1OC9B

Tryparedoxin ii from c.fasciculata solved by mr
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
147
structure length
147
Chain Sequence
HMSGLKKFFPYSTNVLKGAAADIALPSLAGKTVFFYFSASWCPPCRAFTPQLIDFYKAHAEKKNFEVMLISWDESAEDFKDYYAKMPWLALPFEDRKGMEFLTTGFDVKSIPTLVGVEADSGNIITTQARTMVVKDPEAKDFPWPNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPAREDOXIN II
publication title Tryparedoxins from Crithidia Fasciculata and Trypanosoma Brucei: Photoreduction of the Redox Disulfide Using Synchrotron Radiation and Evidence for a Conformational Switch Implicated in Function
pubmed doi rcsb
source organism Crithidia fasciculata
molecule tags Electron transport
total genus 41
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1oc9B00
4OO4A 1HNCA 1GTAA 1YZXA 4JZQA 3G9BA 1AXDA 2VCXA 2FCHA 4X1UA 3NOFA 5KEJA 3EINA 2DJKA 4HU7A 4GTUA 1BAYA 1SJZA 1PL2A 2RIIA 4HOJA 4F82A 4BA7A 2VAFA 2GSQA 5AN1A 2N5AA 4MP4A 1PSQA 4ILFA 5CRGA 3L9SA 1X9MB 4F9ZA 2J23A 4K8MA 2CZ2A 2H6ZA 4WBRD 1GSQA 1Q4JA 1ERTA 1GNEA 2QKEA 5IOWA 2M46A 2WCIA 5LCZA 2CVBA 3P90A 3WT1A 5D9WA 3VWXA 2YCDA 1YY7A 2O87A 4EC0A 4KDYA 1EGRA 5B7CA 3RAZA 1OC8A 2XC2A 1ZYQB 3GH9A 3A5WA 3SBCA 3EU4A 3DGQA 1JLWA 2AYTA 1EP7A 4L0WA 1NHYA 2OA7A 3BCKA 1HNAA 1QK8A 2LQQA 4TR4A 4EDYA 4K9ZA 4G19A 2YN1A 3HHVA 4GWRA 1X9SB 2YWMA 8GSSA 4RI7A 5CYYA 2DIZA 4HI7A 3TB2A 2JZRA 2O85A 2P5QA 3HDCA 3CTFA 1HQOA 4POBA 5D9XA 12GSA 1URMA 2OADA 3W8SA 3PH9A 4I2TA 1V40A 5HFGA 4IELA 1MEKA 2IPAA 1HNBA 3U6VA 6GSXA 2B7JA 2IMEA 1A8YA 3QOUA 5FWGA 1OKDA 4GSSA 2V6KA 3GX8A 5E59A 1GSEA 3ZL5A 2X99A 4G10A 1T3BA 1M2AA 3ZITA 1RQMA 1T00A 4ZILA 1BEDA 2B5YA 3HJOA 3GRXA 3GUSA 4NV2A 3WGDA 2L57A 1R26A 3CRUA 1E6BA 2CAQA 1EEJA 3IE3A 2LJAA 4HZ2A 4XS6A 3QFBC 2B6MA 1VF1A 2V41A 3C73A 5F0GA 1B48A 2GGTA 3LORA 5COHA 1SD8A 3I43A 1F3BA 4D73B 1EWXA 1H75A 1PN9A 3F3RA 3MDKA 3MSZA 3W6GA 4YAPA 3LSZA 1M9AA 1TRWA 7GSSA 4Q5NA 1FVJA 2QGVA 5F05A 2P5RA 4XHMA 1O7UA 3V1WA 4X43A 2H73A 3L4NA 5HR0A 5ECMB 2R5GA 2WRTA 3CXGA 3LJRA 5ECOB 3QAGA 1SL1B 4I2UA 4XTSA 2E0QA 1JLVA 3CSHA 4CW9A 3ZTLA 3I6AA 2IJYA 3EC3A 4LA1A 3HVXA 4ECCA 3DXBA 3RDWA 1TRUA 1PA3A 2HRNA 4E8EA 2VL2A 1AW9A 3D6IA 1O8XA 2B1KA 2LJRA 3CYNA 4WF5A 4RUVA 2J9HA 1BYEA 1GTIA 2E2MA 3UEMA 1YF1A 2JSZA 4MDCA 1VF3A 2OKAA 3FRCA 4GF0A 3DVWA 1HYUA 4JU5A 2G0FA 3KH9A 3QR6A 3H4KA 5LNKe 2YWOA 1ST9A 1K0CA 1SK1A 4MZWA 1ZCPA 4O7HA 3I69A 1A0FA 1F3AA 5JCUA 2MMOA 5KN1A 3ZFBA 2L5OA 2P31A 3EMXA 2YPMA 4XRAA 1B9XC 3LWAA 1TDIA 4J57E 2E7PA 1PRXA 5INYA 5F07A 3HZ8A 2FD3A 4N11A 4JBBA 3FHKA 4PQIA 1G0TA 2Z9SA 1OC9B 2FA4A 2DBCA 3GSTA 1TJDA 4ECJA 1EZKA 3NIVA 4ECIA 3UBKA 2MZCA 1V58A 4ECBA 3QCPA 4L0UA 1SL0B 1R5AA 2GT6A 2PBJA 5JCWA 4PNGA 2WB9A 1MD3A 3HA9A 2FWHA 2CQ9A 2H6XA 1YKCA 3UAPA 1LBKA 1XFLA 3CSJA 3GFKA 6GSWA 2A2SA 3ERGA 4L5OA 3IBHA 4I6XA 3GIXA 1GSYA 4IKHA 3UARA 4JE1A 2F8AA 5HQPA 1J9BA 2BTOT 1PQNA 4XS4A 5CAXA 3HYPA 1GSFA 2PN8A 2IFQA 3ZREA 1J0FA 4DVCA 1EP8A 2ZNMA 3IAM2 4MF6A 1MD4A 3QFAC 2CA8A 1TTZA 1S3AA 3M3MA 2WULA 4PQHA 3RHBA 5IPGA 1GH2A 5HR1A 3UOMA 3VPQA 5JWRB 2KP2A 3GTUA 4AGSA 1XWCA 4D73A 2N5FA 1NM3A 4IP1A 5D8IA 2H0IA 1GSSA 3A2WA 1NHOA 1S3CA 5CRHA 3MWHA 3M0FA 3ZZXA 3IPZA 1ILOA 3ZIVA 2VCVA 3HD5A 1ON4A 1TK0B 11GSA 3F63A 2WDUA 5ELGA 2V2GA 3IXRA 2A4VA 2VM2A 3C8EA 2O89A 3TJJA 5IOXA 2A2RA 2VCWA 4WR4A 4NAXA 4N30A 4KH7A 1G7OA 2B1LA 2H72A 5DCHA 4EVMA 3HJPA 4KGIA 1AC1A 3O76A 4WBJA 4MF5A 3KZQA 2PGTA 1FAAA 1TRSA 2RM5A 3DEXA 3F3QA 3WT2A 16GSA 1F2EA 1WIKA 3H8QA 2I3YA 2B5EA 4F2IA 3ME8A 3CTGA 3P7XA 4KSOA 4K6XA 2H1BA 4KDXA 4CDOA 2B5XA 5HR3A 5LD0A 1PL1A 1JZWA 3LYKA 3F4TA 4FIWA 4WF4A 2DC5A 2VUPA 3TKQA 1K0MA 4KCAA 4ZBBA 1T1VA 1PX6A 2ON7A 1J08A 2H01A 1ZZYA 2LV3A 1SK2A 3F0IA 2C0FA 5IMZA 3F8UA 2R6KA 5F8BA 4HJ2A 1T4YA 1M9BA 5ID2B 2N5BA 3LG6A 5D73A 4YQUA 3J7Yk 3GV1A 3DYRA 3QD9A 3KH7A 1GSUA 4N0ZA 3L9UA 1XVQA 2FY6A 2C0GA 3DRNA 4IQ1A 1S3DA 3VI5A 4X0XA 3D4MA 5J9CA 4I8BA 1AQWA 4PUAA 4AF2A 2IL3A 4EL1A 3FZAA 2GDRA 4DSSA 2EC4A 1GUMA 3L78A 3TKRA 4OWYA 1UC7A 4ZBAA 3QAWA 3GA4A 2H0GA 1U6TA 1OAZA 4RQRA 2RLIA 1FO5A 1XOBA 3VK9A 1YJ6A 2FWFA 2CZ3A 3HY2A 1X5CA 1Z6NA 4TXVA 2XPDA 4KB3A 5J3RA 4GLTA 1QUWA 5B8BA 3DD3A 2PVOC 4TRXA 3G7YA 4JEDA 1PD21 1GNWA 3C7MA 4ML1A 3EU3A 3ISOA 3IHQA 4V2MA 2OBIA 1XBSA 5DAKA 3KXOA 3BJ5A 1ERUA 5H5SA 2HRFA 3ZMLA 4BPYA 2C80A 4K7OA 3TRXA 1OE8A 1AAZA 4IS0A 1A2LA 4RQXA 2C3NA 3GHAA 3A3TA 4IW9A 1JZDA 1KBNA 4FH8A 1TXXA 1DUGA 4TR1A 3RPPA 5IQYA 3F6FA 1K3OA 1U87A 2R4VA 1I9DA 1TW9A 4IVFA 3ERWA 5G1KA 2E2GA 2H19A 4GCIA 2RM6A 2MMAA 3TRQA 3MNGA 2YWNA 2JL4A 1O6JA 19GSA 1QMVA 5G5EA 5HR2A 4HZ4A 2PU9C 2JSYA 2AV4A 2F51A 3BCIA 4OMVA 1X9WB 2ON5A 3TUEA 2YJ7A 2C1YA 2GT5A 3JCML 4PX1A 2B7KA 3M8NA 4BVXA 2DLXA 2I9HA 5JWOB 1V57A 2HSHA 2K6VA 1WJKA 3GMFA 2FA8A 2L4QA 3TGZA 4XS1A 1EOHA 3APQA 4V1Ap 3FR6A 3H1NA 2LNTA 2LRNA 3RPNA 3UVTA 5ECLB 2DMLA 1KTEA 2YP6A 2HLSA 4ISDA 5DQSA 1Z7PA 2L5LA 3PGTA 3O3TA 4L5LA 4OCFA 17GSA 4POLA 2O7KA 5DJMA 2H70A 5A4WA 4ID0A 3VFIA 3H93A 3KP8A 3ED3A 4MABA 4NWYA 2XPEA 2F8FA 2H8LA 2H1DA 5G2ZA 4BL7A 2HE3A 2IMKA 4H86A 2PERA 3TKSC 5C04A 1MDIA 4AJ8A 1TOFA 1Z7RA 3DMLA 1XWBA 2GVPA 1K0DA 1M2BA 4RI6A 2AHEA 1SKSB 1U88A 3HVVA 3IOSA 2C3TA 9GSSA 5F06A 1RW1A 2M72A 1PKWA 1H4OA 3GKXA 2HYXA 1SENA 4JR4A 3IK9A 4IJ3A 3UL3A 2VCTA 1TK8B 4MK3A 1EEMA 4KNDA 4HQSA 4POMA 1Y6EA 4TXOB 1WMJA 5GSSA 1ERWA 3G7IA 2EIRA 2YJHA 3D0ZA 4V1Ag 2VCZA 1OKTA 6GSVA 5ECNB 2DJ3A 5EL8A 5GSTA 1TI1A 4J2FA 2C8UA 5EPFA 3IRAA 3KIJA 2RUEA 4AJ6A 4GQFA 2H71A 3GYKA 2IMIA 3H79A 2JU5A 1FW1A 2VD1A 4ZL7A 2H1GA 3IC4A 2LEGA 1WE0A 1DE1A 1QFNA 3N9JA 3FK8A 1RK4A 1XPVA 4TR3A 2OBKA 4YQVA 4KW6A 1X0RA 3HZ4A 1N8JA 1XWKA 3FR9A 1VF4A 4EDZA 4ACSA 3C1RA 1GLPA 2LRCA 5KN0A 2OE3A 4ZB9A 1THXA 5EVOA 3EVIA 4I5QA 3FY7A 4BVYA 5HFKA 5H5QA 2KUCA 5AIVA 3DVXA 5DVBA 1Z3EA 1YEXA 5KN3A 2OACA 2V32A 2O8VB 5DDLA 4PQ1A 4MJCA 4MCUA 4K2DA 2HNLA 4QL9A 5L71A 2HZEB 1ZOFA 4IP6A 1SU9A 1OVNA 3EURA 4HS1A 2HI7A 2GLRA 2AB6A 4JR6A 4G9HA 3GNJA 1EOGA 2YV7A 2FHEA 5IIZA 5ECPB 1FVKA 3ZMKA 3KTBA 3P8WA 4Q5RA 2LTKA 5J4UA 4O92A 4OO5A 1WOUA 5HFIA 13GSA 2GQMA 1GTUA 4MPFA 2H1AA 1W4VA 1SJ6A 2QSIA 1XCCA 3P2AA 1A8LA 3EYTA 3Q19A 3EMPA 4EF0A 5AISA 4LMVA 4O5RA 1NW2A 1DBYA 3NZNA 1SYRA 2CT6A 3PINA 1F9MA 3ZYWA 3E0UA 1M0UA 2I4AA 2NDOA 1YF0A 1Z5YE 1TU7A 4Q5QA 3ERFA 3KCMA 3ZLPA 4OCEA 4V2LA 1YDKA 3WD6A 3D21A 4WKWA 4LL1B 1Z6MA 2IWTA 1JZOA 2ALBA 2JACA 3F4SA 2IIYA 1R5PA 1EV9A 2CAIA 3L0HA 2IMDA 3HXSA 3TJGA 1W89A 4NV5A 1UN2A 3FZ5A 3GL5A 4HJMA 4MPGA 5ECIB 3LYPA 1K0NA 1QQ2A 3WYWA 5ECHB 1PGTA 4YQMA 3S9FA 3I9V2 3QMXA 1V9WA 1BJXA 3J7Yb 3LEFA 2KP1A 6GSSA 1PKZA 4WETA 3C1SA 1G6YA 3UBLA 1AQXA 1EV4A 1IYIA 5G1LA 14GSA 2DJ1A 1GWCA 3CSIA 2VL3A 6GSUA 3Q74A 2WZ9A 3TDGA 1XW5A 4NMUA 2LS5A 2L6CA 4XCSA 1ACVA 2LUSA 1ML6A 6GSTA 5J41A 1XIYA 1U3IA 4MA9A 3E3EA 4K1FA 2PUKC 1THOA 2CX3A 3A2XA 3FKFA 1XVWA 3UMAA 1M99A 4O32A 1XW9A 4KE3A 4IJIA 5AIXA 4ZXGA 1U3AA 2K8SA 3ZIJA 2XBIA 3US3A 2RUFA 2AJQB 2DJ0A 2TRCP 2CV4A 2MBTA 3VURA 3PR8A 4PUFC 5D96A 5DJLA 3GN3A 6GSYA 5A5KA 2WS2A 1OC9A 2X8GA 1WPIA 4MF7A 4ZB6A 4FYCA 5DALB 2H0HA 3C71A 4IN0A 2YV9A 2HT9A 3GKKA 3EWLA 1A2JA 1GRXA 3ZFLA 3UIWA 4G2EA 1GUKA 2I1UA 2HZEA 1XW6A 4KSMA 2M80A 5C00A 4XIHA 1F37A 4JRRA 3GKMA 4DEJA 2FUG2 4KCEA 1B4PA 4QQ7A 2R37A 1SD9A 4ZIJA 2V1MA 4POKA 2V6OA 3L9VA 3VWUA 1VRSD 2WFCA 2YZUA 4AJ7A 1VF2A 1V98A 2CX4A 1M2DA 5EY6A 1O81A 2C0EA 1T7PB 3F6DA 2YOIA 1GL8A 1G6WA 1SKWB 3IDVA 2JZTA 2VD0A 2FNOA 2H66A 1YKAA 4GXZA 1A0RP 1O73A 4P3YB 1AQVA 1YQ1A 1WP0A 3QPMA 3KJYA 1XOAA 1G7EA 1TU8A 2DSAA 3KEBA 2VL2C 4PXOA 1MDJA 4MJAA 5CP1A 3CRTA 4IBPA 5G5FA 1K0OA 2VOCA 4J56E 3UJ1A 3IAS2 3TKPA 3VLNA 1JZRA 10GSA 2LNSA 4MJBA 1T8EB 1JHBA 1GSDA 3TJBA 2XBQA 1GULA 5DQYA 1LU4A 1VGLA 5ECSA 5J9BA 1A23A 3ME7A 2DIYA 2K9FA 3LXZA 2H30A 1QXHA 3DKSA 2YNXA 4HQZA 1FOVA 1X5EA 5J5NA 3APOA 1MDKA 1I5GA 3DWVA 1A24A 3AY8A 3TOUA 2WJUA 5D9VA 1TRVA 1BX9A 2EIQA 2D2ZA 5IO0A 3FZ4A 2ZCTA 5G31A 2QC7A 1SL2B 4HU9A 3KP9A 2YANA 4YAVA 4TW5A 2HSYA 4MLYA 1CQGA 5D93A 2C0DA 4MMMA 5ENUA 4EO3A 2TRXA 2MYGA 5ECRB 2DJ2A 5B6MA 4XS4B 5IMDA 2IFQB 2YWIA 5IO2A 1K0BA 1K3YA 2VIMA 4IHUA 2GSSA 1K0AA 4PNFA 1T4ZA 4K7IA 5ECQB 1TP9A 2GTUA 3GTUB 3CBUA 5ID2A 2AAWA 1F6MC 1GP1A 1M7TA 4FO5A 1PMTA 2GQLA 2L59A 2TIRA 3KTLA 4QL7A 5CNWA 2VO4A 4ULXA 4ZL8A 1E2YA 3IR4A 4HUAA 4ZBDA 1FB0A 3HCZA 3VI7A 1B4QA 4OFNA 3R2QA 3TOTA 2FLSA 3GX0A 3WGEA 1Z9HA 2LKUA 2C3QA 1GUHA 4KUNA 3E9JB 5JWQB 5DALA 4WXTA 3KMNA 2F9SA 5CRWA 3APSA 3D22A 4KX4A 4KDUA 5DBQA 3W8JA 1KNGA 4KA0A 4ZB8A 4DSRA 1FG4A 3DIEA 3FR3A 2VCQA 3HKRA 2HZFA 5IPHA 1OE7A 3G7JA 1YEPA 1XWGA 2VLUA 3IV4A 3VWWA 3KMOA 3ZVJA 4K0GA 1AIUA 2KOKA 4L8EA 2H75A 2MMZA 3O6TA 4KAEA 2VLTA 22GSA 1X5DA 2DMMA 4YH2A 2IN3A 4OFMA 3MAKA 1ZYEA 4F03A 2OE1A 2VL9A 4CHSA 5B6NA 2KLXA 4OD7A 1BQ7A 3K8NA 2MBSA 4DSQA 3BOAA 2PWJA 3WGXA 5GAPD 2GS3A 4ZL9A 3M1GA 3A2VA 2WGRA 4BWQA 1ZL9A 4EUYA 2X8HA 2GSTA 2P0GA 3LFLA 4N0VA 1OC3A 5ABRA 2B3SA 4MZCA 4GRFA 4OFTA 4HEA2 2R2JA 2BMXA 1ABAA 1O8WA 5D9TA 1O85A 1ZGNA 2NVLA 1BG5A 1GTBA 2C4JA 1DE2A 3D5JA 2XHFA 1EGOA 1JFUA 2DJJA 3GKNA 3UVHA 3Q6OA 2PVQA 3F9UA 1WWJA 2X8CA 4LMWA 1AUCA 3QAVA 1UA5A 1DSBA 4MH3A 1KEBA 4WR5A 2GZPA 2ZUPA 3HVSA 2GSRA 2LSTA 1XWAA 1CQHA 3GH6A 1SKRB 2K8VA 5IMAA 2JADA 1B8XA 1LJRA 4DSSB 4IQAA 1TI3A 3TKSE 4PGTA 4EXJA 2NPBA 4F0CA 1XXUA 2LQOA 3ZVJD 5B8AA 18GSA 3Q18A 4V2NA 2EIOA 5IM9A 4TR0A 5JCGA 5IMVA 2FWGA 2R3XA 3TKSA 3IK7A 2VM1A 4K0NA 3F4RA 2HXKA 2NBSA 4HDEA 3TJFA 2PPTA 3KD0A 4FYUA 3TJKA 2OE0A 3FZ9A 1V2AA 1HD2A 2H76A 20GSA 2GQKA 1QGVA 3ZRDA 5G30A 2HFDA 1K3LA 5DCGA 5CREA 3OR5A 5AGYA 1ERVA 5E4WA 1IYHA 4FYBA 4EKZA 2BJXA 5DAKB 4ML6A 5GZZB 5FHIA 1FB6A 4NHWA 1R4WA 4XRDA 4LLRA 1Y25A 4Q5FA 3TCOA 2CVDA 4LL4B 4TKYA 1SK0A 3FYGA 4E8HA 4K7NA 5ECKB 2L4CA 5GAND 2CVKA 4NHZA 3GL3A 2OJLA 4TR1B 5ELAA 3BBYA 4PURA 4GQCA 1Q98A 1R7HA 2G2QA 3LXTA 1SYXA 5A4UA 1C72A 4GSTA 2I81A 1N2AA 3M9JA 4GSNA 3EE2A 2FWEA 5CRDA 4N10A 2YZHA 3BD2A 3IA1A 4NPBA 4WEYA 2H6YA 2JZSA 4F0BA 3TRPA 1UVZA 5CO3A 4TN8A 3QDNA 4EE0A 4TXOA 5H5RA 4BWSA 5IMFA 3CMIA 4IGJA 2VLVA 1WRYA 4MJEA 2KHPA 1TK5B 3GSSA 3KGKA 1TKDB 1B9YC 3FW2A 2K18A 5FT3A 1GLQA 1OYJA 3LGCA 5IMCA 1XZOA 1USBA 2FGXA 5A4VA 3LQ7A 2X64A 3FEUA 2F3MA 2MMNA 1ZMAA 2GZYA 1NSWA 2REMA 1FHEA 4TVEA 5KN2A 2PMTA 1MTCA 3RBTA 4MH2A 3N5OA 2AUVA 2LRTA 4TOPA 3VPTA 1A2MA 3RHCA 3U5RE 2L6DA 4I97A 1SJIA 3GURA 3KM6A 2GZZA 1PX7A 3SWLA 2IMFA 3M9KA 3D4TA 2ES7A 3HJMA 4MZBA 3VWVA 2H74A 4Z7XA 2NTOA 4NXIA 2LJKA
chains in the Genus database with same CATH superfamily
4OO4A 1HNCA 1GTAA 1YZXA 4JZQA 3G9BA 1AXDA 2VCXA 2FCHA 4X1UA 1M3IA 3NOFA 5KEJA 3EINA 2DJKA 2HRAA 4HU7A 4GTUA 1PN0A 1BAYA 4Z2RA 1SJZA 1PL2A 2RIIA 4HOJA 4F82A 4BA7A 2VAFA 2GSQA 5AN1A 2N5AA 4MP4A 1PSQA 4ILFA 5CRGA 3L9SA 1X9MB 4F9ZA 2J23A 4K8MA 2CZ2A 2H6ZA 4WBRD 1GSQA 1Q4JA 1ERTA 1GNEA 2QKEA 5IOWA 2M46A 2WCIA 5LCZA 2CVBA 3P90A 3WT1A 5D9WA 3VWXA 2YCDA 1YY7A 2O87A 4EC0A 4KDYA 1EGRA 5B7CA 3RAZA 1OC8A 2XC2A 1ZYQB 3GH9A 5KOWA 3A5WA 3SBCA 3EU4A 3DGQA 1JLWA 2AYTA 1EP7A 4L0WA 1NHYA 2OA7A 3BCKA 1HNAA 1QK8A 2LQQA 4TR4A 4EDYA 4K9ZA 4G19A 2YN1A 3HHVA 4GWRA 1X9SB 2YWMA 8GSSA 4RI7A 5CYYA 4PTSA 2DIZA 4HI7A 3TB2A 2JZRA 2O85A 2P5QA 3HDCA 3CTFA 1HQOA 4POBA 5D9XA 12GSA 1URMA 2OADA 3W8SA 3PH9A 4I2TA 1V40A 5HFGA 4IELA 1MEKA 4BVYB 2IPAA 1HNBA 3U6VA 6GSXA 2B7JA 2IMEA 1A8YA 3QOUA 5FWGA 1OKDA 4GSSA 2V6KA 3GX8A 5E59A 1GSEA 3ZL5A 2X99A 4G10A 1T3BA 1M2AA 3ZITA 1RQMA 1T00A 4ZILA 4O5UA 1BEDA 2B5YA 3HJOA 3GRXA 3GUSA 4NV2A 3WGDA 2L57A 1R26A 3CRUA 1E6BA 2CAQA 1EEJA 3IE3A 2HSMA 2LJAA 3CQFA 4HZ2A 4XS6A 3QFBC 2B6MA 1VF1A 2V41A 3C73A 5F0GA 1B48A 2GGTA 3LORA 5COHA 1SD8A 3I43A 1F3BA 4D73B 1EWXA 1H75A 1PN9A 3F3RA 3MDKA 3MSZA 3W6GA 4YAPA 3LSZA 1M9AA 1TRWA 7GSSA 4Q5NA 1FVJA 2QGVA 5F05A 2P5RA 4XHMA 1O7UA 3V1WA 4X43A 2H73A 2DKHA 3L4NA 5HR0A 5ECMB 2R5GA 2WRTA 3CXGA 3LJRA 5ECOB 3QAGA 1SL1B 4I2UA 4XTSA 2E0QA 1JLVA 3CSHA 4CW9A 3ZTLA 3I6AA 2IJYA 3EC3A 4LA1A 3HVXA 4ECCA 3DXBA 3RDWA 4K5RA 1TRUA 1PA3A 2HRNA 4E8EA 2VL2A 1AW9A 3D6IA 1O8XA 2B1KA 2LJRA 3CYNA 4WF5A 4RUVA 2J9HA 1BYEA 1GTIA 2E2MA 3UEMA 1YF1A 2JSZA 4MDCA 1VF3A 2OKAA 3FRCA 4GF0A 3DVWA 1HYUA 4JU5A 2G0FA 3KH9A 3QR6A 3H4KA 5LNKe 2YWOA 1ST9A 1K0CA 1SK1A 3IC8A 4MZWA 1ZCPA 4O7HA 3I69A 1A0FA 1F3AA 5JCUA 2MMOA 5KN1A 3ZFBA 2L5OA 2P31A 3EMXA 2YPMA 4XRAA 1B9XC 3LWAA 1TDIA 4J57E 2E7PA 1PRXA 5INYA 5F07A 3HZ8A 3FMWA 2FD3A 4N11A 4JBBA 3FHKA 4PQIA 1G0TA 2Z9SA 1OC9B 2FA4A 2DBCA 3GSTA 1TJDA 4ECJA 1EZKA 3NIVA 4ECIA 3UBKA 2MZCA 1V58A 4ECBA 3QCPA 4L0UA 1SL0B 1R5AA 2GT6A 2PBJA 5JCWA 4PNGA 2WB9A 1MD3A 4ICYA 3HA9A 2FWHA 2CQ9A 2H6XA 1YKCA 3UAPA 1LBKA 1XFLA 3CSJA 3GFKA 6GSWA 2A2SA 3ERGA 4L5OA 3IBHA 4I6XA 3GIXA 1GSYA 4IKHA 3UARA 4JE1A 2F8AA 5HQPA 1J9BA 2BTOT 1PQNA 4XS4A 5CAXA 3HYPA 1GSFA 2PN8A 2IFQA 3ZREA 1J0FA 4DVCA 1EP8A 2ZNMA 3IAM2 4MF6A 1MD4A 3QFAC 2CA8A 1TTZA 1S3AA 3M3MA 2WULA 4PQHA 3RHBA 5IPGA 1GH2A 5HR1A 3UOMA 3VPQA 5JWRB 2KP2A 3GTUA 4AGSA 1XWCA 2X4AA 4D73A 2N5FA 1NM3A 4IP1A 5D8IA 2H0IA 1GSSA 3A2WA 1NHOA 1S3CA 5CRHA 3MWHA 3M0FA 3ZZXA 3IPZA 1ILOA 3ZIVA 2VCVA 3HD5A 1ON4A 1TK0B 11GSA 3F63A 2WDUA 5ELGA 2V2GA 3IXRA 2A4VA 2VM2A 3C8EA 1PFOA 2O89A 3TJJA 5IOXA 2A2RA 2VCWA 4WR4A 4NAXA 4N30A 4KH7A 1G7OA 2B1LA 2H72A 5DCHA 4EVMA 3HJPA 4KGIA 1AC1A 3O76A 4WBJA 4MF5A 2DKIA 3KZQA 2PGTA 1FAAA 1TRSA 2RM5A 3DEXA 3F3QA 3WT2A 16GSA 1F2EA 1WIKA 3H8QA 2I3YA 2B5EA 4F2IA 3ME8A 3CTGA 3P7XA 4KSOA 4K6XA 2H1BA 4KDXA 4CDOA 2B5XA 4KF9A 5HR3A 5LD0A 1PL1A 1JZWA 3LYKA 3F4TA 4FIWA 4WF4A 2DC5A 2VUPA 3TKQA 1K0MA 4KCAA 4ZBBA 1T1VA 1PX6A 2ON7A 1J08A 2H01A 1ZZYA 2LV3A 1SK2A 3F0IA 2C0FA 4A5PA 5IMZA 5KOXA 3F8UA 2R6KA 5F8BA 4HJ2A 1T4YA 1M9BA 5ID2B 2N5BA 3LG6A 5D73A 4YQUA 3J7Yk 3GV1A 3DYRA 3QD9A 3KH7A 1GSUA 4N0ZA 3L9UA 1XVQA 2FY6A 2C0GA 3DRNA 4IQ1A 1S3DA 3VI5A 4X0XA 3D4MA 5J9CA 4I8BA 1AQWA 4PUAA 4AF2A 2IL3A 4EL1A 3FZAA 2GDRA 4DSSA 2EC4A 1GUMA 3L78A 3TKRA 4OWYA 1UC7A 4ZBAA 3QAWA 3GA4A 2H0GA 1U6TA 1OAZA 4RQRA 2RLIA 1FO5A 1XOBA 3VK9A 1YJ6A 2FWFA 2CZ3A 3HY2A 1X5CA 1Z6NA 4FQUA 4TXVA 2XPDA 4KB3A 5J3RA 4GLTA 1QUWA 5B8BA 3DD3A 2PVOC 4TRXA 3G7YA 4JEDA 1PD21 1GNWA 3C7MA 4ML1A 3EU3A 3ISOA 3IHQA 4V2MA 2OBIA 1XBSA 5DAKA 3KXOA 3BJ5A 1ERUA 5H5SA 2HRFA 4YKGA 3ZMLA 4BPYA 2C80A 4K7OA 4BIKA 3TRXA 1OE8A 1AAZA 4IS0A 1A2LA 4RQXA 2C3NA 3GHAA 3A3TA 4IW9A 1JZDA 1KBNA 4FH8A 1TXXA 1DUGA 4TR1A 3RPPA 5IQYA 3F6FA 1K3OA 1U87A 2R4VA 1I9DA 1TW9A 4IVFA 3ERWA 5G1KA 2E2GA 2H19A 4GCIA 2RM6A 2MMAA 3TRQA 2R0PA 3MNGA 2YWNA 2JL4A 1O6JA 19GSA 1QMVA 5G5EA 5HR2A 4HZ4A 2PU9C 2JSYA 2AV4A 2F51A 3BCIA 4OMVA 1X9WB 2ON5A 3TUEA 2YJ7A 2C1YA 2GT5A 3JCML 4PX1A 2B7KA 3M8NA 4BVXA 2DLXA 3PPUA 2I9HA 5JWOB 1V57A 2HSHA 2K6VA 1WJKA 3GMFA 2FA8A 2L4QA 3TGZA 4XS1A 1EOHA 3APQA 4V1Ap 4HSCX 3FR6A 3H1NA 2LNTA 2LRNA 3RPNA 3UVTA 5ECLB 2DMLA 1KTEA 2YP6A 2HLSA 4ISDA 5DQSA 1Z7PA 2L5LA 3PGTA 3O3TA 4L5LA 4OCFA 17GSA 4POLA 2O7KA 5DJMA 2H70A 5A4WA 4ID0A 3VFIA 3H93A 3KP8A 3ED3A 4MABA 4NWYA 2XPEA 2F8FA 2H8LA 2H1DA 5G2ZA 4BL7A 2HE3A 2IMKA 4H86A 1S3RA 4G0IA 2PERA 3TKSC 5C04A 1MDIA 4AJ8A 1TOFA 2R0GA 1Z7RA 3DMLA 1XWBA 2GVPA 1K0DA 1M2BA 3R3EA 4RI6A 2AHEA 1SKSB 1U88A 3HVVA 3IOSA 2C3TA 9GSSA 5F06A 1RW1A 2M72A 1PKWA 1H4OA 3GKXA 2HYXA 1SENA 4JR4A 3IK9A 4IJ3A 3UL3A 2VCTA 1TK8B 4MK3A 1EEMA 4KNDA 4HQSA 4POMA 1Y6EA 4TXOB 1WMJA 1ZYNA 1ERWA 5GSSA 3G7IA 2EIRA 2YJHA 3D0ZA 4V1Ag 2A4HA 2VCZA 1OKTA 2A2PA 6GSVA 5ECNB 2DJ3A 5EL8A 5GSTA 1TI1A 4J2FA 2C8UA 5EPFA 3IRAA 3KIJA 2RUEA 4AJ6A 4GQFA 2H71A 3GYKA 2IMIA 3H79A 2JU5A 1FW1A 2VD1A 4ZL7A 2H1GA 3IC4A 2LEGA 1WE0A 1DE1A 1QFNA 3N9JA 3FK8A 1RK4A 1XPVA 4TR3A 2OBKA 4YQVA 4KW6A 1X0RA 3HZ4A 1N8JA 1XWKA 3FR9A 1VF4A 4EDZA 4ACSA 3C1RA 1GLPA 2LRCA 5KN0A 2OE3A 4ZB9A 1THXA 1XG8A 5EVOA 3EVIA 4I5QA 3FY7A 4BVYA 5HFKA 5H5QA 2KUCA 5AIVA 3DVXA 5DVBA 1Z3EA 1YEXA 5KN3A 2OACA 2V32A 2O8VB 5DDLA 4PQ1A 4MJCA 4MCUA 4K2DA 2HNLA 4QL9A 5L71A 2HZEB 1ZOFA 4IP6A 1SU9A 1OVNA 3EURA 4HS1A 2HI7A 2GLRA 2AB6A 4JR6A 4G9HA 3GNJA 1EOGA 2YV7A 2FHEA 5IIZA 5ECPB 1FVKA 3ZMKA 3KTBA 3P8WA 4Q5RA 2LTKA 5J4UA 4O92A 4OO5A 1WOUA 5HFIA 13GSA 2GQMA 1GTUA 4MPFA 2H1AA 1W4VA 1SJ6A 2QSIA 1XCCA 3P2AA 1A8LA 3EYTA 3Q19A 3EMPA 4EF0A 4LMVA 4O5RA 5AISA 1NW2A 1DBYA 3NZNA 1SYRA 2CT6A 3PINA 1F9MA 3ZYWA 3E0UA 1M0UA 2I4AA 2NDOA 1YF0A 1Z5YE 1TU7A 4Q5QA 3ERFA 3KCMA 3ZLPA 4OCEA 4V2LA 1YDKA 3WD6A 3D21A 4WKWA 4EIQA 4LL1B 1Z6MA 2IWTA 1JZOA 2ALBA 2JACA 3F4SA 2IIYA 3IHGA 1R5PA 1EV9A 2CAIA 3L0HA 2IMDA 3HXSA 3TJGA 1W89A 4NV5A 1UN2A 3FZ5A 3GL5A 4HJMA 4MPGA 5ECIB 3LYPA 1K0NA 1QQ2A 3WYWA 5ECHB 1PGTA 4YQMA 3S9FA 3I9V2 3QMXA 1V9WA 3MYDA 1BJXA 3J7Yb 3LEFA 2KP1A 3MIXA 6GSSA 1PKZA 4WETA 3C1SA 1G6YA 3UBLA 1AQXA 1EV4A 1IYIA 5G1LA 14GSA 2DJ1A 1GWCA 3CSIA 2VL3A 6GSUA 3Q74A 2WZ9A 3TDGA 1XW5A 4NMUA 2LS5A 2L6CA 4XCSA 4K5SA 1ACVA 2LUSA 1ML6A 6GSTA 5J41A 1XIYA 1U3IA 4MA9A 3E3EA 4K1FA 2PUKC 1THOA 2CX3A 5BRTA 3A2XA 3FKFA 1XVWA 3UMAA 1M99A 4O32A 1XW9A 4KE3A 4IJIA 5AIXA 4ZXGA 1U3AA 2K8SA 3HVNA 3ZIJA 2XBIA 3US3A 2RUFA 2AJQB 2DJ0A 2TRCP 2CV4A 2MBTA 2QA2A 3VURA 3PR8A 4PUFC 5D96A 5DJLA 3GN3A 4YKFA 6GSYA 5A5KA 2WS2A 1OC9A 2X8GA 1WPIA 4MF7A 4ZB6A 4FYCA 5DALB 2H0HA 3C71A 4IN0A 2YV9A 2HT9A 3GKKA 3EWLA 1A2JA 1GRXA 3ZFLA 3UIWA 4G2EA 1GUKA 2I1UA 2HZEA 1XW6A 4KSMA 2M80A 5C00A 4XIHA 1F37A 4JRRA 3GKMA 4DEJA 2FUG2 4KCEA 4Z2UA 1B4PA 4QQ7A 2HRKA 2R37A 1SD9A 4ZIJA 2V1MA 4POKA 2V6OA 1ZYPA 3L9VA 3VWUA 1VRSD 2WFCA 2YZUA 4AJ7A 1VF2A 1V98A 2CX4A 1M2DA 5EY6A 1O81A 2C0EA 1T7PB 3F6DA 2YOIA 1GL8A 1G6WA 2X49A 1SKWB 3IDVA 2JZTA 2VD0A 2FNOA 2H66A 1YKAA 4GXZA 1A0RP 1O73A 4P3YB 1AQVA 1YQ1A 1WP0A 3QPMA 3KJYA 1XOAA 1G7EA 1TU8A 2DSAA 3KEBA 2VL2C 4PXOA 1MDJA 4MJAA 5CP1A 3CRTA 4IBPA 5G5FA 1K0OA 2VOCA 4J56E 3UJ1A 3IAS2 3TKPA 3VLNA 1JZRA 4K2XA 10GSA 2LNSA 4MJBA 1T8EB 1JHBA 1GSDA 3TJBA 2XBQA 1GULA 5DQYA 4G0LA 1LU4A 1VGLA 5ECSA 5J9BA 1A23A 3ME7A 2DIYA 2K9FA 3LXZA 2H30A 1QXHA 3DKSA 2YNXA 4HQZA 1FOVA 1X5EA 5J5NA 3APOA 1MDKA 1I5GA 3DWVA 1A24A 3AY8A 3TOUA 2WJUA 5D9VA 4USSA 1TRVA 1BX9A 4CY6A 2EIQA 2D2ZA 5IO0A 3FZ4A 2ZCTA 5G31A 2QC7A 1SL2B 4HU9A 3KP9A 2YANA 4YAVA 4TW5A 2HSYA 4MLYA 1CQGA 5D93A 2C0DA 4MMMA 5ENUA 4EO3A 2TRXA 2MYGA 5ECRB 2DJ2A 5B6MA 4XS4B 5IMDA 2IFQB 2YWIA 4CY8A 5IO2A 1K0BA 1K3YA 2VIMA 4IHUA 2GSSA 1K0AA 4PNFA 1T4ZA 4K7IA 5ECQB 1TP9A 2GTUA 3GTUB 3CBUA 5ID2A 2AAWA 1F6MC 1GP1A 1M7TA 4FO5A 1PMTA 2GQLA 2L59A 2QA1A 2TIRA 3KTLA 4QL7A 5CNWA 2VO4A 4ULXA 4ZL8A 1E2YA 3IR4A 4X4JA 4HUAA 4ZBDA 1FB0A 3HCZA 3VI7A 1B4QA 4OFNA 3R2QA 3TOTA 2FLSA 3GX0A 3WGEA 1Z9HA 2LKUA 2C3QA 1GUHA 4KUNA 3E9JB 5JWQB 5DALA 4Z2TA 4WXTA 3KMNA 2F9SA 5CRWA 3APSA 3D22A 4KX4A 4KDUA 5DBQA 3W8JA 1KNGA 4KA0A 4ZB8A 4DSRA 1FG4A 3DIEA 3FR3A 2VCQA 3HKRA 2HZFA 5IPHA 1OE7A 3G7JA 1YEPA 1XWGA 2VLUA 3IV4A 3VWWA 3KMOA 3ZVJA 4K0GA 1AIUA 2KOKA 4L8EA 2H75A 2MMZA 3O6TA 4KAEA 2VLTA 22GSA 1X5DA 2DMMA 4YH2A 2IN3A 4OFMA 3MAKA 1ZYEA 4F03A 2OE1A 2VL9A 4CHSA 5B6NA 2KLXA 4OD7A 1BQ7A 3K8NA 2MBSA 4DSQA 3BOAA 2PWJA 3WGXA 5GAPD 2GS3A 4ZL9A 3M1GA 3A2VA 2WGRA 4BWQA 1ZL9A 4EUYA 2X8HA 2GSTA 2P0GA 3LFLA 4N0VA 1OC3A 5ABRA 2B3SA 4MZCA 4GRFA 4OFTA 4HEA2 2R2JA 2BMXA 1ABAA 1O8WA 5D9TA 1O85A 1ZGNA 2NVLA 1BG5A 1GTBA 2C4JA 1DE2A 3D5JA 2XHFA 1EGOA 1JFUA 2DJJA 3GKNA 3UVHA 3Q6OA 2PVQA 3F9UA 1WWJA 2X8CA 4LMWA 1AUCA 3QAVA 1UA5A 1DSBA 4MH3A 1KEBA 4WR5A 2GZPA 2ZUPA 3HVSA 2GSRA 2LSTA 1XWAA 1CQHA 3GH6A 1SKRB 2K8VA 5IMAA 2JADA 1B8XA 1LJRA 4DSSB 4IQAA 1TI3A 3TKSE 5BMUA 4PGTA 4EXJA 2NPBA 4G0KA 4F0CA 1XXUA 2LQOA 3ZVJD 5B8AA 18GSA 3Q18A 4V2NA 2EIOA 5IM9A 1FOHA 4TR0A 5JCGA 5IMVA 2FWGA 2R3XA 3TKSA 3IK7A 2VM1A 3EPTA 4K0NA 3F4RA 2HXKA 2NBSA 4HDEA 3TJFA 2PPTA 3KD0A 4FYUA 3TJKA 2OE0A 3FZ9A 1V2AA 1HD2A 2H76A 20GSA 4O5QA 2GQKA 1QGVA 3ZRDA 5G30A 2HFDA 4MNNA 1K3LA 5DCGA 4EIPA 5CREA 3OR5A 5AGYA 1ERVA 5E4WA 1IYHA 4FYBA 4EKZA 2BJXA 5DAKB 4ML6A 5GZZB 5FHIA 1FB6A 4NHWA 1R4WA 4XRDA 4LLRA 2R0CA 1Y25A 4Q5FA 3TCOA 2CVDA 4LL4B 4TKYA 1SK0A 3FYGA 4E8HA 2UZ8A 4K7NA 5ECKB 2L4CA 5GAND 2CVKA 4NHZA 3GL3A 2OJLA 4TR1B 5ELAA 3BBYA 4PURA 4GQCA 1Q98A 1R7HA 2G2QA 3LXTA 1SYXA 5A4UA 1C72A 4GSTA 2I81A 1N2AA 3M9JA 4GSNA 3EE2A 2FWEA 5CRDA 4N10A 2YZHA 3BD2A 3IA1A 4NPBA 4WEYA 2H6YA 2JZSA 4F0BA 3TRPA 1UVZA 5CO3A 4TN8A 3QDNA 4EE0A 4TXOA 5H5RA 4BWSA 5IMFA 3CMIA 4IGJA 2VLVA 1WRYA 4MJEA 2KHPA 1TK5B 3GSSA 3KGKA 1TKDB 1B9YC 3FW2A 2K18A 5FT3A 1GLQA 1OYJA 3LGCA 5IMCA 4BVXB 1XZOA 1USBA 2FGXA 5A4VA 3LQ7A 2X64A 3FEUA 2F3MA 2MMNA 1ZMAA 2GZYA 1NSWA 2REMA 1FHEA 4TVEA 5KN2A 2PMTA 1MTCA 3RBTA 3A5IA 4MH2A 3N5OA 2AUVA 2LRTA 4TOPA 3VPTA 1A2MA 3RHCA 3U5RE 2L6DA 4I97A 1SJIA 3GURA 3LW9A 3KM6A 2GZZA 1PX7A 3SWLA 2IMFA 3M9KA 3D4TA 2ES7A 3HJMA 4MZBA 3VWVA 4BL7B 2H74A 4Z7XA 2NTOA 1M3JA 4NXIA 2LJKA
chains in the Genus database with same CATH topology
4OO4A 1HNCA 1GTAA 1YZXA 4JZQA 3G9BA 1AXDA 2VCXA 2FCHA 4X1UA 3NOFA 5KEJA 3EINA 2DJKA 2HRAA 4HU7A 4GTUA 1PN0A 1BAYA 4Z2RA 1SJZA 1PL2A 2RIIA 4HOJA 4F82A 4BA7A 2VAFA 2GSQA 5AN1A 2N5AA 4MP4A 1PSQA 4ILFA 5CRGA 3L9SA 1X9MB 4F9ZA 2J23A 4K8MA 2CZ2A 2H6ZA 4WBRD 1GSQA 1Q4JA 1ERTA 1GNEA 2QKEA 5IOWA 2M46A 2WCIA 5LCZA 2CVBA 3P90A 3WT1A 5D9WA 3VWXA 2YCDA 1YY7A 2O87A 4EC0A 4KDYA 1EGRA 5B7CA 3RAZA 1OC8A 2XC2A 1ZYQB 3GH9A 5KOWA 3A5WA 3SBCA 3EU4A 3DGQA 1JLWA 2AYTA 1EP7A 4L0WA 1NHYA 2OA7A 3BCKA 1HNAA 1QK8A 2LQQA 4TR4A 4EDYA 4K9ZA 4G19A 2YN1A 3HHVA 4GWRA 1X9SB 2YWMA 8GSSA 4RI7A 5CYYA 4PTSA 2DIZA 4HI7A 3TB2A 2JZRA 2O85A 2P5QA 3HDCA 3CTFA 1HQOA 4POBA 5D9XA 12GSA 1URMA 2OADA 3W8SA 3PH9A 4I2TA 1V40A 5HFGA 4IELA 1MEKA 4BVYB 2IPAA 1HNBA 3U6VA 6GSXA 2B7JA 2IMEA 1A8YA 3QOUA 5FWGA 1OKDA 4GSSA 2V6KA 3GX8A 5E59A 1GSEA 3ZL5A 2X99A 4G10A 1T3BA 1M2AA 3ZITA 1RQMA 1T00A 4ZILA 4O5UA 1BEDA 2B5YA 3HJOA 3GRXA 3GUSA 4NV2A 3WGDA 2L57A 1R26A 3CRUA 1E6BA 2CAQA 1EEJA 3IE3A 2HSMA 2LJAA 4HZ2A 4XS6A 3QFBC 2B6MA 1VF1A 2V41A 3C73A 5F0GA 1B48A 2GGTA 3LORA 5COHA 1SD8A 3I43A 1F3BA 4D73B 1EWXA 1H75A 1PN9A 3F3RA 3MDKA 3MSZA 3W6GA 4YAPA 3LSZA 1M9AA 1TRWA 7GSSA 4Q5NA 1FVJA 2QGVA 5F05A 2P5RA 4XHMA 1O7UA 3V1WA 4X43A 2H73A 2DKHA 3L4NA 5HR0A 5ECMB 2R5GA 2WRTA 3CXGA 3LJRA 5ECOB 3QAGA 1SL1B 4I2UA 4XTSA 2E0QA 1JLVA 3CSHA 4CW9A 3ZTLA 3I6AA 2IJYA 3EC3A 4LA1A 3HVXA 4ECCA 3DXBA 3RDWA 4K5RA 1TRUA 1PA3A 2HRNA 4E8EA 2VL2A 1AW9A 3D6IA 1O8XA 2B1KA 2LJRA 3CYNA 4WF5A 4RUVA 2J9HA 1BYEA 1GTIA 2E2MA 3UEMA 1YF1A 2JSZA 4MDCA 1VF3A 2OKAA 3FRCA 4GF0A 3DVWA 1HYUA 4JU5A 2G0FA 3KH9A 3QR6A 3H4KA 5LNKe 2YWOA 1ST9A 1K0CA 1SK1A 3IC8A 4MZWA 1ZCPA 4O7HA 3I69A 1A0FA 1F3AA 5JCUA 2MMOA 5KN1A 3ZFBA 2L5OA 2P31A 3EMXA 2YPMA 4XRAA 1B9XC 3LWAA 1TDIA 4J57E 2E7PA 1PRXA 5INYA 5F07A 3HZ8A 3FMWA 2FD3A 4N11A 4JBBA 3FHKA 4PQIA 1G0TA 2Z9SA 1OC9B 2FA4A 2DBCA 3GSTA 1TJDA 4ECJA 1EZKA 3NIVA 4ECIA 3UBKA 2MZCA 1V58A 4ECBA 3QCPA 4L0UA 1SL0B 1R5AA 2GT6A 2PBJA 5JCWA 4PNGA 2WB9A 1MD3A 4ICYA 3HA9A 2FWHA 2CQ9A 2H6XA 1YKCA 3UAPA 1LBKA 1XFLA 3CSJA 3GFKA 6GSWA 2A2SA 3ERGA 4L5OA 3IBHA 4I6XA 3GIXA 1GSYA 4IKHA 3UARA 4JE1A 2F8AA 5HQPA 1J9BA 2BTOT 1PQNA 4XS4A 5CAXA 3HYPA 1GSFA 2PN8A 2IFQA 3ZREA 1J0FA 4DVCA 1EP8A 2ZNMA 3IAM2 4MF6A 1MD4A 3QFAC 2CA8A 1TTZA 1S3AA 3M3MA 2WULA 4PQHA 3RHBA 5IPGA 1GH2A 5HR1A 3UOMA 3VPQA 5JWRB 2KP2A 3GTUA 4AGSA 1XWCA 2X4AA 4D73A 2N5FA 1NM3A 4IP1A 5D8IA 2H0IA 1GSSA 3A2WA 1NHOA 1S3CA 5CRHA 3MWHA 3M0FA 3ZZXA 3IPZA 1ILOA 3ZIVA 2VCVA 3HD5A 1ON4A 1TK0B 11GSA 3F63A 2WDUA 5ELGA 2V2GA 3IXRA 2A4VA 2VM2A 3C8EA 2O89A 3TJJA 5IOXA 2A2RA 2VCWA 4WR4A 4NAXA 4N30A 4KH7A 1G7OA 2B1LA 2H72A 5DCHA 4EVMA 3HJPA 4KGIA 1AC1A 3O76A 4WBJA 4MF5A 2DKIA 3KZQA 2PGTA 1FAAA 1TRSA 2RM5A 3DEXA 3F3QA 3WT2A 16GSA 1F2EA 1WIKA 3H8QA 2I3YA 2B5EA 4F2IA 3ME8A 3CTGA 3P7XA 4KSOA 4K6XA 2H1BA 4KDXA 4CDOA 2B5XA 4KF9A 5HR3A 5LD0A 1PL1A 1JZWA 3LYKA 3F4TA 4FIWA 4WF4A 2DC5A 2VUPA 3TKQA 1K0MA 4KCAA 4ZBBA 1T1VA 1PX6A 2ON7A 1J08A 2H01A 1ZZYA 2LV3A 1SK2A 3F0IA 2C0FA 4A5PA 5IMZA 5KOXA 3F8UA 2R6KA 5F8BA 4HJ2A 1T4YA 1M9BA 5ID2B 2N5BA 3LG6A 5D73A 4YQUA 3J7Yk 3GV1A 3DYRA 3QD9A 3KH7A 1GSUA 4N0ZA 3L9UA 1XVQA 2FY6A 2C0GA 3DRNA 4IQ1A 1S3DA 3VI5A 4X0XA 3D4MA 5J9CA 4I8BA 1AQWA 4PUAA 4AF2A 2IL3A 4EL1A 3FZAA 2GDRA 4DSSA 2EC4A 1GUMA 3L78A 3TKRA 4OWYA 1UC7A 4ZBAA 3QAWA 3GA4A 2H0GA 1U6TA 1OAZA 4RQRA 2RLIA 1FO5A 1XOBA 3VK9A 1YJ6A 2FWFA 2CZ3A 3HY2A 1X5CA 1Z6NA 4FQUA 4TXVA 2XPDA 4KB3A 5J3RA 4GLTA 1QUWA 5B8BA 3DD3A 2PVOC 4TRXA 3G7YA 4JEDA 1PD21 1GNWA 3C7MA 4ML1A 3EU3A 3ISOA 3IHQA 4V2MA 2OBIA 1XBSA 5DAKA 3KXOA 3BJ5A 1ERUA 5H5SA 2HRFA 4YKGA 3ZMLA 4BPYA 2C80A 4K7OA 3TRXA 1OE8A 1AAZA 4IS0A 1A2LA 4RQXA 2C3NA 3GHAA 3A3TA 4IW9A 1JZDA 1KBNA 4FH8A 1TXXA 1DUGA 4TR1A 3RPPA 5IQYA 3F6FA 1K3OA 1U87A 2R4VA 1I9DA 1TW9A 4IVFA 3ERWA 5G1KA 2E2GA 2H19A 4GCIA 2RM6A 2MMAA 3TRQA 2R0PA 3MNGA 2YWNA 2JL4A 1O6JA 19GSA 1QMVA 5G5EA 5HR2A 4HZ4A 2PU9C 2JSYA 2AV4A 2F51A 3BCIA 4OMVA 1X9WB 2ON5A 3TUEA 2YJ7A 2C1YA 2GT5A 3JCML 4PX1A 2B7KA 3M8NA 4BVXA 2DLXA 3PPUA 2I9HA 5JWOB 1V57A 2HSHA 2K6VA 1WJKA 3GMFA 2FA8A 2L4QA 3TGZA 4XS1A 1EOHA 3APQA 4V1Ap 3FR6A 3H1NA 2LNTA 2LRNA 3RPNA 3UVTA 5ECLB 2DMLA 1KTEA 2YP6A 2HLSA 4ISDA 5DQSA 1Z7PA 2L5LA 3PGTA 3O3TA 4L5LA 4OCFA 17GSA 4POLA 2O7KA 5DJMA 2H70A 5A4WA 4ID0A 3VFIA 3H93A 3KP8A 3ED3A 4MABA 4NWYA 2XPEA 2F8FA 2H8LA 2H1DA 5G2ZA 4BL7A 2HE3A 2IMKA 4H86A 4G0IA 2PERA 3TKSC 5C04A 1MDIA 4AJ8A 1TOFA 2R0GA 1Z7RA 3DMLA 1XWBA 2GVPA 1K0DA 1M2BA 3R3EA 4RI6A 2AHEA 1SKSB 1U88A 3HVVA 3IOSA 2C3TA 9GSSA 5F06A 1RW1A 2M72A 1PKWA 1H4OA 3GKXA 2HYXA 1SENA 4JR4A 3IK9A 4IJ3A 3UL3A 2VCTA 1TK8B 4MK3A 1EEMA 4KNDA 4HQSA 4POMA 1Y6EA 4TXOB 1WMJA 1ZYNA 1ERWA 5GSSA 3G7IA 2EIRA 2YJHA 3D0ZA 4V1Ag 2A4HA 2VCZA 1OKTA 2A2PA 6GSVA 5ECNB 2DJ3A 5EL8A 5GSTA 1TI1A 4J2FA 2C8UA 5EPFA 3IRAA 3KIJA 2RUEA 4AJ6A 4GQFA 2H71A 3GYKA 2IMIA 3H79A 2JU5A 1FW1A 2VD1A 4ZL7A 2H1GA 3IC4A 2LEGA 1WE0A 1DE1A 1QFNA 3N9JA 3FK8A 1RK4A 1XPVA 4TR3A 2OBKA 4YQVA 4KW6A 1X0RA 3HZ4A 1N8JA 1XWKA 3FR9A 1VF4A 4EDZA 4ACSA 3C1RA 1GLPA 2LRCA 5KN0A 2OE3A 4ZB9A 1THXA 5EVOA 3EVIA 4I5QA 3FY7A 4BVYA 5HFKA 5H5QA 2KUCA 5AIVA 3DVXA 5DVBA 1Z3EA 1YEXA 5KN3A 2OACA 2V32A 2O8VB 5DDLA 4PQ1A 4MJCA 4MCUA 4K2DA 2HNLA 4QL9A 5L71A 2HZEB 1ZOFA 4IP6A 1SU9A 1OVNA 3EURA 4HS1A 2HI7A 2GLRA 2AB6A 4JR6A 4G9HA 3GNJA 1EOGA 2YV7A 2FHEA 5IIZA 5ECPB 1FVKA 3ZMKA 3KTBA 3P8WA 4Q5RA 2LTKA 5J4UA 4O92A 4OO5A 1WOUA 5HFIA 13GSA 2GQMA 1GTUA 4MPFA 2H1AA 1W4VA 1SJ6A 2QSIA 1XCCA 3P2AA 1A8LA 3EYTA 3Q19A 3EMPA 4EF0A 5AISA 4LMVA 4O5RA 1NW2A 1DBYA 3NZNA 1SYRA 2CT6A 3PINA 1F9MA 3ZYWA 3E0UA 1M0UA 2I4AA 2NDOA 1YF0A 1Z5YE 1TU7A 4Q5QA 3ERFA 3KCMA 3ZLPA 4OCEA 4V2LA 1YDKA 3WD6A 3D21A 4WKWA 4EIQA 4LL1B 1Z6MA 2IWTA 1JZOA 2ALBA 2JACA 3F4SA 2IIYA 3IHGA 1R5PA 1EV9A 2CAIA 3L0HA 2IMDA 3HXSA 3TJGA 1W89A 4NV5A 1UN2A 3FZ5A 3GL5A 4HJMA 4MPGA 5ECIB 3LYPA 1K0NA 1QQ2A 3WYWA 5ECHB 1PGTA 4YQMA 3S9FA 3I9V2 3QMXA 1V9WA 3MYDA 1BJXA 3J7Yb 3LEFA 2KP1A 3MIXA 6GSSA 1PKZA 4WETA 3C1SA 1G6YA 3UBLA 1AQXA 1EV4A 1IYIA 5G1LA 14GSA 2DJ1A 1GWCA 3CSIA 2VL3A 6GSUA 3Q74A 2WZ9A 3TDGA 1XW5A 4NMUA 2LS5A 2L6CA 4XCSA 4K5SA 1ACVA 2LUSA 1ML6A 6GSTA 5J41A 1XIYA 1U3IA 4MA9A 3E3EA 4K1FA 2PUKC 1THOA 2CX3A 5BRTA 3A2XA 3FKFA 1XVWA 3UMAA 1M99A 4O32A 1XW9A 4KE3A 4IJIA 5AIXA 4ZXGA 1U3AA 2K8SA 3ZIJA 2XBIA 3US3A 2RUFA 2AJQB 2DJ0A 2TRCP 2CV4A 2MBTA 2QA2A 3VURA 3PR8A 4PUFC 5D96A 5DJLA 3GN3A 4YKFA 6GSYA 5A5KA 2WS2A 1OC9A 2X8GA 1WPIA 4MF7A 4ZB6A 4FYCA 5DALB 2H0HA 3C71A 4IN0A 2YV9A 2HT9A 3GKKA 3EWLA 1A2JA 1GRXA 3ZFLA 3UIWA 4G2EA 1GUKA 2I1UA 2HZEA 1XW6A 4KSMA 2M80A 5C00A 4XIHA 1F37A 4JRRA 3GKMA 4DEJA 2FUG2 4KCEA 4Z2UA 1B4PA 4QQ7A 2HRKA 2R37A 1SD9A 4ZIJA 2V1MA 4POKA 2V6OA 1ZYPA 3L9VA 3VWUA 1VRSD 2WFCA 2YZUA 4AJ7A 1VF2A 1V98A 2CX4A 1M2DA 5EY6A 1O81A 2C0EA 1T7PB 3F6DA 2YOIA 1GL8A 1G6WA 2X49A 1SKWB 3IDVA 2JZTA 2VD0A 2FNOA 2H66A 1YKAA 4GXZA 1A0RP 1O73A 4P3YB 1AQVA 1YQ1A 1WP0A 3QPMA 3KJYA 1XOAA 1G7EA 1TU8A 2DSAA 3KEBA 2VL2C 4PXOA 1MDJA 4MJAA 5CP1A 3CRTA 4IBPA 5G5FA 1K0OA 2VOCA 4J56E 3UJ1A 3IAS2 3TKPA 3VLNA 1JZRA 4K2XA 10GSA 2LNSA 4MJBA 1T8EB 1JHBA 1GSDA 3TJBA 2XBQA 1GULA 5DQYA 4G0LA 1LU4A 1VGLA 5ECSA 5J9BA 1A23A 3ME7A 2DIYA 2K9FA 3LXZA 2H30A 1QXHA 3DKSA 2YNXA 4HQZA 1FOVA 1X5EA 5J5NA 3APOA 1MDKA 1I5GA 3DWVA 1A24A 3AY8A 3TOUA 2WJUA 5D9VA 4USSA 1TRVA 1BX9A 4CY6A 2EIQA 2D2ZA 5IO0A 3FZ4A 2ZCTA 5G31A 2QC7A 1SL2B 4HU9A 3KP9A 2YANA 4YAVA 4TW5A 2HSYA 4MLYA 1CQGA 5D93A 2C0DA 4MMMA 5ENUA 4EO3A 2TRXA 2MYGA 5ECRB 2DJ2A 5B6MA 4XS4B 5IMDA 2IFQB 2YWIA 4CY8A 5IO2A 1K0BA 1K3YA 2VIMA 4IHUA 2GSSA 1K0AA 4PNFA 1T4ZA 4K7IA 5ECQB 1TP9A 2GTUA 3GTUB 3CBUA 5ID2A 2AAWA 1F6MC 1GP1A 1M7TA 4FO5A 1PMTA 2GQLA 2L59A 2QA1A 2TIRA 3KTLA 4QL7A 5CNWA 2VO4A 4ULXA 4ZL8A 1E2YA 3IR4A 4X4JA 4HUAA 4ZBDA 1FB0A 3HCZA 3VI7A 1B4QA 4OFNA 3R2QA 3TOTA 2FLSA 3GX0A 3WGEA 1Z9HA 2LKUA 2C3QA 1GUHA 4KUNA 3E9JB 5JWQB 5DALA 4Z2TA 4WXTA 3KMNA 2F9SA 5CRWA 3APSA 3D22A 4KX4A 4KDUA 5DBQA 3W8JA 1KNGA 4KA0A 4ZB8A 4DSRA 1FG4A 3DIEA 3FR3A 2VCQA 3HKRA 2HZFA 5IPHA 1OE7A 3G7JA 1YEPA 1XWGA 2VLUA 3IV4A 3VWWA 3KMOA 3ZVJA 4K0GA 1AIUA 2KOKA 4L8EA 2H75A 2MMZA 3O6TA 4KAEA 2VLTA 22GSA 1X5DA 2DMMA 4YH2A 2IN3A 4OFMA 3MAKA 1ZYEA 4F03A 2OE1A 2VL9A 4CHSA 5B6NA 2KLXA 4OD7A 1BQ7A 3K8NA 2MBSA 4DSQA 3BOAA 2PWJA 3WGXA 5GAPD 2GS3A 4ZL9A 3M1GA 3A2VA 2WGRA 4BWQA 1ZL9A 4EUYA 2X8HA 2GSTA 2P0GA 3LFLA 4N0VA 1OC3A 5ABRA 2B3SA 4MZCA 4GRFA 4OFTA 4HEA2 2R2JA 2BMXA 1ABAA 1O8WA 5D9TA 1O85A 1ZGNA 2NVLA 1BG5A 1GTBA 2C4JA 1DE2A 3D5JA 2XHFA 1EGOA 1JFUA 2DJJA 3GKNA 3UVHA 3Q6OA 2PVQA 3F9UA 1WWJA 2X8CA 4LMWA 1AUCA 3QAVA 1UA5A 1DSBA 4MH3A 1KEBA 4WR5A 2GZPA 2ZUPA 3HVSA 2GSRA 2LSTA 1XWAA 1CQHA 3GH6A 1SKRB 2K8VA 5IMAA 2JADA 1B8XA 1LJRA 4DSSB 4IQAA 1TI3A 3TKSE 5BMUA 4PGTA 4EXJA 2NPBA 4G0KA 4F0CA 1XXUA 2LQOA 3ZVJD 5B8AA 18GSA 3Q18A 4V2NA 2EIOA 5IM9A 1FOHA 4TR0A 5JCGA 5IMVA 2FWGA 2R3XA 3TKSA 3IK7A 2VM1A 3EPTA 4K0NA 3F4RA 2HXKA 2NBSA 4HDEA 3TJFA 2PPTA 3KD0A 4FYUA 3TJKA 2OE0A 3FZ9A 1V2AA 1HD2A 2H76A 20GSA 4O5QA 2GQKA 1QGVA 3ZRDA 5G30A 2HFDA 4MNNA 1K3LA 5DCGA 4EIPA 5CREA 3OR5A 5AGYA 1ERVA 5E4WA 1IYHA 4FYBA 4EKZA 2BJXA 5DAKB 4ML6A 5GZZB 5FHIA 1FB6A 4NHWA 1R4WA 4XRDA 4LLRA 2R0CA 1Y25A 4Q5FA 3TCOA 2CVDA 4LL4B 4TKYA 1SK0A 3FYGA 4E8HA 2UZ8A 4K7NA 5ECKB 2L4CA 5GAND 2CVKA 4NHZA 3GL3A 2OJLA 4TR1B 5ELAA 3BBYA 4PURA 4GQCA 1Q98A 1R7HA 2G2QA 3LXTA 1SYXA 5A4UA 1C72A 4GSTA 2I81A 1N2AA 3M9JA 4GSNA 3EE2A 2FWEA 5CRDA 4N10A 2YZHA 3BD2A 3IA1A 4NPBA 4WEYA 2H6YA 2JZSA 4F0BA 3TRPA 1UVZA 5CO3A 4TN8A 3QDNA 4EE0A 4TXOA 5H5RA 4BWSA 5IMFA 3CMIA 4IGJA 2VLVA 1WRYA 4MJEA 2KHPA 1TK5B 3GSSA 3KGKA 1TKDB 1B9YC 3FW2A 2K18A 5FT3A 1GLQA 1OYJA 3LGCA 5IMCA 4BVXB 1XZOA 1USBA 2FGXA 5A4VA 3LQ7A 2X64A 3FEUA 2F3MA 2MMNA 1ZMAA 2GZYA 1NSWA 2REMA 1FHEA 4TVEA 5KN2A 2PMTA 1MTCA 3RBTA 3A5IA 4MH2A 3N5OA 2AUVA 2LRTA 4TOPA 3VPTA 1A2MA 3RHCA 3U5RE 2L6DA 4I97A 1SJIA 3GURA 3LW9A 3KM6A 2GZZA 1PX7A 3SWLA 2IMFA 3M9KA 3D4TA 2ES7A 3HJMA 4MZBA 3VWVA 4BL7B 2H74A 4Z7XA 2NTOA 4NXIA 2LJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO4 A;  1HNC A;  1GTA A;  1YZX A;  4JZQ A;  3G9B A;  1AXD A;  2VCX A;  2FCH A;  4X1U A;  3NOF A;  5KEJ A;  3EIN A;  2DJK A;  4HU7 A;  4GTU A;  1BAY A;  1SJZ A;  1PL2 A;  2RII A;  4HOJ A;  4F82 A;  4BA7 A;  2VAF A;  2GSQ A;  5AN1 A;  2N5A A;  4MP4 A;  1PSQ A;  4ILF A;  5CRG A;  3L9S A;  1X9M B;  4F9Z A;  2J23 A;  4K8M A;  2CZ2 A;  2H6Z A;  4WBR D;  1GSQ A;  1Q4J A;  1ERT A;  1GNE A;  2QKE A;  5IOW A;  2M46 A;  2WCI A;  5LCZ A;  2CVB A;  3P90 A;  3WT1 A;  5D9W A;  3VWX A;  2YCD A;  1YY7 A;  2O87 A;  4EC0 A;  4KDY A;  1EGR A;  5B7C A;  3RAZ A;  1OC8 A;  2XC2 A;  1ZYQ B;  3GH9 A;  3A5W A;  3SBC A;  3EU4 A;  3DGQ A;  1JLW A;  2AYT A;  1EP7 A;  4L0W A;  1NHY A;  2OA7 A;  3BCK A;  1HNA A;  1QK8 A;  2LQQ A;  4TR4 A;  4EDY A;  4K9Z A;  4G19 A;  2YN1 A;  3HHV A;  4GWR A;  1X9S B;  2YWM A;  8GSS A;  4RI7 A;  5CYY A;  2DIZ A;  4HI7 A;  3TB2 A;  2JZR A;  2O85 A;  2P5Q A;  3HDC A;  3CTF A;  1HQO A;  4POB A;  5D9X A;  12GS A;  1URM A;  2OAD A;  3W8S A;  3PH9 A;  4I2T A;  1V40 A;  5HFG A;  4IEL A;  1MEK A;  2IPA A;  1HNB A;  3U6V A;  6GSX A;  2B7J A;  2IME A;  1A8Y A;  3QOU A;  5FWG A;  1OKD A;  4GSS A;  2V6K A;  3GX8 A;  5E59 A;  1GSE A;  3ZL5 A;  2X99 A;  4G10 A;  1T3B A;  1M2A A;  3ZIT A;  1RQM A;  1T00 A;  4ZIL A;  1BED A;  2B5Y A;  3HJO A;  3GRX A;  3GUS A;  4NV2 A;  3WGD A;  2L57 A;  1R26 A;  3CRU A;  1E6B A;  2CAQ A;  1EEJ A;  3IE3 A;  2LJA A;  4HZ2 A;  4XS6 A;  3QFB C;  2B6M A;  1VF1 A;  2V41 A;  3C73 A;  5F0G A;  1B48 A;  2GGT A;  3LOR A;  5COH A;  1SD8 A;  3I43 A;  1F3B A;  4D73 B;  1EWX A;  1H75 A;  1PN9 A;  3F3R A;  3MDK A;  3MSZ A;  3W6G A;  4YAP A;  3LSZ A;  1M9A A;  1TRW A;  7GSS A;  4Q5N A;  1FVJ A;  2QGV A;  5F05 A;  2P5R A;  4XHM A;  1O7U A;  3V1W A;  4X43 A;  2H73 A;  3L4N A;  5HR0 A;  5ECM B;  2R5G A;  2WRT A;  3CXG A;  3LJR A;  5ECO B;  3QAG A;  1SL1 B;  4I2U A;  4XTS A;  2E0Q A;  1JLV A;  3CSH A;  4CW9 A;  3ZTL A;  3I6A A;  2IJY A;  3EC3 A;  4LA1 A;  3HVX A;  4ECC A;  3DXB A;  3RDW A;  1TRU A;  1PA3 A;  2HRN A;  4E8E A;  2VL2 A;  1AW9 A;  3D6I A;  1O8X A;  2B1K A;  2LJR A;  3CYN A;  4WF5 A;  4RUV A;  2J9H A;  1BYE A;  1GTI A;  2E2M A;  3UEM A;  1YF1 A;  2JSZ A;  4MDC A;  1VF3 A;  2OKA A;  3FRC A;  4GF0 A;  3DVW A;  1HYU A;  4JU5 A;  2G0F A;  3KH9 A;  3QR6 A;  3H4K A;  5LNK e;  2YWO A;  1ST9 A;  1K0C A;  1SK1 A;  4MZW A;  1ZCP A;  4O7H A;  3I69 A;  1A0F A;  1F3A A;  5JCU A;  2MMO A;  5KN1 A;  3ZFB A;  2L5O A;  2P31 A;  3EMX A;  2YPM A;  4XRA A;  1B9X C;  3LWA A;  1TDI A;  4J57 E;  2E7P A;  1PRX A;  5INY A;  5F07 A;  3HZ8 A;  2FD3 A;  4N11 A;  4JBB A;  3FHK A;  4PQI A;  1G0T A;  2Z9S A;  1OC9 B;  2FA4 A;  2DBC A;  3GST A;  1TJD A;  4ECJ A;  1EZK A;  3NIV A;  4ECI A;  3UBK A;  2MZC A;  1V58 A;  4ECB A;  3QCP A;  4L0U A;  1SL0 B;  1R5A A;  2GT6 A;  2PBJ A;  5JCW A;  4PNG A;  2WB9 A;  1MD3 A;  3HA9 A;  2FWH A;  2CQ9 A;  2H6X A;  1YKC A;  3UAP A;  1LBK A;  1XFL A;  3CSJ A;  3GFK A;  6GSW A;  2A2S A;  3ERG A;  4L5O A;  3IBH A;  4I6X A;  3GIX A;  1GSY A;  4IKH A;  3UAR A;  4JE1 A;  2F8A A;  5HQP A;  1J9B A;  2BTO T;  1PQN A;  4XS4 A;  5CAX A;  3HYP A;  1GSF A;  2PN8 A;  2IFQ A;  3ZRE A;  1J0F A;  4DVC A;  1EP8 A;  2ZNM A;  3IAM 2;  4MF6 A;  1MD4 A;  3QFA C;  2CA8 A;  1TTZ A;  1S3A A;  3M3M A;  2WUL A;  4PQH A;  3RHB A;  5IPG A;  1GH2 A;  5HR1 A;  3UOM A;  3VPQ A;  5JWR B;  2KP2 A;  3GTU A;  4AGS A;  1XWC A;  4D73 A;  2N5F A;  1NM3 A;  4IP1 A;  5D8I A;  2H0I A;  1GSS A;  3A2W A;  1NHO A;  1S3C A;  5CRH A;  3MWH A;  3M0F A;  3ZZX A;  3IPZ A;  1ILO A;  3ZIV A;  2VCV A;  3HD5 A;  1ON4 A;  1TK0 B;  11GS A;  3F63 A;  2WDU A;  5ELG A;  2V2G A;  3IXR A;  2A4V A;  2VM2 A;  3C8E A;  2O89 A;  3TJJ A;  5IOX A;  2A2R A;  2VCW A;  4WR4 A;  4NAX A;  4N30 A;  4KH7 A;  1G7O A;  2B1L A;  2H72 A;  5DCH A;  4EVM A;  3HJP A;  4KGI A;  1AC1 A;  3O76 A;  4WBJ A;  4MF5 A;  3KZQ A;  2PGT A;  1FAA A;  1TRS A;  2RM5 A;  3DEX A;  3F3Q A;  3WT2 A;  16GS A;  1F2E A;  1WIK A;  3H8Q A;  2I3Y A;  2B5E A;  4F2I A;  3ME8 A;  3CTG A;  3P7X A;  4KSO A;  4K6X A;  2H1B A;  4KDX A;  4CDO A;  2B5X A;  5HR3 A;  5LD0 A;  1PL1 A;  1JZW A;  3LYK A;  3F4T A;  4FIW A;  4WF4 A;  2DC5 A;  2VUP A;  3TKQ A;  1K0M A;  4KCA A;  4ZBB A;  1T1V A;  1PX6 A;  2ON7 A;  1J08 A;  2H01 A;  1ZZY A;  2LV3 A;  1SK2 A;  3F0I A;  2C0F A;  5IMZ A;  3F8U A;  2R6K A;  5F8B A;  4HJ2 A;  1T4Y A;  1M9B A;  5ID2 B;  2N5B A;  3LG6 A;  5D73 A;  4YQU A;  3J7Y k;  3GV1 A;  3DYR A;  3QD9 A;  3KH7 A;  1GSU A;  4N0Z A;  3L9U A;  1XVQ A;  2FY6 A;  2C0G A;  3DRN A;  4IQ1 A;  1S3D A;  3VI5 A;  4X0X A;  3D4M A;  5J9C A;  4I8B A;  1AQW A;  4PUA A;  4AF2 A;  2IL3 A;  4EL1 A;  3FZA A;  2GDR A;  4DSS A;  2EC4 A;  1GUM A;  3L78 A;  3TKR A;  4OWY A;  1UC7 A;  4ZBA A;  3QAW A;  3GA4 A;  2H0G A;  1U6T A;  1OAZ A;  4RQR A;  2RLI A;  1FO5 A;  1XOB A;  3VK9 A;  1YJ6 A;  2FWF A;  2CZ3 A;  3HY2 A;  1X5C A;  1Z6N A;  4TXV A;  2XPD A;  4KB3 A;  5J3R A;  4GLT A;  1QUW A;  5B8B A;  3DD3 A;  2PVO C;  4TRX A;  3G7Y A;  4JED A;  1PD2 1;  1GNW A;  3C7M A;  4ML1 A;  3EU3 A;  3ISO A;  3IHQ A;  4V2M A;  2OBI A;  1XBS A;  5DAK A;  3KXO A;  3BJ5 A;  1ERU A;  5H5S A;  2HRF A;  3ZML A;  4BPY A;  2C80 A;  4K7O A;  3TRX A;  1OE8 A;  1AAZ A;  4IS0 A;  1A2L A;  4RQX A;  2C3N A;  3GHA A;  3A3T A;  4IW9 A;  1JZD A;  1KBN A;  4FH8 A;  1TXX A;  1DUG A;  4TR1 A;  3RPP A;  5IQY A;  3F6F A;  1K3O A;  1U87 A;  2R4V A;  1I9D A;  1TW9 A;  4IVF A;  3ERW A;  5G1K A;  2E2G A;  2H19 A;  4GCI A;  2RM6 A;  2MMA A;  3TRQ A;  3MNG A;  2YWN A;  2JL4 A;  1O6J A;  19GS A;  1QMV A;  5G5E A;  5HR2 A;  4HZ4 A;  2PU9 C;  2JSY A;  2AV4 A;  2F51 A;  3BCI A;  4OMV A;  1X9W B;  2ON5 A;  3TUE A;  2YJ7 A;  2C1Y A;  2GT5 A;  3JCM L;  4PX1 A;  2B7K A;  3M8N A;  4BVX A;  2DLX A;  2I9H A;  5JWO B;  1V57 A;  2HSH A;  2K6V A;  1WJK A;  3GMF A;  2FA8 A;  2L4Q A;  3TGZ A;  4XS1 A;  1EOH A;  3APQ A;  4V1A p;  3FR6 A;  3H1N A;  2LNT A;  2LRN A;  3RPN A;  3UVT A;  5ECL B;  2DML A;  1KTE A;  2YP6 A;  2HLS A;  4ISD A;  5DQS A;  1Z7P A;  2L5L A;  3PGT A;  3O3T A;  4L5L A;  4OCF A;  17GS A;  4POL A;  2O7K A;  5DJM A;  2H70 A;  5A4W A;  4ID0 A;  3VFI A;  3H93 A;  3KP8 A;  3ED3 A;  4MAB A;  4NWY A;  2XPE A;  2F8F A;  2H8L A;  2H1D A;  5G2Z A;  4BL7 A;  2HE3 A;  2IMK A;  4H86 A;  2PER A;  3TKS C;  5C04 A;  1MDI A;  4AJ8 A;  1TOF A;  1Z7R A;  3DML A;  1XWB A;  2GVP A;  1K0D A;  1M2B A;  4RI6 A;  2AHE A;  1SKS B;  1U88 A;  3HVV A;  3IOS A;  2C3T A;  9GSS A;  5F06 A;  1RW1 A;  2M72 A;  1PKW A;  1H4O A;  3GKX A;  2HYX A;  1SEN A;  4JR4 A;  3IK9 A;  4IJ3 A;  3UL3 A;  2VCT A;  1TK8 B;  4MK3 A;  1EEM A;  4KND A;  4HQS A;  4POM A;  1Y6E A;  4TXO B;  1WMJ A;  5GSS A;  1ERW A;  3G7I A;  2EIR A;  2YJH A;  3D0Z A;  4V1A g;  2VCZ A;  1OKT A;  6GSV A;  5ECN B;  2DJ3 A;  5EL8 A;  5GST A;  1TI1 A;  4J2F A;  2C8U A;  5EPF A;  3IRA A;  3KIJ A;  2RUE A;  4AJ6 A;  4GQF A;  2H71 A;  3GYK A;  2IMI A;  3H79 A;  2JU5 A;  1FW1 A;  2VD1 A;  4ZL7 A;  2H1G A;  3IC4 A;  2LEG A;  1WE0 A;  1DE1 A;  1QFN A;  3N9J A;  3FK8 A;  1RK4 A;  1XPV A;  4TR3 A;  2OBK A;  4YQV A;  4KW6 A;  1X0R A;  3HZ4 A;  1N8J A;  1XWK A;  3FR9 A;  1VF4 A;  4EDZ A;  4ACS A;  3C1R A;  1GLP A;  2LRC A;  5KN0 A;  2OE3 A;  4ZB9 A;  1THX A;  5EVO A;  3EVI A;  4I5Q A;  3FY7 A;  4BVY A;  5HFK A;  5H5Q A;  2KUC A;  5AIV A;  3DVX A;  5DVB A;  1Z3E A;  1YEX A;  5KN3 A;  2OAC A;  2V32 A;  2O8V B;  5DDL A;  4PQ1 A;  4MJC A;  4MCU A;  4K2D A;  2HNL A;  4QL9 A;  5L71 A;  2HZE B;  1ZOF A;  4IP6 A;  1SU9 A;  1OVN A;  3EUR A;  4HS1 A;  2HI7 A;  2GLR A;  2AB6 A;  4JR6 A;  4G9H A;  3GNJ A;  1EOG A;  2YV7 A;  2FHE A;  5IIZ A;  5ECP B;  1FVK A;  3ZMK A;  3KTB A;  3P8W A;  4Q5R A;  2LTK A;  5J4U A;  4O92 A;  4OO5 A;  1WOU A;  5HFI A;  13GS A;  2GQM A;  1GTU A;  4MPF A;  2H1A A;  1W4V A;  1SJ6 A;  2QSI A;  1XCC A;  3P2A A;  1A8L A;  3EYT A;  3Q19 A;  3EMP A;  4EF0 A;  5AIS A;  4LMV A;  4O5R A;  1NW2 A;  1DBY A;  3NZN A;  1SYR A;  2CT6 A;  3PIN A;  1F9M A;  3ZYW A;  3E0U A;  1M0U A;  2I4A A;  2NDO A;  1YF0 A;  1Z5Y E;  1TU7 A;  4Q5Q A;  3ERF A;  3KCM A;  3ZLP A;  4OCE A;  4V2L A;  1YDK A;  3WD6 A;  3D21 A;  4WKW A;  4LL1 B;  1Z6M A;  2IWT A;  1JZO A;  2ALB A;  2JAC A;  3F4S A;  2IIY A;  1R5P A;  1EV9 A;  2CAI A;  3L0H A;  2IMD A;  3HXS A;  3TJG A;  1W89 A;  4NV5 A;  1UN2 A;  3FZ5 A;  3GL5 A;  4HJM A;  4MPG A;  5ECI B;  3LYP A;  1K0N A;  1QQ2 A;  3WYW A;  5ECH B;  1PGT A;  4YQM A;  3S9F A;  3I9V 2;  3QMX A;  1V9W A;  1BJX A;  3J7Y b;  3LEF A;  2KP1 A;  6GSS A;  1PKZ A;  4WET A;  3C1S A;  1G6Y A;  3UBL A;  1AQX A;  1EV4 A;  1IYI A;  5G1L A;  14GS A;  2DJ1 A;  1GWC A;  3CSI A;  2VL3 A;  6GSU A;  3Q74 A;  2WZ9 A;  3TDG A;  1XW5 A;  4NMU A;  2LS5 A;  2L6C A;  4XCS A;  1ACV A;  2LUS A;  1ML6 A;  6GST A;  5J41 A;  1XIY A;  1U3I A;  4MA9 A;  3E3E A;  4K1F A;  2PUK C;  1THO A;  2CX3 A;  3A2X A;  3FKF A;  1XVW A;  3UMA A;  1M99 A;  4O32 A;  1XW9 A;  4KE3 A;  4IJI A;  5AIX A;  4ZXG A;  1U3A A;  2K8S A;  3ZIJ A;  2XBI A;  3US3 A;  2RUF A;  2AJQ B;  2DJ0 A;  2TRC P;  2CV4 A;  2MBT A;  3VUR A;  3PR8 A;  4PUF C;  5D96 A;  5DJL A;  3GN3 A;  6GSY A;  5A5K A;  2WS2 A;  1OC9 A;  2X8G A;  1WPI A;  4MF7 A;  4ZB6 A;  4FYC A;  5DAL B;  2H0H A;  3C71 A;  4IN0 A;  2YV9 A;  2HT9 A;  3GKK A;  3EWL A;  1A2J A;  1GRX A;  3ZFL A;  3UIW A;  4G2E A;  1GUK A;  2I1U A;  2HZE A;  1XW6 A;  4KSM A;  2M80 A;  5C00 A;  4XIH A;  1F37 A;  4JRR A;  3GKM A;  4DEJ A;  2FUG 2;  4KCE A;  1B4P A;  4QQ7 A;  2R37 A;  1SD9 A;  4ZIJ A;  2V1M A;  4POK A;  2V6O A;  3L9V A;  3VWU A;  1VRS D;  2WFC A;  2YZU A;  4AJ7 A;  1VF2 A;  1V98 A;  2CX4 A;  1M2D A;  5EY6 A;  1O81 A;  2C0E A;  1T7P B;  3F6D A;  2YOI A;  1GL8 A;  1G6W A;  1SKW B;  3IDV A;  2JZT A;  2VD0 A;  2FNO A;  2H66 A;  1YKA A;  4GXZ A;  1A0R P;  1O73 A;  4P3Y B;  1AQV A;  1YQ1 A;  1WP0 A;  3QPM A;  3KJY A;  1XOA A;  1G7E A;  1TU8 A;  2DSA A;  3KEB A;  2VL2 C;  4PXO A;  1MDJ A;  4MJA A;  5CP1 A;  3CRT A;  4IBP A;  5G5F A;  1K0O A;  2VOC A;  4J56 E;  3UJ1 A;  3IAS 2;  3TKP A;  3VLN A;  1JZR A;  10GS A;  2LNS A;  4MJB A;  1T8E B;  1JHB A;  1GSD A;  3TJB A;  2XBQ A;  1GUL A;  5DQY A;  1LU4 A;  1VGL A;  5ECS A;  5J9B A;  1A23 A;  3ME7 A;  2DIY A;  2K9F A;  3LXZ A;  2H30 A;  1QXH A;  3DKS A;  2YNX A;  4HQZ A;  1FOV A;  1X5E A;  5J5N A;  3APO A;  1MDK A;  1I5G A;  3DWV A;  1A24 A;  3AY8 A;  3TOU A;  2WJU A;  5D9V A;  1TRV A;  1BX9 A;  2EIQ A;  2D2Z A;  5IO0 A;  3FZ4 A;  2ZCT A;  5G31 A;  2QC7 A;  1SL2 B;  4HU9 A;  3KP9 A;  2YAN A;  4YAV A;  4TW5 A;  2HSY A;  4MLY A;  1CQG A;  5D93 A;  2C0D A;  4MMM A;  5ENU A;  4EO3 A;  2TRX A;  2MYG A;  5ECR B;  2DJ2 A;  5B6M A;  4XS4 B;  5IMD A;  2IFQ B;  2YWI A;  5IO2 A;  1K0B A;  1K3Y A;  2VIM A;  4IHU A;  2GSS A;  1K0A A;  4PNF A;  1T4Z A;  4K7I A;  5ECQ B;  1TP9 A;  2GTU A;  3GTU B;  3CBU A;  5ID2 A;  2AAW A;  1F6M C;  1GP1 A;  1M7T A;  4FO5 A;  1PMT A;  2GQL A;  2L59 A;  2TIR A;  3KTL A;  4QL7 A;  5CNW A;  2VO4 A;  4ULX A;  4ZL8 A;  1E2Y A;  3IR4 A;  4HUA A;  4ZBD A;  1FB0 A;  3HCZ A;  3VI7 A;  1B4Q A;  4OFN A;  3R2Q A;  3TOT A;  2FLS A;  3GX0 A;  3WGE A;  1Z9H A;  2LKU A;  2C3Q A;  1GUH A;  4KUN A;  3E9J B;  5JWQ B;  5DAL A;  4WXT A;  3KMN A;  2F9S A;  5CRW A;  3APS A;  3D22 A;  4KX4 A;  4KDU A;  5DBQ A;  3W8J A;  1KNG A;  4KA0 A;  4ZB8 A;  4DSR A;  1FG4 A;  3DIE A;  3FR3 A;  2VCQ A;  3HKR A;  2HZF A;  5IPH A;  1OE7 A;  3G7J A;  1YEP A;  1XWG A;  2VLU A;  3IV4 A;  3VWW A;  3KMO A;  3ZVJ A;  4K0G A;  1AIU A;  2KOK A;  4L8E A;  2H75 A;  2MMZ A;  3O6T A;  4KAE A;  2VLT A;  22GS A;  1X5D A;  2DMM A;  4YH2 A;  2IN3 A;  4OFM A;  3MAK A;  1ZYE A;  4F03 A;  2OE1 A;  2VL9 A;  4CHS A;  5B6N A;  2KLX A;  4OD7 A;  1BQ7 A;  3K8N A;  2MBS A;  4DSQ A;  3BOA A;  2PWJ A;  3WGX A;  5GAP D;  2GS3 A;  4ZL9 A;  3M1G A;  3A2V A;  2WGR A;  4BWQ A;  1ZL9 A;  4EUY A;  2X8H A;  2GST A;  2P0G A;  3LFL A;  4N0V A;  1OC3 A;  5ABR A;  2B3S A;  4MZC A;  4GRF A;  4OFT A;  4HEA 2;  2R2J A;  2BMX A;  1ABA A;  1O8W A;  5D9T A;  1O85 A;  1ZGN A;  2NVL A;  1BG5 A;  1GTB A;  2C4J A;  1DE2 A;  3D5J A;  2XHF A;  1EGO A;  1JFU A;  2DJJ A;  3GKN A;  3UVH A;  3Q6O A;  2PVQ A;  3F9U A;  1WWJ A;  2X8C A;  4LMW A;  1AUC A;  3QAV A;  1UA5 A;  1DSB A;  4MH3 A;  1KEB A;  4WR5 A;  2GZP A;  2ZUP A;  3HVS A;  2GSR A;  2LST A;  1XWA A;  1CQH A;  3GH6 A;  1SKR B;  2K8V A;  5IMA A;  2JAD A;  1B8X A;  1LJR A;  4DSS B;  4IQA A;  1TI3 A;  3TKS E;  4PGT A;  4EXJ A;  2NPB A;  4F0C A;  1XXU A;  2LQO A;  3ZVJ D;  5B8A A;  18GS A;  3Q18 A;  4V2N A;  2EIO A;  5IM9 A;  4TR0 A;  5JCG A;  5IMV A;  2FWG A;  2R3X A;  3TKS A;  3IK7 A;  2VM1 A;  4K0N A;  3F4R A;  2HXK A;  2NBS A;  4HDE A;  3TJF A;  2PPT A;  3KD0 A;  4FYU A;  3TJK A;  2OE0 A;  3FZ9 A;  1V2A A;  1HD2 A;  2H76 A;  20GS A;  2GQK A;  1QGV A;  3ZRD A;  5G30 A;  2HFD A;  1K3L A;  5DCG A;  5CRE A;  3OR5 A;  5AGY A;  1ERV A;  5E4W A;  1IYH A;  4FYB A;  4EKZ A;  2BJX A;  5DAK B;  4ML6 A;  5GZZ B;  5FHI A;  1FB6 A;  4NHW A;  1R4W A;  4XRD A;  4LLR A;  1Y25 A;  4Q5F A;  3TCO A;  2CVD A;  4LL4 B;  4TKY A;  1SK0 A;  3FYG A;  4E8H A;  4K7N A;  5ECK B;  2L4C A;  5GAN D;  2CVK A;  4NHZ A;  3GL3 A;  2OJL A;  4TR1 B;  5ELA A;  3BBY A;  4PUR A;  4GQC A;  1Q98 A;  1R7H A;  2G2Q A;  3LXT A;  1SYX A;  5A4U A;  1C72 A;  4GST A;  2I81 A;  1N2A A;  3M9J A;  4GSN A;  3EE2 A;  2FWE A;  5CRD A;  4N10 A;  2YZH A;  3BD2 A;  3IA1 A;  4NPB A;  4WEY A;  2H6Y A;  2JZS A;  4F0B A;  3TRP A;  1UVZ A;  5CO3 A;  4TN8 A;  3QDN A;  4EE0 A;  4TXO A;  5H5R A;  4BWS A;  5IMF A;  3CMI A;  4IGJ A;  2VLV A;  1WRY A;  4MJE A;  2KHP A;  1TK5 B;  3GSS A;  3KGK A;  1TKD B;  1B9Y C;  3FW2 A;  2K18 A;  5FT3 A;  1GLQ A;  1OYJ A;  3LGC A;  5IMC A;  1XZO A;  1USB A;  2FGX A;  5A4V A;  3LQ7 A;  2X64 A;  3FEU A;  2F3M A;  2MMN A;  1ZMA A;  2GZY A;  1NSW A;  2REM A;  1FHE A;  4TVE A;  5KN2 A;  2PMT A;  1MTC A;  3RBT A;  4MH2 A;  3N5O A;  2AUV A;  2LRT A;  4TOP A;  3VPT A;  1A2M A;  3RHC A;  3U5R E;  2L6D A;  4I97 A;  1SJI A;  3GUR A;  3KM6 A;  2GZZ A;  1PX7 A;  3SWL A;  2IMF A;  3M9K A;  3D4T A;  2ES7 A;  3HJM A;  4MZB A;  3VWV A;  2H74 A;  4Z7X A;  2NTO A;  4NXI A;  2LJK A; 
#chains in the Genus database with same CATH topology
 4OO4 A;  1HNC A;  1GTA A;  1YZX A;  4JZQ A;  3G9B A;  1AXD A;  2VCX A;  2FCH A;  4X1U A;  1M3I A;  3NOF A;  5KEJ A;  3EIN A;  2DJK A;  2HRA A;  4HU7 A;  4GTU A;  1PN0 A;  1BAY A;  4Z2R A;  1SJZ A;  1PL2 A;  2RII A;  4HOJ A;  4F82 A;  4BA7 A;  2VAF A;  2GSQ A;  5AN1 A;  2N5A A;  4MP4 A;  1PSQ A;  4ILF A;  5CRG A;  3L9S A;  1X9M B;  4F9Z A;  2J23 A;  4K8M A;  2CZ2 A;  2H6Z A;  4WBR D;  1GSQ A;  1Q4J A;  1ERT A;  1GNE A;  2QKE A;  5IOW A;  2M46 A;  2WCI A;  5LCZ A;  2CVB A;  3P90 A;  3WT1 A;  5D9W A;  3VWX A;  2YCD A;  1YY7 A;  2O87 A;  4EC0 A;  4KDY A;  1EGR A;  5B7C A;  3RAZ A;  1OC8 A;  2XC2 A;  1ZYQ B;  3GH9 A;  5KOW A;  3A5W A;  3SBC A;  3EU4 A;  3DGQ A;  1JLW A;  2AYT A;  1EP7 A;  4L0W A;  1NHY A;  2OA7 A;  3BCK A;  1HNA A;  1QK8 A;  2LQQ A;  4TR4 A;  4EDY A;  4K9Z A;  4G19 A;  2YN1 A;  3HHV A;  4GWR A;  1X9S B;  2YWM A;  8GSS A;  4RI7 A;  5CYY A;  4PTS A;  2DIZ A;  4HI7 A;  3TB2 A;  2JZR A;  2O85 A;  2P5Q A;  3HDC A;  3CTF A;  1HQO A;  4POB A;  5D9X A;  12GS A;  1URM A;  2OAD A;  3W8S A;  3PH9 A;  4I2T A;  1V40 A;  5HFG A;  4IEL A;  1MEK A;  4BVY B;  2IPA A;  1HNB A;  3U6V A;  6GSX A;  2B7J A;  2IME A;  1A8Y A;  3QOU A;  5FWG A;  1OKD A;  4GSS A;  2V6K A;  3GX8 A;  5E59 A;  1GSE A;  3ZL5 A;  2X99 A;  4G10 A;  1T3B A;  1M2A A;  3ZIT A;  1RQM A;  1T00 A;  4ZIL A;  4O5U A;  1BED A;  2B5Y A;  3HJO A;  3GRX A;  3GUS A;  4NV2 A;  3WGD A;  2L57 A;  1R26 A;  3CRU A;  1E6B A;  2CAQ A;  1EEJ A;  3IE3 A;  2HSM A;  2LJA A;  3CQF A;  4HZ2 A;  4XS6 A;  3QFB C;  2B6M A;  1VF1 A;  2V41 A;  3C73 A;  5F0G A;  1B48 A;  2GGT A;  3LOR A;  5COH A;  1SD8 A;  3I43 A;  1F3B A;  4D73 B;  1EWX A;  1H75 A;  1PN9 A;  3F3R A;  3MDK A;  3MSZ A;  3W6G A;  4YAP A;  3LSZ A;  1M9A A;  1TRW A;  7GSS A;  4Q5N A;  1FVJ A;  2QGV A;  5F05 A;  2P5R A;  4XHM A;  1O7U A;  3V1W A;  4X43 A;  2H73 A;  2DKH A;  3L4N A;  5HR0 A;  5ECM B;  2R5G A;  2WRT A;  3CXG A;  3LJR A;  5ECO B;  3QAG A;  1SL1 B;  4I2U A;  4XTS A;  2E0Q A;  1JLV A;  3CSH A;  4CW9 A;  3ZTL A;  3I6A A;  2IJY A;  3EC3 A;  4LA1 A;  3HVX A;  4ECC A;  3DXB A;  3RDW A;  4K5R A;  1TRU A;  1PA3 A;  2HRN A;  4E8E A;  2VL2 A;  1AW9 A;  3D6I A;  1O8X A;  2B1K A;  2LJR A;  3CYN A;  4WF5 A;  4RUV A;  2J9H A;  1BYE A;  1GTI A;  2E2M A;  3UEM A;  1YF1 A;  2JSZ A;  4MDC A;  1VF3 A;  2OKA A;  3FRC A;  4GF0 A;  3DVW A;  1HYU A;  4JU5 A;  2G0F A;  3KH9 A;  3QR6 A;  3H4K A;  5LNK e;  2YWO A;  1ST9 A;  1K0C A;  1SK1 A;  3IC8 A;  4MZW A;  1ZCP A;  4O7H A;  3I69 A;  1A0F A;  1F3A A;  5JCU A;  2MMO A;  5KN1 A;  3ZFB A;  2L5O A;  2P31 A;  3EMX A;  2YPM A;  4XRA A;  1B9X C;  3LWA A;  1TDI A;  4J57 E;  2E7P A;  1PRX A;  5INY A;  5F07 A;  3HZ8 A;  3FMW A;  2FD3 A;  4N11 A;  4JBB A;  3FHK A;  4PQI A;  1G0T A;  2Z9S A;  1OC9 B;  2FA4 A;  2DBC A;  3GST A;  1TJD A;  4ECJ A;  1EZK A;  3NIV A;  4ECI A;  3UBK A;  2MZC A;  1V58 A;  4ECB A;  3QCP A;  4L0U A;  1SL0 B;  1R5A A;  2GT6 A;  2PBJ A;  5JCW A;  4PNG A;  2WB9 A;  1MD3 A;  4ICY A;  3HA9 A;  2FWH A;  2CQ9 A;  2H6X A;  1YKC A;  3UAP A;  1LBK A;  1XFL A;  3CSJ A;  3GFK A;  6GSW A;  2A2S A;  3ERG A;  4L5O A;  3IBH A;  4I6X A;  3GIX A;  1GSY A;  4IKH A;  3UAR A;  4JE1 A;  2F8A A;  5HQP A;  1J9B A;  2BTO T;  1PQN A;  4XS4 A;  5CAX A;  3HYP A;  1GSF A;  2PN8 A;  2IFQ A;  3ZRE A;  1J0F A;  4DVC A;  1EP8 A;  2ZNM A;  3IAM 2;  4MF6 A;  1MD4 A;  3QFA C;  2CA8 A;  1TTZ A;  1S3A A;  3M3M A;  2WUL A;  4PQH A;  3RHB A;  5IPG A;  1GH2 A;  5HR1 A;  3UOM A;  3VPQ A;  5JWR B;  2KP2 A;  3GTU A;  4AGS A;  1XWC A;  2X4A A;  4D73 A;  2N5F A;  1NM3 A;  4IP1 A;  5D8I A;  2H0I A;  1GSS A;  3A2W A;  1NHO A;  1S3C A;  5CRH A;  3MWH A;  3M0F A;  3ZZX A;  3IPZ A;  1ILO A;  3ZIV A;  2VCV A;  3HD5 A;  1ON4 A;  1TK0 B;  11GS A;  3F63 A;  2WDU A;  5ELG A;  2V2G A;  3IXR A;  2A4V A;  2VM2 A;  3C8E A;  1PFO A;  2O89 A;  3TJJ A;  5IOX A;  2A2R A;  2VCW A;  4WR4 A;  4NAX A;  4N30 A;  4KH7 A;  1G7O A;  2B1L A;  2H72 A;  5DCH A;  4EVM A;  3HJP A;  4KGI A;  1AC1 A;  3O76 A;  4WBJ A;  4MF5 A;  2DKI A;  3KZQ A;  2PGT A;  1FAA A;  1TRS A;  2RM5 A;  3DEX A;  3F3Q A;  3WT2 A;  16GS A;  1F2E A;  1WIK A;  3H8Q A;  2I3Y A;  2B5E A;  4F2I A;  3ME8 A;  3CTG A;  3P7X A;  4KSO A;  4K6X A;  2H1B A;  4KDX A;  4CDO A;  2B5X A;  4KF9 A;  5HR3 A;  5LD0 A;  1PL1 A;  1JZW A;  3LYK A;  3F4T A;  4FIW A;  4WF4 A;  2DC5 A;  2VUP A;  3TKQ A;  1K0M A;  4KCA A;  4ZBB A;  1T1V A;  1PX6 A;  2ON7 A;  1J08 A;  2H01 A;  1ZZY A;  2LV3 A;  1SK2 A;  3F0I A;  2C0F A;  4A5P A;  5IMZ A;  5KOX A;  3F8U A;  2R6K A;  5F8B A;  4HJ2 A;  1T4Y A;  1M9B A;  5ID2 B;  2N5B A;  3LG6 A;  5D73 A;  4YQU A;  3J7Y k;  3GV1 A;  3DYR A;  3QD9 A;  3KH7 A;  1GSU A;  4N0Z A;  3L9U A;  1XVQ A;  2FY6 A;  2C0G A;  3DRN A;  4IQ1 A;  1S3D A;  3VI5 A;  4X0X A;  3D4M A;  5J9C A;  4I8B A;  1AQW A;  4PUA A;  4AF2 A;  2IL3 A;  4EL1 A;  3FZA A;  2GDR A;  4DSS A;  2EC4 A;  1GUM A;  3L78 A;  3TKR A;  4OWY A;  1UC7 A;  4ZBA A;  3QAW A;  3GA4 A;  2H0G A;  1U6T A;  1OAZ A;  4RQR A;  2RLI A;  1FO5 A;  1XOB A;  3VK9 A;  1YJ6 A;  2FWF A;  2CZ3 A;  3HY2 A;  1X5C A;  1Z6N A;  4FQU A;  4TXV A;  2XPD A;  4KB3 A;  5J3R A;  4GLT A;  1QUW A;  5B8B A;  3DD3 A;  2PVO C;  4TRX A;  3G7Y A;  4JED A;  1PD2 1;  1GNW A;  3C7M A;  4ML1 A;  3EU3 A;  3ISO A;  3IHQ A;  4V2M A;  2OBI A;  1XBS A;  5DAK A;  3KXO A;  3BJ5 A;  1ERU A;  5H5S A;  2HRF A;  4YKG A;  3ZML A;  4BPY A;  2C80 A;  4K7O A;  4BIK A;  3TRX A;  1OE8 A;  1AAZ A;  4IS0 A;  1A2L A;  4RQX A;  2C3N A;  3GHA A;  3A3T A;  4IW9 A;  1JZD A;  1KBN A;  4FH8 A;  1TXX A;  1DUG A;  4TR1 A;  3RPP A;  5IQY A;  3F6F A;  1K3O A;  1U87 A;  2R4V A;  1I9D A;  1TW9 A;  4IVF A;  3ERW A;  5G1K A;  2E2G A;  2H19 A;  4GCI A;  2RM6 A;  2MMA A;  3TRQ A;  2R0P A;  3MNG A;  2YWN A;  2JL4 A;  1O6J A;  19GS A;  1QMV A;  5G5E A;  5HR2 A;  4HZ4 A;  2PU9 C;  2JSY A;  2AV4 A;  2F51 A;  3BCI A;  4OMV A;  1X9W B;  2ON5 A;  3TUE A;  2YJ7 A;  2C1Y A;  2GT5 A;  3JCM L;  4PX1 A;  2B7K A;  3M8N A;  4BVX A;  2DLX A;  3PPU A;  2I9H A;  5JWO B;  1V57 A;  2HSH A;  2K6V A;  1WJK A;  3GMF A;  2FA8 A;  2L4Q A;  3TGZ A;  4XS1 A;  1EOH A;  3APQ A;  4V1A p;  4HSC X;  3FR6 A;  3H1N A;  2LNT A;  2LRN A;  3RPN A;  3UVT A;  5ECL B;  2DML A;  1KTE A;  2YP6 A;  2HLS A;  4ISD A;  5DQS A;  1Z7P A;  2L5L A;  3PGT A;  3O3T A;  4L5L A;  4OCF A;  17GS A;  4POL A;  2O7K A;  5DJM A;  2H70 A;  5A4W A;  4ID0 A;  3VFI A;  3H93 A;  3KP8 A;  3ED3 A;  4MAB A;  4NWY A;  2XPE A;  2F8F A;  2H8L A;  2H1D A;  5G2Z A;  4BL7 A;  2HE3 A;  2IMK A;  4H86 A;  1S3R A;  4G0I A;  2PER A;  3TKS C;  5C04 A;  1MDI A;  4AJ8 A;  1TOF A;  2R0G A;  1Z7R A;  3DML A;  1XWB A;  2GVP A;  1K0D A;  1M2B A;  3R3E A;  4RI6 A;  2AHE A;  1SKS B;  1U88 A;  3HVV A;  3IOS A;  2C3T A;  9GSS A;  5F06 A;  1RW1 A;  2M72 A;  1PKW A;  1H4O A;  3GKX A;  2HYX A;  1SEN A;  4JR4 A;  3IK9 A;  4IJ3 A;  3UL3 A;  2VCT A;  1TK8 B;  4MK3 A;  1EEM A;  4KND A;  4HQS A;  4POM A;  1Y6E A;  4TXO B;  1WMJ A;  1ZYN A;  1ERW A;  5GSS A;  3G7I A;  2EIR A;  2YJH A;  3D0Z A;  4V1A g;  2A4H A;  2VCZ A;  1OKT A;  2A2P A;  6GSV A;  5ECN B;  2DJ3 A;  5EL8 A;  5GST A;  1TI1 A;  4J2F A;  2C8U A;  5EPF A;  3IRA A;  3KIJ A;  2RUE A;  4AJ6 A;  4GQF A;  2H71 A;  3GYK A;  2IMI A;  3H79 A;  2JU5 A;  1FW1 A;  2VD1 A;  4ZL7 A;  2H1G A;  3IC4 A;  2LEG A;  1WE0 A;  1DE1 A;  1QFN A;  3N9J A;  3FK8 A;  1RK4 A;  1XPV A;  4TR3 A;  2OBK A;  4YQV A;  4KW6 A;  1X0R A;  3HZ4 A;  1N8J A;  1XWK A;  3FR9 A;  1VF4 A;  4EDZ A;  4ACS A;  3C1R A;  1GLP A;  2LRC A;  5KN0 A;  2OE3 A;  4ZB9 A;  1THX A;  1XG8 A;  5EVO A;  3EVI A;  4I5Q A;  3FY7 A;  4BVY A;  5HFK A;  5H5Q A;  2KUC A;  5AIV A;  3DVX A;  5DVB A;  1Z3E A;  1YEX A;  5KN3 A;  2OAC A;  2V32 A;  2O8V B;  5DDL A;  4PQ1 A;  4MJC A;  4MCU A;  4K2D A;  2HNL A;  4QL9 A;  5L71 A;  2HZE B;  1ZOF A;  4IP6 A;  1SU9 A;  1OVN A;  3EUR A;  4HS1 A;  2HI7 A;  2GLR A;  2AB6 A;  4JR6 A;  4G9H A;  3GNJ A;  1EOG A;  2YV7 A;  2FHE A;  5IIZ A;  5ECP B;  1FVK A;  3ZMK A;  3KTB A;  3P8W A;  4Q5R A;  2LTK A;  5J4U A;  4O92 A;  4OO5 A;  1WOU A;  5HFI A;  13GS A;  2GQM A;  1GTU A;  4MPF A;  2H1A A;  1W4V A;  1SJ6 A;  2QSI A;  1XCC A;  3P2A A;  1A8L A;  3EYT A;  3Q19 A;  3EMP A;  4EF0 A;  4LMV A;  4O5R A;  5AIS A;  1NW2 A;  1DBY A;  3NZN A;  1SYR A;  2CT6 A;  3PIN A;  1F9M A;  3ZYW A;  3E0U A;  1M0U A;  2I4A A;  2NDO A;  1YF0 A;  1Z5Y E;  1TU7 A;  4Q5Q A;  3ERF A;  3KCM A;  3ZLP A;  4OCE A;  4V2L A;  1YDK A;  3WD6 A;  3D21 A;  4WKW A;  4EIQ A;  4LL1 B;  1Z6M A;  2IWT A;  1JZO A;  2ALB A;  2JAC A;  3F4S A;  2IIY A;  3IHG A;  1R5P A;  1EV9 A;  2CAI A;  3L0H A;  2IMD A;  3HXS A;  3TJG A;  1W89 A;  4NV5 A;  1UN2 A;  3FZ5 A;  3GL5 A;  4HJM A;  4MPG A;  5ECI B;  3LYP A;  1K0N A;  1QQ2 A;  3WYW A;  5ECH B;  1PGT A;  4YQM A;  3S9F A;  3I9V 2;  3QMX A;  1V9W A;  3MYD A;  1BJX A;  3J7Y b;  3LEF A;  2KP1 A;  3MIX A;  6GSS A;  1PKZ A;  4WET A;  3C1S A;  1G6Y A;  3UBL A;  1AQX A;  1EV4 A;  1IYI A;  5G1L A;  14GS A;  2DJ1 A;  1GWC A;  3CSI A;  2VL3 A;  6GSU A;  3Q74 A;  2WZ9 A;  3TDG A;  1XW5 A;  4NMU A;  2LS5 A;  2L6C A;  4XCS A;  4K5S A;  1ACV A;  2LUS A;  1ML6 A;  6GST A;  5J41 A;  1XIY A;  1U3I A;  4MA9 A;  3E3E A;  4K1F A;  2PUK C;  1THO A;  2CX3 A;  5BRT A;  3A2X A;  3FKF A;  1XVW A;  3UMA A;  1M99 A;  4O32 A;  1XW9 A;  4KE3 A;  4IJI A;  5AIX A;  4ZXG A;  1U3A A;  2K8S A;  3HVN A;  3ZIJ A;  2XBI A;  3US3 A;  2RUF A;  2AJQ B;  2DJ0 A;  2TRC P;  2CV4 A;  2MBT A;  2QA2 A;  3VUR A;  3PR8 A;  4PUF C;  5D96 A;  5DJL A;  3GN3 A;  4YKF A;  6GSY A;  5A5K A;  2WS2 A;  1OC9 A;  2X8G A;  1WPI A;  4MF7 A;  4ZB6 A;  4FYC A;  5DAL B;  2H0H A;  3C71 A;  4IN0 A;  2YV9 A;  2HT9 A;  3GKK A;  3EWL A;  1A2J A;  1GRX A;  3ZFL A;  3UIW A;  4G2E A;  1GUK A;  2I1U A;  2HZE A;  1XW6 A;  4KSM A;  2M80 A;  5C00 A;  4XIH A;  1F37 A;  4JRR A;  3GKM A;  4DEJ A;  2FUG 2;  4KCE A;  4Z2U A;  1B4P A;  4QQ7 A;  2HRK A;  2R37 A;  1SD9 A;  4ZIJ A;  2V1M A;  4POK A;  2V6O A;  1ZYP A;  3L9V A;  3VWU A;  1VRS D;  2WFC A;  2YZU A;  4AJ7 A;  1VF2 A;  1V98 A;  2CX4 A;  1M2D A;  5EY6 A;  1O81 A;  2C0E A;  1T7P B;  3F6D A;  2YOI A;  1GL8 A;  1G6W A;  2X49 A;  1SKW B;  3IDV A;  2JZT A;  2VD0 A;  2FNO A;  2H66 A;  1YKA A;  4GXZ A;  1A0R P;  1O73 A;  4P3Y B;  1AQV A;  1YQ1 A;  1WP0 A;  3QPM A;  3KJY A;  1XOA A;  1G7E A;  1TU8 A;  2DSA A;  3KEB A;  2VL2 C;  4PXO A;  1MDJ A;  4MJA A;  5CP1 A;  3CRT A;  4IBP A;  5G5F A;  1K0O A;  2VOC A;  4J56 E;  3UJ1 A;  3IAS 2;  3TKP A;  3VLN A;  1JZR A;  4K2X A;  10GS A;  2LNS A;  4MJB A;  1T8E B;  1JHB A;  1GSD A;  3TJB A;  2XBQ A;  1GUL A;  5DQY A;  4G0L A;  1LU4 A;  1VGL A;  5ECS A;  5J9B A;  1A23 A;  3ME7 A;  2DIY A;  2K9F A;  3LXZ A;  2H30 A;  1QXH A;  3DKS A;  2YNX A;  4HQZ A;  1FOV A;  1X5E A;  5J5N A;  3APO A;  1MDK A;  1I5G A;  3DWV A;  1A24 A;  3AY8 A;  3TOU A;  2WJU A;  5D9V A;  4USS A;  1TRV A;  1BX9 A;  4CY6 A;  2EIQ A;  2D2Z A;  5IO0 A;  3FZ4 A;  2ZCT A;  5G31 A;  2QC7 A;  1SL2 B;  4HU9 A;  3KP9 A;  2YAN A;  4YAV A;  4TW5 A;  2HSY A;  4MLY A;  1CQG A;  5D93 A;  2C0D A;  4MMM A;  5ENU A;  4EO3 A;  2TRX A;  2MYG A;  5ECR B;  2DJ2 A;  5B6M A;  4XS4 B;  5IMD A;  2IFQ B;  2YWI A;  4CY8 A;  5IO2 A;  1K0B A;  1K3Y A;  2VIM A;  4IHU A;  2GSS A;  1K0A A;  4PNF A;  1T4Z A;  4K7I A;  5ECQ B;  1TP9 A;  2GTU A;  3GTU B;  3CBU A;  5ID2 A;  2AAW A;  1F6M C;  1GP1 A;  1M7T A;  4FO5 A;  1PMT A;  2GQL A;  2L59 A;  2QA1 A;  2TIR A;  3KTL A;  4QL7 A;  5CNW A;  2VO4 A;  4ULX A;  4ZL8 A;  1E2Y A;  3IR4 A;  4X4J A;  4HUA A;  4ZBD A;  1FB0 A;  3HCZ A;  3VI7 A;  1B4Q A;  4OFN A;  3R2Q A;  3TOT A;  2FLS A;  3GX0 A;  3WGE A;  1Z9H A;  2LKU A;  2C3Q A;  1GUH A;  4KUN A;  3E9J B;  5JWQ B;  5DAL A;  4Z2T A;  4WXT A;  3KMN A;  2F9S A;  5CRW A;  3APS A;  3D22 A;  4KX4 A;  4KDU A;  5DBQ A;  3W8J A;  1KNG A;  4KA0 A;  4ZB8 A;  4DSR A;  1FG4 A;  3DIE A;  3FR3 A;  2VCQ A;  3HKR A;  2HZF A;  5IPH A;  1OE7 A;  3G7J A;  1YEP A;  1XWG A;  2VLU A;  3IV4 A;  3VWW A;  3KMO A;  3ZVJ A;  4K0G A;  1AIU A;  2KOK A;  4L8E A;  2H75 A;  2MMZ A;  3O6T A;  4KAE A;  2VLT A;  22GS A;  1X5D A;  2DMM A;  4YH2 A;  2IN3 A;  4OFM A;  3MAK A;  1ZYE A;  4F03 A;  2OE1 A;  2VL9 A;  4CHS A;  5B6N A;  2KLX A;  4OD7 A;  1BQ7 A;  3K8N A;  2MBS A;  4DSQ A;  3BOA A;  2PWJ A;  3WGX A;  5GAP D;  2GS3 A;  4ZL9 A;  3M1G A;  3A2V A;  2WGR A;  4BWQ A;  1ZL9 A;  4EUY A;  2X8H A;  2GST A;  2P0G A;  3LFL A;  4N0V A;  1OC3 A;  5ABR A;  2B3S A;  4MZC A;  4GRF A;  4OFT A;  4HEA 2;  2R2J A;  2BMX A;  1ABA A;  1O8W A;  5D9T A;  1O85 A;  1ZGN A;  2NVL A;  1BG5 A;  1GTB A;  2C4J A;  1DE2 A;  3D5J A;  2XHF A;  1EGO A;  1JFU A;  2DJJ A;  3GKN A;  3UVH A;  3Q6O A;  2PVQ A;  3F9U A;  1WWJ A;  2X8C A;  4LMW A;  1AUC A;  3QAV A;  1UA5 A;  1DSB A;  4MH3 A;  1KEB A;  4WR5 A;  2GZP A;  2ZUP A;  3HVS A;  2GSR A;  2LST A;  1XWA A;  1CQH A;  3GH6 A;  1SKR B;  2K8V A;  5IMA A;  2JAD A;  1B8X A;  1LJR A;  4DSS B;  4IQA A;  1TI3 A;  3TKS E;  5BMU A;  4PGT A;  4EXJ A;  2NPB A;  4G0K A;  4F0C A;  1XXU A;  2LQO A;  3ZVJ D;  5B8A A;  18GS A;  3Q18 A;  4V2N A;  2EIO A;  5IM9 A;  1FOH A;  4TR0 A;  5JCG A;  5IMV A;  2FWG A;  2R3X A;  3TKS A;  3IK7 A;  2VM1 A;  3EPT A;  4K0N A;  3F4R A;  2HXK A;  2NBS A;  4HDE A;  3TJF A;  2PPT A;  3KD0 A;  4FYU A;  3TJK A;  2OE0 A;  3FZ9 A;  1V2A A;  1HD2 A;  2H76 A;  20GS A;  4O5Q A;  2GQK A;  1QGV A;  3ZRD A;  5G30 A;  2HFD A;  4MNN A;  1K3L A;  5DCG A;  4EIP A;  5CRE A;  3OR5 A;  5AGY A;  1ERV A;  5E4W A;  1IYH A;  4FYB A;  4EKZ A;  2BJX A;  5DAK B;  4ML6 A;  5GZZ B;  5FHI A;  1FB6 A;  4NHW A;  1R4W A;  4XRD A;  4LLR A;  2R0C A;  1Y25 A;  4Q5F A;  3TCO A;  2CVD A;  4LL4 B;  4TKY A;  1SK0 A;  3FYG A;  4E8H A;  2UZ8 A;  4K7N A;  5ECK B;  2L4C A;  5GAN D;  2CVK A;  4NHZ A;  3GL3 A;  2OJL A;  4TR1 B;  5ELA A;  3BBY A;  4PUR A;  4GQC A;  1Q98 A;  1R7H A;  2G2Q A;  3LXT A;  1SYX A;  5A4U A;  1C72 A;  4GST A;  2I81 A;  1N2A A;  3M9J A;  4GSN A;  3EE2 A;  2FWE A;  5CRD A;  4N10 A;  2YZH A;  3BD2 A;  3IA1 A;  4NPB A;  4WEY A;  2H6Y A;  2JZS A;  4F0B A;  3TRP A;  1UVZ A;  5CO3 A;  4TN8 A;  3QDN A;  4EE0 A;  4TXO A;  5H5R A;  4BWS A;  5IMF A;  3CMI A;  4IGJ A;  2VLV A;  1WRY A;  4MJE A;  2KHP A;  1TK5 B;  3GSS A;  3KGK A;  1TKD B;  1B9Y C;  3FW2 A;  2K18 A;  5FT3 A;  1GLQ A;  1OYJ A;  3LGC A;  5IMC A;  4BVX B;  1XZO A;  1USB A;  2FGX A;  5A4V A;  3LQ7 A;  2X64 A;  3FEU A;  2F3M A;  2MMN A;  1ZMA A;  2GZY A;  1NSW A;  2REM A;  1FHE A;  4TVE A;  5KN2 A;  2PMT A;  1MTC A;  3RBT A;  3A5I A;  4MH2 A;  3N5O A;  2AUV A;  2LRT A;  4TOP A;  3VPT A;  1A2M A;  3RHC A;  3U5R E;  2L6D A;  4I97 A;  1SJI A;  3GUR A;  3LW9 A;  3KM6 A;  2GZZ A;  1PX7 A;  3SWL A;  2IMF A;  3M9K A;  3D4T A;  2ES7 A;  3HJM A;  4MZB A;  3VWV A;  4BL7 B;  2H74 A;  4Z7X A;  2NTO A;  1M3J A;  4NXI A;  2LJK A; 
#chains in the Genus database with same CATH homology
 4OO4 A;  1HNC A;  1GTA A;  1YZX A;  4JZQ A;  3G9B A;  1AXD A;  2VCX A;  2FCH A;  4X1U A;  3NOF A;  5KEJ A;  3EIN A;  2DJK A;  2HRA A;  4HU7 A;  4GTU A;  1PN0 A;  1BAY A;  4Z2R A;  1SJZ A;  1PL2 A;  2RII A;  4HOJ A;  4F82 A;  4BA7 A;  2VAF A;  2GSQ A;  5AN1 A;  2N5A A;  4MP4 A;  1PSQ A;  4ILF A;  5CRG A;  3L9S A;  1X9M B;  4F9Z A;  2J23 A;  4K8M A;  2CZ2 A;  2H6Z A;  4WBR D;  1GSQ A;  1Q4J A;  1ERT A;  1GNE A;  2QKE A;  5IOW A;  2M46 A;  2WCI A;  5LCZ A;  2CVB A;  3P90 A;  3WT1 A;  5D9W A;  3VWX A;  2YCD A;  1YY7 A;  2O87 A;  4EC0 A;  4KDY A;  1EGR A;  5B7C A;  3RAZ A;  1OC8 A;  2XC2 A;  1ZYQ B;  3GH9 A;  5KOW A;  3A5W A;  3SBC A;  3EU4 A;  3DGQ A;  1JLW A;  2AYT A;  1EP7 A;  4L0W A;  1NHY A;  2OA7 A;  3BCK A;  1HNA A;  1QK8 A;  2LQQ A;  4TR4 A;  4EDY A;  4K9Z A;  4G19 A;  2YN1 A;  3HHV A;  4GWR A;  1X9S B;  2YWM A;  8GSS A;  4RI7 A;  5CYY A;  4PTS A;  2DIZ A;  4HI7 A;  3TB2 A;  2JZR A;  2O85 A;  2P5Q A;  3HDC A;  3CTF A;  1HQO A;  4POB A;  5D9X A;  12GS A;  1URM A;  2OAD A;  3W8S A;  3PH9 A;  4I2T A;  1V40 A;  5HFG A;  4IEL A;  1MEK A;  4BVY B;  2IPA A;  1HNB A;  3U6V A;  6GSX A;  2B7J A;  2IME A;  1A8Y A;  3QOU A;  5FWG A;  1OKD A;  4GSS A;  2V6K A;  3GX8 A;  5E59 A;  1GSE A;  3ZL5 A;  2X99 A;  4G10 A;  1T3B A;  1M2A A;  3ZIT A;  1RQM A;  1T00 A;  4ZIL A;  4O5U A;  1BED A;  2B5Y A;  3HJO A;  3GRX A;  3GUS A;  4NV2 A;  3WGD A;  2L57 A;  1R26 A;  3CRU A;  1E6B A;  2CAQ A;  1EEJ A;  3IE3 A;  2HSM A;  2LJA A;  4HZ2 A;  4XS6 A;  3QFB C;  2B6M A;  1VF1 A;  2V41 A;  3C73 A;  5F0G A;  1B48 A;  2GGT A;  3LOR A;  5COH A;  1SD8 A;  3I43 A;  1F3B A;  4D73 B;  1EWX A;  1H75 A;  1PN9 A;  3F3R A;  3MDK A;  3MSZ A;  3W6G A;  4YAP A;  3LSZ A;  1M9A A;  1TRW A;  7GSS A;  4Q5N A;  1FVJ A;  2QGV A;  5F05 A;  2P5R A;  4XHM A;  1O7U A;  3V1W A;  4X43 A;  2H73 A;  2DKH A;  3L4N A;  5HR0 A;  5ECM B;  2R5G A;  2WRT A;  3CXG A;  3LJR A;  5ECO B;  3QAG A;  1SL1 B;  4I2U A;  4XTS A;  2E0Q A;  1JLV A;  3CSH A;  4CW9 A;  3ZTL A;  3I6A A;  2IJY A;  3EC3 A;  4LA1 A;  3HVX A;  4ECC A;  3DXB A;  3RDW A;  4K5R A;  1TRU A;  1PA3 A;  2HRN A;  4E8E A;  2VL2 A;  1AW9 A;  3D6I A;  1O8X A;  2B1K A;  2LJR A;  3CYN A;  4WF5 A;  4RUV A;  2J9H A;  1BYE A;  1GTI A;  2E2M A;  3UEM A;  1YF1 A;  2JSZ A;  4MDC A;  1VF3 A;  2OKA A;  3FRC A;  4GF0 A;  3DVW A;  1HYU A;  4JU5 A;  2G0F A;  3KH9 A;  3QR6 A;  3H4K A;  5LNK e;  2YWO A;  1ST9 A;  1K0C A;  1SK1 A;  3IC8 A;  4MZW A;  1ZCP A;  4O7H A;  3I69 A;  1A0F A;  1F3A A;  5JCU A;  2MMO A;  5KN1 A;  3ZFB A;  2L5O A;  2P31 A;  3EMX A;  2YPM A;  4XRA A;  1B9X C;  3LWA A;  1TDI A;  4J57 E;  2E7P A;  1PRX A;  5INY A;  5F07 A;  3HZ8 A;  3FMW A;  2FD3 A;  4N11 A;  4JBB A;  3FHK A;  4PQI A;  1G0T A;  2Z9S A;  1OC9 B;  2FA4 A;  2DBC A;  3GST A;  1TJD A;  4ECJ A;  1EZK A;  3NIV A;  4ECI A;  3UBK A;  2MZC A;  1V58 A;  4ECB A;  3QCP A;  4L0U A;  1SL0 B;  1R5A A;  2GT6 A;  2PBJ A;  5JCW A;  4PNG A;  2WB9 A;  1MD3 A;  4ICY A;  3HA9 A;  2FWH A;  2CQ9 A;  2H6X A;  1YKC A;  3UAP A;  1LBK A;  1XFL A;  3CSJ A;  3GFK A;  6GSW A;  2A2S A;  3ERG A;  4L5O A;  3IBH A;  4I6X A;  3GIX A;  1GSY A;  4IKH A;  3UAR A;  4JE1 A;  2F8A A;  5HQP A;  1J9B A;  2BTO T;  1PQN A;  4XS4 A;  5CAX A;  3HYP A;  1GSF A;  2PN8 A;  2IFQ A;  3ZRE A;  1J0F A;  4DVC A;  1EP8 A;  2ZNM A;  3IAM 2;  4MF6 A;  1MD4 A;  3QFA C;  2CA8 A;  1TTZ A;  1S3A A;  3M3M A;  2WUL A;  4PQH A;  3RHB A;  5IPG A;  1GH2 A;  5HR1 A;  3UOM A;  3VPQ A;  5JWR B;  2KP2 A;  3GTU A;  4AGS A;  1XWC A;  2X4A A;  4D73 A;  2N5F A;  1NM3 A;  4IP1 A;  5D8I A;  2H0I A;  1GSS A;  3A2W A;  1NHO A;  1S3C A;  5CRH A;  3MWH A;  3M0F A;  3ZZX A;  3IPZ A;  1ILO A;  3ZIV A;  2VCV A;  3HD5 A;  1ON4 A;  1TK0 B;  11GS A;  3F63 A;  2WDU A;  5ELG A;  2V2G A;  3IXR A;  2A4V A;  2VM2 A;  3C8E A;  2O89 A;  3TJJ A;  5IOX A;  2A2R A;  2VCW A;  4WR4 A;  4NAX A;  4N30 A;  4KH7 A;  1G7O A;  2B1L A;  2H72 A;  5DCH A;  4EVM A;  3HJP A;  4KGI A;  1AC1 A;  3O76 A;  4WBJ A;  4MF5 A;  2DKI A;  3KZQ A;  2PGT A;  1FAA A;  1TRS A;  2RM5 A;  3DEX A;  3F3Q A;  3WT2 A;  16GS A;  1F2E A;  1WIK A;  3H8Q A;  2I3Y A;  2B5E A;  4F2I A;  3ME8 A;  3CTG A;  3P7X A;  4KSO A;  4K6X A;  2H1B A;  4KDX A;  4CDO A;  2B5X A;  4KF9 A;  5HR3 A;  5LD0 A;  1PL1 A;  1JZW A;  3LYK A;  3F4T A;  4FIW A;  4WF4 A;  2DC5 A;  2VUP A;  3TKQ A;  1K0M A;  4KCA A;  4ZBB A;  1T1V A;  1PX6 A;  2ON7 A;  1J08 A;  2H01 A;  1ZZY A;  2LV3 A;  1SK2 A;  3F0I A;  2C0F A;  4A5P A;  5IMZ A;  5KOX A;  3F8U A;  2R6K A;  5F8B A;  4HJ2 A;  1T4Y A;  1M9B A;  5ID2 B;  2N5B A;  3LG6 A;  5D73 A;  4YQU A;  3J7Y k;  3GV1 A;  3DYR A;  3QD9 A;  3KH7 A;  1GSU A;  4N0Z A;  3L9U A;  1XVQ A;  2FY6 A;  2C0G A;  3DRN A;  4IQ1 A;  1S3D A;  3VI5 A;  4X0X A;  3D4M A;  5J9C A;  4I8B A;  1AQW A;  4PUA A;  4AF2 A;  2IL3 A;  4EL1 A;  3FZA A;  2GDR A;  4DSS A;  2EC4 A;  1GUM A;  3L78 A;  3TKR A;  4OWY A;  1UC7 A;  4ZBA A;  3QAW A;  3GA4 A;  2H0G A;  1U6T A;  1OAZ A;  4RQR A;  2RLI A;  1FO5 A;  1XOB A;  3VK9 A;  1YJ6 A;  2FWF A;  2CZ3 A;  3HY2 A;  1X5C A;  1Z6N A;  4FQU A;  4TXV A;  2XPD A;  4KB3 A;  5J3R A;  4GLT A;  1QUW A;  5B8B A;  3DD3 A;  2PVO C;  4TRX A;  3G7Y A;  4JED A;  1PD2 1;  1GNW A;  3C7M A;  4ML1 A;  3EU3 A;  3ISO A;  3IHQ A;  4V2M A;  2OBI A;  1XBS A;  5DAK A;  3KXO A;  3BJ5 A;  1ERU A;  5H5S A;  2HRF A;  4YKG A;  3ZML A;  4BPY A;  2C80 A;  4K7O A;  3TRX A;  1OE8 A;  1AAZ A;  4IS0 A;  1A2L A;  4RQX A;  2C3N A;  3GHA A;  3A3T A;  4IW9 A;  1JZD A;  1KBN A;  4FH8 A;  1TXX A;  1DUG A;  4TR1 A;  3RPP A;  5IQY A;  3F6F A;  1K3O A;  1U87 A;  2R4V A;  1I9D A;  1TW9 A;  4IVF A;  3ERW A;  5G1K A;  2E2G A;  2H19 A;  4GCI A;  2RM6 A;  2MMA A;  3TRQ A;  2R0P A;  3MNG A;  2YWN A;  2JL4 A;  1O6J A;  19GS A;  1QMV A;  5G5E A;  5HR2 A;  4HZ4 A;  2PU9 C;  2JSY A;  2AV4 A;  2F51 A;  3BCI A;  4OMV A;  1X9W B;  2ON5 A;  3TUE A;  2YJ7 A;  2C1Y A;  2GT5 A;  3JCM L;  4PX1 A;  2B7K A;  3M8N A;  4BVX A;  2DLX A;  3PPU A;  2I9H A;  5JWO B;  1V57 A;  2HSH A;  2K6V A;  1WJK A;  3GMF A;  2FA8 A;  2L4Q A;  3TGZ A;  4XS1 A;  1EOH A;  3APQ A;  4V1A p;  3FR6 A;  3H1N A;  2LNT A;  2LRN A;  3RPN A;  3UVT A;  5ECL B;  2DML A;  1KTE A;  2YP6 A;  2HLS A;  4ISD A;  5DQS A;  1Z7P A;  2L5L A;  3PGT A;  3O3T A;  4L5L A;  4OCF A;  17GS A;  4POL A;  2O7K A;  5DJM A;  2H70 A;  5A4W A;  4ID0 A;  3VFI A;  3H93 A;  3KP8 A;  3ED3 A;  4MAB A;  4NWY A;  2XPE A;  2F8F A;  2H8L A;  2H1D A;  5G2Z A;  4BL7 A;  2HE3 A;  2IMK A;  4H86 A;  4G0I A;  2PER A;  3TKS C;  5C04 A;  1MDI A;  4AJ8 A;  1TOF A;  2R0G A;  1Z7R A;  3DML A;  1XWB A;  2GVP A;  1K0D A;  1M2B A;  3R3E A;  4RI6 A;  2AHE A;  1SKS B;  1U88 A;  3HVV A;  3IOS A;  2C3T A;  9GSS A;  5F06 A;  1RW1 A;  2M72 A;  1PKW A;  1H4O A;  3GKX A;  2HYX A;  1SEN A;  4JR4 A;  3IK9 A;  4IJ3 A;  3UL3 A;  2VCT A;  1TK8 B;  4MK3 A;  1EEM A;  4KND A;  4HQS A;  4POM A;  1Y6E A;  4TXO B;  1WMJ A;  1ZYN A;  1ERW A;  5GSS A;  3G7I A;  2EIR A;  2YJH A;  3D0Z A;  4V1A g;  2A4H A;  2VCZ A;  1OKT A;  2A2P A;  6GSV A;  5ECN B;  2DJ3 A;  5EL8 A;  5GST A;  1TI1 A;  4J2F A;  2C8U A;  5EPF A;  3IRA A;  3KIJ A;  2RUE A;  4AJ6 A;  4GQF A;  2H71 A;  3GYK A;  2IMI A;  3H79 A;  2JU5 A;  1FW1 A;  2VD1 A;  4ZL7 A;  2H1G A;  3IC4 A;  2LEG A;  1WE0 A;  1DE1 A;  1QFN A;  3N9J A;  3FK8 A;  1RK4 A;  1XPV A;  4TR3 A;  2OBK A;  4YQV A;  4KW6 A;  1X0R A;  3HZ4 A;  1N8J A;  1XWK A;  3FR9 A;  1VF4 A;  4EDZ A;  4ACS A;  3C1R A;  1GLP A;  2LRC A;  5KN0 A;  2OE3 A;  4ZB9 A;  1THX A;  5EVO A;  3EVI A;  4I5Q A;  3FY7 A;  4BVY A;  5HFK A;  5H5Q A;  2KUC A;  5AIV A;  3DVX A;  5DVB A;  1Z3E A;  1YEX A;  5KN3 A;  2OAC A;  2V32 A;  2O8V B;  5DDL A;  4PQ1 A;  4MJC A;  4MCU A;  4K2D A;  2HNL A;  4QL9 A;  5L71 A;  2HZE B;  1ZOF A;  4IP6 A;  1SU9 A;  1OVN A;  3EUR A;  4HS1 A;  2HI7 A;  2GLR A;  2AB6 A;  4JR6 A;  4G9H A;  3GNJ A;  1EOG A;  2YV7 A;  2FHE A;  5IIZ A;  5ECP B;  1FVK A;  3ZMK A;  3KTB A;  3P8W A;  4Q5R A;  2LTK A;  5J4U A;  4O92 A;  4OO5 A;  1WOU A;  5HFI A;  13GS A;  2GQM A;  1GTU A;  4MPF A;  2H1A A;  1W4V A;  1SJ6 A;  2QSI A;  1XCC A;  3P2A A;  1A8L A;  3EYT A;  3Q19 A;  3EMP A;  4EF0 A;  5AIS A;  4LMV A;  4O5R A;  1NW2 A;  1DBY A;  3NZN A;  1SYR A;  2CT6 A;  3PIN A;  1F9M A;  3ZYW A;  3E0U A;  1M0U A;  2I4A A;  2NDO A;  1YF0 A;  1Z5Y E;  1TU7 A;  4Q5Q A;  3ERF A;  3KCM A;  3ZLP A;  4OCE A;  4V2L A;  1YDK A;  3WD6 A;  3D21 A;  4WKW A;  4EIQ A;  4LL1 B;  1Z6M A;  2IWT A;  1JZO A;  2ALB A;  2JAC A;  3F4S A;  2IIY A;  3IHG A;  1R5P A;  1EV9 A;  2CAI A;  3L0H A;  2IMD A;  3HXS A;  3TJG A;  1W89 A;  4NV5 A;  1UN2 A;  3FZ5 A;  3GL5 A;  4HJM A;  4MPG A;  5ECI B;  3LYP A;  1K0N A;  1QQ2 A;  3WYW A;  5ECH B;  1PGT A;  4YQM A;  3S9F A;  3I9V 2;  3QMX A;  1V9W A;  3MYD A;  1BJX A;  3J7Y b;  3LEF A;  2KP1 A;  3MIX A;  6GSS A;  1PKZ A;  4WET A;  3C1S A;  1G6Y A;  3UBL A;  1AQX A;  1EV4 A;  1IYI A;  5G1L A;  14GS A;  2DJ1 A;  1GWC A;  3CSI A;  2VL3 A;  6GSU A;  3Q74 A;  2WZ9 A;  3TDG A;  1XW5 A;  4NMU A;  2LS5 A;  2L6C A;  4XCS A;  4K5S A;  1ACV A;  2LUS A;  1ML6 A;  6GST A;  5J41 A;  1XIY A;  1U3I A;  4MA9 A;  3E3E A;  4K1F A;  2PUK C;  1THO A;  2CX3 A;  5BRT A;  3A2X A;  3FKF A;  1XVW A;  3UMA A;  1M99 A;  4O32 A;  1XW9 A;  4KE3 A;  4IJI A;  5AIX A;  4ZXG A;  1U3A A;  2K8S A;  3ZIJ A;  2XBI A;  3US3 A;  2RUF A;  2AJQ B;  2DJ0 A;  2TRC P;  2CV4 A;  2MBT A;  2QA2 A;  3VUR A;  3PR8 A;  4PUF C;  5D96 A;  5DJL A;  3GN3 A;  4YKF A;  6GSY A;  5A5K A;  2WS2 A;  1OC9 A;  2X8G A;  1WPI A;  4MF7 A;  4ZB6 A;  4FYC A;  5DAL B;  2H0H A;  3C71 A;  4IN0 A;  2YV9 A;  2HT9 A;  3GKK A;  3EWL A;  1A2J A;  1GRX A;  3ZFL A;  3UIW A;  4G2E A;  1GUK A;  2I1U A;  2HZE A;  1XW6 A;  4KSM A;  2M80 A;  5C00 A;  4XIH A;  1F37 A;  4JRR A;  3GKM A;  4DEJ A;  2FUG 2;  4KCE A;  4Z2U A;  1B4P A;  4QQ7 A;  2HRK A;  2R37 A;  1SD9 A;  4ZIJ A;  2V1M A;  4POK A;  2V6O A;  1ZYP A;  3L9V A;  3VWU A;  1VRS D;  2WFC A;  2YZU A;  4AJ7 A;  1VF2 A;  1V98 A;  2CX4 A;  1M2D A;  5EY6 A;  1O81 A;  2C0E A;  1T7P B;  3F6D A;  2YOI A;  1GL8 A;  1G6W A;  2X49 A;  1SKW B;  3IDV A;  2JZT A;  2VD0 A;  2FNO A;  2H66 A;  1YKA A;  4GXZ A;  1A0R P;  1O73 A;  4P3Y B;  1AQV A;  1YQ1 A;  1WP0 A;  3QPM A;  3KJY A;  1XOA A;  1G7E A;  1TU8 A;  2DSA A;  3KEB A;  2VL2 C;  4PXO A;  1MDJ A;  4MJA A;  5CP1 A;  3CRT A;  4IBP A;  5G5F A;  1K0O A;  2VOC A;  4J56 E;  3UJ1 A;  3IAS 2;  3TKP A;  3VLN A;  1JZR A;  4K2X A;  10GS A;  2LNS A;  4MJB A;  1T8E B;  1JHB A;  1GSD A;  3TJB A;  2XBQ A;  1GUL A;  5DQY A;  4G0L A;  1LU4 A;  1VGL A;  5ECS A;  5J9B A;  1A23 A;  3ME7 A;  2DIY A;  2K9F A;  3LXZ A;  2H30 A;  1QXH A;  3DKS A;  2YNX A;  4HQZ A;  1FOV A;  1X5E A;  5J5N A;  3APO A;  1MDK A;  1I5G A;  3DWV A;  1A24 A;  3AY8 A;  3TOU A;  2WJU A;  5D9V A;  4USS A;  1TRV A;  1BX9 A;  4CY6 A;  2EIQ A;  2D2Z A;  5IO0 A;  3FZ4 A;  2ZCT A;  5G31 A;  2QC7 A;  1SL2 B;  4HU9 A;  3KP9 A;  2YAN A;  4YAV A;  4TW5 A;  2HSY A;  4MLY A;  1CQG A;  5D93 A;  2C0D A;  4MMM A;  5ENU A;  4EO3 A;  2TRX A;  2MYG A;  5ECR B;  2DJ2 A;  5B6M A;  4XS4 B;  5IMD A;  2IFQ B;  2YWI A;  4CY8 A;  5IO2 A;  1K0B A;  1K3Y A;  2VIM A;  4IHU A;  2GSS A;  1K0A A;  4PNF A;  1T4Z A;  4K7I A;  5ECQ B;  1TP9 A;  2GTU A;  3GTU B;  3CBU A;  5ID2 A;  2AAW A;  1F6M C;  1GP1 A;  1M7T A;  4FO5 A;  1PMT A;  2GQL A;  2L59 A;  2QA1 A;  2TIR A;  3KTL A;  4QL7 A;  5CNW A;  2VO4 A;  4ULX A;  4ZL8 A;  1E2Y A;  3IR4 A;  4X4J A;  4HUA A;  4ZBD A;  1FB0 A;  3HCZ A;  3VI7 A;  1B4Q A;  4OFN A;  3R2Q A;  3TOT A;  2FLS A;  3GX0 A;  3WGE A;  1Z9H A;  2LKU A;  2C3Q A;  1GUH A;  4KUN A;  3E9J B;  5JWQ B;  5DAL A;  4Z2T A;  4WXT A;  3KMN A;  2F9S A;  5CRW A;  3APS A;  3D22 A;  4KX4 A;  4KDU A;  5DBQ A;  3W8J A;  1KNG A;  4KA0 A;  4ZB8 A;  4DSR A;  1FG4 A;  3DIE A;  3FR3 A;  2VCQ A;  3HKR A;  2HZF A;  5IPH A;  1OE7 A;  3G7J A;  1YEP A;  1XWG A;  2VLU A;  3IV4 A;  3VWW A;  3KMO A;  3ZVJ A;  4K0G A;  1AIU A;  2KOK A;  4L8E A;  2H75 A;  2MMZ A;  3O6T A;  4KAE A;  2VLT A;  22GS A;  1X5D A;  2DMM A;  4YH2 A;  2IN3 A;  4OFM A;  3MAK A;  1ZYE A;  4F03 A;  2OE1 A;  2VL9 A;  4CHS A;  5B6N A;  2KLX A;  4OD7 A;  1BQ7 A;  3K8N A;  2MBS A;  4DSQ A;  3BOA A;  2PWJ A;  3WGX A;  5GAP D;  2GS3 A;  4ZL9 A;  3M1G A;  3A2V A;  2WGR A;  4BWQ A;  1ZL9 A;  4EUY A;  2X8H A;  2GST A;  2P0G A;  3LFL A;  4N0V A;  1OC3 A;  5ABR A;  2B3S A;  4MZC A;  4GRF A;  4OFT A;  4HEA 2;  2R2J A;  2BMX A;  1ABA A;  1O8W A;  5D9T A;  1O85 A;  1ZGN A;  2NVL A;  1BG5 A;  1GTB A;  2C4J A;  1DE2 A;  3D5J A;  2XHF A;  1EGO A;  1JFU A;  2DJJ A;  3GKN A;  3UVH A;  3Q6O A;  2PVQ A;  3F9U A;  1WWJ A;  2X8C A;  4LMW A;  1AUC A;  3QAV A;  1UA5 A;  1DSB A;  4MH3 A;  1KEB A;  4WR5 A;  2GZP A;  2ZUP A;  3HVS A;  2GSR A;  2LST A;  1XWA A;  1CQH A;  3GH6 A;  1SKR B;  2K8V A;  5IMA A;  2JAD A;  1B8X A;  1LJR A;  4DSS B;  4IQA A;  1TI3 A;  3TKS E;  5BMU A;  4PGT A;  4EXJ A;  2NPB A;  4G0K A;  4F0C A;  1XXU A;  2LQO A;  3ZVJ D;  5B8A A;  18GS A;  3Q18 A;  4V2N A;  2EIO A;  5IM9 A;  1FOH A;  4TR0 A;  5JCG A;  5IMV A;  2FWG A;  2R3X A;  3TKS A;  3IK7 A;  2VM1 A;  3EPT A;  4K0N A;  3F4R A;  2HXK A;  2NBS A;  4HDE A;  3TJF A;  2PPT A;  3KD0 A;  4FYU A;  3TJK A;  2OE0 A;  3FZ9 A;  1V2A A;  1HD2 A;  2H76 A;  20GS A;  4O5Q A;  2GQK A;  1QGV A;  3ZRD A;  5G30 A;  2HFD A;  4MNN A;  1K3L A;  5DCG A;  4EIP A;  5CRE A;  3OR5 A;  5AGY A;  1ERV A;  5E4W A;  1IYH A;  4FYB A;  4EKZ A;  2BJX A;  5DAK B;  4ML6 A;  5GZZ B;  5FHI A;  1FB6 A;  4NHW A;  1R4W A;  4XRD A;  4LLR A;  2R0C A;  1Y25 A;  4Q5F A;  3TCO A;  2CVD A;  4LL4 B;  4TKY A;  1SK0 A;  3FYG A;  4E8H A;  2UZ8 A;  4K7N A;  5ECK B;  2L4C A;  5GAN D;  2CVK A;  4NHZ A;  3GL3 A;  2OJL A;  4TR1 B;  5ELA A;  3BBY A;  4PUR A;  4GQC A;  1Q98 A;  1R7H A;  2G2Q A;  3LXT A;  1SYX A;  5A4U A;  1C72 A;  4GST A;  2I81 A;  1N2A A;  3M9J A;  4GSN A;  3EE2 A;  2FWE A;  5CRD A;  4N10 A;  2YZH A;  3BD2 A;  3IA1 A;  4NPB A;  4WEY A;  2H6Y A;  2JZS A;  4F0B A;  3TRP A;  1UVZ A;  5CO3 A;  4TN8 A;  3QDN A;  4EE0 A;  4TXO A;  5H5R A;  4BWS A;  5IMF A;  3CMI A;  4IGJ A;  2VLV A;  1WRY A;  4MJE A;  2KHP A;  1TK5 B;  3GSS A;  3KGK A;  1TKD B;  1B9Y C;  3FW2 A;  2K18 A;  5FT3 A;  1GLQ A;  1OYJ A;  3LGC A;  5IMC A;  4BVX B;  1XZO A;  1USB A;  2FGX A;  5A4V A;  3LQ7 A;  2X64 A;  3FEU A;  2F3M A;  2MMN A;  1ZMA A;  2GZY A;  1NSW A;  2REM A;  1FHE A;  4TVE A;  5KN2 A;  2PMT A;  1MTC A;  3RBT A;  3A5I A;  4MH2 A;  3N5O A;  2AUV A;  2LRT A;  4TOP A;  3VPT A;  1A2M A;  3RHC A;  3U5R E;  2L6D A;  4I97 A;  1SJI A;  3GUR A;  3LW9 A;  3KM6 A;  2GZZ A;  1PX7 A;  3SWL A;  2IMF A;  3M9K A;  3D4T A;  2ES7 A;  3HJM A;  4MZB A;  3VWV A;  4BL7 B;  2H74 A;  4Z7X A;  2NTO A;  4NXI A;  2LJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...