1T1VA

Crystal structure of the glutaredoxin-like protein sh3bgrl3 at 1.6 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRTLAGNPKATPPQIVNGNHYCGDYELFVEAVEQDTLQEFLKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SH3 domain-binding glutamic acid-rich protein-like 3
publication title Crystal structure of the glutaredoxin-like protein SH3BGRL3 at 1.6 A resolution
pubmed doi rcsb
source organism Mus musculus
total genus 34
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04908 SH3BGR SH3-binding, glutamic acid-rich protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1t1vA00
2YWOA 2CX4A 2IIYA 1BJXA 22GSA 2DJ1A 1G0TA 2M46A 4XTSA 1AAZA 4HJMA 5B6NA 1AQVA 2OBIA 2I1UA 3CBUA 1PRXA 2O89A 2CZ2A 4IBPA 1JLVA 1NM3A 2IMDA 4I2UA 3EU3A 3GNJA 2GTUA 13GSA 1A8YA 3GH9A 4LL4B 3GKMA 2LQQA 2YNXA 3DD3A 1Z7PA 1M9AA 3GMFA 2IMEA 1U6TA 4XRAA 2P5QA 2PN8A 3F8UA 1B9XC 4NV5A 3UARA 1PN9A 3E0UA 3EE2A 4OO4A 14GSA 3KGKA 3R2QA 1GLQA 1THXA 3QOUA 1X9MB 3CMIA 1MEKA 2HT9A 2L4CA 1EGRA 1TXXA 2FWEA 4ID0A 3LWAA 3D5JA 4E8HA 3HVSA 4K0GA 5D9VA 5DAKA 3F9UA 2LNTA 2ZCTA 2EC4A 1WPIA 4N0VA 5ECPB 3IDVA 3PINA 1FB6A 4MJAA 3C7MA 5H5RA 1TRSA 3VWWA 1KNGA 1I5GA 3M1GA 1FHEA 2WJUA 3DVWA 2DC5A 3DKSA 3FRCA 1NSWA 5ID2A 3US3A 5D8IA 3WGDA 1ZYQB 4KCAA 2L6CA 1TTZA 2IMIA 4XIHA 4HU7A 1Y6EA 2HXKA 1TOFA 3LG6A 4Q5QA 3DXBA 1M0UA 3VI5A 2GGTA 4GWRA 4ZB9A 3EU4A 4G10A 2V2GA 3GYKA 2FWGA 3MAKA 3LEFA 1Q4JA 5A4UA 1O6JA 1G7OA 3J7Yk 2OBKA 4GQFA 5FWGA 1SD9A 2IPAA 3GKKA 2CVKA 4F2IA 3L9VA 1X9WB 4IGJA 5AN1A 3C1RA 3TJKA 2RUEA 1K0NA 5F8BA 5HFKA 3KJYA 3F6FA 2N5BA 3GX0A 1K0OA 2E2GA 2EIRA 2TRCP 1T7PB 3IE3A 2VCVA 1WMJA 4MJCA 3GUSA 3VK9A 1OKTA 4WF4A 1GTBA 4EO3A 5JWOB 1FOVA 6GSYA 2JSYA 5DALA 2B5XA 2JADA 2CVDA 2H8LA 3EYTA 2C0DA 4OFTA 1F2EA 5IO0A 5G31A 2K8VA 3UBLA 4HEA2 5INYA 2GZPA 1BEDA 4X1UA 1YEXA 3FY7A 3GV1A 3UAPA 3IAM2 2WGRA 2WB9A 1XWCA 3U6VA 1V40A 2GQLA 3P8WA 1GLPA 4GCIA 4GSNA 3RAZA 2EIOA 1KBNA 2H70A 1ZOFA 2H0GA 2CQ9A 3NIVA 1MDIA 1XWBA 2H6ZA 5CYYA 3IBHA 3IC4A 1WJKA 2L59A 4NHZA 4JE1A 4GTUA 1J9BA 4IELA 1A0RP 3Q6OA 1TW9A 3TKSA 2GDRA 5JWQB 3TKSC 5ECHB 2VLTA 1SKRB 4DEJA 1GP1A 5F05A 1T1VA 4HJ2A 2YANA 1SKSB 1T4ZA 1T8EB 2M72A 4O5RA 3HD5A 2X64A 5H5QA 2NTOA 5J9BA 2I9HA 2IWTA 4MP4A 4EVMA 1R4WA 16GSA 1U87A 6GSUA 3LORA 2N5AA 2H1AA 2EIQA 1NHYA 3UIWA 2LSTA 4MA9A 3DEXA 4IVFA 3CSIA 4ZL9A 4ECIA 2B7KA 4BWSA 3IRAA 4PQ1A 1GWCA 4PUFC 1AXDA 4OMVA 5IOWA 3ME8A 4AJ8A 4K9ZA 4HQZA 2MMNA 4WBRD 4ZBAA 5D9TA 1W89A 1AIUA 4O7HA 2V6KA 2H0HA 2GS3A 3IV4A 4BWQA 3TRPA 1R5PA 2B5EA 1WP0A 4OFNA 1K0AA 1U88A 4IQ1A 3TUEA 3EC3A 2YP6A 3GSTA 3WD6A 5J4UA 3VWUA 2CZ3A 2G2QA 4Z7XA 2OE3A 5JCUA 2WS2A 3HYPA 5JWRB 1SL2B 3FYGA 3CYNA 2LV3A 1GSQA 4POLA 2I3YA 4FYCA 4X43A 4NAXA 3RDWA 1PL2A 6GSSA 1U3AA 4IP6A 1YDKA 1TI3A 1A23A 2HZEA 2JL4A 4EF0A 3O3TA 2WDUA 2GT6A 5J41A 2LTKA 4RQXA 1X5EA 3TKPA 3WYWA 5CRDA 5HR0A 4OCFA 3MWHA 1BG5A 4AF2A 3C1SA 4HUAA 2VCXA 4ZXGA 3ZFBA 2H6XA 4TXVA 4CDOA 1IYHA 1I9DA 2KLXA 4F0BA 3VPQA 2LRCA 3HJPA 2R6KA 3TJGA 5CAXA 5GAPD 3CRTA 3IK7A 2GSQA 1GSUA 2JZSA 3FK8A 1RQMA 4POMA 2C3NA 4JEDA 4H86A 4J2FA 4JBBA 5F06A 2H74A 2LS5A 5IPHA 2FNOA 5AGYA 1GSSA 1SD8A 3L9SA 2IL3A 1OE7A 4OO5A 3ZLPA 1DE2A 1JZRA 4F82A 1TI1A 2H76A 4MJBA 4GQCA 3U5RE 1LJRA 1GSFA 4HS1A 4IW9A 5D9WA 4ISDA 3FR9A 1JFUA 1J08A 2H1DA 1OC8A 5ECKB 4I2TA 4EKZA 2V32A 4JR4A 1PMTA 1B48A 3GL3A 2VD1A 3SBCA 3UBKA 4N11A 3GRXA 3ZTLA 2IN3A 2OE0A 4KAEA 2E0QA 1KTEA 2PVQA 3TCOA 4KGIA 3ZL5A 3HHVA 4I5QA 2H75A 2B1LA 1FG4A 3GTUA 12GSA 5DBQA 4K2DA 3H93A 1GH2A 4MH3A 3JCML 3I43A 1XPVA 2KOKA 1VF3A 4IJIA 5ECRB 2X99A 1JHBA 1K3LA 1XBSA 5IMAA 1Y25A 5KN2A 5ECQB 3Q18A 1YF0A 1IYIA 3P90A 1SYXA 4L5LA 4HOJA 4BPYA 3NOFA 2FWHA 2R3XA 3MDKA 2JZRA 5AIXA 2L6DA 3DVXA 3IOSA 2I81A 2HE3A 2V41A 1PL1A 3KP9A 1QQ2A 1K0BA 3TB2A 5IPGA 3ERGA 5A4VA 3ZFLA 2GZZA 2GLRA 3FZ9A 2VL2A 4KW6A 4KDUA 4J57E 3GURA 4WR4A 1HQOA 2GSTA 4BVYA 2VL2C 2C0EA 3FZAA 1SL1B 3BJ5A 1ERUA 2KP2A 3UL3A 5GAND 2CAQA 2CAIA 3A5WA 3D0ZA 3I6AA 4EUYA 2H66A 2V1MA 2PGTA 1OYJA 3ME7A 4K0NA 1F6MC 4N10A 1S3AA 4L8EA 1G6YA 4WF5A 1ERWA 3A2XA 3KEBA 3UVTA 1O8XA 1UA5A 2BMXA 3ED3A 2HI7A 4WBJA 5GSSA 2DSAA 1O73A 1FO5A 2MMOA 2VD0A 2DBCA 5J3RA 1AUCA 4MH2A 2F51A 3HY2A 1MTCA 2CT6A 4IQAA 3FEUA 4MF6A 4KSOA 2OADA 2LUSA 4MZBA 3UVHA 3G7JA 2HFDA 2RM6A 2F9SA 3H79A 5DQYA 4TN8A 2ES7A 2OJLA 3QAWA 4IKHA 3DYRA 1NHOA 2N5FA 2FUG2 2E2MA 1TJDA 2P0GA 5L71A 4TW5A 2C3QA 2C8UA 3MSZA 1QK8A 2PMTA 1YY7A 6GSVA 3QAGA 4I6XA 3TRXA 2FCHA 5ECNB 1XWAA 4FIWA 4Q5NA 3HZ8A 4YAPA 3WT1A 2L5OA 3RHCA 3KH9A 2MBTA 3TKRA 1TU8A 2BTOT 5LCZA 3BOAA 3VPTA 1EP7A 1N2AA 2P5RA 3VLNA 4X0XA 3QPMA 5GSTA 3ZYWA 5CRHA 4IS0A 1M2BA 2HSYA 2C0GA 4ILFA 1K3OA 2DJ3A 2P31A 2YWMA 4NHWA 5IMFA 3GIXA 2IFQA 2CV4A 4PQHA 4MDCA 1OE8A 4KUNA 3EWLA 3EINA 1M99A 2O8VB 4HQSA 2GZYA 1XFLA 5IOXA 1PD21 3ERFA 1LBKA 1WIKA 2HZEB 2B7JA 1Z7RA 2VL3A 3G9BA 3HJMA 2VLUA 3IK9A 4YAVA 2F3MA 5CO3A 2J9HA 2QGVA 2AB6A 3QFAC 2NDOA 3FR3A 2DIYA 4D73A 4LA1A 3KH7A 4NXIA 5CRWA 1K0DA 1PSQA 3H8QA 4ZB8A 2CVBA 3TJJA 4TKYA 3ZVJD 5GZZB 5A4WA 5KEJA 1Z6MA 1T4YA 4GF0A 1GUHA 2RLIA 3M0FA 2LRTA 1TU7A 2WRTA 3LSZA 3W8JA 4LMWA 3P2AA 1XW9A 2H73A 3VI7A 4EXJA 1GSDA 1EP8A 3TRQA 4MPGA 4BA7A 2AV4A 1TRWA 4PNGA 1XVQA 3GSSA 4LMVA 4MABA 4OCEA 1THOA 2MMZA 4F03A 1DE1A 1V9WA 4JU5A 5E59A 1QFNA 2VCQA 4K1FA 2DJ0A 5H5SA 4HZ2A 3VWVA 3S9FA 1WE0A 2R2JA 3KMNA 3HCZA 3GTUB 1WOUA 1XOAA 2WULA 2LJRA 3IPZA 5KN1A 4V2MA 3GL5A 1YKAA 4MPFA 4RI7A 1XIYA 4ECCA 3HZ4A 4I97A 4NV2A 1EEMA 4GSTA 5IMCA 1WWJA 2PERA 2XPEA 2VO4A 1A0FA 3F63A 1S3CA 2XBIA 3HXSA 1GSEA 2OA7A 1Q98A 3WT2A 2Z9SA 4V2LA 1M7TA 1OC3A 3F4RA 1ZZYA 5B7CA 1M9BA 6GSWA 4DSSB 4TR0A 2H6YA 4MK3A 2HZFA 3ZZXA 3IXRA 4TVEA 1SJ6A 1V58A 2H30A 2H1GA 1JZOA 4BL7A 3D6IA 5CRGA 1DSBA 3N9JA 1GUMA 5F07A 3O6TA 3TGZA 1SU9A 2AHEA 4KB3A 1PKWA 3ZRDA 2XPDA 5EPFA 3D22A 2H71A 1PX6A 4FYBA 1XVWA 2MBSA 5G5EA 1BQ7A 1EWXA 3CRUA 4ZBDA 1PKZA 5HR3A 4FH8A 17GSA 1ST9A 5B8BA 2IJYA 2HLSA 1XWKA 4HDEA 3CTGA 4AGSA 3PR8A 1OKDA 4KNDA 2XBQA 5IO2A 3IHQA 3PGTA 4GSSA 4HU9A 1ILOA 4K7OA 3GHAA 1EZKA 3DGQA 5ECOB 2YV9A 2K9FA 2YCDA 2VIMA 1VF1A 1M2DA 4MLYA 1PQNA 2GSSA 2B1KA 5KN3A 18GSA 1Z9HA 3W6GA 3KZQA 4ZILA 2H72A 1MD4A 2DMLA 1DUGA 4L0UA 1M2AA 1QXHA 1CQHA 3L78A 3F3RA 3H1NA 1TKDB 5DAKB 2YJ7A 5ELAA 3W8SA 2ZUPA 3FHKA 1YJ6A 2BJXA 3HA9A 4GRFA 1VF4A 2DIZA 5B6MA 1DBYA 2C4JA 3LFLA 2O7KA 4BVXA 5ID2B 1O7UA 1SYRA 3TJBA 1F3BA 1Z3EA 5JCWA 3KMOA 1VRSD 5EL8A 2I4AA 2G0FA 3VWXA 20GSA 2K6VA 4MZCA 2C1YA 1C72A 3F3QA 2AAWA 2VM1A 2RIIA 4V1Ag 5D93A 5HR2A 1RK4A 5FT3A 3M3MA 2KUCA 5LD0A 3I69A 3BCIA 5HR1A 7GSSA 5IMVA 3LQ7A 4MF5A 5IIZA 2LRNA 4KCEA 2VM2A 4ECJA 4K7NA 10GSA 3FW2A 2FHEA 4N30A 1EV9A 3LXZA 4V1Ap 5AISA 2HRNA 3BCKA 2RUFA 4MJEA 1UC7A 1O81A 6GSTA 4DSRA 1F9MA 5E4WA 2AUVA 2XHFA 5F0GA 3A3TA 1HYUA 1Z6NA 3L9UA 1H4OA 5B8AA 5HQPA 4TRXA 3APQA 2DJJA 1QMVA 2LNSA 5DALB 2JSZA 4EC0A 5COHA 2REMA 3V1WA 5DCGA 1YF1A 3GN3A 2LQOA 1O85A 1YEPA 1R5AA 3LYPA 4ECBA 5HFGA 2B3SA 3TOTA 4XHMA 19GSA 3TDGA 3OR5A 2LKUA 4AJ6A 4L5OA 4KX4A 1NW2A 3KTBA 4DSQA 2ON5A 4YH2A 3KXOA 2GT5A 5ABRA 3G7IA 2YZUA 5G30A 3K8NA 2IMKA 2L5LA 4ACSA 2FA4A 4XS1A 2DLXA 5J5NA 3AY8A 1SENA 1AC1A 4OWYA 1SK1A 4O32A 3BD2A 4K8MA 4MF7A 2FLSA 4XS6A 1YKCA 2IMFA 2H0IA 4KE3A 5FHIA 3PH9A 2L4QA 4XS4A 4G2EA 4E8EA 3RBTA 1B9YC 2VLVA 1XWGA 3UEMA 1ABAA 4FO5A 4KDYA 3ZIVA 4KDXA 1FVJA 1XZOA 5IM9A 1X5CA 4TOPA 2XC2A 3J7Yb 3MNGA 2QKEA 3GKXA 2M80A 3KP8A 4KH7A 2VAFA 4Q5RA 1GTUA 2F8AA 4G19A 5ECLB 2MZCA 5C00A 3EURA 1AQXA 2VL9A 2PVOC 1FW1A 1SJZA 1GTIA 4RQRA 4ZL8A 4J56E 3Q74A 4WXTA 4PX1A 3A2WA 3A2VA 1GULA 1X0RA 2TRXA 4POBA 3M9KA 3ISOA 5CNWA 4WEYA 4KSMA 5A5KA 1S3DA 2ON7A 4HI7A 1EV4A 1OVNA 2CA8A 3ZITA 2KP1A 2A2SA 1H75A 2FD3A 2B5YA 4JRRA 3RHBA 2DJKA 2LEGA 2PWJA 2O85A 2HSHA 1XOBA 2R5GA 3O76A 5D9XA 3GH6A 1HNBA 2L57A 2J23A 4GXZA 1GSYA 1V98A 2YWIA 2TIRA 4EE0A 2B6MA 1GTAA 4PNFA 1TK0B 2ZNMA 3UMAA 3Q19A 5ECIB 1V2AA 5DCHA 1GRXA 4PGTA 2FA8A 4ULXA 11GSA 1SJIA 3F6DA 5DQSA 4HZ4A 3DWVA 4TR3A 1YZXA 2LJAA 1SKWB 1UN2A 1W4VA 1TRUA 4YQMA 2YJHA 1EOGA 1FB0A 4TR4A 2WCIA 4OD7A 2LJKA 4G9HA 4IN0A 3TOUA 1USBA 3SWLA 1QUWA 1FVKA 3KTLA 1A24A 2C0FA 3LGCA 2YV7A 2E7PA 1HNAA 4WETA 2YPMA 4P3YB 2GQKA 4ZB6A 1AQWA 1ZCPA 2JACA 2K18A 2X8GA 1J0FA 3ZMLA 1GNWA 3WGXA 1QGVA 4MMMA 4WKWA 4CW9A 2MMAA 2YOIA 1KEBA 3QMXA 4ML1A 4DVCA 3G7YA 3APOA 2PPTA 2PU9C 3VURA 4XCSA 1VGLA 1A2MA 1TK8B 5D96A 4GLTA 3EMXA 4TXOA 1G6WA 2H01A 4TR1A 3QAVA 3GX8A 4QQ7A 3M9JA 4IP1A 3IR4A 1OC9A 1MDKA 3LJRA 1JZDA 2AJQB 2OE1A 1K3YA 3DRNA 1F3AA 2F8FA 4POKA 4FYUA 1TP9A 3DMLA 1BYEA 2QC7A 5G1LA 1MD3A 3KCMA 1O8WA 2WZ9A 1R26A 4MZWA 3HDCA 1ACVA 2C3TA 5EY6A 3L4NA 4YQVA 1AW9A 1UVZA 5IMDA 2AYTA 5JCGA 4Q5FA 3LYKA 3QFBC 1K0CA 2JU5A 1ZYEA 2JZTA 2X8CA 4QL9A 4K7IA 2YN1A 3GFKA 5AIVA 4KA0A 4RUVA 3E9JB 1ERTA 1A2LA 1ZGNA 5HFIA 3HVXA 1GUKA 3C71A 2VUPA 3FKFA 4MCUA 1BAYA 4XS4B 3FR6A 4N0ZA 2HNLA 2X8HA 1TDIA 1TRVA 3L0HA 3IA1A 2NVLA 6GSXA 1PA3A 2K8SA 5ECSA 4PURA 3P7XA 1JZWA 4NPBA 2PUKC 5DDLA 1PX7A 2FY6A 4ZBBA 2MYGA 4AJ7A 1B4PA 2YZHA 8GSSA 3ZIJA 1YQ1A 2GSRA 2PBJA 5J9CA 1ON4A 1XW6A 4IJ3A 3QDNA 4QL7A 4JR6A 2ALBA 5IMZA 2HRFA 4PQIA 2DMMA 3TKSE 5ELGA 1LU4A 5CP1A 2VCZA 3KM6A 4OFMA 4F9ZA 2FWFA 2OKAA 3HVVA 3F4SA 3M8NA 1N8JA 4ZL7A 5KN0A 4PUAA 1X9SB 1BX9A 1R7HA 1RW1A 3CSJA 2A4VA 1EEJA 3F4TA 1FAAA 5DVBA 5D73A 1OAZA 2R4VA 1B8XA 5ENUA 4K6XA 4NMUA 1GNEA 2NBSA 3TJFA 4ML6A 3NZNA 1T3BA 1WRYA 3RPPA 3D4TA 3CSHA 3QCPA 1Z5YE 5DJLA 4JZQA 3I9V2 3GKNA 2IFQB 4LLRA 1EGOA 3FZ5A 5CREA 1A8LA 4I8BA 4O92A 3RPNA 1K0MA 4XRDA 5IQYA 3QR6A 1B4QA 4NWYA 2R37A 1ZL9A 1ERVA 4L0WA 3N5OA 3F0IA 4LL1B 1GL8A 1XCCA 3ZMKA 1SK2A 2VCWA 4CHSA 1A2JA 2O87A 4WR5A 4D73B 2H19A 2OACA 1ML6A 1ZMAA 2D2ZA 9GSSA 1X5DA 3IAS2 3C8EA 3ERWA 4F0CA 5LNKe 3WGEA 2YWNA 3BBYA 2CX3A 3CXGA 1SL0B 3QD9A 1T00A 3APSA 3VFIA 4EDYA 1U3IA 2NPBA 1HD2A 3ZREA 3HJOA 5G1KA 1TK5B 1JLWA 3CTFA 5DJMA 3ZVJA 2H1BA 2QSIA 3KD0A 3E3EA 2VCTA 2A2RA 1XW5A 2FGXA 2GVPA 4V2NA 2WFCA 4RI6A 1G7EA 1XXUA 1SK0A 2VOCA 2RM5A 5ECMB 1URMA 3D21A 5C04A 1MDJA 1E2YA 3EMPA 2C80A 3KIJA 4IHUA 1CQGA 4EDZA 1F37A 5G5FA 4TXOB 2DJ2A 2V6OA 4TR1B 2GQMA 5G2ZA 4YQUA 3TKQA 3UOMA 1PGTA 4DSSA 3EVIA 1OC9B 2KHPA 3LXTA 3GA4A 3DIEA 4PXOA 3HKRA 5EVOA 1EOHA 1VF2A 3FZ4A 4ZIJA 3UJ1A 3D4MA 1HNCA 3C73A 4EL1A 1V57A 2HYXA 3H4KA 1E6BA
chains in the Genus database with same CATH superfamily
2YWOA 2CX4A 2IIYA 1BJXA 22GSA 2DJ1A 1G0TA 2M46A 4XTSA 1AAZA 4HJMA 4BIKA 5B6NA 1AQVA 3MIXA 2HSMA 2OBIA 2I1UA 3CBUA 1PRXA 2O89A 2CZ2A 4IBPA 1JLVA 1NM3A 2IMDA 4I2UA 3EU3A 3GNJA 2GTUA 13GSA 1A8YA 3GH9A 4KF9A 4LL4B 3GKMA 2LQQA 2YNXA 3DD3A 1Z7PA 1M9AA 3GMFA 2IMEA 1U6TA 4XRAA 2P5QA 2PN8A 3CQFA 3F8UA 1B9XC 4NV5A 3UARA 1PN9A 3E0UA 3EE2A 4OO4A 14GSA 3KGKA 3R2QA 2DKIA 1GLQA 1THXA 3QOUA 1X9MB 3CMIA 1MEKA 2HT9A 4O5QA 2L4CA 1EGRA 1TXXA 2FWEA 4ID0A 3LWAA 3D5JA 4E8HA 3HVSA 4K0GA 5D9VA 5DAKA 3F9UA 2LNTA 2ZCTA 2EC4A 1WPIA 4N0VA 5ECPB 3IDVA 3PINA 1FB6A 4MJAA 3C7MA 5H5RA 1TRSA 3VWWA 1KNGA 1I5GA 3M1GA 1FHEA 2WJUA 3DVWA 2DC5A 3DKSA 3FRCA 1NSWA 5ID2A 3US3A 5D8IA 3WGDA 1ZYQB 4KCAA 2L6CA 4G0LA 1TTZA 2IMIA 4XIHA 4HU7A 1Y6EA 2HXKA 1TOFA 3LG6A 4Q5QA 3DXBA 1M0UA 3VI5A 2GGTA 4GWRA 4ZB9A 3EU4A 4G10A 2V2GA 3GYKA 2FWGA 3MAKA 3LEFA 1Q4JA 5A4UA 1O6JA 1G7OA 3J7Yk 1PN0A 3EPTA 2OBKA 4GQFA 4BVXB 5FWGA 1SD9A 2IPAA 3GKKA 2CVKA 4F2IA 3L9VA 1X9WB 4IGJA 5AN1A 3C1RA 3TJKA 2RUEA 1K0NA 5F8BA 5HFKA 3KJYA 3F6FA 2N5BA 3GX0A 1K0OA 2E2GA 2EIRA 2TRCP 1T7PB 3IE3A 2VCVA 1WMJA 4MJCA 3GUSA 3VK9A 1OKTA 4WF4A 1GTBA 4EO3A 5JWOB 1FOVA 6GSYA 2JSYA 5DALA 2B5XA 2JADA 2CVDA 2H8LA 3EYTA 2C0DA 4OFTA 1F2EA 5IO0A 5G31A 2K8VA 3UBLA 4HEA2 5INYA 2GZPA 1BEDA 4X1UA 1YEXA 3FY7A 3GV1A 3UAPA 3IAM2 2WGRA 2WB9A 1XWCA 3U6VA 1V40A 2GQLA 3P8WA 1GLPA 4GCIA 4GSNA 3RAZA 2EIOA 1KBNA 2H70A 1ZOFA 2H0GA 2CQ9A 3NIVA 1MDIA 1XWBA 2H6ZA 5CYYA 3IBHA 3IC4A 1WJKA 2L59A 4NHZA 4JE1A 4GTUA 1J9BA 4CY6A 4IELA 1A0RP 3Q6OA 4YKGA 1TW9A 3TKSA 2GDRA 5JWQB 3TKSC 5ECHB 2VLTA 1SKRB 4DEJA 1GP1A 5F05A 1T1VA 4HJ2A 2YANA 1SKSB 1T4ZA 1T8EB 2M72A 4O5RA 3HD5A 2X64A 5H5QA 2NTOA 5J9BA 2I9HA 2IWTA 4MP4A 4EVMA 1R4WA 16GSA 1U87A 6GSUA 3LORA 2N5AA 2H1AA 2EIQA 1NHYA 3UIWA 2LSTA 4MA9A 3DEXA 4IVFA 3HVNA 3CSIA 4ZL9A 4ECIA 2B7KA 4BWSA 3IRAA 4PQ1A 1GWCA 4PUFC 1AXDA 4OMVA 5IOWA 3ME8A 4AJ8A 4K9ZA 4HQZA 2MMNA 4WBRD 4ZBAA 5D9TA 1W89A 1AIUA 4O7HA 2V6KA 2H0HA 2GS3A 3IV4A 4BWQA 3TRPA 1R5PA 2B5EA 1WP0A 4OFNA 1K0AA 1U88A 4IQ1A 3TUEA 3EC3A 2YP6A 3GSTA 3WD6A 5J4UA 3VWUA 2CZ3A 2G2QA 4Z7XA 2OE3A 5JCUA 2WS2A 3HYPA 5JWRB 1SL2B 3FYGA 3CYNA 2LV3A 1GSQA 4POLA 2I3YA 4FYCA 4X43A 4NAXA 3RDWA 1PL2A 6GSSA 1U3AA 4IP6A 1YDKA 1TI3A 1A23A 2HZEA 2JL4A 4EF0A 3O3TA 2WDUA 2GT6A 5J41A 2LTKA 4RQXA 1X5EA 3TKPA 3WYWA 5CRDA 5HR0A 4OCFA 3MWHA 2R0PA 1BG5A 4AF2A 3C1SA 4HUAA 2VCXA 4ZXGA 3ZFBA 2H6XA 4TXVA 4CDOA 1IYHA 1I9DA 2KLXA 4F0BA 3VPQA 2LRCA 3HJPA 2R6KA 3TJGA 5CAXA 5GAPD 3CRTA 3IK7A 2GSQA 1GSUA 2JZSA 3FK8A 1RQMA 4POMA 2C3NA 4JEDA 4H86A 4J2FA 4JBBA 5F06A 2H74A 2LS5A 5IPHA 2FNOA 5AGYA 1GSSA 3A5IA 1SD8A 3L9SA 2IL3A 1OE7A 4OO5A 2QA1A 3ZLPA 1DE2A 1JZRA 4F82A 1TI1A 2H76A 4MJBA 4GQCA 3U5RE 1LJRA 1GSFA 3LW9A 4HS1A 4IW9A 5D9WA 4ISDA 3FR9A 1JFUA 1J08A 2H1DA 1OC8A 5ECKB 4I2TA 4EKZA 2V32A 4JR4A 1PMTA 1B48A 3GL3A 2VD1A 3SBCA 3UBKA 4N11A 3GRXA 3ZTLA 2IN3A 2OE0A 4KAEA 2E0QA 1KTEA 2PVQA 3TCOA 4KGIA 3ZL5A 3HHVA 4I5QA 2H75A 2B1LA 1FG4A 3GTUA 12GSA 5DBQA 4K2DA 3H93A 1GH2A 4MH3A 3JCML 3I43A 1XPVA 2KOKA 1VF3A 4IJIA 1PFOA 5ECRB 2X99A 1JHBA 1K3LA 1XBSA 5IMAA 1Y25A 5KN2A 5ECQB 3Q18A 1YF0A 1IYIA 3P90A 1SYXA 4L5LA 4HOJA 1ZYNA 4K2XA 4BPYA 4O5UA 3NOFA 2FWHA 2R3XA 3MDKA 2JZRA 5AIXA 2L6DA 3DVXA 3IOSA 2I81A 2HE3A 2V41A 1PL1A 3KP9A 1QQ2A 1K0BA 3TB2A 5IPGA 3ERGA 5A4VA 3ZFLA 2GZZA 2GLRA 3FZ9A 2VL2A 4KW6A 4KDUA 4J57E 3GURA 4WR4A 1HQOA 2GSTA 4BVYA 2VL2C 2C0EA 3FZAA 1SL1B 3BJ5A 1ERUA 2KP2A 3UL3A 2X4AA 5GAND 2CAQA 2CAIA 3A5WA 3D0ZA 3I6AA 4EUYA 2H66A 2V1MA 2PGTA 1OYJA 3ME7A 4K0NA 1F6MC 4N10A 1S3AA 4L8EA 1G6YA 4WF5A 1ERWA 3A2XA 3KEBA 3UVTA 1O8XA 1UA5A 2BMXA 3ED3A 2HI7A 4WBJA 5GSSA 2DSAA 1O73A 1FO5A 2MMOA 2VD0A 2DBCA 5J3RA 1AUCA 4MH2A 2F51A 3HY2A 1MTCA 2CT6A 4IQAA 3FEUA 4MF6A 4KSOA 2OADA 2LUSA 4MZBA 3UVHA 3G7JA 2HFDA 2RM6A 2F9SA 3H79A 5DQYA 4TN8A 2ES7A 2OJLA 3QAWA 4IKHA 3DYRA 1NHOA 4PTSA 2N5FA 2FUG2 2E2MA 1TJDA 2P0GA 5L71A 2QA2A 4TW5A 2C3QA 2C8UA 3MSZA 1QK8A 2PMTA 1YY7A 6GSVA 3QAGA 4I6XA 3TRXA 2FCHA 5ECNB 1XWAA 4FIWA 4Q5NA 3HZ8A 4YAPA 3WT1A 2L5OA 3RHCA 3KH9A 2MBTA 3TKRA 1TU8A 2BTOT 5LCZA 3BOAA 3VPTA 1EP7A 1N2AA 2P5RA 3VLNA 4X0XA 3QPMA 5GSTA 3ZYWA 5CRHA 4IS0A 1M2BA 2HSYA 2C0GA 4ILFA 1K3OA 2DJ3A 2P31A 2YWMA 4NHWA 4G0KA 5IMFA 3R3EA 3GIXA 2IFQA 2CV4A 4PQHA 4MDCA 1OE8A 4KUNA 3EWLA 3EINA 1M99A 2O8VB 4HQSA 2GZYA 1XFLA 5IOXA 1PD21 3ERFA 1LBKA 1WIKA 2HZEB 2B7JA 1Z7RA 2VL3A 3G9BA 3HJMA 2VLUA 3IK9A 4YAVA 2F3MA 5CO3A 2J9HA 2QGVA 2AB6A 3QFAC 2NDOA 3FR3A 2DIYA 4D73A 4LA1A 3KH7A 4NXIA 5CRWA 1K0DA 1PSQA 3H8QA 4ZB8A 2CVBA 3TJJA 4TKYA 3ZVJD 5GZZB 5A4WA 5KEJA 1Z6MA 1T4YA 4GF0A 1GUHA 2RLIA 3M0FA 2LRTA 1TU7A 2WRTA 3LSZA 3W8JA 4LMWA 3P2AA 1XW9A 2H73A 3VI7A 4EXJA 1GSDA 1EP8A 3TRQA 4MPGA 4BA7A 2AV4A 1TRWA 4PNGA 4MNNA 1XVQA 3GSSA 4LMVA 4MABA 4OCEA 1THOA 2MMZA 4F03A 1DE1A 1FOHA 1V9WA 4JU5A 5E59A 1QFNA 2VCQA 4K1FA 2DJ0A 5H5SA 4HZ2A 3VWVA 3S9FA 1WE0A 2R2JA 3KMNA 3HCZA 1ZYPA 3GTUB 1WOUA 1XOAA 2WULA 2LJRA 3IPZA 5KN1A 4V2MA 3GL5A 1YKAA 1M3JA 4MPFA 4RI7A 1XIYA 4ECCA 3HZ4A 4I97A 4NV2A 1EEMA 4GSTA 5IMCA 1WWJA 2PERA 2XPEA 2VO4A 1A0FA 3F63A 1S3CA 2XBIA 3HXSA 1GSEA 2OA7A 1Q98A 3WT2A 2Z9SA 4V2LA 1M7TA 1OC3A 3F4RA 1ZZYA 5B7CA 1M9BA 6GSWA 4DSSB 4TR0A 2H6YA 4MK3A 2HZFA 3ZZXA 3IXRA 4TVEA 1SJ6A 1V58A 2H30A 2H1GA 1JZOA 4BL7A 3D6IA 5CRGA 1DSBA 3N9JA 5BRTA 1GUMA 4EIPA 5F07A 3O6TA 3TGZA 1SU9A 2AHEA 4KB3A 1PKWA 3ZRDA 2XPDA 5EPFA 3D22A 2H71A 1PX6A 4FYBA 1XVWA 2MBSA 5G5EA 1BQ7A 1EWXA 3CRUA 4ZBDA 1PKZA 5HR3A 4FH8A 17GSA 1ST9A 5B8BA 2IJYA 2DKHA 2HLSA 1XWKA 4HDEA 3CTGA 4AGSA 3PR8A 4X4JA 1OKDA 4KNDA 2X49A 2XBQA 4A5PA 5IO2A 3IHQA 3PGTA 4GSSA 4HU9A 1ILOA 4K7OA 3GHAA 1EZKA 3DGQA 5ECOB 2YV9A 2K9FA 2YCDA 2VIMA 1VF1A 1M2DA 4MLYA 1PQNA 2GSSA 2B1KA 5KN3A 18GSA 2A2PA 1Z9HA 3W6GA 3KZQA 4ZILA 2H72A 1MD4A 2DMLA 1DUGA 4L0UA 1M2AA 1QXHA 1CQHA 3L78A 4Z2TA 3F3RA 3H1NA 1TKDB 5DAKB 2YJ7A 5ELAA 4EIQA 3W8SA 2ZUPA 3FHKA 1YJ6A 2BJXA 3HA9A 4GRFA 1VF4A 2DIZA 5B6MA 1DBYA 2C4JA 3LFLA 2O7KA 4BVXA 5ID2B 1O7UA 1SYRA 3TJBA 1F3BA 1Z3EA 5JCWA 3KMOA 1VRSD 5EL8A 2I4AA 2G0FA 3VWXA 20GSA 2K6VA 4MZCA 2C1YA 1C72A 3F3QA 2AAWA 2VM1A 2RIIA 4V1Ag 5D93A 5HR2A 1RK4A 5FT3A 3M3MA 2KUCA 5LD0A 3I69A 3BCIA 4USSA 5HR1A 1S3RA 7GSSA 5IMVA 3LQ7A 4MF5A 5IIZA 2LRNA 4KCEA 2VM2A 4ECJA 4K7NA 10GSA 3FW2A 2FHEA 4N30A 1EV9A 3LXZA 4V1Ap 5AISA 2HRNA 3BCKA 2RUFA 4MJEA 1UC7A 1O81A 6GSTA 4DSRA 1F9MA 5E4WA 2AUVA 2XHFA 5F0GA 3A3TA 1HYUA 1Z6NA 3L9UA 1H4OA 5B8AA 5HQPA 4TRXA 3APQA 2DJJA 1QMVA 2LNSA 5DALB 2JSZA 4EC0A 5COHA 2REMA 3V1WA 5DCGA 1YF1A 3GN3A 2LQOA 1O85A 1YEPA 1R5AA 3LYPA 4ECBA 5HFGA 2B3SA 3TOTA 4XHMA 19GSA 3TDGA 3OR5A 2LKUA 4AJ6A 4L5OA 3MYDA 4KX4A 3IC8A 1NW2A 3KTBA 4DSQA 2ON5A 4YH2A 3KXOA 4K5RA 2GT5A 5ABRA 3G7IA 2YZUA 5G30A 3K8NA 2IMKA 2L5LA 4ACSA 2FA4A 4XS1A 2DLXA 5J5NA 3AY8A 1SENA 1AC1A 4OWYA 1SK1A 4O32A 4G0IA 3BD2A 4K8MA 4MF7A 2FLSA 4XS6A 1YKCA 2IMFA 2H0IA 4KE3A 5FHIA 3PH9A 2L4QA 4XS4A 4G2EA 4E8EA 3RBTA 1B9YC 2VLVA 1XWGA 3UEMA 1ABAA 4FO5A 4KDYA 3ZIVA 4KDXA 1FVJA 4HSCX 1XZOA 5IM9A 1X5CA 4TOPA 2XC2A 3J7Yb 3MNGA 2QKEA 3GKXA 2M80A 3KP8A 4KH7A 2VAFA 4Q5RA 1GTUA 2F8AA 2HRKA 4G19A 4BL7B 5ECLB 2MZCA 5C00A 3EURA 1AQXA 2VL9A 2PVOC 1FW1A 1SJZA 1GTIA 4RQRA 4ZL8A 4J56E 3Q74A 4WXTA 4PX1A 3A2WA 3A2VA 1GULA 1X0RA 2TRXA 4POBA 3M9KA 3ISOA 5CNWA 4WEYA 4KSMA 5A5KA 1S3DA 1XG8A 2ON7A 4HI7A 1EV4A 1OVNA 2CA8A 3ZITA 2KP1A 2A2SA 1H75A 2FD3A 2B5YA 4JRRA 3RHBA 2DJKA 2LEGA 2PWJA 2O85A 2HSHA 1XOBA 2R5GA 3O76A 5D9XA 3GH6A 1HNBA 2L57A 2J23A 4GXZA 1GSYA 1V98A 2YWIA 2TIRA 4EE0A 2B6MA 1GTAA 4PNFA 1TK0B 4Z2RA 2ZNMA 3UMAA 3Q19A 5ECIB 1V2AA 5DCHA 1GRXA 4PGTA 2FA8A 4ULXA 2R0CA 11GSA 1SJIA 3F6DA 5DQSA 4HZ4A 3DWVA 4TR3A 1YZXA 2LJAA 1SKWB 1UN2A 1W4VA 1TRUA 4YQMA 2YJHA 1EOGA 1FB0A 4TR4A 2WCIA 4OD7A 2LJKA 4G9HA 4IN0A 3TOUA 1USBA 3SWLA 1QUWA 1FVKA 3KTLA 1A24A 2C0FA 3LGCA 2YV7A 2E7PA 1HNAA 4WETA 2A4HA 2YPMA 4P3YB 2GQKA 4ZB6A 4Z2UA 1AQWA 1ZCPA 2JACA 2K18A 2X8GA 1J0FA 3ZMLA 1GNWA 3WGXA 1QGVA 4MMMA 4WKWA 4CW9A 2MMAA 2YOIA 1KEBA 1M3IA 3QMXA 4ML1A 4DVCA 3G7YA 3APOA 2PPTA 2PU9C 3VURA 4XCSA 1VGLA 1A2MA 1TK8B 5D96A 4GLTA 3EMXA 4TXOA 1G6WA 2H01A 4TR1A 3QAVA 4YKFA 3GX8A 4QQ7A 3M9JA 4IP1A 3IR4A 1OC9A 1MDKA 3LJRA 1JZDA 2AJQB 2OE1A 1K3YA 3DRNA 3IHGA 5BMUA 1F3AA 2F8FA 4POKA 4FYUA 1TP9A 3DMLA 1BYEA 2R0GA 2QC7A 5G1LA 1MD3A 3KCMA 5KOWA 1O8WA 2WZ9A 1R26A 4MZWA 4FQUA 3HDCA 1ACVA 2HRAA 2C3TA 5EY6A 3L4NA 4YQVA 1AW9A 1UVZA 5IMDA 2AYTA 5JCGA 4Q5FA 3LYKA 3QFBC 1K0CA 2JU5A 1ZYEA 2JZTA 2X8CA 5KOXA 4QL9A 4K7IA 4BVYB 2YN1A 3GFKA 5AIVA 4KA0A 4RUVA 3E9JB 1ERTA 1A2LA 1ZGNA 5HFIA 3HVXA 1GUKA 3C71A 2VUPA 3FKFA 4MCUA 1BAYA 4XS4B 3FR6A 4N0ZA 2HNLA 2X8HA 1TDIA 1TRVA 3L0HA 3IA1A 2NVLA 6GSXA 4ICYA 1PA3A 2K8SA 5ECSA 4PURA 3P7XA 1JZWA 4NPBA 2PUKC 5DDLA 1PX7A 2FY6A 4ZBBA 2MYGA 4AJ7A 1B4PA 2YZHA 8GSSA 3ZIJA 1YQ1A 2GSRA 2PBJA 5J9CA 1ON4A 1XW6A 4IJ3A 3QDNA 4QL7A 4JR6A 2ALBA 5IMZA 2HRFA 4PQIA 2DMMA 3TKSE 5ELGA 1LU4A 5CP1A 2VCZA 3KM6A 4OFMA 4F9ZA 2FWFA 2OKAA 3HVVA 3F4SA 3M8NA 1N8JA 3PPUA 4ZL7A 5KN0A 4PUAA 1X9SB 1BX9A 1R7HA 1RW1A 3CSJA 2A4VA 1EEJA 3F4TA 1FAAA 5DVBA 5D73A 1OAZA 2R4VA 1B8XA 5ENUA 4K6XA 4NMUA 1GNEA 2NBSA 3TJFA 4ML6A 3NZNA 1T3BA 1WRYA 3RPPA 3D4TA 2UZ8A 3CSHA 3QCPA 1Z5YE 5DJLA 4JZQA 3I9V2 3GKNA 2IFQB 4LLRA 1EGOA 3FZ5A 5CREA 1A8LA 4I8BA 4O92A 3RPNA 1K0MA 4XRDA 5IQYA 3QR6A 4K5SA 1B4QA 4NWYA 2R37A 1ZL9A 1ERVA 4L0WA 3N5OA 3F0IA 4LL1B 1GL8A 3FMWA 1XCCA 3ZMKA 1SK2A 2VCWA 4CHSA 1A2JA 2O87A 4WR5A 4D73B 2H19A 2OACA 1ML6A 1ZMAA 2D2ZA 9GSSA 1X5DA 3IAS2 3C8EA 3ERWA 4F0CA 5LNKe 3WGEA 2YWNA 3BBYA 2CX3A 3CXGA 1SL0B 3QD9A 1T00A 3APSA 3VFIA 4EDYA 1U3IA 2NPBA 1HD2A 3ZREA 3HJOA 5G1KA 1TK5B 1JLWA 3CTFA 5DJMA 3ZVJA 2H1BA 2QSIA 3KD0A 3E3EA 2VCTA 2A2RA 1XW5A 2FGXA 2GVPA 4V2NA 2WFCA 4RI6A 1G7EA 1XXUA 1SK0A 2VOCA 2RM5A 5ECMB 1URMA 3D21A 5C04A 1MDJA 1E2YA 3EMPA 2C80A 3KIJA 4IHUA 1CQGA 4EDZA 1F37A 5G5FA 4TXOB 2DJ2A 2V6OA 4TR1B 2GQMA 5G2ZA 4YQUA 3TKQA 3UOMA 1PGTA 4DSSA 3EVIA 1OC9B 2KHPA 3LXTA 3GA4A 3DIEA 4PXOA 3HKRA 5EVOA 1EOHA 1VF2A 3FZ4A 4CY8A 4ZIJA 3UJ1A 3D4MA 1HNCA 3C73A 4EL1A 1V57A 2HYXA 3H4KA 1E6BA
chains in the Genus database with same CATH topology
2YWOA 2CX4A 2IIYA 1BJXA 22GSA 2DJ1A 1G0TA 2M46A 4XTSA 1AAZA 4HJMA 5B6NA 1AQVA 3MIXA 2HSMA 2OBIA 2I1UA 3CBUA 1PRXA 2O89A 2CZ2A 4IBPA 1JLVA 1NM3A 2IMDA 4I2UA 3EU3A 3GNJA 2GTUA 13GSA 1A8YA 3GH9A 4KF9A 4LL4B 3GKMA 2LQQA 2YNXA 3DD3A 1Z7PA 1M9AA 3GMFA 2IMEA 1U6TA 4XRAA 2P5QA 2PN8A 3F8UA 1B9XC 4NV5A 3UARA 1PN9A 3E0UA 3EE2A 4OO4A 14GSA 3KGKA 3R2QA 2DKIA 1GLQA 1THXA 3QOUA 1X9MB 3CMIA 1MEKA 2HT9A 4O5QA 2L4CA 1EGRA 1TXXA 2FWEA 4ID0A 3LWAA 3D5JA 4E8HA 3HVSA 4K0GA 5D9VA 5DAKA 3F9UA 2LNTA 2ZCTA 2EC4A 1WPIA 4N0VA 5ECPB 3IDVA 3PINA 1FB6A 4MJAA 3C7MA 5H5RA 1TRSA 3VWWA 1KNGA 1I5GA 3M1GA 1FHEA 2WJUA 3DVWA 2DC5A 3DKSA 3FRCA 1NSWA 5ID2A 3US3A 5D8IA 3WGDA 1ZYQB 4KCAA 2L6CA 4G0LA 1TTZA 2IMIA 4XIHA 4HU7A 1Y6EA 2HXKA 1TOFA 3LG6A 4Q5QA 3DXBA 1M0UA 3VI5A 2GGTA 4GWRA 4ZB9A 3EU4A 4G10A 2V2GA 3GYKA 2FWGA 3MAKA 3LEFA 1Q4JA 5A4UA 1O6JA 1G7OA 3J7Yk 1PN0A 3EPTA 2OBKA 4GQFA 4BVXB 5FWGA 1SD9A 2IPAA 3GKKA 2CVKA 4F2IA 3L9VA 1X9WB 4IGJA 5AN1A 3C1RA 3TJKA 2RUEA 1K0NA 5F8BA 5HFKA 3KJYA 3F6FA 2N5BA 3GX0A 1K0OA 2E2GA 2EIRA 2TRCP 1T7PB 3IE3A 2VCVA 1WMJA 4MJCA 3GUSA 3VK9A 1OKTA 4WF4A 1GTBA 4EO3A 5JWOB 1FOVA 6GSYA 2JSYA 5DALA 2B5XA 2JADA 2CVDA 2H8LA 3EYTA 2C0DA 4OFTA 1F2EA 5IO0A 5G31A 2K8VA 3UBLA 4HEA2 5INYA 2GZPA 1BEDA 4X1UA 1YEXA 3FY7A 3GV1A 3UAPA 3IAM2 2WGRA 2WB9A 1XWCA 3U6VA 1V40A 2GQLA 3P8WA 1GLPA 4GCIA 4GSNA 3RAZA 2EIOA 1KBNA 2H70A 1ZOFA 2H0GA 2CQ9A 3NIVA 1MDIA 1XWBA 2H6ZA 5CYYA 3IBHA 3IC4A 1WJKA 2L59A 4NHZA 4JE1A 4GTUA 1J9BA 4CY6A 4IELA 1A0RP 3Q6OA 4YKGA 1TW9A 3TKSA 2GDRA 5JWQB 3TKSC 5ECHB 2VLTA 1SKRB 4DEJA 1GP1A 5F05A 1T1VA 4HJ2A 2YANA 1SKSB 1T4ZA 1T8EB 2M72A 4O5RA 3HD5A 2X64A 5H5QA 2NTOA 5J9BA 2I9HA 2IWTA 4MP4A 4EVMA 1R4WA 16GSA 1U87A 6GSUA 3LORA 2N5AA 2H1AA 2EIQA 1NHYA 3UIWA 2LSTA 4MA9A 3DEXA 4IVFA 3CSIA 4ZL9A 4ECIA 2B7KA 4BWSA 3IRAA 4PQ1A 1GWCA 4PUFC 1AXDA 4OMVA 5IOWA 3ME8A 4AJ8A 4K9ZA 4HQZA 2MMNA 4WBRD 4ZBAA 5D9TA 1W89A 1AIUA 4O7HA 2V6KA 2H0HA 2GS3A 3IV4A 4BWQA 3TRPA 1R5PA 2B5EA 1WP0A 4OFNA 1K0AA 1U88A 4IQ1A 3TUEA 3EC3A 2YP6A 3GSTA 3WD6A 5J4UA 3VWUA 2CZ3A 2G2QA 4Z7XA 2OE3A 5JCUA 2WS2A 3HYPA 5JWRB 1SL2B 3FYGA 3CYNA 2LV3A 1GSQA 4POLA 2I3YA 4FYCA 4X43A 4NAXA 3RDWA 1PL2A 6GSSA 1U3AA 4IP6A 1YDKA 1TI3A 1A23A 2HZEA 2JL4A 4EF0A 3O3TA 2WDUA 2GT6A 5J41A 2LTKA 4RQXA 1X5EA 3TKPA 3WYWA 5CRDA 5HR0A 4OCFA 3MWHA 2R0PA 1BG5A 4AF2A 3C1SA 4HUAA 2VCXA 4ZXGA 3ZFBA 2H6XA 4TXVA 4CDOA 1IYHA 1I9DA 2KLXA 4F0BA 3VPQA 2LRCA 3HJPA 2R6KA 3TJGA 5CAXA 5GAPD 3CRTA 3IK7A 2GSQA 1GSUA 2JZSA 3FK8A 1RQMA 4POMA 2C3NA 4JEDA 4H86A 4J2FA 4JBBA 5F06A 2H74A 2LS5A 5IPHA 2FNOA 5AGYA 1GSSA 3A5IA 1SD8A 3L9SA 2IL3A 1OE7A 4OO5A 2QA1A 3ZLPA 1DE2A 1JZRA 4F82A 1TI1A 2H76A 4MJBA 4GQCA 3U5RE 1LJRA 1GSFA 3LW9A 4HS1A 4IW9A 5D9WA 4ISDA 3FR9A 1JFUA 1J08A 2H1DA 1OC8A 5ECKB 4I2TA 4EKZA 2V32A 4JR4A 1PMTA 1B48A 3GL3A 2VD1A 3SBCA 3UBKA 4N11A 3GRXA 3ZTLA 2IN3A 2OE0A 4KAEA 2E0QA 1KTEA 2PVQA 3TCOA 4KGIA 3ZL5A 3HHVA 4I5QA 2H75A 2B1LA 1FG4A 3GTUA 12GSA 5DBQA 4K2DA 3H93A 1GH2A 4MH3A 3JCML 3I43A 1XPVA 2KOKA 1VF3A 4IJIA 5ECRB 2X99A 1JHBA 1K3LA 1XBSA 5IMAA 1Y25A 5KN2A 5ECQB 3Q18A 1YF0A 1IYIA 3P90A 1SYXA 4L5LA 4HOJA 1ZYNA 4K2XA 4BPYA 4O5UA 3NOFA 2FWHA 2R3XA 3MDKA 2JZRA 5AIXA 2L6DA 3DVXA 3IOSA 2I81A 2HE3A 2V41A 1PL1A 3KP9A 1QQ2A 1K0BA 3TB2A 5IPGA 3ERGA 5A4VA 3ZFLA 2GZZA 2GLRA 3FZ9A 2VL2A 4KW6A 4KDUA 4J57E 3GURA 4WR4A 1HQOA 2GSTA 4BVYA 2VL2C 2C0EA 3FZAA 1SL1B 3BJ5A 1ERUA 2KP2A 3UL3A 2X4AA 5GAND 2CAQA 2CAIA 3A5WA 3D0ZA 3I6AA 4EUYA 2H66A 2V1MA 2PGTA 1OYJA 3ME7A 4K0NA 1F6MC 4N10A 1S3AA 4L8EA 1G6YA 4WF5A 1ERWA 3A2XA 3KEBA 3UVTA 1O8XA 1UA5A 2BMXA 3ED3A 2HI7A 4WBJA 5GSSA 2DSAA 1O73A 1FO5A 2MMOA 2VD0A 2DBCA 5J3RA 1AUCA 4MH2A 2F51A 3HY2A 1MTCA 2CT6A 4IQAA 3FEUA 4MF6A 4KSOA 2OADA 2LUSA 4MZBA 3UVHA 3G7JA 2HFDA 2RM6A 2F9SA 3H79A 5DQYA 4TN8A 2ES7A 2OJLA 3QAWA 4IKHA 3DYRA 1NHOA 4PTSA 2N5FA 2FUG2 2E2MA 1TJDA 2P0GA 5L71A 2QA2A 4TW5A 2C3QA 2C8UA 3MSZA 1QK8A 2PMTA 1YY7A 6GSVA 3QAGA 4I6XA 3TRXA 2FCHA 5ECNB 1XWAA 4FIWA 4Q5NA 3HZ8A 4YAPA 3WT1A 2L5OA 3RHCA 3KH9A 2MBTA 3TKRA 1TU8A 2BTOT 5LCZA 3BOAA 3VPTA 1EP7A 1N2AA 2P5RA 3VLNA 4X0XA 3QPMA 5GSTA 3ZYWA 5CRHA 4IS0A 1M2BA 2HSYA 2C0GA 4ILFA 1K3OA 2DJ3A 2P31A 2YWMA 4NHWA 4G0KA 5IMFA 3R3EA 3GIXA 2IFQA 2CV4A 4PQHA 4MDCA 1OE8A 4KUNA 3EWLA 3EINA 1M99A 2O8VB 4HQSA 2GZYA 1XFLA 5IOXA 1PD21 3ERFA 1LBKA 1WIKA 2HZEB 2B7JA 1Z7RA 2VL3A 3G9BA 3HJMA 2VLUA 3IK9A 4YAVA 2F3MA 5CO3A 2J9HA 2QGVA 2AB6A 3QFAC 2NDOA 3FR3A 2DIYA 4D73A 4LA1A 3KH7A 4NXIA 5CRWA 1K0DA 1PSQA 3H8QA 4ZB8A 2CVBA 3TJJA 4TKYA 3ZVJD 5GZZB 5A4WA 5KEJA 1Z6MA 1T4YA 4GF0A 1GUHA 2RLIA 3M0FA 2LRTA 1TU7A 2WRTA 3LSZA 3W8JA 4LMWA 3P2AA 1XW9A 2H73A 3VI7A 4EXJA 1GSDA 1EP8A 3TRQA 4MPGA 4BA7A 2AV4A 1TRWA 4PNGA 4MNNA 1XVQA 3GSSA 4LMVA 4MABA 4OCEA 1THOA 2MMZA 4F03A 1DE1A 1FOHA 1V9WA 4JU5A 5E59A 1QFNA 2VCQA 4K1FA 2DJ0A 5H5SA 4HZ2A 3VWVA 3S9FA 1WE0A 2R2JA 3KMNA 3HCZA 1ZYPA 3GTUB 1WOUA 1XOAA 2WULA 2LJRA 3IPZA 5KN1A 4V2MA 3GL5A 1YKAA 4MPFA 4RI7A 1XIYA 4ECCA 3HZ4A 4I97A 4NV2A 1EEMA 4GSTA 5IMCA 1WWJA 2PERA 2XPEA 2VO4A 1A0FA 3F63A 1S3CA 2XBIA 3HXSA 1GSEA 2OA7A 1Q98A 3WT2A 2Z9SA 4V2LA 1M7TA 1OC3A 3F4RA 1ZZYA 5B7CA 1M9BA 6GSWA 4DSSB 4TR0A 2H6YA 4MK3A 2HZFA 3ZZXA 3IXRA 4TVEA 1SJ6A 1V58A 2H30A 2H1GA 1JZOA 4BL7A 3D6IA 5CRGA 1DSBA 3N9JA 5BRTA 1GUMA 4EIPA 5F07A 3O6TA 3TGZA 1SU9A 2AHEA 4KB3A 1PKWA 3ZRDA 2XPDA 5EPFA 3D22A 2H71A 1PX6A 4FYBA 1XVWA 2MBSA 5G5EA 1BQ7A 1EWXA 3CRUA 4ZBDA 1PKZA 5HR3A 4FH8A 17GSA 1ST9A 5B8BA 2IJYA 2DKHA 2HLSA 1XWKA 4HDEA 3CTGA 4AGSA 3PR8A 4X4JA 1OKDA 4KNDA 2X49A 2XBQA 4A5PA 5IO2A 3IHQA 3PGTA 4GSSA 4HU9A 1ILOA 4K7OA 3GHAA 1EZKA 3DGQA 5ECOB 2YV9A 2K9FA 2YCDA 2VIMA 1VF1A 1M2DA 4MLYA 1PQNA 2GSSA 2B1KA 5KN3A 18GSA 2A2PA 1Z9HA 3W6GA 3KZQA 4ZILA 2H72A 1MD4A 2DMLA 1DUGA 4L0UA 1M2AA 1QXHA 1CQHA 3L78A 4Z2TA 3F3RA 3H1NA 1TKDB 5DAKB 2YJ7A 5ELAA 4EIQA 3W8SA 2ZUPA 3FHKA 1YJ6A 2BJXA 3HA9A 4GRFA 1VF4A 2DIZA 5B6MA 1DBYA 2C4JA 3LFLA 2O7KA 4BVXA 5ID2B 1O7UA 1SYRA 3TJBA 1F3BA 1Z3EA 5JCWA 3KMOA 1VRSD 5EL8A 2I4AA 2G0FA 3VWXA 20GSA 2K6VA 4MZCA 2C1YA 1C72A 3F3QA 2AAWA 2VM1A 2RIIA 4V1Ag 5D93A 5HR2A 1RK4A 5FT3A 3M3MA 2KUCA 5LD0A 3I69A 3BCIA 4USSA 5HR1A 7GSSA 5IMVA 3LQ7A 4MF5A 5IIZA 2LRNA 4KCEA 2VM2A 4ECJA 4K7NA 10GSA 3FW2A 2FHEA 4N30A 1EV9A 3LXZA 4V1Ap 5AISA 2HRNA 3BCKA 2RUFA 4MJEA 1UC7A 1O81A 6GSTA 4DSRA 1F9MA 5E4WA 2AUVA 2XHFA 5F0GA 3A3TA 1HYUA 1Z6NA 3L9UA 1H4OA 5B8AA 5HQPA 4TRXA 3APQA 2DJJA 1QMVA 2LNSA 5DALB 2JSZA 4EC0A 5COHA 2REMA 3V1WA 5DCGA 1YF1A 3GN3A 2LQOA 1O85A 1YEPA 1R5AA 3LYPA 4ECBA 5HFGA 2B3SA 3TOTA 4XHMA 19GSA 3TDGA 3OR5A 2LKUA 4AJ6A 4L5OA 3MYDA 4KX4A 3IC8A 1NW2A 3KTBA 4DSQA 2ON5A 4YH2A 3KXOA 4K5RA 2GT5A 5ABRA 3G7IA 2YZUA 5G30A 3K8NA 2IMKA 2L5LA 4ACSA 2FA4A 4XS1A 2DLXA 5J5NA 3AY8A 1SENA 1AC1A 4OWYA 1SK1A 4O32A 4G0IA 3BD2A 4K8MA 4MF7A 2FLSA 4XS6A 1YKCA 2IMFA 2H0IA 4KE3A 5FHIA 3PH9A 2L4QA 4XS4A 4G2EA 4E8EA 3RBTA 1B9YC 2VLVA 1XWGA 3UEMA 1ABAA 4FO5A 4KDYA 3ZIVA 4KDXA 1FVJA 1XZOA 5IM9A 1X5CA 4TOPA 2XC2A 3J7Yb 3MNGA 2QKEA 3GKXA 2M80A 3KP8A 4KH7A 2VAFA 4Q5RA 1GTUA 2F8AA 2HRKA 4G19A 4BL7B 5ECLB 2MZCA 5C00A 3EURA 1AQXA 2VL9A 2PVOC 1FW1A 1SJZA 1GTIA 4RQRA 4ZL8A 4J56E 3Q74A 4WXTA 4PX1A 3A2WA 3A2VA 1GULA 1X0RA 2TRXA 4POBA 3M9KA 3ISOA 5CNWA 4WEYA 4KSMA 5A5KA 1S3DA 2ON7A 4HI7A 1EV4A 1OVNA 2CA8A 3ZITA 2KP1A 2A2SA 1H75A 2FD3A 2B5YA 4JRRA 3RHBA 2DJKA 2LEGA 2PWJA 2O85A 2HSHA 1XOBA 2R5GA 3O76A 5D9XA 3GH6A 1HNBA 2L57A 2J23A 4GXZA 1GSYA 1V98A 2YWIA 2TIRA 4EE0A 2B6MA 1GTAA 4PNFA 1TK0B 4Z2RA 2ZNMA 3UMAA 3Q19A 5ECIB 1V2AA 5DCHA 1GRXA 4PGTA 2FA8A 4ULXA 2R0CA 11GSA 1SJIA 3F6DA 5DQSA 4HZ4A 3DWVA 4TR3A 1YZXA 2LJAA 1SKWB 1UN2A 1W4VA 1TRUA 4YQMA 2YJHA 1EOGA 1FB0A 4TR4A 2WCIA 4OD7A 2LJKA 4G9HA 4IN0A 3TOUA 1USBA 3SWLA 1QUWA 1FVKA 3KTLA 1A24A 2C0FA 3LGCA 2YV7A 2E7PA 1HNAA 4WETA 2A4HA 2YPMA 4P3YB 2GQKA 4ZB6A 4Z2UA 1AQWA 1ZCPA 2JACA 2K18A 2X8GA 1J0FA 3ZMLA 1GNWA 3WGXA 1QGVA 4MMMA 4WKWA 4CW9A 2MMAA 2YOIA 1KEBA 3QMXA 4ML1A 4DVCA 3G7YA 3APOA 2PPTA 2PU9C 3VURA 4XCSA 1VGLA 1A2MA 1TK8B 5D96A 4GLTA 3EMXA 4TXOA 1G6WA 2H01A 4TR1A 3QAVA 4YKFA 3GX8A 4QQ7A 3M9JA 4IP1A 3IR4A 1OC9A 1MDKA 3LJRA 1JZDA 2AJQB 2OE1A 1K3YA 3DRNA 3IHGA 5BMUA 1F3AA 2F8FA 4POKA 4FYUA 1TP9A 3DMLA 1BYEA 2R0GA 2QC7A 5G1LA 1MD3A 3KCMA 5KOWA 1O8WA 2WZ9A 1R26A 4MZWA 4FQUA 3HDCA 1ACVA 2HRAA 2C3TA 5EY6A 3L4NA 4YQVA 1AW9A 1UVZA 5IMDA 2AYTA 5JCGA 4Q5FA 3LYKA 3QFBC 1K0CA 2JU5A 1ZYEA 2JZTA 2X8CA 5KOXA 4QL9A 4K7IA 4BVYB 2YN1A 3GFKA 5AIVA 4KA0A 4RUVA 3E9JB 1ERTA 1A2LA 1ZGNA 5HFIA 3HVXA 1GUKA 3C71A 2VUPA 3FKFA 4MCUA 1BAYA 4XS4B 3FR6A 4N0ZA 2HNLA 2X8HA 1TDIA 1TRVA 3L0HA 3IA1A 2NVLA 6GSXA 4ICYA 1PA3A 2K8SA 5ECSA 4PURA 3P7XA 1JZWA 4NPBA 2PUKC 5DDLA 1PX7A 2FY6A 4ZBBA 2MYGA 4AJ7A 1B4PA 2YZHA 8GSSA 3ZIJA 1YQ1A 2GSRA 2PBJA 5J9CA 1ON4A 1XW6A 4IJ3A 3QDNA 4QL7A 4JR6A 2ALBA 5IMZA 2HRFA 4PQIA 2DMMA 3TKSE 5ELGA 1LU4A 5CP1A 2VCZA 3KM6A 4OFMA 4F9ZA 2FWFA 2OKAA 3HVVA 3F4SA 3M8NA 1N8JA 3PPUA 4ZL7A 5KN0A 4PUAA 1X9SB 1BX9A 1R7HA 1RW1A 3CSJA 2A4VA 1EEJA 3F4TA 1FAAA 5DVBA 5D73A 1OAZA 2R4VA 1B8XA 5ENUA 4K6XA 4NMUA 1GNEA 2NBSA 3TJFA 4ML6A 3NZNA 1T3BA 1WRYA 3RPPA 3D4TA 2UZ8A 3CSHA 3QCPA 1Z5YE 5DJLA 4JZQA 3I9V2 3GKNA 2IFQB 4LLRA 1EGOA 3FZ5A 5CREA 1A8LA 4I8BA 4O92A 3RPNA 1K0MA 4XRDA 5IQYA 3QR6A 4K5SA 1B4QA 4NWYA 2R37A 1ZL9A 1ERVA 4L0WA 3N5OA 3F0IA 4LL1B 1GL8A 3FMWA 1XCCA 3ZMKA 1SK2A 2VCWA 4CHSA 1A2JA 2O87A 4WR5A 4D73B 2H19A 2OACA 1ML6A 1ZMAA 2D2ZA 9GSSA 1X5DA 3IAS2 3C8EA 3ERWA 4F0CA 5LNKe 3WGEA 2YWNA 3BBYA 2CX3A 3CXGA 1SL0B 3QD9A 1T00A 3APSA 3VFIA 4EDYA 1U3IA 2NPBA 1HD2A 3ZREA 3HJOA 5G1KA 1TK5B 1JLWA 3CTFA 5DJMA 3ZVJA 2H1BA 2QSIA 3KD0A 3E3EA 2VCTA 2A2RA 1XW5A 2FGXA 2GVPA 4V2NA 2WFCA 4RI6A 1G7EA 1XXUA 1SK0A 2VOCA 2RM5A 5ECMB 1URMA 3D21A 5C04A 1MDJA 1E2YA 3EMPA 2C80A 3KIJA 4IHUA 1CQGA 4EDZA 1F37A 5G5FA 4TXOB 2DJ2A 2V6OA 4TR1B 2GQMA 5G2ZA 4YQUA 3TKQA 3UOMA 1PGTA 4DSSA 3EVIA 1OC9B 2KHPA 3LXTA 3GA4A 3DIEA 4PXOA 3HKRA 5EVOA 1EOHA 1VF2A 3FZ4A 4CY8A 4ZIJA 3UJ1A 3D4MA 1HNCA 3C73A 4EL1A 1V57A 2HYXA 3H4KA 1E6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YWO A;  2CX4 A;  2IIY A;  1BJX A;  22GS A;  2DJ1 A;  1G0T A;  2M46 A;  4XTS A;  1AAZ A;  4HJM A;  5B6N A;  1AQV A;  2OBI A;  2I1U A;  3CBU A;  1PRX A;  2O89 A;  2CZ2 A;  4IBP A;  1JLV A;  1NM3 A;  2IMD A;  4I2U A;  3EU3 A;  3GNJ A;  2GTU A;  13GS A;  1A8Y A;  3GH9 A;  4LL4 B;  3GKM A;  2LQQ A;  2YNX A;  3DD3 A;  1Z7P A;  1M9A A;  3GMF A;  2IME A;  1U6T A;  4XRA A;  2P5Q A;  2PN8 A;  3F8U A;  1B9X C;  4NV5 A;  3UAR A;  1PN9 A;  3E0U A;  3EE2 A;  4OO4 A;  14GS A;  3KGK A;  3R2Q A;  1GLQ A;  1THX A;  3QOU A;  1X9M B;  3CMI A;  1MEK A;  2HT9 A;  2L4C A;  1EGR A;  1TXX A;  2FWE A;  4ID0 A;  3LWA A;  3D5J A;  4E8H A;  3HVS A;  4K0G A;  5D9V A;  5DAK A;  3F9U A;  2LNT A;  2ZCT A;  2EC4 A;  1WPI A;  4N0V A;  5ECP B;  3IDV A;  3PIN A;  1FB6 A;  4MJA A;  3C7M A;  5H5R A;  1TRS A;  3VWW A;  1KNG A;  1I5G A;  3M1G A;  1FHE A;  2WJU A;  3DVW A;  2DC5 A;  3DKS A;  3FRC A;  1NSW A;  5ID2 A;  3US3 A;  5D8I A;  3WGD A;  1ZYQ B;  4KCA A;  2L6C A;  1TTZ A;  2IMI A;  4XIH A;  4HU7 A;  1Y6E A;  2HXK A;  1TOF A;  3LG6 A;  4Q5Q A;  3DXB A;  1M0U A;  3VI5 A;  2GGT A;  4GWR A;  4ZB9 A;  3EU4 A;  4G10 A;  2V2G A;  3GYK A;  2FWG A;  3MAK A;  3LEF A;  1Q4J A;  5A4U A;  1O6J A;  1G7O A;  3J7Y k;  2OBK A;  4GQF A;  5FWG A;  1SD9 A;  2IPA A;  3GKK A;  2CVK A;  4F2I A;  3L9V A;  1X9W B;  4IGJ A;  5AN1 A;  3C1R A;  3TJK A;  2RUE A;  1K0N A;  5F8B A;  5HFK A;  3KJY A;  3F6F A;  2N5B A;  3GX0 A;  1K0O A;  2E2G A;  2EIR A;  2TRC P;  1T7P B;  3IE3 A;  2VCV A;  1WMJ A;  4MJC A;  3GUS A;  3VK9 A;  1OKT A;  4WF4 A;  1GTB A;  4EO3 A;  5JWO B;  1FOV A;  6GSY A;  2JSY A;  5DAL A;  2B5X A;  2JAD A;  2CVD A;  2H8L A;  3EYT A;  2C0D A;  4OFT A;  1F2E A;  5IO0 A;  5G31 A;  2K8V A;  3UBL A;  4HEA 2;  5INY A;  2GZP A;  1BED A;  4X1U A;  1YEX A;  3FY7 A;  3GV1 A;  3UAP A;  3IAM 2;  2WGR A;  2WB9 A;  1XWC A;  3U6V A;  1V40 A;  2GQL A;  3P8W A;  1GLP A;  4GCI A;  4GSN A;  3RAZ A;  2EIO A;  1KBN A;  2H70 A;  1ZOF A;  2H0G A;  2CQ9 A;  3NIV A;  1MDI A;  1XWB A;  2H6Z A;  5CYY A;  3IBH A;  3IC4 A;  1WJK A;  2L59 A;  4NHZ A;  4JE1 A;  4GTU A;  1J9B A;  4IEL A;  1A0R P;  3Q6O A;  1TW9 A;  3TKS A;  2GDR A;  5JWQ B;  3TKS C;  5ECH B;  2VLT A;  1SKR B;  4DEJ A;  1GP1 A;  5F05 A;  1T1V A;  4HJ2 A;  2YAN A;  1SKS B;  1T4Z A;  1T8E B;  2M72 A;  4O5R A;  3HD5 A;  2X64 A;  5H5Q A;  2NTO A;  5J9B A;  2I9H A;  2IWT A;  4MP4 A;  4EVM A;  1R4W A;  16GS A;  1U87 A;  6GSU A;  3LOR A;  2N5A A;  2H1A A;  2EIQ A;  1NHY A;  3UIW A;  2LST A;  4MA9 A;  3DEX A;  4IVF A;  3CSI A;  4ZL9 A;  4ECI A;  2B7K A;  4BWS A;  3IRA A;  4PQ1 A;  1GWC A;  4PUF C;  1AXD A;  4OMV A;  5IOW A;  3ME8 A;  4AJ8 A;  4K9Z A;  4HQZ A;  2MMN A;  4WBR D;  4ZBA A;  5D9T A;  1W89 A;  1AIU A;  4O7H A;  2V6K A;  2H0H A;  2GS3 A;  3IV4 A;  4BWQ A;  3TRP A;  1R5P A;  2B5E A;  1WP0 A;  4OFN A;  1K0A A;  1U88 A;  4IQ1 A;  3TUE A;  3EC3 A;  2YP6 A;  3GST A;  3WD6 A;  5J4U A;  3VWU A;  2CZ3 A;  2G2Q A;  4Z7X A;  2OE3 A;  5JCU A;  2WS2 A;  3HYP A;  5JWR B;  1SL2 B;  3FYG A;  3CYN A;  2LV3 A;  1GSQ A;  4POL A;  2I3Y A;  4FYC A;  4X43 A;  4NAX A;  3RDW A;  1PL2 A;  6GSS A;  1U3A A;  4IP6 A;  1YDK A;  1TI3 A;  1A23 A;  2HZE A;  2JL4 A;  4EF0 A;  3O3T A;  2WDU A;  2GT6 A;  5J41 A;  2LTK A;  4RQX A;  1X5E A;  3TKP A;  3WYW A;  5CRD A;  5HR0 A;  4OCF A;  3MWH A;  1BG5 A;  4AF2 A;  3C1S A;  4HUA A;  2VCX A;  4ZXG A;  3ZFB A;  2H6X A;  4TXV A;  4CDO A;  1IYH A;  1I9D A;  2KLX A;  4F0B A;  3VPQ A;  2LRC A;  3HJP A;  2R6K A;  3TJG A;  5CAX A;  5GAP D;  3CRT A;  3IK7 A;  2GSQ A;  1GSU A;  2JZS A;  3FK8 A;  1RQM A;  4POM A;  2C3N A;  4JED A;  4H86 A;  4J2F A;  4JBB A;  5F06 A;  2H74 A;  2LS5 A;  5IPH A;  2FNO A;  5AGY A;  1GSS A;  1SD8 A;  3L9S A;  2IL3 A;  1OE7 A;  4OO5 A;  3ZLP A;  1DE2 A;  1JZR A;  4F82 A;  1TI1 A;  2H76 A;  4MJB A;  4GQC A;  3U5R E;  1LJR A;  1GSF A;  4HS1 A;  4IW9 A;  5D9W A;  4ISD A;  3FR9 A;  1JFU A;  1J08 A;  2H1D A;  1OC8 A;  5ECK B;  4I2T A;  4EKZ A;  2V32 A;  4JR4 A;  1PMT A;  1B48 A;  3GL3 A;  2VD1 A;  3SBC A;  3UBK A;  4N11 A;  3GRX A;  3ZTL A;  2IN3 A;  2OE0 A;  4KAE A;  2E0Q A;  1KTE A;  2PVQ A;  3TCO A;  4KGI A;  3ZL5 A;  3HHV A;  4I5Q A;  2H75 A;  2B1L A;  1FG4 A;  3GTU A;  12GS A;  5DBQ A;  4K2D A;  3H93 A;  1GH2 A;  4MH3 A;  3JCM L;  3I43 A;  1XPV A;  2KOK A;  1VF3 A;  4IJI A;  5ECR B;  2X99 A;  1JHB A;  1K3L A;  1XBS A;  5IMA A;  1Y25 A;  5KN2 A;  5ECQ B;  3Q18 A;  1YF0 A;  1IYI A;  3P90 A;  1SYX A;  4L5L A;  4HOJ A;  4BPY A;  3NOF A;  2FWH A;  2R3X A;  3MDK A;  2JZR A;  5AIX A;  2L6D A;  3DVX A;  3IOS A;  2I81 A;  2HE3 A;  2V41 A;  1PL1 A;  3KP9 A;  1QQ2 A;  1K0B A;  3TB2 A;  5IPG A;  3ERG A;  5A4V A;  3ZFL A;  2GZZ A;  2GLR A;  3FZ9 A;  2VL2 A;  4KW6 A;  4KDU A;  4J57 E;  3GUR A;  4WR4 A;  1HQO A;  2GST A;  4BVY A;  2VL2 C;  2C0E A;  3FZA A;  1SL1 B;  3BJ5 A;  1ERU A;  2KP2 A;  3UL3 A;  5GAN D;  2CAQ A;  2CAI A;  3A5W A;  3D0Z A;  3I6A A;  4EUY A;  2H66 A;  2V1M A;  2PGT A;  1OYJ A;  3ME7 A;  4K0N A;  1F6M C;  4N10 A;  1S3A A;  4L8E A;  1G6Y A;  4WF5 A;  1ERW A;  3A2X A;  3KEB A;  3UVT A;  1O8X A;  1UA5 A;  2BMX A;  3ED3 A;  2HI7 A;  4WBJ A;  5GSS A;  2DSA A;  1O73 A;  1FO5 A;  2MMO A;  2VD0 A;  2DBC A;  5J3R A;  1AUC A;  4MH2 A;  2F51 A;  3HY2 A;  1MTC A;  2CT6 A;  4IQA A;  3FEU A;  4MF6 A;  4KSO A;  2OAD A;  2LUS A;  4MZB A;  3UVH A;  3G7J A;  2HFD A;  2RM6 A;  2F9S A;  3H79 A;  5DQY A;  4TN8 A;  2ES7 A;  2OJL A;  3QAW A;  4IKH A;  3DYR A;  1NHO A;  2N5F A;  2FUG 2;  2E2M A;  1TJD A;  2P0G A;  5L71 A;  4TW5 A;  2C3Q A;  2C8U A;  3MSZ A;  1QK8 A;  2PMT A;  1YY7 A;  6GSV A;  3QAG A;  4I6X A;  3TRX A;  2FCH A;  5ECN B;  1XWA A;  4FIW A;  4Q5N A;  3HZ8 A;  4YAP A;  3WT1 A;  2L5O A;  3RHC A;  3KH9 A;  2MBT A;  3TKR A;  1TU8 A;  2BTO T;  5LCZ A;  3BOA A;  3VPT A;  1EP7 A;  1N2A A;  2P5R A;  3VLN A;  4X0X A;  3QPM A;  5GST A;  3ZYW A;  5CRH A;  4IS0 A;  1M2B A;  2HSY A;  2C0G A;  4ILF A;  1K3O A;  2DJ3 A;  2P31 A;  2YWM A;  4NHW A;  5IMF A;  3GIX A;  2IFQ A;  2CV4 A;  4PQH A;  4MDC A;  1OE8 A;  4KUN A;  3EWL A;  3EIN A;  1M99 A;  2O8V B;  4HQS A;  2GZY A;  1XFL A;  5IOX A;  1PD2 1;  3ERF A;  1LBK A;  1WIK A;  2HZE B;  2B7J A;  1Z7R A;  2VL3 A;  3G9B A;  3HJM A;  2VLU A;  3IK9 A;  4YAV A;  2F3M A;  5CO3 A;  2J9H A;  2QGV A;  2AB6 A;  3QFA C;  2NDO A;  3FR3 A;  2DIY A;  4D73 A;  4LA1 A;  3KH7 A;  4NXI A;  5CRW A;  1K0D A;  1PSQ A;  3H8Q A;  4ZB8 A;  2CVB A;  3TJJ A;  4TKY A;  3ZVJ D;  5GZZ B;  5A4W A;  5KEJ A;  1Z6M A;  1T4Y A;  4GF0 A;  1GUH A;  2RLI A;  3M0F A;  2LRT A;  1TU7 A;  2WRT A;  3LSZ A;  3W8J A;  4LMW A;  3P2A A;  1XW9 A;  2H73 A;  3VI7 A;  4EXJ A;  1GSD A;  1EP8 A;  3TRQ A;  4MPG A;  4BA7 A;  2AV4 A;  1TRW A;  4PNG A;  1XVQ A;  3GSS A;  4LMV A;  4MAB A;  4OCE A;  1THO A;  2MMZ A;  4F03 A;  1DE1 A;  1V9W A;  4JU5 A;  5E59 A;  1QFN A;  2VCQ A;  4K1F A;  2DJ0 A;  5H5S A;  4HZ2 A;  3VWV A;  3S9F A;  1WE0 A;  2R2J A;  3KMN A;  3HCZ A;  3GTU B;  1WOU A;  1XOA A;  2WUL A;  2LJR A;  3IPZ A;  5KN1 A;  4V2M A;  3GL5 A;  1YKA A;  4MPF A;  4RI7 A;  1XIY A;  4ECC A;  3HZ4 A;  4I97 A;  4NV2 A;  1EEM A;  4GST A;  5IMC A;  1WWJ A;  2PER A;  2XPE A;  2VO4 A;  1A0F A;  3F63 A;  1S3C A;  2XBI A;  3HXS A;  1GSE A;  2OA7 A;  1Q98 A;  3WT2 A;  2Z9S A;  4V2L A;  1M7T A;  1OC3 A;  3F4R A;  1ZZY A;  5B7C A;  1M9B A;  6GSW A;  4DSS B;  4TR0 A;  2H6Y A;  4MK3 A;  2HZF A;  3ZZX A;  3IXR A;  4TVE A;  1SJ6 A;  1V58 A;  2H30 A;  2H1G A;  1JZO A;  4BL7 A;  3D6I A;  5CRG A;  1DSB A;  3N9J A;  1GUM A;  5F07 A;  3O6T A;  3TGZ A;  1SU9 A;  2AHE A;  4KB3 A;  1PKW A;  3ZRD A;  2XPD A;  5EPF A;  3D22 A;  2H71 A;  1PX6 A;  4FYB A;  1XVW A;  2MBS A;  5G5E A;  1BQ7 A;  1EWX A;  3CRU A;  4ZBD A;  1PKZ A;  5HR3 A;  4FH8 A;  17GS A;  1ST9 A;  5B8B A;  2IJY A;  2HLS A;  1XWK A;  4HDE A;  3CTG A;  4AGS A;  3PR8 A;  1OKD A;  4KND A;  2XBQ A;  5IO2 A;  3IHQ A;  3PGT A;  4GSS A;  4HU9 A;  1ILO A;  4K7O A;  3GHA A;  1EZK A;  3DGQ A;  5ECO B;  2YV9 A;  2K9F A;  2YCD A;  2VIM A;  1VF1 A;  1M2D A;  4MLY A;  1PQN A;  2GSS A;  2B1K A;  5KN3 A;  18GS A;  1Z9H A;  3W6G A;  3KZQ A;  4ZIL A;  2H72 A;  1MD4 A;  2DML A;  1DUG A;  4L0U A;  1M2A A;  1QXH A;  1CQH A;  3L78 A;  3F3R A;  3H1N A;  1TKD B;  5DAK B;  2YJ7 A;  5ELA A;  3W8S A;  2ZUP A;  3FHK A;  1YJ6 A;  2BJX A;  3HA9 A;  4GRF A;  1VF4 A;  2DIZ A;  5B6M A;  1DBY A;  2C4J A;  3LFL A;  2O7K A;  4BVX A;  5ID2 B;  1O7U A;  1SYR A;  3TJB A;  1F3B A;  1Z3E A;  5JCW A;  3KMO A;  1VRS D;  5EL8 A;  2I4A A;  2G0F A;  3VWX A;  20GS A;  2K6V A;  4MZC A;  2C1Y A;  1C72 A;  3F3Q A;  2AAW A;  2VM1 A;  2RII A;  4V1A g;  5D93 A;  5HR2 A;  1RK4 A;  5FT3 A;  3M3M A;  2KUC A;  5LD0 A;  3I69 A;  3BCI A;  5HR1 A;  7GSS A;  5IMV A;  3LQ7 A;  4MF5 A;  5IIZ A;  2LRN A;  4KCE A;  2VM2 A;  4ECJ A;  4K7N A;  10GS A;  3FW2 A;  2FHE A;  4N30 A;  1EV9 A;  3LXZ A;  4V1A p;  5AIS A;  2HRN A;  3BCK A;  2RUF A;  4MJE A;  1UC7 A;  1O81 A;  6GST A;  4DSR A;  1F9M A;  5E4W A;  2AUV A;  2XHF A;  5F0G A;  3A3T A;  1HYU A;  1Z6N A;  3L9U A;  1H4O A;  5B8A A;  5HQP A;  4TRX A;  3APQ A;  2DJJ A;  1QMV A;  2LNS A;  5DAL B;  2JSZ A;  4EC0 A;  5COH A;  2REM A;  3V1W A;  5DCG A;  1YF1 A;  3GN3 A;  2LQO A;  1O85 A;  1YEP A;  1R5A A;  3LYP A;  4ECB A;  5HFG A;  2B3S A;  3TOT A;  4XHM A;  19GS A;  3TDG A;  3OR5 A;  2LKU A;  4AJ6 A;  4L5O A;  4KX4 A;  1NW2 A;  3KTB A;  4DSQ A;  2ON5 A;  4YH2 A;  3KXO A;  2GT5 A;  5ABR A;  3G7I A;  2YZU A;  5G30 A;  3K8N A;  2IMK A;  2L5L A;  4ACS A;  2FA4 A;  4XS1 A;  2DLX A;  5J5N A;  3AY8 A;  1SEN A;  1AC1 A;  4OWY A;  1SK1 A;  4O32 A;  3BD2 A;  4K8M A;  4MF7 A;  2FLS A;  4XS6 A;  1YKC A;  2IMF A;  2H0I A;  4KE3 A;  5FHI A;  3PH9 A;  2L4Q A;  4XS4 A;  4G2E A;  4E8E A;  3RBT A;  1B9Y C;  2VLV A;  1XWG A;  3UEM A;  1ABA A;  4FO5 A;  4KDY A;  3ZIV A;  4KDX A;  1FVJ A;  1XZO A;  5IM9 A;  1X5C A;  4TOP A;  2XC2 A;  3J7Y b;  3MNG A;  2QKE A;  3GKX A;  2M80 A;  3KP8 A;  4KH7 A;  2VAF A;  4Q5R A;  1GTU A;  2F8A A;  4G19 A;  5ECL B;  2MZC A;  5C00 A;  3EUR A;  1AQX A;  2VL9 A;  2PVO C;  1FW1 A;  1SJZ A;  1GTI A;  4RQR A;  4ZL8 A;  4J56 E;  3Q74 A;  4WXT A;  4PX1 A;  3A2W A;  3A2V A;  1GUL A;  1X0R A;  2TRX A;  4POB A;  3M9K A;  3ISO A;  5CNW A;  4WEY A;  4KSM A;  5A5K A;  1S3D A;  2ON7 A;  4HI7 A;  1EV4 A;  1OVN A;  2CA8 A;  3ZIT A;  2KP1 A;  2A2S A;  1H75 A;  2FD3 A;  2B5Y A;  4JRR A;  3RHB A;  2DJK A;  2LEG A;  2PWJ A;  2O85 A;  2HSH A;  1XOB A;  2R5G A;  3O76 A;  5D9X A;  3GH6 A;  1HNB A;  2L57 A;  2J23 A;  4GXZ A;  1GSY A;  1V98 A;  2YWI A;  2TIR A;  4EE0 A;  2B6M A;  1GTA A;  4PNF A;  1TK0 B;  2ZNM A;  3UMA A;  3Q19 A;  5ECI B;  1V2A A;  5DCH A;  1GRX A;  4PGT A;  2FA8 A;  4ULX A;  11GS A;  1SJI A;  3F6D A;  5DQS A;  4HZ4 A;  3DWV A;  4TR3 A;  1YZX A;  2LJA A;  1SKW B;  1UN2 A;  1W4V A;  1TRU A;  4YQM A;  2YJH A;  1EOG A;  1FB0 A;  4TR4 A;  2WCI A;  4OD7 A;  2LJK A;  4G9H A;  4IN0 A;  3TOU A;  1USB A;  3SWL A;  1QUW A;  1FVK A;  3KTL A;  1A24 A;  2C0F A;  3LGC A;  2YV7 A;  2E7P A;  1HNA A;  4WET A;  2YPM A;  4P3Y B;  2GQK A;  4ZB6 A;  1AQW A;  1ZCP A;  2JAC A;  2K18 A;  2X8G A;  1J0F A;  3ZML A;  1GNW A;  3WGX A;  1QGV A;  4MMM A;  4WKW A;  4CW9 A;  2MMA A;  2YOI A;  1KEB A;  3QMX A;  4ML1 A;  4DVC A;  3G7Y A;  3APO A;  2PPT A;  2PU9 C;  3VUR A;  4XCS A;  1VGL A;  1A2M A;  1TK8 B;  5D96 A;  4GLT A;  3EMX A;  4TXO A;  1G6W A;  2H01 A;  4TR1 A;  3QAV A;  3GX8 A;  4QQ7 A;  3M9J A;  4IP1 A;  3IR4 A;  1OC9 A;  1MDK A;  3LJR A;  1JZD A;  2AJQ B;  2OE1 A;  1K3Y A;  3DRN A;  1F3A A;  2F8F A;  4POK A;  4FYU A;  1TP9 A;  3DML A;  1BYE A;  2QC7 A;  5G1L A;  1MD3 A;  3KCM A;  1O8W A;  2WZ9 A;  1R26 A;  4MZW A;  3HDC A;  1ACV A;  2C3T A;  5EY6 A;  3L4N A;  4YQV A;  1AW9 A;  1UVZ A;  5IMD A;  2AYT A;  5JCG A;  4Q5F A;  3LYK A;  3QFB C;  1K0C A;  2JU5 A;  1ZYE A;  2JZT A;  2X8C A;  4QL9 A;  4K7I A;  2YN1 A;  3GFK A;  5AIV A;  4KA0 A;  4RUV A;  3E9J B;  1ERT A;  1A2L A;  1ZGN A;  5HFI A;  3HVX A;  1GUK A;  3C71 A;  2VUP A;  3FKF A;  4MCU A;  1BAY A;  4XS4 B;  3FR6 A;  4N0Z A;  2HNL A;  2X8H A;  1TDI A;  1TRV A;  3L0H A;  3IA1 A;  2NVL A;  6GSX A;  1PA3 A;  2K8S A;  5ECS A;  4PUR A;  3P7X A;  1JZW A;  4NPB A;  2PUK C;  5DDL A;  1PX7 A;  2FY6 A;  4ZBB A;  2MYG A;  4AJ7 A;  1B4P A;  2YZH A;  8GSS A;  3ZIJ A;  1YQ1 A;  2GSR A;  2PBJ A;  5J9C A;  1ON4 A;  1XW6 A;  4IJ3 A;  3QDN A;  4QL7 A;  4JR6 A;  2ALB A;  5IMZ A;  2HRF A;  4PQI A;  2DMM A;  3TKS E;  5ELG A;  1LU4 A;  5CP1 A;  2VCZ A;  3KM6 A;  4OFM A;  4F9Z A;  2FWF A;  2OKA A;  3HVV A;  3F4S A;  3M8N A;  1N8J A;  4ZL7 A;  5KN0 A;  4PUA A;  1X9S B;  1BX9 A;  1R7H A;  1RW1 A;  3CSJ A;  2A4V A;  1EEJ A;  3F4T A;  1FAA A;  5DVB A;  5D73 A;  1OAZ A;  2R4V A;  1B8X A;  5ENU A;  4K6X A;  4NMU A;  1GNE A;  2NBS A;  3TJF A;  4ML6 A;  3NZN A;  1T3B A;  1WRY A;  3RPP A;  3D4T A;  3CSH A;  3QCP A;  1Z5Y E;  5DJL A;  4JZQ A;  3I9V 2;  3GKN A;  2IFQ B;  4LLR A;  1EGO A;  3FZ5 A;  5CRE A;  1A8L A;  4I8B A;  4O92 A;  3RPN A;  1K0M A;  4XRD A;  5IQY A;  3QR6 A;  1B4Q A;  4NWY A;  2R37 A;  1ZL9 A;  1ERV A;  4L0W A;  3N5O A;  3F0I A;  4LL1 B;  1GL8 A;  1XCC A;  3ZMK A;  1SK2 A;  2VCW A;  4CHS A;  1A2J A;  2O87 A;  4WR5 A;  4D73 B;  2H19 A;  2OAC A;  1ML6 A;  1ZMA A;  2D2Z A;  9GSS A;  1X5D A;  3IAS 2;  3C8E A;  3ERW A;  4F0C A;  5LNK e;  3WGE A;  2YWN A;  3BBY A;  2CX3 A;  3CXG A;  1SL0 B;  3QD9 A;  1T00 A;  3APS A;  3VFI A;  4EDY A;  1U3I A;  2NPB A;  1HD2 A;  3ZRE A;  3HJO A;  5G1K A;  1TK5 B;  1JLW A;  3CTF A;  5DJM A;  3ZVJ A;  2H1B A;  2QSI A;  3KD0 A;  3E3E A;  2VCT A;  2A2R A;  1XW5 A;  2FGX A;  2GVP A;  4V2N A;  2WFC A;  4RI6 A;  1G7E A;  1XXU A;  1SK0 A;  2VOC A;  2RM5 A;  5ECM B;  1URM A;  3D21 A;  5C04 A;  1MDJ A;  1E2Y A;  3EMP A;  2C80 A;  3KIJ A;  4IHU A;  1CQG A;  4EDZ A;  1F37 A;  5G5F A;  4TXO B;  2DJ2 A;  2V6O A;  4TR1 B;  2GQM A;  5G2Z A;  4YQU A;  3TKQ A;  3UOM A;  1PGT A;  4DSS A;  3EVI A;  1OC9 B;  2KHP A;  3LXT A;  3GA4 A;  3DIE A;  4PXO A;  3HKR A;  5EVO A;  1EOH A;  1VF2 A;  3FZ4 A;  4ZIJ A;  3UJ1 A;  3D4M A;  1HNC A;  3C73 A;  4EL1 A;  1V57 A;  2HYX A;  3H4K A;  1E6B A; 
#chains in the Genus database with same CATH topology
 2YWO A;  2CX4 A;  2IIY A;  1BJX A;  22GS A;  2DJ1 A;  1G0T A;  2M46 A;  4XTS A;  1AAZ A;  4HJM A;  4BIK A;  5B6N A;  1AQV A;  3MIX A;  2HSM A;  2OBI A;  2I1U A;  3CBU A;  1PRX A;  2O89 A;  2CZ2 A;  4IBP A;  1JLV A;  1NM3 A;  2IMD A;  4I2U A;  3EU3 A;  3GNJ A;  2GTU A;  13GS A;  1A8Y A;  3GH9 A;  4KF9 A;  4LL4 B;  3GKM A;  2LQQ A;  2YNX A;  3DD3 A;  1Z7P A;  1M9A A;  3GMF A;  2IME A;  1U6T A;  4XRA A;  2P5Q A;  2PN8 A;  3CQF A;  3F8U A;  1B9X C;  4NV5 A;  3UAR A;  1PN9 A;  3E0U A;  3EE2 A;  4OO4 A;  14GS A;  3KGK A;  3R2Q A;  2DKI A;  1GLQ A;  1THX A;  3QOU A;  1X9M B;  3CMI A;  1MEK A;  2HT9 A;  4O5Q A;  2L4C A;  1EGR A;  1TXX A;  2FWE A;  4ID0 A;  3LWA A;  3D5J A;  4E8H A;  3HVS A;  4K0G A;  5D9V A;  5DAK A;  3F9U A;  2LNT A;  2ZCT A;  2EC4 A;  1WPI A;  4N0V A;  5ECP B;  3IDV A;  3PIN A;  1FB6 A;  4MJA A;  3C7M A;  5H5R A;  1TRS A;  3VWW A;  1KNG A;  1I5G A;  3M1G A;  1FHE A;  2WJU A;  3DVW A;  2DC5 A;  3DKS A;  3FRC A;  1NSW A;  5ID2 A;  3US3 A;  5D8I A;  3WGD A;  1ZYQ B;  4KCA A;  2L6C A;  4G0L A;  1TTZ A;  2IMI A;  4XIH A;  4HU7 A;  1Y6E A;  2HXK A;  1TOF A;  3LG6 A;  4Q5Q A;  3DXB A;  1M0U A;  3VI5 A;  2GGT A;  4GWR A;  4ZB9 A;  3EU4 A;  4G10 A;  2V2G A;  3GYK A;  2FWG A;  3MAK A;  3LEF A;  1Q4J A;  5A4U A;  1O6J A;  1G7O A;  3J7Y k;  1PN0 A;  3EPT A;  2OBK A;  4GQF A;  4BVX B;  5FWG A;  1SD9 A;  2IPA A;  3GKK A;  2CVK A;  4F2I A;  3L9V A;  1X9W B;  4IGJ A;  5AN1 A;  3C1R A;  3TJK A;  2RUE A;  1K0N A;  5F8B A;  5HFK A;  3KJY A;  3F6F A;  2N5B A;  3GX0 A;  1K0O A;  2E2G A;  2EIR A;  2TRC P;  1T7P B;  3IE3 A;  2VCV A;  1WMJ A;  4MJC A;  3GUS A;  3VK9 A;  1OKT A;  4WF4 A;  1GTB A;  4EO3 A;  5JWO B;  1FOV A;  6GSY A;  2JSY A;  5DAL A;  2B5X A;  2JAD A;  2CVD A;  2H8L A;  3EYT A;  2C0D A;  4OFT A;  1F2E A;  5IO0 A;  5G31 A;  2K8V A;  3UBL A;  4HEA 2;  5INY A;  2GZP A;  1BED A;  4X1U A;  1YEX A;  3FY7 A;  3GV1 A;  3UAP A;  3IAM 2;  2WGR A;  2WB9 A;  1XWC A;  3U6V A;  1V40 A;  2GQL A;  3P8W A;  1GLP A;  4GCI A;  4GSN A;  3RAZ A;  2EIO A;  1KBN A;  2H70 A;  1ZOF A;  2H0G A;  2CQ9 A;  3NIV A;  1MDI A;  1XWB A;  2H6Z A;  5CYY A;  3IBH A;  3IC4 A;  1WJK A;  2L59 A;  4NHZ A;  4JE1 A;  4GTU A;  1J9B A;  4CY6 A;  4IEL A;  1A0R P;  3Q6O A;  4YKG A;  1TW9 A;  3TKS A;  2GDR A;  5JWQ B;  3TKS C;  5ECH B;  2VLT A;  1SKR B;  4DEJ A;  1GP1 A;  5F05 A;  1T1V A;  4HJ2 A;  2YAN A;  1SKS B;  1T4Z A;  1T8E B;  2M72 A;  4O5R A;  3HD5 A;  2X64 A;  5H5Q A;  2NTO A;  5J9B A;  2I9H A;  2IWT A;  4MP4 A;  4EVM A;  1R4W A;  16GS A;  1U87 A;  6GSU A;  3LOR A;  2N5A A;  2H1A A;  2EIQ A;  1NHY A;  3UIW A;  2LST A;  4MA9 A;  3DEX A;  4IVF A;  3HVN A;  3CSI A;  4ZL9 A;  4ECI A;  2B7K A;  4BWS A;  3IRA A;  4PQ1 A;  1GWC A;  4PUF C;  1AXD A;  4OMV A;  5IOW A;  3ME8 A;  4AJ8 A;  4K9Z A;  4HQZ A;  2MMN A;  4WBR D;  4ZBA A;  5D9T A;  1W89 A;  1AIU A;  4O7H A;  2V6K A;  2H0H A;  2GS3 A;  3IV4 A;  4BWQ A;  3TRP A;  1R5P A;  2B5E A;  1WP0 A;  4OFN A;  1K0A A;  1U88 A;  4IQ1 A;  3TUE A;  3EC3 A;  2YP6 A;  3GST A;  3WD6 A;  5J4U A;  3VWU A;  2CZ3 A;  2G2Q A;  4Z7X A;  2OE3 A;  5JCU A;  2WS2 A;  3HYP A;  5JWR B;  1SL2 B;  3FYG A;  3CYN A;  2LV3 A;  1GSQ A;  4POL A;  2I3Y A;  4FYC A;  4X43 A;  4NAX A;  3RDW A;  1PL2 A;  6GSS A;  1U3A A;  4IP6 A;  1YDK A;  1TI3 A;  1A23 A;  2HZE A;  2JL4 A;  4EF0 A;  3O3T A;  2WDU A;  2GT6 A;  5J41 A;  2LTK A;  4RQX A;  1X5E A;  3TKP A;  3WYW A;  5CRD A;  5HR0 A;  4OCF A;  3MWH A;  2R0P A;  1BG5 A;  4AF2 A;  3C1S A;  4HUA A;  2VCX A;  4ZXG A;  3ZFB A;  2H6X A;  4TXV A;  4CDO A;  1IYH A;  1I9D A;  2KLX A;  4F0B A;  3VPQ A;  2LRC A;  3HJP A;  2R6K A;  3TJG A;  5CAX A;  5GAP D;  3CRT A;  3IK7 A;  2GSQ A;  1GSU A;  2JZS A;  3FK8 A;  1RQM A;  4POM A;  2C3N A;  4JED A;  4H86 A;  4J2F A;  4JBB A;  5F06 A;  2H74 A;  2LS5 A;  5IPH A;  2FNO A;  5AGY A;  1GSS A;  3A5I A;  1SD8 A;  3L9S A;  2IL3 A;  1OE7 A;  4OO5 A;  2QA1 A;  3ZLP A;  1DE2 A;  1JZR A;  4F82 A;  1TI1 A;  2H76 A;  4MJB A;  4GQC A;  3U5R E;  1LJR A;  1GSF A;  3LW9 A;  4HS1 A;  4IW9 A;  5D9W A;  4ISD A;  3FR9 A;  1JFU A;  1J08 A;  2H1D A;  1OC8 A;  5ECK B;  4I2T A;  4EKZ A;  2V32 A;  4JR4 A;  1PMT A;  1B48 A;  3GL3 A;  2VD1 A;  3SBC A;  3UBK A;  4N11 A;  3GRX A;  3ZTL A;  2IN3 A;  2OE0 A;  4KAE A;  2E0Q A;  1KTE A;  2PVQ A;  3TCO A;  4KGI A;  3ZL5 A;  3HHV A;  4I5Q A;  2H75 A;  2B1L A;  1FG4 A;  3GTU A;  12GS A;  5DBQ A;  4K2D A;  3H93 A;  1GH2 A;  4MH3 A;  3JCM L;  3I43 A;  1XPV A;  2KOK A;  1VF3 A;  4IJI A;  1PFO A;  5ECR B;  2X99 A;  1JHB A;  1K3L A;  1XBS A;  5IMA A;  1Y25 A;  5KN2 A;  5ECQ B;  3Q18 A;  1YF0 A;  1IYI A;  3P90 A;  1SYX A;  4L5L A;  4HOJ A;  1ZYN A;  4K2X A;  4BPY A;  4O5U A;  3NOF A;  2FWH A;  2R3X A;  3MDK A;  2JZR A;  5AIX A;  2L6D A;  3DVX A;  3IOS A;  2I81 A;  2HE3 A;  2V41 A;  1PL1 A;  3KP9 A;  1QQ2 A;  1K0B A;  3TB2 A;  5IPG A;  3ERG A;  5A4V A;  3ZFL A;  2GZZ A;  2GLR A;  3FZ9 A;  2VL2 A;  4KW6 A;  4KDU A;  4J57 E;  3GUR A;  4WR4 A;  1HQO A;  2GST A;  4BVY A;  2VL2 C;  2C0E A;  3FZA A;  1SL1 B;  3BJ5 A;  1ERU A;  2KP2 A;  3UL3 A;  2X4A A;  5GAN D;  2CAQ A;  2CAI A;  3A5W A;  3D0Z A;  3I6A A;  4EUY A;  2H66 A;  2V1M A;  2PGT A;  1OYJ A;  3ME7 A;  4K0N A;  1F6M C;  4N10 A;  1S3A A;  4L8E A;  1G6Y A;  4WF5 A;  1ERW A;  3A2X A;  3KEB A;  3UVT A;  1O8X A;  1UA5 A;  2BMX A;  3ED3 A;  2HI7 A;  4WBJ A;  5GSS A;  2DSA A;  1O73 A;  1FO5 A;  2MMO A;  2VD0 A;  2DBC A;  5J3R A;  1AUC A;  4MH2 A;  2F51 A;  3HY2 A;  1MTC A;  2CT6 A;  4IQA A;  3FEU A;  4MF6 A;  4KSO A;  2OAD A;  2LUS A;  4MZB A;  3UVH A;  3G7J A;  2HFD A;  2RM6 A;  2F9S A;  3H79 A;  5DQY A;  4TN8 A;  2ES7 A;  2OJL A;  3QAW A;  4IKH A;  3DYR A;  1NHO A;  4PTS A;  2N5F A;  2FUG 2;  2E2M A;  1TJD A;  2P0G A;  5L71 A;  2QA2 A;  4TW5 A;  2C3Q A;  2C8U A;  3MSZ A;  1QK8 A;  2PMT A;  1YY7 A;  6GSV A;  3QAG A;  4I6X A;  3TRX A;  2FCH A;  5ECN B;  1XWA A;  4FIW A;  4Q5N A;  3HZ8 A;  4YAP A;  3WT1 A;  2L5O A;  3RHC A;  3KH9 A;  2MBT A;  3TKR A;  1TU8 A;  2BTO T;  5LCZ A;  3BOA A;  3VPT A;  1EP7 A;  1N2A A;  2P5R A;  3VLN A;  4X0X A;  3QPM A;  5GST A;  3ZYW A;  5CRH A;  4IS0 A;  1M2B A;  2HSY A;  2C0G A;  4ILF A;  1K3O A;  2DJ3 A;  2P31 A;  2YWM A;  4NHW A;  4G0K A;  5IMF A;  3R3E A;  3GIX A;  2IFQ A;  2CV4 A;  4PQH A;  4MDC A;  1OE8 A;  4KUN A;  3EWL A;  3EIN A;  1M99 A;  2O8V B;  4HQS A;  2GZY A;  1XFL A;  5IOX A;  1PD2 1;  3ERF A;  1LBK A;  1WIK A;  2HZE B;  2B7J A;  1Z7R A;  2VL3 A;  3G9B A;  3HJM A;  2VLU A;  3IK9 A;  4YAV A;  2F3M A;  5CO3 A;  2J9H A;  2QGV A;  2AB6 A;  3QFA C;  2NDO A;  3FR3 A;  2DIY A;  4D73 A;  4LA1 A;  3KH7 A;  4NXI A;  5CRW A;  1K0D A;  1PSQ A;  3H8Q A;  4ZB8 A;  2CVB A;  3TJJ A;  4TKY A;  3ZVJ D;  5GZZ B;  5A4W A;  5KEJ A;  1Z6M A;  1T4Y A;  4GF0 A;  1GUH A;  2RLI A;  3M0F A;  2LRT A;  1TU7 A;  2WRT A;  3LSZ A;  3W8J A;  4LMW A;  3P2A A;  1XW9 A;  2H73 A;  3VI7 A;  4EXJ A;  1GSD A;  1EP8 A;  3TRQ A;  4MPG A;  4BA7 A;  2AV4 A;  1TRW A;  4PNG A;  4MNN A;  1XVQ A;  3GSS A;  4LMV A;  4MAB A;  4OCE A;  1THO A;  2MMZ A;  4F03 A;  1DE1 A;  1FOH A;  1V9W A;  4JU5 A;  5E59 A;  1QFN A;  2VCQ A;  4K1F A;  2DJ0 A;  5H5S A;  4HZ2 A;  3VWV A;  3S9F A;  1WE0 A;  2R2J A;  3KMN A;  3HCZ A;  1ZYP A;  3GTU B;  1WOU A;  1XOA A;  2WUL A;  2LJR A;  3IPZ A;  5KN1 A;  4V2M A;  3GL5 A;  1YKA A;  1M3J A;  4MPF A;  4RI7 A;  1XIY A;  4ECC A;  3HZ4 A;  4I97 A;  4NV2 A;  1EEM A;  4GST A;  5IMC A;  1WWJ A;  2PER A;  2XPE A;  2VO4 A;  1A0F A;  3F63 A;  1S3C A;  2XBI A;  3HXS A;  1GSE A;  2OA7 A;  1Q98 A;  3WT2 A;  2Z9S A;  4V2L A;  1M7T A;  1OC3 A;  3F4R A;  1ZZY A;  5B7C A;  1M9B A;  6GSW A;  4DSS B;  4TR0 A;  2H6Y A;  4MK3 A;  2HZF A;  3ZZX A;  3IXR A;  4TVE A;  1SJ6 A;  1V58 A;  2H30 A;  2H1G A;  1JZO A;  4BL7 A;  3D6I A;  5CRG A;  1DSB A;  3N9J A;  5BRT A;  1GUM A;  4EIP A;  5F07 A;  3O6T A;  3TGZ A;  1SU9 A;  2AHE A;  4KB3 A;  1PKW A;  3ZRD A;  2XPD A;  5EPF A;  3D22 A;  2H71 A;  1PX6 A;  4FYB A;  1XVW A;  2MBS A;  5G5E A;  1BQ7 A;  1EWX A;  3CRU A;  4ZBD A;  1PKZ A;  5HR3 A;  4FH8 A;  17GS A;  1ST9 A;  5B8B A;  2IJY A;  2DKH A;  2HLS A;  1XWK A;  4HDE A;  3CTG A;  4AGS A;  3PR8 A;  4X4J A;  1OKD A;  4KND A;  2X49 A;  2XBQ A;  4A5P A;  5IO2 A;  3IHQ A;  3PGT A;  4GSS A;  4HU9 A;  1ILO A;  4K7O A;  3GHA A;  1EZK A;  3DGQ A;  5ECO B;  2YV9 A;  2K9F A;  2YCD A;  2VIM A;  1VF1 A;  1M2D A;  4MLY A;  1PQN A;  2GSS A;  2B1K A;  5KN3 A;  18GS A;  2A2P A;  1Z9H A;  3W6G A;  3KZQ A;  4ZIL A;  2H72 A;  1MD4 A;  2DML A;  1DUG A;  4L0U A;  1M2A A;  1QXH A;  1CQH A;  3L78 A;  4Z2T A;  3F3R A;  3H1N A;  1TKD B;  5DAK B;  2YJ7 A;  5ELA A;  4EIQ A;  3W8S A;  2ZUP A;  3FHK A;  1YJ6 A;  2BJX A;  3HA9 A;  4GRF A;  1VF4 A;  2DIZ A;  5B6M A;  1DBY A;  2C4J A;  3LFL A;  2O7K A;  4BVX A;  5ID2 B;  1O7U A;  1SYR A;  3TJB A;  1F3B A;  1Z3E A;  5JCW A;  3KMO A;  1VRS D;  5EL8 A;  2I4A A;  2G0F A;  3VWX A;  20GS A;  2K6V A;  4MZC A;  2C1Y A;  1C72 A;  3F3Q A;  2AAW A;  2VM1 A;  2RII A;  4V1A g;  5D93 A;  5HR2 A;  1RK4 A;  5FT3 A;  3M3M A;  2KUC A;  5LD0 A;  3I69 A;  3BCI A;  4USS A;  5HR1 A;  1S3R A;  7GSS A;  5IMV A;  3LQ7 A;  4MF5 A;  5IIZ A;  2LRN A;  4KCE A;  2VM2 A;  4ECJ A;  4K7N A;  10GS A;  3FW2 A;  2FHE A;  4N30 A;  1EV9 A;  3LXZ A;  4V1A p;  5AIS A;  2HRN A;  3BCK A;  2RUF A;  4MJE A;  1UC7 A;  1O81 A;  6GST A;  4DSR A;  1F9M A;  5E4W A;  2AUV A;  2XHF A;  5F0G A;  3A3T A;  1HYU A;  1Z6N A;  3L9U A;  1H4O A;  5B8A A;  5HQP A;  4TRX A;  3APQ A;  2DJJ A;  1QMV A;  2LNS A;  5DAL B;  2JSZ A;  4EC0 A;  5COH A;  2REM A;  3V1W A;  5DCG A;  1YF1 A;  3GN3 A;  2LQO A;  1O85 A;  1YEP A;  1R5A A;  3LYP A;  4ECB A;  5HFG A;  2B3S A;  3TOT A;  4XHM A;  19GS A;  3TDG A;  3OR5 A;  2LKU A;  4AJ6 A;  4L5O A;  3MYD A;  4KX4 A;  3IC8 A;  1NW2 A;  3KTB A;  4DSQ A;  2ON5 A;  4YH2 A;  3KXO A;  4K5R A;  2GT5 A;  5ABR A;  3G7I A;  2YZU A;  5G30 A;  3K8N A;  2IMK A;  2L5L A;  4ACS A;  2FA4 A;  4XS1 A;  2DLX A;  5J5N A;  3AY8 A;  1SEN A;  1AC1 A;  4OWY A;  1SK1 A;  4O32 A;  4G0I A;  3BD2 A;  4K8M A;  4MF7 A;  2FLS A;  4XS6 A;  1YKC A;  2IMF A;  2H0I A;  4KE3 A;  5FHI A;  3PH9 A;  2L4Q A;  4XS4 A;  4G2E A;  4E8E A;  3RBT A;  1B9Y C;  2VLV A;  1XWG A;  3UEM A;  1ABA A;  4FO5 A;  4KDY A;  3ZIV A;  4KDX A;  1FVJ A;  4HSC X;  1XZO A;  5IM9 A;  1X5C A;  4TOP A;  2XC2 A;  3J7Y b;  3MNG A;  2QKE A;  3GKX A;  2M80 A;  3KP8 A;  4KH7 A;  2VAF A;  4Q5R A;  1GTU A;  2F8A A;  2HRK A;  4G19 A;  4BL7 B;  5ECL B;  2MZC A;  5C00 A;  3EUR A;  1AQX A;  2VL9 A;  2PVO C;  1FW1 A;  1SJZ A;  1GTI A;  4RQR A;  4ZL8 A;  4J56 E;  3Q74 A;  4WXT A;  4PX1 A;  3A2W A;  3A2V A;  1GUL A;  1X0R A;  2TRX A;  4POB A;  3M9K A;  3ISO A;  5CNW A;  4WEY A;  4KSM A;  5A5K A;  1S3D A;  1XG8 A;  2ON7 A;  4HI7 A;  1EV4 A;  1OVN A;  2CA8 A;  3ZIT A;  2KP1 A;  2A2S A;  1H75 A;  2FD3 A;  2B5Y A;  4JRR A;  3RHB A;  2DJK A;  2LEG A;  2PWJ A;  2O85 A;  2HSH A;  1XOB A;  2R5G A;  3O76 A;  5D9X A;  3GH6 A;  1HNB A;  2L57 A;  2J23 A;  4GXZ A;  1GSY A;  1V98 A;  2YWI A;  2TIR A;  4EE0 A;  2B6M A;  1GTA A;  4PNF A;  1TK0 B;  4Z2R A;  2ZNM A;  3UMA A;  3Q19 A;  5ECI B;  1V2A A;  5DCH A;  1GRX A;  4PGT A;  2FA8 A;  4ULX A;  2R0C A;  11GS A;  1SJI A;  3F6D A;  5DQS A;  4HZ4 A;  3DWV A;  4TR3 A;  1YZX A;  2LJA A;  1SKW B;  1UN2 A;  1W4V A;  1TRU A;  4YQM A;  2YJH A;  1EOG A;  1FB0 A;  4TR4 A;  2WCI A;  4OD7 A;  2LJK A;  4G9H A;  4IN0 A;  3TOU A;  1USB A;  3SWL A;  1QUW A;  1FVK A;  3KTL A;  1A24 A;  2C0F A;  3LGC A;  2YV7 A;  2E7P A;  1HNA A;  4WET A;  2A4H A;  2YPM A;  4P3Y B;  2GQK A;  4ZB6 A;  4Z2U A;  1AQW A;  1ZCP A;  2JAC A;  2K18 A;  2X8G A;  1J0F A;  3ZML A;  1GNW A;  3WGX A;  1QGV A;  4MMM A;  4WKW A;  4CW9 A;  2MMA A;  2YOI A;  1KEB A;  1M3I A;  3QMX A;  4ML1 A;  4DVC A;  3G7Y A;  3APO A;  2PPT A;  2PU9 C;  3VUR A;  4XCS A;  1VGL A;  1A2M A;  1TK8 B;  5D96 A;  4GLT A;  3EMX A;  4TXO A;  1G6W A;  2H01 A;  4TR1 A;  3QAV A;  4YKF A;  3GX8 A;  4QQ7 A;  3M9J A;  4IP1 A;  3IR4 A;  1OC9 A;  1MDK A;  3LJR A;  1JZD A;  2AJQ B;  2OE1 A;  1K3Y A;  3DRN A;  3IHG A;  5BMU A;  1F3A A;  2F8F A;  4POK A;  4FYU A;  1TP9 A;  3DML A;  1BYE A;  2R0G A;  2QC7 A;  5G1L A;  1MD3 A;  3KCM A;  5KOW A;  1O8W A;  2WZ9 A;  1R26 A;  4MZW A;  4FQU A;  3HDC A;  1ACV A;  2HRA A;  2C3T A;  5EY6 A;  3L4N A;  4YQV A;  1AW9 A;  1UVZ A;  5IMD A;  2AYT A;  5JCG A;  4Q5F A;  3LYK A;  3QFB C;  1K0C A;  2JU5 A;  1ZYE A;  2JZT A;  2X8C A;  5KOX A;  4QL9 A;  4K7I A;  4BVY B;  2YN1 A;  3GFK A;  5AIV A;  4KA0 A;  4RUV A;  3E9J B;  1ERT A;  1A2L A;  1ZGN A;  5HFI A;  3HVX A;  1GUK A;  3C71 A;  2VUP A;  3FKF A;  4MCU A;  1BAY A;  4XS4 B;  3FR6 A;  4N0Z A;  2HNL A;  2X8H A;  1TDI A;  1TRV A;  3L0H A;  3IA1 A;  2NVL A;  6GSX A;  4ICY A;  1PA3 A;  2K8S A;  5ECS A;  4PUR A;  3P7X A;  1JZW A;  4NPB A;  2PUK C;  5DDL A;  1PX7 A;  2FY6 A;  4ZBB A;  2MYG A;  4AJ7 A;  1B4P A;  2YZH A;  8GSS A;  3ZIJ A;  1YQ1 A;  2GSR A;  2PBJ A;  5J9C A;  1ON4 A;  1XW6 A;  4IJ3 A;  3QDN A;  4QL7 A;  4JR6 A;  2ALB A;  5IMZ A;  2HRF A;  4PQI A;  2DMM A;  3TKS E;  5ELG A;  1LU4 A;  5CP1 A;  2VCZ A;  3KM6 A;  4OFM A;  4F9Z A;  2FWF A;  2OKA A;  3HVV A;  3F4S A;  3M8N A;  1N8J A;  3PPU A;  4ZL7 A;  5KN0 A;  4PUA A;  1X9S B;  1BX9 A;  1R7H A;  1RW1 A;  3CSJ A;  2A4V A;  1EEJ A;  3F4T A;  1FAA A;  5DVB A;  5D73 A;  1OAZ A;  2R4V A;  1B8X A;  5ENU A;  4K6X A;  4NMU A;  1GNE A;  2NBS A;  3TJF A;  4ML6 A;  3NZN A;  1T3B A;  1WRY A;  3RPP A;  3D4T A;  2UZ8 A;  3CSH A;  3QCP A;  1Z5Y E;  5DJL A;  4JZQ A;  3I9V 2;  3GKN A;  2IFQ B;  4LLR A;  1EGO A;  3FZ5 A;  5CRE A;  1A8L A;  4I8B A;  4O92 A;  3RPN A;  1K0M A;  4XRD A;  5IQY A;  3QR6 A;  4K5S A;  1B4Q A;  4NWY A;  2R37 A;  1ZL9 A;  1ERV A;  4L0W A;  3N5O A;  3F0I A;  4LL1 B;  1GL8 A;  3FMW A;  1XCC A;  3ZMK A;  1SK2 A;  2VCW A;  4CHS A;  1A2J A;  2O87 A;  4WR5 A;  4D73 B;  2H19 A;  2OAC A;  1ML6 A;  1ZMA A;  2D2Z A;  9GSS A;  1X5D A;  3IAS 2;  3C8E A;  3ERW A;  4F0C A;  5LNK e;  3WGE A;  2YWN A;  3BBY A;  2CX3 A;  3CXG A;  1SL0 B;  3QD9 A;  1T00 A;  3APS A;  3VFI A;  4EDY A;  1U3I A;  2NPB A;  1HD2 A;  3ZRE A;  3HJO A;  5G1K A;  1TK5 B;  1JLW A;  3CTF A;  5DJM A;  3ZVJ A;  2H1B A;  2QSI A;  3KD0 A;  3E3E A;  2VCT A;  2A2R A;  1XW5 A;  2FGX A;  2GVP A;  4V2N A;  2WFC A;  4RI6 A;  1G7E A;  1XXU A;  1SK0 A;  2VOC A;  2RM5 A;  5ECM B;  1URM A;  3D21 A;  5C04 A;  1MDJ A;  1E2Y A;  3EMP A;  2C80 A;  3KIJ A;  4IHU A;  1CQG A;  4EDZ A;  1F37 A;  5G5F A;  4TXO B;  2DJ2 A;  2V6O A;  4TR1 B;  2GQM A;  5G2Z A;  4YQU A;  3TKQ A;  3UOM A;  1PGT A;  4DSS A;  3EVI A;  1OC9 B;  2KHP A;  3LXT A;  3GA4 A;  3DIE A;  4PXO A;  3HKR A;  5EVO A;  1EOH A;  1VF2 A;  3FZ4 A;  4CY8 A;  4ZIJ A;  3UJ1 A;  3D4M A;  1HNC A;  3C73 A;  4EL1 A;  1V57 A;  2HYX A;  3H4K A;  1E6B A; 
#chains in the Genus database with same CATH homology
 2YWO A;  2CX4 A;  2IIY A;  1BJX A;  22GS A;  2DJ1 A;  1G0T A;  2M46 A;  4XTS A;  1AAZ A;  4HJM A;  5B6N A;  1AQV A;  3MIX A;  2HSM A;  2OBI A;  2I1U A;  3CBU A;  1PRX A;  2O89 A;  2CZ2 A;  4IBP A;  1JLV A;  1NM3 A;  2IMD A;  4I2U A;  3EU3 A;  3GNJ A;  2GTU A;  13GS A;  1A8Y A;  3GH9 A;  4KF9 A;  4LL4 B;  3GKM A;  2LQQ A;  2YNX A;  3DD3 A;  1Z7P A;  1M9A A;  3GMF A;  2IME A;  1U6T A;  4XRA A;  2P5Q A;  2PN8 A;  3F8U A;  1B9X C;  4NV5 A;  3UAR A;  1PN9 A;  3E0U A;  3EE2 A;  4OO4 A;  14GS A;  3KGK A;  3R2Q A;  2DKI A;  1GLQ A;  1THX A;  3QOU A;  1X9M B;  3CMI A;  1MEK A;  2HT9 A;  4O5Q A;  2L4C A;  1EGR A;  1TXX A;  2FWE A;  4ID0 A;  3LWA A;  3D5J A;  4E8H A;  3HVS A;  4K0G A;  5D9V A;  5DAK A;  3F9U A;  2LNT A;  2ZCT A;  2EC4 A;  1WPI A;  4N0V A;  5ECP B;  3IDV A;  3PIN A;  1FB6 A;  4MJA A;  3C7M A;  5H5R A;  1TRS A;  3VWW A;  1KNG A;  1I5G A;  3M1G A;  1FHE A;  2WJU A;  3DVW A;  2DC5 A;  3DKS A;  3FRC A;  1NSW A;  5ID2 A;  3US3 A;  5D8I A;  3WGD A;  1ZYQ B;  4KCA A;  2L6C A;  4G0L A;  1TTZ A;  2IMI A;  4XIH A;  4HU7 A;  1Y6E A;  2HXK A;  1TOF A;  3LG6 A;  4Q5Q A;  3DXB A;  1M0U A;  3VI5 A;  2GGT A;  4GWR A;  4ZB9 A;  3EU4 A;  4G10 A;  2V2G A;  3GYK A;  2FWG A;  3MAK A;  3LEF A;  1Q4J A;  5A4U A;  1O6J A;  1G7O A;  3J7Y k;  1PN0 A;  3EPT A;  2OBK A;  4GQF A;  4BVX B;  5FWG A;  1SD9 A;  2IPA A;  3GKK A;  2CVK A;  4F2I A;  3L9V A;  1X9W B;  4IGJ A;  5AN1 A;  3C1R A;  3TJK A;  2RUE A;  1K0N A;  5F8B A;  5HFK A;  3KJY A;  3F6F A;  2N5B A;  3GX0 A;  1K0O A;  2E2G A;  2EIR A;  2TRC P;  1T7P B;  3IE3 A;  2VCV A;  1WMJ A;  4MJC A;  3GUS A;  3VK9 A;  1OKT A;  4WF4 A;  1GTB A;  4EO3 A;  5JWO B;  1FOV A;  6GSY A;  2JSY A;  5DAL A;  2B5X A;  2JAD A;  2CVD A;  2H8L A;  3EYT A;  2C0D A;  4OFT A;  1F2E A;  5IO0 A;  5G31 A;  2K8V A;  3UBL A;  4HEA 2;  5INY A;  2GZP A;  1BED A;  4X1U A;  1YEX A;  3FY7 A;  3GV1 A;  3UAP A;  3IAM 2;  2WGR A;  2WB9 A;  1XWC A;  3U6V A;  1V40 A;  2GQL A;  3P8W A;  1GLP A;  4GCI A;  4GSN A;  3RAZ A;  2EIO A;  1KBN A;  2H70 A;  1ZOF A;  2H0G A;  2CQ9 A;  3NIV A;  1MDI A;  1XWB A;  2H6Z A;  5CYY A;  3IBH A;  3IC4 A;  1WJK A;  2L59 A;  4NHZ A;  4JE1 A;  4GTU A;  1J9B A;  4CY6 A;  4IEL A;  1A0R P;  3Q6O A;  4YKG A;  1TW9 A;  3TKS A;  2GDR A;  5JWQ B;  3TKS C;  5ECH B;  2VLT A;  1SKR B;  4DEJ A;  1GP1 A;  5F05 A;  1T1V A;  4HJ2 A;  2YAN A;  1SKS B;  1T4Z A;  1T8E B;  2M72 A;  4O5R A;  3HD5 A;  2X64 A;  5H5Q A;  2NTO A;  5J9B A;  2I9H A;  2IWT A;  4MP4 A;  4EVM A;  1R4W A;  16GS A;  1U87 A;  6GSU A;  3LOR A;  2N5A A;  2H1A A;  2EIQ A;  1NHY A;  3UIW A;  2LST A;  4MA9 A;  3DEX A;  4IVF A;  3CSI A;  4ZL9 A;  4ECI A;  2B7K A;  4BWS A;  3IRA A;  4PQ1 A;  1GWC A;  4PUF C;  1AXD A;  4OMV A;  5IOW A;  3ME8 A;  4AJ8 A;  4K9Z A;  4HQZ A;  2MMN A;  4WBR D;  4ZBA A;  5D9T A;  1W89 A;  1AIU A;  4O7H A;  2V6K A;  2H0H A;  2GS3 A;  3IV4 A;  4BWQ A;  3TRP A;  1R5P A;  2B5E A;  1WP0 A;  4OFN A;  1K0A A;  1U88 A;  4IQ1 A;  3TUE A;  3EC3 A;  2YP6 A;  3GST A;  3WD6 A;  5J4U A;  3VWU A;  2CZ3 A;  2G2Q A;  4Z7X A;  2OE3 A;  5JCU A;  2WS2 A;  3HYP A;  5JWR B;  1SL2 B;  3FYG A;  3CYN A;  2LV3 A;  1GSQ A;  4POL A;  2I3Y A;  4FYC A;  4X43 A;  4NAX A;  3RDW A;  1PL2 A;  6GSS A;  1U3A A;  4IP6 A;  1YDK A;  1TI3 A;  1A23 A;  2HZE A;  2JL4 A;  4EF0 A;  3O3T A;  2WDU A;  2GT6 A;  5J41 A;  2LTK A;  4RQX A;  1X5E A;  3TKP A;  3WYW A;  5CRD A;  5HR0 A;  4OCF A;  3MWH A;  2R0P A;  1BG5 A;  4AF2 A;  3C1S A;  4HUA A;  2VCX A;  4ZXG A;  3ZFB A;  2H6X A;  4TXV A;  4CDO A;  1IYH A;  1I9D A;  2KLX A;  4F0B A;  3VPQ A;  2LRC A;  3HJP A;  2R6K A;  3TJG A;  5CAX A;  5GAP D;  3CRT A;  3IK7 A;  2GSQ A;  1GSU A;  2JZS A;  3FK8 A;  1RQM A;  4POM A;  2C3N A;  4JED A;  4H86 A;  4J2F A;  4JBB A;  5F06 A;  2H74 A;  2LS5 A;  5IPH A;  2FNO A;  5AGY A;  1GSS A;  3A5I A;  1SD8 A;  3L9S A;  2IL3 A;  1OE7 A;  4OO5 A;  2QA1 A;  3ZLP A;  1DE2 A;  1JZR A;  4F82 A;  1TI1 A;  2H76 A;  4MJB A;  4GQC A;  3U5R E;  1LJR A;  1GSF A;  3LW9 A;  4HS1 A;  4IW9 A;  5D9W A;  4ISD A;  3FR9 A;  1JFU A;  1J08 A;  2H1D A;  1OC8 A;  5ECK B;  4I2T A;  4EKZ A;  2V32 A;  4JR4 A;  1PMT A;  1B48 A;  3GL3 A;  2VD1 A;  3SBC A;  3UBK A;  4N11 A;  3GRX A;  3ZTL A;  2IN3 A;  2OE0 A;  4KAE A;  2E0Q A;  1KTE A;  2PVQ A;  3TCO A;  4KGI A;  3ZL5 A;  3HHV A;  4I5Q A;  2H75 A;  2B1L A;  1FG4 A;  3GTU A;  12GS A;  5DBQ A;  4K2D A;  3H93 A;  1GH2 A;  4MH3 A;  3JCM L;  3I43 A;  1XPV A;  2KOK A;  1VF3 A;  4IJI A;  5ECR B;  2X99 A;  1JHB A;  1K3L A;  1XBS A;  5IMA A;  1Y25 A;  5KN2 A;  5ECQ B;  3Q18 A;  1YF0 A;  1IYI A;  3P90 A;  1SYX A;  4L5L A;  4HOJ A;  1ZYN A;  4K2X A;  4BPY A;  4O5U A;  3NOF A;  2FWH A;  2R3X A;  3MDK A;  2JZR A;  5AIX A;  2L6D A;  3DVX A;  3IOS A;  2I81 A;  2HE3 A;  2V41 A;  1PL1 A;  3KP9 A;  1QQ2 A;  1K0B A;  3TB2 A;  5IPG A;  3ERG A;  5A4V A;  3ZFL A;  2GZZ A;  2GLR A;  3FZ9 A;  2VL2 A;  4KW6 A;  4KDU A;  4J57 E;  3GUR A;  4WR4 A;  1HQO A;  2GST A;  4BVY A;  2VL2 C;  2C0E A;  3FZA A;  1SL1 B;  3BJ5 A;  1ERU A;  2KP2 A;  3UL3 A;  2X4A A;  5GAN D;  2CAQ A;  2CAI A;  3A5W A;  3D0Z A;  3I6A A;  4EUY A;  2H66 A;  2V1M A;  2PGT A;  1OYJ A;  3ME7 A;  4K0N A;  1F6M C;  4N10 A;  1S3A A;  4L8E A;  1G6Y A;  4WF5 A;  1ERW A;  3A2X A;  3KEB A;  3UVT A;  1O8X A;  1UA5 A;  2BMX A;  3ED3 A;  2HI7 A;  4WBJ A;  5GSS A;  2DSA A;  1O73 A;  1FO5 A;  2MMO A;  2VD0 A;  2DBC A;  5J3R A;  1AUC A;  4MH2 A;  2F51 A;  3HY2 A;  1MTC A;  2CT6 A;  4IQA A;  3FEU A;  4MF6 A;  4KSO A;  2OAD A;  2LUS A;  4MZB A;  3UVH A;  3G7J A;  2HFD A;  2RM6 A;  2F9S A;  3H79 A;  5DQY A;  4TN8 A;  2ES7 A;  2OJL A;  3QAW A;  4IKH A;  3DYR A;  1NHO A;  4PTS A;  2N5F A;  2FUG 2;  2E2M A;  1TJD A;  2P0G A;  5L71 A;  2QA2 A;  4TW5 A;  2C3Q A;  2C8U A;  3MSZ A;  1QK8 A;  2PMT A;  1YY7 A;  6GSV A;  3QAG A;  4I6X A;  3TRX A;  2FCH A;  5ECN B;  1XWA A;  4FIW A;  4Q5N A;  3HZ8 A;  4YAP A;  3WT1 A;  2L5O A;  3RHC A;  3KH9 A;  2MBT A;  3TKR A;  1TU8 A;  2BTO T;  5LCZ A;  3BOA A;  3VPT A;  1EP7 A;  1N2A A;  2P5R A;  3VLN A;  4X0X A;  3QPM A;  5GST A;  3ZYW A;  5CRH A;  4IS0 A;  1M2B A;  2HSY A;  2C0G A;  4ILF A;  1K3O A;  2DJ3 A;  2P31 A;  2YWM A;  4NHW A;  4G0K A;  5IMF A;  3R3E A;  3GIX A;  2IFQ A;  2CV4 A;  4PQH A;  4MDC A;  1OE8 A;  4KUN A;  3EWL A;  3EIN A;  1M99 A;  2O8V B;  4HQS A;  2GZY A;  1XFL A;  5IOX A;  1PD2 1;  3ERF A;  1LBK A;  1WIK A;  2HZE B;  2B7J A;  1Z7R A;  2VL3 A;  3G9B A;  3HJM A;  2VLU A;  3IK9 A;  4YAV A;  2F3M A;  5CO3 A;  2J9H A;  2QGV A;  2AB6 A;  3QFA C;  2NDO A;  3FR3 A;  2DIY A;  4D73 A;  4LA1 A;  3KH7 A;  4NXI A;  5CRW A;  1K0D A;  1PSQ A;  3H8Q A;  4ZB8 A;  2CVB A;  3TJJ A;  4TKY A;  3ZVJ D;  5GZZ B;  5A4W A;  5KEJ A;  1Z6M A;  1T4Y A;  4GF0 A;  1GUH A;  2RLI A;  3M0F A;  2LRT A;  1TU7 A;  2WRT A;  3LSZ A;  3W8J A;  4LMW A;  3P2A A;  1XW9 A;  2H73 A;  3VI7 A;  4EXJ A;  1GSD A;  1EP8 A;  3TRQ A;  4MPG A;  4BA7 A;  2AV4 A;  1TRW A;  4PNG A;  4MNN A;  1XVQ A;  3GSS A;  4LMV A;  4MAB A;  4OCE A;  1THO A;  2MMZ A;  4F03 A;  1DE1 A;  1FOH A;  1V9W A;  4JU5 A;  5E59 A;  1QFN A;  2VCQ A;  4K1F A;  2DJ0 A;  5H5S A;  4HZ2 A;  3VWV A;  3S9F A;  1WE0 A;  2R2J A;  3KMN A;  3HCZ A;  1ZYP A;  3GTU B;  1WOU A;  1XOA A;  2WUL A;  2LJR A;  3IPZ A;  5KN1 A;  4V2M A;  3GL5 A;  1YKA A;  4MPF A;  4RI7 A;  1XIY A;  4ECC A;  3HZ4 A;  4I97 A;  4NV2 A;  1EEM A;  4GST A;  5IMC A;  1WWJ A;  2PER A;  2XPE A;  2VO4 A;  1A0F A;  3F63 A;  1S3C A;  2XBI A;  3HXS A;  1GSE A;  2OA7 A;  1Q98 A;  3WT2 A;  2Z9S A;  4V2L A;  1M7T A;  1OC3 A;  3F4R A;  1ZZY A;  5B7C A;  1M9B A;  6GSW A;  4DSS B;  4TR0 A;  2H6Y A;  4MK3 A;  2HZF A;  3ZZX A;  3IXR A;  4TVE A;  1SJ6 A;  1V58 A;  2H30 A;  2H1G A;  1JZO A;  4BL7 A;  3D6I A;  5CRG A;  1DSB A;  3N9J A;  5BRT A;  1GUM A;  4EIP A;  5F07 A;  3O6T A;  3TGZ A;  1SU9 A;  2AHE A;  4KB3 A;  1PKW A;  3ZRD A;  2XPD A;  5EPF A;  3D22 A;  2H71 A;  1PX6 A;  4FYB A;  1XVW A;  2MBS A;  5G5E A;  1BQ7 A;  1EWX A;  3CRU A;  4ZBD A;  1PKZ A;  5HR3 A;  4FH8 A;  17GS A;  1ST9 A;  5B8B A;  2IJY A;  2DKH A;  2HLS A;  1XWK A;  4HDE A;  3CTG A;  4AGS A;  3PR8 A;  4X4J A;  1OKD A;  4KND A;  2X49 A;  2XBQ A;  4A5P A;  5IO2 A;  3IHQ A;  3PGT A;  4GSS A;  4HU9 A;  1ILO A;  4K7O A;  3GHA A;  1EZK A;  3DGQ A;  5ECO B;  2YV9 A;  2K9F A;  2YCD A;  2VIM A;  1VF1 A;  1M2D A;  4MLY A;  1PQN A;  2GSS A;  2B1K A;  5KN3 A;  18GS A;  2A2P A;  1Z9H A;  3W6G A;  3KZQ A;  4ZIL A;  2H72 A;  1MD4 A;  2DML A;  1DUG A;  4L0U A;  1M2A A;  1QXH A;  1CQH A;  3L78 A;  4Z2T A;  3F3R A;  3H1N A;  1TKD B;  5DAK B;  2YJ7 A;  5ELA A;  4EIQ A;  3W8S A;  2ZUP A;  3FHK A;  1YJ6 A;  2BJX A;  3HA9 A;  4GRF A;  1VF4 A;  2DIZ A;  5B6M A;  1DBY A;  2C4J A;  3LFL A;  2O7K A;  4BVX A;  5ID2 B;  1O7U A;  1SYR A;  3TJB A;  1F3B A;  1Z3E A;  5JCW A;  3KMO A;  1VRS D;  5EL8 A;  2I4A A;  2G0F A;  3VWX A;  20GS A;  2K6V A;  4MZC A;  2C1Y A;  1C72 A;  3F3Q A;  2AAW A;  2VM1 A;  2RII A;  4V1A g;  5D93 A;  5HR2 A;  1RK4 A;  5FT3 A;  3M3M A;  2KUC A;  5LD0 A;  3I69 A;  3BCI A;  4USS A;  5HR1 A;  7GSS A;  5IMV A;  3LQ7 A;  4MF5 A;  5IIZ A;  2LRN A;  4KCE A;  2VM2 A;  4ECJ A;  4K7N A;  10GS A;  3FW2 A;  2FHE A;  4N30 A;  1EV9 A;  3LXZ A;  4V1A p;  5AIS A;  2HRN A;  3BCK A;  2RUF A;  4MJE A;  1UC7 A;  1O81 A;  6GST A;  4DSR A;  1F9M A;  5E4W A;  2AUV A;  2XHF A;  5F0G A;  3A3T A;  1HYU A;  1Z6N A;  3L9U A;  1H4O A;  5B8A A;  5HQP A;  4TRX A;  3APQ A;  2DJJ A;  1QMV A;  2LNS A;  5DAL B;  2JSZ A;  4EC0 A;  5COH A;  2REM A;  3V1W A;  5DCG A;  1YF1 A;  3GN3 A;  2LQO A;  1O85 A;  1YEP A;  1R5A A;  3LYP A;  4ECB A;  5HFG A;  2B3S A;  3TOT A;  4XHM A;  19GS A;  3TDG A;  3OR5 A;  2LKU A;  4AJ6 A;  4L5O A;  3MYD A;  4KX4 A;  3IC8 A;  1NW2 A;  3KTB A;  4DSQ A;  2ON5 A;  4YH2 A;  3KXO A;  4K5R A;  2GT5 A;  5ABR A;  3G7I A;  2YZU A;  5G30 A;  3K8N A;  2IMK A;  2L5L A;  4ACS A;  2FA4 A;  4XS1 A;  2DLX A;  5J5N A;  3AY8 A;  1SEN A;  1AC1 A;  4OWY A;  1SK1 A;  4O32 A;  4G0I A;  3BD2 A;  4K8M A;  4MF7 A;  2FLS A;  4XS6 A;  1YKC A;  2IMF A;  2H0I A;  4KE3 A;  5FHI A;  3PH9 A;  2L4Q A;  4XS4 A;  4G2E A;  4E8E A;  3RBT A;  1B9Y C;  2VLV A;  1XWG A;  3UEM A;  1ABA A;  4FO5 A;  4KDY A;  3ZIV A;  4KDX A;  1FVJ A;  1XZO A;  5IM9 A;  1X5C A;  4TOP A;  2XC2 A;  3J7Y b;  3MNG A;  2QKE A;  3GKX A;  2M80 A;  3KP8 A;  4KH7 A;  2VAF A;  4Q5R A;  1GTU A;  2F8A A;  2HRK A;  4G19 A;  4BL7 B;  5ECL B;  2MZC A;  5C00 A;  3EUR A;  1AQX A;  2VL9 A;  2PVO C;  1FW1 A;  1SJZ A;  1GTI A;  4RQR A;  4ZL8 A;  4J56 E;  3Q74 A;  4WXT A;  4PX1 A;  3A2W A;  3A2V A;  1GUL A;  1X0R A;  2TRX A;  4POB A;  3M9K A;  3ISO A;  5CNW A;  4WEY A;  4KSM A;  5A5K A;  1S3D A;  2ON7 A;  4HI7 A;  1EV4 A;  1OVN A;  2CA8 A;  3ZIT A;  2KP1 A;  2A2S A;  1H75 A;  2FD3 A;  2B5Y A;  4JRR A;  3RHB A;  2DJK A;  2LEG A;  2PWJ A;  2O85 A;  2HSH A;  1XOB A;  2R5G A;  3O76 A;  5D9X A;  3GH6 A;  1HNB A;  2L57 A;  2J23 A;  4GXZ A;  1GSY A;  1V98 A;  2YWI A;  2TIR A;  4EE0 A;  2B6M A;  1GTA A;  4PNF A;  1TK0 B;  4Z2R A;  2ZNM A;  3UMA A;  3Q19 A;  5ECI B;  1V2A A;  5DCH A;  1GRX A;  4PGT A;  2FA8 A;  4ULX A;  2R0C A;  11GS A;  1SJI A;  3F6D A;  5DQS A;  4HZ4 A;  3DWV A;  4TR3 A;  1YZX A;  2LJA A;  1SKW B;  1UN2 A;  1W4V A;  1TRU A;  4YQM A;  2YJH A;  1EOG A;  1FB0 A;  4TR4 A;  2WCI A;  4OD7 A;  2LJK A;  4G9H A;  4IN0 A;  3TOU A;  1USB A;  3SWL A;  1QUW A;  1FVK A;  3KTL A;  1A24 A;  2C0F A;  3LGC A;  2YV7 A;  2E7P A;  1HNA A;  4WET A;  2A4H A;  2YPM A;  4P3Y B;  2GQK A;  4ZB6 A;  4Z2U A;  1AQW A;  1ZCP A;  2JAC A;  2K18 A;  2X8G A;  1J0F A;  3ZML A;  1GNW A;  3WGX A;  1QGV A;  4MMM A;  4WKW A;  4CW9 A;  2MMA A;  2YOI A;  1KEB A;  3QMX A;  4ML1 A;  4DVC A;  3G7Y A;  3APO A;  2PPT A;  2PU9 C;  3VUR A;  4XCS A;  1VGL A;  1A2M A;  1TK8 B;  5D96 A;  4GLT A;  3EMX A;  4TXO A;  1G6W A;  2H01 A;  4TR1 A;  3QAV A;  4YKF A;  3GX8 A;  4QQ7 A;  3M9J A;  4IP1 A;  3IR4 A;  1OC9 A;  1MDK A;  3LJR A;  1JZD A;  2AJQ B;  2OE1 A;  1K3Y A;  3DRN A;  3IHG A;  5BMU A;  1F3A A;  2F8F A;  4POK A;  4FYU A;  1TP9 A;  3DML A;  1BYE A;  2R0G A;  2QC7 A;  5G1L A;  1MD3 A;  3KCM A;  5KOW A;  1O8W A;  2WZ9 A;  1R26 A;  4MZW A;  4FQU A;  3HDC A;  1ACV A;  2HRA A;  2C3T A;  5EY6 A;  3L4N A;  4YQV A;  1AW9 A;  1UVZ A;  5IMD A;  2AYT A;  5JCG A;  4Q5F A;  3LYK A;  3QFB C;  1K0C A;  2JU5 A;  1ZYE A;  2JZT A;  2X8C A;  5KOX A;  4QL9 A;  4K7I A;  4BVY B;  2YN1 A;  3GFK A;  5AIV A;  4KA0 A;  4RUV A;  3E9J B;  1ERT A;  1A2L A;  1ZGN A;  5HFI A;  3HVX A;  1GUK A;  3C71 A;  2VUP A;  3FKF A;  4MCU A;  1BAY A;  4XS4 B;  3FR6 A;  4N0Z A;  2HNL A;  2X8H A;  1TDI A;  1TRV A;  3L0H A;  3IA1 A;  2NVL A;  6GSX A;  4ICY A;  1PA3 A;  2K8S A;  5ECS A;  4PUR A;  3P7X A;  1JZW A;  4NPB A;  2PUK C;  5DDL A;  1PX7 A;  2FY6 A;  4ZBB A;  2MYG A;  4AJ7 A;  1B4P A;  2YZH A;  8GSS A;  3ZIJ A;  1YQ1 A;  2GSR A;  2PBJ A;  5J9C A;  1ON4 A;  1XW6 A;  4IJ3 A;  3QDN A;  4QL7 A;  4JR6 A;  2ALB A;  5IMZ A;  2HRF A;  4PQI A;  2DMM A;  3TKS E;  5ELG A;  1LU4 A;  5CP1 A;  2VCZ A;  3KM6 A;  4OFM A;  4F9Z A;  2FWF A;  2OKA A;  3HVV A;  3F4S A;  3M8N A;  1N8J A;  3PPU A;  4ZL7 A;  5KN0 A;  4PUA A;  1X9S B;  1BX9 A;  1R7H A;  1RW1 A;  3CSJ A;  2A4V A;  1EEJ A;  3F4T A;  1FAA A;  5DVB A;  5D73 A;  1OAZ A;  2R4V A;  1B8X A;  5ENU A;  4K6X A;  4NMU A;  1GNE A;  2NBS A;  3TJF A;  4ML6 A;  3NZN A;  1T3B A;  1WRY A;  3RPP A;  3D4T A;  2UZ8 A;  3CSH A;  3QCP A;  1Z5Y E;  5DJL A;  4JZQ A;  3I9V 2;  3GKN A;  2IFQ B;  4LLR A;  1EGO A;  3FZ5 A;  5CRE A;  1A8L A;  4I8B A;  4O92 A;  3RPN A;  1K0M A;  4XRD A;  5IQY A;  3QR6 A;  4K5S A;  1B4Q A;  4NWY A;  2R37 A;  1ZL9 A;  1ERV A;  4L0W A;  3N5O A;  3F0I A;  4LL1 B;  1GL8 A;  3FMW A;  1XCC A;  3ZMK A;  1SK2 A;  2VCW A;  4CHS A;  1A2J A;  2O87 A;  4WR5 A;  4D73 B;  2H19 A;  2OAC A;  1ML6 A;  1ZMA A;  2D2Z A;  9GSS A;  1X5D A;  3IAS 2;  3C8E A;  3ERW A;  4F0C A;  5LNK e;  3WGE A;  2YWN A;  3BBY A;  2CX3 A;  3CXG A;  1SL0 B;  3QD9 A;  1T00 A;  3APS A;  3VFI A;  4EDY A;  1U3I A;  2NPB A;  1HD2 A;  3ZRE A;  3HJO A;  5G1K A;  1TK5 B;  1JLW A;  3CTF A;  5DJM A;  3ZVJ A;  2H1B A;  2QSI A;  3KD0 A;  3E3E A;  2VCT A;  2A2R A;  1XW5 A;  2FGX A;  2GVP A;  4V2N A;  2WFC A;  4RI6 A;  1G7E A;  1XXU A;  1SK0 A;  2VOC A;  2RM5 A;  5ECM B;  1URM A;  3D21 A;  5C04 A;  1MDJ A;  1E2Y A;  3EMP A;  2C80 A;  3KIJ A;  4IHU A;  1CQG A;  4EDZ A;  1F37 A;  5G5F A;  4TXO B;  2DJ2 A;  2V6O A;  4TR1 B;  2GQM A;  5G2Z A;  4YQU A;  3TKQ A;  3UOM A;  1PGT A;  4DSS A;  3EVI A;  1OC9 B;  2KHP A;  3LXT A;  3GA4 A;  3DIE A;  4PXO A;  3HKR A;  5EVO A;  1EOH A;  1VF2 A;  3FZ4 A;  4CY8 A;  4ZIJ A;  3UJ1 A;  3D4M A;  1HNC A;  3C73 A;  4EL1 A;  1V57 A;  2HYX A;  3H4K A;  1E6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...