  1QUW A;  5KEJ A;  4GTU A;  2REM A;  1WPI A;  4N0Z A;  4EO3 A;  1B8X A;  1NW2 A;  2HFD A;  2IL3 A;  2M72 A;  1GTI A;  4I97 A;  4YKF A;  1K0O A;  1FOV A;  1ON4 A;  2H6Z A;  2VOC A;  4Q5Q A;  3ZTL A;  1E6B A;  4G0L A;  4X1U A;  3QAG A;  1N8J A;  2ON5 A;  3LYK A;  1URM A;  2OE3 A;  4N11 A;  2DKH A;  3TKR A;  5C04 A;  3DKS A;  4LMW A;  1IYI A;  2H6X A;  2X64 A;  3RBT A;  4BWS A;  4OFM A;  2VLT A;  4POM A;  3UMA A;  2N5A A;  2I3Y A;  3GSS A;  5HQP A;  1ACV A;  4Z7X A;  2TIR A;  2WRT A;  5IMZ A;  3KMO A;  3KTL A;  3WD6 A;  4KSO A;  3FZ9 A;  1K0C A;  3ERW A;  3H79 A;  2NTO A;  1OE7 A;  2RLI A;  4Z2T A;  5J41 A;  3QAV A;  3E3E A;  2I81 A;  3JCM L;  3TB2 A;  4XRD A;  4O5U A;  1BG5 A;  4ZBD A;  1GTA A;  1PA3 A;  5F06 A;  4K1F A;  3VK9 A;  2HZE A;  3ME8 A;  1QGV A;  1GSQ A;  4XS4 B;  3FZ4 A;  3U6V A;  1KBN A;  3M3M A;  2X8C A;  1M2A A;  4GWR A;  4NPB A;  19GS A;  1O8W A;  1PFO A;  4F2I A;  1O6J A;  1XCC A;  2B6M A;  2IMK A;  2O87 A;  2O89 A;  2X49 A;  4P3Y B;  1TK5 B;  2WGR A;  2BJX A;  4OFT A;  1HD2 A;  4V2L A;  6GSS A;  3GRX A;  1TK0 B;  4JRR A;  1CQG A;  1T7P B;  1X5C A;  9GSS A;  4K9Z A;  3WGD A;  1GL8 A;  4OO5 A;  2C0D A;  5H5R A;  3U5R E;  4G0K A;  3KMN A;  3A2X A;  3WYW A;  3IBH A;  2HE3 A;  4JED A;  1ZYP A;  4WXT A;  2N5F A;  5DVB A; 
#chains in the Genus database with same CATH homology
 1W89 A;  1OE8 A;  3IOS A;  1U88 A;  3SBC A;  3RPP A;  1PX7 A;  4G2E A;  1XXU A;  3BCI A;  5F8B A;  4MJC A;  3EIN A;  1SJZ A;  1ERU A;  2FCH A;  1MDI A;  5G5E A;  2L6C A;  1KNG A;  1YY7 A;  4I2T A;  4Z2U A;  2C0G A;  1ZCP A;  4HU7 A;  5LD0 A;  4KA0 A;  4TXO B;  2AAW A;  4OO4 A;  1K0D A;  2LRN A;  1SK0 A;  4PUA A;  1ZZY A;  3TOU A;  4FYU A;  3HVX A;  3LWA A;  2VL2 C;  4PX1 A;  1NHO A;  1ST9 A;  1JHB A;  4POB A;  4Q5N A;  3A2W A;  5FWG A;  1Z3E A;  2A4V A;  4DSS A;  3IA1 A;  1X9M B;  5B8A A;  4Q5F A;  3O6T A;  5BMU A;  2HSY A;  1AAZ A;  2DML A;  1GSY A;  4TR1 B;  4MP4 A;  1GNE A;  3LFL A;  2CQ9 A;  5C00 A;  1XW9 A;  1NHY A;  1TI1 A;  1TTZ A;  3F0I A;  4FH8 A;  4NAX A;  4ML1 A;  1M2D A;  1SU9 A;  4ICY A;  2FWH A;  2GLR A;  6GSX A;  3CSJ A;  2E2G A;  2LUS A;  3GN3 A;  5ECK B;  1MD3 A;  5IIZ A;  5AGY A;  3R2Q A;  5DJL A;  4GSS A;  1XZO A;  3F6F A;  1DUG A;  2B5E A;  4K2D A;  4DEJ A;  1PMT A;  3GIX A;  5IMF A;  5A4V A;  3FZ5 A;  2PWJ A;  3CBU A;  4X43 A;  5HFG A;  3GL3 A;  4TW5 A;  4D73 B;  4ZBA A;  1U87 A;  5DAL A;  2L5O A;  2C3T A;  2FLS A;  3CSH A;  2DLX A;  1A8L A;  1Y25 A;  3TJB A;  1B9Y C;  1BQ7 A;  1GSE A;  2P5Q A;  3H4K A;  4EDY A;  1O81 A;  1ZYE A;  5F07 A;  4OMV A;  2QA2 A;  3I9V 2;  1V57 A;  1YEP A;  1GUM A;  1PL1 A;  4LMV A;  3VWU A;  5B6M A;  2LQQ A;  2WDU A;  2C4J A;  4BVY B;  5IOX A;  1RK4 A;  4BL7 B;  1MEK A;  3TJK A;  2GZP A;  4J2F A;  1T4Z A;  1V98 A;  3CYN A;  2GSR A;  1XWG A;  3VUR A;  5D9T A;  4HI7 A;  4ECJ A;  1AC1 A;  2F3M A;  2I9H A;  1AQX A;  4MLY A;  2WCI A;  1ZGN A;  1EP7 A;  2IJY A;  5GZZ B;  1GP1 A;  1THX A;  2VCW A;  1K0M A;  3DD3 A;  2H71 A;  2H70 A;  3K8N A;  1ERV A;  3UBK A;  4IS0 A;  1HYU A;  5DAK B;  4Q5R A;  3HJP A;  2WB9 A;  4EF0 A;  10GS A;  2JAD A;  4HDE A;  4WKW A;  4AJ8 A;  2OA7 A;  2YWN A;  4BPY A;  4ZB8 A;  2GT6 A;  3MDK A;  2GQK A;  2XBQ A;  4HQZ A;  2WZ9 A;  2PN8 A;  4CY6 A;  1C72 A;  2GZY A;  1JLV A;  3IDV A;  1PQN A;  2H72 A;  4KAE A;  3D0Z A;  1XW5 A;  2UZ8 A;  6GST A;  4V1A g;  1LJR A;  2HNL A;  1PRX A;  1EOG A;  2VL3 A;  5ECM B;  1UC7 A;  3C8E A;  1S3C A;  3D22 A;  3FK8 A;  5ECH B;  4PQI A;  4TXV A;  3EE2 A;  3FKF A;  1TOF A;  2EIR A;  2YWI A;  3AY8 A;  4MH3 A;  1GLP A;  2ON7 A;  3ZRD A;  3F63 A;  3WT2 A;  4KDY A;  5D9X A;  1TRU A;  4PNF A;  4CW9 A;  3GUS A;  3HKR A;  4NWY A;  4PTS A;  1LU4 A;  3HA9 A;  2VD1 A;  3MWH A;  1SEN A;  3MSZ A;  3GH9 A;  4GLT A;  3RPN A;  3M9J A;  2DBC A;  2YV7 A;  4E8E A;  2R2J A;  3ZYW A;  1F3A A;  3BD2 A;  3ED3 A;  2M80 A;  1Z7R A;  1U3I A;  1WMJ A;  1V40 A;  1YZX A;  3M1G A;  2AB6 A;  2H74 A;  3DVX A;  3VWW A;  3UAP A;  1F2E A;  2L4C A;  5JCW A;  1SYX A;  1R5A A;  2K18 A;  4WR5 A;  11GS A;  2IWT A;  4KUN A;  5CYY A;  1TK8 B;  1Z7P A;  4DSR A;  3HDC A;  1SL2 B;  1WWJ A;  1X5D A;  4HZ4 A;  1G6Y A;  1EOH A;  3QCP A;  4YH2 A;  4KF9 A;  3PIN A;  4MPF A;  4WEY A;  3HXS A;  1XWA A;  3EC3 A;  4IW9 A;  1O85 A;  3LXT A;  4IEL A;  3A3T A;  4MJB A;  2VL9 A;  1K3L A;  4O5Q A;  3GMF A;  2H75 A;  1UVZ A;  2JZS A;  4EIQ A;  4ZB9 A;  3UJ1 A;  3ZL5 A;  3FZA A;  5CRW A;  3FHK A;  1SKR B;  1A24 A;  16GS A;  1F3B A;  1ZYN A;  2JZT A;  2CVB A;  4AJ6 A;  2FWG A;  2MMA A;  4O32 A;  1DSB A;  1A2M A;  3EU3 A;  3KM6 A;  2MMN A;  2YN1 A;  5AIS A;  3CSI A;  4PXO A;  4FYB A;  3C71 A;  2ZUP A;  2HSH A;  4AGS A;  3ZRE A;  2HT9 A;  2CVD A;  5G1K A;  1SK2 A;  2R3X A;  3IK7 A;  1VF1 A;  1HQO A;  4XRA A;  3IAS 2;  3CMI A;  2C3N A;  1IYH A;  1WP0 A;  2FD3 A;  4DVC A;  5ENU A;  2LQO A;  3TKS E;  2HZF A;  1A0R P;  4IJI A;  3F4T A;  1T00 A;  2MYG A;  4N30 A;  5H5S A;  5GAN D;  2HZE B;  3IE3 A;  3QFA C;  3HHV A;  3ZVJ D;  3HYP A;  2HRN A;  2VCX A;  2V1M A;  4G10 A;  4DSQ A;  2OAC A;  3CRT A;  3DGQ A;  4NHZ A;  3ZIT A;  1R4W A;  5D9W A;  5DCG A;  2IMF A;  4CHS A;  4KB3 A;  4EVM A;  3KP9 A;  2NPB A;  3ZLP A;  3KH9 A;  1M7T A;  5EY6 A;  2YZH A;  4PQH A;  4NXI A;  4FQU A;  2H1G A;  4WBJ A;  4EL1 A;  2LTK A;  4TOP A;  4YAP A;  1I5G A;  4MAB A;  4J57 E;  2LNT A;  4NV5 A;  1HNC A;  3DVW A;  1FVK A;  1AIU A;  3CTF A;  3MYD A;  3UVT A;  1WE0 A;  4MA9 A;  5A4W A;  4JZQ A;  4AF2 A;  5JCG A;  4ID0 A;  2OE1 A;  5JCU A;  2M46 A;  2GS3 A;  3VLN A;  4F0B A;  2X8G A;  4K2X A;  3ZFB A;  2JZR A;  4MJA A;  5INY A;  1KTE A;  3I6A A;  1DBY A;  4MF5 A;  2H01 A;  3ZFL A;  3C1R A;  1J9B A;  4GCI A;  5AIV A;  2HRA A;  2IFQ B;  4O5R A;  1FB6 A;  1MDJ A;  1XWC A;  5KN2 A;  3IK9 A;  5G2Z A;  1GSF A;  3CTG A;  4X4J A;  4I6X A;  2EIQ A;  4MF7 A;  5F0G A;  1RW1 A;  4PGT A;  4BA7 A;  2GZZ A;  2DJ2 A;  2G2Q A;  4F82 A;  1QMV A;  2A4H A;  2CVK A;  4GST A;  3NIV A;  4XTS A;  1GTB A;  1PN9 A;  4NV2 A;  4K7O A;  2XPE A;  2B1L A;  4TVE A;  1XVW A;  1T8E B;  2H0G A;  3H93 A;  3RHB A;  1M2B A;  3HD5 A;  1OAZ A;  3LJR A;  1SD8 A;  3FEU A;  3DXB A;  4FYC A;  3TJF A;  1EGR A;  5A4U A;  3QR6 A;  5G5F A;  3GNJ A;  4V1A p;  2F9S A;  2VD0 A;  1JZD A;  3L78 A;  2CX3 A;  3IHG A;  4GQC A;  1E2Y A;  3HZ8 A;  1HNA A;  3Q19 A;  2BMX A;  3ZVJ A;  4IQA A;  3GV1 A;  5ECQ B;  2FWE A;  4GRF A;  4MDC A;  5DAL B;  3KIJ A;  1GLQ A;  5CRH A;  1GSD A;  4EDZ A;  4NHW A;  1DE1 A;  1MD4 A;  3TGZ A;  5HR2 A;  4MH2 A;  4G9H A;  1SL1 B;  5EPF A;  3WT1 A;  2V6K A;  3QPM A;  3D5J A;  1EP8 A;  2O85 A;  3IR4 A;  2RII A;  4MZB A;  4K6X A;  2VAF A;  2B3S A;  2WFC A;  3TDG A;  3VPQ A;  4HS1 A;  3VWX A;  1OC3 A;  3LOR A;  3OR5 A;  1YKA A;  5IQY A;  3IHQ A;  1WOU A;  3A2V A;  4K0G A;  4WF5 A;  5JWR B;  3ZIV A;  5LCZ A;  2PVQ A;  2VIM A;  1TU7 A;  3N5O A;  1AW9 A;  2YWO A;  1PD2 1;  1PKZ A;  5J9B A;  4GF0 A;  1XVQ A;  5D9V A;  2R4V A;  2DIZ A;  3Q74 A;  5G31 A;  4L0U A;  1VF4 A;  2P0G A;  2LS5 A;  2FWF A;  3L4N A;  3KH7 A;  3N9J A;  2QKE A;  2P31 A;  2LV3 A;  6GSW A;  1FAA A;  1USB A;  2FA4 A;  1PGT A;  4YQU A;  4K8M A;  1GSU A;  4JR4 A;  1RQM A;  2R0P A;  3GKX A;  5ABR A;  2JSZ A;  1NM3 A;  5CRD A;  2ALB A;  2IIY A;  1THO A;  1VRS D;  2IMD A;  2KLX A;  3TKS A;  1FVJ A;  1QQ2 A;  3GUR A;  5CAX A;  1JLW A;  2DJ0 A;  2R0C A;  2C0F A;  3UIW A;  1O73 A;  2B7J A;  5CRE A;  5ELA A;  5J4U A;  1V9W A;  2KHP A;  4L5O A;  3WGX A;  4I2U A;  4RUV A;  3HJM A;  2H66 A;  3FR3 A;  3MNG A;  1YF1 A;  4RQR A;  2NVL A;  1OYJ A;  18GS A;  4KW6 A;  3APQ A;  2FNO A;  2YJ7 A;  4L0W A;  2O7K A;  4KX4 A;  4HOJ A;  4L8E A;  1G0T A;  2K6V A;  2H8L A;  5FHI A;  2PMT A;  3O3T A;  3Q18 A;  2R37 A;  3UEM A;  1J08 A;  2A2R A;  1ZMA A;  1BJX A;  4YQV A;  4IJ3 A;  5ECN B;  3DYR A;  1W4V A;  2I4A A;  1GTU A;  1Z9H A;  1WIK A;  5GST A;  1ERT A;  2K9F A;  1V2A A;  2LRT A;  2CZ3 A;  2Z9S A;  3KZQ A;  4MF6 A;  2CT6 A;  1OC9 B;  2H1B A;  5HR0 A;  5CP1 A;  3US3 A;  3M8N A;  4MNN A;  2C1Y A;  4Z2R A;  4ILF A;  2L6D A;  2HSM A;  4KCE A;  5ECO B;  4K7N A;  2R5G A;  5DBQ A;  4WR4 A;  4F9Z A;  1TRV A;  3VPT A;  3KD0 A;  3P8W A;  5J5N A;  3DIE A;  1V58 A;  1PL2 A;  2HI7 A;  1TKD B;  3NOF A;  1FB0 A;  1PN0 A;  2CZ2 A;  1ZYQ B;  2FY6 A;  2JL4 A;  2RUF A;  3IC8 A;  3ZMK A;  4BVY A;  3HVS A;  2J9H A;  1XW6 A;  2H0H A;  4BL7 A;  3GL5 A;  2WUL A;  3HZ4 A;  2ES7 A;  2H1D A;  7GSS A;  3D21 A;  4GQF A;  14GS A;  2DSA A;  1TJD A;  4IQ1 A;  1Q4J A;  2RM5 A;  3W6G A;  4O7H A;  3HJO A;  1A0F A;  5AIX A;  3MAK A;  1R26 A;  4F03 A;  1ZL9 A;  3QOU A;  2D2Z A;  3F6D A;  2H6Y A;  3EWL A;  1LBK A;  4MCU A;  4LL1 B;  1UN2 A;  4HJ2 A;  1X0R A;  1NSW A;  2E7P A;  4N0V A;  2PER A;  4EKZ A;  2MMZ A;  2L4Q A;  3J7Y b;  4IVF A;  3H8Q A;  4PUF C;  1K3Y A;  3GTU A;  5DQS A;  4ZL8 A;  2VO4 A;  2HLS A;  1B4Q A;  1Y6E A;  2B7K A;  3UL3 A;  1B9X C;  2IME A;  2NBS A;  4EIP A;  3KGK A;  4HU9 A;  1OC8 A;  1MTC A;  3VI7 A;  3G7J A;  4RI7 A;  3APS A;  3KCM A;  2B5Y A;  4XIH A;  2C8U A;  4K5S A;  3Q6O A;  3KXO A;  4BVX A;  5IPG A;  4G19 A;  1XIY A;  2LJA A;  4FO5 A;  5IM9 A;  3E9J B;  3GYK A;  3G7I A;  4GXZ A;  1X9S B;  2L59 A;  4TR3 A;  3F9U A;  1GRX A;  3GX0 A;  2VLU A;  2HYX A;  5D73 A;  2VCZ A;  1SKS B;  1YF0 A;  1XWK A;  4QL9 A;  1S3D A;  1Z6N A;  4ECI A;  3IXR A;  1M99 A;  1T4Y A;  3GKN A;  5IOW A;  3I43 A;  2MBT A;  4I5Q A;  1UA5 A;  3TRP A;  3F3Q A;  2PGT A;  2EC4 A;  2I1U A;  5DCH A;  3ZZX A;  1SL0 B;  3O76 A;  3EU4 A;  2VM2 A;  3TJJ A;  2IPA A;  3RAZ A;  5CRG A;  6GSU A;  5F05 A;  5H5Q A;  5ECR B;  3ERF A;  2LNS A;  4XCS A;  2HRF A;  2GQL A;  5IO0 A;  3GKM A;  2XHF A;  2MBS A;  1G7E A;  3E0U A;  1AXD A;  1SYR A;  5GSS A;  3TRX A;  2RUE A;  4ZL7 A;  2GT5 A;  3LXZ A;  2LJR A;  4TKY A;  3GA4 A;  2WS2 A;  3TRQ A;  4GSN A;  4QQ7 A;  1QXH A;  5DDL A;  2HXK A;  3QAW A;  1M9B A;  2DKI A;  3BCK A;  3FRC A;  1JZR A;  2LRC A;  1U3A A;  4HQS A;  1YQ1 A;  3NZN A;  3SWL A;  4ZL9 A;  3TKP A;  2B1K A;  2RM6 A;  1ILO A;  1S3A A;  5ID2 A;  3UAR A;  1JZW A;  2X4A A;  3VI5 A;  1SD9 A;  2OKA A;  4E8H A;  4CDO A;  1VF3 A;  2H30 A;  3TOT A;  3D4T A;  1BYE A;  4PUR A;  4MJE A;  5D93 A;  4BWQ A;  4XS1 A;  1YKC A;  2YCD A;  3G7Y A;  3GH6 A;  1KEB A;  1AQW A;  2YOI A;  3QMX A;  4MZW A;  3LQ7 A;  3TJG A;  3BOA A;  2PPT A;  3FR9 A;  4XS6 A;  4K5R A;  2DC5 A;  2FHE A;  2LST A;  2CAQ A;  2H76 A;  1K0A A;  4ECB A;  1K0N A;  1Z6M A;  2QSI A;  2YPM A;  4IBP A;  2TRC P;  2V32 A;  1JFU A;  4NMU A;  3ME7 A;  5BRT A;  4X0X A;  4EE0 A;  2VCV A;  1YDK A;  3QFB C;  1DE2 A;  3VFI A;  1QK8 A;  12GS A;  3J7Y k;  3HVV A;  4ZIL A;  2VM1 A;  1ERW A;  3DRN A;  4O92 A;  3FR6 A;  4YKG A;  1ABA A;  3GHA A;  3P2A A;  3LG6 A;  2AYT A;  4LLR A;  1O7U A;  3EYT A;  4G0I A;  2DJJ A;  4MZC A;  1BED A;  4DSS B;  2X8H A;  3EPT A;  2VLV A;  2LJK A;  3P90 A;  4MK3 A;  2L57 A;  2FUG 2;  2JAC A;  1G7O A;  4ZB6 A;  5IMC A;  1GH2 A;  4HEA 2;  5L71 A;  1H75 A;  3D4M A;  4IP1 A;  4F0C A;  3C1S A;  2QA1 A;  3W8S A;  4QL7 A;  1BAY A;  1EV4 A;  2A2P A;  2PVO C;  2ZCT A;  2C80 A;  3F4S A;  4KE3 A;  1XOA A;  4OFN A;  4TRX A;  5D8I A;  4YAV A;  1SJI A;  3F3R A;  3PPU A;  1SJ6 A;  5ECI B;  2GST A;  4V2M A;  5GAP D;  2K8V A;  2V2G A;  4H86 A;  4POK A;  2IFQ A;  2H0I A;  2F51 A;  3I69 A;  3EUR A;  2MZC A;  2F8A A;  1GWC A;  2TRX A;  3UOM A;  2H73 A;  2VCT A;  4XS4 A;  1PX6 A;  4TR0 A;  3L9V A;  4ZBB A;  4IGJ A;  2JU5 A;  1FW1 A;  1OKD A;  2XBI A;  5KN1 A;  3F8U A;  3CRU A;  3HY2 A;  3UVH A;  1T1V A;  1MDK A;  4KDX A;  13GS A;  1FO5 A;  2C0E A;  2VL2 A;  3BJ5 A;  3EMX A;  1X9W B;  1JZO A;  1TRS A;  3ZML A;  5DJM A;  2FA8 A;  5IMD A;  1J0F A;  3RHC A;  2YP6 A;  1EV9 A;  4EC0 A;  4JE1 A;  5KN3 A;  2JSY A;  5HFK A;  4MMM A;  5HR1 A;  4RQX A;  4ZXG A;  5DQY A;  1CQH A;  3KEB A;  2C3Q A;  5JWO B;  1U6T A;  1SK1 A;  2DMM A;  6GSV A;  1TP9 A;  2DJK A;  2BTO T;  4ULX A;  2OAD A;  2HRK A;  2K8S A;  4L5L A;  4TN8 A;  3F4R A;  1GUL A;  1I9D A;  3FW2 A;  3GKK A;  2NDO A;  3TKS C;  2LEG A;  5KN0 A;  2OBK A;  5CO3 A;  5KOW A;  4TXO A;  3DML A;  5E4W A;  5EL8 A;  4LL4 B;  4KSM A;  2PU9 C;  2LKU A;  1Q98 A;  4ECC A;  4A5P A;  4KND A;  1A2L A;  2GGT A;  2A2S A;  2EIO A;  4WF4 A;  1WRY A;  1QFN A;  2GQM A;  4JU5 A;  1XPV A;  4USS A;  2GSQ A;  4CY8 A;  4PNG A;  1XWB A;  3S9F A;  1T3B A;  1F37 A;  4KGI A;  3VWV A;  2CAI A;  2O8V B;  2PUK C;  1AQV A;  1EGO A;  3IC4 A;  5ECL B;  4JR6 A;  5ECS A;  4ZIJ A;  3RDW A;  4N10 A;  5HFI A;  4TR1 A;  1TW9 A;  2CX4 A;  2OJL A;  4OWY A;  1B4P A;  3WGE A;  3BBY A;  20GS A;  4RI6 A;  3C7M A;  3ZIJ A;  3TUE A;  1TI3 A;  2KP2 A;  5ELG A;  3DEX A;  3IRA A;  8GSS A;  1K0B A;  1XOB A;  3DWV A;  2B5X A;  1M9A A;  4HZ2 A;  2PBJ A;  5B8B A;  3IPZ A;  5HR3 A;  1EEM A;  3EVI A;  4K0N A;  4OD7 A;  4IP6 A;  4K7I A;  1F9M A;  2WJU A;  2AUV A;  3LYP A;  2V41 A;  2H19 A;  1B48 A;  22GS A;  3GTU B;  17GS A;  3P7X A;  1FG4 A;  1FOH A;  3GX8 A;  1X5E A;  4IKH A;  3UBL A;  4D73 A;  1A8Y A;  2CA8 A;  6GSY A;  1GSS A;  3L0H A;  2YWM A;  4KH7 A;  4V2N A;  4ACS A;  1A23 A;  3A5W A;  4ML6 A;  2KUC A;  2FGX A;  3L9S A;  2XC2 A;  1EEJ A;  5KOX A;  5LNK e;  1TXX A;  3LEF A;  4TR4 A;  4PQ1 A;  3ISO A;  1ML6 A;  3IV4 A;  5B7C A;  4BVX B;  2H1A A;  3IAM 2;  2DIY A;  2OE0 A;  1VGL A;  3HCZ A;  3FYG A;  2N5B A;  3FY7 A;  5A5K A;  1G6W A;  3W8J A;  2ZNM A;  2AV4 A;  3A5I A;  2J23 A;  5COH A;  2V6O A;  1TDI A;  1FHE A;  3D6I A;  2QC7 A;  3L9U A;  2XPD A;  1O8X A;  3R3E A;  1EWX A;  2DJ3 A;  5DAK A;  5JWQ B;  1R5P A;  3CXG A;  1Z5Y E;  3GST A;  4WET A;  3V1W A;  3GFK A;  2E0Q A;  2VCQ A;  5IO2 A;  3PH9 A;  1TRW A;  2R6K A;  2YJH A;  5J9C A;  3PGT A;  3LGC A;  3KTB A;  3KJY A;  1GNW A;  2OBI A;  2GSS A;  1OC9 A;  2VUP A;  1K3O A;  2E2M A;  3EMP A;  5FT3 A;  4HJM A;  2R0G A;  3G9B A;  2YNX A;  5IMA A;  1AUC A;  3QDN A;  2P5R A;  2IMI A;  2L5L A;  4IHU A;  1A2J A;  3M0F A;  4J56 E;  3TKQ A;  1OKT A;  4ISD A;  5EVO A;  2G0F A;  4KDU A;  1EZK A;  4POL A;  3C73 A;  5G1L A;  2MMO A;  1SKW B;  1VF2 A;  3LSZ A;  4I8B A;  2GVP A;  4EXJ A;  1BX9 A;  5CNW A;  1YEX A;  4MPG A;  1H4O A;  5ID2 B;  2AHE A;  4IN0 A;  3QD9 A;  2F8F A;  2AJQ B;  3M9K A;  4EUY A;  1N2A A;  1GUH A;  4OCF A;  4HUA A;  1R7H A;  3APO A;  5D96 A;  3KP8 A;  4KCA A;  4AJ7 A;  3FMW A;  1ZOF A;  3ERG A;  2QGV A;  2GDR A;  2X99 A;  2CV4 A;  1F6M C;  2YAN A;  5B6N A;  1OVN A;  2GTU A;  5IMV A;  2IN3 A;  1PKW A;  3MIX A;  5IPH A;  4FIW A;  1M0U A;  1PSQ A;  5ECP B;  4WBR D;  4LA1 A;  5J3R A;  4OCE A;  3LW9 A;  5AN1 A;  1TU8 A;  1WJK A;  2KP1 A;  1HNB A;  4YQM A;  2KOK A;  3TCO A;  1XBS A;  1XFL A;  2DJ1 A;  3H1N A;  5E59 A;  4JBB A;  1GUK A;  2YZU A;  4XHM A;  1YJ6 A;  2YV9 A;  5G30 A;  3PR8 A;  1QUW A;  5KEJ A;  4GTU A;  2REM A;  1WPI A;  4N0Z A;  4EO3 A;  1B8X A;  1NW2 A;  2HFD A;  2IL3 A;  2M72 A;  1GTI A;  4I97 A;  4YKF A;  1K0O A;  1FOV A;  1ON4 A;  2H6Z A;  2VOC A;  4Q5Q A;  3ZTL A;  1E6B A;  4G0L A;  4X1U A;  3QAG A;  1N8J A;  2ON5 A;  3LYK A;  1URM A;  2OE3 A;  4N11 A;  2DKH A;  3TKR A;  5C04 A;  3DKS A;  4LMW A;  1IYI A;  2H6X A;  2X64 A;  3RBT A;  4BWS A;  4OFM A;  2VLT A;  4POM A;  3UMA A;  2N5A A;  2I3Y A;  3GSS A;  5HQP A;  1ACV A;  4Z7X A;  2TIR A;  2WRT A;  5IMZ A;  3KMO A;  3KTL A;  3WD6 A;  4KSO A;  3FZ9 A;  1K0C A;  3ERW A;  3H79 A;  2NTO A;  1OE7 A;  2RLI A;  4Z2T A;  5J41 A;  3QAV A;  3E3E A;  2I81 A;  3JCM L;  3TB2 A;  4XRD A;  4O5U A;  1BG5 A;  4ZBD A;  1GTA A;  1PA3 A;  5F06 A;  4K1F A;  3VK9 A;  2HZE A;  3ME8 A;  1QGV A;  1GSQ A;  4XS4 B;  3FZ4 A;  3U6V A;  1KBN A;  3M3M A;  2X8C A;  1M2A A;  4GWR A;  4NPB A;  19GS A;  1O8W A;  4F2I A;  1O6J A;  1XCC A;  2B6M A;  2IMK A;  2O87 A;  2O89 A;  2X49 A;  4P3Y B;  1TK5 B;  2WGR A;  2BJX A;  4OFT A;  1HD2 A;  4V2L A;  6GSS A;  3GRX A;  1TK0 B;  4JRR A;  1CQG A;  1T7P B;  1X5C A;  9GSS A;  4K9Z A;  3WGD A;  1GL8 A;  4OO5 A;  2C0D A;  5H5R A;  3U5R E;  4G0K A;  3KMN A;  3A2X A;  3WYW A;  3IBH A;  2HE3 A;  4JED A;  1ZYP A;  4WXT A;  2N5F A;  5DVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...