1OC9B

Tryparedoxin ii from c.fasciculata solved by mr
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
147
structure length
147
Chain Sequence
HMSGLKKFFPYSTNVLKGAAADIALPSLAGKTVFFYFSASWCPPCRAFTPQLIDFYKAHAEKKNFEVMLISWDESAEDFKDYYAKMPWLALPFEDRKGMEFLTTGFDVKSIPTLVGVEADSGNIITTQARTMVVKDPEAKDFPWPNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords TRYPAREDOXIN II
publication title Tryparedoxins from Crithidia Fasciculata and Trypanosoma Brucei: Photoreduction of the Redox Disulfide Using Synchrotron Radiation and Evidence for a Conformational Switch Implicated in Function
pubmed doi rcsb
source organism Crithidia fasciculata
total genus 41
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1oc9B00
2HSYA 1ST9A 2J23A 2GVPA 4OFNA 3TRQA 1B8XA 2KOKA 1XBSA 3FR6A 3TOUA 2KP2A 4ZBBA 2H66A 3TOTA 4PQIA 1PN9A 5JWRB 4ML6A 1PL2A 2KLXA 2ZNMA 4GF0A 1B9YC 2C1YA 2LJRA 1LU4A 3C8EA 3ZTLA 1SK0A 3LXZA 1C72A 3CBUA 4PURA 5EL8A 1CQHA 4Q5FA 1SK2A 1G7EA 16GSA 2DJ0A 1UC7A 1GUHA 1YF1A 2OE0A 2LRCA 1JLVA 6GSSA 2K8VA 1YDKA 3VI5A 2V2GA 2V32A 2P5QA 2JACA 1BQ7A 3I69A 1M9AA 5A4VA 1WPIA 5AISA 4EVMA 1O81A 3LSZA 5JCUA 3J7Yb 4IHUA 3GRXA 1BX9A 1AIUA 7GSSA 3GURA 3ZITA 1G6WA 3VWXA 2CX3A 1GSSA 2GTUA 1S3DA 2HRNA 3PGTA 3M9KA 2F3MA 4MJBA 3EVIA 3WGXA 3WYWA 4KX4A 3KCMA 1X5EA 4TR0A 2C3TA 3PR8A 2XPDA 3TCOA 3IK7A 4ZB9A 2X64A 2IFQA 3LEFA 1F37A 2DMMA 4TN8A 1F6MC 3LWAA 3GSTA 3ZLPA 4ACSA 2VM2A 2JZTA 1UA5A 3L9SA 6GSYA 5ID2B 3CRUA 2GQLA 2LJAA 2FD3A 3F6FA 3QFBC 3FHKA 4I2TA 2DJ2A 4EL1A 1NSWA 5KN0A 4POBA 3G7YA 3M1GA 3I43A 4E8EA 4NPBA 5B8AA 2M80A 3TKRA 3DRNA 2B7KA 3Q6OA 2LUSA 4YH2A 5IQYA 4ID0A 3SWLA 3ERFA 3KTBA 4DSRA 4DSSA 2GSQA 3M9JA 1WJKA 4KW6A 2C3QA 3ERWA 3APQA 6GSVA 3FRCA 2P0GA 2QC7A 1LBKA 4KDUA 1XW5A 3KTLA 1PX7A 2F8AA 1WIKA 2VAFA 1XW9A 3KD0A 3PH9A 4IKHA 3HYPA 3CTGA 1JHBA 2ZUPA 1PL1A 3H8QA 4OWYA 1ML6A 5DCHA 4IN0A 2CV4A 1R5PA 4KDYA 3HJPA 2E2GA 4O5RA 2DIZA 2O89A 5ABRA 3F3QA 1FO5A 2YWMA 3LXTA 4MJAA 1GP1A 5DBQA 4YAPA 2IMKA 2E0QA 3TB2A 3U6VA 2TRXA 4O32A 2LQQA 1TKDB 3FZ5A 2FWEA 3L9VA 1DUGA 1X9MB 1M0UA 2B6MA 5C00A 4TRXA 4KSMA 4NV5A 4XHMA 1J0FA 2OE3A 1QK8A 5IMCA 2H73A 5ECKB 4WEYA 3M0FA 2NBSA 1VF1A 13GSA 3FEUA 2CX4A 1SL2B 3GH9A 4ZB6A 3KH9A 2QSIA 5CYYA 3ED3A 3HA9A 2WB9A 4GSTA 3RDWA 2WFCA 4ZBDA 5HR0A 2XBQA 1BEDA 2B7JA 3KIJA 3DXBA 3QD9A 5D93A 4BVYA 3G7JA 5DAKB 1U88A 5F05A 4ECIA 2PPTA 2LNTA 3IHQA 5EPFA 4OMVA 3ME7A 4KAEA 1GSEA 3KP9A 3H4KA 5JCWA 2JZRA 4K0GA 3ME8A 3BD2A 2B1LA 1QUWA 3EWLA 1AQXA 3CYNA 1GTAA 3TJJA 4IW9A 4OFMA 3U5RE 3BCKA 1RW1A 3GX0A 5JWOB 1JLWA 4YQUA 2VCXA 5J3RA 3VFIA 1TI3A 2NPBA 2N5BA 12GSA 3J7Yk 4CW9A 2X8GA 1DE1A 3D4TA 3GV1A 5CRGA 3TDGA 5B7CA 1X0RA 4IJ3A 1K0AA 5IMDA 3F0IA 5CNWA 1SD9A 1GLPA 2LSTA 2PUKC 3IDVA 4KCEA 4GTUA 3I6AA 2LKUA 1OKTA 2L5OA 1PMTA 1W89A 1JZDA 17GSA 4RI7A 4JR4A 4X0XA 3TGZA 1UVZA 2K6VA 2ON5A 1U3AA 2DJ1A 2MZCA 3FZAA 3EU3A 2OADA 3QCPA 3DKSA 2FGXA 3UEMA 5D96A 1SJZA 2H30A 1MD3A 1VF4A 1F2EA 3M8NA 3LYPA 2GSTA 2MMZA 3A5WA 1OKDA 2R5GA 5GAPD 1A0FA 1QXHA 1K0CA 2KHPA 2BJXA 3A2XA 4POKA 2FLSA 1XWGA 1ERWA 4ZL7A 4ZXGA 1B4QA 1VGLA 3W8SA 2C0FA 1THXA 2R4VA 4HEA2 2GSRA 5COHA 3LORA 1GNEA 1TW9A 5EY6A 2I9HA 4QL7A 3GNJA 5KN1A 4E8HA 3FZ9A 2HZFA 3TKPA 1KNGA 1Y6EA 1IYHA 1MTCA 4JU5A 1B4PA 2WGRA 1QGVA 1A2JA 1FG4A 1TK0B 1EV9A 3HJOA 4Q5RA 4ZB8A 1JZRA 4AGSA 1HD2A 4NHZA 3CSJA 2YWNA 4OO5A 1USBA 1LJRA 4J57E 3DVXA 1TTZA 3HJMA 3LFLA 2G0FA 5JWQB 3IPZA 4ZILA 4IELA 2VLVA 3N5OA 2L59A 4K9ZA 2P5RA 1TOFA 3L78A 4OCEA 2HI7A 2IL3A 3HCZA 4YQMA 2FA4A 5IMZA 1T00A 5CO3A 3GMFA 4GQCA 2NDOA 4FH8A 1VRSD 2I4AA 9GSSA 1AXDA 3C7MA 3CSIA 4P3YB 3F8UA 2OKAA 1XWCA 1V58A 4MZBA 1TU7A 2AUVA 1V2AA 4WR4A 1H4OA 5FT3A 2YWIA 3UBLA 3GTUA 2O85A 2PBJA 3F4RA 2R2JA 1TK5B 2V1MA 1Z7RA 3Q19A 3TJBA 1VF2A 5F06A 3GX8A 2CVDA 3A2VA 1AQVA 4N0ZA 1TRWA 4O92A 4GSNA 2LQOA 2DC5A 2YZUA 4KH7A 1Q98A 2X8HA 4KE3A 5D9VA 3IE3A 1HNCA 2IFQB 2JSZA 4X43A 1IYIA 4TXOA 4K0NA 1KBNA 2O87A 3RHCA 1DBYA 1K0MA 1Q4JA 2VLUA 3VWUA 1SYRA 1FB6A 1ERUA 4TR4A 5A5KA 5ECMB 2TIRA 5D9WA 3HZ4A 3HHVA 4FIWA 5FHIA 5GSTA 3GSSA 5IPHA 3H1NA 1JFUA 4LA1A 3TJFA 3RAZA 1QQ2A 3TJGA 5KN3A 1PA3A 3DMLA 4KCAA 5H5RA 1EGOA 1B48A 1SKRB 1AAZA 2L6DA 3IK9A 4NAXA 1DE2A 1VF3A 2IMEA 4HUAA 3KZQA 1O7UA 1GSUA 1SK1A 5J9CA 5LD0A 5G5EA 4DSQA 5HR3A 1O8XA 2HZEB 4I6XA 5DDLA 1G6YA 4NV2A 3GKXA 1XOAA 3D6IA 4F2IA 1GTUA 4DVCA 3HD5A 4KSOA 3DYRA 4G10A 1WOUA 5ECQB 4FYUA 1YQ1A 11GSA 3F63A 1YF0A 5J4UA 2R6KA 1A2LA 1HQOA 4WF5A 4GSSA 4I5QA 4XS6A 4KA0A 4XTSA 3UOMA 2B5XA 2VL2A 4WETA 4MK3A 1J08A 1BJXA 4LMVA 1OC8A 1UN2A 3IV4A 4BWSA 4BVXA 2LNSA 2YOIA 5G1LA 4ZBAA 3FZ4A 2XPEA 4Q5QA 1XWKA 2BTOT 5HR1A 2GT5A 1M99A 5C04A 1WE0A 5E4WA 4PUFC 3IXRA 3QR6A 1PKZA 4YQVA 3UARA 2H0GA 4K7OA 1ZOFA 2B5EA 3C71A 3BCIA 3BBYA 1V40A 1A24A 1HYUA 3P2AA 1TRVA 2CZ2A 4HQZA 2H0HA 4V2LA 4EDZA 3ZFBA 5D8IA 2K18A 4L0WA 4POMA 1XCCA 3IA1A 1N8JA 1K3LA 4PNFA 4MLYA 4TW5A 4BPYA 1MDKA 2OE1A 2OBIA 5G5FA 2AJQB 1NHOA 3UJ1A 1FOVA 4N11A 2E2MA 1GRXA 4I97A 4JRRA 4ZL9A 2REMA 1ERTA 1JZOA 2AAWA 2H6YA 2CA8A 3P7XA 2LV3A 2ON7A 2PMTA 1PRXA 4F0BA 3K8NA 1SYXA 2OA7A 1T7PB 2IIYA 3L4NA 3DD3A 2LTKA 5L71A 4GWRA 5JCGA 1T4ZA 2DSAA 3Q74A 1T4YA 2IMDA 3M3MA 2VIMA 2DJKA 1GH2A 3GL3A 1GUKA 2ES7A 2WS2A 1GSQA 3MAKA 2OBKA 2J9HA 1T3BA 4IGJA 3KMOA 2EIQA 1XXUA 2L4QA 5DJMA 2AB6A 4GCIA 1URMA 1PKWA 3HVXA 2HNLA 1I5GA 4XIHA 1SL1B 1WWJA 1Z6NA 2CT6A 4I2UA 5HFKA 4KUNA 2DJJA 5DALB 5ECHB 1OE7A 3H79A 3GKKA 3MSZA 4KGIA 2JL4A 1V9WA 3A3TA 2H0IA 1SL0B 1Z3EA 2HFDA 1K0NA 2L4CA 1X9SB 1R26A 2WULA 1EGRA 3CTFA 5ELGA 3CXGA 4XS4B 1X5CA 4MH3A 1KTEA 2QGVA 3E3EA 1A2MA 5ID2A 4TR1A 1E6BA 2I81A 2GZYA 5CREA 1M9BA 3HKRA 2H1GA 3W8JA 2PVQA 3TJKA 2VL9A 14GSA 1TI1A 2PVOC 2VCZA 3UVHA 5CAXA 5B8BA 1THOA 3TKSE 4GLTA 4WF4A 1G0TA 4PGTA 5GAND 1Z7PA 4HQSA 1TP9A 8GSSA 2GS3A 1OC9B 3LJRA 3LQ7A 4ZL8A 2FNOA 2AV4A 3KH7A 1SKWB 1MEKA 2JSYA 1F3BA 4F0CA 3JCML 2XBIA 5HFGA 2YANA 1ZGNA 3WT2A 1PD21 4RI6A 1F3AA 1XWBA 1V98A 2YCDA 1MDIA 3GTUB 4HZ4A 4RQRA 6GSWA 3UIWA 2PWJA 2NTOA 4K6XA 1GTIA 1YKAA 2CAIA 1O85A 1PGTA 3UAPA 20GSA 2LS5A 5CRDA 4L5OA 1S3CA 5IIZA 1EP7A 4EC0A 2H1BA 3DVWA 2F51A 1EV4A 5H5SA 2FWHA 1I9DA 4TXOB 1K0DA 3UBKA 4OD7A 1GTBA 1YJ6A 5IOWA 1NM3A 2FWFA 2GZZA 2CVKA 2R37A 2B3SA 2YZHA 1F9MA 4GXZA 3OR5A 4F82A 4PQ1A 4TOPA 1H75A 2F8FA 1GSYA 2XC2A 5IOXA 3PINA 4ML1A 1EEMA 4CDOA 4IS0A 5D9XA 1GSFA 2VL3A 2H19A 3GKMA 3ZREA 1XPVA 1ZL9A 5B6NA 3CRTA 3F4SA 2RUFA 1V57A 1SENA 3TKSA 3TRXA 2JU5A 2RLIA 3F3RA 4PXOA 3RHBA 3BOAA 3ZVJA 3APSA 2H70A 3MWHA 4XS1A 2VCVA 4TVEA 1K3OA 5G30A 5EVOA 2WZ9A 1TJDA 1OC3A 4PNGA 4MF7A 1M7TA 4D73A 4EUYA 2VM1A 4GRFA 1MD4A 1XWAA 5G2ZA 4Q5NA 1GL8A 2CQ9A 4K7IA 3EU4A 2GQMA 3GN3A 5GSSA 4WBJA 6GSXA 3EYTA 3NIVA 4MPFA 1R5AA 4FYBA 2FWGA 1T8EB 4BWQA 1G7OA 3EURA 3D4MA 3IC4A 3WD6A 2VO4A 1SD8A 1XOBA 4MZWA 3ZL5A 4K7NA 4MP4A 4L0UA 3DGQA 5CRWA 5IMVA 2H6XA 4XCSA 3US3A 4ECJA 2FA8A 2DLXA 3FR9A 4PUAA 5IPGA 4IP1A 2H72A 3TKQA 1FAAA 18GSA 4WXTA 2C0EA 3QFAC 1OYJA 1BYEA 1YEXA 4AJ6A 2YV7A 3ERGA 4AJ7A 2GQKA 1YZXA 2VD1A 3ZIVA 4NMUA 1ACVA 1M2DA 2DJ3A 5AGYA 4K8MA 2XHFA 3E9JB 1GLQA 5ECNB 4IJIA 4TR3A 4G9HA 4RUVA 4MDCA 3NOFA 2M46A 3ZZXA 2K8SA 3D5JA 2GZPA 2A2SA 1E2YA 1OAZA 2HLSA 1RQMA 2VCWA 3AY8A 2RUEA 3WGEA 5IM9A 2TRCP 4IP6A 2L6CA 3C73A 3SBCA 2VD0A 2GT6A 2WCIA 2YWOA 2R3XA 3ZMLA 3GH6A 3GUSA 5A4WA 1U3IA 1M2AA 4JZQA 4QL9A 4EO3A 2RIIA 3MDKA 4ULXA 4WR5A 4DSSB 2JADA 1ABAA 2YNXA 3FK8A 1DSBA 3RPPA 1AW9A 4EF0A 3VK9A 3DIEA 4G2EA 1Z5YE 4JR6A 5B6MA 4CHSA 4OFTA 3F4TA 4I8BA 3IOSA 4Z7XA 2ALBA 3HY2A 2C8UA 1CQGA 1EOHA 1Z6MA 3W6GA 1SU9A 4FO5A 5KEJA 2L57A 2MBTA 1HNBA 1X5DA 2A2RA 19GSA 3NZNA 4HU9A 1J9BA 2B1KA 2OJLA 5F8BA 4HS1A 1R4WA 5HFIA 22GSA 4V1Ag 2WJUA 1K0OA 2IWTA 3UVTA 1S3AA 4ILFA 1FVKA 6GSUA 4ECCA 3UMAA 4F03A 3VPQA 1N2AA 1XW6A 5CP1A 1O73A 3EE2A 1OE8A 1FHEA 5GZZB 1JZWA 1SJIA 2VCTA 1TK8B 2LEGA 3GL5A 1ZZYA 1FVJA 3FYGA 1ZYEA 4KDXA 3VURA 1Z9HA 4V2MA 3CMIA 5DQYA 2LRNA 2C80A 4FYCA 4PX1A 2B5YA 4F9ZA 3GA4A 1Y25A 1WRYA 4N0VA 2M72A 2HRFA 2BMXA 2H1AA 3IR4A 3TUEA 1PQNA 1K3YA 2VUPA 4TR1B 1ILOA 3D0ZA 5IO2A 3ISOA 4EXJA 1NW2A 3QAWA 2EIRA 1U6TA 5AN1A 5ECIB 3IAS2 4H86A 3KEBA 3GYKA 5D73A 5DCGA 3G9BA 2N5FA 3G7IA 3FW2A 2LJKA 5G31A 4K2DA 3E0UA 3FR3A 2H74A 3KXOA 2FY6A 5CRHA 2H6ZA 1XIYA 4EE0A 3QAGA 1EEJA 5ELAA 1XVWA 3RPNA 5ENUA 3P90A 4HDEA 1GWCA 2H76A 2H71A 2IPAA 4JEDA 1BAYA 4LL4B 3KM6A 2QKEA 2MBSA 3FKFA 2HZEA 2AYTA 4MJEA 2C0GA 4KNDA 2IN3A 3ZRDA 5ECOB 3GFKA 4HZ2A 2GGTA 1GSDA 1KEBA 3HVVA 2VLTA 4LLRA 4LL1B 3LG6A 1QMVA 2VCQA 2FUG2 1TRUA 4MF5A 1XVQA 3QMXA 5E59A 3TRPA 1PSQA 6GSTA 1PX6A 2DMLA 5AIVA 1NHYA 2HXKA 1AUCA 5J5NA 4MPGA 1GNWA 2G2QA 4OCFA 2OACA 4HJ2A 2FHEA 10GSA 2MMOA 5INYA 3H93A 4BA7A 1YKCA 3LGCA 4J2FA 1TXXA 3TKSC 2YJ7A 2GLRA 3IRAA 4L5LA 3VWWA 3EMXA 4L8EA 3VI7A 3EC3A 4J56E 2PGTA 2C4JA 4JBBA 5H5QA 2V41A 4LMWA 1A8LA 3RBTA 2AHEA 3KP8A 1FB0A 2YJHA 2YPMA 3ZVJD 4AF2A 3A2WA 2H75A 2RM6A 1SKSB 1AQWA 2EC4A 2MMAA 3F6DA 1K0BA 1FW1A 4HOJA 4DEJA 4D73B 4X1UA 2YN1A 1AC1A 4TXVA 5ECPB 5IO0A 1U87A 3GKNA 4ISDA 2EIOA 2H8LA 4RQXA 5G1KA 1XZOA 2WDUA 3QAVA 3DEXA 1YEPA 1EOGA 4EKZA 4EDYA 4MF6A 3KMNA 4QQ7A 1SJ6A 2CAQA 2CVBA 2ZCTA 2L5LA 2JZSA 2NVLA 2MMNA 3O6TA 3O3TA 2Z9SA 4V2NA 4IVFA 2DBCA 4NXIA 3ZMKA 3IBHA 4ECBA 3QDNA 2GSSA 4IQAA 5HQPA 1ON4A 1R7HA 4G19A 1BG5A 3VWVA 1M2BA 5J41A 3HDCA 4NWYA 4K1FA 1GUMA 4HJMA 3Q18A 4O7HA 2V6KA 3QOUA 4HI7A 4MA9A 2KUCA 3ZIJA 4WBRD 5ECLB 1TDIA 2O7KA 3VLNA 4MH2A 4MMMA 1A23A 2X99A 2C3NA 2H1DA 1W4VA 1WP0A 1GULA 3L0HA 2CZ3A 2LRTA 5DQSA 5F0GA 2IJYA 5DALA 2D2ZA 5D9TA 1EZKA 2VOCA 5LNKe 2K9FA 3D22A 2RM5A 2HYXA 4XRDA 4N30A 1HNAA 1OVNA 3C1SA 2O8VB 1X9WB 2IMFA 3WGDA 3C1RA 1ZMAA 4XS4A 4YAVA 5HR2A 4NHWA 1WMJA 4TKYA 3FY7A 3GHAA 4IQ1A 1EWXA 3DWVA 5F07A 5DAKA 4MABA 2WRTA 5LCZA 5ECRB 2P31A 3ZYWA 1O6JA 4IBPA 3UL3A 3V1WA 3R2QA 2E7PA 3D21A 3VPTA 1YY7A 5FWGA 1ZYQB 4MZCA 4MJCA 5IMFA 4HU7A 3BJ5A 3GIXA 4N10A 3WT1A 4XRAA 3LYKA 2YP6A 2X8CA 1O8WA 3HZ8A 1TRSA 3EINA 3I9V2 1OC9A 2DIYA 5IMAA 3QPMA 1QFNA 1XFLA 1TU8A 3APOA 1ZCPA 1RK4A 2HE3A 4KB3A 2VL2C 2N5AA 2YV9A 3L9UA 2HSHA 3P8WA 5KN2A 2A4VA 2PERA 2KP1A 5A4UA 4WKWA 4AJ8A 1T1VA 3O76A 2PN8A 3ZFLA 2HT9A 4PQHA 4POLA 4V1Ap 3HVSA 1A8YA 4BL7A 1EP8A 4GQFA 5DJLA 2IMIA 2H01A 3MNGA 5ECSA 4JE1A 1ERVA 5J9BA 3KJYA 3EMPA 2F9SA 2GDRA 4ZIJA 2MYGA 2I3YA 1MDJA 3CSHA 2I1UA 3HXSA 5DVBA 1B9XC 3F9UA 3S9FA 3KGKA 5AIXA 2FCHA 3N9JA 4MCUA 2V6OA 4OO4A 2C0DA 1A0RP 2PU9C 3IAM2
chains in the Genus database with same CATH superfamily
2HSYA 1ST9A 2J23A 2GVPA 4OFNA 3TRQA 1B8XA 2KOKA 1XBSA 3FR6A 3TOUA 2KP2A 4ZBBA 2H66A 3TOTA 4PQIA 1PN9A 5JWRB 4ML6A 1PL2A 2KLXA 2ZNMA 4GF0A 1B9YC 2C1YA 2LJRA 1LU4A 3C8EA 3ZTLA 5KOXA 1SK0A 3LXZA 1C72A 3CBUA 4PURA 5EL8A 1CQHA 4Q5FA 1SK2A 1G7EA 16GSA 2DJ0A 1UC7A 1GUHA 1YF1A 2OE0A 2LRCA 1JLVA 6GSSA 2K8VA 1XG8A 1YDKA 3VI5A 2V2GA 2V32A 2P5QA 2JACA 1BQ7A 3I69A 1M9AA 5A4VA 4HSCX 1WPIA 5AISA 4EVMA 1O81A 3LSZA 5JCUA 4G0LA 3J7Yb 4IHUA 3GRXA 1BX9A 1AIUA 7GSSA 3GURA 3ZITA 2X49A 1G6WA 3VWXA 2CX3A 1GSSA 2GTUA 1S3DA 2HRNA 3PGTA 3M9KA 2F3MA 4MJBA 3EVIA 3WGXA 3WYWA 3A5IA 4YKFA 4KX4A 3KCMA 1X5EA 4TR0A 2C3TA 3PR8A 2XPDA 3TCOA 3IK7A 4ZB9A 2X64A 2IFQA 3LEFA 1F37A 3FMWA 2DMMA 4TN8A 1F6MC 3LWAA 3GSTA 3ZLPA 4ACSA 2VM2A 2JZTA 1UA5A 3L9SA 6GSYA 5ID2B 3CRUA 2GQLA 2LJAA 2FD3A 3F6FA 3QFBC 3FHKA 4I2TA 2DJ2A 4EL1A 2A4HA 1NSWA 5KN0A 4POBA 3G7YA 4ICYA 3M1GA 3I43A 4E8EA 4NPBA 5B8AA 2M80A 3TKRA 3DRNA 2B7KA 3Q6OA 2LUSA 4YH2A 5IQYA 4ID0A 3SWLA 3ERFA 3KTBA 2X4AA 4DSRA 4DSSA 2GSQA 3M9JA 1WJKA 4KW6A 2C3QA 3ERWA 3APQA 6GSVA 3FRCA 2P0GA 2QC7A 1LBKA 4KDUA 1XW5A 3KTLA 1PX7A 2F8AA 1WIKA 2VAFA 1XW9A 3KD0A 3PH9A 4IKHA 3HYPA 3CTGA 1JHBA 2ZUPA 1PL1A 3H8QA 4OWYA 1ML6A 5DCHA 4IN0A 5BMUA 2CV4A 1R5PA 4KDYA 3HJPA 2E2GA 4O5RA 2DIZA 2O89A 5ABRA 3F3QA 1FO5A 2YWMA 3LXTA 4MJAA 1GP1A 5DBQA 4YAPA 2IMKA 2E0QA 3TB2A 3U6VA 2TRXA 4O32A 2LQQA 3PPUA 3FZ5A 1TKDB 2FWEA 3L9VA 1DUGA 1X9MB 1M0UA 2B6MA 5C00A 4K5SA 4TRXA 4KSMA 4NV5A 4MNNA 4XHMA 1J0FA 2OE3A 1QK8A 5IMCA 2H73A 5ECKB 4WEYA 2DKHA 3M0FA 2NBSA 1VF1A 13GSA 3FEUA 2CX4A 1SL2B 3GH9A 4ZB6A 3KH9A 2QSIA 4X4JA 5CYYA 3ED3A 3HA9A 2WB9A 4GSTA 3RDWA 2WFCA 4ZBDA 5HR0A 2XBQA 1BEDA 2B7JA 3KIJA 3DXBA 3QD9A 5D93A 4BVYA 3G7JA 5DAKB 1U88A 5F05A 4ECIA 2PPTA 1ZYPA 2LNTA 3IHQA 5EPFA 4OMVA 3ME7A 4KAEA 1GSEA 3KP9A 3H4KA 5JCWA 2JZRA 4K0GA 3ME8A 3BD2A 2B1LA 1QUWA 3EWLA 1AQXA 3CYNA 1GTAA 3TJJA 4IW9A 4OFMA 3U5RE 3BCKA 1RW1A 3GX0A 5JWOB 1JLWA 4YQUA 2VCXA 5J3RA 3VFIA 1TI3A 2NPBA 2N5BA 12GSA 3J7Yk 4CW9A 2X8GA 1DE1A 3D4TA 3GV1A 5CRGA 3TDGA 5B7CA 1X0RA 4IJ3A 1K0AA 5IMDA 3F0IA 5CNWA 1SD9A 1GLPA 2LSTA 2PUKC 3IDVA 4KCEA 4GTUA 3I6AA 2LKUA 1OKTA 2L5OA 1PMTA 1W89A 1JZDA 17GSA 4RI7A 4JR4A 4X0XA 3TGZA 1UVZA 2K6VA 2ON5A 1U3AA 2DJ1A 2MZCA 3FZAA 3EU3A 2OADA 3QCPA 3DKSA 2FGXA 3UEMA 5D96A 1SJZA 2H30A 1MD3A 1VF4A 1F2EA 3M8NA 3LYPA 2GSTA 2MMZA 3A5WA 1OKDA 2R5GA 5GAPD 1A0FA 1QXHA 1K0CA 2KHPA 2BJXA 3A2XA 4POKA 2FLSA 1XWGA 1ERWA 4ZL7A 4ZXGA 2QA2A 1B4QA 1VGLA 3W8SA 2C0FA 1THXA 2R4VA 4HEA2 2GSRA 5COHA 3LORA 1GNEA 1TW9A 5EY6A 2I9HA 4QL7A 3GNJA 5KN1A 4O5UA 4E8HA 3FZ9A 2HZFA 3TKPA 1KNGA 1Y6EA 1IYHA 1MTCA 4JU5A 1B4PA 2WGRA 1QGVA 1A2JA 1FG4A 1TK0B 1EV9A 3HJOA 4Q5RA 4ZB8A 1JZRA 4AGSA 1HD2A 4NHZA 3CSJA 2YWNA 4OO5A 1USBA 1LJRA 4J57E 3DVXA 1TTZA 3HJMA 3LFLA 2G0FA 5JWQB 3IPZA 4ZILA 4IELA 2VLVA 3N5OA 2L59A 4K9ZA 4KF9A 2P5RA 4YKGA 1ZYNA 1TOFA 3L78A 4OCEA 2HI7A 2IL3A 3HCZA 4YQMA 2FA4A 5IMZA 1T00A 5CO3A 3GMFA 4GQCA 2NDOA 4FH8A 1VRSD 2I4AA 9GSSA 1AXDA 3C7MA 3CSIA 4P3YB 3F8UA 2OKAA 1XWCA 1V58A 4MZBA 1TU7A 2AUVA 1V2AA 4WR4A 1H4OA 5FT3A 2YWIA 3UBLA 3GTUA 2O85A 2PBJA 3F4RA 2R2JA 1TK5B 2V1MA 1Z7RA 3Q19A 3TJBA 1VF2A 5F06A 3IHGA 3GX8A 2CVDA 3A2VA 1AQVA 4N0ZA 1TRWA 4O92A 4GSNA 2LQOA 2DC5A 2YZUA 4KH7A 1Q98A 2X8HA 4KE3A 2DKIA 5D9VA 3IE3A 1HNCA 2IFQB 2JSZA 4X43A 1IYIA 4TXOA 4K0NA 1KBNA 2O87A 3RHCA 1DBYA 1K0MA 1Q4JA 2VLUA 3VWUA 1SYRA 1FB6A 1ERUA 4TR4A 5A5KA 5ECMB 2TIRA 5D9WA 3HZ4A 3HHVA 4FIWA 5FHIA 5GSTA 3GSSA 4G0IA 5IPHA 5KOWA 3H1NA 1JFUA 4LA1A 2HSMA 3TJFA 3RAZA 1QQ2A 3TJGA 5KN3A 1PA3A 3DMLA 4KCAA 5H5RA 1EGOA 1B48A 1SKRB 1AAZA 4EIQA 2L6DA 3IK9A 4NAXA 1DE2A 1VF3A 2IMEA 4HUAA 1M3JA 3KZQA 1O7UA 1GSUA 1SK1A 5J9CA 5LD0A 5G5EA 4DSQA 5HR3A 1O8XA 2HZEB 4I6XA 5DDLA 1G6YA 4NV2A 5BRTA 2R0GA 3GKXA 1XOAA 3D6IA 4F2IA 1GTUA 4DVCA 3MIXA 3HD5A 4KSOA 3DYRA 4G10A 1WOUA 5ECQB 4FYUA 1YQ1A 4Z2TA 11GSA 3F63A 1YF0A 5J4UA 2R6KA 1A2LA 1HQOA 4WF5A 4GSSA 4I5QA 4XS6A 4KA0A 4XTSA 3UOMA 2B5XA 2VL2A 4WETA 4MK3A 1J08A 1BJXA 4LMVA 1OC8A 1UN2A 3IV4A 4BWSA 4BVXA 2LNSA 2YOIA 5G1LA 4ZBAA 3FZ4A 2XPEA 4Q5QA 1XWKA 2BTOT 5HR1A 3R3EA 2GT5A 1M99A 5C04A 1WE0A 5E4WA 4PUFC 3IXRA 3QR6A 1PKZA 4YQVA 3UARA 2H0GA 4K7OA 1ZOFA 2B5EA 3C71A 3BCIA 3BBYA 1V40A 1A24A 1HYUA 3P2AA 1TRVA 2CZ2A 4HQZA 2H0HA 4V2LA 4EDZA 3ZFBA 5D8IA 2K18A 4POMA 4L0WA 1XCCA 3IA1A 1N8JA 1K3LA 4PNFA 4MLYA 4TW5A 4BPYA 1MDKA 2OE1A 2OBIA 5G5FA 2AJQB 1NHOA 3UJ1A 1FOVA 4N11A 2E2MA 1GRXA 4I97A 4JRRA 4ZL9A 2REMA 1ERTA 1JZOA 2AAWA 2H6YA 2CA8A 3P7XA 2LV3A 2ON7A 2PMTA 1PRXA 4F0BA 3K8NA 1SYXA 2OA7A 1T7PB 2IIYA 3L4NA 3DD3A 2LTKA 5L71A 4GWRA 5JCGA 1T4ZA 2DSAA 3Q74A 1T4YA 2IMDA 3M3MA 2VIMA 2DJKA 1GH2A 3GL3A 1GUKA 2ES7A 2WS2A 1GSQA 3MAKA 2OBKA 2J9HA 1T3BA 4IGJA 3KMOA 2EIQA 3EPTA 1XXUA 2L4QA 5DJMA 2AB6A 4GCIA 1URMA 1PKWA 3HVXA 2HNLA 1I5GA 4XIHA 1SL1B 1WWJA 1Z6NA 2CT6A 4I2UA 5HFKA 4KUNA 2DJJA 5DALB 1OE7A 3H79A 5ECHB 3GKKA 3MSZA 4KGIA 2JL4A 1V9WA 3A3TA 2H0IA 1SL0B 1Z3EA 2HFDA 1K0NA 2L4CA 1X9SB 1R26A 2WULA 1EGRA 3CTFA 5ELGA 3CXGA 4XS4B 1X5CA 4MH3A 4O5QA 1KTEA 2QGVA 3E3EA 1A2MA 5ID2A 4TR1A 1E6BA 2I81A 2GZYA 5CREA 1M9BA 3HKRA 2H1GA 3W8JA 2PVQA 3TJKA 2VL9A 14GSA 1TI1A 2PVOC 2VCZA 3UVHA 5CAXA 5B8BA 1THOA 3TKSE 4GLTA 4WF4A 1G0TA 4PGTA 5GAND 1Z7PA 4HQSA 1TP9A 8GSSA 2GS3A 1OC9B 3LJRA 3LQ7A 3IC8A 4ZL8A 2FNOA 2AV4A 3KH7A 1SKWB 1MEKA 2JSYA 1F3BA 4F0CA 3JCML 1S3RA 2XBIA 5HFGA 2YANA 1ZGNA 3WT2A 1PD21 4RI6A 1F3AA 4G0KA 1XWBA 1V98A 2YCDA 1MDIA 3GTUB 4HZ4A 4RQRA 6GSWA 3UIWA 2PWJA 2NTOA 4K6XA 1GTIA 1YKAA 2CAIA 1O85A 1PGTA 3UAPA 20GSA 2LS5A 5CRDA 4BL7B 4L5OA 1S3CA 5IIZA 1EP7A 4EC0A 2H1BA 3DVWA 2F51A 1EV4A 5H5SA 2FWHA 1I9DA 4TXOB 1K0DA 3UBKA 4OD7A 1GTBA 1YJ6A 5IOWA 1NM3A 2FWFA 2GZZA 2CVKA 2R37A 2B3SA 2YZHA 1F9MA 4GXZA 3OR5A 4F82A 4PQ1A 4TOPA 1H75A 2UZ8A 2F8FA 1GSYA 2XC2A 5IOXA 3PINA 4ML1A 1EEMA 4CDOA 4IS0A 5D9XA 1GSFA 2VL3A 2H19A 3GKMA 3ZREA 1XPVA 1ZL9A 4Z2UA 5B6NA 3CRTA 3F4SA 2RUFA 1V57A 1SENA 3TKSA 3TRXA 2JU5A 2RLIA 3F3RA 4PXOA 3RHBA 3BOAA 3ZVJA 3APSA 2H70A 3MWHA 4XS1A 2VCVA 4TVEA 1K3OA 5G30A 5EVOA 2WZ9A 1TJDA 1OC3A 4PNGA 4MF7A 1M7TA 4D73A 4EUYA 2VM1A 4GRFA 1MD4A 1XWAA 5G2ZA 4Q5NA 1GL8A 2CQ9A 4K7IA 3EU4A 2GQMA 3GN3A 5GSSA 4WBJA 6GSXA 4K2XA 3EYTA 3NIVA 4MPFA 1R5AA 4FYBA 2FWGA 1T8EB 4BWQA 1G7OA 3EURA 3D4MA 3IC4A 3WD6A 2VO4A 1SD8A 1XOBA 4MZWA 3ZL5A 4K7NA 4MP4A 4L0UA 3DGQA 5CRWA 5IMVA 2H6XA 4XCSA 3US3A 4ECJA 1M3IA 2FA8A 2DLXA 3FR9A 4PUAA 5IPGA 4IP1A 2H72A 3TKQA 1FAAA 18GSA 4WXTA 2C0EA 3QFAC 1OYJA 1BYEA 1YEXA 4AJ6A 2YV7A 3ERGA 4AJ7A 2GQKA 3HVNA 1YZXA 2VD1A 3ZIVA 4NMUA 1ACVA 1M2DA 2DJ3A 5AGYA 4K8MA 2XHFA 3E9JB 1GLQA 5ECNB 4BVXB 4IJIA 4TR3A 4G9HA 4RUVA 4MDCA 3NOFA 2M46A 3ZZXA 2K8SA 3D5JA 2GZPA 2A2SA 1E2YA 1OAZA 2HLSA 1RQMA 1PN0A 2VCWA 3AY8A 2RUEA 3WGEA 5IM9A 2TRCP 4IP6A 2L6CA 3CQFA 3C73A 3SBCA 2VD0A 2GT6A 2WCIA 2YWOA 2R3XA 3ZMLA 3GH6A 3GUSA 5A4WA 1U3IA 1M2AA 4JZQA 4QL9A 4EO3A 2RIIA 3MDKA 4ULXA 4WR5A 4DSSB 2JADA 1ABAA 2YNXA 3FK8A 1DSBA 2HRKA 3RPPA 1AW9A 4EF0A 3VK9A 3DIEA 4G2EA 1Z5YE 4JR6A 5B6MA 4CHSA 4OFTA 3F4TA 4I8BA 3IOSA 4Z7XA 2ALBA 3HY2A 2C8UA 1CQGA 1EOHA 1Z6MA 3W6GA 1SU9A 4FO5A 3MYDA 5KEJA 2L57A 2MBTA 1HNBA 1X5DA 2A2RA 19GSA 3NZNA 4HU9A 1FOHA 1J9BA 2B1KA 2OJLA 5F8BA 4HS1A 1R4WA 5HFIA 22GSA 4V1Ag 2WJUA 1K0OA 2IWTA 3UVTA 1S3AA 4ILFA 1FVKA 6GSUA 4Z2RA 4ECCA 3UMAA 4F03A 3VPQA 1N2AA 1XW6A 5CP1A 1O73A 3EE2A 1OE8A 1FHEA 5GZZB 1JZWA 1SJIA 2VCTA 1TK8B 2LEGA 3GL5A 1ZZYA 1FVJA 3FYGA 1ZYEA 4KDXA 3VURA 1Z9HA 4V2MA 3CMIA 5DQYA 2LRNA 2C80A 4FYCA 4PX1A 2B5YA 4F9ZA 2R0PA 3GA4A 1Y25A 1WRYA 4N0VA 2M72A 2HRFA 4BVYB 2BMXA 2H1AA 3IR4A 3TUEA 1PQNA 1K3YA 2VUPA 4TR1B 1ILOA 3D0ZA 5IO2A 3ISOA 4EXJA 1NW2A 3QAWA 2EIRA 1U6TA 5AN1A 5ECIB 4BIKA 3IAS2 4H86A 3KEBA 3GYKA 5D73A 5DCGA 3G9BA 2N5FA 3G7IA 3FW2A 2LJKA 4K5RA 5G31A 4FQUA 4K2DA 3E0UA 3FR3A 2H74A 3KXOA 2FY6A 5CRHA 2H6ZA 1XIYA 4EE0A 3QAGA 1EEJA 5ELAA 1XVWA 3RPNA 5ENUA 3P90A 4HDEA 1GWCA 2H76A 2H71A 2IPAA 4JEDA 1BAYA 4LL4B 3KM6A 2QKEA 2MBSA 3FKFA 2HZEA 2AYTA 4MJEA 2C0GA 4KNDA 2IN3A 3ZRDA 5ECOB 3GFKA 4HZ2A 2GGTA 1GSDA 1KEBA 3HVVA 2VLTA 4LLRA 4LL1B 3LG6A 1QMVA 2VCQA 2FUG2 1TRUA 4MF5A 1XVQA 3QMXA 5E59A 3TRPA 1PSQA 6GSTA 1PX6A 2DMLA 5AIVA 1NHYA 2HXKA 1AUCA 5J5NA 4MPGA 1GNWA 2G2QA 4OCFA 4PTSA 2OACA 4HJ2A 2FHEA 4A5PA 10GSA 2MMOA 5INYA 3H93A 4BA7A 1YKCA 3LGCA 4J2FA 1TXXA 3TKSC 2YJ7A 2GLRA 3IRAA 4L5LA 3VWWA 3EMXA 4L8EA 3VI7A 3EC3A 4J56E 2PGTA 2C4JA 4JBBA 5H5QA 2V41A 4LMWA 1A8LA 4CY8A 3RBTA 2AHEA 3KP8A 1FB0A 2YJHA 2YPMA 3ZVJD 4AF2A 3A2WA 2H75A 2RM6A 1SKSB 1AQWA 2EC4A 2MMAA 3F6DA 1K0BA 1FW1A 4HOJA 4DEJA 4D73B 4X1UA 2YN1A 1AC1A 4TXVA 5ECPB 5IO0A 1U87A 3GKNA 4ISDA 2EIOA 2H8LA 4RQXA 5G1KA 1XZOA 2WDUA 3QAVA 3DEXA 1YEPA 1EOGA 4EKZA 4EDYA 4MF6A 3KMNA 4QQ7A 1SJ6A 2CAQA 2CVBA 2ZCTA 2L5LA 2JZSA 2NVLA 2MMNA 3O6TA 3O3TA 2Z9SA 4V2NA 4IVFA 2DBCA 4NXIA 3ZMKA 3IBHA 4ECBA 3QDNA 2GSSA 4IQAA 5HQPA 1ON4A 1R7HA 4G19A 1BG5A 3VWVA 1M2BA 5J41A 3HDCA 4NWYA 4K1FA 1GUMA 4HJMA 3Q18A 4O7HA 2V6KA 3QOUA 4HI7A 4MA9A 2KUCA 3ZIJA 4WBRD 5ECLB 1TDIA 2O7KA 3VLNA 4MH2A 4MMMA 1A23A 2X99A 2C3NA 2H1DA 2R0CA 1W4VA 1WP0A 1GULA 3L0HA 2CZ3A 2LRTA 5DQSA 5F0GA 2IJYA 5DALA 2D2ZA 5D9TA 1EZKA 2VOCA 5LNKe 2K9FA 3D22A 2RM5A 2HYXA 4XRDA 3LW9A 4N30A 1HNAA 1OVNA 3C1SA 2O8VB 1X9WB 2IMFA 3WGDA 3C1RA 4CY6A 1ZMAA 4XS4A 4YAVA 5HR2A 4NHWA 1WMJA 4TKYA 3FY7A 3GHAA 4IQ1A 1EWXA 3DWVA 5F07A 5DAKA 4MABA 2WRTA 5LCZA 5ECRB 2P31A 3ZYWA 1O6JA 4IBPA 3UL3A 3V1WA 3R2QA 2E7PA 3D21A 3VPTA 1YY7A 5FWGA 2QA1A 1ZYQB 4MZCA 4MJCA 5IMFA 4HU7A 3BJ5A 3GIXA 4EIPA 4N10A 3WT1A 4XRAA 3LYKA 2YP6A 2X8CA 1O8WA 3HZ8A 1TRSA 3EINA 3I9V2 1OC9A 2DIYA 4USSA 5IMAA 3QPMA 1QFNA 1XFLA 1PFOA 1TU8A 3APOA 1ZCPA 1RK4A 2HE3A 4KB3A 2VL2C 2N5AA 2YV9A 2A2PA 3L9UA 2HSHA 3P8WA 5KN2A 2A4VA 2PERA 2KP1A 5A4UA 4WKWA 4AJ8A 1T1VA 3O76A 2PN8A 3ZFLA 2HT9A 4PQHA 4POLA 4V1Ap 3HVSA 1A8YA 4BL7A 1EP8A 4GQFA 5DJLA 2IMIA 2H01A 3MNGA 5ECSA 4JE1A 1ERVA 5J9BA 3KJYA 3EMPA 2F9SA 2GDRA 4ZIJA 2MYGA 2I3YA 1MDJA 2HRAA 3CSHA 2I1UA 3HXSA 5DVBA 1B9XC 3F9UA 3S9FA 3KGKA 5AIXA 2FCHA 3N9JA 4MCUA 2V6OA 4OO4A 2C0DA 1A0RP 2PU9C 3IAM2
chains in the Genus database with same CATH topology
2HSYA 1ST9A 2J23A 2GVPA 4OFNA 3TRQA 1B8XA 2KOKA 1XBSA 3FR6A 3TOUA 2KP2A 4ZBBA 2H66A 3TOTA 4PQIA 1PN9A 5JWRB 4ML6A 1PL2A 2KLXA 2ZNMA 4GF0A 1B9YC 2C1YA 2LJRA 1LU4A 3C8EA 3ZTLA 5KOXA 1SK0A 3LXZA 1C72A 3CBUA 4PURA 5EL8A 1CQHA 4Q5FA 1SK2A 1G7EA 16GSA 2DJ0A 1UC7A 1GUHA 1YF1A 2OE0A 2LRCA 1JLVA 6GSSA 2K8VA 1YDKA 3VI5A 2V2GA 2V32A 2P5QA 2JACA 1BQ7A 3I69A 1M9AA 5A4VA 1WPIA 5AISA 4EVMA 1O81A 3LSZA 5JCUA 4G0LA 3J7Yb 4IHUA 3GRXA 1BX9A 1AIUA 7GSSA 3GURA 3ZITA 2X49A 1G6WA 3VWXA 2CX3A 1GSSA 2GTUA 1S3DA 2HRNA 3PGTA 3M9KA 2F3MA 4MJBA 3EVIA 3WGXA 3WYWA 3A5IA 4YKFA 4KX4A 3KCMA 1X5EA 4TR0A 2C3TA 3PR8A 2XPDA 3TCOA 3IK7A 4ZB9A 2X64A 2IFQA 3LEFA 1F37A 3FMWA 2DMMA 4TN8A 1F6MC 3LWAA 3GSTA 3ZLPA 4ACSA 2VM2A 2JZTA 1UA5A 3L9SA 6GSYA 5ID2B 3CRUA 2GQLA 2LJAA 2FD3A 3F6FA 3QFBC 3FHKA 4I2TA 2DJ2A 4EL1A 2A4HA 1NSWA 5KN0A 4POBA 3G7YA 4ICYA 3M1GA 3I43A 4E8EA 4NPBA 5B8AA 2M80A 3TKRA 3DRNA 2B7KA 3Q6OA 2LUSA 4YH2A 5IQYA 4ID0A 3SWLA 3ERFA 3KTBA 2X4AA 4DSRA 4DSSA 2GSQA 3M9JA 1WJKA 4KW6A 2C3QA 3ERWA 3APQA 6GSVA 3FRCA 2P0GA 2QC7A 1LBKA 4KDUA 1XW5A 3KTLA 1PX7A 2F8AA 1WIKA 2VAFA 1XW9A 3KD0A 3PH9A 4IKHA 3HYPA 3CTGA 1JHBA 2ZUPA 1PL1A 3H8QA 4OWYA 1ML6A 5DCHA 4IN0A 5BMUA 2CV4A 1R5PA 4KDYA 3HJPA 2E2GA 4O5RA 2DIZA 2O89A 5ABRA 3F3QA 1FO5A 2YWMA 3LXTA 4MJAA 1GP1A 5DBQA 4YAPA 2IMKA 2E0QA 3TB2A 3U6VA 2TRXA 4O32A 2LQQA 3PPUA 3FZ5A 1TKDB 2FWEA 3L9VA 1DUGA 1X9MB 1M0UA 2B6MA 5C00A 4K5SA 4TRXA 4KSMA 4NV5A 4MNNA 4XHMA 1J0FA 2OE3A 1QK8A 5IMCA 2H73A 5ECKB 4WEYA 2DKHA 3M0FA 2NBSA 1VF1A 13GSA 3FEUA 2CX4A 1SL2B 3GH9A 4ZB6A 3KH9A 2QSIA 4X4JA 5CYYA 3ED3A 3HA9A 2WB9A 4GSTA 3RDWA 2WFCA 4ZBDA 5HR0A 2XBQA 1BEDA 2B7JA 3KIJA 3DXBA 3QD9A 5D93A 4BVYA 3G7JA 5DAKB 1U88A 5F05A 4ECIA 2PPTA 1ZYPA 2LNTA 3IHQA 5EPFA 4OMVA 3ME7A 4KAEA 1GSEA 3KP9A 3H4KA 5JCWA 2JZRA 4K0GA 3ME8A 3BD2A 2B1LA 1QUWA 3EWLA 1AQXA 3CYNA 1GTAA 3TJJA 4IW9A 4OFMA 3U5RE 3BCKA 1RW1A 3GX0A 5JWOB 1JLWA 4YQUA 2VCXA 5J3RA 3VFIA 1TI3A 2NPBA 2N5BA 12GSA 3J7Yk 4CW9A 2X8GA 1DE1A 3D4TA 3GV1A 5CRGA 3TDGA 5B7CA 1X0RA 4IJ3A 1K0AA 5IMDA 3F0IA 5CNWA 1SD9A 1GLPA 2LSTA 2PUKC 3IDVA 4KCEA 4GTUA 3I6AA 2LKUA 1OKTA 2L5OA 1PMTA 1W89A 1JZDA 17GSA 4RI7A 4JR4A 4X0XA 3TGZA 1UVZA 2K6VA 2ON5A 1U3AA 2DJ1A 2MZCA 3FZAA 3EU3A 2OADA 3QCPA 3DKSA 2FGXA 3UEMA 5D96A 1SJZA 2H30A 1MD3A 1VF4A 1F2EA 3M8NA 3LYPA 2GSTA 2MMZA 3A5WA 1OKDA 2R5GA 5GAPD 1A0FA 1QXHA 1K0CA 2KHPA 2BJXA 3A2XA 4POKA 2FLSA 1XWGA 1ERWA 4ZL7A 4ZXGA 2QA2A 1B4QA 1VGLA 3W8SA 2C0FA 1THXA 2R4VA 4HEA2 2GSRA 5COHA 3LORA 1GNEA 1TW9A 5EY6A 2I9HA 4QL7A 3GNJA 5KN1A 4O5UA 4E8HA 3FZ9A 2HZFA 3TKPA 1KNGA 1Y6EA 1IYHA 1MTCA 4JU5A 1B4PA 2WGRA 1QGVA 1A2JA 1FG4A 1TK0B 1EV9A 3HJOA 4Q5RA 4ZB8A 1JZRA 4AGSA 1HD2A 4NHZA 3CSJA 2YWNA 4OO5A 1USBA 1LJRA 4J57E 3DVXA 1TTZA 3HJMA 3LFLA 2G0FA 5JWQB 3IPZA 4ZILA 4IELA 2VLVA 3N5OA 2L59A 4K9ZA 4KF9A 2P5RA 4YKGA 1ZYNA 1TOFA 3L78A 4OCEA 2HI7A 2IL3A 3HCZA 4YQMA 2FA4A 5IMZA 1T00A 5CO3A 3GMFA 4GQCA 2NDOA 4FH8A 1VRSD 2I4AA 9GSSA 1AXDA 3C7MA 3CSIA 4P3YB 3F8UA 2OKAA 1XWCA 1V58A 4MZBA 1TU7A 2AUVA 1V2AA 4WR4A 1H4OA 5FT3A 2YWIA 3UBLA 3GTUA 2O85A 2PBJA 3F4RA 2R2JA 1TK5B 2V1MA 1Z7RA 3Q19A 3TJBA 1VF2A 5F06A 3IHGA 3GX8A 2CVDA 3A2VA 1AQVA 4N0ZA 1TRWA 4O92A 4GSNA 2LQOA 2DC5A 2YZUA 4KH7A 1Q98A 2X8HA 4KE3A 2DKIA 5D9VA 3IE3A 1HNCA 2IFQB 2JSZA 4X43A 1IYIA 4TXOA 4K0NA 1KBNA 2O87A 3RHCA 1DBYA 1K0MA 1Q4JA 2VLUA 3VWUA 1SYRA 1FB6A 1ERUA 4TR4A 5A5KA 5ECMB 2TIRA 5D9WA 3HZ4A 3HHVA 4FIWA 5FHIA 5GSTA 3GSSA 4G0IA 5IPHA 5KOWA 3H1NA 1JFUA 4LA1A 2HSMA 3TJFA 3RAZA 1QQ2A 3TJGA 5KN3A 1PA3A 3DMLA 4KCAA 5H5RA 1EGOA 1B48A 1SKRB 1AAZA 4EIQA 2L6DA 3IK9A 4NAXA 1DE2A 1VF3A 2IMEA 4HUAA 3KZQA 1O7UA 1GSUA 1SK1A 5J9CA 5LD0A 5G5EA 4DSQA 5HR3A 1O8XA 2HZEB 4I6XA 5DDLA 1G6YA 4NV2A 5BRTA 2R0GA 3GKXA 1XOAA 3D6IA 4F2IA 1GTUA 4DVCA 3MIXA 3HD5A 4KSOA 3DYRA 4G10A 1WOUA 5ECQB 4FYUA 1YQ1A 4Z2TA 11GSA 3F63A 1YF0A 5J4UA 2R6KA 1A2LA 1HQOA 4WF5A 4GSSA 4I5QA 4XS6A 4KA0A 4XTSA 3UOMA 2B5XA 2VL2A 4WETA 4MK3A 1J08A 1BJXA 4LMVA 1OC8A 1UN2A 3IV4A 4BWSA 4BVXA 2LNSA 2YOIA 5G1LA 4ZBAA 3FZ4A 2XPEA 4Q5QA 1XWKA 2BTOT 5HR1A 3R3EA 2GT5A 1M99A 5C04A 1WE0A 5E4WA 4PUFC 3IXRA 3QR6A 1PKZA 4YQVA 3UARA 2H0GA 4K7OA 1ZOFA 2B5EA 3C71A 3BCIA 3BBYA 1V40A 1A24A 1HYUA 3P2AA 1TRVA 2CZ2A 4HQZA 2H0HA 4V2LA 4EDZA 3ZFBA 5D8IA 2K18A 4POMA 4L0WA 1XCCA 3IA1A 1N8JA 1K3LA 4PNFA 4MLYA 4TW5A 4BPYA 1MDKA 2OE1A 2OBIA 5G5FA 2AJQB 1NHOA 3UJ1A 1FOVA 4N11A 2E2MA 1GRXA 4I97A 4JRRA 4ZL9A 2REMA 1ERTA 1JZOA 2AAWA 2H6YA 2CA8A 3P7XA 2LV3A 2ON7A 2PMTA 1PRXA 4F0BA 3K8NA 1SYXA 2OA7A 1T7PB 2IIYA 3L4NA 3DD3A 2LTKA 5L71A 4GWRA 5JCGA 1T4ZA 2DSAA 3Q74A 1T4YA 2IMDA 3M3MA 2VIMA 2DJKA 1GH2A 3GL3A 1GUKA 2ES7A 2WS2A 1GSQA 3MAKA 2OBKA 2J9HA 1T3BA 4IGJA 3KMOA 2EIQA 3EPTA 1XXUA 2L4QA 5DJMA 2AB6A 4GCIA 1URMA 1PKWA 3HVXA 2HNLA 1I5GA 4XIHA 1SL1B 1WWJA 1Z6NA 2CT6A 4I2UA 5HFKA 4KUNA 2DJJA 5DALB 1OE7A 3H79A 5ECHB 3GKKA 3MSZA 4KGIA 2JL4A 1V9WA 3A3TA 2H0IA 1SL0B 1Z3EA 2HFDA 1K0NA 2L4CA 1X9SB 1R26A 2WULA 1EGRA 3CTFA 5ELGA 3CXGA 4XS4B 1X5CA 4MH3A 4O5QA 1KTEA 2QGVA 3E3EA 1A2MA 5ID2A 4TR1A 1E6BA 2I81A 2GZYA 5CREA 1M9BA 3HKRA 2H1GA 3W8JA 2PVQA 3TJKA 2VL9A 14GSA 1TI1A 2PVOC 2VCZA 3UVHA 5CAXA 5B8BA 1THOA 3TKSE 4GLTA 4WF4A 1G0TA 4PGTA 5GAND 1Z7PA 4HQSA 1TP9A 8GSSA 2GS3A 1OC9B 3LJRA 3LQ7A 3IC8A 4ZL8A 2FNOA 2AV4A 3KH7A 1SKWB 1MEKA 2JSYA 1F3BA 4F0CA 3JCML 2XBIA 5HFGA 2YANA 1ZGNA 3WT2A 1PD21 4RI6A 1F3AA 4G0KA 1XWBA 1V98A 2YCDA 1MDIA 3GTUB 4HZ4A 4RQRA 6GSWA 3UIWA 2PWJA 2NTOA 4K6XA 1GTIA 1YKAA 2CAIA 1O85A 1PGTA 3UAPA 20GSA 2LS5A 5CRDA 4BL7B 4L5OA 1S3CA 5IIZA 1EP7A 4EC0A 2H1BA 3DVWA 2F51A 1EV4A 5H5SA 2FWHA 1I9DA 4TXOB 1K0DA 3UBKA 4OD7A 1GTBA 1YJ6A 5IOWA 1NM3A 2FWFA 2GZZA 2CVKA 2R37A 2B3SA 2YZHA 1F9MA 4GXZA 3OR5A 4F82A 4PQ1A 4TOPA 1H75A 2UZ8A 2F8FA 1GSYA 2XC2A 5IOXA 3PINA 4ML1A 1EEMA 4CDOA 4IS0A 5D9XA 1GSFA 2VL3A 2H19A 3GKMA 3ZREA 1XPVA 1ZL9A 4Z2UA 5B6NA 3CRTA 3F4SA 2RUFA 1V57A 1SENA 3TKSA 3TRXA 2JU5A 2RLIA 3F3RA 4PXOA 3RHBA 3BOAA 3ZVJA 3APSA 2H70A 3MWHA 4XS1A 2VCVA 4TVEA 1K3OA 5G30A 5EVOA 2WZ9A 1TJDA 1OC3A 4PNGA 4MF7A 1M7TA 4D73A 4EUYA 2VM1A 4GRFA 1MD4A 1XWAA 5G2ZA 4Q5NA 1GL8A 2CQ9A 4K7IA 3EU4A 2GQMA 3GN3A 5GSSA 4WBJA 6GSXA 4K2XA 3EYTA 3NIVA 4MPFA 1R5AA 4FYBA 2FWGA 1T8EB 4BWQA 1G7OA 3EURA 3D4MA 3IC4A 3WD6A 2VO4A 1SD8A 1XOBA 4MZWA 3ZL5A 4K7NA 4MP4A 4L0UA 3DGQA 5CRWA 5IMVA 2H6XA 4XCSA 3US3A 4ECJA 2FA8A 2DLXA 3FR9A 4PUAA 5IPGA 4IP1A 2H72A 3TKQA 1FAAA 18GSA 4WXTA 2C0EA 3QFAC 1OYJA 1BYEA 1YEXA 4AJ6A 2YV7A 3ERGA 4AJ7A 2GQKA 1YZXA 2VD1A 3ZIVA 4NMUA 1ACVA 1M2DA 2DJ3A 5AGYA 4K8MA 2XHFA 3E9JB 1GLQA 5ECNB 4BVXB 4IJIA 4TR3A 4G9HA 4RUVA 4MDCA 3NOFA 2M46A 3ZZXA 2K8SA 3D5JA 2GZPA 2A2SA 1E2YA 1OAZA 2HLSA 1RQMA 1PN0A 2VCWA 3AY8A 2RUEA 3WGEA 5IM9A 2TRCP 4IP6A 2L6CA 3C73A 3SBCA 2VD0A 2GT6A 2WCIA 2YWOA 2R3XA 3ZMLA 3GH6A 3GUSA 5A4WA 1U3IA 1M2AA 4JZQA 4QL9A 4EO3A 2RIIA 3MDKA 4ULXA 4WR5A 4DSSB 2JADA 1ABAA 2YNXA 3FK8A 1DSBA 2HRKA 3RPPA 1AW9A 4EF0A 3VK9A 3DIEA 4G2EA 1Z5YE 4JR6A 5B6MA 4CHSA 4OFTA 3F4TA 4I8BA 3IOSA 4Z7XA 2ALBA 3HY2A 2C8UA 1CQGA 1EOHA 1Z6MA 3W6GA 1SU9A 4FO5A 3MYDA 5KEJA 2L57A 2MBTA 1HNBA 1X5DA 2A2RA 19GSA 3NZNA 4HU9A 1FOHA 1J9BA 2B1KA 2OJLA 5F8BA 4HS1A 1R4WA 5HFIA 22GSA 4V1Ag 2WJUA 1K0OA 2IWTA 3UVTA 1S3AA 4ILFA 1FVKA 6GSUA 4Z2RA 4ECCA 3UMAA 4F03A 3VPQA 1N2AA 1XW6A 5CP1A 1O73A 3EE2A 1OE8A 1FHEA 5GZZB 1JZWA 1SJIA 2VCTA 1TK8B 2LEGA 3GL5A 1ZZYA 1FVJA 3FYGA 1ZYEA 4KDXA 3VURA 1Z9HA 4V2MA 3CMIA 5DQYA 2LRNA 2C80A 4FYCA 4PX1A 2B5YA 4F9ZA 2R0PA 3GA4A 1Y25A 1WRYA 4N0VA 2M72A 2HRFA 4BVYB 2BMXA 2H1AA 3IR4A 3TUEA 1PQNA 1K3YA 2VUPA 4TR1B 1ILOA 3D0ZA 5IO2A 3ISOA 4EXJA 1NW2A 3QAWA 2EIRA 1U6TA 5AN1A 5ECIB 3IAS2 4H86A 3KEBA 3GYKA 5D73A 5DCGA 3G9BA 2N5FA 3G7IA 3FW2A 2LJKA 4K5RA 5G31A 4FQUA 4K2DA 3E0UA 3FR3A 2H74A 3KXOA 2FY6A 5CRHA 2H6ZA 1XIYA 4EE0A 3QAGA 1EEJA 5ELAA 1XVWA 3RPNA 5ENUA 3P90A 4HDEA 1GWCA 2H76A 2H71A 2IPAA 4JEDA 1BAYA 4LL4B 3KM6A 2QKEA 2MBSA 3FKFA 2HZEA 2AYTA 4MJEA 2C0GA 4KNDA 2IN3A 3ZRDA 5ECOB 3GFKA 4HZ2A 2GGTA 1GSDA 1KEBA 3HVVA 2VLTA 4LLRA 4LL1B 3LG6A 1QMVA 2VCQA 2FUG2 1TRUA 4MF5A 1XVQA 3QMXA 5E59A 3TRPA 1PSQA 6GSTA 1PX6A 2DMLA 5AIVA 1NHYA 2HXKA 1AUCA 5J5NA 4MPGA 1GNWA 2G2QA 4OCFA 4PTSA 2OACA 4HJ2A 2FHEA 4A5PA 10GSA 2MMOA 5INYA 3H93A 4BA7A 1YKCA 3LGCA 4J2FA 1TXXA 3TKSC 2YJ7A 2GLRA 3IRAA 4L5LA 3VWWA 3EMXA 4L8EA 3VI7A 3EC3A 4J56E 2PGTA 2C4JA 4JBBA 5H5QA 2V41A 4LMWA 1A8LA 4CY8A 3RBTA 2AHEA 3KP8A 1FB0A 2YJHA 2YPMA 3ZVJD 4AF2A 3A2WA 2H75A 2RM6A 1SKSB 1AQWA 2EC4A 2MMAA 3F6DA 1K0BA 1FW1A 4HOJA 4DEJA 4D73B 4X1UA 2YN1A 1AC1A 4TXVA 5ECPB 5IO0A 1U87A 3GKNA 4ISDA 2EIOA 2H8LA 4RQXA 5G1KA 1XZOA 2WDUA 3QAVA 3DEXA 1YEPA 1EOGA 4EKZA 4EDYA 4MF6A 3KMNA 4QQ7A 1SJ6A 2CAQA 2CVBA 2ZCTA 2L5LA 2JZSA 2NVLA 2MMNA 3O6TA 3O3TA 2Z9SA 4V2NA 4IVFA 2DBCA 4NXIA 3ZMKA 3IBHA 4ECBA 3QDNA 2GSSA 4IQAA 5HQPA 1ON4A 1R7HA 4G19A 1BG5A 3VWVA 1M2BA 5J41A 3HDCA 4NWYA 4K1FA 1GUMA 4HJMA 3Q18A 4O7HA 2V6KA 3QOUA 4HI7A 4MA9A 2KUCA 3ZIJA 4WBRD 5ECLB 1TDIA 2O7KA 3VLNA 4MH2A 4MMMA 1A23A 2X99A 2C3NA 2H1DA 2R0CA 1W4VA 1WP0A 1GULA 3L0HA 2CZ3A 2LRTA 5DQSA 5F0GA 2IJYA 5DALA 2D2ZA 5D9TA 1EZKA 2VOCA 5LNKe 2K9FA 3D22A 2RM5A 2HYXA 4XRDA 3LW9A 4N30A 1HNAA 1OVNA 3C1SA 2O8VB 1X9WB 2IMFA 3WGDA 3C1RA 4CY6A 1ZMAA 4XS4A 4YAVA 5HR2A 4NHWA 1WMJA 4TKYA 3FY7A 3GHAA 4IQ1A 1EWXA 3DWVA 5F07A 5DAKA 4MABA 2WRTA 5LCZA 5ECRB 2P31A 3ZYWA 1O6JA 4IBPA 3UL3A 3V1WA 3R2QA 2E7PA 3D21A 3VPTA 1YY7A 5FWGA 2QA1A 1ZYQB 4MZCA 4MJCA 5IMFA 4HU7A 3BJ5A 3GIXA 4EIPA 4N10A 3WT1A 4XRAA 3LYKA 2YP6A 2X8CA 1O8WA 3HZ8A 1TRSA 3EINA 3I9V2 1OC9A 2DIYA 4USSA 5IMAA 3QPMA 1QFNA 1XFLA 1TU8A 3APOA 1ZCPA 1RK4A 2HE3A 4KB3A 2VL2C 2N5AA 2YV9A 2A2PA 3L9UA 2HSHA 3P8WA 5KN2A 2A4VA 2PERA 2KP1A 5A4UA 4WKWA 4AJ8A 1T1VA 3O76A 2PN8A 3ZFLA 2HT9A 4PQHA 4POLA 4V1Ap 3HVSA 1A8YA 4BL7A 1EP8A 4GQFA 5DJLA 2IMIA 2H01A 3MNGA 5ECSA 4JE1A 1ERVA 5J9BA 3KJYA 3EMPA 2F9SA 2GDRA 4ZIJA 2MYGA 2I3YA 1MDJA 2HRAA 3CSHA 2I1UA 3HXSA 5DVBA 1B9XC 3F9UA 3S9FA 3KGKA 5AIXA 2FCHA 3N9JA 4MCUA 2V6OA 4OO4A 2C0DA 1A0RP 2PU9C 3IAM2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HSY A;  1ST9 A;  2J23 A;  2GVP A;  4OFN A;  3TRQ A;  1B8X A;  2KOK A;  1XBS A;  3FR6 A;  3TOU A;  2KP2 A;  4ZBB A;  2H66 A;  3TOT A;  4PQI A;  1PN9 A;  5JWR B;  4ML6 A;  1PL2 A;  2KLX A;  2ZNM A;  4GF0 A;  1B9Y C;  2C1Y A;  2LJR A;  1LU4 A;  3C8E A;  3ZTL A;  1SK0 A;  3LXZ A;  1C72 A;  3CBU A;  4PUR A;  5EL8 A;  1CQH A;  4Q5F A;  1SK2 A;  1G7E A;  16GS A;  2DJ0 A;  1UC7 A;  1GUH A;  1YF1 A;  2OE0 A;  2LRC A;  1JLV A;  6GSS A;  2K8V A;  1YDK A;  3VI5 A;  2V2G A;  2V32 A;  2P5Q A;  2JAC A;  1BQ7 A;  3I69 A;  1M9A A;  5A4V A;  1WPI A;  5AIS A;  4EVM A;  1O81 A;  3LSZ A;  5JCU A;  3J7Y b;  4IHU A;  3GRX A;  1BX9 A;  1AIU A;  7GSS A;  3GUR A;  3ZIT A;  1G6W A;  3VWX A;  2CX3 A;  1GSS A;  2GTU A;  1S3D A;  2HRN A;  3PGT A;  3M9K A;  2F3M A;  4MJB A;  3EVI A;  3WGX A;  3WYW A;  4KX4 A;  3KCM A;  1X5E A;  4TR0 A;  2C3T A;  3PR8 A;  2XPD A;  3TCO A;  3IK7 A;  4ZB9 A;  2X64 A;  2IFQ A;  3LEF A;  1F37 A;  2DMM A;  4TN8 A;  1F6M C;  3LWA A;  3GST A;  3ZLP A;  4ACS A;  2VM2 A;  2JZT A;  1UA5 A;  3L9S A;  6GSY A;  5ID2 B;  3CRU A;  2GQL A;  2LJA A;  2FD3 A;  3F6F A;  3QFB C;  3FHK A;  4I2T A;  2DJ2 A;  4EL1 A;  1NSW A;  5KN0 A;  4POB A;  3G7Y A;  3M1G A;  3I43 A;  4E8E A;  4NPB A;  5B8A A;  2M80 A;  3TKR A;  3DRN A;  2B7K A;  3Q6O A;  2LUS A;  4YH2 A;  5IQY A;  4ID0 A;  3SWL A;  3ERF A;  3KTB A;  4DSR A;  4DSS A;  2GSQ A;  3M9J A;  1WJK A;  4KW6 A;  2C3Q A;  3ERW A;  3APQ A;  6GSV A;  3FRC A;  2P0G A;  2QC7 A;  1LBK A;  4KDU A;  1XW5 A;  3KTL A;  1PX7 A;  2F8A A;  1WIK A;  2VAF A;  1XW9 A;  3KD0 A;  3PH9 A;  4IKH A;  3HYP A;  3CTG A;  1JHB A;  2ZUP A;  1PL1 A;  3H8Q A;  4OWY A;  1ML6 A;  5DCH A;  4IN0 A;  2CV4 A;  1R5P A;  4KDY A;  3HJP A;  2E2G A;  4O5R A;  2DIZ A;  2O89 A;  5ABR A;  3F3Q A;  1FO5 A;  2YWM A;  3LXT A;  4MJA A;  1GP1 A;  5DBQ A;  4YAP A;  2IMK A;  2E0Q A;  3TB2 A;  3U6V A;  2TRX A;  4O32 A;  2LQQ A;  1TKD B;  3FZ5 A;  2FWE A;  3L9V A;  1DUG A;  1X9M B;  1M0U A;  2B6M A;  5C00 A;  4TRX A;  4KSM A;  4NV5 A;  4XHM A;  1J0F A;  2OE3 A;  1QK8 A;  5IMC A;  2H73 A;  5ECK B;  4WEY A;  3M0F A;  2NBS A;  1VF1 A;  13GS A;  3FEU A;  2CX4 A;  1SL2 B;  3GH9 A;  4ZB6 A;  3KH9 A;  2QSI A;  5CYY A;  3ED3 A;  3HA9 A;  2WB9 A;  4GST A;  3RDW A;  2WFC A;  4ZBD A;  5HR0 A;  2XBQ A;  1BED A;  2B7J A;  3KIJ A;  3DXB A;  3QD9 A;  5D93 A;  4BVY A;  3G7J A;  5DAK B;  1U88 A;  5F05 A;  4ECI A;  2PPT A;  2LNT A;  3IHQ A;  5EPF A;  4OMV A;  3ME7 A;  4KAE A;  1GSE A;  3KP9 A;  3H4K A;  5JCW A;  2JZR A;  4K0G A;  3ME8 A;  3BD2 A;  2B1L A;  1QUW A;  3EWL A;  1AQX A;  3CYN A;  1GTA A;  3TJJ A;  4IW9 A;  4OFM A;  3U5R E;  3BCK A;  1RW1 A;  3GX0 A;  5JWO B;  1JLW A;  4YQU A;  2VCX A;  5J3R A;  3VFI A;  1TI3 A;  2NPB A;  2N5B A;  12GS A;  3J7Y k;  4CW9 A;  2X8G A;  1DE1 A;  3D4T A;  3GV1 A;  5CRG A;  3TDG A;  5B7C A;  1X0R A;  4IJ3 A;  1K0A A;  5IMD A;  3F0I A;  5CNW A;  1SD9 A;  1GLP A;  2LST A;  2PUK C;  3IDV A;  4KCE A;  4GTU A;  3I6A A;  2LKU A;  1OKT A;  2L5O A;  1PMT A;  1W89 A;  1JZD A;  17GS A;  4RI7 A;  4JR4 A;  4X0X A;  3TGZ A;  1UVZ A;  2K6V A;  2ON5 A;  1U3A A;  2DJ1 A;  2MZC A;  3FZA A;  3EU3 A;  2OAD A;  3QCP A;  3DKS A;  2FGX A;  3UEM A;  5D96 A;  1SJZ A;  2H30 A;  1MD3 A;  1VF4 A;  1F2E A;  3M8N A;  3LYP A;  2GST A;  2MMZ A;  3A5W A;  1OKD A;  2R5G A;  5GAP D;  1A0F A;  1QXH A;  1K0C A;  2KHP A;  2BJX A;  3A2X A;  4POK A;  2FLS A;  1XWG A;  1ERW A;  4ZL7 A;  4ZXG A;  1B4Q A;  1VGL A;  3W8S A;  2C0F A;  1THX A;  2R4V A;  4HEA 2;  2GSR A;  5COH A;  3LOR A;  1GNE A;  1TW9 A;  5EY6 A;  2I9H A;  4QL7 A;  3GNJ A;  5KN1 A;  4E8H A;  3FZ9 A;  2HZF A;  3TKP A;  1KNG A;  1Y6E A;  1IYH A;  1MTC A;  4JU5 A;  1B4P A;  2WGR A;  1QGV A;  1A2J A;  1FG4 A;  1TK0 B;  1EV9 A;  3HJO A;  4Q5R A;  4ZB8 A;  1JZR A;  4AGS A;  1HD2 A;  4NHZ A;  3CSJ A;  2YWN A;  4OO5 A;  1USB A;  1LJR A;  4J57 E;  3DVX A;  1TTZ A;  3HJM A;  3LFL A;  2G0F A;  5JWQ B;  3IPZ A;  4ZIL A;  4IEL A;  2VLV A;  3N5O A;  2L59 A;  4K9Z A;  2P5R A;  1TOF A;  3L78 A;  4OCE A;  2HI7 A;  2IL3 A;  3HCZ A;  4YQM A;  2FA4 A;  5IMZ A;  1T00 A;  5CO3 A;  3GMF A;  4GQC A;  2NDO A;  4FH8 A;  1VRS D;  2I4A A;  9GSS A;  1AXD A;  3C7M A;  3CSI A;  4P3Y B;  3F8U A;  2OKA A;  1XWC A;  1V58 A;  4MZB A;  1TU7 A;  2AUV A;  1V2A A;  4WR4 A;  1H4O A;  5FT3 A;  2YWI A;  3UBL A;  3GTU A;  2O85 A;  2PBJ A;  3F4R A;  2R2J A;  1TK5 B;  2V1M A;  1Z7R A;  3Q19 A;  3TJB A;  1VF2 A;  5F06 A;  3GX8 A;  2CVD A;  3A2V A;  1AQV A;  4N0Z A;  1TRW A;  4O92 A;  4GSN A;  2LQO A;  2DC5 A;  2YZU A;  4KH7 A;  1Q98 A;  2X8H A;  4KE3 A;  5D9V A;  3IE3 A;  1HNC A;  2IFQ B;  2JSZ A;  4X43 A;  1IYI A;  4TXO A;  4K0N A;  1KBN A;  2O87 A;  3RHC A;  1DBY A;  1K0M A;  1Q4J A;  2VLU A;  3VWU A;  1SYR A;  1FB6 A;  1ERU A;  4TR4 A;  5A5K A;  5ECM B;  2TIR A;  5D9W A;  3HZ4 A;  3HHV A;  4FIW A;  5FHI A;  5GST A;  3GSS A;  5IPH A;  3H1N A;  1JFU A;  4LA1 A;  3TJF A;  3RAZ A;  1QQ2 A;  3TJG A;  5KN3 A;  1PA3 A;  3DML A;  4KCA A;  5H5R A;  1EGO A;  1B48 A;  1SKR B;  1AAZ A;  2L6D A;  3IK9 A;  4NAX A;  1DE2 A;  1VF3 A;  2IME A;  4HUA A;  3KZQ A;  1O7U A;  1GSU A;  1SK1 A;  5J9C A;  5LD0 A;  5G5E A;  4DSQ A;  5HR3 A;  1O8X A;  2HZE B;  4I6X A;  5DDL A;  1G6Y A;  4NV2 A;  3GKX A;  1XOA A;  3D6I A;  4F2I A;  1GTU A;  4DVC A;  3HD5 A;  4KSO A;  3DYR A;  4G10 A;  1WOU A;  5ECQ B;  4FYU A;  1YQ1 A;  11GS A;  3F63 A;  1YF0 A;  5J4U A;  2R6K A;  1A2L A;  1HQO A;  4WF5 A;  4GSS A;  4I5Q A;  4XS6 A;  4KA0 A;  4XTS A;  3UOM A;  2B5X A;  2VL2 A;  4WET A;  4MK3 A;  1J08 A;  1BJX A;  4LMV A;  1OC8 A;  1UN2 A;  3IV4 A;  4BWS A;  4BVX A;  2LNS A;  2YOI A;  5G1L A;  4ZBA A;  3FZ4 A;  2XPE A;  4Q5Q A;  1XWK A;  2BTO T;  5HR1 A;  2GT5 A;  1M99 A;  5C04 A;  1WE0 A;  5E4W A;  4PUF C;  3IXR A;  3QR6 A;  1PKZ A;  4YQV A;  3UAR A;  2H0G A;  4K7O A;  1ZOF A;  2B5E A;  3C71 A;  3BCI A;  3BBY A;  1V40 A;  1A24 A;  1HYU A;  3P2A A;  1TRV A;  2CZ2 A;  4HQZ A;  2H0H A;  4V2L A;  4EDZ A;  3ZFB A;  5D8I A;  2K18 A;  4L0W A;  4POM A;  1XCC A;  3IA1 A;  1N8J A;  1K3L A;  4PNF A;  4MLY A;  4TW5 A;  4BPY A;  1MDK A;  2OE1 A;  2OBI A;  5G5F A;  2AJQ B;  1NHO A;  3UJ1 A;  1FOV A;  4N11 A;  2E2M A;  1GRX A;  4I97 A;  4JRR A;  4ZL9 A;  2REM A;  1ERT A;  1JZO A;  2AAW A;  2H6Y A;  2CA8 A;  3P7X A;  2LV3 A;  2ON7 A;  2PMT A;  1PRX A;  4F0B A;  3K8N A;  1SYX A;  2OA7 A;  1T7P B;  2IIY A;  3L4N A;  3DD3 A;  2LTK A;  5L71 A;  4GWR A;  5JCG A;  1T4Z A;  2DSA A;  3Q74 A;  1T4Y A;  2IMD A;  3M3M A;  2VIM A;  2DJK A;  1GH2 A;  3GL3 A;  1GUK A;  2ES7 A;  2WS2 A;  1GSQ A;  3MAK A;  2OBK A;  2J9H A;  1T3B A;  4IGJ A;  3KMO A;  2EIQ A;  1XXU A;  2L4Q A;  5DJM A;  2AB6 A;  4GCI A;  1URM A;  1PKW A;  3HVX A;  2HNL A;  1I5G A;  4XIH A;  1SL1 B;  1WWJ A;  1Z6N A;  2CT6 A;  4I2U A;  5HFK A;  4KUN A;  2DJJ A;  5DAL B;  5ECH B;  1OE7 A;  3H79 A;  3GKK A;  3MSZ A;  4KGI A;  2JL4 A;  1V9W A;  3A3T A;  2H0I A;  1SL0 B;  1Z3E A;  2HFD A;  1K0N A;  2L4C A;  1X9S B;  1R26 A;  2WUL A;  1EGR A;  3CTF A;  5ELG A;  3CXG A;  4XS4 B;  1X5C A;  4MH3 A;  1KTE A;  2QGV A;  3E3E A;  1A2M A;  5ID2 A;  4TR1 A;  1E6B A;  2I81 A;  2GZY A;  5CRE A;  1M9B A;  3HKR A;  2H1G A;  3W8J A;  2PVQ A;  3TJK A;  2VL9 A;  14GS A;  1TI1 A;  2PVO C;  2VCZ A;  3UVH A;  5CAX A;  5B8B A;  1THO A;  3TKS E;  4GLT A;  4WF4 A;  1G0T A;  4PGT A;  5GAN D;  1Z7P A;  4HQS A;  1TP9 A;  8GSS A;  2GS3 A;  1OC9 B;  3LJR A;  3LQ7 A;  4ZL8 A;  2FNO A;  2AV4 A;  3KH7 A;  1SKW B;  1MEK A;  2JSY A;  1F3B A;  4F0C A;  3JCM L;  2XBI A;  5HFG A;  2YAN A;  1ZGN A;  3WT2 A;  1PD2 1;  4RI6 A;  1F3A A;  1XWB A;  1V98 A;  2YCD A;  1MDI A;  3GTU B;  4HZ4 A;  4RQR A;  6GSW A;  3UIW A;  2PWJ A;  2NTO A;  4K6X A;  1GTI A;  1YKA A;  2CAI A;  1O85 A;  1PGT A;  3UAP A;  20GS A;  2LS5 A;  5CRD A;  4L5O A;  1S3C A;  5IIZ A;  1EP7 A;  4EC0 A;  2H1B A;  3DVW A;  2F51 A;  1EV4 A;  5H5S A;  2FWH A;  1I9D A;  4TXO B;  1K0D A;  3UBK A;  4OD7 A;  1GTB A;  1YJ6 A;  5IOW A;  1NM3 A;  2FWF A;  2GZZ A;  2CVK A;  2R37 A;  2B3S A;  2YZH A;  1F9M A;  4GXZ A;  3OR5 A;  4F82 A;  4PQ1 A;  4TOP A;  1H75 A;  2F8F A;  1GSY A;  2XC2 A;  5IOX A;  3PIN A;  4ML1 A;  1EEM A;  4CDO A;  4IS0 A;  5D9X A;  1GSF A;  2VL3 A;  2H19 A;  3GKM A;  3ZRE A;  1XPV A;  1ZL9 A;  5B6N A;  3CRT A;  3F4S A;  2RUF A;  1V57 A;  1SEN A;  3TKS A;  3TRX A;  2JU5 A;  2RLI A;  3F3R A;  4PXO A;  3RHB A;  3BOA A;  3ZVJ A;  3APS A;  2H70 A;  3MWH A;  4XS1 A;  2VCV A;  4TVE A;  1K3O A;  5G30 A;  5EVO A;  2WZ9 A;  1TJD A;  1OC3 A;  4PNG A;  4MF7 A;  1M7T A;  4D73 A;  4EUY A;  2VM1 A;  4GRF A;  1MD4 A;  1XWA A;  5G2Z A;  4Q5N A;  1GL8 A;  2CQ9 A;  4K7I A;  3EU4 A;  2GQM A;  3GN3 A;  5GSS A;  4WBJ A;  6GSX A;  3EYT A;  3NIV A;  4MPF A;  1R5A A;  4FYB A;  2FWG A;  1T8E B;  4BWQ A;  1G7O A;  3EUR A;  3D4M A;  3IC4 A;  3WD6 A;  2VO4 A;  1SD8 A;  1XOB A;  4MZW A;  3ZL5 A;  4K7N A;  4MP4 A;  4L0U A;  3DGQ A;  5CRW A;  5IMV A;  2H6X A;  4XCS A;  3US3 A;  4ECJ A;  2FA8 A;  2DLX A;  3FR9 A;  4PUA A;  5IPG A;  4IP1 A;  2H72 A;  3TKQ A;  1FAA A;  18GS A;  4WXT A;  2C0E A;  3QFA C;  1OYJ A;  1BYE A;  1YEX A;  4AJ6 A;  2YV7 A;  3ERG A;  4AJ7 A;  2GQK A;  1YZX A;  2VD1 A;  3ZIV A;  4NMU A;  1ACV A;  1M2D A;  2DJ3 A;  5AGY A;  4K8M A;  2XHF A;  3E9J B;  1GLQ A;  5ECN B;  4IJI A;  4TR3 A;  4G9H A;  4RUV A;  4MDC A;  3NOF A;  2M46 A;  3ZZX A;  2K8S A;  3D5J A;  2GZP A;  2A2S A;  1E2Y A;  1OAZ A;  2HLS A;  1RQM A;  2VCW A;  3AY8 A;  2RUE A;  3WGE A;  5IM9 A;  2TRC P;  4IP6 A;  2L6C A;  3C73 A;  3SBC A;  2VD0 A;  2GT6 A;  2WCI A;  2YWO A;  2R3X A;  3ZML A;  3GH6 A;  3GUS A;  5A4W A;  1U3I A;  1M2A A;  4JZQ A;  4QL9 A;  4EO3 A;  2RII A;  3MDK A;  4ULX A;  4WR5 A;  4DSS B;  2JAD A;  1ABA A;  2YNX A;  3FK8 A;  1DSB A;  3RPP A;  1AW9 A;  4EF0 A;  3VK9 A;  3DIE A;  4G2E A;  1Z5Y E;  4JR6 A;  5B6M A;  4CHS A;  4OFT A;  3F4T A;  4I8B A;  3IOS A;  4Z7X A;  2ALB A;  3HY2 A;  2C8U A;  1CQG A;  1EOH A;  1Z6M A;  3W6G A;  1SU9 A;  4FO5 A;  5KEJ A;  2L57 A;  2MBT A;  1HNB A;  1X5D A;  2A2R A;  19GS A;  3NZN A;  4HU9 A;  1J9B A;  2B1K A;  2OJL A;  5F8B A;  4HS1 A;  1R4W A;  5HFI A;  22GS A;  4V1A g;  2WJU A;  1K0O A;  2IWT A;  3UVT A;  1S3A A;  4ILF A;  1FVK A;  6GSU A;  4ECC A;  3UMA A;  4F03 A;  3VPQ A;  1N2A A;  1XW6 A;  5CP1 A;  1O73 A;  3EE2 A;  1OE8 A;  1FHE A;  5GZZ B;  1JZW A;  1SJI A;  2VCT A;  1TK8 B;  2LEG A;  3GL5 A;  1ZZY A;  1FVJ A;  3FYG A;  1ZYE A;  4KDX A;  3VUR A;  1Z9H A;  4V2M A;  3CMI A;  5DQY A;  2LRN A;  2C80 A;  4FYC A;  4PX1 A;  2B5Y A;  4F9Z A;  3GA4 A;  1Y25 A;  1WRY A;  4N0V A;  2M72 A;  2HRF A;  2BMX A;  2H1A A;  3IR4 A;  3TUE A;  1PQN A;  1K3Y A;  2VUP A;  4TR1 B;  1ILO A;  3D0Z A;  5IO2 A;  3ISO A;  4EXJ A;  1NW2 A;  3QAW A;  2EIR A;  1U6T A;  5AN1 A;  5ECI B;  3IAS 2;  4H86 A;  3KEB A;  3GYK A;  5D73 A;  5DCG A;  3G9B A;  2N5F A;  3G7I A;  3FW2 A;  2LJK A;  5G31 A;  4K2D A;  3E0U A;  3FR3 A;  2H74 A;  3KXO A;  2FY6 A;  5CRH A;  2H6Z A;  1XIY A;  4EE0 A;  3QAG A;  1EEJ A;  5ELA A;  1XVW A;  3RPN A;  5ENU A;  3P90 A;  4HDE A;  1GWC A;  2H76 A;  2H71 A;  2IPA A;  4JED A;  1BAY A;  4LL4 B;  3KM6 A;  2QKE A;  2MBS A;  3FKF A;  2HZE A;  2AYT A;  4MJE A;  2C0G A;  4KND A;  2IN3 A;  3ZRD A;  5ECO B;  3GFK A;  4HZ2 A;  2GGT A;  1GSD A;  1KEB A;  3HVV A;  2VLT A;  4LLR A;  4LL1 B;  3LG6 A;  1QMV A;  2VCQ A;  2FUG 2;  1TRU A;  4MF5 A;  1XVQ A;  3QMX A;  5E59 A;  3TRP A;  1PSQ A;  6GST A;  1PX6 A;  2DML A;  5AIV A;  1NHY A;  2HXK A;  1AUC A;  5J5N A;  4MPG A;  1GNW A;  2G2Q A;  4OCF A;  2OAC A;  4HJ2 A;  2FHE A;  10GS A;  2MMO A;  5INY A;  3H93 A;  4BA7 A;  1YKC A;  3LGC A;  4J2F A;  1TXX A;  3TKS C;  2YJ7 A;  2GLR A;  3IRA A;  4L5L A;  3VWW A;  3EMX A;  4L8E A;  3VI7 A;  3EC3 A;  4J56 E;  2PGT A;  2C4J A;  4JBB A;  5H5Q A;  2V41 A;  4LMW A;  1A8L A;  3RBT A;  2AHE A;  3KP8 A;  1FB0 A;  2YJH A;  2YPM A;  3ZVJ D;  4AF2 A;  3A2W A;  2H75 A;  2RM6 A;  1SKS B;  1AQW A;  2EC4 A;  2MMA A;  3F6D A;  1K0B A;  1FW1 A;  4HOJ A;  4DEJ A;  4D73 B;  4X1U A;  2YN1 A;  1AC1 A;  4TXV A;  5ECP B;  5IO0 A;  1U87 A;  3GKN A;  4ISD A;  2EIO A;  2H8L A;  4RQX A;  5G1K A;  1XZO A;  2WDU A;  3QAV A;  3DEX A;  1YEP A;  1EOG A;  4EKZ A;  4EDY A;  4MF6 A;  3KMN A;  4QQ7 A;  1SJ6 A;  2CAQ A;  2CVB A;  2ZCT A;  2L5L A;  2JZS A;  2NVL A;  2MMN A;  3O6T A;  3O3T A;  2Z9S A;  4V2N A;  4IVF A;  2DBC A;  4NXI A;  3ZMK A;  3IBH A;  4ECB A;  3QDN A;  2GSS A;  4IQA A;  5HQP A;  1ON4 A;  1R7H A;  4G19 A;  1BG5 A;  3VWV A;  1M2B A;  5J41 A;  3HDC A;  4NWY A;  4K1F A;  1GUM A;  4HJM A;  3Q18 A;  4O7H A;  2V6K A;  3QOU A;  4HI7 A;  4MA9 A;  2KUC A;  3ZIJ A;  4WBR D;  5ECL B;  1TDI A;  2O7K A;  3VLN A;  4MH2 A;  4MMM A;  1A23 A;  2X99 A;  2C3N A;  2H1D A;  1W4V A;  1WP0 A;  1GUL A;  3L0H A;  2CZ3 A;  2LRT A;  5DQS A;  5F0G A;  2IJY A;  5DAL A;  2D2Z A;  5D9T A;  1EZK A;  2VOC A;  5LNK e;  2K9F A;  3D22 A;  2RM5 A;  2HYX A;  4XRD A;  4N30 A;  1HNA A;  1OVN A;  3C1S A;  2O8V B;  1X9W B;  2IMF A;  3WGD A;  3C1R A;  1ZMA A;  4XS4 A;  4YAV A;  5HR2 A;  4NHW A;  1WMJ A;  4TKY A;  3FY7 A;  3GHA A;  4IQ1 A;  1EWX A;  3DWV A;  5F07 A;  5DAK A;  4MAB A;  2WRT A;  5LCZ A;  5ECR B;  2P31 A;  3ZYW A;  1O6J A;  4IBP A;  3UL3 A;  3V1W A;  3R2Q A;  2E7P A;  3D21 A;  3VPT A;  1YY7 A;  5FWG A;  1ZYQ B;  4MZC A;  4MJC A;  5IMF A;  4HU7 A;  3BJ5 A;  3GIX A;  4N10 A;  3WT1 A;  4XRA A;  3LYK A;  2YP6 A;  2X8C A;  1O8W A;  3HZ8 A;  1TRS A;  3EIN A;  3I9V 2;  1OC9 A;  2DIY A;  5IMA A;  3QPM A;  1QFN A;  1XFL A;  1TU8 A;  3APO A;  1ZCP A;  1RK4 A;  2HE3 A;  4KB3 A;  2VL2 C;  2N5A A;  2YV9 A;  3L9U A;  2HSH A;  3P8W A;  5KN2 A;  2A4V A;  2PER A;  2KP1 A;  5A4U A;  4WKW A;  4AJ8 A;  1T1V A;  3O76 A;  2PN8 A;  3ZFL A;  2HT9 A;  4PQH A;  4POL A;  4V1A p;  3HVS A;  1A8Y A;  4BL7 A;  1EP8 A;  4GQF A;  5DJL A;  2IMI A;  2H01 A;  3MNG A;  5ECS A;  4JE1 A;  1ERV A;  5J9B A;  3KJY A;  3EMP A;  2F9S A;  2GDR A;  4ZIJ A;  2MYG A;  2I3Y A;  1MDJ A;  3CSH A;  2I1U A;  3HXS A;  5DVB A;  1B9X C;  3F9U A;  3S9F A;  3KGK A;  5AIX A;  2FCH A;  3N9J A;  4MCU A;  2V6O A;  4OO4 A;  2C0D A;  1A0R P;  2PU9 C;  3IAM 2; 
#chains in the Genus database with same CATH topology
 2HSY A;  1ST9 A;  2J23 A;  2GVP A;  4OFN A;  3TRQ A;  1B8X A;  2KOK A;  1XBS A;  3FR6 A;  3TOU A;  2KP2 A;  4ZBB A;  2H66 A;  3TOT A;  4PQI A;  1PN9 A;  5JWR B;  4ML6 A;  1PL2 A;  2KLX A;  2ZNM A;  4GF0 A;  1B9Y C;  2C1Y A;  2LJR A;  1LU4 A;  3C8E A;  3ZTL A;  5KOX A;  1SK0 A;  3LXZ A;  1C72 A;  3CBU A;  4PUR A;  5EL8 A;  1CQH A;  4Q5F A;  1SK2 A;  1G7E A;  16GS A;  2DJ0 A;  1UC7 A;  1GUH A;  1YF1 A;  2OE0 A;  2LRC A;  1JLV A;  6GSS A;  2K8V A;  1XG8 A;  1YDK A;  3VI5 A;  2V2G A;  2V32 A;  2P5Q A;  2JAC A;  1BQ7 A;  3I69 A;  1M9A A;  5A4V A;  4HSC X;  1WPI A;  5AIS A;  4EVM A;  1O81 A;  3LSZ A;  5JCU A;  4G0L A;  3J7Y b;  4IHU A;  3GRX A;  1BX9 A;  1AIU A;  7GSS A;  3GUR A;  3ZIT A;  2X49 A;  1G6W A;  3VWX A;  2CX3 A;  1GSS A;  2GTU A;  1S3D A;  2HRN A;  3PGT A;  3M9K A;  2F3M A;  4MJB A;  3EVI A;  3WGX A;  3WYW A;  3A5I A;  4YKF A;  4KX4 A;  3KCM A;  1X5E A;  4TR0 A;  2C3T A;  3PR8 A;  2XPD A;  3TCO A;  3IK7 A;  4ZB9 A;  2X64 A;  2IFQ A;  3LEF A;  1F37 A;  3FMW A;  2DMM A;  4TN8 A;  1F6M C;  3LWA A;  3GST A;  3ZLP A;  4ACS A;  2VM2 A;  2JZT A;  1UA5 A;  3L9S A;  6GSY A;  5ID2 B;  3CRU A;  2GQL A;  2LJA A;  2FD3 A;  3F6F A;  3QFB C;  3FHK A;  4I2T A;  2DJ2 A;  4EL1 A;  2A4H A;  1NSW A;  5KN0 A;  4POB A;  3G7Y A;  4ICY A;  3M1G A;  3I43 A;  4E8E A;  4NPB A;  5B8A A;  2M80 A;  3TKR A;  3DRN A;  2B7K A;  3Q6O A;  2LUS A;  4YH2 A;  5IQY A;  4ID0 A;  3SWL A;  3ERF A;  3KTB A;  2X4A A;  4DSR A;  4DSS A;  2GSQ A;  3M9J A;  1WJK A;  4KW6 A;  2C3Q A;  3ERW A;  3APQ A;  6GSV A;  3FRC A;  2P0G A;  2QC7 A;  1LBK A;  4KDU A;  1XW5 A;  3KTL A;  1PX7 A;  2F8A A;  1WIK A;  2VAF A;  1XW9 A;  3KD0 A;  3PH9 A;  4IKH A;  3HYP A;  3CTG A;  1JHB A;  2ZUP A;  1PL1 A;  3H8Q A;  4OWY A;  1ML6 A;  5DCH A;  4IN0 A;  5BMU A;  2CV4 A;  1R5P A;  4KDY A;  3HJP A;  2E2G A;  4O5R A;  2DIZ A;  2O89 A;  5ABR A;  3F3Q A;  1FO5 A;  2YWM A;  3LXT A;  4MJA A;  1GP1 A;  5DBQ A;  4YAP A;  2IMK A;  2E0Q A;  3TB2 A;  3U6V A;  2TRX A;  4O32 A;  2LQQ A;  3PPU A;  3FZ5 A;  1TKD B;  2FWE A;  3L9V A;  1DUG A;  1X9M B;  1M0U A;  2B6M A;  5C00 A;  4K5S A;  4TRX A;  4KSM A;  4NV5 A;  4MNN A;  4XHM A;  1J0F A;  2OE3 A;  1QK8 A;  5IMC A;  2H73 A;  5ECK B;  4WEY A;  2DKH A;  3M0F A;  2NBS A;  1VF1 A;  13GS A;  3FEU A;  2CX4 A;  1SL2 B;  3GH9 A;  4ZB6 A;  3KH9 A;  2QSI A;  4X4J A;  5CYY A;  3ED3 A;  3HA9 A;  2WB9 A;  4GST A;  3RDW A;  2WFC A;  4ZBD A;  5HR0 A;  2XBQ A;  1BED A;  2B7J A;  3KIJ A;  3DXB A;  3QD9 A;  5D93 A;  4BVY A;  3G7J A;  5DAK B;  1U88 A;  5F05 A;  4ECI A;  2PPT A;  1ZYP A;  2LNT A;  3IHQ A;  5EPF A;  4OMV A;  3ME7 A;  4KAE A;  1GSE A;  3KP9 A;  3H4K A;  5JCW A;  2JZR A;  4K0G A;  3ME8 A;  3BD2 A;  2B1L A;  1QUW A;  3EWL A;  1AQX A;  3CYN A;  1GTA A;  3TJJ A;  4IW9 A;  4OFM A;  3U5R E;  3BCK A;  1RW1 A;  3GX0 A;  5JWO B;  1JLW A;  4YQU A;  2VCX A;  5J3R A;  3VFI A;  1TI3 A;  2NPB A;  2N5B A;  12GS A;  3J7Y k;  4CW9 A;  2X8G A;  1DE1 A;  3D4T A;  3GV1 A;  5CRG A;  3TDG A;  5B7C A;  1X0R A;  4IJ3 A;  1K0A A;  5IMD A;  3F0I A;  5CNW A;  1SD9 A;  1GLP A;  2LST A;  2PUK C;  3IDV A;  4KCE A;  4GTU A;  3I6A A;  2LKU A;  1OKT A;  2L5O A;  1PMT A;  1W89 A;  1JZD A;  17GS A;  4RI7 A;  4JR4 A;  4X0X A;  3TGZ A;  1UVZ A;  2K6V A;  2ON5 A;  1U3A A;  2DJ1 A;  2MZC A;  3FZA A;  3EU3 A;  2OAD A;  3QCP A;  3DKS A;  2FGX A;  3UEM A;  5D96 A;  1SJZ A;  2H30 A;  1MD3 A;  1VF4 A;  1F2E A;  3M8N A;  3LYP A;  2GST A;  2MMZ A;  3A5W A;  1OKD A;  2R5G A;  5GAP D;  1A0F A;  1QXH A;  1K0C A;  2KHP A;  2BJX A;  3A2X A;  4POK A;  2FLS A;  1XWG A;  1ERW A;  4ZL7 A;  4ZXG A;  2QA2 A;  1B4Q A;  1VGL A;  3W8S A;  2C0F A;  1THX A;  2R4V A;  4HEA 2;  2GSR A;  5COH A;  3LOR A;  1GNE A;  1TW9 A;  5EY6 A;  2I9H A;  4QL7 A;  3GNJ A;  5KN1 A;  4O5U A;  4E8H A;  3FZ9 A;  2HZF A;  3TKP A;  1KNG A;  1Y6E A;  1IYH A;  1MTC A;  4JU5 A;  1B4P A;  2WGR A;  1QGV A;  1A2J A;  1FG4 A;  1TK0 B;  1EV9 A;  3HJO A;  4Q5R A;  4ZB8 A;  1JZR A;  4AGS A;  1HD2 A;  4NHZ A;  3CSJ A;  2YWN A;  4OO5 A;  1USB A;  1LJR A;  4J57 E;  3DVX A;  1TTZ A;  3HJM A;  3LFL A;  2G0F A;  5JWQ B;  3IPZ A;  4ZIL A;  4IEL A;  2VLV A;  3N5O A;  2L59 A;  4K9Z A;  4KF9 A;  2P5R A;  4YKG A;  1ZYN A;  1TOF A;  3L78 A;  4OCE A;  2HI7 A;  2IL3 A;  3HCZ A;  4YQM A;  2FA4 A;  5IMZ A;  1T00 A;  5CO3 A;  3GMF A;  4GQC A;  2NDO A;  4FH8 A;  1VRS D;  2I4A A;  9GSS A;  1AXD A;  3C7M A;  3CSI A;  4P3Y B;  3F8U A;  2OKA A;  1XWC A;  1V58 A;  4MZB A;  1TU7 A;  2AUV A;  1V2A A;  4WR4 A;  1H4O A;  5FT3 A;  2YWI A;  3UBL A;  3GTU A;  2O85 A;  2PBJ A;  3F4R A;  2R2J A;  1TK5 B;  2V1M A;  1Z7R A;  3Q19 A;  3TJB A;  1VF2 A;  5F06 A;  3IHG A;  3GX8 A;  2CVD A;  3A2V A;  1AQV A;  4N0Z A;  1TRW A;  4O92 A;  4GSN A;  2LQO A;  2DC5 A;  2YZU A;  4KH7 A;  1Q98 A;  2X8H A;  4KE3 A;  2DKI A;  5D9V A;  3IE3 A;  1HNC A;  2IFQ B;  2JSZ A;  4X43 A;  1IYI A;  4TXO A;  4K0N A;  1KBN A;  2O87 A;  3RHC A;  1DBY A;  1K0M A;  1Q4J A;  2VLU A;  3VWU A;  1SYR A;  1FB6 A;  1ERU A;  4TR4 A;  5A5K A;  5ECM B;  2TIR A;  5D9W A;  3HZ4 A;  3HHV A;  4FIW A;  5FHI A;  5GST A;  3GSS A;  4G0I A;  5IPH A;  5KOW A;  3H1N A;  1JFU A;  4LA1 A;  2HSM A;  3TJF A;  3RAZ A;  1QQ2 A;  3TJG A;  5KN3 A;  1PA3 A;  3DML A;  4KCA A;  5H5R A;  1EGO A;  1B48 A;  1SKR B;  1AAZ A;  4EIQ A;  2L6D A;  3IK9 A;  4NAX A;  1DE2 A;  1VF3 A;  2IME A;  4HUA A;  1M3J A;  3KZQ A;  1O7U A;  1GSU A;  1SK1 A;  5J9C A;  5LD0 A;  5G5E A;  4DSQ A;  5HR3 A;  1O8X A;  2HZE B;  4I6X A;  5DDL A;  1G6Y A;  4NV2 A;  5BRT A;  2R0G A;  3GKX A;  1XOA A;  3D6I A;  4F2I A;  1GTU A;  4DVC A;  3MIX A;  3HD5 A;  4KSO A;  3DYR A;  4G10 A;  1WOU A;  5ECQ B;  4FYU A;  1YQ1 A;  4Z2T A;  11GS A;  3F63 A;  1YF0 A;  5J4U A;  2R6K A;  1A2L A;  1HQO A;  4WF5 A;  4GSS A;  4I5Q A;  4XS6 A;  4KA0 A;  4XTS A;  3UOM A;  2B5X A;  2VL2 A;  4WET A;  4MK3 A;  1J08 A;  1BJX A;  4LMV A;  1OC8 A;  1UN2 A;  3IV4 A;  4BWS A;  4BVX A;  2LNS A;  2YOI A;  5G1L A;  4ZBA A;  3FZ4 A;  2XPE A;  4Q5Q A;  1XWK A;  2BTO T;  5HR1 A;  3R3E A;  2GT5 A;  1M99 A;  5C04 A;  1WE0 A;  5E4W A;  4PUF C;  3IXR A;  3QR6 A;  1PKZ A;  4YQV A;  3UAR A;  2H0G A;  4K7O A;  1ZOF A;  2B5E A;  3C71 A;  3BCI A;  3BBY A;  1V40 A;  1A24 A;  1HYU A;  3P2A A;  1TRV A;  2CZ2 A;  4HQZ A;  2H0H A;  4V2L A;  4EDZ A;  3ZFB A;  5D8I A;  2K18 A;  4POM A;  4L0W A;  1XCC A;  3IA1 A;  1N8J A;  1K3L A;  4PNF A;  4MLY A;  4TW5 A;  4BPY A;  1MDK A;  2OE1 A;  2OBI A;  5G5F A;  2AJQ B;  1NHO A;  3UJ1 A;  1FOV A;  4N11 A;  2E2M A;  1GRX A;  4I97 A;  4JRR A;  4ZL9 A;  2REM A;  1ERT A;  1JZO A;  2AAW A;  2H6Y A;  2CA8 A;  3P7X A;  2LV3 A;  2ON7 A;  2PMT A;  1PRX A;  4F0B A;  3K8N A;  1SYX A;  2OA7 A;  1T7P B;  2IIY A;  3L4N A;  3DD3 A;  2LTK A;  5L71 A;  4GWR A;  5JCG A;  1T4Z A;  2DSA A;  3Q74 A;  1T4Y A;  2IMD A;  3M3M A;  2VIM A;  2DJK A;  1GH2 A;  3GL3 A;  1GUK A;  2ES7 A;  2WS2 A;  1GSQ A;  3MAK A;  2OBK A;  2J9H A;  1T3B A;  4IGJ A;  3KMO A;  2EIQ A;  3EPT A;  1XXU A;  2L4Q A;  5DJM A;  2AB6 A;  4GCI A;  1URM A;  1PKW A;  3HVX A;  2HNL A;  1I5G A;  4XIH A;  1SL1 B;  1WWJ A;  1Z6N A;  2CT6 A;  4I2U A;  5HFK A;  4KUN A;  2DJJ A;  5DAL B;  1OE7 A;  3H79 A;  5ECH B;  3GKK A;  3MSZ A;  4KGI A;  2JL4 A;  1V9W A;  3A3T A;  2H0I A;  1SL0 B;  1Z3E A;  2HFD A;  1K0N A;  2L4C A;  1X9S B;  1R26 A;  2WUL A;  1EGR A;  3CTF A;  5ELG A;  3CXG A;  4XS4 B;  1X5C A;  4MH3 A;  4O5Q A;  1KTE A;  2QGV A;  3E3E A;  1A2M A;  5ID2 A;  4TR1 A;  1E6B A;  2I81 A;  2GZY A;  5CRE A;  1M9B A;  3HKR A;  2H1G A;  3W8J A;  2PVQ A;  3TJK A;  2VL9 A;  14GS A;  1TI1 A;  2PVO C;  2VCZ A;  3UVH A;  5CAX A;  5B8B A;  1THO A;  3TKS E;  4GLT A;  4WF4 A;  1G0T A;  4PGT A;  5GAN D;  1Z7P A;  4HQS A;  1TP9 A;  8GSS A;  2GS3 A;  1OC9 B;  3LJR A;  3LQ7 A;  3IC8 A;  4ZL8 A;  2FNO A;  2AV4 A;  3KH7 A;  1SKW B;  1MEK A;  2JSY A;  1F3B A;  4F0C A;  3JCM L;  1S3R A;  2XBI A;  5HFG A;  2YAN A;  1ZGN A;  3WT2 A;  1PD2 1;  4RI6 A;  1F3A A;  4G0K A;  1XWB A;  1V98 A;  2YCD A;  1MDI A;  3GTU B;  4HZ4 A;  4RQR A;  6GSW A;  3UIW A;  2PWJ A;  2NTO A;  4K6X A;  1GTI A;  1YKA A;  2CAI A;  1O85 A;  1PGT A;  3UAP A;  20GS A;  2LS5 A;  5CRD A;  4BL7 B;  4L5O A;  1S3C A;  5IIZ A;  1EP7 A;  4EC0 A;  2H1B A;  3DVW A;  2F51 A;  1EV4 A;  5H5S A;  2FWH A;  1I9D A;  4TXO B;  1K0D A;  3UBK A;  4OD7 A;  1GTB A;  1YJ6 A;  5IOW A;  1NM3 A;  2FWF A;  2GZZ A;  2CVK A;  2R37 A;  2B3S A;  2YZH A;  1F9M A;  4GXZ A;  3OR5 A;  4F82 A;  4PQ1 A;  4TOP A;  1H75 A;  2UZ8 A;  2F8F A;  1GSY A;  2XC2 A;  5IOX A;  3PIN A;  4ML1 A;  1EEM A;  4CDO A;  4IS0 A;  5D9X A;  1GSF A;  2VL3 A;  2H19 A;  3GKM A;  3ZRE A;  1XPV A;  1ZL9 A;  4Z2U A;  5B6N A;  3CRT A;  3F4S A;  2RUF A;  1V57 A;  1SEN A;  3TKS A;  3TRX A;  2JU5 A;  2RLI A;  3F3R A;  4PXO A;  3RHB A;  3BOA A;  3ZVJ A;  3APS A;  2H70 A;  3MWH A;  4XS1 A;  2VCV A;  4TVE A;  1K3O A;  5G30 A;  5EVO A;  2WZ9 A;  1TJD A;  1OC3 A;  4PNG A;  4MF7 A;  1M7T A;  4D73 A;  4EUY A;  2VM1 A;  4GRF A;  1MD4 A;  1XWA A;  5G2Z A;  4Q5N A;  1GL8 A;  2CQ9 A;  4K7I A;  3EU4 A;  2GQM A;  3GN3 A;  5GSS A;  4WBJ A;  6GSX A;  4K2X A;  3EYT A;  3NIV A;  4MPF A;  1R5A A;  4FYB A;  2FWG A;  1T8E B;  4BWQ A;  1G7O A;  3EUR A;  3D4M A;  3IC4 A;  3WD6 A;  2VO4 A;  1SD8 A;  1XOB A;  4MZW A;  3ZL5 A;  4K7N A;  4MP4 A;  4L0U A;  3DGQ A;  5CRW A;  5IMV A;  2H6X A;  4XCS A;  3US3 A;  4ECJ A;  1M3I A;  2FA8 A;  2DLX A;  3FR9 A;  4PUA A;  5IPG A;  4IP1 A;  2H72 A;  3TKQ A;  1FAA A;  18GS A;  4WXT A;  2C0E A;  3QFA C;  1OYJ A;  1BYE A;  1YEX A;  4AJ6 A;  2YV7 A;  3ERG A;  4AJ7 A;  2GQK A;  3HVN A;  1YZX A;  2VD1 A;  3ZIV A;  4NMU A;  1ACV A;  1M2D A;  2DJ3 A;  5AGY A;  4K8M A;  2XHF A;  3E9J B;  1GLQ A;  5ECN B;  4BVX B;  4IJI A;  4TR3 A;  4G9H A;  4RUV A;  4MDC A;  3NOF A;  2M46 A;  3ZZX A;  2K8S A;  3D5J A;  2GZP A;  2A2S A;  1E2Y A;  1OAZ A;  2HLS A;  1RQM A;  1PN0 A;  2VCW A;  3AY8 A;  2RUE A;  3WGE A;  5IM9 A;  2TRC P;  4IP6 A;  2L6C A;  3CQF A;  3C73 A;  3SBC A;  2VD0 A;  2GT6 A;  2WCI A;  2YWO A;  2R3X A;  3ZML A;  3GH6 A;  3GUS A;  5A4W A;  1U3I A;  1M2A A;  4JZQ A;  4QL9 A;  4EO3 A;  2RII A;  3MDK A;  4ULX A;  4WR5 A;  4DSS B;  2JAD A;  1ABA A;  2YNX A;  3FK8 A;  1DSB A;  2HRK A;  3RPP A;  1AW9 A;  4EF0 A;  3VK9 A;  3DIE A;  4G2E A;  1Z5Y E;  4JR6 A;  5B6M A;  4CHS A;  4OFT A;  3F4T A;  4I8B A;  3IOS A;  4Z7X A;  2ALB A;  3HY2 A;  2C8U A;  1CQG A;  1EOH A;  1Z6M A;  3W6G A;  1SU9 A;  4FO5 A;  3MYD A;  5KEJ A;  2L57 A;  2MBT A;  1HNB A;  1X5D A;  2A2R A;  19GS A;  3NZN A;  4HU9 A;  1FOH A;  1J9B A;  2B1K A;  2OJL A;  5F8B A;  4HS1 A;  1R4W A;  5HFI A;  22GS A;  4V1A g;  2WJU A;  1K0O A;  2IWT A;  3UVT A;  1S3A A;  4ILF A;  1FVK A;  6GSU A;  4Z2R A;  4ECC A;  3UMA A;  4F03 A;  3VPQ A;  1N2A A;  1XW6 A;  5CP1 A;  1O73 A;  3EE2 A;  1OE8 A;  1FHE A;  5GZZ B;  1JZW A;  1SJI A;  2VCT A;  1TK8 B;  2LEG A;  3GL5 A;  1ZZY A;  1FVJ A;  3FYG A;  1ZYE A;  4KDX A;  3VUR A;  1Z9H A;  4V2M A;  3CMI A;  5DQY A;  2LRN A;  2C80 A;  4FYC A;  4PX1 A;  2B5Y A;  4F9Z A;  2R0P A;  3GA4 A;  1Y25 A;  1WRY A;  4N0V A;  2M72 A;  2HRF A;  4BVY B;  2BMX A;  2H1A A;  3IR4 A;  3TUE A;  1PQN A;  1K3Y A;  2VUP A;  4TR1 B;  1ILO A;  3D0Z A;  5IO2 A;  3ISO A;  4EXJ A;  1NW2 A;  3QAW A;  2EIR A;  1U6T A;  5AN1 A;  5ECI B;  4BIK A;  3IAS 2;  4H86 A;  3KEB A;  3GYK A;  5D73 A;  5DCG A;  3G9B A;  2N5F A;  3G7I A;  3FW2 A;  2LJK A;  4K5R A;  5G31 A;  4FQU A;  4K2D A;  3E0U A;  3FR3 A;  2H74 A;  3KXO A;  2FY6 A;  5CRH A;  2H6Z A;  1XIY A;  4EE0 A;  3QAG A;  1EEJ A;  5ELA A;  1XVW A;  3RPN A;  5ENU A;  3P90 A;  4HDE A;  1GWC A;  2H76 A;  2H71 A;  2IPA A;  4JED A;  1BAY A;  4LL4 B;  3KM6 A;  2QKE A;  2MBS A;  3FKF A;  2HZE A;  2AYT A;  4MJE A;  2C0G A;  4KND A;  2IN3 A;  3ZRD A;  5ECO B;  3GFK A;  4HZ2 A;  2GGT A;  1GSD A;  1KEB A;  3HVV A;  2VLT A;  4LLR A;  4LL1 B;  3LG6 A;  1QMV A;  2VCQ A;  2FUG 2;  1TRU A;  4MF5 A;  1XVQ A;  3QMX A;  5E59 A;  3TRP A;  1PSQ A;  6GST A;  1PX6 A;  2DML A;  5AIV A;  1NHY A;  2HXK A;  1AUC A;  5J5N A;  4MPG A;  1GNW A;  2G2Q A;  4OCF A;  4PTS A;  2OAC A;  4HJ2 A;  2FHE A;  4A5P A;  10GS A;  2MMO A;  5INY A;  3H93 A;  4BA7 A;  1YKC A;  3LGC A;  4J2F A;  1TXX A;  3TKS C;  2YJ7 A;  2GLR A;  3IRA A;  4L5L A;  3VWW A;  3EMX A;  4L8E A;  3VI7 A;  3EC3 A;  4J56 E;  2PGT A;  2C4J A;  4JBB A;  5H5Q A;  2V41 A;  4LMW A;  1A8L A;  4CY8 A;  3RBT A;  2AHE A;  3KP8 A;  1FB0 A;  2YJH A;  2YPM A;  3ZVJ D;  4AF2 A;  3A2W A;  2H75 A;  2RM6 A;  1SKS B;  1AQW A;  2EC4 A;  2MMA A;  3F6D A;  1K0B A;  1FW1 A;  4HOJ A;  4DEJ A;  4D73 B;  4X1U A;  2YN1 A;  1AC1 A;  4TXV A;  5ECP B;  5IO0 A;  1U87 A;  3GKN A;  4ISD A;  2EIO A;  2H8L A;  4RQX A;  5G1K A;  1XZO A;  2WDU A;  3QAV A;  3DEX A;  1YEP A;  1EOG A;  4EKZ A;  4EDY A;  4MF6 A;  3KMN A;  4QQ7 A;  1SJ6 A;  2CAQ A;  2CVB A;  2ZCT A;  2L5L A;  2JZS A;  2NVL A;  2MMN A;  3O6T A;  3O3T A;  2Z9S A;  4V2N A;  4IVF A;  2DBC A;  4NXI A;  3ZMK A;  3IBH A;  4ECB A;  3QDN A;  2GSS A;  4IQA A;  5HQP A;  1ON4 A;  1R7H A;  4G19 A;  1BG5 A;  3VWV A;  1M2B A;  5J41 A;  3HDC A;  4NWY A;  4K1F A;  1GUM A;  4HJM A;  3Q18 A;  4O7H A;  2V6K A;  3QOU A;  4HI7 A;  4MA9 A;  2KUC A;  3ZIJ A;  4WBR D;  5ECL B;  1TDI A;  2O7K A;  3VLN A;  4MH2 A;  4MMM A;  1A23 A;  2X99 A;  2C3N A;  2H1D A;  2R0C A;  1W4V A;  1WP0 A;  1GUL A;  3L0H A;  2CZ3 A;  2LRT A;  5DQS A;  5F0G A;  2IJY A;  5DAL A;  2D2Z A;  5D9T A;  1EZK A;  2VOC A;  5LNK e;  2K9F A;  3D22 A;  2RM5 A;  2HYX A;  4XRD A;  3LW9 A;  4N30 A;  1HNA A;  1OVN A;  3C1S A;  2O8V B;  1X9W B;  2IMF A;  3WGD A;  3C1R A;  4CY6 A;  1ZMA A;  4XS4 A;  4YAV A;  5HR2 A;  4NHW A;  1WMJ A;  4TKY A;  3FY7 A;  3GHA A;  4IQ1 A;  1EWX A;  3DWV A;  5F07 A;  5DAK A;  4MAB A;  2WRT A;  5LCZ A;  5ECR B;  2P31 A;  3ZYW A;  1O6J A;  4IBP A;  3UL3 A;  3V1W A;  3R2Q A;  2E7P A;  3D21 A;  3VPT A;  1YY7 A;  5FWG A;  2QA1 A;  1ZYQ B;  4MZC A;  4MJC A;  5IMF A;  4HU7 A;  3BJ5 A;  3GIX A;  4EIP A;  4N10 A;  3WT1 A;  4XRA A;  3LYK A;  2YP6 A;  2X8C A;  1O8W A;  3HZ8 A;  1TRS A;  3EIN A;  3I9V 2;  1OC9 A;  2DIY A;  4USS A;  5IMA A;  3QPM A;  1QFN A;  1XFL A;  1PFO A;  1TU8 A;  3APO A;  1ZCP A;  1RK4 A;  2HE3 A;  4KB3 A;  2VL2 C;  2N5A A;  2YV9 A;  2A2P A;  3L9U A;  2HSH A;  3P8W A;  5KN2 A;  2A4V A;  2PER A;  2KP1 A;  5A4U A;  4WKW A;  4AJ8 A;  1T1V A;  3O76 A;  2PN8 A;  3ZFL A;  2HT9 A;  4PQH A;  4POL A;  4V1A p;  3HVS A;  1A8Y A;  4BL7 A;  1EP8 A;  4GQF A;  5DJL A;  2IMI A;  2H01 A;  3MNG A;  5ECS A;  4JE1 A;  1ERV A;  5J9B A;  3KJY A;  3EMP A;  2F9S A;  2GDR A;  4ZIJ A;  2MYG A;  2I3Y A;  1MDJ A;  2HRA A;  3CSH A;  2I1U A;  3HXS A;  5DVB A;  1B9X C;  3F9U A;  3S9F A;  3KGK A;  5AIX A;  2FCH A;  3N9J A;  4MCU A;  2V6O A;  4OO4 A;  2C0D A;  1A0R P;  2PU9 C;  3IAM 2; 
#chains in the Genus database with same CATH homology
 2HSY A;  1ST9 A;  2J23 A;  2GVP A;  4OFN A;  3TRQ A;  1B8X A;  2KOK A;  1XBS A;  3FR6 A;  3TOU A;  2KP2 A;  4ZBB A;  2H66 A;  3TOT A;  4PQI A;  1PN9 A;  5JWR B;  4ML6 A;  1PL2 A;  2KLX A;  2ZNM A;  4GF0 A;  1B9Y C;  2C1Y A;  2LJR A;  1LU4 A;  3C8E A;  3ZTL A;  5KOX A;  1SK0 A;  3LXZ A;  1C72 A;  3CBU A;  4PUR A;  5EL8 A;  1CQH A;  4Q5F A;  1SK2 A;  1G7E A;  16GS A;  2DJ0 A;  1UC7 A;  1GUH A;  1YF1 A;  2OE0 A;  2LRC A;  1JLV A;  6GSS A;  2K8V A;  1YDK A;  3VI5 A;  2V2G A;  2V32 A;  2P5Q A;  2JAC A;  1BQ7 A;  3I69 A;  1M9A A;  5A4V A;  1WPI A;  5AIS A;  4EVM A;  1O81 A;  3LSZ A;  5JCU A;  4G0L A;  3J7Y b;  4IHU A;  3GRX A;  1BX9 A;  1AIU A;  7GSS A;  3GUR A;  3ZIT A;  2X49 A;  1G6W A;  3VWX A;  2CX3 A;  1GSS A;  2GTU A;  1S3D A;  2HRN A;  3PGT A;  3M9K A;  2F3M A;  4MJB A;  3EVI A;  3WGX A;  3WYW A;  3A5I A;  4YKF A;  4KX4 A;  3KCM A;  1X5E A;  4TR0 A;  2C3T A;  3PR8 A;  2XPD A;  3TCO A;  3IK7 A;  4ZB9 A;  2X64 A;  2IFQ A;  3LEF A;  1F37 A;  3FMW A;  2DMM A;  4TN8 A;  1F6M C;  3LWA A;  3GST A;  3ZLP A;  4ACS A;  2VM2 A;  2JZT A;  1UA5 A;  3L9S A;  6GSY A;  5ID2 B;  3CRU A;  2GQL A;  2LJA A;  2FD3 A;  3F6F A;  3QFB C;  3FHK A;  4I2T A;  2DJ2 A;  4EL1 A;  2A4H A;  1NSW A;  5KN0 A;  4POB A;  3G7Y A;  4ICY A;  3M1G A;  3I43 A;  4E8E A;  4NPB A;  5B8A A;  2M80 A;  3TKR A;  3DRN A;  2B7K A;  3Q6O A;  2LUS A;  4YH2 A;  5IQY A;  4ID0 A;  3SWL A;  3ERF A;  3KTB A;  2X4A A;  4DSR A;  4DSS A;  2GSQ A;  3M9J A;  1WJK A;  4KW6 A;  2C3Q A;  3ERW A;  3APQ A;  6GSV A;  3FRC A;  2P0G A;  2QC7 A;  1LBK A;  4KDU A;  1XW5 A;  3KTL A;  1PX7 A;  2F8A A;  1WIK A;  2VAF A;  1XW9 A;  3KD0 A;  3PH9 A;  4IKH A;  3HYP A;  3CTG A;  1JHB A;  2ZUP A;  1PL1 A;  3H8Q A;  4OWY A;  1ML6 A;  5DCH A;  4IN0 A;  5BMU A;  2CV4 A;  1R5P A;  4KDY A;  3HJP A;  2E2G A;  4O5R A;  2DIZ A;  2O89 A;  5ABR A;  3F3Q A;  1FO5 A;  2YWM A;  3LXT A;  4MJA A;  1GP1 A;  5DBQ A;  4YAP A;  2IMK A;  2E0Q A;  3TB2 A;  3U6V A;  2TRX A;  4O32 A;  2LQQ A;  3PPU A;  3FZ5 A;  1TKD B;  2FWE A;  3L9V A;  1DUG A;  1X9M B;  1M0U A;  2B6M A;  5C00 A;  4K5S A;  4TRX A;  4KSM A;  4NV5 A;  4MNN A;  4XHM A;  1J0F A;  2OE3 A;  1QK8 A;  5IMC A;  2H73 A;  5ECK B;  4WEY A;  2DKH A;  3M0F A;  2NBS A;  1VF1 A;  13GS A;  3FEU A;  2CX4 A;  1SL2 B;  3GH9 A;  4ZB6 A;  3KH9 A;  2QSI A;  4X4J A;  5CYY A;  3ED3 A;  3HA9 A;  2WB9 A;  4GST A;  3RDW A;  2WFC A;  4ZBD A;  5HR0 A;  2XBQ A;  1BED A;  2B7J A;  3KIJ A;  3DXB A;  3QD9 A;  5D93 A;  4BVY A;  3G7J A;  5DAK B;  1U88 A;  5F05 A;  4ECI A;  2PPT A;  1ZYP A;  2LNT A;  3IHQ A;  5EPF A;  4OMV A;  3ME7 A;  4KAE A;  1GSE A;  3KP9 A;  3H4K A;  5JCW A;  2JZR A;  4K0G A;  3ME8 A;  3BD2 A;  2B1L A;  1QUW A;  3EWL A;  1AQX A;  3CYN A;  1GTA A;  3TJJ A;  4IW9 A;  4OFM A;  3U5R E;  3BCK A;  1RW1 A;  3GX0 A;  5JWO B;  1JLW A;  4YQU A;  2VCX A;  5J3R A;  3VFI A;  1TI3 A;  2NPB A;  2N5B A;  12GS A;  3J7Y k;  4CW9 A;  2X8G A;  1DE1 A;  3D4T A;  3GV1 A;  5CRG A;  3TDG A;  5B7C A;  1X0R A;  4IJ3 A;  1K0A A;  5IMD A;  3F0I A;  5CNW A;  1SD9 A;  1GLP A;  2LST A;  2PUK C;  3IDV A;  4KCE A;  4GTU A;  3I6A A;  2LKU A;  1OKT A;  2L5O A;  1PMT A;  1W89 A;  1JZD A;  17GS A;  4RI7 A;  4JR4 A;  4X0X A;  3TGZ A;  1UVZ A;  2K6V A;  2ON5 A;  1U3A A;  2DJ1 A;  2MZC A;  3FZA A;  3EU3 A;  2OAD A;  3QCP A;  3DKS A;  2FGX A;  3UEM A;  5D96 A;  1SJZ A;  2H30 A;  1MD3 A;  1VF4 A;  1F2E A;  3M8N A;  3LYP A;  2GST A;  2MMZ A;  3A5W A;  1OKD A;  2R5G A;  5GAP D;  1A0F A;  1QXH A;  1K0C A;  2KHP A;  2BJX A;  3A2X A;  4POK A;  2FLS A;  1XWG A;  1ERW A;  4ZL7 A;  4ZXG A;  2QA2 A;  1B4Q A;  1VGL A;  3W8S A;  2C0F A;  1THX A;  2R4V A;  4HEA 2;  2GSR A;  5COH A;  3LOR A;  1GNE A;  1TW9 A;  5EY6 A;  2I9H A;  4QL7 A;  3GNJ A;  5KN1 A;  4O5U A;  4E8H A;  3FZ9 A;  2HZF A;  3TKP A;  1KNG A;  1Y6E A;  1IYH A;  1MTC A;  4JU5 A;  1B4P A;  2WGR A;  1QGV A;  1A2J A;  1FG4 A;  1TK0 B;  1EV9 A;  3HJO A;  4Q5R A;  4ZB8 A;  1JZR A;  4AGS A;  1HD2 A;  4NHZ A;  3CSJ A;  2YWN A;  4OO5 A;  1USB A;  1LJR A;  4J57 E;  3DVX A;  1TTZ A;  3HJM A;  3LFL A;  2G0F A;  5JWQ B;  3IPZ A;  4ZIL A;  4IEL A;  2VLV A;  3N5O A;  2L59 A;  4K9Z A;  4KF9 A;  2P5R A;  4YKG A;  1ZYN A;  1TOF A;  3L78 A;  4OCE A;  2HI7 A;  2IL3 A;  3HCZ A;  4YQM A;  2FA4 A;  5IMZ A;  1T00 A;  5CO3 A;  3GMF A;  4GQC A;  2NDO A;  4FH8 A;  1VRS D;  2I4A A;  9GSS A;  1AXD A;  3C7M A;  3CSI A;  4P3Y B;  3F8U A;  2OKA A;  1XWC A;  1V58 A;  4MZB A;  1TU7 A;  2AUV A;  1V2A A;  4WR4 A;  1H4O A;  5FT3 A;  2YWI A;  3UBL A;  3GTU A;  2O85 A;  2PBJ A;  3F4R A;  2R2J A;  1TK5 B;  2V1M A;  1Z7R A;  3Q19 A;  3TJB A;  1VF2 A;  5F06 A;  3IHG A;  3GX8 A;  2CVD A;  3A2V A;  1AQV A;  4N0Z A;  1TRW A;  4O92 A;  4GSN A;  2LQO A;  2DC5 A;  2YZU A;  4KH7 A;  1Q98 A;  2X8H A;  4KE3 A;  2DKI A;  5D9V A;  3IE3 A;  1HNC A;  2IFQ B;  2JSZ A;  4X43 A;  1IYI A;  4TXO A;  4K0N A;  1KBN A;  2O87 A;  3RHC A;  1DBY A;  1K0M A;  1Q4J A;  2VLU A;  3VWU A;  1SYR A;  1FB6 A;  1ERU A;  4TR4 A;  5A5K A;  5ECM B;  2TIR A;  5D9W A;  3HZ4 A;  3HHV A;  4FIW A;  5FHI A;  5GST A;  3GSS A;  4G0I A;  5IPH A;  5KOW A;  3H1N A;  1JFU A;  4LA1 A;  2HSM A;  3TJF A;  3RAZ A;  1QQ2 A;  3TJG A;  5KN3 A;  1PA3 A;  3DML A;  4KCA A;  5H5R A;  1EGO A;  1B48 A;  1SKR B;  1AAZ A;  4EIQ A;  2L6D A;  3IK9 A;  4NAX A;  1DE2 A;  1VF3 A;  2IME A;  4HUA A;  3KZQ A;  1O7U A;  1GSU A;  1SK1 A;  5J9C A;  5LD0 A;  5G5E A;  4DSQ A;  5HR3 A;  1O8X A;  2HZE B;  4I6X A;  5DDL A;  1G6Y A;  4NV2 A;  5BRT A;  2R0G A;  3GKX A;  1XOA A;  3D6I A;  4F2I A;  1GTU A;  4DVC A;  3MIX A;  3HD5 A;  4KSO A;  3DYR A;  4G10 A;  1WOU A;  5ECQ B;  4FYU A;  1YQ1 A;  4Z2T A;  11GS A;  3F63 A;  1YF0 A;  5J4U A;  2R6K A;  1A2L A;  1HQO A;  4WF5 A;  4GSS A;  4I5Q A;  4XS6 A;  4KA0 A;  4XTS A;  3UOM A;  2B5X A;  2VL2 A;  4WET A;  4MK3 A;  1J08 A;  1BJX A;  4LMV A;  1OC8 A;  1UN2 A;  3IV4 A;  4BWS A;  4BVX A;  2LNS A;  2YOI A;  5G1L A;  4ZBA A;  3FZ4 A;  2XPE A;  4Q5Q A;  1XWK A;  2BTO T;  5HR1 A;  3R3E A;  2GT5 A;  1M99 A;  5C04 A;  1WE0 A;  5E4W A;  4PUF C;  3IXR A;  3QR6 A;  1PKZ A;  4YQV A;  3UAR A;  2H0G A;  4K7O A;  1ZOF A;  2B5E A;  3C71 A;  3BCI A;  3BBY A;  1V40 A;  1A24 A;  1HYU A;  3P2A A;  1TRV A;  2CZ2 A;  4HQZ A;  2H0H A;  4V2L A;  4EDZ A;  3ZFB A;  5D8I A;  2K18 A;  4POM A;  4L0W A;  1XCC A;  3IA1 A;  1N8J A;  1K3L A;  4PNF A;  4MLY A;  4TW5 A;  4BPY A;  1MDK A;  2OE1 A;  2OBI A;  5G5F A;  2AJQ B;  1NHO A;  3UJ1 A;  1FOV A;  4N11 A;  2E2M A;  1GRX A;  4I97 A;  4JRR A;  4ZL9 A;  2REM A;  1ERT A;  1JZO A;  2AAW A;  2H6Y A;  2CA8 A;  3P7X A;  2LV3 A;  2ON7 A;  2PMT A;  1PRX A;  4F0B A;  3K8N A;  1SYX A;  2OA7 A;  1T7P B;  2IIY A;  3L4N A;  3DD3 A;  2LTK A;  5L71 A;  4GWR A;  5JCG A;  1T4Z A;  2DSA A;  3Q74 A;  1T4Y A;  2IMD A;  3M3M A;  2VIM A;  2DJK A;  1GH2 A;  3GL3 A;  1GUK A;  2ES7 A;  2WS2 A;  1GSQ A;  3MAK A;  2OBK A;  2J9H A;  1T3B A;  4IGJ A;  3KMO A;  2EIQ A;  3EPT A;  1XXU A;  2L4Q A;  5DJM A;  2AB6 A;  4GCI A;  1URM A;  1PKW A;  3HVX A;  2HNL A;  1I5G A;  4XIH A;  1SL1 B;  1WWJ A;  1Z6N A;  2CT6 A;  4I2U A;  5HFK A;  4KUN A;  2DJJ A;  5DAL B;  1OE7 A;  3H79 A;  5ECH B;  3GKK A;  3MSZ A;  4KGI A;  2JL4 A;  1V9W A;  3A3T A;  2H0I A;  1SL0 B;  1Z3E A;  2HFD A;  1K0N A;  2L4C A;  1X9S B;  1R26 A;  2WUL A;  1EGR A;  3CTF A;  5ELG A;  3CXG A;  4XS4 B;  1X5C A;  4MH3 A;  4O5Q A;  1KTE A;  2QGV A;  3E3E A;  1A2M A;  5ID2 A;  4TR1 A;  1E6B A;  2I81 A;  2GZY A;  5CRE A;  1M9B A;  3HKR A;  2H1G A;  3W8J A;  2PVQ A;  3TJK A;  2VL9 A;  14GS A;  1TI1 A;  2PVO C;  2VCZ A;  3UVH A;  5CAX A;  5B8B A;  1THO A;  3TKS E;  4GLT A;  4WF4 A;  1G0T A;  4PGT A;  5GAN D;  1Z7P A;  4HQS A;  1TP9 A;  8GSS A;  2GS3 A;  1OC9 B;  3LJR A;  3LQ7 A;  3IC8 A;  4ZL8 A;  2FNO A;  2AV4 A;  3KH7 A;  1SKW B;  1MEK A;  2JSY A;  1F3B A;  4F0C A;  3JCM L;  2XBI A;  5HFG A;  2YAN A;  1ZGN A;  3WT2 A;  1PD2 1;  4RI6 A;  1F3A A;  4G0K A;  1XWB A;  1V98 A;  2YCD A;  1MDI A;  3GTU B;  4HZ4 A;  4RQR A;  6GSW A;  3UIW A;  2PWJ A;  2NTO A;  4K6X A;  1GTI A;  1YKA A;  2CAI A;  1O85 A;  1PGT A;  3UAP A;  20GS A;  2LS5 A;  5CRD A;  4BL7 B;  4L5O A;  1S3C A;  5IIZ A;  1EP7 A;  4EC0 A;  2H1B A;  3DVW A;  2F51 A;  1EV4 A;  5H5S A;  2FWH A;  1I9D A;  4TXO B;  1K0D A;  3UBK A;  4OD7 A;  1GTB A;  1YJ6 A;  5IOW A;  1NM3 A;  2FWF A;  2GZZ A;  2CVK A;  2R37 A;  2B3S A;  2YZH A;  1F9M A;  4GXZ A;  3OR5 A;  4F82 A;  4PQ1 A;  4TOP A;  1H75 A;  2UZ8 A;  2F8F A;  1GSY A;  2XC2 A;  5IOX A;  3PIN A;  4ML1 A;  1EEM A;  4CDO A;  4IS0 A;  5D9X A;  1GSF A;  2VL3 A;  2H19 A;  3GKM A;  3ZRE A;  1XPV A;  1ZL9 A;  4Z2U A;  5B6N A;  3CRT A;  3F4S A;  2RUF A;  1V57 A;  1SEN A;  3TKS A;  3TRX A;  2JU5 A;  2RLI A;  3F3R A;  4PXO A;  3RHB A;  3BOA A;  3ZVJ A;  3APS A;  2H70 A;  3MWH A;  4XS1 A;  2VCV A;  4TVE A;  1K3O A;  5G30 A;  5EVO A;  2WZ9 A;  1TJD A;  1OC3 A;  4PNG A;  4MF7 A;  1M7T A;  4D73 A;  4EUY A;  2VM1 A;  4GRF A;  1MD4 A;  1XWA A;  5G2Z A;  4Q5N A;  1GL8 A;  2CQ9 A;  4K7I A;  3EU4 A;  2GQM A;  3GN3 A;  5GSS A;  4WBJ A;  6GSX A;  4K2X A;  3EYT A;  3NIV A;  4MPF A;  1R5A A;  4FYB A;  2FWG A;  1T8E B;  4BWQ A;  1G7O A;  3EUR A;  3D4M A;  3IC4 A;  3WD6 A;  2VO4 A;  1SD8 A;  1XOB A;  4MZW A;  3ZL5 A;  4K7N A;  4MP4 A;  4L0U A;  3DGQ A;  5CRW A;  5IMV A;  2H6X A;  4XCS A;  3US3 A;  4ECJ A;  2FA8 A;  2DLX A;  3FR9 A;  4PUA A;  5IPG A;  4IP1 A;  2H72 A;  3TKQ A;  1FAA A;  18GS A;  4WXT A;  2C0E A;  3QFA C;  1OYJ A;  1BYE A;  1YEX A;  4AJ6 A;  2YV7 A;  3ERG A;  4AJ7 A;  2GQK A;  1YZX A;  2VD1 A;  3ZIV A;  4NMU A;  1ACV A;  1M2D A;  2DJ3 A;  5AGY A;  4K8M A;  2XHF A;  3E9J B;  1GLQ A;  5ECN B;  4BVX B;  4IJI A;  4TR3 A;  4G9H A;  4RUV A;  4MDC A;  3NOF A;  2M46 A;  3ZZX A;  2K8S A;  3D5J A;  2GZP A;  2A2S A;  1E2Y A;  1OAZ A;  2HLS A;  1RQM A;  1PN0 A;  2VCW A;  3AY8 A;  2RUE A;  3WGE A;  5IM9 A;  2TRC P;  4IP6 A;  2L6C A;  3C73 A;  3SBC A;  2VD0 A;  2GT6 A;  2WCI A;  2YWO A;  2R3X A;  3ZML A;  3GH6 A;  3GUS A;  5A4W A;  1U3I A;  1M2A A;  4JZQ A;  4QL9 A;  4EO3 A;  2RII A;  3MDK A;  4ULX A;  4WR5 A;  4DSS B;  2JAD A;  1ABA A;  2YNX A;  3FK8 A;  1DSB A;  2HRK A;  3RPP A;  1AW9 A;  4EF0 A;  3VK9 A;  3DIE A;  4G2E A;  1Z5Y E;  4JR6 A;  5B6M A;  4CHS A;  4OFT A;  3F4T A;  4I8B A;  3IOS A;  4Z7X A;  2ALB A;  3HY2 A;  2C8U A;  1CQG A;  1EOH A;  1Z6M A;  3W6G A;  1SU9 A;  4FO5 A;  3MYD A;  5KEJ A;  2L57 A;  2MBT A;  1HNB A;  1X5D A;  2A2R A;  19GS A;  3NZN A;  4HU9 A;  1FOH A;  1J9B A;  2B1K A;  2OJL A;  5F8B A;  4HS1 A;  1R4W A;  5HFI A;  22GS A;  4V1A g;  2WJU A;  1K0O A;  2IWT A;  3UVT A;  1S3A A;  4ILF A;  1FVK A;  6GSU A;  4Z2R A;  4ECC A;  3UMA A;  4F03 A;  3VPQ A;  1N2A A;  1XW6 A;  5CP1 A;  1O73 A;  3EE2 A;  1OE8 A;  1FHE A;  5GZZ B;  1JZW A;  1SJI A;  2VCT A;  1TK8 B;  2LEG A;  3GL5 A;  1ZZY A;  1FVJ A;  3FYG A;  1ZYE A;  4KDX A;  3VUR A;  1Z9H A;  4V2M A;  3CMI A;  5DQY A;  2LRN A;  2C80 A;  4FYC A;  4PX1 A;  2B5Y A;  4F9Z A;  2R0P A;  3GA4 A;  1Y25 A;  1WRY A;  4N0V A;  2M72 A;  2HRF A;  4BVY B;  2BMX A;  2H1A A;  3IR4 A;  3TUE A;  1PQN A;  1K3Y A;  2VUP A;  4TR1 B;  1ILO A;  3D0Z A;  5IO2 A;  3ISO A;  4EXJ A;  1NW2 A;  3QAW A;  2EIR A;  1U6T A;  5AN1 A;  5ECI B;  3IAS 2;  4H86 A;  3KEB A;  3GYK A;  5D73 A;  5DCG A;  3G9B A;  2N5F A;  3G7I A;  3FW2 A;  2LJK A;  4K5R A;  5G31 A;  4FQU A;  4K2D A;  3E0U A;  3FR3 A;  2H74 A;  3KXO A;  2FY6 A;  5CRH A;  2H6Z A;  1XIY A;  4EE0 A;  3QAG A;  1EEJ A;  5ELA A;  1XVW A;  3RPN A;  5ENU A;  3P90 A;  4HDE A;  1GWC A;  2H76 A;  2H71 A;  2IPA A;  4JED A;  1BAY A;  4LL4 B;  3KM6 A;  2QKE A;  2MBS A;  3FKF A;  2HZE A;  2AYT A;  4MJE A;  2C0G A;  4KND A;  2IN3 A;  3ZRD A;  5ECO B;  3GFK A;  4HZ2 A;  2GGT A;  1GSD A;  1KEB A;  3HVV A;  2VLT A;  4LLR A;  4LL1 B;  3LG6 A;  1QMV A;  2VCQ A;  2FUG 2;  1TRU A;  4MF5 A;  1XVQ A;  3QMX A;  5E59 A;  3TRP A;  1PSQ A;  6GST A;  1PX6 A;  2DML A;  5AIV A;  1NHY A;  2HXK A;  1AUC A;  5J5N A;  4MPG A;  1GNW A;  2G2Q A;  4OCF A;  4PTS A;  2OAC A;  4HJ2 A;  2FHE A;  4A5P A;  10GS A;  2MMO A;  5INY A;  3H93 A;  4BA7 A;  1YKC A;  3LGC A;  4J2F A;  1TXX A;  3TKS C;  2YJ7 A;  2GLR A;  3IRA A;  4L5L A;  3VWW A;  3EMX A;  4L8E A;  3VI7 A;  3EC3 A;  4J56 E;  2PGT A;  2C4J A;  4JBB A;  5H5Q A;  2V41 A;  4LMW A;  1A8L A;  4CY8 A;  3RBT A;  2AHE A;  3KP8 A;  1FB0 A;  2YJH A;  2YPM A;  3ZVJ D;  4AF2 A;  3A2W A;  2H75 A;  2RM6 A;  1SKS B;  1AQW A;  2EC4 A;  2MMA A;  3F6D A;  1K0B A;  1FW1 A;  4HOJ A;  4DEJ A;  4D73 B;  4X1U A;  2YN1 A;  1AC1 A;  4TXV A;  5ECP B;  5IO0 A;  1U87 A;  3GKN A;  4ISD A;  2EIO A;  2H8L A;  4RQX A;  5G1K A;  1XZO A;  2WDU A;  3QAV A;  3DEX A;  1YEP A;  1EOG A;  4EKZ A;  4EDY A;  4MF6 A;  3KMN A;  4QQ7 A;  1SJ6 A;  2CAQ A;  2CVB A;  2ZCT A;  2L5L A;  2JZS A;  2NVL A;  2MMN A;  3O6T A;  3O3T A;  2Z9S A;  4V2N A;  4IVF A;  2DBC A;  4NXI A;  3ZMK A;  3IBH A;  4ECB A;  3QDN A;  2GSS A;  4IQA A;  5HQP A;  1ON4 A;  1R7H A;  4G19 A;  1BG5 A;  3VWV A;  1M2B A;  5J41 A;  3HDC A;  4NWY A;  4K1F A;  1GUM A;  4HJM A;  3Q18 A;  4O7H A;  2V6K A;  3QOU A;  4HI7 A;  4MA9 A;  2KUC A;  3ZIJ A;  4WBR D;  5ECL B;  1TDI A;  2O7K A;  3VLN A;  4MH2 A;  4MMM A;  1A23 A;  2X99 A;  2C3N A;  2H1D A;  2R0C A;  1W4V A;  1WP0 A;  1GUL A;  3L0H A;  2CZ3 A;  2LRT A;  5DQS A;  5F0G A;  2IJY A;  5DAL A;  2D2Z A;  5D9T A;  1EZK A;  2VOC A;  5LNK e;  2K9F A;  3D22 A;  2RM5 A;  2HYX A;  4XRD A;  3LW9 A;  4N30 A;  1HNA A;  1OVN A;  3C1S A;  2O8V B;  1X9W B;  2IMF A;  3WGD A;  3C1R A;  4CY6 A;  1ZMA A;  4XS4 A;  4YAV A;  5HR2 A;  4NHW A;  1WMJ A;  4TKY A;  3FY7 A;  3GHA A;  4IQ1 A;  1EWX A;  3DWV A;  5F07 A;  5DAK A;  4MAB A;  2WRT A;  5LCZ A;  5ECR B;  2P31 A;  3ZYW A;  1O6J A;  4IBP A;  3UL3 A;  3V1W A;  3R2Q A;  2E7P A;  3D21 A;  3VPT A;  1YY7 A;  5FWG A;  2QA1 A;  1ZYQ B;  4MZC A;  4MJC A;  5IMF A;  4HU7 A;  3BJ5 A;  3GIX A;  4EIP A;  4N10 A;  3WT1 A;  4XRA A;  3LYK A;  2YP6 A;  2X8C A;  1O8W A;  3HZ8 A;  1TRS A;  3EIN A;  3I9V 2;  1OC9 A;  2DIY A;  4USS A;  5IMA A;  3QPM A;  1QFN A;  1XFL A;  1TU8 A;  3APO A;  1ZCP A;  1RK4 A;  2HE3 A;  4KB3 A;  2VL2 C;  2N5A A;  2YV9 A;  2A2P A;  3L9U A;  2HSH A;  3P8W A;  5KN2 A;  2A4V A;  2PER A;  2KP1 A;  5A4U A;  4WKW A;  4AJ8 A;  1T1V A;  3O76 A;  2PN8 A;  3ZFL A;  2HT9 A;  4PQH A;  4POL A;  4V1A p;  3HVS A;  1A8Y A;  4BL7 A;  1EP8 A;  4GQF A;  5DJL A;  2IMI A;  2H01 A;  3MNG A;  5ECS A;  4JE1 A;  1ERV A;  5J9B A;  3KJY A;  3EMP A;  2F9S A;  2GDR A;  4ZIJ A;  2MYG A;  2I3Y A;  1MDJ A;  2HRA A;  3CSH A;  2I1U A;  3HXS A;  5DVB A;  1B9X C;  3F9U A;  3S9F A;  3KGK A;  5AIX A;  2FCH A;  3N9J A;  4MCU A;  2V6O A;  4OO4 A;  2C0D A;  1A0R P;  2PU9 C;  3IAM 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...