2R2JA

Crystal structure of human erp44
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
370
structure length
328
Chain Sequence
TSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFNQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFSSPPESSFQKLAPSEYRYTLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Thioredoxin domain-containing protein 4
publication title Crystal structure of human ERp44 shows a dynamic functional modulation by its carboxy-terminal tail.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 328
sequence length 370
ec nomenclature
pdb deposition date 2007-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
A PF13848 Thioredoxin_6 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2r2jA03
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2r2jA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2r2jA02
3ZRDA 4EDZA 3VWUA 2KOKA 5J9BA 2TRXA 3RDWA 2PU9C 5IM9A 4HOJA 3CRUA 1AAZA 3KMOA 1AQWA 2EIQA 1V58A 3BCIA 2VM2A 2VCQA 4KH7A 3UARA 3GUSA 2K8VA 5F05A 1ABAA 4EVMA 2C1YA 5EPFA 2V6KA 3MAKA 4IS0A 4IN0A 1GSQA 4K7OA 1O85A 2R2JA 5IO0A 2E2MA 3RAZA 3D4TA 2FGXA 2OA7A 4POKA 2GT5A 5DQSA 9GSSA 3GHAA 1H4OA 1S3DA 5G30A 3ERFA 4E8HA 2WFCA 2PWJA 3HVXA 4LL4B 2L4CA 2R3XA 2ZCTA 1B4QA 1HNAA 2H76A 1SK1A 1EP8A 2X8GA 1PKWA 1ZYEA 3F63A 3IR4A 4WETA 2VLUA 2LJKA 2YZUA 3I6AA 3A2WA 5J9CA 1YY7A 4ZBBA 2YOIA 3H93A 5CRWA 3EMPA 3ED3A 3VI7A 2FWEA 3TOTA 5F07A 5DALA 2HE3A 1T4ZA 3UBKA 3DWVA 1FVKA 2VL3A 3KTLA 3D6IA 3WGXA 1U87A 3TJFA 3KP9A 4ML1A 1BG5A 3E3EA 2X64A 3E0UA 1YJ6A 2L59A 2DBCA 1K3OA 4BVXA 3ZTLA 4AF2A 3SBCA 3JCML 5DAKB 1AUCA 4GRFA 1B8XA 4WBRD 3C7MA 1X9SB 1VF1A 5B8BA 4YQUA 2GZPA 4BL7A 4MABA 4MPFA 2VLVA 1TK5B 3RBTA 5IMCA 4KSMA 2XHFA 3Q6OA 4QL7A 3U6VA 5J4UA 2PUKC 3UEMA 1F3BA 5GSTA 4BWQA 2CZ2A 5HR2A 3VWVA 3G7JA 4PNFA 5KN1A 3GRXA 1A23A 1I5GA 5DJMA 1A8LA 1K3LA 2AV4A 3F4RA 5KN0A 1GTBA 3F4SA 4Q5FA 2YV9A 4YAVA 1XZOA 4Q5QA 3IDVA 4KAEA 1ZL9A 2O87A 5C00A 1XW6A 4GSNA 2DJKA 5EY6A 4EO3A 3M9JA 3GNJA 4LMVA 2GQMA 1TOFA 2LRCA 2VCVA 3ZL5A 3EINA 1HD2A 3TKQA 4IW9A 4IKHA 3OR5A 2ALBA 2GVPA 3TKSA 5HFGA 5D9WA 1TXXA 1XVWA 1ACVA 1F9MA 2P31A 1XVQA 2XC2A 2HSYA 5IQYA 2B7JA 2GT6A 2AJQB 1U6TA 1NHYA 2JSYA 4HJ2A 2CVDA 4GSTA 1SD9A 4HZ4A 5FT3A 2MYGA 4AGSA 1SL0B 1SL1B 3I43A 1GUMA 3DMLA 3IRAA 2CX4A 1TRUA 1YF1A 3C1RA 1T8EB 3DKSA 1C72A 1ZYQB 5CRGA 4X1UA 3IK7A 1GL8A 3HD5A 1XWAA 1PA3A 1QXHA 4GXZA 1Z5YE 3SWLA 3TRPA 3K8NA 2FA4A 4PQHA 4ECBA 2B5XA 5IOWA 4J2FA 4EDYA 2HI7A 4JEDA 2IMFA 2GGTA 1Q4JA 2VM1A 5IMFA 4WF4A 3HY2A 4OFTA 5ECHB 2VCWA 1JZOA 2CX3A 3D0ZA 3HDCA 2GSRA 4MMMA 2N5FA 1SD8A 3WT1A 4EL1A 3IXRA 1SYXA 4MDCA 3FZAA 3GSTA 3J7Yb 4NHZA 4JU5A 1T00A 3W8JA 3M9KA 3FZ4A 4DVCA 3QOUA 1PRXA 2V6OA 1XWCA 4ZILA 5CREA 1OC3A 17GSA 4D73A 3GURA 1BJXA 3QD9A 4YAPA 1O81A 3VI5A 2ON7A 2VL9A 5DCHA 20GSA 1M2BA 1O8XA 2MMZA 3BCKA 4L0UA 4KX4A 1PSQA 1EOGA 3EU4A 1TRVA 2YWMA 1EV9A 4KA0A 3UIWA 4I5QA 2AYTA 4J57E 5KN2A 3F9UA 4CDOA 1SU9A 5ECNB 1SL2B 2DJ2A 1XXUA 2JACA 2H1DA 3WD6A 1BQ7A 1NW2A 5KEJA 2CAQA 5A4WA 1U3IA 4NWYA 2AAWA 5D9TA 1XPVA 1G6WA 2MMNA 1TW9A 4EUYA 3CRTA 1KNGA 5IPHA 3Q19A 4K6XA 3TRXA 3L9VA 1GSYA 1TDIA 3GL3A 4GCIA 4TR0A 2IMEA 4RUVA 4MP4A 1NHOA 3VPQA 2EIOA 3A5WA 3CXGA 1A0FA 4MLYA 4IBPA 1TRSA 4MJBA 4KDYA 4IJ3A 1XW5A 1ZCPA 2NPBA 5GZZB 4DEJA 2H30A 4NXIA 2JSZA 3IOSA 2LQQA 2V1MA 2DJ1A 2I3YA 3F6DA 2PGTA 4MF6A 8GSSA 4XS6A 1AC1A 4FYCA 1O6JA 5B7CA 2HZEB 3HZ8A 1A24A 2J23A 1BX9A 3LJRA 2J9HA 5D73A 3LG6A 4IELA 1DSBA 2IMDA 1GTIA 3LEFA 2YWNA 4PX1A 2MBSA 2IN3A 5GAND 3C71A 3IE3A 2YZHA 2V32A 1F6MC 4K7IA 3ERWA 2VL2C 4XS4A 4KW6A 1AIUA 1M9AA 2QSIA 3H4KA 2H19A 1MEKA 1U88A 2RUEA 2GZZA 3IHQA 1TKDB 2NTOA 5H5QA 1SKRB 2HYXA 3HYPA 1DBYA 1FB6A 3MSZA 1G0TA 1HQOA 3KTBA 4DSQA 3TJBA 3TDGA 3GX0A 2CQ9A 2H66A 4E8EA 4O32A 4TRXA 3DGQA 2DJJA 3DYRA 1Y6EA 4F2IA 1MDKA 1R5PA 2KP2A 2CAIA 1JLWA 1QFNA 5IMAA 1EZKA 22GSA 3U5RE 1Y25A 2MZCA 5FHIA 3ZIVA 2IFQB 2FHEA 1IYIA 4TKYA 5CO3A 2TRCP 4KDXA 1R5AA 3EC3A 5IPGA 5B6MA 4LMWA 1G7OA 4F82A 1N8JA 3TJJA 4I2UA 4OMVA 2R37A 3GH9A 2F8AA 3KXOA 1OC9B 1THOA 1BYEA 2L4QA 3E9JB 3GIXA 1WPIA 2CZ3A 2PVQA 3QMXA 4NHWA 1A0RP 2B5EA 1FHEA 5ECRB 4GTUA 2DMMA 1Z7PA 3I69A 1YKCA 3PH9A 1TU8A 4FO5A 2H72A 5EL8A 4GQFA 3KZQA 2FLSA 1GSEA 2XPEA 5ECOB 2H0IA 2BMXA 3TKRA 1J08A 4XTSA 4POBA 1XBSA 4LLRA 4ECCA 2HT9A 5ID2B 4NPBA 3TKSE 1HYUA 2CVKA 2G0FA 1G6YA 4WR5A 1ON4A 4WEYA 3FW2A 1RW1A 4OO4A 5JWRB 3G7YA 4IP6A 2JZSA 2OE0A 4PUFC 3MNGA 1ILOA 2Z9SA 2F8FA 1FB0A 2I81A 3RHBA 2E2GA 2RIIA 4MK3A 4G10A 1T3BA 4N10A 5E4WA 5D9VA 3GTUB 4NMUA 2KLXA 2AUVA 4NAXA 3ZZXA 4F0BA 1TU7A 3UBLA 2X8HA 3FR6A 4FYBA 4FH8A 3P8WA 1EGOA 4Q5RA 1XOAA 2JU5A 3TOUA 2F3MA 5ECSA 3FZ5A 2FD3A 2WULA 1EWXA 2KUCA 2LSTA 2PMTA 4Z7XA 2B5YA 1LU4A 5CYYA 4HUAA 1GSSA 2HNLA 2PBJA 3DD3A 4ECIA 3V1WA 2FA8A 2YN1A 2P5QA 4NV5A 2FY6A 3RPNA 3APSA 1GSUA 2M46A 5G5EA 1GULA 1WWJA 1H75A 2R5GA 4OCFA 4MZBA 3F3QA 4ZBDA 1T4YA 3KP8A 3LFLA 5CRDA 2C0DA 1NM3A 4O92A 4TXOB 2RM5A 3HJMA 3EURA 1X9MB 4HI7A 3ZMLA 1ZZYA 2WZ9A 3QAGA 2WDUA 3UVHA 2OE3A 1QQ2A 1V9WA 1WOUA 2HXKA 3QFAC 4YH2A 2VLTA 5IMZA 1JZDA 3LYKA 2GDRA 1ERWA 3ZFBA 5D93A 2A4VA 1B4PA 4EC0A 3D5JA 6GSXA 4TW5A 2DSAA 3LXTA 2HLSA 4ZL8A 3GKNA 5CRHA 2JL4A 3KM6A 4L0WA 2FUG2 1X5DA 4K9ZA 4ZBAA 3HVVA 2H1BA 1TI3A 4K0NA 3GH6A 4HU9A 4JRRA 4TVEA 2OKAA 2OJLA 4MJCA 3US3A 1TK8B 2D2ZA 4EKZA 1FAAA 5HFKA 3ZYWA 2FNOA 1WP0A 4I8BA 1A8YA 4JR4A 4ZL9A 5JCUA 1JHBA 4TR4A 5INYA 1OKDA 1HNBA 2FCHA 1TRWA 1V40A 2VCTA 5GSSA 4K2DA 2YWIA 4MCUA 3HVSA 5COHA 3PINA 4X43A 4GLTA 3FYGA 4TR1A 1M7TA 5DBQA 4X0XA 1SKSB 1A2LA 1MDIA 1SJZA 2HFDA 4HU7A 1FVJA 3NZNA 1YF0A 1OVNA 3W8SA 3J7Yk 3UJ1A 3CSHA 2R4VA 1FO5A 4KCAA 5G2ZA 13GSA 4JR6A 2GQKA 3VWXA 4KGIA 3N5OA 1VF3A 2C3NA 4DSSA 1NSWA 1SENA 4V2NA 4MJEA 4WR4A 1KBNA 2N5BA 2L6CA 1AQVA 2LV3A 3TGZA 2H01A 2XBQA 1XWBA 1OKTA 2A2RA 4V2LA 1M2DA 3H8QA 1UC7A 2CA8A 3CBUA 4ACSA 4MZCA 2L57A 5ABRA 1SYRA 5JCWA 1YKAA 3FK8A 1R4WA 4H86A 1AW9A 3WGDA 4OD7A 4LL1B 2I1UA 3M8NA 5CAXA 5DALB 3GKKA 5A4UA 3UOMA 2H1GA 4POLA 3PGTA 2LUSA 3DVXA 4F03A 2YWOA 1B48A 4XCSA 4PQ1A 4OFNA 1VGLA 1A2JA 4HS1A 3F6FA 3IV4A 2A2SA 2XBIA 4O5RA 2I4AA 5ENUA 5DJLA 1ERVA 5EVOA 3LGCA 4BVYA 3ZMKA 5A5KA 1MTCA 2VCZA 1T1VA 4IQ1A 2M72A 3LWAA 1EOHA 3DEXA 5F06A 2K9FA 3RHCA 3BD2A 3ZITA 1I9DA 4ILFA 3GYKA 1K0DA 3M0FA 5AN1A 3QCPA 4AJ7A 3RPPA 2K18A 5G1KA 2OBIA 5CP1A 1GLQA 5DDLA 1LJRA 4ML6A 4XRDA 5LD0A 1UA5A 2O7KA 2PPTA 2WS2A 3N9JA 1XWGA 4MZWA 3GA4A 1F3AA 1UN2A 5DVBA 4F9ZA 2WGRA 2VL2A 4N30A 1DUGA 3GKMA 3L9SA 1X0RA 3CMIA 1PD21 1GH2A 1VRSD 2VCXA 4MJAA 4XS1A 1WJKA 3GV1A 1IYHA 2WJUA 1FOVA 5JWQB 4V1Ag 4JE1A 1RK4A 3DIEA 2OE1A 2MBTA 2VO4A 2GSQA 4PGTA 4MF5A 2C0EA 3ISOA 4TR3A 4ID0A 6GSYA 4BPYA 1F37A 3FR3A 2C0FA 1JLVA 4RI7A 3HJOA 3NOFA 1HNCA 4HQSA 3CYNA 1PN9A 3APQA 3APOA 1GSFA 3WGEA 2ES7A 4V1Ap 3LYPA 1S3AA 5DAKA 4MH3A 3FZ9A 2CV4A 19GSA 3EE2A 5FWGA 5IO2A 4N0VA 3FRCA 4ECJA 5IMVA 4K1FA 4ZB9A 2H0HA 1WMJA 3Q74A 4LA1A 1M0UA 3A3TA 3GFKA 2B1KA 2R6KA 1JZWA 4KUNA 1K0BA 4HJMA 2PN8A 2YPMA 1E6BA 5JCGA 1EP7A 3FR9A 5ECKB 1KEBA 3A2XA 3O76A 4KSOA 2HSHA 2IWTA 3TB2A 4RI6A 1ERTA 4ZB6A 2YP6A 5G5FA 1RQMA 3KGKA 1TTZA 2DC5A 4I97A 1YDKA 2H71A 3EVIA 2GZYA 2JZTA 4JZQA 2H74A 3TRQA 2LRNA 1YQ1A 2C8UA 3IAM2 3CSJA 6GSWA 4QL9A 2BTOT 2RM6A 4D73B 2LJAA 1SJ6A 3LORA 1GWCA 3BOAA 3EU3A 10GSA 2VD0A 4KCEA 1V98A 1U3AA 5HQPA 2MMOA 1TP9A 4N0ZA 1USBA 1DE2A 3GKXA 1W4VA 2FWFA 2WRTA 3IC4A 2X99A 1GTAA 4KDUA 2H70A 5J3RA 1OE7A 5DCGA 4OO5A 3BJ5A 4HEA2 1XOBA 2DLXA 2YJHA 2VIMA 7GSSA 3A2VA 2O89A 2LKUA 2H0GA 1FW1A 2JZRA 3W6GA 2H73A 1UVZA 1PX6A 3DXBA 1ZGNA 2LS5A 2IPAA 3F3RA 3TJGA 1EEJA 4V2MA 3ZREA 2L5OA 1SJIA 5JWOB 5ECLB 1PKZA 1T7PB 4I6XA 1PL2A 5F8BA 4JBBA 2EC4A 4OFMA 5ELGA 2LQOA 5LCZA 1YZXA 2GLRA 2B6MA 3CSIA 3F4TA 3O3TA 3DVWA 4IGJA 4FIWA 1F2EA 2M80A 1ERUA 2OBKA 5F0GA 1WE0A 3ME8A 3FY7A 3TUEA 3KEBA 5E59A 3D21A 2LTKA 3O6TA 2C3TA 2P0GA 1QUWA 3GL5A 4PURA 2E7PA 4IVFA 1PMTA 3L78A 3G7IA 2K8SA 3HA9A 1OAZA 3IBHA 3IK9A 4L8EA 2MMAA 5HR3A 2NVLA 1FG4A 2KP1A 2BJXA 3ZFLA 2B3SA 1N2AA 6GSVA 2KHPA 1K0MA 1ZMAA 1EV4A 5AISA 4J56E 1GNWA 1S3CA 2YV7A 3VURA 1MD4A 2IL3A 1Z9HA 1QMVA 1K0CA 5D96A 3MWHA 4K7NA 4XRAA 1A2MA 2DIZA 1O73A 2G2QA 2RLIA 1WRYA 4WF5A 2HRFA 4L5LA 1CQGA 3GN3A 1BEDA 3VWWA 4XS4B 4Q5NA 1OC8A 2H6XA 3M3MA 4OCEA 4MH2A 3FEUA 2O8VB 1YEXA 2V2GA 3L9UA 3UL3A 5HR1A 4MF7A 2H8LA 2AHEA 4ZL7A 3P2AA 3VK9A 1EEMA 4YQVA 2GQLA 5GAPD 2LNTA 4KNDA 4WXTA 1PL1A 5ECMB 1K3YA 1Z3EA 2QGVA 2C3QA 1GSDA 2WB9A 3GMFA 2GSSA 11GSA 4OWYA 2IMKA 3NIVA 4MPGA 2QKEA 1B9XC 4DSRA 5ECQB 3QFBC 1VF4A 5HFIA 4FYUA 2PVOC 3QPMA 1DE1A 4ISDA 2I9HA 4PUAA 4EE0A 2NBSA 3ZIJA 1GUHA 1SK0A 5DQYA 1Z6MA 3L0HA 1O7UA 3HHVA 2LNSA 2VD1A 2IIYA 1K0NA 1LBKA 4GSSA 2H75A 1OE8A 1Z6NA 2FWGA 4PNGA 5AIXA 2LJRA 2HZEA 2L6DA 6GSUA 1PGTA 2B1LA 4ZIJA 1V2AA 1E2YA 16GSA 4MA9A 1BAYA 2ZNMA 4YQMA 1SKWB 4GQCA 5C04A 3ZVJD 2YCDA 4L5OA 2O85A 5H5SA 4BWSA 2P5RA 1MD3A 4IJIA 3GX8A 2VOCA 1XFLA 2YANA 1Q98A 3I9V2 1O8WA 4GF0A 4KE3A 2C80A 2ON5A 2LEGA 2DMLA 2LRTA 4TXVA 3TKSC 3M1GA 1TI1A 1J9BA 3KH7A 4ULXA 3ME7A 3EMXA 4O7HA 5G31A 4TN8A 3C8EA 4XIHA 3R2QA 1X5EA 4IP1A 1PX7A 2VAFA 4G19A 3KCMA 3WYWA 4NV2A 1ML6A 5D8IA 1GRXA 2F9SA 2EIRA 1PQNA 2IFQA 1W89A 1R26A 14GSA 2IMIA 4KB3A 5J5NA 3MDKA 3EWLA 1M9BA 4I2TA 4WBJA 5LNKe 4QQ7A 1Z7RA 3P90A 3ERGA 1EGRA 1GUKA 1X9WB 4PQIA 4CHSA 1GP1A 1OC9A 3VLNA 1KTEA 3HXSA 5KN3A 2VUPA 3VPTA 2C0GA 2HZFA 2C4JA 2RUFA 2OADA 1GNEA 6GSTA 2CVBA 1QK8A 3QAVA 4TOPA 1MDJA 1R7HA 1JZRA 3DRNA 4ZB8A 3ZLPA 1ZOFA 2XPDA 3PR8A 2N5AA 3KIJA 12GSA 1X5CA 1JFUA 1GTUA 5IMDA 1URMA 2H6ZA 2WCIA 2QC7A 3LSZA 2AB6A 1GLPA 1OYJA 3HJPA 4G9HA 5ID2A 5CNWA 4ZXGA 2TIRA 1B9YC 5IIZA 4RQXA 2YNXA 3UAPA 2X8CA 2H6YA 5AGYA 4BA7A 5L71A 5HR0A 1M99A 1TK0B 2K6VA 1THXA 1AQXA 2JADA 3CTGA 2GS3A 1TJDA 2REMA 4PXOA 3GTUA 3IAS2 4HQZA 2OACA 3LXZA 3H1NA 4XHMA 2V41A 5H5RA 5B8AA 3KH9A 2H1AA 3IPZA 3F0IA 3QR6A 2DJ3A 4WKWA 3CTFA 1ST9A 2FWHA 2F51A 3BBYA 5B6NA 4AJ8A 4K0GA 2IJYA 4K8MA 3TCOA 3EYTA 4EF0A 1J0FA 4IHUA 2YJ7A 2ZUPA 3WT2A 2DIYA 3P7XA 3D22A 4IQAA 3TJKA 1K0OA 3ZVJA 2L5LA 3Q18A 4TR1B 5A4VA 5D9XA 3G9BA 2GTUA 1M2AA 18GSA 3UVTA 1YEPA 3C73A 4N11A 1QGVA 3VFIA 3IA1A 4F0CA 4TXOA 3TKPA 5J41A 5IOXA 1VF2A 2NDOA 3FHKA 2DJ0A 4HDEA 3HKRA 6GSSA 4CW9A 3UMAA 3KJYA 3KMNA 3QAWA 3H79A 2B7KA 3FKFA 4DSSB 1XW9A 5ECIB 3F8UA 4POMA 1CQHA 3L4NA 3HZ4A 1K0AA 5AIVA 2HRNA 1V57A 5ECPB 1WIKA 4G2EA 4AJ6A 3GSSA 4P3YB 1XWKA 3KD0A 3D4MA 5G1LA 2CT6A 3LQ7A 4RQRA 1AXDA 3C1SA 5ELAA 1XIYA 2PERA 4EXJA 3S9FA 3QDNA 2E0QA 1SK2A 4GWRA 2GSTA 1G7EA 4HZ2A 3HCZA 1XCCA 3AY8A
chains in the Genus database with same CATH superfamily
3ZRDA 4EDZA 3VWUA 2KOKA 5J9BA 2TRXA 3R3EA 3RDWA 2PU9C 5IM9A 4HOJA 3CRUA 1AAZA 3KMOA 1AQWA 2EIQA 2HRKA 1V58A 3BCIA 2VM2A 2VCQA 4KH7A 3UARA 3GUSA 2K8VA 5F05A 1ABAA 4BVYB 4EVMA 2C1YA 5EPFA 2V6KA 3MAKA 4IS0A 4IN0A 1GSQA 4K7OA 1O85A 2R2JA 5IO0A 2E2MA 3RAZA 3D4TA 2HSMA 2FGXA 2OA7A 4POKA 2GT5A 5DQSA 9GSSA 2R0PA 3GHAA 1H4OA 1S3DA 5G30A 3ERFA 4E8HA 2WFCA 2PWJA 3HVXA 4LL4B 2L4CA 2R3XA 2ZCTA 1B4QA 1HNAA 2H76A 1SK1A 1EP8A 2X8GA 1PKWA 1ZYEA 3F63A 3IR4A 4WETA 2VLUA 2LJKA 2YZUA 3I6AA 3A2WA 5J9CA 1YY7A 4ZBBA 2YOIA 3H93A 5CRWA 3EMPA 4YKGA 3ED3A 3VI7A 2X49A 2FWEA 3TOTA 5F07A 5DALA 2HE3A 1T4ZA 4MNNA 3UBKA 3DWVA 1FVKA 2VL3A 3KTLA 3D6IA 3WGXA 1U87A 3TJFA 3KP9A 4ML1A 1BG5A 3E3EA 2X64A 3E0UA 1YJ6A 2L59A 2DBCA 1K3OA 4BVXA 4EIPA 3ZTLA 4AF2A 3SBCA 3JCML 5DAKB 1AUCA 4GRFA 1B8XA 4WBRD 3C7MA 1X9SB 1VF1A 5B8BA 4YQUA 2GZPA 4BL7A 4MABA 4MPFA 2VLVA 1TK5B 3RBTA 5IMCA 4KSMA 2XHFA 3Q6OA 4QL7A 3U6VA 5J4UA 2PUKC 3UEMA 1F3BA 5GSTA 4BWQA 2CZ2A 5HR2A 3VWVA 3G7JA 4PNFA 5KN1A 3GRXA 1A23A 1I5GA 3MIXA 5DJMA 1A8LA 1K3LA 2AV4A 3F4RA 5KN0A 1GTBA 3F4SA 4Q5FA 2YV9A 4YAVA 1XZOA 4Q5QA 3IDVA 4KAEA 1ZL9A 2O87A 5C00A 1XW6A 4GSNA 2DJKA 5EY6A 4EO3A 3M9JA 3GNJA 4LMVA 2GQMA 1TOFA 2LRCA 2VCVA 3ZL5A 3EINA 1HD2A 3TKQA 4IW9A 4IKHA 3OR5A 2ALBA 2GVPA 3TKSA 5HFGA 5D9WA 1TXXA 1XVWA 1ACVA 1F9MA 2P31A 1M3IA 1XVQA 2XC2A 2HSYA 5IQYA 2B7JA 2GT6A 2AJQB 1U6TA 1NHYA 4HJ2A 2JSYA 2CVDA 4GSTA 1SD9A 4HZ4A 5FT3A 2MYGA 4AGSA 1SL0B 1SL1B 3I43A 1GUMA 3DMLA 3IRAA 2CX4A 1TRUA 1YF1A 3C1RA 1T8EB 3A5IA 3DKSA 1C72A 1ZYQB 5CRGA 4X1UA 3IK7A 1GL8A 3HD5A 1XWAA 1PA3A 1QXHA 4GXZA 1Z5YE 3SWLA 3TRPA 3K8NA 2FA4A 2R0CA 4PQHA 4ECBA 2B5XA 5IOWA 4J2FA 4EDYA 2HI7A 4JEDA 2IMFA 2GGTA 1Q4JA 2VM1A 5IMFA 4WF4A 3HY2A 4OFTA 5ECHB 2VCWA 1JZOA 2CX3A 3D0ZA 3HDCA 2GSRA 4MMMA 2N5FA 1SD8A 3WT1A 4EL1A 3IXRA 1SYXA 4HSCX 4MDCA 3FZAA 3GSTA 3J7Yb 4NHZA 4JU5A 1T00A 3W8JA 3M9KA 3FZ4A 4DVCA 3QOUA 1PRXA 2V6OA 1XWCA 4ZILA 5CREA 1OC3A 17GSA 4D73A 3GURA 1BJXA 1PN0A 3QD9A 4YAPA 1O81A 3VI5A 2ON7A 2VL9A 5DCHA 20GSA 1M2BA 1O8XA 2MMZA 3BCKA 4L0UA 4KX4A 1PSQA 1EOGA 3EU4A 4FQUA 1TRVA 2YWMA 1EV9A 4KA0A 2UZ8A 3UIWA 4I5QA 2AYTA 4J57E 5KN2A 3F9UA 4CDOA 1SU9A 5ECNB 1SL2B 2DJ2A 1XXUA 2JACA 2H1DA 3WD6A 1BQ7A 1NW2A 5KEJA 2CAQA 5A4WA 1U3IA 4NWYA 2AAWA 5D9TA 1XPVA 1G6WA 2MMNA 1TW9A 4EUYA 3CRTA 1KNGA 5IPHA 3Q19A 4K6XA 3TRXA 3L9VA 1GSYA 1TDIA 5KOXA 3GL3A 4GCIA 4TR0A 2IMEA 4RUVA 4MP4A 1NHOA 3VPQA 2EIOA 3A5WA 4K5RA 3CXGA 1A0FA 4MLYA 4IBPA 1TRSA 4MJBA 4KDYA 4IJ3A 1XW5A 1ZCPA 2NPBA 5GZZB 4DEJA 2H30A 4NXIA 2JSZA 3IOSA 2LQQA 2V1MA 2DJ1A 2I3YA 3F6DA 2PGTA 4MF6A 8GSSA 4XS6A 4BIKA 1AC1A 4FYCA 1O6JA 5B7CA 2HZEB 5BRTA 3HZ8A 1A24A 2J23A 1BX9A 3LJRA 2J9HA 5D73A 3LG6A 4IELA 1DSBA 2IMDA 1GTIA 3LEFA 2YWNA 4PX1A 2MBSA 2IN3A 4G0KA 5GAND 3C71A 3IE3A 3FMWA 2YZHA 2V32A 1F6MC 4K7IA 3ERWA 2VL2C 4XS4A 4KW6A 1AIUA 1M9AA 2QSIA 3H4KA 2H19A 1MEKA 1U88A 2RUEA 2GZZA 3IHQA 1TKDB 2NTOA 5H5QA 1SKRB 2HYXA 3HYPA 1DBYA 1FB6A 3MSZA 1G0TA 1HQOA 3KTBA 4DSQA 3TJBA 3TDGA 3GX0A 2CQ9A 2H66A 4E8EA 4O32A 4TRXA 3DGQA 2DJJA 3DYRA 1Y6EA 4F2IA 1MDKA 1R5PA 2KP2A 2CAIA 1JLWA 1QFNA 5IMAA 1EZKA 22GSA 3U5RE 1Y25A 2MZCA 5FHIA 3ZIVA 2IFQB 2FHEA 1IYIA 4TKYA 4YKFA 5CO3A 2TRCP 4KDXA 1R5AA 3EC3A 5IPGA 5B6MA 4LMWA 1G7OA 4F82A 1N8JA 3TJJA 4I2UA 4OMVA 2R37A 3GH9A 2F8AA 3KXOA 1OC9B 1THOA 1BYEA 2L4QA 3E9JB 3GIXA 1WPIA 2CZ3A 2PVQA 3QMXA 4NHWA 1A0RP 2B5EA 1FHEA 5ECRB 4GTUA 2DMMA 1Z7PA 3I69A 1YKCA 3PH9A 1TU8A 4FO5A 2H72A 2DKHA 5EL8A 4GQFA 3KZQA 2FLSA 1GSEA 2XPEA 5ECOB 4Z2UA 2H0IA 2BMXA 3TKRA 1J08A 4XTSA 4POBA 1XBSA 4LLRA 4ECCA 2HT9A 5ID2B 4NPBA 3TKSE 1HYUA 2CVKA 2G0FA 1G6YA 4WR5A 1ON4A 4WEYA 3FW2A 1RW1A 4OO4A 5JWRB 3G7YA 4IP6A 2JZSA 2OE0A 4PUFC 3MNGA 1ILOA 2Z9SA 2F8FA 1FB0A 2I81A 3RHBA 1ZYPA 2E2GA 2RIIA 4MK3A 4G10A 1T3BA 4N10A 5E4WA 5D9VA 3GTUB 4NMUA 2KLXA 2AUVA 4NAXA 3ZZXA 4F0BA 1TU7A 3UBLA 2X8HA 3FR6A 4FYBA 4FH8A 3P8WA 1EGOA 4Q5RA 1XOAA 2JU5A 3TOUA 2F3MA 5ECSA 3FZ5A 2FD3A 2WULA 1EWXA 2KUCA 2LSTA 2PMTA 4Z7XA 2B5YA 1LU4A 5CYYA 4HUAA 1GSSA 2HNLA 2PBJA 3DD3A 4G0IA 4ECIA 3V1WA 2FA8A 2YN1A 2P5QA 4A5PA 4NV5A 2FY6A 3RPNA 3APSA 1GSUA 2M46A 5G5EA 1GULA 1WWJA 1H75A 2R5GA 4OCFA 4MZBA 3F3QA 4ZBDA 1T4YA 3KP8A 3LFLA 5CRDA 2C0DA 1NM3A 4O92A 4TXOB 2RM5A 3HJMA 3EURA 2R0GA 1X9MB 4HI7A 3ZMLA 1ZZYA 2WZ9A 3QAGA 2WDUA 3UVHA 2OE3A 1QQ2A 1V9WA 1WOUA 2HXKA 3QFAC 4YH2A 2VLTA 5IMZA 1JZDA 4PTSA 3LYKA 2GDRA 1ERWA 3ZFBA 5D93A 2A4VA 1B4PA 4EC0A 3D5JA 6GSXA 4TW5A 2DSAA 3LXTA 2HLSA 4ZL8A 3GKNA 5CRHA 2JL4A 3KM6A 4L0WA 2FUG2 1X5DA 4ICYA 4K9ZA 4ZBAA 3HVVA 2H1BA 1TI3A 4K0NA 3GH6A 4HU9A 4JRRA 4TVEA 2OKAA 2QA1A 2OJLA 4MJCA 3US3A 1TK8B 2D2ZA 4EKZA 1FAAA 5HFKA 3ZYWA 2FNOA 1WP0A 4I8BA 1A8YA 4JR4A 4ZL9A 5JCUA 1JHBA 4TR4A 5INYA 1OKDA 1HNBA 2FCHA 1TRWA 1V40A 2VCTA 5GSSA 4K2DA 2YWIA 4MCUA 3HVSA 5COHA 3PINA 4X4JA 4X43A 4GLTA 3FYGA 4TR1A 1M7TA 3HVNA 5DBQA 4X0XA 1SKSB 1A2LA 1MDIA 1SJZA 2HFDA 4HU7A 1FVJA 3NZNA 4Z2TA 1YF0A 1OVNA 3W8SA 3J7Yk 3UJ1A 3CSHA 2R4VA 1FO5A 4KCAA 5G2ZA 13GSA 4JR6A 2GQKA 3VWXA 4KGIA 3N5OA 1VF3A 2C3NA 4DSSA 2DKIA 1NSWA 1SENA 4V2NA 4MJEA 4WR4A 1KBNA 2N5BA 4KF9A 2L6CA 5BMUA 1AQVA 2LV3A 3TGZA 2H01A 2XBQA 1XWBA 1OKTA 2A2RA 4V2LA 1M2DA 3H8QA 1UC7A 2CA8A 3CBUA 4ACSA 4MZCA 2L57A 5ABRA 1SYRA 5JCWA 1YKAA 3FK8A 1R4WA 4H86A 1AW9A 3WGDA 4OD7A 4LL1B 2I1UA 3M8NA 5CAXA 5DALB 3GKKA 5A4UA 3UOMA 2H1GA 4POLA 3PGTA 2LUSA 3DVXA 4F03A 2YWOA 1B48A 4XCSA 4PQ1A 4CY8A 4OFNA 4BVXB 1VGLA 1A2JA 4HS1A 1ZYNA 3F6FA 3IV4A 2A2SA 2XBIA 4O5RA 2I4AA 5ENUA 5DJLA 1ERVA 5EVOA 3LGCA 4BVYA 4BL7B 3ZMKA 5A5KA 1MTCA 2VCZA 1T1VA 4IQ1A 2M72A 3LWAA 1EOHA 3DEXA 5F06A 2K9FA 3RHCA 3BD2A 3ZITA 1I9DA 4ILFA 3GYKA 1K0DA 3M0FA 5AN1A 3QCPA 4AJ7A 3RPPA 2K18A 5G1KA 2OBIA 5CP1A 1GLQA 5DDLA 1LJRA 4ML6A 4XRDA 5LD0A 1UA5A 2O7KA 2PPTA 2WS2A 3N9JA 1XWGA 4MZWA 3GA4A 1F3AA 1UN2A 5DVBA 4F9ZA 2WGRA 2VL2A 4N30A 1DUGA 3GKMA 3L9SA 1X0RA 3CMIA 1PD21 1GH2A 1VRSD 2VCXA 4MJAA 4XS1A 1WJKA 3GV1A 1IYHA 2WJUA 1FOVA 5JWQB 4V1Ag 4JE1A 1RK4A 3DIEA 2OE1A 2MBTA 2VO4A 2GSQA 4PGTA 4MF5A 2C0EA 3ISOA 4TR3A 4ID0A 6GSYA 4BPYA 1F37A 3FR3A 2C0FA 1JLVA 4RI7A 3HJOA 3NOFA 1HNCA 4HQSA 3CYNA 1PN9A 3APQA 3APOA 1GSFA 3WGEA 2ES7A 4V1Ap 3LYPA 1S3AA 5DAKA 4MH3A 3FZ9A 2CV4A 19GSA 2HRAA 3EE2A 5FWGA 5IO2A 4N0VA 3FRCA 4ECJA 5IMVA 4K1FA 4ZB9A 2H0HA 1WMJA 3Q74A 4LA1A 1M0UA 3A3TA 1M3JA 3GFKA 2B1KA 2R6KA 1JZWA 4KUNA 1K0BA 4HJMA 2PN8A 2YPMA 1E6BA 5JCGA 1EP7A 3FR9A 5ECKB 2QA2A 1KEBA 3A2XA 3O76A 4G0LA 4KSOA 2HSHA 2IWTA 3TB2A 4RI6A 1ERTA 4ZB6A 2YP6A 5G5FA 1RQMA 3KGKA 1TTZA 2DC5A 4I97A 1YDKA 2H71A 3EVIA 2GZYA 2JZTA 4JZQA 2H74A 3TRQA 2LRNA 1YQ1A 2C8UA 3IAM2 3CSJA 5KOWA 6GSWA 4QL9A 2BTOT 2RM6A 4D73B 2LJAA 1SJ6A 3LORA 1GWCA 3BOAA 3EU3A 10GSA 2VD0A 4KCEA 1V98A 1U3AA 5HQPA 2MMOA 1TP9A 4N0ZA 1USBA 1DE2A 3GKXA 1W4VA 2FWFA 3CQFA 2WRTA 3IC4A 2X99A 1GTAA 4KDUA 2H70A 3PPUA 5J3RA 1OE7A 5DCGA 4OO5A 3BJ5A 4HEA2 1XOBA 2DLXA 2YJHA 2VIMA 7GSSA 3A2VA 2O89A 2LKUA 2H0GA 1FW1A 2JZRA 3W6GA 2H73A 1UVZA 1PX6A 3DXBA 1ZGNA 3LW9A 2LS5A 2IPAA 3F3RA 3TJGA 1EEJA 4V2MA 3ZREA 2L5OA 3IHGA 1SJIA 5JWOB 5ECLB 1PKZA 1T7PB 3IC8A 4I6XA 1PL2A 5F8BA 4JBBA 2EC4A 4OFMA 5ELGA 2LQOA 5LCZA 1YZXA 2GLRA 2B6MA 3CSIA 3F4TA 3O3TA 3DVWA 4IGJA 4FIWA 1F2EA 2M80A 1ERUA 2OBKA 5F0GA 1WE0A 3ME8A 3FY7A 3TUEA 3KEBA 5E59A 3D21A 2LTKA 3O6TA 2C3TA 2P0GA 1QUWA 3GL5A 4PURA 2E7PA 4IVFA 1PMTA 2X4AA 3L78A 3G7IA 2K8SA 3HA9A 1OAZA 3IBHA 3IK9A 4L8EA 2MMAA 5HR3A 2NVLA 1FG4A 2KP1A 2BJXA 3ZFLA 2B3SA 1N2AA 6GSVA 2KHPA 1K0MA 1ZMAA 1EV4A 4J56E 5AISA 1GNWA 1S3CA 2YV7A 3VURA 1MD4A 4K5SA 2IL3A 1Z9HA 1QMVA 1K0CA 5D96A 3MWHA 4K7NA 4XRAA 1A2MA 2DIZA 1O73A 2G2QA 2RLIA 1WRYA 4WF5A 2HRFA 4L5LA 1CQGA 3GN3A 1BEDA 3VWWA 4XS4B 4Q5NA 1OC8A 2H6XA 3M3MA 4OCEA 4MH2A 3FEUA 2O8VB 1YEXA 2V2GA 1S3RA 3L9UA 3UL3A 5HR1A 4MF7A 2H8LA 2AHEA 2A2PA 4ZL7A 3P2AA 3VK9A 1EEMA 4YQVA 2GQLA 5GAPD 2LNTA 4KNDA 4WXTA 1PL1A 5ECMB 1K3YA 1Z3EA 2QGVA 2C3QA 1GSDA 4O5QA 2WB9A 3GMFA 2GSSA 11GSA 4OWYA 2IMKA 3NIVA 4MPGA 2QKEA 1B9XC 4DSRA 5ECQB 3QFBC 1VF4A 5HFIA 4FYUA 2PVOC 3QPMA 1PFOA 1DE1A 4ISDA 2I9HA 4PUAA 4EE0A 2NBSA 3ZIJA 1GUHA 1SK0A 5DQYA 1Z6MA 3L0HA 1O7UA 3HHVA 2LNSA 2VD1A 2IIYA 1K0NA 1LBKA 4GSSA 2H75A 1OE8A 1Z6NA 2FWGA 4PNGA 2LJRA 5AIXA 2HZEA 2L6DA 6GSUA 1PGTA 2B1LA 4ZIJA 1V2AA 1E2YA 16GSA 4MA9A 1BAYA 2ZNMA 4Z2RA 4YQMA 1SKWB 4GQCA 5C04A 3ZVJD 2YCDA 4L5OA 2O85A 5H5SA 4BWSA 2P5RA 1MD3A 4IJIA 3GX8A 2VOCA 1XG8A 1XFLA 2YANA 1Q98A 3I9V2 1O8WA 4GF0A 4KE3A 2C80A 2ON5A 2LEGA 2DMLA 2LRTA 4TXVA 3TKSC 3M1GA 1TI1A 1J9BA 3KH7A 4ULXA 3ME7A 3EMXA 4O7HA 1FOHA 5G31A 4TN8A 3C8EA 4XIHA 3R2QA 1X5EA 4IP1A 1PX7A 2VAFA 4G19A 3KCMA 3WYWA 4NV2A 1ML6A 5D8IA 1GRXA 2F9SA 2EIRA 1PQNA 2IFQA 1W89A 1R26A 14GSA 2IMIA 4KB3A 5J5NA 3MDKA 3EWLA 1M9BA 4I2TA 4WBJA 5LNKe 4QQ7A 1Z7RA 3P90A 3ERGA 1EGRA 1GUKA 1X9WB 4PQIA 3EPTA 4CHSA 1GP1A 1OC9A 3VLNA 1KTEA 3HXSA 5KN3A 2VUPA 3VPTA 2C0GA 2HZFA 2C4JA 2RUFA 2OADA 1GNEA 6GSTA 2CVBA 1QK8A 3QAVA 4TOPA 1MDJA 1R7HA 1JZRA 3MYDA 3DRNA 4ZB8A 3ZLPA 1ZOFA 2XPDA 3PR8A 2N5AA 3KIJA 12GSA 1X5CA 1JFUA 1GTUA 5IMDA 1URMA 2H6ZA 2WCIA 2QC7A 3LSZA 2AB6A 1GLPA 1OYJA 3HJPA 4G9HA 5ID2A 4O5UA 5CNWA 4ZXGA 2TIRA 1B9YC 5IIZA 4RQXA 2YNXA 3UAPA 2X8CA 2H6YA 5AGYA 4BA7A 5L71A 5HR0A 1M99A 1TK0B 2K6VA 1THXA 1AQXA 2JADA 3CTGA 2GS3A 1TJDA 2REMA 4EIQA 4PXOA 3GTUA 3IAS2 4HQZA 2OACA 3LXZA 3H1NA 4XHMA 2V41A 5H5RA 5B8AA 3KH9A 2H1AA 3IPZA 3F0IA 3QR6A 2DJ3A 4WKWA 3CTFA 1ST9A 2FWHA 2F51A 3BBYA 5B6NA 4AJ8A 4K0GA 2IJYA 4K8MA 3TCOA 3EYTA 4EF0A 1J0FA 4IHUA 2YJ7A 2ZUPA 3WT2A 2DIYA 3P7XA 3D22A 4IQAA 3TJKA 1K0OA 3ZVJA 2L5LA 3Q18A 4TR1B 5A4VA 5D9XA 3G9BA 2GTUA 1M2AA 18GSA 3UVTA 1YEPA 3C73A 4N11A 1QGVA 3VFIA 3IA1A 4F0CA 4TXOA 3TKPA 5J41A 5IOXA 1VF2A 2NDOA 3FHKA 2DJ0A 4HDEA 3HKRA 6GSSA 4CW9A 3UMAA 3KJYA 3KMNA 3QAWA 3H79A 2B7KA 3FKFA 4DSSB 1XW9A 5ECIB 3F8UA 4POMA 1CQHA 3L4NA 3HZ4A 1K0AA 2A4HA 5AIVA 2HRNA 1V57A 5ECPB 1WIKA 4G2EA 4K2XA 4AJ6A 3GSSA 4P3YB 1XWKA 3KD0A 3D4MA 5G1LA 2CT6A 3LQ7A 4RQRA 4USSA 1AXDA 3C1SA 5ELAA 1XIYA 2PERA 4EXJA 3S9FA 3QDNA 2E0QA 1SK2A 4GWRA 2GSTA 1G7EA 4HZ2A 3HCZA 1XCCA 4CY6A 3AY8A
chains in the Genus database with same CATH topology
3ZRDA 4EDZA 3VWUA 2KOKA 5J9BA 2TRXA 3R3EA 3RDWA 2PU9C 5IM9A 4HOJA 3CRUA 1AAZA 3KMOA 1AQWA 2EIQA 2HRKA 1V58A 3BCIA 2VM2A 2VCQA 4KH7A 3UARA 3GUSA 2K8VA 5F05A 1ABAA 4BVYB 4EVMA 2C1YA 5EPFA 2V6KA 3MAKA 4IS0A 4IN0A 1GSQA 4K7OA 1O85A 2R2JA 5IO0A 2E2MA 3RAZA 3D4TA 2HSMA 2FGXA 2OA7A 4POKA 2GT5A 5DQSA 9GSSA 2R0PA 3GHAA 1H4OA 1S3DA 5G30A 3ERFA 4E8HA 2WFCA 2PWJA 3HVXA 4LL4B 2L4CA 2R3XA 2ZCTA 1B4QA 1HNAA 2H76A 1SK1A 1EP8A 2X8GA 1PKWA 1ZYEA 3F63A 3IR4A 4WETA 2VLUA 2LJKA 2YZUA 3I6AA 3A2WA 5J9CA 1YY7A 4ZBBA 2YOIA 3H93A 5CRWA 3EMPA 4YKGA 3ED3A 3VI7A 2X49A 2FWEA 3TOTA 5F07A 5DALA 2HE3A 1T4ZA 4MNNA 3UBKA 3DWVA 1FVKA 2VL3A 3KTLA 3D6IA 3WGXA 1U87A 3TJFA 3KP9A 4ML1A 1BG5A 3E3EA 2X64A 3E0UA 1YJ6A 2L59A 2DBCA 1K3OA 4BVXA 4EIPA 3ZTLA 4AF2A 3SBCA 3JCML 5DAKB 1AUCA 4GRFA 1B8XA 4WBRD 3C7MA 1X9SB 1VF1A 5B8BA 4YQUA 2GZPA 4BL7A 4MABA 4MPFA 2VLVA 1TK5B 3RBTA 5IMCA 4KSMA 2XHFA 3Q6OA 4QL7A 3U6VA 5J4UA 2PUKC 3UEMA 1F3BA 5GSTA 4BWQA 2CZ2A 5HR2A 3VWVA 3G7JA 4PNFA 5KN1A 3GRXA 1A23A 1I5GA 3MIXA 5DJMA 1A8LA 1K3LA 2AV4A 3F4RA 5KN0A 1GTBA 3F4SA 4Q5FA 2YV9A 4YAVA 1XZOA 4Q5QA 3IDVA 4KAEA 1ZL9A 2O87A 5C00A 1XW6A 4GSNA 2DJKA 5EY6A 4EO3A 3M9JA 3GNJA 4LMVA 2GQMA 1TOFA 2LRCA 2VCVA 3ZL5A 3EINA 1HD2A 3TKQA 4IW9A 4IKHA 3OR5A 2ALBA 2GVPA 3TKSA 5HFGA 5D9WA 1TXXA 1XVWA 1ACVA 1F9MA 2P31A 1XVQA 2XC2A 2HSYA 5IQYA 2B7JA 2GT6A 2AJQB 1U6TA 1NHYA 4HJ2A 2JSYA 2CVDA 4GSTA 1SD9A 4HZ4A 5FT3A 2MYGA 4AGSA 1SL0B 1SL1B 3I43A 1GUMA 3DMLA 3IRAA 2CX4A 1TRUA 1YF1A 3C1RA 1T8EB 3A5IA 3DKSA 1C72A 1ZYQB 5CRGA 4X1UA 3IK7A 1GL8A 3HD5A 1XWAA 1PA3A 1QXHA 4GXZA 1Z5YE 3SWLA 3TRPA 3K8NA 2FA4A 2R0CA 4PQHA 4ECBA 2B5XA 5IOWA 4J2FA 4EDYA 2HI7A 4JEDA 2IMFA 2GGTA 1Q4JA 2VM1A 5IMFA 4WF4A 3HY2A 4OFTA 5ECHB 2VCWA 1JZOA 2CX3A 3D0ZA 3HDCA 2GSRA 4MMMA 2N5FA 1SD8A 3WT1A 4EL1A 3IXRA 1SYXA 4MDCA 3FZAA 3GSTA 3J7Yb 4NHZA 4JU5A 1T00A 3W8JA 3M9KA 3FZ4A 4DVCA 3QOUA 1PRXA 2V6OA 1XWCA 4ZILA 5CREA 1OC3A 17GSA 4D73A 3GURA 1BJXA 1PN0A 3QD9A 4YAPA 1O81A 3VI5A 2ON7A 2VL9A 5DCHA 20GSA 1M2BA 1O8XA 2MMZA 3BCKA 4L0UA 4KX4A 1PSQA 1EOGA 3EU4A 4FQUA 1TRVA 2YWMA 1EV9A 4KA0A 2UZ8A 3UIWA 4I5QA 2AYTA 4J57E 5KN2A 3F9UA 4CDOA 1SU9A 5ECNB 1SL2B 2DJ2A 1XXUA 2JACA 2H1DA 3WD6A 1BQ7A 1NW2A 5KEJA 2CAQA 5A4WA 1U3IA 4NWYA 2AAWA 5D9TA 1XPVA 1G6WA 2MMNA 1TW9A 4EUYA 3CRTA 1KNGA 5IPHA 3Q19A 4K6XA 3TRXA 3L9VA 1GSYA 1TDIA 5KOXA 3GL3A 4GCIA 4TR0A 2IMEA 4RUVA 4MP4A 1NHOA 3VPQA 2EIOA 3A5WA 4K5RA 3CXGA 1A0FA 4MLYA 4IBPA 1TRSA 4MJBA 4KDYA 4IJ3A 1XW5A 1ZCPA 2NPBA 5GZZB 4DEJA 2H30A 4NXIA 2JSZA 3IOSA 2LQQA 2V1MA 2DJ1A 2I3YA 3F6DA 2PGTA 4MF6A 8GSSA 4XS6A 1AC1A 4FYCA 1O6JA 5B7CA 2HZEB 5BRTA 3HZ8A 1A24A 2J23A 1BX9A 3LJRA 2J9HA 5D73A 3LG6A 4IELA 1DSBA 2IMDA 1GTIA 3LEFA 2YWNA 4PX1A 2MBSA 2IN3A 4G0KA 5GAND 3C71A 3IE3A 3FMWA 2YZHA 2V32A 1F6MC 4K7IA 3ERWA 2VL2C 4XS4A 4KW6A 1AIUA 1M9AA 2QSIA 3H4KA 2H19A 1MEKA 1U88A 2RUEA 2GZZA 3IHQA 1TKDB 2NTOA 5H5QA 1SKRB 2HYXA 3HYPA 1DBYA 1FB6A 3MSZA 1G0TA 1HQOA 3KTBA 4DSQA 3TJBA 3TDGA 3GX0A 2CQ9A 2H66A 4E8EA 4O32A 4TRXA 3DGQA 2DJJA 3DYRA 1Y6EA 4F2IA 1MDKA 1R5PA 2KP2A 2CAIA 1JLWA 1QFNA 5IMAA 1EZKA 22GSA 3U5RE 1Y25A 2MZCA 5FHIA 3ZIVA 2IFQB 2FHEA 1IYIA 4TKYA 4YKFA 5CO3A 2TRCP 4KDXA 1R5AA 3EC3A 5IPGA 5B6MA 4LMWA 1G7OA 4F82A 1N8JA 3TJJA 4I2UA 4OMVA 2R37A 3GH9A 2F8AA 3KXOA 1OC9B 1THOA 1BYEA 2L4QA 3E9JB 3GIXA 1WPIA 2CZ3A 2PVQA 3QMXA 4NHWA 1A0RP 2B5EA 1FHEA 5ECRB 4GTUA 2DMMA 1Z7PA 3I69A 1YKCA 3PH9A 1TU8A 4FO5A 2H72A 2DKHA 5EL8A 4GQFA 3KZQA 2FLSA 1GSEA 2XPEA 5ECOB 4Z2UA 2H0IA 2BMXA 3TKRA 1J08A 4XTSA 4POBA 1XBSA 4LLRA 4ECCA 2HT9A 5ID2B 4NPBA 3TKSE 1HYUA 2CVKA 2G0FA 1G6YA 4WR5A 1ON4A 4WEYA 3FW2A 1RW1A 4OO4A 5JWRB 3G7YA 4IP6A 2JZSA 2OE0A 4PUFC 3MNGA 1ILOA 2Z9SA 2F8FA 1FB0A 2I81A 3RHBA 1ZYPA 2E2GA 2RIIA 4MK3A 4G10A 1T3BA 4N10A 5E4WA 5D9VA 3GTUB 4NMUA 2KLXA 2AUVA 4NAXA 3ZZXA 4F0BA 1TU7A 3UBLA 2X8HA 3FR6A 4FYBA 4FH8A 3P8WA 1EGOA 4Q5RA 1XOAA 2JU5A 3TOUA 2F3MA 5ECSA 3FZ5A 2FD3A 2WULA 1EWXA 2KUCA 2LSTA 2PMTA 4Z7XA 2B5YA 1LU4A 5CYYA 4HUAA 1GSSA 2HNLA 2PBJA 3DD3A 4G0IA 4ECIA 3V1WA 2FA8A 2YN1A 2P5QA 4A5PA 4NV5A 2FY6A 3RPNA 3APSA 1GSUA 2M46A 5G5EA 1GULA 1WWJA 1H75A 2R5GA 4OCFA 4MZBA 3F3QA 4ZBDA 1T4YA 3KP8A 3LFLA 5CRDA 2C0DA 1NM3A 4O92A 4TXOB 2RM5A 3HJMA 3EURA 2R0GA 1X9MB 4HI7A 3ZMLA 1ZZYA 2WZ9A 3QAGA 2WDUA 3UVHA 2OE3A 1QQ2A 1V9WA 1WOUA 2HXKA 3QFAC 4YH2A 2VLTA 5IMZA 1JZDA 4PTSA 3LYKA 2GDRA 1ERWA 3ZFBA 5D93A 2A4VA 1B4PA 4EC0A 3D5JA 6GSXA 4TW5A 2DSAA 3LXTA 2HLSA 4ZL8A 3GKNA 5CRHA 2JL4A 3KM6A 4L0WA 2FUG2 1X5DA 4ICYA 4K9ZA 4ZBAA 3HVVA 2H1BA 1TI3A 4K0NA 3GH6A 4HU9A 4JRRA 4TVEA 2OKAA 2QA1A 2OJLA 4MJCA 3US3A 1TK8B 2D2ZA 4EKZA 1FAAA 5HFKA 3ZYWA 2FNOA 1WP0A 4I8BA 1A8YA 4JR4A 4ZL9A 5JCUA 1JHBA 4TR4A 5INYA 1OKDA 1HNBA 2FCHA 1TRWA 1V40A 2VCTA 5GSSA 4K2DA 2YWIA 4MCUA 3HVSA 5COHA 3PINA 4X4JA 4X43A 4GLTA 3FYGA 4TR1A 1M7TA 5DBQA 4X0XA 1SKSB 1A2LA 1MDIA 1SJZA 2HFDA 4HU7A 1FVJA 3NZNA 4Z2TA 1YF0A 1OVNA 3W8SA 3J7Yk 3UJ1A 3CSHA 2R4VA 1FO5A 4KCAA 5G2ZA 13GSA 4JR6A 2GQKA 3VWXA 4KGIA 3N5OA 1VF3A 2C3NA 4DSSA 2DKIA 1NSWA 1SENA 4V2NA 4MJEA 4WR4A 1KBNA 2N5BA 4KF9A 2L6CA 5BMUA 1AQVA 2LV3A 3TGZA 2H01A 2XBQA 1XWBA 1OKTA 2A2RA 4V2LA 1M2DA 3H8QA 1UC7A 2CA8A 3CBUA 4ACSA 4MZCA 2L57A 5ABRA 1SYRA 5JCWA 1YKAA 3FK8A 1R4WA 4H86A 1AW9A 3WGDA 4OD7A 4LL1B 2I1UA 3M8NA 5CAXA 5DALB 3GKKA 5A4UA 3UOMA 2H1GA 4POLA 3PGTA 2LUSA 3DVXA 4F03A 2YWOA 1B48A 4XCSA 4PQ1A 4CY8A 4OFNA 4BVXB 1VGLA 1A2JA 4HS1A 1ZYNA 3F6FA 3IV4A 2A2SA 2XBIA 4O5RA 2I4AA 5ENUA 5DJLA 1ERVA 5EVOA 3LGCA 4BVYA 4BL7B 3ZMKA 5A5KA 1MTCA 2VCZA 1T1VA 4IQ1A 2M72A 3LWAA 1EOHA 3DEXA 5F06A 2K9FA 3RHCA 3BD2A 3ZITA 1I9DA 4ILFA 3GYKA 1K0DA 3M0FA 5AN1A 3QCPA 4AJ7A 3RPPA 2K18A 5G1KA 2OBIA 5CP1A 1GLQA 5DDLA 1LJRA 4ML6A 4XRDA 5LD0A 1UA5A 2O7KA 2PPTA 2WS2A 3N9JA 1XWGA 4MZWA 3GA4A 1F3AA 1UN2A 5DVBA 4F9ZA 2WGRA 2VL2A 4N30A 1DUGA 3GKMA 3L9SA 1X0RA 3CMIA 1PD21 1GH2A 1VRSD 2VCXA 4MJAA 4XS1A 1WJKA 3GV1A 1IYHA 2WJUA 1FOVA 5JWQB 4V1Ag 4JE1A 1RK4A 3DIEA 2OE1A 2MBTA 2VO4A 2GSQA 4PGTA 4MF5A 2C0EA 3ISOA 4TR3A 4ID0A 6GSYA 4BPYA 1F37A 3FR3A 2C0FA 1JLVA 4RI7A 3HJOA 3NOFA 1HNCA 4HQSA 3CYNA 1PN9A 3APQA 3APOA 1GSFA 3WGEA 2ES7A 4V1Ap 3LYPA 1S3AA 5DAKA 4MH3A 3FZ9A 2CV4A 19GSA 2HRAA 3EE2A 5FWGA 5IO2A 4N0VA 3FRCA 4ECJA 5IMVA 4K1FA 4ZB9A 2H0HA 1WMJA 3Q74A 4LA1A 1M0UA 3A3TA 3GFKA 2B1KA 2R6KA 1JZWA 4KUNA 1K0BA 4HJMA 2PN8A 2YPMA 1E6BA 5JCGA 1EP7A 3FR9A 5ECKB 2QA2A 1KEBA 3A2XA 3O76A 4G0LA 4KSOA 2HSHA 2IWTA 3TB2A 4RI6A 1ERTA 4ZB6A 2YP6A 5G5FA 1RQMA 3KGKA 1TTZA 2DC5A 4I97A 1YDKA 2H71A 3EVIA 2GZYA 2JZTA 4JZQA 2H74A 3TRQA 2LRNA 1YQ1A 2C8UA 3IAM2 3CSJA 5KOWA 6GSWA 4QL9A 2BTOT 2RM6A 4D73B 2LJAA 1SJ6A 3LORA 1GWCA 3BOAA 3EU3A 10GSA 2VD0A 4KCEA 1V98A 1U3AA 5HQPA 2MMOA 1TP9A 4N0ZA 1USBA 1DE2A 3GKXA 1W4VA 2FWFA 2WRTA 3IC4A 2X99A 1GTAA 4KDUA 2H70A 3PPUA 5J3RA 1OE7A 5DCGA 4OO5A 3BJ5A 4HEA2 1XOBA 2DLXA 2YJHA 2VIMA 7GSSA 3A2VA 2O89A 2LKUA 2H0GA 1FW1A 2JZRA 3W6GA 2H73A 1UVZA 1PX6A 3DXBA 1ZGNA 3LW9A 2LS5A 2IPAA 3F3RA 3TJGA 1EEJA 4V2MA 3ZREA 2L5OA 3IHGA 1SJIA 5JWOB 5ECLB 1PKZA 1T7PB 3IC8A 4I6XA 1PL2A 5F8BA 4JBBA 2EC4A 4OFMA 5ELGA 2LQOA 5LCZA 1YZXA 2GLRA 2B6MA 3CSIA 3F4TA 3O3TA 3DVWA 4IGJA 4FIWA 1F2EA 2M80A 1ERUA 2OBKA 5F0GA 1WE0A 3ME8A 3FY7A 3TUEA 3KEBA 5E59A 3D21A 2LTKA 3O6TA 2C3TA 2P0GA 1QUWA 3GL5A 4PURA 2E7PA 4IVFA 1PMTA 2X4AA 3L78A 3G7IA 2K8SA 3HA9A 1OAZA 3IBHA 3IK9A 4L8EA 2MMAA 5HR3A 2NVLA 1FG4A 2KP1A 2BJXA 3ZFLA 2B3SA 1N2AA 6GSVA 2KHPA 1K0MA 1ZMAA 1EV4A 5AISA 4J56E 1GNWA 1S3CA 2YV7A 3VURA 1MD4A 4K5SA 2IL3A 1Z9HA 1QMVA 1K0CA 5D96A 3MWHA 4K7NA 4XRAA 1A2MA 2DIZA 1O73A 2G2QA 2RLIA 1WRYA 4WF5A 2HRFA 4L5LA 1CQGA 3GN3A 1BEDA 3VWWA 4XS4B 4Q5NA 1OC8A 2H6XA 3M3MA 4OCEA 4MH2A 3FEUA 2O8VB 1YEXA 2V2GA 3L9UA 3UL3A 5HR1A 4MF7A 2H8LA 2AHEA 2A2PA 4ZL7A 3P2AA 3VK9A 1EEMA 4YQVA 2GQLA 5GAPD 2LNTA 4KNDA 4WXTA 1PL1A 5ECMB 1K3YA 1Z3EA 2QGVA 2C3QA 1GSDA 4O5QA 2WB9A 3GMFA 2GSSA 11GSA 4OWYA 2IMKA 3NIVA 4MPGA 2QKEA 1B9XC 4DSRA 5ECQB 3QFBC 1VF4A 5HFIA 4FYUA 2PVOC 3QPMA 1DE1A 4ISDA 2I9HA 4PUAA 4EE0A 2NBSA 3ZIJA 1GUHA 1SK0A 5DQYA 1Z6MA 3L0HA 1O7UA 3HHVA 2LNSA 2VD1A 2IIYA 1K0NA 1LBKA 4GSSA 2H75A 1OE8A 1Z6NA 2FWGA 4PNGA 5AIXA 2LJRA 2HZEA 2L6DA 6GSUA 1PGTA 2B1LA 4ZIJA 1V2AA 1E2YA 16GSA 4MA9A 1BAYA 2ZNMA 4Z2RA 4YQMA 1SKWB 4GQCA 5C04A 3ZVJD 2YCDA 4L5OA 2O85A 5H5SA 4BWSA 2P5RA 1MD3A 4IJIA 3GX8A 2VOCA 1XFLA 2YANA 1Q98A 3I9V2 1O8WA 4GF0A 4KE3A 2C80A 2ON5A 2LEGA 2DMLA 2LRTA 4TXVA 3TKSC 3M1GA 1TI1A 1J9BA 3KH7A 4ULXA 3ME7A 3EMXA 4O7HA 1FOHA 5G31A 4TN8A 3C8EA 4XIHA 3R2QA 1X5EA 4IP1A 1PX7A 2VAFA 4G19A 3KCMA 3WYWA 4NV2A 1ML6A 5D8IA 1GRXA 2F9SA 2EIRA 1PQNA 2IFQA 1W89A 1R26A 14GSA 2IMIA 4KB3A 5J5NA 3MDKA 3EWLA 1M9BA 4I2TA 4WBJA 5LNKe 4QQ7A 1Z7RA 3P90A 3ERGA 1EGRA 1GUKA 1X9WB 4PQIA 3EPTA 4CHSA 1GP1A 1OC9A 3VLNA 1KTEA 3HXSA 5KN3A 2VUPA 3VPTA 2C0GA 2HZFA 2C4JA 2RUFA 2OADA 1GNEA 6GSTA 2CVBA 1QK8A 3QAVA 4TOPA 1MDJA 1R7HA 1JZRA 3MYDA 3DRNA 4ZB8A 3ZLPA 1ZOFA 2XPDA 3PR8A 2N5AA 3KIJA 12GSA 1X5CA 1JFUA 1GTUA 5IMDA 1URMA 2H6ZA 2WCIA 2QC7A 3LSZA 2AB6A 1GLPA 1OYJA 3HJPA 4G9HA 5ID2A 4O5UA 5CNWA 4ZXGA 2TIRA 1B9YC 5IIZA 4RQXA 2YNXA 3UAPA 2X8CA 2H6YA 5AGYA 4BA7A 5L71A 5HR0A 1M99A 1TK0B 2K6VA 1THXA 1AQXA 2JADA 3CTGA 2GS3A 1TJDA 2REMA 4EIQA 4PXOA 3GTUA 3IAS2 4HQZA 2OACA 3LXZA 3H1NA 4XHMA 2V41A 5H5RA 5B8AA 3KH9A 2H1AA 3IPZA 3F0IA 3QR6A 2DJ3A 4WKWA 3CTFA 1ST9A 2FWHA 2F51A 3BBYA 5B6NA 4AJ8A 4K0GA 2IJYA 4K8MA 3TCOA 3EYTA 4EF0A 1J0FA 4IHUA 2YJ7A 2ZUPA 3WT2A 2DIYA 3P7XA 3D22A 4IQAA 3TJKA 1K0OA 3ZVJA 2L5LA 3Q18A 4TR1B 5A4VA 5D9XA 3G9BA 2GTUA 1M2AA 18GSA 3UVTA 1YEPA 3C73A 4N11A 1QGVA 3VFIA 3IA1A 4F0CA 4TXOA 3TKPA 5J41A 5IOXA 1VF2A 2NDOA 3FHKA 2DJ0A 4HDEA 3HKRA 6GSSA 4CW9A 3UMAA 3KJYA 3KMNA 3QAWA 3H79A 2B7KA 3FKFA 4DSSB 1XW9A 5ECIB 3F8UA 4POMA 1CQHA 3L4NA 3HZ4A 1K0AA 2A4HA 5AIVA 2HRNA 1V57A 5ECPB 1WIKA 4G2EA 4K2XA 4AJ6A 3GSSA 4P3YB 1XWKA 3KD0A 3D4MA 5G1LA 2CT6A 3LQ7A 4RQRA 4USSA 1AXDA 3C1SA 5ELAA 1XIYA 2PERA 4EXJA 3S9FA 3QDNA 2E0QA 1SK2A 4GWRA 2GSTA 1G7EA 4HZ2A 3HCZA 1XCCA 4CY6A 3AY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRD A;  4EDZ A;  3VWU A;  2KOK A;  5J9B A;  2TRX A;  3RDW A;  2PU9 C;  5IM9 A;  4HOJ A;  3CRU A;  1AAZ A;  3KMO A;  1AQW A;  2EIQ A;  1V58 A;  3BCI A;  2VM2 A;  2VCQ A;  4KH7 A;  3UAR A;  3GUS A;  2K8V A;  5F05 A;  1ABA A;  4EVM A;  2C1Y A;  5EPF A;  2V6K A;  3MAK A;  4IS0 A;  4IN0 A;  1GSQ A;  4K7O A;  1O85 A;  2R2J A;  5IO0 A;  2E2M A;  3RAZ A;  3D4T A;  2FGX A;  2OA7 A;  4POK A;  2GT5 A;  5DQS A;  9GSS A;  3GHA A;  1H4O A;  1S3D A;  5G30 A;  3ERF A;  4E8H A;  2WFC A;  2PWJ A;  3HVX A;  4LL4 B;  2L4C A;  2R3X A;  2ZCT A;  1B4Q A;  1HNA A;  2H76 A;  1SK1 A;  1EP8 A;  2X8G A;  1PKW A;  1ZYE A;  3F63 A;  3IR4 A;  4WET A;  2VLU A;  2LJK A;  2YZU A;  3I6A A;  3A2W A;  5J9C A;  1YY7 A;  4ZBB A;  2YOI A;  3H93 A;  5CRW A;  3EMP A;  3ED3 A;  3VI7 A;  2FWE A;  3TOT A;  5F07 A;  5DAL A;  2HE3 A;  1T4Z A;  3UBK A;  3DWV A;  1FVK A;  2VL3 A;  3KTL A;  3D6I A;  3WGX A;  1U87 A;  3TJF A;  3KP9 A;  4ML1 A;  1BG5 A;  3E3E A;  2X64 A;  3E0U A;  1YJ6 A;  2L59 A;  2DBC A;  1K3O A;  4BVX A;  3ZTL A;  4AF2 A;  3SBC A;  3JCM L;  5DAK B;  1AUC A;  4GRF A;  1B8X A;  4WBR D;  3C7M A;  1X9S B;  1VF1 A;  5B8B A;  4YQU A;  2GZP A;  4BL7 A;  4MAB A;  4MPF A;  2VLV A;  1TK5 B;  3RBT A;  5IMC A;  4KSM A;  2XHF A;  3Q6O A;  4QL7 A;  3U6V A;  5J4U A;  2PUK C;  3UEM A;  1F3B A;  5GST A;  4BWQ A;  2CZ2 A;  5HR2 A;  3VWV A;  3G7J A;  4PNF A;  5KN1 A;  3GRX A;  1A23 A;  1I5G A;  5DJM A;  1A8L A;  1K3L A;  2AV4 A;  3F4R A;  5KN0 A;  1GTB A;  3F4S A;  4Q5F A;  2YV9 A;  4YAV A;  1XZO A;  4Q5Q A;  3IDV A;  4KAE A;  1ZL9 A;  2O87 A;  5C00 A;  1XW6 A;  4GSN A;  2DJK A;  5EY6 A;  4EO3 A;  3M9J A;  3GNJ A;  4LMV A;  2GQM A;  1TOF A;  2LRC A;  2VCV A;  3ZL5 A;  3EIN A;  1HD2 A;  3TKQ A;  4IW9 A;  4IKH A;  3OR5 A;  2ALB A;  2GVP A;  3TKS A;  5HFG A;  5D9W A;  1TXX A;  1XVW A;  1ACV A;  1F9M A;  2P31 A;  1XVQ A;  2XC2 A;  2HSY A;  5IQY A;  2B7J A;  2GT6 A;  2AJQ B;  1U6T A;  1NHY A;  2JSY A;  4HJ2 A;  2CVD A;  4GST A;  1SD9 A;  4HZ4 A;  5FT3 A;  2MYG A;  4AGS A;  1SL0 B;  1SL1 B;  3I43 A;  1GUM A;  3DML A;  3IRA A;  2CX4 A;  1TRU A;  1YF1 A;  3C1R A;  1T8E B;  3DKS A;  1C72 A;  1ZYQ B;  5CRG A;  4X1U A;  3IK7 A;  1GL8 A;  3HD5 A;  1XWA A;  1PA3 A;  1QXH A;  4GXZ A;  1Z5Y E;  3SWL A;  3TRP A;  3K8N A;  2FA4 A;  4PQH A;  4ECB A;  2B5X A;  5IOW A;  4J2F A;  4EDY A;  2HI7 A;  4JED A;  2IMF A;  2GGT A;  1Q4J A;  2VM1 A;  5IMF A;  4WF4 A;  3HY2 A;  4OFT A;  5ECH B;  2VCW A;  1JZO A;  2CX3 A;  3D0Z A;  3HDC A;  2GSR A;  4MMM A;  2N5F A;  1SD8 A;  3WT1 A;  4EL1 A;  3IXR A;  1SYX A;  4MDC A;  3FZA A;  3GST A;  3J7Y b;  4NHZ A;  4JU5 A;  1T00 A;  3W8J A;  3M9K A;  3FZ4 A;  4DVC A;  3QOU A;  1PRX A;  2V6O A;  1XWC A;  4ZIL A;  5CRE A;  1OC3 A;  17GS A;  4D73 A;  3GUR A;  1BJX A;  3QD9 A;  4YAP A;  1O81 A;  3VI5 A;  2ON7 A;  2VL9 A;  5DCH A;  20GS A;  1M2B A;  1O8X A;  2MMZ A;  3BCK A;  4L0U A;  4KX4 A;  1PSQ A;  1EOG A;  3EU4 A;  1TRV A;  2YWM A;  1EV9 A;  4KA0 A;  3UIW A;  4I5Q A;  2AYT A;  4J57 E;  5KN2 A;  3F9U A;  4CDO A;  1SU9 A;  5ECN B;  1SL2 B;  2DJ2 A;  1XXU A;  2JAC A;  2H1D A;  3WD6 A;  1BQ7 A;  1NW2 A;  5KEJ A;  2CAQ A;  5A4W A;  1U3I A;  4NWY A;  2AAW A;  5D9T A;  1XPV A;  1G6W A;  2MMN A;  1TW9 A;  4EUY A;  3CRT A;  1KNG A;  5IPH A;  3Q19 A;  4K6X A;  3TRX A;  3L9V A;  1GSY A;  1TDI A;  3GL3 A;  4GCI A;  4TR0 A;  2IME A;  4RUV A;  4MP4 A;  1NHO A;  3VPQ A;  2EIO A;  3A5W A;  3CXG A;  1A0F A;  4MLY A;  4IBP A;  1TRS A;  4MJB A;  4KDY A;  4IJ3 A;  1XW5 A;  1ZCP A;  2NPB A;  5GZZ B;  4DEJ A;  2H30 A;  4NXI A;  2JSZ A;  3IOS A;  2LQQ A;  2V1M A;  2DJ1 A;  2I3Y A;  3F6D A;  2PGT A;  4MF6 A;  8GSS A;  4XS6 A;  1AC1 A;  4FYC A;  1O6J A;  5B7C A;  2HZE B;  3HZ8 A;  1A24 A;  2J23 A;  1BX9 A;  3LJR A;  2J9H A;  5D73 A;  3LG6 A;  4IEL A;  1DSB A;  2IMD A;  1GTI A;  3LEF A;  2YWN A;  4PX1 A;  2MBS A;  2IN3 A;  5GAN D;  3C71 A;  3IE3 A;  2YZH A;  2V32 A;  1F6M C;  4K7I A;  3ERW A;  2VL2 C;  4XS4 A;  4KW6 A;  1AIU A;  1M9A A;  2QSI A;  3H4K A;  2H19 A;  1MEK A;  1U88 A;  2RUE A;  2GZZ A;  3IHQ A;  1TKD B;  2NTO A;  5H5Q A;  1SKR B;  2HYX A;  3HYP A;  1DBY A;  1FB6 A;  3MSZ A;  1G0T A;  1HQO A;  3KTB A;  4DSQ A;  3TJB A;  3TDG A;  3GX0 A;  2CQ9 A;  2H66 A;  4E8E A;  4O32 A;  4TRX A;  3DGQ A;  2DJJ A;  3DYR A;  1Y6E A;  4F2I A;  1MDK A;  1R5P A;  2KP2 A;  2CAI A;  1JLW A;  1QFN A;  5IMA A;  1EZK A;  22GS A;  3U5R E;  1Y25 A;  2MZC A;  5FHI A;  3ZIV A;  2IFQ B;  2FHE A;  1IYI A;  4TKY A;  5CO3 A;  2TRC P;  4KDX A;  1R5A A;  3EC3 A;  5IPG A;  5B6M A;  4LMW A;  1G7O A;  4F82 A;  1N8J A;  3TJJ A;  4I2U A;  4OMV A;  2R37 A;  3GH9 A;  2F8A A;  3KXO A;  1OC9 B;  1THO A;  1BYE A;  2L4Q A;  3E9J B;  3GIX A;  1WPI A;  2CZ3 A;  2PVQ A;  3QMX A;  4NHW A;  1A0R P;  2B5E A;  1FHE A;  5ECR B;  4GTU A;  2DMM A;  1Z7P A;  3I69 A;  1YKC A;  3PH9 A;  1TU8 A;  4FO5 A;  2H72 A;  5EL8 A;  4GQF A;  3KZQ A;  2FLS A;  1GSE A;  2XPE A;  5ECO B;  2H0I A;  2BMX A;  3TKR A;  1J08 A;  4XTS A;  4POB A;  1XBS A;  4LLR A;  4ECC A;  2HT9 A;  5ID2 B;  4NPB A;  3TKS E;  1HYU A;  2CVK A;  2G0F A;  1G6Y A;  4WR5 A;  1ON4 A;  4WEY A;  3FW2 A;  1RW1 A;  4OO4 A;  5JWR B;  3G7Y A;  4IP6 A;  2JZS A;  2OE0 A;  4PUF C;  3MNG A;  1ILO A;  2Z9S A;  2F8F A;  1FB0 A;  2I81 A;  3RHB A;  2E2G A;  2RII A;  4MK3 A;  4G10 A;  1T3B A;  4N10 A;  5E4W A;  5D9V A;  3GTU B;  4NMU A;  2KLX A;  2AUV A;  4NAX A;  3ZZX A;  4F0B A;  1TU7 A;  3UBL A;  2X8H A;  3FR6 A;  4FYB A;  4FH8 A;  3P8W A;  1EGO A;  4Q5R A;  1XOA A;  2JU5 A;  3TOU A;  2F3M A;  5ECS A;  3FZ5 A;  2FD3 A;  2WUL A;  1EWX A;  2KUC A;  2LST A;  2PMT A;  4Z7X A;  2B5Y A;  1LU4 A;  5CYY A;  4HUA A;  1GSS A;  2HNL A;  2PBJ A;  3DD3 A;  4ECI A;  3V1W A;  2FA8 A;  2YN1 A;  2P5Q A;  4NV5 A;  2FY6 A;  3RPN A;  3APS A;  1GSU A;  2M46 A;  5G5E A;  1GUL A;  1WWJ A;  1H75 A;  2R5G A;  4OCF A;  4MZB A;  3F3Q A;  4ZBD A;  1T4Y A;  3KP8 A;  3LFL A;  5CRD A;  2C0D A;  1NM3 A;  4O92 A;  4TXO B;  2RM5 A;  3HJM A;  3EUR A;  1X9M B;  4HI7 A;  3ZML A;  1ZZY A;  2WZ9 A;  3QAG A;  2WDU A;  3UVH A;  2OE3 A;  1QQ2 A;  1V9W A;  1WOU A;  2HXK A;  3QFA C;  4YH2 A;  2VLT A;  5IMZ A;  1JZD A;  3LYK A;  2GDR A;  1ERW A;  3ZFB A;  5D93 A;  2A4V A;  1B4P A;  4EC0 A;  3D5J A;  6GSX A;  4TW5 A;  2DSA A;  3LXT A;  2HLS A;  4ZL8 A;  3GKN A;  5CRH A;  2JL4 A;  3KM6 A;  4L0W A;  2FUG 2;  1X5D A;  4K9Z A;  4ZBA A;  3HVV A;  2H1B A;  1TI3 A;  4K0N A;  3GH6 A;  4HU9 A;  4JRR A;  4TVE A;  2OKA A;  2OJL A;  4MJC A;  3US3 A;  1TK8 B;  2D2Z A;  4EKZ A;  1FAA A;  5HFK A;  3ZYW A;  2FNO A;  1WP0 A;  4I8B A;  1A8Y A;  4JR4 A;  4ZL9 A;  5JCU A;  1JHB A;  4TR4 A;  5INY A;  1OKD A;  1HNB A;  2FCH A;  1TRW A;  1V40 A;  2VCT A;  5GSS A;  4K2D A;  2YWI A;  4MCU A;  3HVS A;  5COH A;  3PIN A;  4X43 A;  4GLT A;  3FYG A;  4TR1 A;  1M7T A;  5DBQ A;  4X0X A;  1SKS B;  1A2L A;  1MDI A;  1SJZ A;  2HFD A;  4HU7 A;  1FVJ A;  3NZN A;  1YF0 A;  1OVN A;  3W8S A;  3J7Y k;  3UJ1 A;  3CSH A;  2R4V A;  1FO5 A;  4KCA A;  5G2Z A;  13GS A;  4JR6 A;  2GQK A;  3VWX A;  4KGI A;  3N5O A;  1VF3 A;  2C3N A;  4DSS A;  1NSW A;  1SEN A;  4V2N A;  4MJE A;  4WR4 A;  1KBN A;  2N5B A;  2L6C A;  1AQV A;  2LV3 A;  3TGZ A;  2H01 A;  2XBQ A;  1XWB A;  1OKT A;  2A2R A;  4V2L A;  1M2D A;  3H8Q A;  1UC7 A;  2CA8 A;  3CBU A;  4ACS A;  4MZC A;  2L57 A;  5ABR A;  1SYR A;  5JCW A;  1YKA A;  3FK8 A;  1R4W A;  4H86 A;  1AW9 A;  3WGD A;  4OD7 A;  4LL1 B;  2I1U A;  3M8N A;  5CAX A;  5DAL B;  3GKK A;  5A4U A;  3UOM A;  2H1G A;  4POL A;  3PGT A;  2LUS A;  3DVX A;  4F03 A;  2YWO A;  1B48 A;  4XCS A;  4PQ1 A;  4OFN A;  1VGL A;  1A2J A;  4HS1 A;  3F6F A;  3IV4 A;  2A2S A;  2XBI A;  4O5R A;  2I4A A;  5ENU A;  5DJL A;  1ERV A;  5EVO A;  3LGC A;  4BVY A;  3ZMK A;  5A5K A;  1MTC A;  2VCZ A;  1T1V A;  4IQ1 A;  2M72 A;  3LWA A;  1EOH A;  3DEX A;  5F06 A;  2K9F A;  3RHC A;  3BD2 A;  3ZIT A;  1I9D A;  4ILF A;  3GYK A;  1K0D A;  3M0F A;  5AN1 A;  3QCP A;  4AJ7 A;  3RPP A;  2K18 A;  5G1K A;  2OBI A;  5CP1 A;  1GLQ A;  5DDL A;  1LJR A;  4ML6 A;  4XRD A;  5LD0 A;  1UA5 A;  2O7K A;  2PPT A;  2WS2 A;  3N9J A;  1XWG A;  4MZW A;  3GA4 A;  1F3A A;  1UN2 A;  5DVB A;  4F9Z A;  2WGR A;  2VL2 A;  4N30 A;  1DUG A;  3GKM A;  3L9S A;  1X0R A;  3CMI A;  1PD2 1;  1GH2 A;  1VRS D;  2VCX A;  4MJA A;  4XS1 A;  1WJK A;  3GV1 A;  1IYH A;  2WJU A;  1FOV A;  5JWQ B;  4V1A g;  4JE1 A;  1RK4 A;  3DIE A;  2OE1 A;  2MBT A;  2VO4 A;  2GSQ A;  4PGT A;  4MF5 A;  2C0E A;  3ISO A;  4TR3 A;  4ID0 A;  6GSY A;  4BPY A;  1F37 A;  3FR3 A;  2C0F A;  1JLV A;  4RI7 A;  3HJO A;  3NOF A;  1HNC A;  4HQS A;  3CYN A;  1PN9 A;  3APQ A;  3APO A;  1GSF A;  3WGE A;  2ES7 A;  4V1A p;  3LYP A;  1S3A A;  5DAK A;  4MH3 A;  3FZ9 A;  2CV4 A;  19GS A;  3EE2 A;  5FWG A;  5IO2 A;  4N0V A;  3FRC A;  4ECJ A;  5IMV A;  4K1F A;  4ZB9 A;  2H0H A;  1WMJ A;  3Q74 A;  4LA1 A;  1M0U A;  3A3T A;  3GFK A;  2B1K A;  2R6K A;  1JZW A;  4KUN A;  1K0B A;  4HJM A;  2PN8 A;  2YPM A;  1E6B A;  5JCG A;  1EP7 A;  3FR9 A;  5ECK B;  1KEB A;  3A2X A;  3O76 A;  4KSO A;  2HSH A;  2IWT A;  3TB2 A;  4RI6 A;  1ERT A;  4ZB6 A;  2YP6 A;  5G5F A;  1RQM A;  3KGK A;  1TTZ A;  2DC5 A;  4I97 A;  1YDK A;  2H71 A;  3EVI A;  2GZY A;  2JZT A;  4JZQ A;  2H74 A;  3TRQ A;  2LRN A;  1YQ1 A;  2C8U A;  3IAM 2;  3CSJ A;  6GSW A;  4QL9 A;  2BTO T;  2RM6 A;  4D73 B;  2LJA A;  1SJ6 A;  3LOR A;  1GWC A;  3BOA A;  3EU3 A;  10GS A;  2VD0 A;  4KCE A;  1V98 A;  1U3A A;  5HQP A;  2MMO A;  1TP9 A;  4N0Z A;  1USB A;  1DE2 A;  3GKX A;  1W4V A;  2FWF A;  2WRT A;  3IC4 A;  2X99 A;  1GTA A;  4KDU A;  2H70 A;  5J3R A;  1OE7 A;  5DCG A;  4OO5 A;  3BJ5 A;  4HEA 2;  1XOB A;  2DLX A;  2YJH A;  2VIM A;  7GSS A;  3A2V A;  2O89 A;  2LKU A;  2H0G A;  1FW1 A;  2JZR A;  3W6G A;  2H73 A;  1UVZ A;  1PX6 A;  3DXB A;  1ZGN A;  2LS5 A;  2IPA A;  3F3R A;  3TJG A;  1EEJ A;  4V2M A;  3ZRE A;  2L5O A;  1SJI A;  5JWO B;  5ECL B;  1PKZ A;  1T7P B;  4I6X A;  1PL2 A;  5F8B A;  4JBB A;  2EC4 A;  4OFM A;  5ELG A;  2LQO A;  5LCZ A;  1YZX A;  2GLR A;  2B6M A;  3CSI A;  3F4T A;  3O3T A;  3DVW A;  4IGJ A;  4FIW A;  1F2E A;  2M80 A;  1ERU A;  2OBK A;  5F0G A;  1WE0 A;  3ME8 A;  3FY7 A;  3TUE A;  3KEB A;  5E59 A;  3D21 A;  2LTK A;  3O6T A;  2C3T A;  2P0G A;  1QUW A;  3GL5 A;  4PUR A;  2E7P A;  4IVF A;  1PMT A;  3L78 A;  3G7I A;  2K8S A;  3HA9 A;  1OAZ A;  3IBH A;  3IK9 A;  4L8E A;  2MMA A;  5HR3 A;  2NVL A;  1FG4 A;  2KP1 A;  2BJX A;  3ZFL A;  2B3S A;  1N2A A;  6GSV A;  2KHP A;  1K0M A;  1ZMA A;  1EV4 A;  5AIS A;  4J56 E;  1GNW A;  1S3C A;  2YV7 A;  3VUR A;  1MD4 A;  2IL3 A;  1Z9H A;  1QMV A;  1K0C A;  5D96 A;  3MWH A;  4K7N A;  4XRA A;  1A2M A;  2DIZ A;  1O73 A;  2G2Q A;  2RLI A;  1WRY A;  4WF5 A;  2HRF A;  4L5L A;  1CQG A;  3GN3 A;  1BED A;  3VWW A;  4XS4 B;  4Q5N A;  1OC8 A;  2H6X A;  3M3M A;  4OCE A;  4MH2 A;  3FEU A;  2O8V B;  1YEX A;  2V2G A;  3L9U A;  3UL3 A;  5HR1 A;  4MF7 A;  2H8L A;  2AHE A;  4ZL7 A;  3P2A A;  3VK9 A;  1EEM A;  4YQV A;  2GQL A;  5GAP D;  2LNT A;  4KND A;  4WXT A;  1PL1 A;  5ECM B;  1K3Y A;  1Z3E A;  2QGV A;  2C3Q A;  1GSD A;  2WB9 A;  3GMF A;  2GSS A;  11GS A;  4OWY A;  2IMK A;  3NIV A;  4MPG A;  2QKE A;  1B9X C;  4DSR A;  5ECQ B;  3QFB C;  1VF4 A;  5HFI A;  4FYU A;  2PVO C;  3QPM A;  1DE1 A;  4ISD A;  2I9H A;  4PUA A;  4EE0 A;  2NBS A;  3ZIJ A;  1GUH A;  1SK0 A;  5DQY A;  1Z6M A;  3L0H A;  1O7U A;  3HHV A;  2LNS A;  2VD1 A;  2IIY A;  1K0N A;  1LBK A;  4GSS A;  2H75 A;  1OE8 A;  1Z6N A;  2FWG A;  4PNG A;  5AIX A;  2LJR A;  2HZE A;  2L6D A;  6GSU A;  1PGT A;  2B1L A;  4ZIJ A;  1V2A A;  1E2Y A;  16GS A;  4MA9 A;  1BAY A;  2ZNM A;  4YQM A;  1SKW B;  4GQC A;  5C04 A;  3ZVJ D;  2YCD A;  4L5O A;  2O85 A;  5H5S A;  4BWS A;  2P5R A;  1MD3 A;  4IJI A;  3GX8 A;  2VOC A;  1XFL A;  2YAN A;  1Q98 A;  3I9V 2;  1O8W A;  4GF0 A;  4KE3 A;  2C80 A;  2ON5 A;  2LEG A;  2DML A;  2LRT A;  4TXV A;  3TKS C;  3M1G A;  1TI1 A;  1J9B A;  3KH7 A;  4ULX A;  3ME7 A;  3EMX A;  4O7H A;  5G31 A;  4TN8 A;  3C8E A;  4XIH A;  3R2Q A;  1X5E A;  4IP1 A;  1PX7 A;  2VAF A;  4G19 A;  3KCM A;  3WYW A;  4NV2 A;  1ML6 A;  5D8I A;  1GRX A;  2F9S A;  2EIR A;  1PQN A;  2IFQ A;  1W89 A;  1R26 A;  14GS A;  2IMI A;  4KB3 A;  5J5N A;  3MDK A;  3EWL A;  1M9B A;  4I2T A;  4WBJ A;  5LNK e;  4QQ7 A;  1Z7R A;  3P90 A;  3ERG A;  1EGR A;  1GUK A;  1X9W B;  4PQI A;  4CHS A;  1GP1 A;  1OC9 A;  3VLN A;  1KTE A;  3HXS A;  5KN3 A;  2VUP A;  3VPT A;  2C0G A;  2HZF A;  2C4J A;  2RUF A;  2OAD A;  1GNE A;  6GST A;  2CVB A;  1QK8 A;  3QAV A;  4TOP A;  1MDJ A;  1R7H A;  1JZR A;  3DRN A;  4ZB8 A;  3ZLP A;  1ZOF A;  2XPD A;  3PR8 A;  2N5A A;  3KIJ A;  12GS A;  1X5C A;  1JFU A;  1GTU A;  5IMD A;  1URM A;  2H6Z A;  2WCI A;  2QC7 A;  3LSZ A;  2AB6 A;  1GLP A;  1OYJ A;  3HJP A;  4G9H A;  5ID2 A;  5CNW A;  4ZXG A;  2TIR A;  1B9Y C;  5IIZ A;  4RQX A;  2YNX A;  3UAP A;  2X8C A;  2H6Y A;  5AGY A;  4BA7 A;  5L71 A;  5HR0 A;  1M99 A;  1TK0 B;  2K6V A;  1THX A;  1AQX A;  2JAD A;  3CTG A;  2GS3 A;  1TJD A;  2REM A;  4PXO A;  3GTU A;  3IAS 2;  4HQZ A;  2OAC A;  3LXZ A;  3H1N A;  4XHM A;  2V41 A;  5H5R A;  5B8A A;  3KH9 A;  2H1A A;  3IPZ A;  3F0I A;  3QR6 A;  2DJ3 A;  4WKW A;  3CTF A;  1ST9 A;  2FWH A;  2F51 A;  3BBY A;  5B6N A;  4AJ8 A;  4K0G A;  2IJY A;  4K8M A;  3TCO A;  3EYT A;  4EF0 A;  1J0F A;  4IHU A;  2YJ7 A;  2ZUP A;  3WT2 A;  2DIY A;  3P7X A;  3D22 A;  4IQA A;  3TJK A;  1K0O A;  3ZVJ A;  2L5L A;  3Q18 A;  4TR1 B;  5A4V A;  5D9X A;  3G9B A;  2GTU A;  1M2A A;  18GS A;  3UVT A;  1YEP A;  3C73 A;  4N11 A;  1QGV A;  3VFI A;  3IA1 A;  4F0C A;  4TXO A;  3TKP A;  5J41 A;  5IOX A;  1VF2 A;  2NDO A;  3FHK A;  2DJ0 A;  4HDE A;  3HKR A;  6GSS A;  4CW9 A;  3UMA A;  3KJY A;  3KMN A;  3QAW A;  3H79 A;  2B7K A;  3FKF A;  4DSS B;  1XW9 A;  5ECI B;  3F8U A;  4POM A;  1CQH A;  3L4N A;  3HZ4 A;  1K0A A;  5AIV A;  2HRN A;  1V57 A;  5ECP B;  1WIK A;  4G2E A;  4AJ6 A;  3GSS A;  4P3Y B;  1XWK A;  3KD0 A;  3D4M A;  5G1L A;  2CT6 A;  3LQ7 A;  4RQR A;  1AXD A;  3C1S A;  5ELA A;  1XIY A;  2PER A;  4EXJ A;  3S9F A;  3QDN A;  2E0Q A;  1SK2 A;  4GWR A;  2GST A;  1G7E A;  4HZ2 A;  3HCZ A;  1XCC A;  3AY8 A; 
#chains in the Genus database with same CATH topology
 3ZRD A;  4EDZ A;  3VWU A;  2KOK A;  5J9B A;  2TRX A;  3R3E A;  3RDW A;  2PU9 C;  5IM9 A;  4HOJ A;  3CRU A;  1AAZ A;  3KMO A;  1AQW A;  2EIQ A;  2HRK A;  1V58 A;  3BCI A;  2VM2 A;  2VCQ A;  4KH7 A;  3UAR A;  3GUS A;  2K8V A;  5F05 A;  1ABA A;  4BVY B;  4EVM A;  2C1Y A;  5EPF A;  2V6K A;  3MAK A;  4IS0 A;  4IN0 A;  1GSQ A;  4K7O A;  1O85 A;  2R2J A;  5IO0 A;  2E2M A;  3RAZ A;  3D4T A;  2HSM A;  2FGX A;  2OA7 A;  4POK A;  2GT5 A;  5DQS A;  9GSS A;  2R0P A;  3GHA A;  1H4O A;  1S3D A;  5G30 A;  3ERF A;  4E8H A;  2WFC A;  2PWJ A;  3HVX A;  4LL4 B;  2L4C A;  2R3X A;  2ZCT A;  1B4Q A;  1HNA A;  2H76 A;  1SK1 A;  1EP8 A;  2X8G A;  1PKW A;  1ZYE A;  3F63 A;  3IR4 A;  4WET A;  2VLU A;  2LJK A;  2YZU A;  3I6A A;  3A2W A;  5J9C A;  1YY7 A;  4ZBB A;  2YOI A;  3H93 A;  5CRW A;  3EMP A;  4YKG A;  3ED3 A;  3VI7 A;  2X49 A;  2FWE A;  3TOT A;  5F07 A;  5DAL A;  2HE3 A;  1T4Z A;  4MNN A;  3UBK A;  3DWV A;  1FVK A;  2VL3 A;  3KTL A;  3D6I A;  3WGX A;  1U87 A;  3TJF A;  3KP9 A;  4ML1 A;  1BG5 A;  3E3E A;  2X64 A;  3E0U A;  1YJ6 A;  2L59 A;  2DBC A;  1K3O A;  4BVX A;  4EIP A;  3ZTL A;  4AF2 A;  3SBC A;  3JCM L;  5DAK B;  1AUC A;  4GRF A;  1B8X A;  4WBR D;  3C7M A;  1X9S B;  1VF1 A;  5B8B A;  4YQU A;  2GZP A;  4BL7 A;  4MAB A;  4MPF A;  2VLV A;  1TK5 B;  3RBT A;  5IMC A;  4KSM A;  2XHF A;  3Q6O A;  4QL7 A;  3U6V A;  5J4U A;  2PUK C;  3UEM A;  1F3B A;  5GST A;  4BWQ A;  2CZ2 A;  5HR2 A;  3VWV A;  3G7J A;  4PNF A;  5KN1 A;  3GRX A;  1A23 A;  1I5G A;  3MIX A;  5DJM A;  1A8L A;  1K3L A;  2AV4 A;  3F4R A;  5KN0 A;  1GTB A;  3F4S A;  4Q5F A;  2YV9 A;  4YAV A;  1XZO A;  4Q5Q A;  3IDV A;  4KAE A;  1ZL9 A;  2O87 A;  5C00 A;  1XW6 A;  4GSN A;  2DJK A;  5EY6 A;  4EO3 A;  3M9J A;  3GNJ A;  4LMV A;  2GQM A;  1TOF A;  2LRC A;  2VCV A;  3ZL5 A;  3EIN A;  1HD2 A;  3TKQ A;  4IW9 A;  4IKH A;  3OR5 A;  2ALB A;  2GVP A;  3TKS A;  5HFG A;  5D9W A;  1TXX A;  1XVW A;  1ACV A;  1F9M A;  2P31 A;  1M3I A;  1XVQ A;  2XC2 A;  2HSY A;  5IQY A;  2B7J A;  2GT6 A;  2AJQ B;  1U6T A;  1NHY A;  4HJ2 A;  2JSY A;  2CVD A;  4GST A;  1SD9 A;  4HZ4 A;  5FT3 A;  2MYG A;  4AGS A;  1SL0 B;  1SL1 B;  3I43 A;  1GUM A;  3DML A;  3IRA A;  2CX4 A;  1TRU A;  1YF1 A;  3C1R A;  1T8E B;  3A5I A;  3DKS A;  1C72 A;  1ZYQ B;  5CRG A;  4X1U A;  3IK7 A;  1GL8 A;  3HD5 A;  1XWA A;  1PA3 A;  1QXH A;  4GXZ A;  1Z5Y E;  3SWL A;  3TRP A;  3K8N A;  2FA4 A;  2R0C A;  4PQH A;  4ECB A;  2B5X A;  5IOW A;  4J2F A;  4EDY A;  2HI7 A;  4JED A;  2IMF A;  2GGT A;  1Q4J A;  2VM1 A;  5IMF A;  4WF4 A;  3HY2 A;  4OFT A;  5ECH B;  2VCW A;  1JZO A;  2CX3 A;  3D0Z A;  3HDC A;  2GSR A;  4MMM A;  2N5F A;  1SD8 A;  3WT1 A;  4EL1 A;  3IXR A;  1SYX A;  4HSC X;  4MDC A;  3FZA A;  3GST A;  3J7Y b;  4NHZ A;  4JU5 A;  1T00 A;  3W8J A;  3M9K A;  3FZ4 A;  4DVC A;  3QOU A;  1PRX A;  2V6O A;  1XWC A;  4ZIL A;  5CRE A;  1OC3 A;  17GS A;  4D73 A;  3GUR A;  1BJX A;  1PN0 A;  3QD9 A;  4YAP A;  1O81 A;  3VI5 A;  2ON7 A;  2VL9 A;  5DCH A;  20GS A;  1M2B A;  1O8X A;  2MMZ A;  3BCK A;  4L0U A;  4KX4 A;  1PSQ A;  1EOG A;  3EU4 A;  4FQU A;  1TRV A;  2YWM A;  1EV9 A;  4KA0 A;  2UZ8 A;  3UIW A;  4I5Q A;  2AYT A;  4J57 E;  5KN2 A;  3F9U A;  4CDO A;  1SU9 A;  5ECN B;  1SL2 B;  2DJ2 A;  1XXU A;  2JAC A;  2H1D A;  3WD6 A;  1BQ7 A;  1NW2 A;  5KEJ A;  2CAQ A;  5A4W A;  1U3I A;  4NWY A;  2AAW A;  5D9T A;  1XPV A;  1G6W A;  2MMN A;  1TW9 A;  4EUY A;  3CRT A;  1KNG A;  5IPH A;  3Q19 A;  4K6X A;  3TRX A;  3L9V A;  1GSY A;  1TDI A;  5KOX A;  3GL3 A;  4GCI A;  4TR0 A;  2IME A;  4RUV A;  4MP4 A;  1NHO A;  3VPQ A;  2EIO A;  3A5W A;  4K5R A;  3CXG A;  1A0F A;  4MLY A;  4IBP A;  1TRS A;  4MJB A;  4KDY A;  4IJ3 A;  1XW5 A;  1ZCP A;  2NPB A;  5GZZ B;  4DEJ A;  2H30 A;  4NXI A;  2JSZ A;  3IOS A;  2LQQ A;  2V1M A;  2DJ1 A;  2I3Y A;  3F6D A;  2PGT A;  4MF6 A;  8GSS A;  4XS6 A;  4BIK A;  1AC1 A;  4FYC A;  1O6J A;  5B7C A;  2HZE B;  5BRT A;  3HZ8 A;  1A24 A;  2J23 A;  1BX9 A;  3LJR A;  2J9H A;  5D73 A;  3LG6 A;  4IEL A;  1DSB A;  2IMD A;  1GTI A;  3LEF A;  2YWN A;  4PX1 A;  2MBS A;  2IN3 A;  4G0K A;  5GAN D;  3C71 A;  3IE3 A;  3FMW A;  2YZH A;  2V32 A;  1F6M C;  4K7I A;  3ERW A;  2VL2 C;  4XS4 A;  4KW6 A;  1AIU A;  1M9A A;  2QSI A;  3H4K A;  2H19 A;  1MEK A;  1U88 A;  2RUE A;  2GZZ A;  3IHQ A;  1TKD B;  2NTO A;  5H5Q A;  1SKR B;  2HYX A;  3HYP A;  1DBY A;  1FB6 A;  3MSZ A;  1G0T A;  1HQO A;  3KTB A;  4DSQ A;  3TJB A;  3TDG A;  3GX0 A;  2CQ9 A;  2H66 A;  4E8E A;  4O32 A;  4TRX A;  3DGQ A;  2DJJ A;  3DYR A;  1Y6E A;  4F2I A;  1MDK A;  1R5P A;  2KP2 A;  2CAI A;  1JLW A;  1QFN A;  5IMA A;  1EZK A;  22GS A;  3U5R E;  1Y25 A;  2MZC A;  5FHI A;  3ZIV A;  2IFQ B;  2FHE A;  1IYI A;  4TKY A;  4YKF A;  5CO3 A;  2TRC P;  4KDX A;  1R5A A;  3EC3 A;  5IPG A;  5B6M A;  4LMW A;  1G7O A;  4F82 A;  1N8J A;  3TJJ A;  4I2U A;  4OMV A;  2R37 A;  3GH9 A;  2F8A A;  3KXO A;  1OC9 B;  1THO A;  1BYE A;  2L4Q A;  3E9J B;  3GIX A;  1WPI A;  2CZ3 A;  2PVQ A;  3QMX A;  4NHW A;  1A0R P;  2B5E A;  1FHE A;  5ECR B;  4GTU A;  2DMM A;  1Z7P A;  3I69 A;  1YKC A;  3PH9 A;  1TU8 A;  4FO5 A;  2H72 A;  2DKH A;  5EL8 A;  4GQF A;  3KZQ A;  2FLS A;  1GSE A;  2XPE A;  5ECO B;  4Z2U A;  2H0I A;  2BMX A;  3TKR A;  1J08 A;  4XTS A;  4POB A;  1XBS A;  4LLR A;  4ECC A;  2HT9 A;  5ID2 B;  4NPB A;  3TKS E;  1HYU A;  2CVK A;  2G0F A;  1G6Y A;  4WR5 A;  1ON4 A;  4WEY A;  3FW2 A;  1RW1 A;  4OO4 A;  5JWR B;  3G7Y A;  4IP6 A;  2JZS A;  2OE0 A;  4PUF C;  3MNG A;  1ILO A;  2Z9S A;  2F8F A;  1FB0 A;  2I81 A;  3RHB A;  1ZYP A;  2E2G A;  2RII A;  4MK3 A;  4G10 A;  1T3B A;  4N10 A;  5E4W A;  5D9V A;  3GTU B;  4NMU A;  2KLX A;  2AUV A;  4NAX A;  3ZZX A;  4F0B A;  1TU7 A;  3UBL A;  2X8H A;  3FR6 A;  4FYB A;  4FH8 A;  3P8W A;  1EGO A;  4Q5R A;  1XOA A;  2JU5 A;  3TOU A;  2F3M A;  5ECS A;  3FZ5 A;  2FD3 A;  2WUL A;  1EWX A;  2KUC A;  2LST A;  2PMT A;  4Z7X A;  2B5Y A;  1LU4 A;  5CYY A;  4HUA A;  1GSS A;  2HNL A;  2PBJ A;  3DD3 A;  4G0I A;  4ECI A;  3V1W A;  2FA8 A;  2YN1 A;  2P5Q A;  4A5P A;  4NV5 A;  2FY6 A;  3RPN A;  3APS A;  1GSU A;  2M46 A;  5G5E A;  1GUL A;  1WWJ A;  1H75 A;  2R5G A;  4OCF A;  4MZB A;  3F3Q A;  4ZBD A;  1T4Y A;  3KP8 A;  3LFL A;  5CRD A;  2C0D A;  1NM3 A;  4O92 A;  4TXO B;  2RM5 A;  3HJM A;  3EUR A;  2R0G A;  1X9M B;  4HI7 A;  3ZML A;  1ZZY A;  2WZ9 A;  3QAG A;  2WDU A;  3UVH A;  2OE3 A;  1QQ2 A;  1V9W A;  1WOU A;  2HXK A;  3QFA C;  4YH2 A;  2VLT A;  5IMZ A;  1JZD A;  4PTS A;  3LYK A;  2GDR A;  1ERW A;  3ZFB A;  5D93 A;  2A4V A;  1B4P A;  4EC0 A;  3D5J A;  6GSX A;  4TW5 A;  2DSA A;  3LXT A;  2HLS A;  4ZL8 A;  3GKN A;  5CRH A;  2JL4 A;  3KM6 A;  4L0W A;  2FUG 2;  1X5D A;  4ICY A;  4K9Z A;  4ZBA A;  3HVV A;  2H1B A;  1TI3 A;  4K0N A;  3GH6 A;  4HU9 A;  4JRR A;  4TVE A;  2OKA A;  2QA1 A;  2OJL A;  4MJC A;  3US3 A;  1TK8 B;  2D2Z A;  4EKZ A;  1FAA A;  5HFK A;  3ZYW A;  2FNO A;  1WP0 A;  4I8B A;  1A8Y A;  4JR4 A;  4ZL9 A;  5JCU A;  1JHB A;  4TR4 A;  5INY A;  1OKD A;  1HNB A;  2FCH A;  1TRW A;  1V40 A;  2VCT A;  5GSS A;  4K2D A;  2YWI A;  4MCU A;  3HVS A;  5COH A;  3PIN A;  4X4J A;  4X43 A;  4GLT A;  3FYG A;  4TR1 A;  1M7T A;  3HVN A;  5DBQ A;  4X0X A;  1SKS B;  1A2L A;  1MDI A;  1SJZ A;  2HFD A;  4HU7 A;  1FVJ A;  3NZN A;  4Z2T A;  1YF0 A;  1OVN A;  3W8S A;  3J7Y k;  3UJ1 A;  3CSH A;  2R4V A;  1FO5 A;  4KCA A;  5G2Z A;  13GS A;  4JR6 A;  2GQK A;  3VWX A;  4KGI A;  3N5O A;  1VF3 A;  2C3N A;  4DSS A;  2DKI A;  1NSW A;  1SEN A;  4V2N A;  4MJE A;  4WR4 A;  1KBN A;  2N5B A;  4KF9 A;  2L6C A;  5BMU A;  1AQV A;  2LV3 A;  3TGZ A;  2H01 A;  2XBQ A;  1XWB A;  1OKT A;  2A2R A;  4V2L A;  1M2D A;  3H8Q A;  1UC7 A;  2CA8 A;  3CBU A;  4ACS A;  4MZC A;  2L57 A;  5ABR A;  1SYR A;  5JCW A;  1YKA A;  3FK8 A;  1R4W A;  4H86 A;  1AW9 A;  3WGD A;  4OD7 A;  4LL1 B;  2I1U A;  3M8N A;  5CAX A;  5DAL B;  3GKK A;  5A4U A;  3UOM A;  2H1G A;  4POL A;  3PGT A;  2LUS A;  3DVX A;  4F03 A;  2YWO A;  1B48 A;  4XCS A;  4PQ1 A;  4CY8 A;  4OFN A;  4BVX B;  1VGL A;  1A2J A;  4HS1 A;  1ZYN A;  3F6F A;  3IV4 A;  2A2S A;  2XBI A;  4O5R A;  2I4A A;  5ENU A;  5DJL A;  1ERV A;  5EVO A;  3LGC A;  4BVY A;  4BL7 B;  3ZMK A;  5A5K A;  1MTC A;  2VCZ A;  1T1V A;  4IQ1 A;  2M72 A;  3LWA A;  1EOH A;  3DEX A;  5F06 A;  2K9F A;  3RHC A;  3BD2 A;  3ZIT A;  1I9D A;  4ILF A;  3GYK A;  1K0D A;  3M0F A;  5AN1 A;  3QCP A;  4AJ7 A;  3RPP A;  2K18 A;  5G1K A;  2OBI A;  5CP1 A;  1GLQ A;  5DDL A;  1LJR A;  4ML6 A;  4XRD A;  5LD0 A;  1UA5 A;  2O7K A;  2PPT A;  2WS2 A;  3N9J A;  1XWG A;  4MZW A;  3GA4 A;  1F3A A;  1UN2 A;  5DVB A;  4F9Z A;  2WGR A;  2VL2 A;  4N30 A;  1DUG A;  3GKM A;  3L9S A;  1X0R A;  3CMI A;  1PD2 1;  1GH2 A;  1VRS D;  2VCX A;  4MJA A;  4XS1 A;  1WJK A;  3GV1 A;  1IYH A;  2WJU A;  1FOV A;  5JWQ B;  4V1A g;  4JE1 A;  1RK4 A;  3DIE A;  2OE1 A;  2MBT A;  2VO4 A;  2GSQ A;  4PGT A;  4MF5 A;  2C0E A;  3ISO A;  4TR3 A;  4ID0 A;  6GSY A;  4BPY A;  1F37 A;  3FR3 A;  2C0F A;  1JLV A;  4RI7 A;  3HJO A;  3NOF A;  1HNC A;  4HQS A;  3CYN A;  1PN9 A;  3APQ A;  3APO A;  1GSF A;  3WGE A;  2ES7 A;  4V1A p;  3LYP A;  1S3A A;  5DAK A;  4MH3 A;  3FZ9 A;  2CV4 A;  19GS A;  2HRA A;  3EE2 A;  5FWG A;  5IO2 A;  4N0V A;  3FRC A;  4ECJ A;  5IMV A;  4K1F A;  4ZB9 A;  2H0H A;  1WMJ A;  3Q74 A;  4LA1 A;  1M0U A;  3A3T A;  1M3J A;  3GFK A;  2B1K A;  2R6K A;  1JZW A;  4KUN A;  1K0B A;  4HJM A;  2PN8 A;  2YPM A;  1E6B A;  5JCG A;  1EP7 A;  3FR9 A;  5ECK B;  2QA2 A;  1KEB A;  3A2X A;  3O76 A;  4G0L A;  4KSO A;  2HSH A;  2IWT A;  3TB2 A;  4RI6 A;  1ERT A;  4ZB6 A;  2YP6 A;  5G5F A;  1RQM A;  3KGK A;  1TTZ A;  2DC5 A;  4I97 A;  1YDK A;  2H71 A;  3EVI A;  2GZY A;  2JZT A;  4JZQ A;  2H74 A;  3TRQ A;  2LRN A;  1YQ1 A;  2C8U A;  3IAM 2;  3CSJ A;  5KOW A;  6GSW A;  4QL9 A;  2BTO T;  2RM6 A;  4D73 B;  2LJA A;  1SJ6 A;  3LOR A;  1GWC A;  3BOA A;  3EU3 A;  10GS A;  2VD0 A;  4KCE A;  1V98 A;  1U3A A;  5HQP A;  2MMO A;  1TP9 A;  4N0Z A;  1USB A;  1DE2 A;  3GKX A;  1W4V A;  2FWF A;  3CQF A;  2WRT A;  3IC4 A;  2X99 A;  1GTA A;  4KDU A;  2H70 A;  3PPU A;  5J3R A;  1OE7 A;  5DCG A;  4OO5 A;  3BJ5 A;  4HEA 2;  1XOB A;  2DLX A;  2YJH A;  2VIM A;  7GSS A;  3A2V A;  2O89 A;  2LKU A;  2H0G A;  1FW1 A;  2JZR A;  3W6G A;  2H73 A;  1UVZ A;  1PX6 A;  3DXB A;  1ZGN A;  3LW9 A;  2LS5 A;  2IPA A;  3F3R A;  3TJG A;  1EEJ A;  4V2M A;  3ZRE A;  2L5O A;  3IHG A;  1SJI A;  5JWO B;  5ECL B;  1PKZ A;  1T7P B;  3IC8 A;  4I6X A;  1PL2 A;  5F8B A;  4JBB A;  2EC4 A;  4OFM A;  5ELG A;  2LQO A;  5LCZ A;  1YZX A;  2GLR A;  2B6M A;  3CSI A;  3F4T A;  3O3T A;  3DVW A;  4IGJ A;  4FIW A;  1F2E A;  2M80 A;  1ERU A;  2OBK A;  5F0G A;  1WE0 A;  3ME8 A;  3FY7 A;  3TUE A;  3KEB A;  5E59 A;  3D21 A;  2LTK A;  3O6T A;  2C3T A;  2P0G A;  1QUW A;  3GL5 A;  4PUR A;  2E7P A;  4IVF A;  1PMT A;  2X4A A;  3L78 A;  3G7I A;  2K8S A;  3HA9 A;  1OAZ A;  3IBH A;  3IK9 A;  4L8E A;  2MMA A;  5HR3 A;  2NVL A;  1FG4 A;  2KP1 A;  2BJX A;  3ZFL A;  2B3S A;  1N2A A;  6GSV A;  2KHP A;  1K0M A;  1ZMA A;  1EV4 A;  4J56 E;  5AIS A;  1GNW A;  1S3C A;  2YV7 A;  3VUR A;  1MD4 A;  4K5S A;  2IL3 A;  1Z9H A;  1QMV A;  1K0C A;  5D96 A;  3MWH A;  4K7N A;  4XRA A;  1A2M A;  2DIZ A;  1O73 A;  2G2Q A;  2RLI A;  1WRY A;  4WF5 A;  2HRF A;  4L5L A;  1CQG A;  3GN3 A;  1BED A;  3VWW A;  4XS4 B;  4Q5N A;  1OC8 A;  2H6X A;  3M3M A;  4OCE A;  4MH2 A;  3FEU A;  2O8V B;  1YEX A;  2V2G A;  1S3R A;  3L9U A;  3UL3 A;  5HR1 A;  4MF7 A;  2H8L A;  2AHE A;  2A2P A;  4ZL7 A;  3P2A A;  3VK9 A;  1EEM A;  4YQV A;  2GQL A;  5GAP D;  2LNT A;  4KND A;  4WXT A;  1PL1 A;  5ECM B;  1K3Y A;  1Z3E A;  2QGV A;  2C3Q A;  1GSD A;  4O5Q A;  2WB9 A;  3GMF A;  2GSS A;  11GS A;  4OWY A;  2IMK A;  3NIV A;  4MPG A;  2QKE A;  1B9X C;  4DSR A;  5ECQ B;  3QFB C;  1VF4 A;  5HFI A;  4FYU A;  2PVO C;  3QPM A;  1PFO A;  1DE1 A;  4ISD A;  2I9H A;  4PUA A;  4EE0 A;  2NBS A;  3ZIJ A;  1GUH A;  1SK0 A;  5DQY A;  1Z6M A;  3L0H A;  1O7U A;  3HHV A;  2LNS A;  2VD1 A;  2IIY A;  1K0N A;  1LBK A;  4GSS A;  2H75 A;  1OE8 A;  1Z6N A;  2FWG A;  4PNG A;  2LJR A;  5AIX A;  2HZE A;  2L6D A;  6GSU A;  1PGT A;  2B1L A;  4ZIJ A;  1V2A A;  1E2Y A;  16GS A;  4MA9 A;  1BAY A;  2ZNM A;  4Z2R A;  4YQM A;  1SKW B;  4GQC A;  5C04 A;  3ZVJ D;  2YCD A;  4L5O A;  2O85 A;  5H5S A;  4BWS A;  2P5R A;  1MD3 A;  4IJI A;  3GX8 A;  2VOC A;  1XG8 A;  1XFL A;  2YAN A;  1Q98 A;  3I9V 2;  1O8W A;  4GF0 A;  4KE3 A;  2C80 A;  2ON5 A;  2LEG A;  2DML A;  2LRT A;  4TXV A;  3TKS C;  3M1G A;  1TI1 A;  1J9B A;  3KH7 A;  4ULX A;  3ME7 A;  3EMX A;  4O7H A;  1FOH A;  5G31 A;  4TN8 A;  3C8E A;  4XIH A;  3R2Q A;  1X5E A;  4IP1 A;  1PX7 A;  2VAF A;  4G19 A;  3KCM A;  3WYW A;  4NV2 A;  1ML6 A;  5D8I A;  1GRX A;  2F9S A;  2EIR A;  1PQN A;  2IFQ A;  1W89 A;  1R26 A;  14GS A;  2IMI A;  4KB3 A;  5J5N A;  3MDK A;  3EWL A;  1M9B A;  4I2T A;  4WBJ A;  5LNK e;  4QQ7 A;  1Z7R A;  3P90 A;  3ERG A;  1EGR A;  1GUK A;  1X9W B;  4PQI A;  3EPT A;  4CHS A;  1GP1 A;  1OC9 A;  3VLN A;  1KTE A;  3HXS A;  5KN3 A;  2VUP A;  3VPT A;  2C0G A;  2HZF A;  2C4J A;  2RUF A;  2OAD A;  1GNE A;  6GST A;  2CVB A;  1QK8 A;  3QAV A;  4TOP A;  1MDJ A;  1R7H A;  1JZR A;  3MYD A;  3DRN A;  4ZB8 A;  3ZLP A;  1ZOF A;  2XPD A;  3PR8 A;  2N5A A;  3KIJ A;  12GS A;  1X5C A;  1JFU A;  1GTU A;  5IMD A;  1URM A;  2H6Z A;  2WCI A;  2QC7 A;  3LSZ A;  2AB6 A;  1GLP A;  1OYJ A;  3HJP A;  4G9H A;  5ID2 A;  4O5U A;  5CNW A;  4ZXG A;  2TIR A;  1B9Y C;  5IIZ A;  4RQX A;  2YNX A;  3UAP A;  2X8C A;  2H6Y A;  5AGY A;  4BA7 A;  5L71 A;  5HR0 A;  1M99 A;  1TK0 B;  2K6V A;  1THX A;  1AQX A;  2JAD A;  3CTG A;  2GS3 A;  1TJD A;  2REM A;  4EIQ A;  4PXO A;  3GTU A;  3IAS 2;  4HQZ A;  2OAC A;  3LXZ A;  3H1N A;  4XHM A;  2V41 A;  5H5R A;  5B8A A;  3KH9 A;  2H1A A;  3IPZ A;  3F0I A;  3QR6 A;  2DJ3 A;  4WKW A;  3CTF A;  1ST9 A;  2FWH A;  2F51 A;  3BBY A;  5B6N A;  4AJ8 A;  4K0G A;  2IJY A;  4K8M A;  3TCO A;  3EYT A;  4EF0 A;  1J0F A;  4IHU A;  2YJ7 A;  2ZUP A;  3WT2 A;  2DIY A;  3P7X A;  3D22 A;  4IQA A;  3TJK A;  1K0O A;  3ZVJ A;  2L5L A;  3Q18 A;  4TR1 B;  5A4V A;  5D9X A;  3G9B A;  2GTU A;  1M2A A;  18GS A;  3UVT A;  1YEP A;  3C73 A;  4N11 A;  1QGV A;  3VFI A;  3IA1 A;  4F0C A;  4TXO A;  3TKP A;  5J41 A;  5IOX A;  1VF2 A;  2NDO A;  3FHK A;  2DJ0 A;  4HDE A;  3HKR A;  6GSS A;  4CW9 A;  3UMA A;  3KJY A;  3KMN A;  3QAW A;  3H79 A;  2B7K A;  3FKF A;  4DSS B;  1XW9 A;  5ECI B;  3F8U A;  4POM A;  1CQH A;  3L4N A;  3HZ4 A;  1K0A A;  2A4H A;  5AIV A;  2HRN A;  1V57 A;  5ECP B;  1WIK A;  4G2E A;  4K2X A;  4AJ6 A;  3GSS A;  4P3Y B;  1XWK A;  3KD0 A;  3D4M A;  5G1L A;  2CT6 A;  3LQ7 A;  4RQR A;  4USS A;  1AXD A;  3C1S A;  5ELA A;  1XIY A;  2PER A;  4EXJ A;  3S9F A;  3QDN A;  2E0Q A;  1SK2 A;  4GWR A;  2GST A;  1G7E A;  4HZ2 A;  3HCZ A;  1XCC A;  4CY6 A;  3AY8 A; 
#chains in the Genus database with same CATH homology
 3ZRD A;  4EDZ A;  3VWU A;  2KOK A;  5J9B A;  2TRX A;  3R3E A;  3RDW A;  2PU9 C;  5IM9 A;  4HOJ A;  3CRU A;  1AAZ A;  3KMO A;  1AQW A;  2EIQ A;  2HRK A;  1V58 A;  3BCI A;  2VM2 A;  2VCQ A;  4KH7 A;  3UAR A;  3GUS A;  2K8V A;  5F05 A;  1ABA A;  4BVY B;  4EVM A;  2C1Y A;  5EPF A;  2V6K A;  3MAK A;  4IS0 A;  4IN0 A;  1GSQ A;  4K7O A;  1O85 A;  2R2J A;  5IO0 A;  2E2M A;  3RAZ A;  3D4T A;  2HSM A;  2FGX A;  2OA7 A;  4POK A;  2GT5 A;  5DQS A;  9GSS A;  2R0P A;  3GHA A;  1H4O A;  1S3D A;  5G30 A;  3ERF A;  4E8H A;  2WFC A;  2PWJ A;  3HVX A;  4LL4 B;  2L4C A;  2R3X A;  2ZCT A;  1B4Q A;  1HNA A;  2H76 A;  1SK1 A;  1EP8 A;  2X8G A;  1PKW A;  1ZYE A;  3F63 A;  3IR4 A;  4WET A;  2VLU A;  2LJK A;  2YZU A;  3I6A A;  3A2W A;  5J9C A;  1YY7 A;  4ZBB A;  2YOI A;  3H93 A;  5CRW A;  3EMP A;  4YKG A;  3ED3 A;  3VI7 A;  2X49 A;  2FWE A;  3TOT A;  5F07 A;  5DAL A;  2HE3 A;  1T4Z A;  4MNN A;  3UBK A;  3DWV A;  1FVK A;  2VL3 A;  3KTL A;  3D6I A;  3WGX A;  1U87 A;  3TJF A;  3KP9 A;  4ML1 A;  1BG5 A;  3E3E A;  2X64 A;  3E0U A;  1YJ6 A;  2L59 A;  2DBC A;  1K3O A;  4BVX A;  4EIP A;  3ZTL A;  4AF2 A;  3SBC A;  3JCM L;  5DAK B;  1AUC A;  4GRF A;  1B8X A;  4WBR D;  3C7M A;  1X9S B;  1VF1 A;  5B8B A;  4YQU A;  2GZP A;  4BL7 A;  4MAB A;  4MPF A;  2VLV A;  1TK5 B;  3RBT A;  5IMC A;  4KSM A;  2XHF A;  3Q6O A;  4QL7 A;  3U6V A;  5J4U A;  2PUK C;  3UEM A;  1F3B A;  5GST A;  4BWQ A;  2CZ2 A;  5HR2 A;  3VWV A;  3G7J A;  4PNF A;  5KN1 A;  3GRX A;  1A23 A;  1I5G A;  3MIX A;  5DJM A;  1A8L A;  1K3L A;  2AV4 A;  3F4R A;  5KN0 A;  1GTB A;  3F4S A;  4Q5F A;  2YV9 A;  4YAV A;  1XZO A;  4Q5Q A;  3IDV A;  4KAE A;  1ZL9 A;  2O87 A;  5C00 A;  1XW6 A;  4GSN A;  2DJK A;  5EY6 A;  4EO3 A;  3M9J A;  3GNJ A;  4LMV A;  2GQM A;  1TOF A;  2LRC A;  2VCV A;  3ZL5 A;  3EIN A;  1HD2 A;  3TKQ A;  4IW9 A;  4IKH A;  3OR5 A;  2ALB A;  2GVP A;  3TKS A;  5HFG A;  5D9W A;  1TXX A;  1XVW A;  1ACV A;  1F9M A;  2P31 A;  1XVQ A;  2XC2 A;  2HSY A;  5IQY A;  2B7J A;  2GT6 A;  2AJQ B;  1U6T A;  1NHY A;  4HJ2 A;  2JSY A;  2CVD A;  4GST A;  1SD9 A;  4HZ4 A;  5FT3 A;  2MYG A;  4AGS A;  1SL0 B;  1SL1 B;  3I43 A;  1GUM A;  3DML A;  3IRA A;  2CX4 A;  1TRU A;  1YF1 A;  3C1R A;  1T8E B;  3A5I A;  3DKS A;  1C72 A;  1ZYQ B;  5CRG A;  4X1U A;  3IK7 A;  1GL8 A;  3HD5 A;  1XWA A;  1PA3 A;  1QXH A;  4GXZ A;  1Z5Y E;  3SWL A;  3TRP A;  3K8N A;  2FA4 A;  2R0C A;  4PQH A;  4ECB A;  2B5X A;  5IOW A;  4J2F A;  4EDY A;  2HI7 A;  4JED A;  2IMF A;  2GGT A;  1Q4J A;  2VM1 A;  5IMF A;  4WF4 A;  3HY2 A;  4OFT A;  5ECH B;  2VCW A;  1JZO A;  2CX3 A;  3D0Z A;  3HDC A;  2GSR A;  4MMM A;  2N5F A;  1SD8 A;  3WT1 A;  4EL1 A;  3IXR A;  1SYX A;  4MDC A;  3FZA A;  3GST A;  3J7Y b;  4NHZ A;  4JU5 A;  1T00 A;  3W8J A;  3M9K A;  3FZ4 A;  4DVC A;  3QOU A;  1PRX A;  2V6O A;  1XWC A;  4ZIL A;  5CRE A;  1OC3 A;  17GS A;  4D73 A;  3GUR A;  1BJX A;  1PN0 A;  3QD9 A;  4YAP A;  1O81 A;  3VI5 A;  2ON7 A;  2VL9 A;  5DCH A;  20GS A;  1M2B A;  1O8X A;  2MMZ A;  3BCK A;  4L0U A;  4KX4 A;  1PSQ A;  1EOG A;  3EU4 A;  4FQU A;  1TRV A;  2YWM A;  1EV9 A;  4KA0 A;  2UZ8 A;  3UIW A;  4I5Q A;  2AYT A;  4J57 E;  5KN2 A;  3F9U A;  4CDO A;  1SU9 A;  5ECN B;  1SL2 B;  2DJ2 A;  1XXU A;  2JAC A;  2H1D A;  3WD6 A;  1BQ7 A;  1NW2 A;  5KEJ A;  2CAQ A;  5A4W A;  1U3I A;  4NWY A;  2AAW A;  5D9T A;  1XPV A;  1G6W A;  2MMN A;  1TW9 A;  4EUY A;  3CRT A;  1KNG A;  5IPH A;  3Q19 A;  4K6X A;  3TRX A;  3L9V A;  1GSY A;  1TDI A;  5KOX A;  3GL3 A;  4GCI A;  4TR0 A;  2IME A;  4RUV A;  4MP4 A;  1NHO A;  3VPQ A;  2EIO A;  3A5W A;  4K5R A;  3CXG A;  1A0F A;  4MLY A;  4IBP A;  1TRS A;  4MJB A;  4KDY A;  4IJ3 A;  1XW5 A;  1ZCP A;  2NPB A;  5GZZ B;  4DEJ A;  2H30 A;  4NXI A;  2JSZ A;  3IOS A;  2LQQ A;  2V1M A;  2DJ1 A;  2I3Y A;  3F6D A;  2PGT A;  4MF6 A;  8GSS A;  4XS6 A;  1AC1 A;  4FYC A;  1O6J A;  5B7C A;  2HZE B;  5BRT A;  3HZ8 A;  1A24 A;  2J23 A;  1BX9 A;  3LJR A;  2J9H A;  5D73 A;  3LG6 A;  4IEL A;  1DSB A;  2IMD A;  1GTI A;  3LEF A;  2YWN A;  4PX1 A;  2MBS A;  2IN3 A;  4G0K A;  5GAN D;  3C71 A;  3IE3 A;  3FMW A;  2YZH A;  2V32 A;  1F6M C;  4K7I A;  3ERW A;  2VL2 C;  4XS4 A;  4KW6 A;  1AIU A;  1M9A A;  2QSI A;  3H4K A;  2H19 A;  1MEK A;  1U88 A;  2RUE A;  2GZZ A;  3IHQ A;  1TKD B;  2NTO A;  5H5Q A;  1SKR B;  2HYX A;  3HYP A;  1DBY A;  1FB6 A;  3MSZ A;  1G0T A;  1HQO A;  3KTB A;  4DSQ A;  3TJB A;  3TDG A;  3GX0 A;  2CQ9 A;  2H66 A;  4E8E A;  4O32 A;  4TRX A;  3DGQ A;  2DJJ A;  3DYR A;  1Y6E A;  4F2I A;  1MDK A;  1R5P A;  2KP2 A;  2CAI A;  1JLW A;  1QFN A;  5IMA A;  1EZK A;  22GS A;  3U5R E;  1Y25 A;  2MZC A;  5FHI A;  3ZIV A;  2IFQ B;  2FHE A;  1IYI A;  4TKY A;  4YKF A;  5CO3 A;  2TRC P;  4KDX A;  1R5A A;  3EC3 A;  5IPG A;  5B6M A;  4LMW A;  1G7O A;  4F82 A;  1N8J A;  3TJJ A;  4I2U A;  4OMV A;  2R37 A;  3GH9 A;  2F8A A;  3KXO A;  1OC9 B;  1THO A;  1BYE A;  2L4Q A;  3E9J B;  3GIX A;  1WPI A;  2CZ3 A;  2PVQ A;  3QMX A;  4NHW A;  1A0R P;  2B5E A;  1FHE A;  5ECR B;  4GTU A;  2DMM A;  1Z7P A;  3I69 A;  1YKC A;  3PH9 A;  1TU8 A;  4FO5 A;  2H72 A;  2DKH A;  5EL8 A;  4GQF A;  3KZQ A;  2FLS A;  1GSE A;  2XPE A;  5ECO B;  4Z2U A;  2H0I A;  2BMX A;  3TKR A;  1J08 A;  4XTS A;  4POB A;  1XBS A;  4LLR A;  4ECC A;  2HT9 A;  5ID2 B;  4NPB A;  3TKS E;  1HYU A;  2CVK A;  2G0F A;  1G6Y A;  4WR5 A;  1ON4 A;  4WEY A;  3FW2 A;  1RW1 A;  4OO4 A;  5JWR B;  3G7Y A;  4IP6 A;  2JZS A;  2OE0 A;  4PUF C;  3MNG A;  1ILO A;  2Z9S A;  2F8F A;  1FB0 A;  2I81 A;  3RHB A;  1ZYP A;  2E2G A;  2RII A;  4MK3 A;  4G10 A;  1T3B A;  4N10 A;  5E4W A;  5D9V A;  3GTU B;  4NMU A;  2KLX A;  2AUV A;  4NAX A;  3ZZX A;  4F0B A;  1TU7 A;  3UBL A;  2X8H A;  3FR6 A;  4FYB A;  4FH8 A;  3P8W A;  1EGO A;  4Q5R A;  1XOA A;  2JU5 A;  3TOU A;  2F3M A;  5ECS A;  3FZ5 A;  2FD3 A;  2WUL A;  1EWX A;  2KUC A;  2LST A;  2PMT A;  4Z7X A;  2B5Y A;  1LU4 A;  5CYY A;  4HUA A;  1GSS A;  2HNL A;  2PBJ A;  3DD3 A;  4G0I A;  4ECI A;  3V1W A;  2FA8 A;  2YN1 A;  2P5Q A;  4A5P A;  4NV5 A;  2FY6 A;  3RPN A;  3APS A;  1GSU A;  2M46 A;  5G5E A;  1GUL A;  1WWJ A;  1H75 A;  2R5G A;  4OCF A;  4MZB A;  3F3Q A;  4ZBD A;  1T4Y A;  3KP8 A;  3LFL A;  5CRD A;  2C0D A;  1NM3 A;  4O92 A;  4TXO B;  2RM5 A;  3HJM A;  3EUR A;  2R0G A;  1X9M B;  4HI7 A;  3ZML A;  1ZZY A;  2WZ9 A;  3QAG A;  2WDU A;  3UVH A;  2OE3 A;  1QQ2 A;  1V9W A;  1WOU A;  2HXK A;  3QFA C;  4YH2 A;  2VLT A;  5IMZ A;  1JZD A;  4PTS A;  3LYK A;  2GDR A;  1ERW A;  3ZFB A;  5D93 A;  2A4V A;  1B4P A;  4EC0 A;  3D5J A;  6GSX A;  4TW5 A;  2DSA A;  3LXT A;  2HLS A;  4ZL8 A;  3GKN A;  5CRH A;  2JL4 A;  3KM6 A;  4L0W A;  2FUG 2;  1X5D A;  4ICY A;  4K9Z A;  4ZBA A;  3HVV A;  2H1B A;  1TI3 A;  4K0N A;  3GH6 A;  4HU9 A;  4JRR A;  4TVE A;  2OKA A;  2QA1 A;  2OJL A;  4MJC A;  3US3 A;  1TK8 B;  2D2Z A;  4EKZ A;  1FAA A;  5HFK A;  3ZYW A;  2FNO A;  1WP0 A;  4I8B A;  1A8Y A;  4JR4 A;  4ZL9 A;  5JCU A;  1JHB A;  4TR4 A;  5INY A;  1OKD A;  1HNB A;  2FCH A;  1TRW A;  1V40 A;  2VCT A;  5GSS A;  4K2D A;  2YWI A;  4MCU A;  3HVS A;  5COH A;  3PIN A;  4X4J A;  4X43 A;  4GLT A;  3FYG A;  4TR1 A;  1M7T A;  5DBQ A;  4X0X A;  1SKS B;  1A2L A;  1MDI A;  1SJZ A;  2HFD A;  4HU7 A;  1FVJ A;  3NZN A;  4Z2T A;  1YF0 A;  1OVN A;  3W8S A;  3J7Y k;  3UJ1 A;  3CSH A;  2R4V A;  1FO5 A;  4KCA A;  5G2Z A;  13GS A;  4JR6 A;  2GQK A;  3VWX A;  4KGI A;  3N5O A;  1VF3 A;  2C3N A;  4DSS A;  2DKI A;  1NSW A;  1SEN A;  4V2N A;  4MJE A;  4WR4 A;  1KBN A;  2N5B A;  4KF9 A;  2L6C A;  5BMU A;  1AQV A;  2LV3 A;  3TGZ A;  2H01 A;  2XBQ A;  1XWB A;  1OKT A;  2A2R A;  4V2L A;  1M2D A;  3H8Q A;  1UC7 A;  2CA8 A;  3CBU A;  4ACS A;  4MZC A;  2L57 A;  5ABR A;  1SYR A;  5JCW A;  1YKA A;  3FK8 A;  1R4W A;  4H86 A;  1AW9 A;  3WGD A;  4OD7 A;  4LL1 B;  2I1U A;  3M8N A;  5CAX A;  5DAL B;  3GKK A;  5A4U A;  3UOM A;  2H1G A;  4POL A;  3PGT A;  2LUS A;  3DVX A;  4F03 A;  2YWO A;  1B48 A;  4XCS A;  4PQ1 A;  4CY8 A;  4OFN A;  4BVX B;  1VGL A;  1A2J A;  4HS1 A;  1ZYN A;  3F6F A;  3IV4 A;  2A2S A;  2XBI A;  4O5R A;  2I4A A;  5ENU A;  5DJL A;  1ERV A;  5EVO A;  3LGC A;  4BVY A;  4BL7 B;  3ZMK A;  5A5K A;  1MTC A;  2VCZ A;  1T1V A;  4IQ1 A;  2M72 A;  3LWA A;  1EOH A;  3DEX A;  5F06 A;  2K9F A;  3RHC A;  3BD2 A;  3ZIT A;  1I9D A;  4ILF A;  3GYK A;  1K0D A;  3M0F A;  5AN1 A;  3QCP A;  4AJ7 A;  3RPP A;  2K18 A;  5G1K A;  2OBI A;  5CP1 A;  1GLQ A;  5DDL A;  1LJR A;  4ML6 A;  4XRD A;  5LD0 A;  1UA5 A;  2O7K A;  2PPT A;  2WS2 A;  3N9J A;  1XWG A;  4MZW A;  3GA4 A;  1F3A A;  1UN2 A;  5DVB A;  4F9Z A;  2WGR A;  2VL2 A;  4N30 A;  1DUG A;  3GKM A;  3L9S A;  1X0R A;  3CMI A;  1PD2 1;  1GH2 A;  1VRS D;  2VCX A;  4MJA A;  4XS1 A;  1WJK A;  3GV1 A;  1IYH A;  2WJU A;  1FOV A;  5JWQ B;  4V1A g;  4JE1 A;  1RK4 A;  3DIE A;  2OE1 A;  2MBT A;  2VO4 A;  2GSQ A;  4PGT A;  4MF5 A;  2C0E A;  3ISO A;  4TR3 A;  4ID0 A;  6GSY A;  4BPY A;  1F37 A;  3FR3 A;  2C0F A;  1JLV A;  4RI7 A;  3HJO A;  3NOF A;  1HNC A;  4HQS A;  3CYN A;  1PN9 A;  3APQ A;  3APO A;  1GSF A;  3WGE A;  2ES7 A;  4V1A p;  3LYP A;  1S3A A;  5DAK A;  4MH3 A;  3FZ9 A;  2CV4 A;  19GS A;  2HRA A;  3EE2 A;  5FWG A;  5IO2 A;  4N0V A;  3FRC A;  4ECJ A;  5IMV A;  4K1F A;  4ZB9 A;  2H0H A;  1WMJ A;  3Q74 A;  4LA1 A;  1M0U A;  3A3T A;  3GFK A;  2B1K A;  2R6K A;  1JZW A;  4KUN A;  1K0B A;  4HJM A;  2PN8 A;  2YPM A;  1E6B A;  5JCG A;  1EP7 A;  3FR9 A;  5ECK B;  2QA2 A;  1KEB A;  3A2X A;  3O76 A;  4G0L A;  4KSO A;  2HSH A;  2IWT A;  3TB2 A;  4RI6 A;  1ERT A;  4ZB6 A;  2YP6 A;  5G5F A;  1RQM A;  3KGK A;  1TTZ A;  2DC5 A;  4I97 A;  1YDK A;  2H71 A;  3EVI A;  2GZY A;  2JZT A;  4JZQ A;  2H74 A;  3TRQ A;  2LRN A;  1YQ1 A;  2C8U A;  3IAM 2;  3CSJ A;  5KOW A;  6GSW A;  4QL9 A;  2BTO T;  2RM6 A;  4D73 B;  2LJA A;  1SJ6 A;  3LOR A;  1GWC A;  3BOA A;  3EU3 A;  10GS A;  2VD0 A;  4KCE A;  1V98 A;  1U3A A;  5HQP A;  2MMO A;  1TP9 A;  4N0Z A;  1USB A;  1DE2 A;  3GKX A;  1W4V A;  2FWF A;  2WRT A;  3IC4 A;  2X99 A;  1GTA A;  4KDU A;  2H70 A;  3PPU A;  5J3R A;  1OE7 A;  5DCG A;  4OO5 A;  3BJ5 A;  4HEA 2;  1XOB A;  2DLX A;  2YJH A;  2VIM A;  7GSS A;  3A2V A;  2O89 A;  2LKU A;  2H0G A;  1FW1 A;  2JZR A;  3W6G A;  2H73 A;  1UVZ A;  1PX6 A;  3DXB A;  1ZGN A;  3LW9 A;  2LS5 A;  2IPA A;  3F3R A;  3TJG A;  1EEJ A;  4V2M A;  3ZRE A;  2L5O A;  3IHG A;  1SJI A;  5JWO B;  5ECL B;  1PKZ A;  1T7P B;  3IC8 A;  4I6X A;  1PL2 A;  5F8B A;  4JBB A;  2EC4 A;  4OFM A;  5ELG A;  2LQO A;  5LCZ A;  1YZX A;  2GLR A;  2B6M A;  3CSI A;  3F4T A;  3O3T A;  3DVW A;  4IGJ A;  4FIW A;  1F2E A;  2M80 A;  1ERU A;  2OBK A;  5F0G A;  1WE0 A;  3ME8 A;  3FY7 A;  3TUE A;  3KEB A;  5E59 A;  3D21 A;  2LTK A;  3O6T A;  2C3T A;  2P0G A;  1QUW A;  3GL5 A;  4PUR A;  2E7P A;  4IVF A;  1PMT A;  2X4A A;  3L78 A;  3G7I A;  2K8S A;  3HA9 A;  1OAZ A;  3IBH A;  3IK9 A;  4L8E A;  2MMA A;  5HR3 A;  2NVL A;  1FG4 A;  2KP1 A;  2BJX A;  3ZFL A;  2B3S A;  1N2A A;  6GSV A;  2KHP A;  1K0M A;  1ZMA A;  1EV4 A;  5AIS A;  4J56 E;  1GNW A;  1S3C A;  2YV7 A;  3VUR A;  1MD4 A;  4K5S A;  2IL3 A;  1Z9H A;  1QMV A;  1K0C A;  5D96 A;  3MWH A;  4K7N A;  4XRA A;  1A2M A;  2DIZ A;  1O73 A;  2G2Q A;  2RLI A;  1WRY A;  4WF5 A;  2HRF A;  4L5L A;  1CQG A;  3GN3 A;  1BED A;  3VWW A;  4XS4 B;  4Q5N A;  1OC8 A;  2H6X A;  3M3M A;  4OCE A;  4MH2 A;  3FEU A;  2O8V B;  1YEX A;  2V2G A;  3L9U A;  3UL3 A;  5HR1 A;  4MF7 A;  2H8L A;  2AHE A;  2A2P A;  4ZL7 A;  3P2A A;  3VK9 A;  1EEM A;  4YQV A;  2GQL A;  5GAP D;  2LNT A;  4KND A;  4WXT A;  1PL1 A;  5ECM B;  1K3Y A;  1Z3E A;  2QGV A;  2C3Q A;  1GSD A;  4O5Q A;  2WB9 A;  3GMF A;  2GSS A;  11GS A;  4OWY A;  2IMK A;  3NIV A;  4MPG A;  2QKE A;  1B9X C;  4DSR A;  5ECQ B;  3QFB C;  1VF4 A;  5HFI A;  4FYU A;  2PVO C;  3QPM A;  1DE1 A;  4ISD A;  2I9H A;  4PUA A;  4EE0 A;  2NBS A;  3ZIJ A;  1GUH A;  1SK0 A;  5DQY A;  1Z6M A;  3L0H A;  1O7U A;  3HHV A;  2LNS A;  2VD1 A;  2IIY A;  1K0N A;  1LBK A;  4GSS A;  2H75 A;  1OE8 A;  1Z6N A;  2FWG A;  4PNG A;  5AIX A;  2LJR A;  2HZE A;  2L6D A;  6GSU A;  1PGT A;  2B1L A;  4ZIJ A;  1V2A A;  1E2Y A;  16GS A;  4MA9 A;  1BAY A;  2ZNM A;  4Z2R A;  4YQM A;  1SKW B;  4GQC A;  5C04 A;  3ZVJ D;  2YCD A;  4L5O A;  2O85 A;  5H5S A;  4BWS A;  2P5R A;  1MD3 A;  4IJI A;  3GX8 A;  2VOC A;  1XFL A;  2YAN A;  1Q98 A;  3I9V 2;  1O8W A;  4GF0 A;  4KE3 A;  2C80 A;  2ON5 A;  2LEG A;  2DML A;  2LRT A;  4TXV A;  3TKS C;  3M1G A;  1TI1 A;  1J9B A;  3KH7 A;  4ULX A;  3ME7 A;  3EMX A;  4O7H A;  1FOH A;  5G31 A;  4TN8 A;  3C8E A;  4XIH A;  3R2Q A;  1X5E A;  4IP1 A;  1PX7 A;  2VAF A;  4G19 A;  3KCM A;  3WYW A;  4NV2 A;  1ML6 A;  5D8I A;  1GRX A;  2F9S A;  2EIR A;  1PQN A;  2IFQ A;  1W89 A;  1R26 A;  14GS A;  2IMI A;  4KB3 A;  5J5N A;  3MDK A;  3EWL A;  1M9B A;  4I2T A;  4WBJ A;  5LNK e;  4QQ7 A;  1Z7R A;  3P90 A;  3ERG A;  1EGR A;  1GUK A;  1X9W B;  4PQI A;  3EPT A;  4CHS A;  1GP1 A;  1OC9 A;  3VLN A;  1KTE A;  3HXS A;  5KN3 A;  2VUP A;  3VPT A;  2C0G A;  2HZF A;  2C4J A;  2RUF A;  2OAD A;  1GNE A;  6GST A;  2CVB A;  1QK8 A;  3QAV A;  4TOP A;  1MDJ A;  1R7H A;  1JZR A;  3MYD A;  3DRN A;  4ZB8 A;  3ZLP A;  1ZOF A;  2XPD A;  3PR8 A;  2N5A A;  3KIJ A;  12GS A;  1X5C A;  1JFU A;  1GTU A;  5IMD A;  1URM A;  2H6Z A;  2WCI A;  2QC7 A;  3LSZ A;  2AB6 A;  1GLP A;  1OYJ A;  3HJP A;  4G9H A;  5ID2 A;  4O5U A;  5CNW A;  4ZXG A;  2TIR A;  1B9Y C;  5IIZ A;  4RQX A;  2YNX A;  3UAP A;  2X8C A;  2H6Y A;  5AGY A;  4BA7 A;  5L71 A;  5HR0 A;  1M99 A;  1TK0 B;  2K6V A;  1THX A;  1AQX A;  2JAD A;  3CTG A;  2GS3 A;  1TJD A;  2REM A;  4EIQ A;  4PXO A;  3GTU A;  3IAS 2;  4HQZ A;  2OAC A;  3LXZ A;  3H1N A;  4XHM A;  2V41 A;  5H5R A;  5B8A A;  3KH9 A;  2H1A A;  3IPZ A;  3F0I A;  3QR6 A;  2DJ3 A;  4WKW A;  3CTF A;  1ST9 A;  2FWH A;  2F51 A;  3BBY A;  5B6N A;  4AJ8 A;  4K0G A;  2IJY A;  4K8M A;  3TCO A;  3EYT A;  4EF0 A;  1J0F A;  4IHU A;  2YJ7 A;  2ZUP A;  3WT2 A;  2DIY A;  3P7X A;  3D22 A;  4IQA A;  3TJK A;  1K0O A;  3ZVJ A;  2L5L A;  3Q18 A;  4TR1 B;  5A4V A;  5D9X A;  3G9B A;  2GTU A;  1M2A A;  18GS A;  3UVT A;  1YEP A;  3C73 A;  4N11 A;  1QGV A;  3VFI A;  3IA1 A;  4F0C A;  4TXO A;  3TKP A;  5J41 A;  5IOX A;  1VF2 A;  2NDO A;  3FHK A;  2DJ0 A;  4HDE A;  3HKR A;  6GSS A;  4CW9 A;  3UMA A;  3KJY A;  3KMN A;  3QAW A;  3H79 A;  2B7K A;  3FKF A;  4DSS B;  1XW9 A;  5ECI B;  3F8U A;  4POM A;  1CQH A;  3L4N A;  3HZ4 A;  1K0A A;  2A4H A;  5AIV A;  2HRN A;  1V57 A;  5ECP B;  1WIK A;  4G2E A;  4K2X A;  4AJ6 A;  3GSS A;  4P3Y B;  1XWK A;  3KD0 A;  3D4M A;  5G1L A;  2CT6 A;  3LQ7 A;  4RQR A;  4USS A;  1AXD A;  3C1S A;  5ELA A;  1XIY A;  2PER A;  4EXJ A;  3S9F A;  3QDN A;  2E0Q A;  1SK2 A;  4GWR A;  2GST A;  1G7E A;  4HZ2 A;  3HCZ A;  1XCC A;  4CY6 A;  3AY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...