2R2JA

Crystal structure of human erp44
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
370
structure length
328
Chain Sequence
b'TSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFNQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFSSPPESSFQKLAPSEYRYTLLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin domain-containing protein 4
publication title Crystal structure of human ERp44 shows a dynamic functional modulation by its carboxy-terminal tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 97
structure length 328
sequence length 370
ec nomenclature
pdb deposition date 2007-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
A PF13848 Thioredoxin_6 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2r2jA03
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2r2jA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2r2jA02
1BAYA 1BQ7A 3TJJA 3APOA 5G1KA 4BWSA 4IELA 5GAND 2GSSA 3L9VA 3CSIA 3UVTA 3EC3A 4BVYA 2AJQB 3LYPA 3HY2A 2DIZA 4XS4A 3FR9A 2LJAA 2V1MA 5HFIA 3ERWA 3CBUA 3CTGA 4EDZA 1TOFA 3LSZA 2QKEA 2GT5A 4OO5A 3U6VA 3HVVA 1M9AA 3FYGA 4O7HA 5GSTA 2OKAA 3EE2A 4ZL8A 1HQOA 14GSA 2WCIA 1NM3A 2M80A 4PQHA 1R5AA 3CYNA 3GX0A 4KDXA 5G31A 1DE2A 3HKRA 5AN1A 3ZVJD 4MPFA 1O8XA 3HZ4A 1R26A 4PNFA 4HS1A 5A5KA 1GRXA 3VPQA 2CVBA 4IJ3A 3DIEA 3Q74A 3UOMA 2XHFA 4LMWA 1K3LA 2QSIA 3FY7A 1PRXA 1XWBA 2DJ1A 3A2VA 4WETA 1S3AA 2H72A 2YNXA 2H73A 4ISDA 1Z9HA 3ZIVA 1YJ6A 3FEUA 2H66A 1GULA 3TB2A 4JRRA 3S9FA 3TJBA 2TIRA 5DAKA 4TW5A 4XRAA 3ZTLA 2B5XA 2IIYA 2DIYA 1PX7A 5D73A 2PWJA 4EO3A 1GUKA 3HHVA 2B6MA 1YY7A 2LS5A 2C0DA 3IC4A 2ON5A 4HEA2 5A4UA 5IMAA 4D73B 3EWLA 5LNKe 3F63A 4Q5FA 5CNWA 4P3YB 1T7PB 1FAAA 4GWRA 4ZBDA 4AJ7A 1KTEA 2YP6A 4POKA 3L78A 1B9XC 1XW5A 3F6DA 2B7KA 2H1DA 3MSZA 2VOCA 4TR1B 6GSYA 2L57A 1VRSD 1YEPA 1IYIA 3L9UA 3G7YA 3HA9A 3P2AA 2WFCA 4MF7A 2F9SA 3QCPA 1ZZYA 3NOFA 3BOAA 3TUEA 4I2TA 4JE1A 4OFTA 3PINA 1URMA 2IMFA 3HYPA 4RQRA 5GSSA 4V2MA 3J7Yk 2IMEA 2VD1A 2IWTA 3PGTA 1KEBA 5A4WA 1W4VA 2FWHA 4MABA 5G1LA 3DVWA 2IMDA 2CVDA 3HVXA 4HUAA 1T8EB 4PURA 1PL1A 2O8VB 2OBIA 1A0RP 1M9BA 4V1Ag 2H6XA 3I43A 1TRVA 2HRNA 1PKWA 3H8QA 2RIIA 4EC0A 2CZ2A 1PQNA 1XW9A 1JZOA 2FNOA 4KE3A 1M2BA 4ZILA 3H93A 1PMTA 2C3QA 3US3A 5ECMB 2OACA 9GSSA 4MZBA 5J9BA 4Q5RA 3UMAA 3F9UA 1TJDA 4ZB8A 2J9HA 3VWUA 1BJXA 3HJPA 2CVKA 4F0BA 2LNSA 2MMZA 4TR4A 4N11A 5GAPD 2GVPA 2HZEA 5COHA 3L0HA 4IVFA 2MMAA 3GN3A 4XTSA 3ZLPA 2Z9SA 1SK1A 2AHEA 5F07A 2H6ZA 2VAFA 4HQZA 3ZVJA 1VF2A 3GSSA 4WR5A 4TR0A 1ZCPA 5JWRB 2VM1A 4LMVA 3ZZXA 3WD6A 4ECJA 3F4RA 2X8GA 2YWNA 3C73A 5DAKB 4K1FA 2R4VA 5ECRB 1XVWA 1X9SB 1C72A 5HR3A 2WS2A 3E0UA 3C8EA 5KN2A 4HI7A 5J3RA 2R3XA 2LNTA 3VPTA 1T4YA 4K7NA 1TXXA 3CRUA 1Q4JA 4FIWA 5G2ZA 1Z5YE 4K9ZA 5D9XA 1J9BA 3D21A 2R37A 1EGOA 1XBSA 4HDEA 1X9MB 2NTOA 5D8IA 1NW2A 2GZYA 1UN2A 2LJRA 2F8AA 5IIZA 1U88A 3ERFA 1E2YA 1WPIA 1XIYA 1T00A 2EIOA 4IKHA 3G9BA 5CYYA 4EUYA 4E8HA 3BCIA 3D4TA 2IL3A 5J5NA 3GKNA 4HZ4A 3IBHA 1JZDA 2VD0A 1F37A 3KXOA 2WULA 5INYA 3DGQA 2I81A 2FA8A 3QFBC 1QQ2A 3TRXA 1A8LA 2OE1A 2P31A 2K6VA 3FR3A 3ZL5A 5IM9A 5IOXA 1J08A 3UVHA 1MDJA 2JACA 2B1LA 2JADA 2WGRA 3H4KA 3FZAA 2C8UA 3IE3A 1SD8A 1TRUA 1FB6A 1A0FA 5KN0A 4KDUA 3U5RE 6GSTA 4F2IA 1VF3A 2EIQA 3GKXA 1SD9A 3A5WA 4PXOA 2CQ9A 5DJLA 2GGTA 1OYJA 2AAWA 3FRCA 4NXIA 4BVXA 1BX9A 4Q5NA 3UARA 5J9CA 4GSSA 1K0DA 4KDYA 1A2MA 5D93A 4IQAA 2IFQB 2WZ9A 1Z7PA 2B5EA 3KMNA 2YCDA 3EVIA 5D9VA 2K8VA 4KW6A 5G5FA 3GSTA 3A3TA 3QD9A 1V58A 4OCEA 2H1AA 2XC2A 3C1SA 3DMLA 4MJEA 2I9HA 4PUFC 1TI3A 1SENA 3ME8A 3F8UA 1TP9A 3FZ5A 1OAZA 4L0WA 3KIJA 2DSAA 4ID0A 3HJMA 1U6TA 3CSHA 1WP0A 5HFGA 5IOWA 3GURA 2V2GA 4F82A 5JWOB 1OC3A 2C0FA 4NPBA 3VWWA 3RDWA 3H1NA 3L9SA 2OJLA 2H30A 3UBKA 1TRSA 3L4NA 4L5LA 4I8BA 3FHKA 2X99A 4L8EA 1TK8B 3GKKA 1UA5A 6GSSA 4FYUA 3HJOA 1SKSB 10GSA 3KM6A 5CRWA 2HRFA 3QPMA 5D9WA 2LTKA 4ZBAA 1GTBA 4ZXGA 3WT2A 5E4WA 3CMIA 4MH2A 5CP1A 3R2QA 2E7PA 4FYCA 4XS6A 1TRWA 3TKSE 1ERWA 5ID2A 4ECIA 3TDGA 2JZSA 4DSRA 3IPZA 4NV5A 2H6YA 2E2MA 1X5DA 1WJKA 3AY8A 2M46A 1B9YC 1AQWA 1BYEA 4IP6A 6GSXA 2DJJA 2WRTA 4K8MA 5IMZA 2WJUA 3GIXA 4GF0A 3E9JB 2AYTA 3LFLA 3W6GA 3UAPA 5DALA 1A2LA 1V57A 4JZQA 4FYBA 1Z6NA 1V98A 2RUEA 2DBCA 1ERUA 3Q18A 3SBCA 2XPDA 3LJRA 2C3TA 2L5LA 1OC9B 2L5OA 4LA1A 1T4ZA 1Z6MA 1AIUA 3FR6A 4WBRD 1PL2A 2CAIA 3TCOA 4GQCA 1S3CA 4K0NA 2MBSA 4ZL7A 1EP8A 4KSOA 2KP2A 4WEYA 4LLRA 1PSQA 2X64A 2H01A 1JHBA 4Z7XA 4KCAA 2C80A 3APSA 8GSSA 5JCUA 1DBYA 1QMVA 1Y25A 3PH9A 3KP9A 3O3TA 1X0RA 1PKZA 1GNEA 2A2SA 5J4UA 2TRXA 4YQVA 3HD5A 2PN8A 3UBLA 4I2UA 1MDIA 2H1BA 4YH2A 2YOIA 1EWXA 4FO5A 4IGJA 4F9ZA 1HD2A 2K9FA 1OKTA 3Q6OA 2B5YA 3QFAC 1XZOA 2H1GA 2YN1A 2X8HA 1Q98A 4EVMA 5DJMA 1T3BA 1QXHA 2C0GA 4YQMA 3ZYWA 1JZRA 2BTOT 1SL0B 3TKSC 3F0IA 5B8BA 3F4SA 2FHEA 1YEXA 1PN9A 4J57E 1ERVA 2YJHA 1PX6A 1SKWB 4EXJA 1GNWA 3M9JA 4NV2A 2XBIA 2JL4A 3ZFLA 3M3MA 3JCML 2GSRA 2FCHA 4G9HA 4RI6A 4RQXA 3IAS2 2H71A 2R5GA 1FVJA 3TGZA 4ECBA 3LQ7A 1VGLA 2DMMA 3QDNA 5DQYA 1WE0A 1BG5A 4TVEA 2WDUA 3ERGA 3GKMA 4OD7A 1XWKA 3SWLA 2L4CA 4OFNA 4IP1A 2CX4A 1ACVA 5ELGA 1GSFA 2YJ7A 3BD2A 2LKUA 4E8EA 1S3DA 4XS4B 2FGXA 4KX4A 3UIWA 3GNJA 2H8LA 2H0GA 5D9TA 4POLA 2ON7A 2YV9A 4XRDA 5AISA 2AV4A 5CRDA 3CTFA 1FO5A 1GWCA 2O7KA 5CAXA 4HQSA 3IV4A 4NHZA 3TJFA 3MAKA 4TXOA 1R4WA 4X1UA 3P90A 3KEBA 3W8JA 3IOSA 2G2QA 4ULXA 4MH3A 2CX3A 3EMPA 3VLNA 4DSQA 1TU8A 2N5FA 3GTUA 2FUG2 1U3IA 1WOUA 2VL3A 7GSSA 4WF5A 4TN8A 5D96A 4MDCA 2GQLA 1MD3A 2OE0A 3I69A 2VLUA 2HSYA 4MZWA 1F9MA 5G30A 1YF1A 2D2ZA 4O32A 4N0VA 1HNAA 3IK9A 3KP8A 4K0GA 3F4TA 2MYGA 4MLYA 3RHCA 3DYRA 1USBA 4IBPA 1RW1A 2H19A 4K7OA 1RQMA 4RI7A 2N5AA 4L0UA 1XWCA 1PGTA 1O85A 3Q19A 2NVLA 4NAXA 3E3EA 4GRFA 4GTUA 3HXSA 1TK0B 2O85A 5F06A 4MMMA 4G2EA 3EMXA 2DJ0A 4K2DA 2LJKA 2YANA 5ABRA 5HR2A 4LL1B 2VIMA 4OFMA 4ECCA 1R5PA 1GUMA 1O7UA 4HZ2A 1EEJA 4XHMA 1WRYA 1DUGA 3NIVA 1XWGA 1DE1A 1VF4A 1Y6EA 2OADA 1J0FA 5DVBA 2L6DA 3VURA 2E2GA 3GX8A 2DJKA 1NHYA 2XBQA 4WKWA 4POBA 2B7JA 2V32A 5CRGA 2NBSA 3GUSA 3M8NA 1FHEA 3K8NA 2V6OA 1BEDA 2FLSA 4DSSA 3MNGA 4ML6A 4BPYA 19GSA 1F2EA 2GLRA 2PMTA 2RUFA 4J2FA 3FW2A 1G0TA 5IPGA 2GDRA 4CDOA 4OWYA 1ZMAA 4IN0A 3KMOA 1EV9A 5H5SA 2G0FA 5FT3A 5E59A 3HZ8A 1X9WB 5IO2A 2AB6A 3KH7A 1YKCA 3IA1A 3IK7A 1K0MA 3TKRA 3TOUA 1GSQA 2HI7A 3G7JA 2X8CA 1GSSA 5B6NA 1XFLA 5FWGA 1JFUA 1V2AA 3V1WA 4F0CA 3QMXA 3P7XA 1TDIA 4LL4B 2VCZA 2GQKA 2GZZA 1YKAA 1TK5B 2MMOA 5LD0A 2LQOA 4GSTA 1LBKA 11GSA 1H75A 1VF1A 2A2RA 2P0GA 4Q5QA 3CSJA 5HR1A 1ERTA 3KTBA 5IMVA 2P5QA 3DVXA 4GCIA 4TKYA 1V40A 2HLSA 2VLVA 2HT9A 3G7IA 5ECKB 5IMDA 1A24A 5HR0A 3D5JA 3C71A 3GHAA 3KCMA 1GTUA 4KGIA 4PUAA 4FH8A 4ILFA 2HZEB 2XPEA 1O81A 4KUNA 2KOKA 4AJ8A 3MDKA 1FG4A 4AGSA 3N9JA 2DMLA 1LU4A 2HZFA 4OCFA 1I5GA 4DEJA 1SL1B 4MJAA 4MF6A 2BJXA 2LRNA 1FB0A 2K8SA 4EL1A 4KA0A 4MJCA 4TR3A 3IDVA 3GV1A 3WT1A 1B48A 4D73A 5B6MA 5IMFA 1OC8A 5C04A 1ZYEA 1WMJA 1KNGA 3ZITA 1K0BA 1RK4A 2BMXA 2ES7A 2LEGA 3GA4A 2QGVA 1B4QA 1ABAA 1FVKA 2YV7A 4BWQA 2HXKA 3ZRDA 1F6MC 4GSNA 3F3RA 1SJ6A 1MEKA 1TKDB 2IMIA 4TR1A 5DBQA 4ACSA 2KLXA 3TKQA 2LUSA 2E0QA 3N5OA 3QR6A 2QC7A 3KZQA 3QAVA 6GSWA 3HCZA 3KH9A 1JLVA 1FOVA 3GYKA 3TOTA 4I5QA 3IAM2 2OA7A 1YQ1A 2LQQA 5AGYA 5KN3A 1SKRB 2RLIA 5ECPB 4WBJA 1MD4A 3EYTA 4HJMA 3IXRA 3KJYA 4N30A 2VCXA 3GH6A 2JSYA 1AUCA 2JSZA 2C0EA 1ZOFA 3MWHA 4JR4A 1H4OA 3FK8A 1QFNA 1TW9A 3GH9A 5EL8A 4ZB9A 4JBBA 4J56E 5B8AA 4IS0A 2AUVA 2VM2A 1HNCA 1ZL9A 5DCHA 3UL3A 3GFKA 3IRAA 3QAGA 1M0UA 5JCGA 1SK2A 1IYHA 2GSTA 4IHUA 12GSA 2PVOC 1G7OA 1ML6A 3M0FA 3VWVA 3RPNA 3I9V2 4PGTA 2GSQA 3TJKA 2JZRA 3IR4A 4G19A 4NWYA 4DVCA 3C7MA 5CRHA 3O76A 1R7HA 4N0ZA 1GH2A 18GSA 4N10A 4I6XA 2FD3A 1F3AA 4MZCA 13GSA 4KB3A 2DC5A 4O92A 1DSBA 3ISOA 1PA3A 3F6FA 2H74A 1GSEA 2L6CA 4POMA 2DJ3A 3ED3A 3M1GA 2HFDA 1GUHA 1WIKA 1SU9A 3VI5A 1YF0A 3M9KA 5JCWA 1XW6A 1JLWA 2C4JA 4HU9A 4EE0A 1AXDA 5ECHB 1KBNA 4RUVA 2F3MA 2A4VA 1M7TA 4V2NA 16GSA 5B7CA 2PVQA 2VCTA 4GLTA 2B1KA 1A2JA 2PUKC 4NHWA 2KP1A 3O6TA 2F8FA 2N5BA 2PERA 2C1YA 5AIXA 1AW9A 1GTIA 2CZ3A 1QGVA 5DDLA 4YQUA 1GP1A 5ECOB 2I3YA 1SJZA 1B4PA 2IJYA 3J7Yb 3RBTA 2V41A 2CV4A 5IPHA 1M99A 2FY6A 5FHIA 2L4QA 1XOBA 1SYRA 4EKZA 1ZYQB 1YZXA 2NDOA 1GTAA 2PPTA 4F03A 2P5RA 3VFIA 2IN3A 1WWJA 1Z3EA 2WB9A 4TRXA 3D6IA 2R2JA 1A8YA 4IJIA 2L59A 3TRPA 2TRCP 3BBYA 5ID2B 3FZ9A 4KH7A 4MA9A 4HU7A 1N8JA 4KAEA 1GLQA 2O87A 4JEDA 2H0IA 2MBTA 3WYWA 1XWAA 2R6KA 4MJBA 4WR4A 1XXUA 1OE7A 4TXVA 5C00A 3GL5A 4MF5A 1A23A 2DLXA 2YZHA 5EVOA 1XVQA 6GSUA 3DRNA 1X5EA 2FWGA 4MP4A 4NMUA 3WGEA 2FWEA 2KHPA 1TU7A 1K3YA 2KUCA 5DALB 1V9WA 4AJ6A 3DXBA 1N2AA 2YWOA 5F05A 3LEFA 2DJ2A 1THXA 3CRTA 3H79A 3OR5A 5F0GA 3RAZA 2VCVA 2H0HA 1EGRA 3WGDA 1GSDA 1EP7A 4L5OA 2GS3A 2ALBA 3D22A 2YPMA 4BA7A 3UJ1A 1O6JA 1YDKA 2GQMA 1O73A 2IFQA 2JZTA 3ZIJA 2OE3A 2MMNA 4V1Ap 4OMVA 4XS1A 3W8SA 4KSMA 1QUWA 4CW9A 1AAZA 2VUPA 5ECQB 17GSA 2EC4A 1OKDA 3VWXA 3FZ4A 4X0XA 5KN1A 1F3BA 1B8XA 5KEJA 3LGCA 5LCZA 4GXZA 4PQ1A 3EURA 1THOA 3LWAA 3GL3A 3CXGA 4ZL9A 2VO4A 1EZKA 5ELAA 1I9DA 2PGTA 1G7EA 1K0NA 2GT6A 20GSA 5HFKA 4QL9A 2LSTA 3KTLA 5A4VA 2VL2A 3BCKA 1X5CA 4MPGA 1K0OA 4WF4A 1G6WA 2V6KA 4AF2A 5ECIB 4H86A 5DQSA 3EINA 2GTUA 1AQVA 1GSUA 2ZCTA 5ENUA 2HE3A 5ECSA 2YWMA 3QAWA 4PNGA 3ZFBA 3APQA 5CREA 5IMCA 3EU4A 3LYKA 4V2LA 1T1VA 1K3OA 3C1RA 1GSYA 2VL9A 1E6BA 1O8WA 1U3AA 1FW1A 4PX1A 3TJGA 1GL8A 4K7IA 2CT6A 2FA4A 2K18A 3WGXA 1M2DA 2REMA 4XIHA 4CHSA 1SK0A 1UC7A 3ZREA 3QOUA 2LV3A 1AQXA 3RPPA 4QL7A 1JZWA 3LORA 3VK9A 4MCUA 2YWIA 3ME7A 2I1UA 3D4MA 4KNDA 1PD21 4HOJA 2M72A 3LG6A 3D0ZA 2IMKA 4EDYA 2LRTA 1XPVA 1NHOA 4IQ1A 3F3QA 2GZPA 1QK8A 2I4AA 1SYXA 5IO0A 3FKFA 3UEMA 2CAQA 4TOPA 2FWFA 22GSA 1K0AA 5EPFA 2H76A 1OC9A 5F8BA 1OVNA 4BL7A 2PU9C 2OBKA 4G10A 5EY6A 2HSHA 3DD3A 4TXOB 4K6XA 5DCGA 1EEMA 2VCQA 4I97A 2ZUPA 3BJ5A 4ZIJA 1U87A 2HYXA 3HVSA 2PBJA 5AIVA 5HQPA 3LXTA 1EV4A 2CA8A 3ZMKA 3GTUB 4OO4A 1G6YA 2EIRA 4IW9A 4ZBBA 3TKSA 1UVZA 1ZGNA 2RM6A 5JWQB 4X43A 1EOGA 3PR8A 1HNBA 5GZZB 2RM5A 1XCCA 1AC1A 1SL2B 5J41A 3VI7A 2ZNMA 2H75A 4MK3A 1ON4A 1W89A 3DEXA 1CQGA 4JU5A 2J23A 3TRQA 2HNLA 5H5RA 3LXZA 5ECNB 1MDKA 4ML1A 4WXTA 2O89A 1K0CA 2LRCA 4YAPA 4PQIA 1EOHA 1TI1A 3DWVA 5G5EA 3A2XA 3NZNA 1ST9A 2IPAA 3KGKA 5L71A 2VLTA 2YZUA 1NSWA 4O5RA 1SJIA 1GLPA 5CO3A 4JR6A 6GSVA 3RHBA 4HJ2A 1TTZA 1MTCA 2VCWA 3GMFA 3GRXA 2MZCA 1Z7RA 4XCSA 3P8WA 5H5QA 1ILOA 3HDCA 4ZB6A 2F51A 4QQ7A 2C3NA 4GQFA 3TKPA 1M2AA 2VL2C 3A2WA 3KD0A 1HYUA 1LJRA 4KCEA 1OE8A 4DSSB 1XOAA 4EF0A 3IHQA 3EU3A 2B3SA 5ECLB 3DKSA 3I6AA 5IQYA 1CQHA 2H70A 3ZMLA 4YAVA 2NPBA 2JU5A
chains in the Genus database with same CATH superfamily
1BAYA 1BQ7A 3TJJA 3APOA 5G1KA 4BWSA 4IELA 5GAND 2GSSA 3L9VA 3CSIA 3UVTA 4A5PA 3EC3A 4BVYA 2AJQB 3LYPA 3HY2A 2DIZA 4XS4A 3FR9A 2LJAA 2V1MA 5HFIA 3ERWA 3CBUA 3CTGA 4EDZA 1TOFA 3LSZA 2QKEA 2GT5A 3MYDA 4OO5A 3U6VA 3HVVA 1M9AA 3FYGA 3CQFA 4O7HA 5GSTA 2OKAA 3EE2A 4ZL8A 1HQOA 14GSA 2WCIA 1NM3A 2M80A 4PQHA 1R5AA 3CYNA 3GX0A 4KDXA 5G31A 1DE2A 3HKRA 5AN1A 3ZVJD 4MPFA 4MNNA 1O8XA 3HZ4A 1R26A 4PNFA 4HS1A 5A5KA 1GRXA 3VPQA 2CVBA 4IJ3A 3DIEA 3Q74A 3UOMA 2XHFA 4LMWA 1K3LA 2QSIA 3FY7A 1PRXA 1XWBA 2DJ1A 3A2VA 4WETA 1S3AA 2H72A 2YNXA 2H73A 4ISDA 1Z9HA 3ZIVA 1YJ6A 3FEUA 2H66A 1GULA 3TB2A 4JRRA 3S9FA 3TJBA 2TIRA 5DAKA 4TW5A 4XRAA 3ZTLA 2B5XA 2IIYA 2DIYA 1PX7A 5D73A 2PWJA 4EO3A 1GUKA 3HHVA 2B6MA 1YY7A 2LS5A 2C0DA 3IC4A 2ON5A 4HEA2 5A4UA 5IMAA 4D73B 3EWLA 5LNKe 3F63A 4Q5FA 5CNWA 4P3YB 1T7PB 2A4HA 1FAAA 4GWRA 4ZBDA 4AJ7A 1KTEA 2YP6A 4POKA 3L78A 1B9XC 1XW5A 3F6DA 2B7KA 2H1DA 3MSZA 2VOCA 4TR1B 6GSYA 2L57A 1VRSD 1YEPA 1IYIA 3L9UA 3G7YA 3HA9A 3P2AA 2WFCA 4MF7A 2F9SA 3QCPA 1ZZYA 3NOFA 3BOAA 3TUEA 4I2TA 4JE1A 4OFTA 3PINA 1URMA 2IMFA 4X4JA 3HYPA 4RQRA 5GSSA 4V2MA 3J7Yk 2IMEA 2VD1A 2IWTA 3PGTA 1KEBA 5A4WA 1W4VA 2FWHA 4MABA 5G1LA 3DVWA 2IMDA 2CVDA 3HVXA 4HUAA 1T8EB 4PURA 1PL1A 2O8VB 2OBIA 1A0RP 4Z2RA 1M9BA 2HSMA 4V1Ag 2H6XA 3I43A 1TRVA 2HRNA 1PKWA 3H8QA 2RIIA 4EC0A 2CZ2A 1PQNA 1XW9A 1JZOA 2FNOA 4KE3A 1M2BA 4ZILA 3H93A 1PMTA 2C3QA 3US3A 5ECMB 2OACA 9GSSA 4MZBA 5J9BA 4Q5RA 3UMAA 3F9UA 1TJDA 4ZB8A 2J9HA 3VWUA 1BJXA 3HJPA 2CVKA 4F0BA 2LNSA 2MMZA 4TR4A 4N11A 5GAPD 2GVPA 2HZEA 5COHA 3L0HA 4IVFA 2MMAA 3GN3A 3EPTA 4XTSA 3ZLPA 2Z9SA 1SK1A 2AHEA 5F07A 2H6ZA 2VAFA 4HQZA 3ZVJA 1VF2A 3GSSA 4WR5A 4TR0A 1ZCPA 5JWRB 2VM1A 4LMVA 3ZZXA 3WD6A 4ECJA 3F4RA 2X8GA 2YWNA 3C73A 5DAKB 4K1FA 2R4VA 5ECRB 1XVWA 1X9SB 1C72A 5HR3A 2WS2A 3E0UA 3C8EA 5KN2A 4HI7A 5J3RA 2R3XA 2LNTA 3VPTA 1T4YA 4K7NA 1TXXA 3CRUA 1Q4JA 4FIWA 5G2ZA 1Z5YE 4K9ZA 5D9XA 1J9BA 3D21A 2R37A 1EGOA 1XBSA 4HDEA 1X9MB 2NTOA 5D8IA 1NW2A 2GZYA 1UN2A 2LJRA 2F8AA 5IIZA 4CY8A 1U88A 3ERFA 1E2YA 1WPIA 1XIYA 1T00A 2EIOA 4IKHA 3G9BA 5CYYA 4EUYA 4E8HA 3BCIA 3D4TA 2IL3A 5J5NA 3GKNA 4HZ4A 4Z2UA 3IBHA 1JZDA 2VD0A 1ZYNA 1F37A 3KXOA 2WULA 5INYA 3DGQA 2I81A 2FA8A 3QFBC 1QQ2A 3TRXA 1A8LA 2OE1A 2P31A 2K6VA 3FR3A 3ZL5A 5IM9A 5IOXA 1J08A 3UVHA 1MDJA 2JACA 2B1LA 2JADA 2WGRA 3H4KA 3FZAA 2C8UA 3IE3A 1SD8A 1TRUA 1FB6A 1A0FA 5KN0A 4KDUA 3U5RE 6GSTA 4ICYA 4F2IA 1VF3A 2EIQA 3GKXA 1SD9A 3A5WA 4PXOA 2CQ9A 5DJLA 2GGTA 1OYJA 2AAWA 3FRCA 4NXIA 4BVXA 1BX9A 4Q5NA 3UARA 5J9CA 4GSSA 1K0DA 4KDYA 1A2MA 5D93A 4IQAA 2IFQB 2WZ9A 1Z7PA 2B5EA 3KMNA 2YCDA 3EVIA 5D9VA 2K8VA 4KW6A 5G5FA 3GSTA 3A3TA 3QD9A 1V58A 4OCEA 2H1AA 2XC2A 3C1SA 3DMLA 4MJEA 2I9HA 4PUFC 1TI3A 4BIKA 1SENA 3ME8A 3F8UA 1TP9A 4G0IA 3FZ5A 1OAZA 4L0WA 3KIJA 2DSAA 4ID0A 3HJMA 1U6TA 3CSHA 1WP0A 5HFGA 5IOWA 3GURA 2V2GA 4F82A 5JWOB 1OC3A 2C0FA 4NPBA 3VWWA 3RDWA 3H1NA 4CY6A 3L9SA 2OJLA 2H30A 3UBKA 1TRSA 3L4NA 4L5LA 4I8BA 3FHKA 2X99A 4L8EA 1TK8B 3GKKA 1UA5A 6GSSA 4FYUA 3HJOA 1SKSB 10GSA 3KM6A 4G0LA 5CRWA 2HRFA 3QPMA 5D9WA 2LTKA 4ZBAA 1GTBA 5BRTA 4ZXGA 3WT2A 5E4WA 3CMIA 4MH2A 5CP1A 3R2QA 2E7PA 4FYCA 4XS6A 1TRWA 3TKSE 1ERWA 5ID2A 4ECIA 3TDGA 2JZSA 4O5QA 4DSRA 3IPZA 4NV5A 5BMUA 2H6YA 2E2MA 1X5DA 3FMWA 1WJKA 3AY8A 2M46A 1B9YC 1AQWA 1BYEA 4IP6A 6GSXA 2DJJA 2WRTA 4K8MA 5IMZA 2WJUA 3GIXA 4GF0A 3E9JB 2AYTA 3LFLA 3W6GA 3UAPA 5DALA 1A2LA 1V57A 4JZQA 4FYBA 1Z6NA 1V98A 2RUEA 2DBCA 1ERUA 3Q18A 3SBCA 2XPDA 3LJRA 2C3TA 2L5LA 1OC9B 2L5OA 4LA1A 1T4ZA 1Z6MA 1AIUA 3FR6A 2QA1A 4WBRD 1PL2A 2CAIA 4BL7B 3TCOA 4GQCA 1S3CA 4K0NA 2MBSA 4ZL7A 1EP8A 4KSOA 2KP2A 4WEYA 4LLRA 1PSQA 2X64A 2H01A 1JHBA 4Z7XA 4KCAA 2C80A 3APSA 8GSSA 5JCUA 1DBYA 1QMVA 1Y25A 3PH9A 3KP9A 3O3TA 1X0RA 1PKZA 1GNEA 2A2SA 5J4UA 2TRXA 4YQVA 3HD5A 2PN8A 3UBLA 4I2UA 1MDIA 2H1BA 4YH2A 2YOIA 1EWXA 4FO5A 4IGJA 4F9ZA 1HD2A 2K9FA 1OKTA 3Q6OA 2B5YA 3QFAC 1XZOA 4FQUA 2H1GA 2YN1A 2X8HA 1Q98A 4EVMA 5DJMA 1T3BA 1QXHA 2C0GA 4YQMA 3ZYWA 1JZRA 2BTOT 1SL0B 3TKSC 3F0IA 5B8BA 3F4SA 2FHEA 1YEXA 1PN9A 4J57E 1ERVA 2YJHA 1PX6A 1SKWB 4EXJA 1GNWA 3M9JA 4NV2A 3A5IA 2XBIA 2JL4A 3ZFLA 3M3MA 3JCML 2GSRA 2FCHA 4G9HA 4RI6A 4RQXA 3IAS2 2H71A 2R5GA 1FVJA 5KOWA 3TGZA 4ECBA 3LQ7A 1VGLA 2DMMA 3QDNA 5DQYA 1WE0A 1BG5A 1S3RA 4TVEA 2WDUA 3ERGA 3GKMA 4OD7A 1XWKA 3SWLA 2L4CA 4OFNA 4IP1A 2CX4A 4KF9A 4BVYB 1ACVA 5ELGA 1GSFA 2YJ7A 3BD2A 2LKUA 4E8EA 1S3DA 4XS4B 2FGXA 4KX4A 3UIWA 3GNJA 2H8LA 2H0GA 5D9TA 4POLA 2ON7A 2YV9A 4XRDA 5AISA 2AV4A 5CRDA 3CTFA 1FO5A 1GWCA 2O7KA 5CAXA 4HQSA 3IV4A 4NHZA 4O5UA 3TJFA 3MAKA 4TXOA 1R4WA 4X1UA 3P90A 3KEBA 3W8JA 3IOSA 1M3IA 2G2QA 4ULXA 4MH3A 2CX3A 3EMPA 3VLNA 4DSQA 1TU8A 2N5FA 3GTUA 2FUG2 1U3IA 1WOUA 2VL3A 7GSSA 4WF5A 4TN8A 5D96A 4MDCA 2GQLA 1MD3A 2OE0A 3I69A 2VLUA 2HSYA 4MZWA 1F9MA 2X49A 5G30A 1YF1A 2D2ZA 4O32A 4N0VA 1HNAA 3IK9A 3KP8A 4K0GA 3F4TA 2MYGA 4MLYA 3RHCA 3DYRA 1USBA 4IBPA 1RW1A 2H19A 4K7OA 1RQMA 4RI7A 2N5AA 4K5SA 4L0UA 1XWCA 1PGTA 1O85A 3Q19A 2NVLA 4NAXA 3E3EA 4GRFA 4GTUA 3HXSA 1TK0B 2O85A 4K5RA 5F06A 4MMMA 4G2EA 3EMXA 2DJ0A 4PTSA 4EIQA 4K2DA 2LJKA 2YANA 5ABRA 5HR2A 4LL1B 2VIMA 3IC8A 4OFMA 4ECCA 1R5PA 1GUMA 1O7UA 5KOXA 4HZ2A 2QA2A 1EEJA 2DKIA 4XHMA 1WRYA 1DUGA 3NIVA 1XWGA 1DE1A 1VF4A 1Y6EA 2OADA 1J0FA 5DVBA 2L6DA 3VURA 2E2GA 3GX8A 2DJKA 1NHYA 2XBQA 4WKWA 4POBA 2B7JA 2V32A 5CRGA 2NBSA 3GUSA 3M8NA 1FHEA 3K8NA 2V6OA 1BEDA 2FLSA 4DSSA 3MNGA 4ML6A 4BPYA 19GSA 1F2EA 2GLRA 2PMTA 2RUFA 4J2FA 3FW2A 1G0TA 2R0GA 5IPGA 2GDRA 4CDOA 4OWYA 1ZMAA 4IN0A 3KMOA 1EV9A 5H5SA 2G0FA 5FT3A 5E59A 3HZ8A 1X9WB 5IO2A 2AB6A 3KH7A 1YKCA 3IA1A 3IK7A 1K0MA 3TKRA 3TOUA 1GSQA 2HI7A 3G7JA 2X8CA 1GSSA 5B6NA 1XFLA 5FWGA 1JFUA 1V2AA 3V1WA 4F0CA 3QMXA 3P7XA 1TDIA 4LL4B 2VCZA 4K2XA 2GQKA 2GZZA 1YKAA 1TK5B 2MMOA 5LD0A 2LQOA 4GSTA 1LBKA 11GSA 1H75A 1VF1A 2A2RA 2P0GA 4Q5QA 3CSJA 5HR1A 1ERTA 3KTBA 5IMVA 2P5QA 3DVXA 4GCIA 4TKYA 1V40A 2HLSA 2VLVA 2HT9A 3G7IA 5ECKB 5IMDA 1A24A 5HR0A 3D5JA 3C71A 3GHAA 3KCMA 1GTUA 4KGIA 4PUAA 4FH8A 4ILFA 1XG8A 2HZEB 2XPEA 1O81A 4KUNA 2KOKA 4AJ8A 3MDKA 1FG4A 4AGSA 3N9JA 2DMLA 1LU4A 2HZFA 4OCFA 1I5GA 4DEJA 1SL1B 4MJAA 4MF6A 2BJXA 2LRNA 1FB0A 2K8SA 4EL1A 4KA0A 4MJCA 4TR3A 3IDVA 3GV1A 3WT1A 1B48A 4D73A 5B6MA 5IMFA 1OC8A 5C04A 1ZYEA 1WMJA 1KNGA 3ZITA 1K0BA 1RK4A 2BMXA 2ES7A 2LEGA 3GA4A 2QGVA 1B4QA 1ABAA 1FVKA 2YV7A 4BWQA 2HXKA 3ZRDA 1F6MC 4GSNA 3F3RA 1SJ6A 1MEKA 1TKDB 2IMIA 4TR1A 5DBQA 4ACSA 2KLXA 3TKQA 2LUSA 2E0QA 3N5OA 3QR6A 2QC7A 3KZQA 3QAVA 2UZ8A 6GSWA 3HCZA 3KH9A 1JLVA 1FOVA 3GYKA 3TOTA 4I5QA 3IAM2 2OA7A 1YQ1A 2LQQA 5AGYA 5KN3A 1SKRB 2RLIA 4WBJA 5ECPB 1MD4A 3EYTA 4HJMA 3IXRA 3KJYA 4N30A 2VCXA 3GH6A 2JSYA 2A2PA 1AUCA 2JSZA 4YKFA 2C0EA 1ZOFA 3MWHA 4JR4A 1H4OA 3FK8A 1QFNA 1TW9A 3GH9A 5EL8A 4ZB9A 4JBBA 4J56E 5B8AA 4IS0A 2AUVA 2VM2A 1HNCA 1ZL9A 5DCHA 3UL3A 3GFKA 3IRAA 3QAGA 1M0UA 5JCGA 1SK2A 1IYHA 2GSTA 4IHUA 12GSA 2PVOC 1G7OA 1ML6A 3M0FA 3VWVA 3RPNA 4HSCX 3I9V2 4PGTA 2GSQA 3TJKA 2JZRA 3IR4A 4G19A 4NWYA 4DVCA 3C7MA 5CRHA 3O76A 3HVNA 1R7HA 4N0ZA 1GH2A 18GSA 4N10A 4I6XA 4BVXB 2FD3A 4MZCA 1F3AA 13GSA 4KB3A 2DC5A 2X4AA 4O92A 1DSBA 3ISOA 1PA3A 3F6FA 2H74A 1GSEA 2L6CA 4POMA 2DJ3A 3ED3A 3M1GA 2HFDA 1GUHA 1WIKA 1SU9A 3VI5A 1YF0A 3M9KA 5JCWA 1XW6A 1JLWA 2C4JA 4HU9A 4EE0A 1AXDA 5ECHB 1KBNA 4RUVA 2F3MA 2A4VA 1M7TA 4V2NA 16GSA 5B7CA 2PVQA 2VCTA 4GLTA 2B1KA 1A2JA 2PUKC 4NHWA 2KP1A 3O6TA 2F8FA 2N5BA 2PERA 2C1YA 5AIXA 1AW9A 1GTIA 2CZ3A 1QGVA 5DDLA 4YQUA 1GP1A 5ECOB 2I3YA 1SJZA 1B4PA 2IJYA 3PPUA 3J7Yb 3RBTA 2V41A 2CV4A 5IPHA 1M99A 2FY6A 5FHIA 2L4QA 1XOBA 1SYRA 4EKZA 1ZYQB 1YZXA 2NDOA 1GTAA 2PPTA 4F03A 2P5RA 3VFIA 2IN3A 1WWJA 1Z3EA 2WB9A 4TRXA 3D6IA 2R2JA 1A8YA 4IJIA 1PFOA 2L59A 3TRPA 2TRCP 3BBYA 5ID2B 3FZ9A 4KH7A 4MA9A 4HU7A 1N8JA 4KAEA 1GLQA 2O87A 4JEDA 2H0IA 2MBTA 3WYWA 1XWAA 2R6KA 4MJBA 4WR4A 1XXUA 1OE7A 4TXVA 5C00A 3GL5A 3MIXA 4MF5A 1A23A 2DLXA 2YZHA 5EVOA 1XVQA 1M3JA 6GSUA 3DRNA 1X5EA 2FWGA 4MP4A 4NMUA 3WGEA 2FWEA 2KHPA 1TU7A 1K3YA 2KUCA 5DALB 1V9WA 4AJ6A 3DXBA 1N2AA 2YWOA 5F05A 3LW9A 3LEFA 2DJ2A 1THXA 3CRTA 3H79A 3OR5A 5F0GA 3RAZA 2VCVA 2H0HA 1EGRA 3WGDA 1GSDA 1EP7A 4L5OA 2GS3A 2ALBA 3D22A 2YPMA 4BA7A 3UJ1A 1O6JA 1YDKA 2GQMA 1O73A 2IFQA 2JZTA 3ZIJA 2OE3A 2MMNA 4V1Ap 4OMVA 4XS1A 3W8SA 4KSMA 1QUWA 4CW9A 1AAZA 2VUPA 5ECQB 17GSA 2EC4A 1OKDA 3VWXA 3FZ4A 4X0XA 5KN1A 1F3BA 1B8XA 5KEJA 3LGCA 5LCZA 4GXZA 4PQ1A 3EURA 1THOA 3LWAA 3GL3A 3CXGA 4ZL9A 2VO4A 1EZKA 5ELAA 1I9DA 2PGTA 1G7EA 1K0NA 2GT6A 20GSA 5HFKA 4QL9A 2LSTA 3KTLA 5A4VA 2VL2A 3BCKA 1X5CA 4MPGA 1K0OA 4WF4A 1G6WA 2V6KA 4AF2A 5ECIB 4H86A 3IHGA 5DQSA 3EINA 2GTUA 1AQVA 1GSUA 2ZCTA 5ENUA 2HE3A 5ECSA 2YWMA 3QAWA 4PNGA 3ZFBA 3APQA 3R3EA 5CREA 5IMCA 3EU4A 3LYKA 4V2LA 1T1VA 1K3OA 3C1RA 1GSYA 2VL9A 1E6BA 1O8WA 1U3AA 1FW1A 4PX1A 1ZYPA 3TJGA 1GL8A 4K7IA 2CT6A 2FA4A 2K18A 2R0CA 3WGXA 1M2DA 4Z2TA 2REMA 4XIHA 4CHSA 1SK0A 1UC7A 3ZREA 2HRKA 3QOUA 2LV3A 1AQXA 3RPPA 4QL7A 1JZWA 3LORA 3VK9A 4MCUA 2YWIA 3ME7A 2I1UA 3D4MA 4KNDA 1PD21 4HOJA 2M72A 3LG6A 3D0ZA 2IMKA 4EDYA 2LRTA 1XPVA 1NHOA 4IQ1A 3F3QA 2GZPA 1QK8A 2I4AA 1SYXA 5IO0A 3FKFA 3UEMA 2CAQA 4TOPA 2FWFA 22GSA 1K0AA 5EPFA 2H76A 1OC9A 5F8BA 1OVNA 4USSA 4BL7A 2PU9C 2OBKA 4G10A 5EY6A 2HSHA 3DD3A 4TXOB 4K6XA 5DCGA 1EEMA 2VCQA 4I97A 2ZUPA 3BJ5A 4ZIJA 1U87A 2HYXA 3HVSA 2PBJA 5AIVA 5HQPA 3LXTA 1EV4A 2CA8A 3ZMKA 3GTUB 4OO4A 1G6YA 2EIRA 4IW9A 4ZBBA 3TKSA 1UVZA 1ZGNA 2RM6A 5JWQB 2DKHA 4X43A 1EOGA 3PR8A 1HNBA 5GZZB 2RM5A 1XCCA 1AC1A 1SL2B 5J41A 3VI7A 2ZNMA 2H75A 4MK3A 1ON4A 1W89A 3DEXA 4G0KA 1CQGA 4JU5A 4YKGA 2J23A 3TRQA 2HNLA 2R0PA 5H5RA 3LXZA 5ECNB 1MDKA 4ML1A 4WXTA 2O89A 2HRAA 1K0CA 2LRCA 4YAPA 4PQIA 1EOHA 1TI1A 3DWVA 5G5EA 3A2XA 3NZNA 1ST9A 2IPAA 3KGKA 5L71A 2VLTA 2YZUA 1NSWA 4O5RA 1SJIA 1GLPA 5CO3A 4JR6A 6GSVA 3RHBA 1PN0A 4HJ2A 1TTZA 4EIPA 1MTCA 2VCWA 3GMFA 3GRXA 2MZCA 1Z7RA 4XCSA 3P8WA 5H5QA 1ILOA 3HDCA 4ZB6A 2F51A 4QQ7A 2C3NA 4GQFA 3TKPA 1M2AA 2VL2C 3A2WA 3KD0A 1HYUA 1LJRA 4KCEA 1OE8A 4DSSB 1XOAA 4EF0A 3IHQA 3EU3A 2B3SA 1FOHA 5ECLB 3DKSA 3I6AA 5IQYA 1CQHA 2H70A 3ZMLA 4YAVA 2NPBA 2JU5A
chains in the Genus database with same CATH topology
1BAYA 1BQ7A 3TJJA 3APOA 5G1KA 4BWSA 4IELA 5GAND 2GSSA 3L9VA 3CSIA 3UVTA 4A5PA 3EC3A 4BVYA 2AJQB 3LYPA 3HY2A 2DIZA 4XS4A 3FR9A 2LJAA 2V1MA 5HFIA 3ERWA 3CBUA 3CTGA 4EDZA 1TOFA 3LSZA 2QKEA 2GT5A 3MYDA 4OO5A 3U6VA 3HVVA 1M9AA 3FYGA 4O7HA 5GSTA 2OKAA 3EE2A 4ZL8A 1HQOA 14GSA 2WCIA 1NM3A 2M80A 4PQHA 1R5AA 3CYNA 3GX0A 4KDXA 5G31A 1DE2A 3HKRA 5AN1A 3ZVJD 4MPFA 4MNNA 1O8XA 3HZ4A 1R26A 4PNFA 4HS1A 5A5KA 1GRXA 3VPQA 2CVBA 4IJ3A 3DIEA 3Q74A 3UOMA 2XHFA 4LMWA 1K3LA 2QSIA 3FY7A 1PRXA 1XWBA 2DJ1A 3A2VA 4WETA 1S3AA 2H72A 2YNXA 2H73A 4ISDA 1Z9HA 3ZIVA 1YJ6A 3FEUA 2H66A 1GULA 3TB2A 4JRRA 3S9FA 3TJBA 2TIRA 5DAKA 4TW5A 4XRAA 3ZTLA 2B5XA 2IIYA 2DIYA 1PX7A 5D73A 2PWJA 4EO3A 1GUKA 3HHVA 2B6MA 1YY7A 2LS5A 2C0DA 3IC4A 2ON5A 4HEA2 5A4UA 5IMAA 4D73B 3EWLA 5LNKe 3F63A 4Q5FA 5CNWA 4P3YB 1T7PB 2A4HA 1FAAA 4GWRA 4ZBDA 4AJ7A 1KTEA 2YP6A 4POKA 3L78A 1B9XC 1XW5A 3F6DA 2B7KA 2H1DA 3MSZA 2VOCA 4TR1B 6GSYA 2L57A 1VRSD 1YEPA 1IYIA 3L9UA 3G7YA 3HA9A 3P2AA 2WFCA 4MF7A 2F9SA 3QCPA 1ZZYA 3NOFA 3BOAA 3TUEA 4I2TA 4JE1A 4OFTA 3PINA 1URMA 2IMFA 4X4JA 3HYPA 4RQRA 5GSSA 4V2MA 3J7Yk 2IMEA 2VD1A 2IWTA 3PGTA 1KEBA 5A4WA 1W4VA 2FWHA 4MABA 5G1LA 3DVWA 2IMDA 2CVDA 3HVXA 4HUAA 1T8EB 4PURA 1PL1A 2O8VB 2OBIA 1A0RP 4Z2RA 1M9BA 2HSMA 4V1Ag 2H6XA 3I43A 1TRVA 2HRNA 1PKWA 3H8QA 2RIIA 4EC0A 2CZ2A 1PQNA 1XW9A 1JZOA 2FNOA 4KE3A 1M2BA 4ZILA 3H93A 1PMTA 2C3QA 3US3A 5ECMB 2OACA 9GSSA 4MZBA 5J9BA 4Q5RA 3UMAA 3F9UA 1TJDA 4ZB8A 2J9HA 3VWUA 1BJXA 3HJPA 2CVKA 4F0BA 2LNSA 2MMZA 4TR4A 4N11A 5GAPD 2GVPA 2HZEA 5COHA 3L0HA 4IVFA 2MMAA 3GN3A 3EPTA 4XTSA 3ZLPA 2Z9SA 1SK1A 2AHEA 5F07A 2H6ZA 2VAFA 4HQZA 3ZVJA 1VF2A 3GSSA 4WR5A 4TR0A 1ZCPA 5JWRB 2VM1A 4LMVA 3ZZXA 3WD6A 4ECJA 3F4RA 2X8GA 2YWNA 3C73A 5DAKB 4K1FA 2R4VA 5ECRB 1XVWA 1X9SB 1C72A 5HR3A 2WS2A 3E0UA 3C8EA 5KN2A 4HI7A 5J3RA 2R3XA 2LNTA 3VPTA 1T4YA 4K7NA 1TXXA 3CRUA 1Q4JA 4FIWA 5G2ZA 1Z5YE 4K9ZA 5D9XA 1J9BA 3D21A 2R37A 1EGOA 1XBSA 4HDEA 1X9MB 2NTOA 5D8IA 1NW2A 2GZYA 1UN2A 2LJRA 2F8AA 5IIZA 4CY8A 1U88A 3ERFA 1E2YA 1WPIA 1XIYA 1T00A 2EIOA 4IKHA 3G9BA 5CYYA 4EUYA 4E8HA 3BCIA 3D4TA 2IL3A 5J5NA 3GKNA 4HZ4A 4Z2UA 3IBHA 1JZDA 2VD0A 1ZYNA 1F37A 3KXOA 2WULA 5INYA 3DGQA 2I81A 2FA8A 3QFBC 1QQ2A 3TRXA 1A8LA 2OE1A 2P31A 2K6VA 3FR3A 3ZL5A 5IM9A 5IOXA 1J08A 3UVHA 1MDJA 2JACA 2B1LA 2JADA 2WGRA 3H4KA 3FZAA 2C8UA 3IE3A 1SD8A 1TRUA 1FB6A 1A0FA 5KN0A 4KDUA 3U5RE 6GSTA 4ICYA 4F2IA 1VF3A 2EIQA 3GKXA 1SD9A 3A5WA 4PXOA 2CQ9A 5DJLA 2GGTA 1OYJA 2AAWA 3FRCA 4NXIA 4BVXA 1BX9A 4Q5NA 3UARA 5J9CA 4GSSA 1K0DA 4KDYA 1A2MA 5D93A 4IQAA 2IFQB 2WZ9A 1Z7PA 2B5EA 3KMNA 2YCDA 3EVIA 5D9VA 2K8VA 4KW6A 5G5FA 3GSTA 3A3TA 3QD9A 1V58A 4OCEA 2H1AA 2XC2A 3C1SA 3DMLA 4MJEA 2I9HA 4PUFC 1TI3A 1SENA 3ME8A 3F8UA 1TP9A 4G0IA 3FZ5A 1OAZA 4L0WA 3KIJA 2DSAA 4ID0A 3HJMA 1U6TA 3CSHA 1WP0A 5HFGA 5IOWA 3GURA 2V2GA 4F82A 5JWOB 1OC3A 2C0FA 4NPBA 3VWWA 3RDWA 3H1NA 4CY6A 3L9SA 2OJLA 2H30A 3UBKA 1TRSA 3L4NA 4L5LA 4I8BA 3FHKA 2X99A 4L8EA 1TK8B 3GKKA 1UA5A 6GSSA 4FYUA 3HJOA 1SKSB 10GSA 3KM6A 4G0LA 5CRWA 2HRFA 3QPMA 5D9WA 2LTKA 4ZBAA 1GTBA 5BRTA 4ZXGA 3WT2A 5E4WA 3CMIA 4MH2A 5CP1A 3R2QA 2E7PA 4FYCA 4XS6A 1TRWA 3TKSE 1ERWA 5ID2A 4ECIA 3TDGA 2JZSA 4O5QA 4DSRA 3IPZA 4NV5A 5BMUA 2H6YA 2E2MA 1X5DA 3FMWA 1WJKA 3AY8A 2M46A 1B9YC 1AQWA 1BYEA 4IP6A 6GSXA 2DJJA 2WRTA 4K8MA 5IMZA 2WJUA 3GIXA 4GF0A 3E9JB 2AYTA 3LFLA 3W6GA 3UAPA 5DALA 1A2LA 1V57A 4JZQA 4FYBA 1Z6NA 1V98A 2RUEA 2DBCA 1ERUA 3Q18A 3SBCA 2XPDA 3LJRA 2C3TA 2L5LA 1OC9B 2L5OA 4LA1A 1T4ZA 1Z6MA 1AIUA 3FR6A 2QA1A 4WBRD 1PL2A 2CAIA 4BL7B 3TCOA 4GQCA 1S3CA 4K0NA 2MBSA 4ZL7A 1EP8A 4KSOA 2KP2A 4WEYA 4LLRA 1PSQA 2X64A 2H01A 1JHBA 4Z7XA 4KCAA 2C80A 3APSA 8GSSA 5JCUA 1DBYA 1QMVA 1Y25A 3PH9A 3KP9A 3O3TA 1X0RA 1PKZA 1GNEA 2A2SA 5J4UA 2TRXA 4YQVA 3HD5A 2PN8A 3UBLA 4I2UA 1MDIA 2H1BA 4YH2A 2YOIA 1EWXA 4FO5A 4IGJA 4F9ZA 1HD2A 2K9FA 1OKTA 3Q6OA 2B5YA 3QFAC 1XZOA 4FQUA 2H1GA 2YN1A 2X8HA 1Q98A 4EVMA 5DJMA 1T3BA 1QXHA 2C0GA 4YQMA 3ZYWA 1JZRA 2BTOT 1SL0B 3TKSC 3F0IA 5B8BA 3F4SA 2FHEA 1YEXA 1PN9A 4J57E 1ERVA 2YJHA 1PX6A 1SKWB 4EXJA 1GNWA 3M9JA 4NV2A 3A5IA 2XBIA 2JL4A 3ZFLA 3M3MA 3JCML 2GSRA 2FCHA 4G9HA 4RI6A 4RQXA 3IAS2 2H71A 2R5GA 1FVJA 5KOWA 3TGZA 4ECBA 3LQ7A 1VGLA 2DMMA 3QDNA 5DQYA 1WE0A 1BG5A 4TVEA 2WDUA 3ERGA 3GKMA 4OD7A 1XWKA 3SWLA 2L4CA 4OFNA 4IP1A 2CX4A 4KF9A 4BVYB 1ACVA 5ELGA 1GSFA 2YJ7A 3BD2A 2LKUA 4E8EA 1S3DA 4XS4B 2FGXA 4KX4A 3UIWA 3GNJA 2H8LA 2H0GA 5D9TA 4POLA 2ON7A 2YV9A 4XRDA 5AISA 2AV4A 5CRDA 3CTFA 1FO5A 1GWCA 2O7KA 5CAXA 4HQSA 3IV4A 4NHZA 4O5UA 3TJFA 3MAKA 4TXOA 1R4WA 4X1UA 3P90A 3KEBA 3W8JA 3IOSA 2G2QA 4ULXA 4MH3A 2CX3A 3EMPA 3VLNA 4DSQA 1TU8A 2N5FA 3GTUA 2FUG2 1U3IA 1WOUA 2VL3A 7GSSA 4WF5A 4TN8A 5D96A 4MDCA 2GQLA 1MD3A 2OE0A 3I69A 2VLUA 2HSYA 4MZWA 1F9MA 2X49A 5G30A 1YF1A 2D2ZA 4O32A 4N0VA 1HNAA 3IK9A 3KP8A 4K0GA 3F4TA 2MYGA 4MLYA 3RHCA 3DYRA 1USBA 4IBPA 1RW1A 2H19A 4K7OA 1RQMA 4RI7A 2N5AA 4K5SA 4L0UA 1XWCA 1PGTA 1O85A 3Q19A 2NVLA 4NAXA 3E3EA 4GRFA 4GTUA 3HXSA 1TK0B 2O85A 4K5RA 5F06A 4MMMA 4G2EA 3EMXA 2DJ0A 4PTSA 4EIQA 4K2DA 2LJKA 2YANA 5ABRA 5HR2A 4LL1B 2VIMA 3IC8A 4OFMA 4ECCA 1R5PA 1GUMA 1O7UA 5KOXA 4HZ2A 2QA2A 1EEJA 2DKIA 4XHMA 1WRYA 1DUGA 3NIVA 1XWGA 1DE1A 1VF4A 1Y6EA 2OADA 1J0FA 5DVBA 2L6DA 3VURA 2E2GA 3GX8A 2DJKA 1NHYA 2XBQA 4WKWA 4POBA 2B7JA 2V32A 5CRGA 2NBSA 3GUSA 3M8NA 1FHEA 3K8NA 2V6OA 1BEDA 2FLSA 4DSSA 3MNGA 4ML6A 4BPYA 19GSA 1F2EA 2GLRA 2PMTA 2RUFA 4J2FA 3FW2A 1G0TA 2R0GA 5IPGA 2GDRA 4CDOA 4OWYA 1ZMAA 4IN0A 3KMOA 1EV9A 5H5SA 2G0FA 5FT3A 5E59A 3HZ8A 1X9WB 5IO2A 2AB6A 3KH7A 1YKCA 3IA1A 3IK7A 1K0MA 3TKRA 3TOUA 1GSQA 2HI7A 3G7JA 2X8CA 1GSSA 5B6NA 1XFLA 5FWGA 1JFUA 1V2AA 3V1WA 4F0CA 3QMXA 3P7XA 1TDIA 4LL4B 2VCZA 4K2XA 2GQKA 2GZZA 1YKAA 1TK5B 2MMOA 5LD0A 2LQOA 4GSTA 1LBKA 11GSA 1H75A 1VF1A 2A2RA 2P0GA 4Q5QA 3CSJA 5HR1A 1ERTA 3KTBA 5IMVA 2P5QA 3DVXA 4GCIA 4TKYA 1V40A 2HLSA 2VLVA 2HT9A 3G7IA 5ECKB 5IMDA 1A24A 5HR0A 3D5JA 3C71A 3GHAA 3KCMA 1GTUA 4KGIA 4PUAA 4FH8A 4ILFA 2HZEB 2XPEA 1O81A 4KUNA 2KOKA 4AJ8A 3MDKA 1FG4A 4AGSA 3N9JA 2DMLA 1LU4A 2HZFA 4OCFA 1I5GA 4DEJA 1SL1B 4MJAA 4MF6A 2BJXA 2LRNA 1FB0A 2K8SA 4EL1A 4KA0A 4MJCA 4TR3A 3IDVA 3GV1A 3WT1A 1B48A 4D73A 5B6MA 5IMFA 1OC8A 5C04A 1ZYEA 1WMJA 1KNGA 3ZITA 1K0BA 1RK4A 2BMXA 2ES7A 2LEGA 3GA4A 2QGVA 1B4QA 1ABAA 1FVKA 2YV7A 4BWQA 2HXKA 3ZRDA 1F6MC 4GSNA 3F3RA 1SJ6A 1MEKA 1TKDB 2IMIA 4TR1A 5DBQA 4ACSA 2KLXA 3TKQA 2LUSA 2E0QA 3N5OA 3QR6A 2QC7A 3KZQA 3QAVA 2UZ8A 6GSWA 3HCZA 3KH9A 1JLVA 1FOVA 3GYKA 3TOTA 4I5QA 3IAM2 2OA7A 1YQ1A 2LQQA 5AGYA 5KN3A 1SKRB 2RLIA 4WBJA 5ECPB 1MD4A 3EYTA 4HJMA 3IXRA 3KJYA 4N30A 2VCXA 3GH6A 2JSYA 2A2PA 1AUCA 2JSZA 4YKFA 2C0EA 1ZOFA 3MWHA 4JR4A 1H4OA 3FK8A 1QFNA 1TW9A 3GH9A 5EL8A 4ZB9A 4JBBA 4J56E 5B8AA 4IS0A 2AUVA 2VM2A 1HNCA 1ZL9A 5DCHA 3UL3A 3GFKA 3IRAA 3QAGA 1M0UA 5JCGA 1SK2A 1IYHA 2GSTA 4IHUA 12GSA 2PVOC 1G7OA 1ML6A 3M0FA 3VWVA 3RPNA 3I9V2 4PGTA 2GSQA 3TJKA 2JZRA 3IR4A 4G19A 4NWYA 4DVCA 3C7MA 5CRHA 3O76A 1R7HA 4N0ZA 1GH2A 18GSA 4N10A 4I6XA 4BVXB 2FD3A 4MZCA 1F3AA 13GSA 4KB3A 2DC5A 2X4AA 4O92A 1DSBA 3ISOA 1PA3A 3F6FA 2H74A 1GSEA 2L6CA 4POMA 2DJ3A 3ED3A 3M1GA 2HFDA 1GUHA 1WIKA 1SU9A 3VI5A 1YF0A 3M9KA 5JCWA 1XW6A 1JLWA 2C4JA 4HU9A 4EE0A 1AXDA 5ECHB 1KBNA 4RUVA 2F3MA 2A4VA 1M7TA 4V2NA 16GSA 5B7CA 2PVQA 2VCTA 4GLTA 2B1KA 1A2JA 2PUKC 4NHWA 2KP1A 3O6TA 2F8FA 2N5BA 2PERA 2C1YA 5AIXA 1AW9A 1GTIA 2CZ3A 1QGVA 5DDLA 4YQUA 1GP1A 5ECOB 2I3YA 1SJZA 1B4PA 2IJYA 3PPUA 3J7Yb 3RBTA 2V41A 2CV4A 5IPHA 1M99A 2FY6A 5FHIA 2L4QA 1XOBA 1SYRA 4EKZA 1ZYQB 1YZXA 2NDOA 1GTAA 2PPTA 4F03A 2P5RA 3VFIA 2IN3A 1WWJA 1Z3EA 2WB9A 4TRXA 3D6IA 2R2JA 1A8YA 4IJIA 2L59A 3TRPA 2TRCP 3BBYA 5ID2B 3FZ9A 4KH7A 4MA9A 4HU7A 1N8JA 4KAEA 1GLQA 2O87A 4JEDA 2H0IA 2MBTA 3WYWA 1XWAA 2R6KA 4MJBA 4WR4A 1XXUA 1OE7A 4TXVA 5C00A 3GL5A 3MIXA 4MF5A 1A23A 2DLXA 2YZHA 5EVOA 1XVQA 6GSUA 3DRNA 1X5EA 2FWGA 4MP4A 4NMUA 3WGEA 2FWEA 2KHPA 1TU7A 1K3YA 2KUCA 5DALB 1V9WA 4AJ6A 3DXBA 1N2AA 2YWOA 5F05A 3LW9A 3LEFA 2DJ2A 1THXA 3CRTA 3H79A 3OR5A 5F0GA 3RAZA 2VCVA 2H0HA 1EGRA 3WGDA 1GSDA 1EP7A 4L5OA 2GS3A 2ALBA 3D22A 2YPMA 4BA7A 3UJ1A 1O6JA 1YDKA 2GQMA 1O73A 2IFQA 2JZTA 3ZIJA 2OE3A 2MMNA 4V1Ap 4OMVA 4XS1A 3W8SA 4KSMA 1QUWA 4CW9A 1AAZA 2VUPA 5ECQB 17GSA 2EC4A 1OKDA 3VWXA 3FZ4A 4X0XA 5KN1A 1F3BA 1B8XA 5KEJA 3LGCA 5LCZA 4GXZA 4PQ1A 3EURA 1THOA 3LWAA 3GL3A 3CXGA 4ZL9A 2VO4A 1EZKA 5ELAA 1I9DA 2PGTA 1G7EA 1K0NA 2GT6A 20GSA 5HFKA 4QL9A 2LSTA 3KTLA 5A4VA 2VL2A 3BCKA 1X5CA 4MPGA 1K0OA 4WF4A 1G6WA 2V6KA 4AF2A 5ECIB 4H86A 3IHGA 5DQSA 3EINA 2GTUA 1AQVA 1GSUA 2ZCTA 5ENUA 2HE3A 5ECSA 2YWMA 3QAWA 4PNGA 3ZFBA 3APQA 3R3EA 5CREA 5IMCA 3EU4A 3LYKA 4V2LA 1T1VA 1K3OA 3C1RA 1GSYA 2VL9A 1E6BA 1O8WA 1U3AA 1FW1A 4PX1A 1ZYPA 3TJGA 1GL8A 4K7IA 2CT6A 2FA4A 2K18A 2R0CA 3WGXA 1M2DA 4Z2TA 2REMA 4XIHA 4CHSA 1SK0A 1UC7A 3ZREA 2HRKA 3QOUA 2LV3A 1AQXA 3RPPA 4QL7A 1JZWA 3LORA 3VK9A 4MCUA 2YWIA 3ME7A 2I1UA 3D4MA 4KNDA 1PD21 4HOJA 2M72A 3LG6A 3D0ZA 2IMKA 4EDYA 2LRTA 1XPVA 1NHOA 4IQ1A 3F3QA 2GZPA 1QK8A 2I4AA 1SYXA 5IO0A 3FKFA 3UEMA 2CAQA 4TOPA 2FWFA 22GSA 1K0AA 5EPFA 2H76A 1OC9A 5F8BA 1OVNA 4USSA 4BL7A 2PU9C 2OBKA 4G10A 5EY6A 2HSHA 3DD3A 4TXOB 4K6XA 5DCGA 1EEMA 2VCQA 4I97A 2ZUPA 3BJ5A 4ZIJA 1U87A 2HYXA 3HVSA 2PBJA 5AIVA 5HQPA 3LXTA 1EV4A 2CA8A 3ZMKA 3GTUB 4OO4A 1G6YA 2EIRA 4IW9A 4ZBBA 3TKSA 1UVZA 1ZGNA 2RM6A 5JWQB 2DKHA 4X43A 1EOGA 3PR8A 1HNBA 5GZZB 2RM5A 1XCCA 1AC1A 1SL2B 5J41A 3VI7A 2ZNMA 2H75A 4MK3A 1ON4A 1W89A 3DEXA 4G0KA 1CQGA 4JU5A 4YKGA 2J23A 3TRQA 2HNLA 2R0PA 5H5RA 3LXZA 5ECNB 1MDKA 4ML1A 4WXTA 2O89A 2HRAA 1K0CA 2LRCA 4YAPA 4PQIA 1EOHA 1TI1A 3DWVA 5G5EA 3A2XA 3NZNA 1ST9A 2IPAA 3KGKA 5L71A 2VLTA 2YZUA 1NSWA 4O5RA 1SJIA 1GLPA 5CO3A 4JR6A 6GSVA 3RHBA 1PN0A 4HJ2A 1TTZA 4EIPA 1MTCA 2VCWA 3GMFA 3GRXA 2MZCA 1Z7RA 4XCSA 3P8WA 5H5QA 1ILOA 3HDCA 4ZB6A 2F51A 4QQ7A 2C3NA 4GQFA 3TKPA 1M2AA 2VL2C 3A2WA 3KD0A 1HYUA 1LJRA 4KCEA 1OE8A 4DSSB 1XOAA 4EF0A 3IHQA 3EU3A 2B3SA 1FOHA 5ECLB 3DKSA 3I6AA 5IQYA 1CQHA 2H70A 3ZMLA 4YAVA 2NPBA 2JU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAY A;  1BQ7 A;  3TJJ A;  3APO A;  5G1K A;  4BWS A;  4IEL A;  5GAN D;  2GSS A;  3L9V A;  3CSI A;  3UVT A;  3EC3 A;  4BVY A;  2AJQ B;  3LYP A;  3HY2 A;  2DIZ A;  4XS4 A;  3FR9 A;  2LJA A;  2V1M A;  5HFI A;  3ERW A;  3CBU A;  3CTG A;  4EDZ A;  1TOF A;  3LSZ A;  2QKE A;  2GT5 A;  4OO5 A;  3U6V A;  3HVV A;  1M9A A;  3FYG A;  4O7H A;  5GST A;  2OKA A;  3EE2 A;  4ZL8 A;  1HQO A;  14GS A;  2WCI A;  1NM3 A;  2M80 A;  4PQH A;  1R5A A;  3CYN A;  3GX0 A;  4KDX A;  5G31 A;  1DE2 A;  3HKR A;  5AN1 A;  3ZVJ D;  4MPF A;  1O8X A;  3HZ4 A;  1R26 A;  4PNF A;  4HS1 A;  5A5K A;  1GRX A;  3VPQ A;  2CVB A;  4IJ3 A;  3DIE A;  3Q74 A;  3UOM A;  2XHF A;  4LMW A;  1K3L A;  2QSI A;  3FY7 A;  1PRX A;  1XWB A;  2DJ1 A;  3A2V A;  4WET A;  1S3A A;  2H72 A;  2YNX A;  2H73 A;  4ISD A;  1Z9H A;  3ZIV A;  1YJ6 A;  3FEU A;  2H66 A;  1GUL A;  3TB2 A;  4JRR A;  3S9F A;  3TJB A;  2TIR A;  5DAK A;  4TW5 A;  4XRA A;  3ZTL A;  2B5X A;  2IIY A;  2DIY A;  1PX7 A;  5D73 A;  2PWJ A;  4EO3 A;  1GUK A;  3HHV A;  2B6M A;  1YY7 A;  2LS5 A;  2C0D A;  3IC4 A;  2ON5 A;  4HEA 2;  5A4U A;  5IMA A;  4D73 B;  3EWL A;  5LNK e;  3F63 A;  4Q5F A;  5CNW A;  4P3Y B;  1T7P B;  1FAA A;  4GWR A;  4ZBD A;  4AJ7 A;  1KTE A;  2YP6 A;  4POK A;  3L78 A;  1B9X C;  1XW5 A;  3F6D A;  2B7K A;  2H1D A;  3MSZ A;  2VOC A;  4TR1 B;  6GSY A;  2L57 A;  1VRS D;  1YEP A;  1IYI A;  3L9U A;  3G7Y A;  3HA9 A;  3P2A A;  2WFC A;  4MF7 A;  2F9S A;  3QCP A;  1ZZY A;  3NOF A;  3BOA A;  3TUE A;  4I2T A;  4JE1 A;  4OFT A;  3PIN A;  1URM A;  2IMF A;  3HYP A;  4RQR A;  5GSS A;  4V2M A;  3J7Y k;  2IME A;  2VD1 A;  2IWT A;  3PGT A;  1KEB A;  5A4W A;  1W4V A;  2FWH A;  4MAB A;  5G1L A;  3DVW A;  2IMD A;  2CVD A;  3HVX A;  4HUA A;  1T8E B;  4PUR A;  1PL1 A;  2O8V B;  2OBI A;  1A0R P;  1M9B A;  4V1A g;  2H6X A;  3I43 A;  1TRV A;  2HRN A;  1PKW A;  3H8Q A;  2RII A;  4EC0 A;  2CZ2 A;  1PQN A;  1XW9 A;  1JZO A;  2FNO A;  4KE3 A;  1M2B A;  4ZIL A;  3H93 A;  1PMT A;  2C3Q A;  3US3 A;  5ECM B;  2OAC A;  9GSS A;  4MZB A;  5J9B A;  4Q5R A;  3UMA A;  3F9U A;  1TJD A;  4ZB8 A;  2J9H A;  3VWU A;  1BJX A;  3HJP A;  2CVK A;  4F0B A;  2LNS A;  2MMZ A;  4TR4 A;  4N11 A;  5GAP D;  2GVP A;  2HZE A;  5COH A;  3L0H A;  4IVF A;  2MMA A;  3GN3 A;  4XTS A;  3ZLP A;  2Z9S A;  1SK1 A;  2AHE A;  5F07 A;  2H6Z A;  2VAF A;  4HQZ A;  3ZVJ A;  1VF2 A;  3GSS A;  4WR5 A;  4TR0 A;  1ZCP A;  5JWR B;  2VM1 A;  4LMV A;  3ZZX A;  3WD6 A;  4ECJ A;  3F4R A;  2X8G A;  2YWN A;  3C73 A;  5DAK B;  4K1F A;  2R4V A;  5ECR B;  1XVW A;  1X9S B;  1C72 A;  5HR3 A;  2WS2 A;  3E0U A;  3C8E A;  5KN2 A;  4HI7 A;  5J3R A;  2R3X A;  2LNT A;  3VPT A;  1T4Y A;  4K7N A;  1TXX A;  3CRU A;  1Q4J A;  4FIW A;  5G2Z A;  1Z5Y E;  4K9Z A;  5D9X A;  1J9B A;  3D21 A;  2R37 A;  1EGO A;  1XBS A;  4HDE A;  1X9M B;  2NTO A;  5D8I A;  1NW2 A;  2GZY A;  1UN2 A;  2LJR A;  2F8A A;  5IIZ A;  1U88 A;  3ERF A;  1E2Y A;  1WPI A;  1XIY A;  1T00 A;  2EIO A;  4IKH A;  3G9B A;  5CYY A;  4EUY A;  4E8H A;  3BCI A;  3D4T A;  2IL3 A;  5J5N A;  3GKN A;  4HZ4 A;  3IBH A;  1JZD A;  2VD0 A;  1F37 A;  3KXO A;  2WUL A;  5INY A;  3DGQ A;  2I81 A;  2FA8 A;  3QFB C;  1QQ2 A;  3TRX A;  1A8L A;  2OE1 A;  2P31 A;  2K6V A;  3FR3 A;  3ZL5 A;  5IM9 A;  5IOX A;  1J08 A;  3UVH A;  1MDJ A;  2JAC A;  2B1L A;  2JAD A;  2WGR A;  3H4K A;  3FZA A;  2C8U A;  3IE3 A;  1SD8 A;  1TRU A;  1FB6 A;  1A0F A;  5KN0 A;  4KDU A;  3U5R E;  6GST A;  4F2I A;  1VF3 A;  2EIQ A;  3GKX A;  1SD9 A;  3A5W A;  4PXO A;  2CQ9 A;  5DJL A;  2GGT A;  1OYJ A;  2AAW A;  3FRC A;  4NXI A;  4BVX A;  1BX9 A;  4Q5N A;  3UAR A;  5J9C A;  4GSS A;  1K0D A;  4KDY A;  1A2M A;  5D93 A;  4IQA A;  2IFQ B;  2WZ9 A;  1Z7P A;  2B5E A;  3KMN A;  2YCD A;  3EVI A;  5D9V A;  2K8V A;  4KW6 A;  5G5F A;  3GST A;  3A3T A;  3QD9 A;  1V58 A;  4OCE A;  2H1A A;  2XC2 A;  3C1S A;  3DML A;  4MJE A;  2I9H A;  4PUF C;  1TI3 A;  1SEN A;  3ME8 A;  3F8U A;  1TP9 A;  3FZ5 A;  1OAZ A;  4L0W A;  3KIJ A;  2DSA A;  4ID0 A;  3HJM A;  1U6T A;  3CSH A;  1WP0 A;  5HFG A;  5IOW A;  3GUR A;  2V2G A;  4F82 A;  5JWO B;  1OC3 A;  2C0F A;  4NPB A;  3VWW A;  3RDW A;  3H1N A;  3L9S A;  2OJL A;  2H30 A;  3UBK A;  1TRS A;  3L4N A;  4L5L A;  4I8B A;  3FHK A;  2X99 A;  4L8E A;  1TK8 B;  3GKK A;  1UA5 A;  6GSS A;  4FYU A;  3HJO A;  1SKS B;  10GS A;  3KM6 A;  5CRW A;  2HRF A;  3QPM A;  5D9W A;  2LTK A;  4ZBA A;  1GTB A;  4ZXG A;  3WT2 A;  5E4W A;  3CMI A;  4MH2 A;  5CP1 A;  3R2Q A;  2E7P A;  4FYC A;  4XS6 A;  1TRW A;  3TKS E;  1ERW A;  5ID2 A;  4ECI A;  3TDG A;  2JZS A;  4DSR A;  3IPZ A;  4NV5 A;  2H6Y A;  2E2M A;  1X5D A;  1WJK A;  3AY8 A;  2M46 A;  1B9Y C;  1AQW A;  1BYE A;  4IP6 A;  6GSX A;  2DJJ A;  2WRT A;  4K8M A;  5IMZ A;  2WJU A;  3GIX A;  4GF0 A;  3E9J B;  2AYT A;  3LFL A;  3W6G A;  3UAP A;  5DAL A;  1A2L A;  1V57 A;  4JZQ A;  4FYB A;  1Z6N A;  1V98 A;  2RUE A;  2DBC A;  1ERU A;  3Q18 A;  3SBC A;  2XPD A;  3LJR A;  2C3T A;  2L5L A;  1OC9 B;  2L5O A;  4LA1 A;  1T4Z A;  1Z6M A;  1AIU A;  3FR6 A;  4WBR D;  1PL2 A;  2CAI A;  3TCO A;  4GQC A;  1S3C A;  4K0N A;  2MBS A;  4ZL7 A;  1EP8 A;  4KSO A;  2KP2 A;  4WEY A;  4LLR A;  1PSQ A;  2X64 A;  2H01 A;  1JHB A;  4Z7X A;  4KCA A;  2C80 A;  3APS A;  8GSS A;  5JCU A;  1DBY A;  1QMV A;  1Y25 A;  3PH9 A;  3KP9 A;  3O3T A;  1X0R A;  1PKZ A;  1GNE A;  2A2S A;  5J4U A;  2TRX A;  4YQV A;  3HD5 A;  2PN8 A;  3UBL A;  4I2U A;  1MDI A;  2H1B A;  4YH2 A;  2YOI A;  1EWX A;  4FO5 A;  4IGJ A;  4F9Z A;  1HD2 A;  2K9F A;  1OKT A;  3Q6O A;  2B5Y A;  3QFA C;  1XZO A;  2H1G A;  2YN1 A;  2X8H A;  1Q98 A;  4EVM A;  5DJM A;  1T3B A;  1QXH A;  2C0G A;  4YQM A;  3ZYW A;  1JZR A;  2BTO T;  1SL0 B;  3TKS C;  3F0I A;  5B8B A;  3F4S A;  2FHE A;  1YEX A;  1PN9 A;  4J57 E;  1ERV A;  2YJH A;  1PX6 A;  1SKW B;  4EXJ A;  1GNW A;  3M9J A;  4NV2 A;  2XBI A;  2JL4 A;  3ZFL A;  3M3M A;  3JCM L;  2GSR A;  2FCH A;  4G9H A;  4RI6 A;  4RQX A;  3IAS 2;  2H71 A;  2R5G A;  1FVJ A;  3TGZ A;  4ECB A;  3LQ7 A;  1VGL A;  2DMM A;  3QDN A;  5DQY A;  1WE0 A;  1BG5 A;  4TVE A;  2WDU A;  3ERG A;  3GKM A;  4OD7 A;  1XWK A;  3SWL A;  2L4C A;  4OFN A;  4IP1 A;  2CX4 A;  1ACV A;  5ELG A;  1GSF A;  2YJ7 A;  3BD2 A;  2LKU A;  4E8E A;  1S3D A;  4XS4 B;  2FGX A;  4KX4 A;  3UIW A;  3GNJ A;  2H8L A;  2H0G A;  5D9T A;  4POL A;  2ON7 A;  2YV9 A;  4XRD A;  5AIS A;  2AV4 A;  5CRD A;  3CTF A;  1FO5 A;  1GWC A;  2O7K A;  5CAX A;  4HQS A;  3IV4 A;  4NHZ A;  3TJF A;  3MAK A;  4TXO A;  1R4W A;  4X1U A;  3P90 A;  3KEB A;  3W8J A;  3IOS A;  2G2Q A;  4ULX A;  4MH3 A;  2CX3 A;  3EMP A;  3VLN A;  4DSQ A;  1TU8 A;  2N5F A;  3GTU A;  2FUG 2;  1U3I A;  1WOU A;  2VL3 A;  7GSS A;  4WF5 A;  4TN8 A;  5D96 A;  4MDC A;  2GQL A;  1MD3 A;  2OE0 A;  3I69 A;  2VLU A;  2HSY A;  4MZW A;  1F9M A;  5G30 A;  1YF1 A;  2D2Z A;  4O32 A;  4N0V A;  1HNA A;  3IK9 A;  3KP8 A;  4K0G A;  3F4T A;  2MYG A;  4MLY A;  3RHC A;  3DYR A;  1USB A;  4IBP A;  1RW1 A;  2H19 A;  4K7O A;  1RQM A;  4RI7 A;  2N5A A;  4L0U A;  1XWC A;  1PGT A;  1O85 A;  3Q19 A;  2NVL A;  4NAX A;  3E3E A;  4GRF A;  4GTU A;  3HXS A;  1TK0 B;  2O85 A;  5F06 A;  4MMM A;  4G2E A;  3EMX A;  2DJ0 A;  4K2D A;  2LJK A;  2YAN A;  5ABR A;  5HR2 A;  4LL1 B;  2VIM A;  4OFM A;  4ECC A;  1R5P A;  1GUM A;  1O7U A;  4HZ2 A;  1EEJ A;  4XHM A;  1WRY A;  1DUG A;  3NIV A;  1XWG A;  1DE1 A;  1VF4 A;  1Y6E A;  2OAD A;  1J0F A;  5DVB A;  2L6D A;  3VUR A;  2E2G A;  3GX8 A;  2DJK A;  1NHY A;  2XBQ A;  4WKW A;  4POB A;  2B7J A;  2V32 A;  5CRG A;  2NBS A;  3GUS A;  3M8N A;  1FHE A;  3K8N A;  2V6O A;  1BED A;  2FLS A;  4DSS A;  3MNG A;  4ML6 A;  4BPY A;  19GS A;  1F2E A;  2GLR A;  2PMT A;  2RUF A;  4J2F A;  3FW2 A;  1G0T A;  5IPG A;  2GDR A;  4CDO A;  4OWY A;  1ZMA A;  4IN0 A;  3KMO A;  1EV9 A;  5H5S A;  2G0F A;  5FT3 A;  5E59 A;  3HZ8 A;  1X9W B;  5IO2 A;  2AB6 A;  3KH7 A;  1YKC A;  3IA1 A;  3IK7 A;  1K0M A;  3TKR A;  3TOU A;  1GSQ A;  2HI7 A;  3G7J A;  2X8C A;  1GSS A;  5B6N A;  1XFL A;  5FWG A;  1JFU A;  1V2A A;  3V1W A;  4F0C A;  3QMX A;  3P7X A;  1TDI A;  4LL4 B;  2VCZ A;  2GQK A;  2GZZ A;  1YKA A;  1TK5 B;  2MMO A;  5LD0 A;  2LQO A;  4GST A;  1LBK A;  11GS A;  1H75 A;  1VF1 A;  2A2R A;  2P0G A;  4Q5Q A;  3CSJ A;  5HR1 A;  1ERT A;  3KTB A;  5IMV A;  2P5Q A;  3DVX A;  4GCI A;  4TKY A;  1V40 A;  2HLS A;  2VLV A;  2HT9 A;  3G7I A;  5ECK B;  5IMD A;  1A24 A;  5HR0 A;  3D5J A;  3C71 A;  3GHA A;  3KCM A;  1GTU A;  4KGI A;  4PUA A;  4FH8 A;  4ILF A;  2HZE B;  2XPE A;  1O81 A;  4KUN A;  2KOK A;  4AJ8 A;  3MDK A;  1FG4 A;  4AGS A;  3N9J A;  2DML A;  1LU4 A;  2HZF A;  4OCF A;  1I5G A;  4DEJ A;  1SL1 B;  4MJA A;  4MF6 A;  2BJX A;  2LRN A;  1FB0 A;  2K8S A;  4EL1 A;  4KA0 A;  4MJC A;  4TR3 A;  3IDV A;  3GV1 A;  3WT1 A;  1B48 A;  4D73 A;  5B6M A;  5IMF A;  1OC8 A;  5C04 A;  1ZYE A;  1WMJ A;  1KNG A;  3ZIT A;  1K0B A;  1RK4 A;  2BMX A;  2ES7 A;  2LEG A;  3GA4 A;  2QGV A;  1B4Q A;  1ABA A;  1FVK A;  2YV7 A;  4BWQ A;  2HXK A;  3ZRD A;  1F6M C;  4GSN A;  3F3R A;  1SJ6 A;  1MEK A;  1TKD B;  2IMI A;  4TR1 A;  5DBQ A;  4ACS A;  2KLX A;  3TKQ A;  2LUS A;  2E0Q A;  3N5O A;  3QR6 A;  2QC7 A;  3KZQ A;  3QAV A;  6GSW A;  3HCZ A;  3KH9 A;  1JLV A;  1FOV A;  3GYK A;  3TOT A;  4I5Q A;  3IAM 2;  2OA7 A;  1YQ1 A;  2LQQ A;  5AGY A;  5KN3 A;  1SKR B;  2RLI A;  5ECP B;  4WBJ A;  1MD4 A;  3EYT A;  4HJM A;  3IXR A;  3KJY A;  4N30 A;  2VCX A;  3GH6 A;  2JSY A;  1AUC A;  2JSZ A;  2C0E A;  1ZOF A;  3MWH A;  4JR4 A;  1H4O A;  3FK8 A;  1QFN A;  1TW9 A;  3GH9 A;  5EL8 A;  4ZB9 A;  4JBB A;  4J56 E;  5B8A A;  4IS0 A;  2AUV A;  2VM2 A;  1HNC A;  1ZL9 A;  5DCH A;  3UL3 A;  3GFK A;  3IRA A;  3QAG A;  1M0U A;  5JCG A;  1SK2 A;  1IYH A;  2GST A;  4IHU A;  12GS A;  2PVO C;  1G7O A;  1ML6 A;  3M0F A;  3VWV A;  3RPN A;  3I9V 2;  4PGT A;  2GSQ A;  3TJK A;  2JZR A;  3IR4 A;  4G19 A;  4NWY A;  4DVC A;  3C7M A;  5CRH A;  3O76 A;  1R7H A;  4N0Z A;  1GH2 A;  18GS A;  4N10 A;  4I6X A;  2FD3 A;  1F3A A;  4MZC A;  13GS A;  4KB3 A;  2DC5 A;  4O92 A;  1DSB A;  3ISO A;  1PA3 A;  3F6F A;  2H74 A;  1GSE A;  2L6C A;  4POM A;  2DJ3 A;  3ED3 A;  3M1G A;  2HFD A;  1GUH A;  1WIK A;  1SU9 A;  3VI5 A;  1YF0 A;  3M9K A;  5JCW A;  1XW6 A;  1JLW A;  2C4J A;  4HU9 A;  4EE0 A;  1AXD A;  5ECH B;  1KBN A;  4RUV A;  2F3M A;  2A4V A;  1M7T A;  4V2N A;  16GS A;  5B7C A;  2PVQ A;  2VCT A;  4GLT A;  2B1K A;  1A2J A;  2PUK C;  4NHW A;  2KP1 A;  3O6T A;  2F8F A;  2N5B A;  2PER A;  2C1Y A;  5AIX A;  1AW9 A;  1GTI A;  2CZ3 A;  1QGV A;  5DDL A;  4YQU A;  1GP1 A;  5ECO B;  2I3Y A;  1SJZ A;  1B4P A;  2IJY A;  3J7Y b;  3RBT A;  2V41 A;  2CV4 A;  5IPH A;  1M99 A;  2FY6 A;  5FHI A;  2L4Q A;  1XOB A;  1SYR A;  4EKZ A;  1ZYQ B;  1YZX A;  2NDO A;  1GTA A;  2PPT A;  4F03 A;  2P5R A;  3VFI A;  2IN3 A;  1WWJ A;  1Z3E A;  2WB9 A;  4TRX A;  3D6I A;  2R2J A;  1A8Y A;  4IJI A;  2L59 A;  3TRP A;  2TRC P;  3BBY A;  5ID2 B;  3FZ9 A;  4KH7 A;  4MA9 A;  4HU7 A;  1N8J A;  4KAE A;  1GLQ A;  2O87 A;  4JED A;  2H0I A;  2MBT A;  3WYW A;  1XWA A;  2R6K A;  4MJB A;  4WR4 A;  1XXU A;  1OE7 A;  4TXV A;  5C00 A;  3GL5 A;  4MF5 A;  1A23 A;  2DLX A;  2YZH A;  5EVO A;  1XVQ A;  6GSU A;  3DRN A;  1X5E A;  2FWG A;  4MP4 A;  4NMU A;  3WGE A;  2FWE A;  2KHP A;  1TU7 A;  1K3Y A;  2KUC A;  5DAL B;  1V9W A;  4AJ6 A;  3DXB A;  1N2A A;  2YWO A;  5F05 A;  3LEF A;  2DJ2 A;  1THX A;  3CRT A;  3H79 A;  3OR5 A;  5F0G A;  3RAZ A;  2VCV A;  2H0H A;  1EGR A;  3WGD A;  1GSD A;  1EP7 A;  4L5O A;  2GS3 A;  2ALB A;  3D22 A;  2YPM A;  4BA7 A;  3UJ1 A;  1O6J A;  1YDK A;  2GQM A;  1O73 A;  2IFQ A;  2JZT A;  3ZIJ A;  2OE3 A;  2MMN A;  4V1A p;  4OMV A;  4XS1 A;  3W8S A;  4KSM A;  1QUW A;  4CW9 A;  1AAZ A;  2VUP A;  5ECQ B;  17GS A;  2EC4 A;  1OKD A;  3VWX A;  3FZ4 A;  4X0X A;  5KN1 A;  1F3B A;  1B8X A;  5KEJ A;  3LGC A;  5LCZ A;  4GXZ A;  4PQ1 A;  3EUR A;  1THO A;  3LWA A;  3GL3 A;  3CXG A;  4ZL9 A;  2VO4 A;  1EZK A;  5ELA A;  1I9D A;  2PGT A;  1G7E A;  1K0N A;  2GT6 A;  20GS A;  5HFK A;  4QL9 A;  2LST A;  3KTL A;  5A4V A;  2VL2 A;  3BCK A;  1X5C A;  4MPG A;  1K0O A;  4WF4 A;  1G6W A;  2V6K A;  4AF2 A;  5ECI B;  4H86 A;  5DQS A;  3EIN A;  2GTU A;  1AQV A;  1GSU A;  2ZCT A;  5ENU A;  2HE3 A;  5ECS A;  2YWM A;  3QAW A;  4PNG A;  3ZFB A;  3APQ A;  5CRE A;  5IMC A;  3EU4 A;  3LYK A;  4V2L A;  1T1V A;  1K3O A;  3C1R A;  1GSY A;  2VL9 A;  1E6B A;  1O8W A;  1U3A A;  1FW1 A;  4PX1 A;  3TJG A;  1GL8 A;  4K7I A;  2CT6 A;  2FA4 A;  2K18 A;  3WGX A;  1M2D A;  2REM A;  4XIH A;  4CHS A;  1SK0 A;  1UC7 A;  3ZRE A;  3QOU A;  2LV3 A;  1AQX A;  3RPP A;  4QL7 A;  1JZW A;  3LOR A;  3VK9 A;  4MCU A;  2YWI A;  3ME7 A;  2I1U A;  3D4M A;  4KND A;  1PD2 1;  4HOJ A;  2M72 A;  3LG6 A;  3D0Z A;  2IMK A;  4EDY A;  2LRT A;  1XPV A;  1NHO A;  4IQ1 A;  3F3Q A;  2GZP A;  1QK8 A;  2I4A A;  1SYX A;  5IO0 A;  3FKF A;  3UEM A;  2CAQ A;  4TOP A;  2FWF A;  22GS A;  1K0A A;  5EPF A;  2H76 A;  1OC9 A;  5F8B A;  1OVN A;  4BL7 A;  2PU9 C;  2OBK A;  4G10 A;  5EY6 A;  2HSH A;  3DD3 A;  4TXO B;  4K6X A;  5DCG A;  1EEM A;  2VCQ A;  4I97 A;  2ZUP A;  3BJ5 A;  4ZIJ A;  1U87 A;  2HYX A;  3HVS A;  2PBJ A;  5AIV A;  5HQP A;  3LXT A;  1EV4 A;  2CA8 A;  3ZMK A;  3GTU B;  4OO4 A;  1G6Y A;  2EIR A;  4IW9 A;  4ZBB A;  3TKS A;  1UVZ A;  1ZGN A;  2RM6 A;  5JWQ B;  4X43 A;  1EOG A;  3PR8 A;  1HNB A;  5GZZ B;  2RM5 A;  1XCC A;  1AC1 A;  1SL2 B;  5J41 A;  3VI7 A;  2ZNM A;  2H75 A;  4MK3 A;  1ON4 A;  1W89 A;  3DEX A;  1CQG A;  4JU5 A;  2J23 A;  3TRQ A;  2HNL A;  5H5R A;  3LXZ A;  5ECN B;  1MDK A;  4ML1 A;  4WXT A;  2O89 A;  1K0C A;  2LRC A;  4YAP A;  4PQI A;  1EOH A;  1TI1 A;  3DWV A;  5G5E A;  3A2X A;  3NZN A;  1ST9 A;  2IPA A;  3KGK A;  5L71 A;  2VLT A;  2YZU A;  1NSW A;  4O5R A;  1SJI A;  1GLP A;  5CO3 A;  4JR6 A;  6GSV A;  3RHB A;  4HJ2 A;  1TTZ A;  1MTC A;  2VCW A;  3GMF A;  3GRX A;  2MZC A;  1Z7R A;  4XCS A;  3P8W A;  5H5Q A;  1ILO A;  3HDC A;  4ZB6 A;  2F51 A;  4QQ7 A;  2C3N A;  4GQF A;  3TKP A;  1M2A A;  2VL2 C;  3A2W A;  3KD0 A;  1HYU A;  1LJR A;  4KCE A;  1OE8 A;  4DSS B;  1XOA A;  4EF0 A;  3IHQ A;  3EU3 A;  2B3S A;  5ECL B;  3DKS A;  3I6A A;  5IQY A;  1CQH A;  2H70 A;  3ZML A;  4YAV A;  2NPB A;  2JU5 A; 
#chains in the Genus database with same CATH topology
 1BAY A;  1BQ7 A;  3TJJ A;  3APO A;  5G1K A;  4BWS A;  4IEL A;  5GAN D;  2GSS A;  3L9V A;  3CSI A;  3UVT A;  4A5P A;  3EC3 A;  4BVY A;  2AJQ B;  3LYP A;  3HY2 A;  2DIZ A;  4XS4 A;  3FR9 A;  2LJA A;  2V1M A;  5HFI A;  3ERW A;  3CBU A;  3CTG A;  4EDZ A;  1TOF A;  3LSZ A;  2QKE A;  2GT5 A;  3MYD A;  4OO5 A;  3U6V A;  3HVV A;  1M9A A;  3FYG A;  3CQF A;  4O7H A;  5GST A;  2OKA A;  3EE2 A;  4ZL8 A;  1HQO A;  14GS A;  2WCI A;  1NM3 A;  2M80 A;  4PQH A;  1R5A A;  3CYN A;  3GX0 A;  4KDX A;  5G31 A;  1DE2 A;  3HKR A;  5AN1 A;  3ZVJ D;  4MPF A;  4MNN A;  1O8X A;  3HZ4 A;  1R26 A;  4PNF A;  4HS1 A;  5A5K A;  1GRX A;  3VPQ A;  2CVB A;  4IJ3 A;  3DIE A;  3Q74 A;  3UOM A;  2XHF A;  4LMW A;  1K3L A;  2QSI A;  3FY7 A;  1PRX A;  1XWB A;  2DJ1 A;  3A2V A;  4WET A;  1S3A A;  2H72 A;  2YNX A;  2H73 A;  4ISD A;  1Z9H A;  3ZIV A;  1YJ6 A;  3FEU A;  2H66 A;  1GUL A;  3TB2 A;  4JRR A;  3S9F A;  3TJB A;  2TIR A;  5DAK A;  4TW5 A;  4XRA A;  3ZTL A;  2B5X A;  2IIY A;  2DIY A;  1PX7 A;  5D73 A;  2PWJ A;  4EO3 A;  1GUK A;  3HHV A;  2B6M A;  1YY7 A;  2LS5 A;  2C0D A;  3IC4 A;  2ON5 A;  4HEA 2;  5A4U A;  5IMA A;  4D73 B;  3EWL A;  5LNK e;  3F63 A;  4Q5F A;  5CNW A;  4P3Y B;  1T7P B;  2A4H A;  1FAA A;  4GWR A;  4ZBD A;  4AJ7 A;  1KTE A;  2YP6 A;  4POK A;  3L78 A;  1B9X C;  1XW5 A;  3F6D A;  2B7K A;  2H1D A;  3MSZ A;  2VOC A;  4TR1 B;  6GSY A;  2L57 A;  1VRS D;  1YEP A;  1IYI A;  3L9U A;  3G7Y A;  3HA9 A;  3P2A A;  2WFC A;  4MF7 A;  2F9S A;  3QCP A;  1ZZY A;  3NOF A;  3BOA A;  3TUE A;  4I2T A;  4JE1 A;  4OFT A;  3PIN A;  1URM A;  2IMF A;  4X4J A;  3HYP A;  4RQR A;  5GSS A;  4V2M A;  3J7Y k;  2IME A;  2VD1 A;  2IWT A;  3PGT A;  1KEB A;  5A4W A;  1W4V A;  2FWH A;  4MAB A;  5G1L A;  3DVW A;  2IMD A;  2CVD A;  3HVX A;  4HUA A;  1T8E B;  4PUR A;  1PL1 A;  2O8V B;  2OBI A;  1A0R P;  4Z2R A;  1M9B A;  2HSM A;  4V1A g;  2H6X A;  3I43 A;  1TRV A;  2HRN A;  1PKW A;  3H8Q A;  2RII A;  4EC0 A;  2CZ2 A;  1PQN A;  1XW9 A;  1JZO A;  2FNO A;  4KE3 A;  1M2B A;  4ZIL A;  3H93 A;  1PMT A;  2C3Q A;  3US3 A;  5ECM B;  2OAC A;  9GSS A;  4MZB A;  5J9B A;  4Q5R A;  3UMA A;  3F9U A;  1TJD A;  4ZB8 A;  2J9H A;  3VWU A;  1BJX A;  3HJP A;  2CVK A;  4F0B A;  2LNS A;  2MMZ A;  4TR4 A;  4N11 A;  5GAP D;  2GVP A;  2HZE A;  5COH A;  3L0H A;  4IVF A;  2MMA A;  3GN3 A;  3EPT A;  4XTS A;  3ZLP A;  2Z9S A;  1SK1 A;  2AHE A;  5F07 A;  2H6Z A;  2VAF A;  4HQZ A;  3ZVJ A;  1VF2 A;  3GSS A;  4WR5 A;  4TR0 A;  1ZCP A;  5JWR B;  2VM1 A;  4LMV A;  3ZZX A;  3WD6 A;  4ECJ A;  3F4R A;  2X8G A;  2YWN A;  3C73 A;  5DAK B;  4K1F A;  2R4V A;  5ECR B;  1XVW A;  1X9S B;  1C72 A;  5HR3 A;  2WS2 A;  3E0U A;  3C8E A;  5KN2 A;  4HI7 A;  5J3R A;  2R3X A;  2LNT A;  3VPT A;  1T4Y A;  4K7N A;  1TXX A;  3CRU A;  1Q4J A;  4FIW A;  5G2Z A;  1Z5Y E;  4K9Z A;  5D9X A;  1J9B A;  3D21 A;  2R37 A;  1EGO A;  1XBS A;  4HDE A;  1X9M B;  2NTO A;  5D8I A;  1NW2 A;  2GZY A;  1UN2 A;  2LJR A;  2F8A A;  5IIZ A;  4CY8 A;  1U88 A;  3ERF A;  1E2Y A;  1WPI A;  1XIY A;  1T00 A;  2EIO A;  4IKH A;  3G9B A;  5CYY A;  4EUY A;  4E8H A;  3BCI A;  3D4T A;  2IL3 A;  5J5N A;  3GKN A;  4HZ4 A;  4Z2U A;  3IBH A;  1JZD A;  2VD0 A;  1ZYN A;  1F37 A;  3KXO A;  2WUL A;  5INY A;  3DGQ A;  2I81 A;  2FA8 A;  3QFB C;  1QQ2 A;  3TRX A;  1A8L A;  2OE1 A;  2P31 A;  2K6V A;  3FR3 A;  3ZL5 A;  5IM9 A;  5IOX A;  1J08 A;  3UVH A;  1MDJ A;  2JAC A;  2B1L A;  2JAD A;  2WGR A;  3H4K A;  3FZA A;  2C8U A;  3IE3 A;  1SD8 A;  1TRU A;  1FB6 A;  1A0F A;  5KN0 A;  4KDU A;  3U5R E;  6GST A;  4ICY A;  4F2I A;  1VF3 A;  2EIQ A;  3GKX A;  1SD9 A;  3A5W A;  4PXO A;  2CQ9 A;  5DJL A;  2GGT A;  1OYJ A;  2AAW A;  3FRC A;  4NXI A;  4BVX A;  1BX9 A;  4Q5N A;  3UAR A;  5J9C A;  4GSS A;  1K0D A;  4KDY A;  1A2M A;  5D93 A;  4IQA A;  2IFQ B;  2WZ9 A;  1Z7P A;  2B5E A;  3KMN A;  2YCD A;  3EVI A;  5D9V A;  2K8V A;  4KW6 A;  5G5F A;  3GST A;  3A3T A;  3QD9 A;  1V58 A;  4OCE A;  2H1A A;  2XC2 A;  3C1S A;  3DML A;  4MJE A;  2I9H A;  4PUF C;  1TI3 A;  4BIK A;  1SEN A;  3ME8 A;  3F8U A;  1TP9 A;  4G0I A;  3FZ5 A;  1OAZ A;  4L0W A;  3KIJ A;  2DSA A;  4ID0 A;  3HJM A;  1U6T A;  3CSH A;  1WP0 A;  5HFG A;  5IOW A;  3GUR A;  2V2G A;  4F82 A;  5JWO B;  1OC3 A;  2C0F A;  4NPB A;  3VWW A;  3RDW A;  3H1N A;  4CY6 A;  3L9S A;  2OJL A;  2H30 A;  3UBK A;  1TRS A;  3L4N A;  4L5L A;  4I8B A;  3FHK A;  2X99 A;  4L8E A;  1TK8 B;  3GKK A;  1UA5 A;  6GSS A;  4FYU A;  3HJO A;  1SKS B;  10GS A;  3KM6 A;  4G0L A;  5CRW A;  2HRF A;  3QPM A;  5D9W A;  2LTK A;  4ZBA A;  1GTB A;  5BRT A;  4ZXG A;  3WT2 A;  5E4W A;  3CMI A;  4MH2 A;  5CP1 A;  3R2Q A;  2E7P A;  4FYC A;  4XS6 A;  1TRW A;  3TKS E;  1ERW A;  5ID2 A;  4ECI A;  3TDG A;  2JZS A;  4O5Q A;  4DSR A;  3IPZ A;  4NV5 A;  5BMU A;  2H6Y A;  2E2M A;  1X5D A;  3FMW A;  1WJK A;  3AY8 A;  2M46 A;  1B9Y C;  1AQW A;  1BYE A;  4IP6 A;  6GSX A;  2DJJ A;  2WRT A;  4K8M A;  5IMZ A;  2WJU A;  3GIX A;  4GF0 A;  3E9J B;  2AYT A;  3LFL A;  3W6G A;  3UAP A;  5DAL A;  1A2L A;  1V57 A;  4JZQ A;  4FYB A;  1Z6N A;  1V98 A;  2RUE A;  2DBC A;  1ERU A;  3Q18 A;  3SBC A;  2XPD A;  3LJR A;  2C3T A;  2L5L A;  1OC9 B;  2L5O A;  4LA1 A;  1T4Z A;  1Z6M A;  1AIU A;  3FR6 A;  2QA1 A;  4WBR D;  1PL2 A;  2CAI A;  4BL7 B;  3TCO A;  4GQC A;  1S3C A;  4K0N A;  2MBS A;  4ZL7 A;  1EP8 A;  4KSO A;  2KP2 A;  4WEY A;  4LLR A;  1PSQ A;  2X64 A;  2H01 A;  1JHB A;  4Z7X A;  4KCA A;  2C80 A;  3APS A;  8GSS A;  5JCU A;  1DBY A;  1QMV A;  1Y25 A;  3PH9 A;  3KP9 A;  3O3T A;  1X0R A;  1PKZ A;  1GNE A;  2A2S A;  5J4U A;  2TRX A;  4YQV A;  3HD5 A;  2PN8 A;  3UBL A;  4I2U A;  1MDI A;  2H1B A;  4YH2 A;  2YOI A;  1EWX A;  4FO5 A;  4IGJ A;  4F9Z A;  1HD2 A;  2K9F A;  1OKT A;  3Q6O A;  2B5Y A;  3QFA C;  1XZO A;  4FQU A;  2H1G A;  2YN1 A;  2X8H A;  1Q98 A;  4EVM A;  5DJM A;  1T3B A;  1QXH A;  2C0G A;  4YQM A;  3ZYW A;  1JZR A;  2BTO T;  1SL0 B;  3TKS C;  3F0I A;  5B8B A;  3F4S A;  2FHE A;  1YEX A;  1PN9 A;  4J57 E;  1ERV A;  2YJH A;  1PX6 A;  1SKW B;  4EXJ A;  1GNW A;  3M9J A;  4NV2 A;  3A5I A;  2XBI A;  2JL4 A;  3ZFL A;  3M3M A;  3JCM L;  2GSR A;  2FCH A;  4G9H A;  4RI6 A;  4RQX A;  3IAS 2;  2H71 A;  2R5G A;  1FVJ A;  5KOW A;  3TGZ A;  4ECB A;  3LQ7 A;  1VGL A;  2DMM A;  3QDN A;  5DQY A;  1WE0 A;  1BG5 A;  1S3R A;  4TVE A;  2WDU A;  3ERG A;  3GKM A;  4OD7 A;  1XWK A;  3SWL A;  2L4C A;  4OFN A;  4IP1 A;  2CX4 A;  4KF9 A;  4BVY B;  1ACV A;  5ELG A;  1GSF A;  2YJ7 A;  3BD2 A;  2LKU A;  4E8E A;  1S3D A;  4XS4 B;  2FGX A;  4KX4 A;  3UIW A;  3GNJ A;  2H8L A;  2H0G A;  5D9T A;  4POL A;  2ON7 A;  2YV9 A;  4XRD A;  5AIS A;  2AV4 A;  5CRD A;  3CTF A;  1FO5 A;  1GWC A;  2O7K A;  5CAX A;  4HQS A;  3IV4 A;  4NHZ A;  4O5U A;  3TJF A;  3MAK A;  4TXO A;  1R4W A;  4X1U A;  3P90 A;  3KEB A;  3W8J A;  3IOS A;  1M3I A;  2G2Q A;  4ULX A;  4MH3 A;  2CX3 A;  3EMP A;  3VLN A;  4DSQ A;  1TU8 A;  2N5F A;  3GTU A;  2FUG 2;  1U3I A;  1WOU A;  2VL3 A;  7GSS A;  4WF5 A;  4TN8 A;  5D96 A;  4MDC A;  2GQL A;  1MD3 A;  2OE0 A;  3I69 A;  2VLU A;  2HSY A;  4MZW A;  1F9M A;  2X49 A;  5G30 A;  1YF1 A;  2D2Z A;  4O32 A;  4N0V A;  1HNA A;  3IK9 A;  3KP8 A;  4K0G A;  3F4T A;  2MYG A;  4MLY A;  3RHC A;  3DYR A;  1USB A;  4IBP A;  1RW1 A;  2H19 A;  4K7O A;  1RQM A;  4RI7 A;  2N5A A;  4K5S A;  4L0U A;  1XWC A;  1PGT A;  1O85 A;  3Q19 A;  2NVL A;  4NAX A;  3E3E A;  4GRF A;  4GTU A;  3HXS A;  1TK0 B;  2O85 A;  4K5R A;  5F06 A;  4MMM A;  4G2E A;  3EMX A;  2DJ0 A;  4PTS A;  4EIQ A;  4K2D A;  2LJK A;  2YAN A;  5ABR A;  5HR2 A;  4LL1 B;  2VIM A;  3IC8 A;  4OFM A;  4ECC A;  1R5P A;  1GUM A;  1O7U A;  5KOX A;  4HZ2 A;  2QA2 A;  1EEJ A;  2DKI A;  4XHM A;  1WRY A;  1DUG A;  3NIV A;  1XWG A;  1DE1 A;  1VF4 A;  1Y6E A;  2OAD A;  1J0F A;  5DVB A;  2L6D A;  3VUR A;  2E2G A;  3GX8 A;  2DJK A;  1NHY A;  2XBQ A;  4WKW A;  4POB A;  2B7J A;  2V32 A;  5CRG A;  2NBS A;  3GUS A;  3M8N A;  1FHE A;  3K8N A;  2V6O A;  1BED A;  2FLS A;  4DSS A;  3MNG A;  4ML6 A;  4BPY A;  19GS A;  1F2E A;  2GLR A;  2PMT A;  2RUF A;  4J2F A;  3FW2 A;  1G0T A;  2R0G A;  5IPG A;  2GDR A;  4CDO A;  4OWY A;  1ZMA A;  4IN0 A;  3KMO A;  1EV9 A;  5H5S A;  2G0F A;  5FT3 A;  5E59 A;  3HZ8 A;  1X9W B;  5IO2 A;  2AB6 A;  3KH7 A;  1YKC A;  3IA1 A;  3IK7 A;  1K0M A;  3TKR A;  3TOU A;  1GSQ A;  2HI7 A;  3G7J A;  2X8C A;  1GSS A;  5B6N A;  1XFL A;  5FWG A;  1JFU A;  1V2A A;  3V1W A;  4F0C A;  3QMX A;  3P7X A;  1TDI A;  4LL4 B;  2VCZ A;  4K2X A;  2GQK A;  2GZZ A;  1YKA A;  1TK5 B;  2MMO A;  5LD0 A;  2LQO A;  4GST A;  1LBK A;  11GS A;  1H75 A;  1VF1 A;  2A2R A;  2P0G A;  4Q5Q A;  3CSJ A;  5HR1 A;  1ERT A;  3KTB A;  5IMV A;  2P5Q A;  3DVX A;  4GCI A;  4TKY A;  1V40 A;  2HLS A;  2VLV A;  2HT9 A;  3G7I A;  5ECK B;  5IMD A;  1A24 A;  5HR0 A;  3D5J A;  3C71 A;  3GHA A;  3KCM A;  1GTU A;  4KGI A;  4PUA A;  4FH8 A;  4ILF A;  1XG8 A;  2HZE B;  2XPE A;  1O81 A;  4KUN A;  2KOK A;  4AJ8 A;  3MDK A;  1FG4 A;  4AGS A;  3N9J A;  2DML A;  1LU4 A;  2HZF A;  4OCF A;  1I5G A;  4DEJ A;  1SL1 B;  4MJA A;  4MF6 A;  2BJX A;  2LRN A;  1FB0 A;  2K8S A;  4EL1 A;  4KA0 A;  4MJC A;  4TR3 A;  3IDV A;  3GV1 A;  3WT1 A;  1B48 A;  4D73 A;  5B6M A;  5IMF A;  1OC8 A;  5C04 A;  1ZYE A;  1WMJ A;  1KNG A;  3ZIT A;  1K0B A;  1RK4 A;  2BMX A;  2ES7 A;  2LEG A;  3GA4 A;  2QGV A;  1B4Q A;  1ABA A;  1FVK A;  2YV7 A;  4BWQ A;  2HXK A;  3ZRD A;  1F6M C;  4GSN A;  3F3R A;  1SJ6 A;  1MEK A;  1TKD B;  2IMI A;  4TR1 A;  5DBQ A;  4ACS A;  2KLX A;  3TKQ A;  2LUS A;  2E0Q A;  3N5O A;  3QR6 A;  2QC7 A;  3KZQ A;  3QAV A;  2UZ8 A;  6GSW A;  3HCZ A;  3KH9 A;  1JLV A;  1FOV A;  3GYK A;  3TOT A;  4I5Q A;  3IAM 2;  2OA7 A;  1YQ1 A;  2LQQ A;  5AGY A;  5KN3 A;  1SKR B;  2RLI A;  4WBJ A;  5ECP B;  1MD4 A;  3EYT A;  4HJM A;  3IXR A;  3KJY A;  4N30 A;  2VCX A;  3GH6 A;  2JSY A;  2A2P A;  1AUC A;  2JSZ A;  4YKF A;  2C0E A;  1ZOF A;  3MWH A;  4JR4 A;  1H4O A;  3FK8 A;  1QFN A;  1TW9 A;  3GH9 A;  5EL8 A;  4ZB9 A;  4JBB A;  4J56 E;  5B8A A;  4IS0 A;  2AUV A;  2VM2 A;  1HNC A;  1ZL9 A;  5DCH A;  3UL3 A;  3GFK A;  3IRA A;  3QAG A;  1M0U A;  5JCG A;  1SK2 A;  1IYH A;  2GST A;  4IHU A;  12GS A;  2PVO C;  1G7O A;  1ML6 A;  3M0F A;  3VWV A;  3RPN A;  4HSC X;  3I9V 2;  4PGT A;  2GSQ A;  3TJK A;  2JZR A;  3IR4 A;  4G19 A;  4NWY A;  4DVC A;  3C7M A;  5CRH A;  3O76 A;  3HVN A;  1R7H A;  4N0Z A;  1GH2 A;  18GS A;  4N10 A;  4I6X A;  4BVX B;  2FD3 A;  4MZC A;  1F3A A;  13GS A;  4KB3 A;  2DC5 A;  2X4A A;  4O92 A;  1DSB A;  3ISO A;  1PA3 A;  3F6F A;  2H74 A;  1GSE A;  2L6C A;  4POM A;  2DJ3 A;  3ED3 A;  3M1G A;  2HFD A;  1GUH A;  1WIK A;  1SU9 A;  3VI5 A;  1YF0 A;  3M9K A;  5JCW A;  1XW6 A;  1JLW A;  2C4J A;  4HU9 A;  4EE0 A;  1AXD A;  5ECH B;  1KBN A;  4RUV A;  2F3M A;  2A4V A;  1M7T A;  4V2N A;  16GS A;  5B7C A;  2PVQ A;  2VCT A;  4GLT A;  2B1K A;  1A2J A;  2PUK C;  4NHW A;  2KP1 A;  3O6T A;  2F8F A;  2N5B A;  2PER A;  2C1Y A;  5AIX A;  1AW9 A;  1GTI A;  2CZ3 A;  1QGV A;  5DDL A;  4YQU A;  1GP1 A;  5ECO B;  2I3Y A;  1SJZ A;  1B4P A;  2IJY A;  3PPU A;  3J7Y b;  3RBT A;  2V41 A;  2CV4 A;  5IPH A;  1M99 A;  2FY6 A;  5FHI A;  2L4Q A;  1XOB A;  1SYR A;  4EKZ A;  1ZYQ B;  1YZX A;  2NDO A;  1GTA A;  2PPT A;  4F03 A;  2P5R A;  3VFI A;  2IN3 A;  1WWJ A;  1Z3E A;  2WB9 A;  4TRX A;  3D6I A;  2R2J A;  1A8Y A;  4IJI A;  1PFO A;  2L59 A;  3TRP A;  2TRC P;  3BBY A;  5ID2 B;  3FZ9 A;  4KH7 A;  4MA9 A;  4HU7 A;  1N8J A;  4KAE A;  1GLQ A;  2O87 A;  4JED A;  2H0I A;  2MBT A;  3WYW A;  1XWA A;  2R6K A;  4MJB A;  4WR4 A;  1XXU A;  1OE7 A;  4TXV A;  5C00 A;  3GL5 A;  3MIX A;  4MF5 A;  1A23 A;  2DLX A;  2YZH A;  5EVO A;  1XVQ A;  1M3J A;  6GSU A;  3DRN A;  1X5E A;  2FWG A;  4MP4 A;  4NMU A;  3WGE A;  2FWE A;  2KHP A;  1TU7 A;  1K3Y A;  2KUC A;  5DAL B;  1V9W A;  4AJ6 A;  3DXB A;  1N2A A;  2YWO A;  5F05 A;  3LW9 A;  3LEF A;  2DJ2 A;  1THX A;  3CRT A;  3H79 A;  3OR5 A;  5F0G A;  3RAZ A;  2VCV A;  2H0H A;  1EGR A;  3WGD A;  1GSD A;  1EP7 A;  4L5O A;  2GS3 A;  2ALB A;  3D22 A;  2YPM A;  4BA7 A;  3UJ1 A;  1O6J A;  1YDK A;  2GQM A;  1O73 A;  2IFQ A;  2JZT A;  3ZIJ A;  2OE3 A;  2MMN A;  4V1A p;  4OMV A;  4XS1 A;  3W8S A;  4KSM A;  1QUW A;  4CW9 A;  1AAZ A;  2VUP A;  5ECQ B;  17GS A;  2EC4 A;  1OKD A;  3VWX A;  3FZ4 A;  4X0X A;  5KN1 A;  1F3B A;  1B8X A;  5KEJ A;  3LGC A;  5LCZ A;  4GXZ A;  4PQ1 A;  3EUR A;  1THO A;  3LWA A;  3GL3 A;  3CXG A;  4ZL9 A;  2VO4 A;  1EZK A;  5ELA A;  1I9D A;  2PGT A;  1G7E A;  1K0N A;  2GT6 A;  20GS A;  5HFK A;  4QL9 A;  2LST A;  3KTL A;  5A4V A;  2VL2 A;  3BCK A;  1X5C A;  4MPG A;  1K0O A;  4WF4 A;  1G6W A;  2V6K A;  4AF2 A;  5ECI B;  4H86 A;  3IHG A;  5DQS A;  3EIN A;  2GTU A;  1AQV A;  1GSU A;  2ZCT A;  5ENU A;  2HE3 A;  5ECS A;  2YWM A;  3QAW A;  4PNG A;  3ZFB A;  3APQ A;  3R3E A;  5CRE A;  5IMC A;  3EU4 A;  3LYK A;  4V2L A;  1T1V A;  1K3O A;  3C1R A;  1GSY A;  2VL9 A;  1E6B A;  1O8W A;  1U3A A;  1FW1 A;  4PX1 A;  1ZYP A;  3TJG A;  1GL8 A;  4K7I A;  2CT6 A;  2FA4 A;  2K18 A;  2R0C A;  3WGX A;  1M2D A;  4Z2T A;  2REM A;  4XIH A;  4CHS A;  1SK0 A;  1UC7 A;  3ZRE A;  2HRK A;  3QOU A;  2LV3 A;  1AQX A;  3RPP A;  4QL7 A;  1JZW A;  3LOR A;  3VK9 A;  4MCU A;  2YWI A;  3ME7 A;  2I1U A;  3D4M A;  4KND A;  1PD2 1;  4HOJ A;  2M72 A;  3LG6 A;  3D0Z A;  2IMK A;  4EDY A;  2LRT A;  1XPV A;  1NHO A;  4IQ1 A;  3F3Q A;  2GZP A;  1QK8 A;  2I4A A;  1SYX A;  5IO0 A;  3FKF A;  3UEM A;  2CAQ A;  4TOP A;  2FWF A;  22GS A;  1K0A A;  5EPF A;  2H76 A;  1OC9 A;  5F8B A;  1OVN A;  4USS A;  4BL7 A;  2PU9 C;  2OBK A;  4G10 A;  5EY6 A;  2HSH A;  3DD3 A;  4TXO B;  4K6X A;  5DCG A;  1EEM A;  2VCQ A;  4I97 A;  2ZUP A;  3BJ5 A;  4ZIJ A;  1U87 A;  2HYX A;  3HVS A;  2PBJ A;  5AIV A;  5HQP A;  3LXT A;  1EV4 A;  2CA8 A;  3ZMK A;  3GTU B;  4OO4 A;  1G6Y A;  2EIR A;  4IW9 A;  4ZBB A;  3TKS A;  1UVZ A;  1ZGN A;  2RM6 A;  5JWQ B;  2DKH A;  4X43 A;  1EOG A;  3PR8 A;  1HNB A;  5GZZ B;  2RM5 A;  1XCC A;  1AC1 A;  1SL2 B;  5J41 A;  3VI7 A;  2ZNM A;  2H75 A;  4MK3 A;  1ON4 A;  1W89 A;  3DEX A;  4G0K A;  1CQG A;  4JU5 A;  4YKG A;  2J23 A;  3TRQ A;  2HNL A;  2R0P A;  5H5R A;  3LXZ A;  5ECN B;  1MDK A;  4ML1 A;  4WXT A;  2O89 A;  2HRA A;  1K0C A;  2LRC A;  4YAP A;  4PQI A;  1EOH A;  1TI1 A;  3DWV A;  5G5E A;  3A2X A;  3NZN A;  1ST9 A;  2IPA A;  3KGK A;  5L71 A;  2VLT A;  2YZU A;  1NSW A;  4O5R A;  1SJI A;  1GLP A;  5CO3 A;  4JR6 A;  6GSV A;  3RHB A;  1PN0 A;  4HJ2 A;  1TTZ A;  4EIP A;  1MTC A;  2VCW A;  3GMF A;  3GRX A;  2MZC A;  1Z7R A;  4XCS A;  3P8W A;  5H5Q A;  1ILO A;  3HDC A;  4ZB6 A;  2F51 A;  4QQ7 A;  2C3N A;  4GQF A;  3TKP A;  1M2A A;  2VL2 C;  3A2W A;  3KD0 A;  1HYU A;  1LJR A;  4KCE A;  1OE8 A;  4DSS B;  1XOA A;  4EF0 A;  3IHQ A;  3EU3 A;  2B3S A;  1FOH A;  5ECL B;  3DKS A;  3I6A A;  5IQY A;  1CQH A;  2H70 A;  3ZML A;  4YAV A;  2NPB A;  2JU5 A; 
#chains in the Genus database with same CATH homology
 1BAY A;  1BQ7 A;  3TJJ A;  3APO A;  5G1K A;  4BWS A;  4IEL A;  5GAN D;  2GSS A;  3L9V A;  3CSI A;  3UVT A;  4A5P A;  3EC3 A;  4BVY A;  2AJQ B;  3LYP A;  3HY2 A;  2DIZ A;  4XS4 A;  3FR9 A;  2LJA A;  2V1M A;  5HFI A;  3ERW A;  3CBU A;  3CTG A;  4EDZ A;  1TOF A;  3LSZ A;  2QKE A;  2GT5 A;  3MYD A;  4OO5 A;  3U6V A;  3HVV A;  1M9A A;  3FYG A;  4O7H A;  5GST A;  2OKA A;  3EE2 A;  4ZL8 A;  1HQO A;  14GS A;  2WCI A;  1NM3 A;  2M80 A;  4PQH A;  1R5A A;  3CYN A;  3GX0 A;  4KDX A;  5G31 A;  1DE2 A;  3HKR A;  5AN1 A;  3ZVJ D;  4MPF A;  4MNN A;  1O8X A;  3HZ4 A;  1R26 A;  4PNF A;  4HS1 A;  5A5K A;  1GRX A;  3VPQ A;  2CVB A;  4IJ3 A;  3DIE A;  3Q74 A;  3UOM A;  2XHF A;  4LMW A;  1K3L A;  2QSI A;  3FY7 A;  1PRX A;  1XWB A;  2DJ1 A;  3A2V A;  4WET A;  1S3A A;  2H72 A;  2YNX A;  2H73 A;  4ISD A;  1Z9H A;  3ZIV A;  1YJ6 A;  3FEU A;  2H66 A;  1GUL A;  3TB2 A;  4JRR A;  3S9F A;  3TJB A;  2TIR A;  5DAK A;  4TW5 A;  4XRA A;  3ZTL A;  2B5X A;  2IIY A;  2DIY A;  1PX7 A;  5D73 A;  2PWJ A;  4EO3 A;  1GUK A;  3HHV A;  2B6M A;  1YY7 A;  2LS5 A;  2C0D A;  3IC4 A;  2ON5 A;  4HEA 2;  5A4U A;  5IMA A;  4D73 B;  3EWL A;  5LNK e;  3F63 A;  4Q5F A;  5CNW A;  4P3Y B;  1T7P B;  2A4H A;  1FAA A;  4GWR A;  4ZBD A;  4AJ7 A;  1KTE A;  2YP6 A;  4POK A;  3L78 A;  1B9X C;  1XW5 A;  3F6D A;  2B7K A;  2H1D A;  3MSZ A;  2VOC A;  4TR1 B;  6GSY A;  2L57 A;  1VRS D;  1YEP A;  1IYI A;  3L9U A;  3G7Y A;  3HA9 A;  3P2A A;  2WFC A;  4MF7 A;  2F9S A;  3QCP A;  1ZZY A;  3NOF A;  3BOA A;  3TUE A;  4I2T A;  4JE1 A;  4OFT A;  3PIN A;  1URM A;  2IMF A;  4X4J A;  3HYP A;  4RQR A;  5GSS A;  4V2M A;  3J7Y k;  2IME A;  2VD1 A;  2IWT A;  3PGT A;  1KEB A;  5A4W A;  1W4V A;  2FWH A;  4MAB A;  5G1L A;  3DVW A;  2IMD A;  2CVD A;  3HVX A;  4HUA A;  1T8E B;  4PUR A;  1PL1 A;  2O8V B;  2OBI A;  1A0R P;  4Z2R A;  1M9B A;  2HSM A;  4V1A g;  2H6X A;  3I43 A;  1TRV A;  2HRN A;  1PKW A;  3H8Q A;  2RII A;  4EC0 A;  2CZ2 A;  1PQN A;  1XW9 A;  1JZO A;  2FNO A;  4KE3 A;  1M2B A;  4ZIL A;  3H93 A;  1PMT A;  2C3Q A;  3US3 A;  5ECM B;  2OAC A;  9GSS A;  4MZB A;  5J9B A;  4Q5R A;  3UMA A;  3F9U A;  1TJD A;  4ZB8 A;  2J9H A;  3VWU A;  1BJX A;  3HJP A;  2CVK A;  4F0B A;  2LNS A;  2MMZ A;  4TR4 A;  4N11 A;  5GAP D;  2GVP A;  2HZE A;  5COH A;  3L0H A;  4IVF A;  2MMA A;  3GN3 A;  3EPT A;  4XTS A;  3ZLP A;  2Z9S A;  1SK1 A;  2AHE A;  5F07 A;  2H6Z A;  2VAF A;  4HQZ A;  3ZVJ A;  1VF2 A;  3GSS A;  4WR5 A;  4TR0 A;  1ZCP A;  5JWR B;  2VM1 A;  4LMV A;  3ZZX A;  3WD6 A;  4ECJ A;  3F4R A;  2X8G A;  2YWN A;  3C73 A;  5DAK B;  4K1F A;  2R4V A;  5ECR B;  1XVW A;  1X9S B;  1C72 A;  5HR3 A;  2WS2 A;  3E0U A;  3C8E A;  5KN2 A;  4HI7 A;  5J3R A;  2R3X A;  2LNT A;  3VPT A;  1T4Y A;  4K7N A;  1TXX A;  3CRU A;  1Q4J A;  4FIW A;  5G2Z A;  1Z5Y E;  4K9Z A;  5D9X A;  1J9B A;  3D21 A;  2R37 A;  1EGO A;  1XBS A;  4HDE A;  1X9M B;  2NTO A;  5D8I A;  1NW2 A;  2GZY A;  1UN2 A;  2LJR A;  2F8A A;  5IIZ A;  4CY8 A;  1U88 A;  3ERF A;  1E2Y A;  1WPI A;  1XIY A;  1T00 A;  2EIO A;  4IKH A;  3G9B A;  5CYY A;  4EUY A;  4E8H A;  3BCI A;  3D4T A;  2IL3 A;  5J5N A;  3GKN A;  4HZ4 A;  4Z2U A;  3IBH A;  1JZD A;  2VD0 A;  1ZYN A;  1F37 A;  3KXO A;  2WUL A;  5INY A;  3DGQ A;  2I81 A;  2FA8 A;  3QFB C;  1QQ2 A;  3TRX A;  1A8L A;  2OE1 A;  2P31 A;  2K6V A;  3FR3 A;  3ZL5 A;  5IM9 A;  5IOX A;  1J08 A;  3UVH A;  1MDJ A;  2JAC A;  2B1L A;  2JAD A;  2WGR A;  3H4K A;  3FZA A;  2C8U A;  3IE3 A;  1SD8 A;  1TRU A;  1FB6 A;  1A0F A;  5KN0 A;  4KDU A;  3U5R E;  6GST A;  4ICY A;  4F2I A;  1VF3 A;  2EIQ A;  3GKX A;  1SD9 A;  3A5W A;  4PXO A;  2CQ9 A;  5DJL A;  2GGT A;  1OYJ A;  2AAW A;  3FRC A;  4NXI A;  4BVX A;  1BX9 A;  4Q5N A;  3UAR A;  5J9C A;  4GSS A;  1K0D A;  4KDY A;  1A2M A;  5D93 A;  4IQA A;  2IFQ B;  2WZ9 A;  1Z7P A;  2B5E A;  3KMN A;  2YCD A;  3EVI A;  5D9V A;  2K8V A;  4KW6 A;  5G5F A;  3GST A;  3A3T A;  3QD9 A;  1V58 A;  4OCE A;  2H1A A;  2XC2 A;  3C1S A;  3DML A;  4MJE A;  2I9H A;  4PUF C;  1TI3 A;  1SEN A;  3ME8 A;  3F8U A;  1TP9 A;  4G0I A;  3FZ5 A;  1OAZ A;  4L0W A;  3KIJ A;  2DSA A;  4ID0 A;  3HJM A;  1U6T A;  3CSH A;  1WP0 A;  5HFG A;  5IOW A;  3GUR A;  2V2G A;  4F82 A;  5JWO B;  1OC3 A;  2C0F A;  4NPB A;  3VWW A;  3RDW A;  3H1N A;  4CY6 A;  3L9S A;  2OJL A;  2H30 A;  3UBK A;  1TRS A;  3L4N A;  4L5L A;  4I8B A;  3FHK A;  2X99 A;  4L8E A;  1TK8 B;  3GKK A;  1UA5 A;  6GSS A;  4FYU A;  3HJO A;  1SKS B;  10GS A;  3KM6 A;  4G0L A;  5CRW A;  2HRF A;  3QPM A;  5D9W A;  2LTK A;  4ZBA A;  1GTB A;  5BRT A;  4ZXG A;  3WT2 A;  5E4W A;  3CMI A;  4MH2 A;  5CP1 A;  3R2Q A;  2E7P A;  4FYC A;  4XS6 A;  1TRW A;  3TKS E;  1ERW A;  5ID2 A;  4ECI A;  3TDG A;  2JZS A;  4O5Q A;  4DSR A;  3IPZ A;  4NV5 A;  5BMU A;  2H6Y A;  2E2M A;  1X5D A;  3FMW A;  1WJK A;  3AY8 A;  2M46 A;  1B9Y C;  1AQW A;  1BYE A;  4IP6 A;  6GSX A;  2DJJ A;  2WRT A;  4K8M A;  5IMZ A;  2WJU A;  3GIX A;  4GF0 A;  3E9J B;  2AYT A;  3LFL A;  3W6G A;  3UAP A;  5DAL A;  1A2L A;  1V57 A;  4JZQ A;  4FYB A;  1Z6N A;  1V98 A;  2RUE A;  2DBC A;  1ERU A;  3Q18 A;  3SBC A;  2XPD A;  3LJR A;  2C3T A;  2L5L A;  1OC9 B;  2L5O A;  4LA1 A;  1T4Z A;  1Z6M A;  1AIU A;  3FR6 A;  2QA1 A;  4WBR D;  1PL2 A;  2CAI A;  4BL7 B;  3TCO A;  4GQC A;  1S3C A;  4K0N A;  2MBS A;  4ZL7 A;  1EP8 A;  4KSO A;  2KP2 A;  4WEY A;  4LLR A;  1PSQ A;  2X64 A;  2H01 A;  1JHB A;  4Z7X A;  4KCA A;  2C80 A;  3APS A;  8GSS A;  5JCU A;  1DBY A;  1QMV A;  1Y25 A;  3PH9 A;  3KP9 A;  3O3T A;  1X0R A;  1PKZ A;  1GNE A;  2A2S A;  5J4U A;  2TRX A;  4YQV A;  3HD5 A;  2PN8 A;  3UBL A;  4I2U A;  1MDI A;  2H1B A;  4YH2 A;  2YOI A;  1EWX A;  4FO5 A;  4IGJ A;  4F9Z A;  1HD2 A;  2K9F A;  1OKT A;  3Q6O A;  2B5Y A;  3QFA C;  1XZO A;  4FQU A;  2H1G A;  2YN1 A;  2X8H A;  1Q98 A;  4EVM A;  5DJM A;  1T3B A;  1QXH A;  2C0G A;  4YQM A;  3ZYW A;  1JZR A;  2BTO T;  1SL0 B;  3TKS C;  3F0I A;  5B8B A;  3F4S A;  2FHE A;  1YEX A;  1PN9 A;  4J57 E;  1ERV A;  2YJH A;  1PX6 A;  1SKW B;  4EXJ A;  1GNW A;  3M9J A;  4NV2 A;  3A5I A;  2XBI A;  2JL4 A;  3ZFL A;  3M3M A;  3JCM L;  2GSR A;  2FCH A;  4G9H A;  4RI6 A;  4RQX A;  3IAS 2;  2H71 A;  2R5G A;  1FVJ A;  5KOW A;  3TGZ A;  4ECB A;  3LQ7 A;  1VGL A;  2DMM A;  3QDN A;  5DQY A;  1WE0 A;  1BG5 A;  4TVE A;  2WDU A;  3ERG A;  3GKM A;  4OD7 A;  1XWK A;  3SWL A;  2L4C A;  4OFN A;  4IP1 A;  2CX4 A;  4KF9 A;  4BVY B;  1ACV A;  5ELG A;  1GSF A;  2YJ7 A;  3BD2 A;  2LKU A;  4E8E A;  1S3D A;  4XS4 B;  2FGX A;  4KX4 A;  3UIW A;  3GNJ A;  2H8L A;  2H0G A;  5D9T A;  4POL A;  2ON7 A;  2YV9 A;  4XRD A;  5AIS A;  2AV4 A;  5CRD A;  3CTF A;  1FO5 A;  1GWC A;  2O7K A;  5CAX A;  4HQS A;  3IV4 A;  4NHZ A;  4O5U A;  3TJF A;  3MAK A;  4TXO A;  1R4W A;  4X1U A;  3P90 A;  3KEB A;  3W8J A;  3IOS A;  2G2Q A;  4ULX A;  4MH3 A;  2CX3 A;  3EMP A;  3VLN A;  4DSQ A;  1TU8 A;  2N5F A;  3GTU A;  2FUG 2;  1U3I A;  1WOU A;  2VL3 A;  7GSS A;  4WF5 A;  4TN8 A;  5D96 A;  4MDC A;  2GQL A;  1MD3 A;  2OE0 A;  3I69 A;  2VLU A;  2HSY A;  4MZW A;  1F9M A;  2X49 A;  5G30 A;  1YF1 A;  2D2Z A;  4O32 A;  4N0V A;  1HNA A;  3IK9 A;  3KP8 A;  4K0G A;  3F4T A;  2MYG A;  4MLY A;  3RHC A;  3DYR A;  1USB A;  4IBP A;  1RW1 A;  2H19 A;  4K7O A;  1RQM A;  4RI7 A;  2N5A A;  4K5S A;  4L0U A;  1XWC A;  1PGT A;  1O85 A;  3Q19 A;  2NVL A;  4NAX A;  3E3E A;  4GRF A;  4GTU A;  3HXS A;  1TK0 B;  2O85 A;  4K5R A;  5F06 A;  4MMM A;  4G2E A;  3EMX A;  2DJ0 A;  4PTS A;  4EIQ A;  4K2D A;  2LJK A;  2YAN A;  5ABR A;  5HR2 A;  4LL1 B;  2VIM A;  3IC8 A;  4OFM A;  4ECC A;  1R5P A;  1GUM A;  1O7U A;  5KOX A;  4HZ2 A;  2QA2 A;  1EEJ A;  2DKI A;  4XHM A;  1WRY A;  1DUG A;  3NIV A;  1XWG A;  1DE1 A;  1VF4 A;  1Y6E A;  2OAD A;  1J0F A;  5DVB A;  2L6D A;  3VUR A;  2E2G A;  3GX8 A;  2DJK A;  1NHY A;  2XBQ A;  4WKW A;  4POB A;  2B7J A;  2V32 A;  5CRG A;  2NBS A;  3GUS A;  3M8N A;  1FHE A;  3K8N A;  2V6O A;  1BED A;  2FLS A;  4DSS A;  3MNG A;  4ML6 A;  4BPY A;  19GS A;  1F2E A;  2GLR A;  2PMT A;  2RUF A;  4J2F A;  3FW2 A;  1G0T A;  2R0G A;  5IPG A;  2GDR A;  4CDO A;  4OWY A;  1ZMA A;  4IN0 A;  3KMO A;  1EV9 A;  5H5S A;  2G0F A;  5FT3 A;  5E59 A;  3HZ8 A;  1X9W B;  5IO2 A;  2AB6 A;  3KH7 A;  1YKC A;  3IA1 A;  3IK7 A;  1K0M A;  3TKR A;  3TOU A;  1GSQ A;  2HI7 A;  3G7J A;  2X8C A;  1GSS A;  5B6N A;  1XFL A;  5FWG A;  1JFU A;  1V2A A;  3V1W A;  4F0C A;  3QMX A;  3P7X A;  1TDI A;  4LL4 B;  2VCZ A;  4K2X A;  2GQK A;  2GZZ A;  1YKA A;  1TK5 B;  2MMO A;  5LD0 A;  2LQO A;  4GST A;  1LBK A;  11GS A;  1H75 A;  1VF1 A;  2A2R A;  2P0G A;  4Q5Q A;  3CSJ A;  5HR1 A;  1ERT A;  3KTB A;  5IMV A;  2P5Q A;  3DVX A;  4GCI A;  4TKY A;  1V40 A;  2HLS A;  2VLV A;  2HT9 A;  3G7I A;  5ECK B;  5IMD A;  1A24 A;  5HR0 A;  3D5J A;  3C71 A;  3GHA A;  3KCM A;  1GTU A;  4KGI A;  4PUA A;  4FH8 A;  4ILF A;  2HZE B;  2XPE A;  1O81 A;  4KUN A;  2KOK A;  4AJ8 A;  3MDK A;  1FG4 A;  4AGS A;  3N9J A;  2DML A;  1LU4 A;  2HZF A;  4OCF A;  1I5G A;  4DEJ A;  1SL1 B;  4MJA A;  4MF6 A;  2BJX A;  2LRN A;  1FB0 A;  2K8S A;  4EL1 A;  4KA0 A;  4MJC A;  4TR3 A;  3IDV A;  3GV1 A;  3WT1 A;  1B48 A;  4D73 A;  5B6M A;  5IMF A;  1OC8 A;  5C04 A;  1ZYE A;  1WMJ A;  1KNG A;  3ZIT A;  1K0B A;  1RK4 A;  2BMX A;  2ES7 A;  2LEG A;  3GA4 A;  2QGV A;  1B4Q A;  1ABA A;  1FVK A;  2YV7 A;  4BWQ A;  2HXK A;  3ZRD A;  1F6M C;  4GSN A;  3F3R A;  1SJ6 A;  1MEK A;  1TKD B;  2IMI A;  4TR1 A;  5DBQ A;  4ACS A;  2KLX A;  3TKQ A;  2LUS A;  2E0Q A;  3N5O A;  3QR6 A;  2QC7 A;  3KZQ A;  3QAV A;  2UZ8 A;  6GSW A;  3HCZ A;  3KH9 A;  1JLV A;  1FOV A;  3GYK A;  3TOT A;  4I5Q A;  3IAM 2;  2OA7 A;  1YQ1 A;  2LQQ A;  5AGY A;  5KN3 A;  1SKR B;  2RLI A;  4WBJ A;  5ECP B;  1MD4 A;  3EYT A;  4HJM A;  3IXR A;  3KJY A;  4N30 A;  2VCX A;  3GH6 A;  2JSY A;  2A2P A;  1AUC A;  2JSZ A;  4YKF A;  2C0E A;  1ZOF A;  3MWH A;  4JR4 A;  1H4O A;  3FK8 A;  1QFN A;  1TW9 A;  3GH9 A;  5EL8 A;  4ZB9 A;  4JBB A;  4J56 E;  5B8A A;  4IS0 A;  2AUV A;  2VM2 A;  1HNC A;  1ZL9 A;  5DCH A;  3UL3 A;  3GFK A;  3IRA A;  3QAG A;  1M0U A;  5JCG A;  1SK2 A;  1IYH A;  2GST A;  4IHU A;  12GS A;  2PVO C;  1G7O A;  1ML6 A;  3M0F A;  3VWV A;  3RPN A;  3I9V 2;  4PGT A;  2GSQ A;  3TJK A;  2JZR A;  3IR4 A;  4G19 A;  4NWY A;  4DVC A;  3C7M A;  5CRH A;  3O76 A;  1R7H A;  4N0Z A;  1GH2 A;  18GS A;  4N10 A;  4I6X A;  4BVX B;  2FD3 A;  4MZC A;  1F3A A;  13GS A;  4KB3 A;  2DC5 A;  2X4A A;  4O92 A;  1DSB A;  3ISO A;  1PA3 A;  3F6F A;  2H74 A;  1GSE A;  2L6C A;  4POM A;  2DJ3 A;  3ED3 A;  3M1G A;  2HFD A;  1GUH A;  1WIK A;  1SU9 A;  3VI5 A;  1YF0 A;  3M9K A;  5JCW A;  1XW6 A;  1JLW A;  2C4J A;  4HU9 A;  4EE0 A;  1AXD A;  5ECH B;  1KBN A;  4RUV A;  2F3M A;  2A4V A;  1M7T A;  4V2N A;  16GS A;  5B7C A;  2PVQ A;  2VCT A;  4GLT A;  2B1K A;  1A2J A;  2PUK C;  4NHW A;  2KP1 A;  3O6T A;  2F8F A;  2N5B A;  2PER A;  2C1Y A;  5AIX A;  1AW9 A;  1GTI A;  2CZ3 A;  1QGV A;  5DDL A;  4YQU A;  1GP1 A;  5ECO B;  2I3Y A;  1SJZ A;  1B4P A;  2IJY A;  3PPU A;  3J7Y b;  3RBT A;  2V41 A;  2CV4 A;  5IPH A;  1M99 A;  2FY6 A;  5FHI A;  2L4Q A;  1XOB A;  1SYR A;  4EKZ A;  1ZYQ B;  1YZX A;  2NDO A;  1GTA A;  2PPT A;  4F03 A;  2P5R A;  3VFI A;  2IN3 A;  1WWJ A;  1Z3E A;  2WB9 A;  4TRX A;  3D6I A;  2R2J A;  1A8Y A;  4IJI A;  2L59 A;  3TRP A;  2TRC P;  3BBY A;  5ID2 B;  3FZ9 A;  4KH7 A;  4MA9 A;  4HU7 A;  1N8J A;  4KAE A;  1GLQ A;  2O87 A;  4JED A;  2H0I A;  2MBT A;  3WYW A;  1XWA A;  2R6K A;  4MJB A;  4WR4 A;  1XXU A;  1OE7 A;  4TXV A;  5C00 A;  3GL5 A;  3MIX A;  4MF5 A;  1A23 A;  2DLX A;  2YZH A;  5EVO A;  1XVQ A;  6GSU A;  3DRN A;  1X5E A;  2FWG A;  4MP4 A;  4NMU A;  3WGE A;  2FWE A;  2KHP A;  1TU7 A;  1K3Y A;  2KUC A;  5DAL B;  1V9W A;  4AJ6 A;  3DXB A;  1N2A A;  2YWO A;  5F05 A;  3LW9 A;  3LEF A;  2DJ2 A;  1THX A;  3CRT A;  3H79 A;  3OR5 A;  5F0G A;  3RAZ A;  2VCV A;  2H0H A;  1EGR A;  3WGD A;  1GSD A;  1EP7 A;  4L5O A;  2GS3 A;  2ALB A;  3D22 A;  2YPM A;  4BA7 A;  3UJ1 A;  1O6J A;  1YDK A;  2GQM A;  1O73 A;  2IFQ A;  2JZT A;  3ZIJ A;  2OE3 A;  2MMN A;  4V1A p;  4OMV A;  4XS1 A;  3W8S A;  4KSM A;  1QUW A;  4CW9 A;  1AAZ A;  2VUP A;  5ECQ B;  17GS A;  2EC4 A;  1OKD A;  3VWX A;  3FZ4 A;  4X0X A;  5KN1 A;  1F3B A;  1B8X A;  5KEJ A;  3LGC A;  5LCZ A;  4GXZ A;  4PQ1 A;  3EUR A;  1THO A;  3LWA A;  3GL3 A;  3CXG A;  4ZL9 A;  2VO4 A;  1EZK A;  5ELA A;  1I9D A;  2PGT A;  1G7E A;  1K0N A;  2GT6 A;  20GS A;  5HFK A;  4QL9 A;  2LST A;  3KTL A;  5A4V A;  2VL2 A;  3BCK A;  1X5C A;  4MPG A;  1K0O A;  4WF4 A;  1G6W A;  2V6K A;  4AF2 A;  5ECI B;  4H86 A;  3IHG A;  5DQS A;  3EIN A;  2GTU A;  1AQV A;  1GSU A;  2ZCT A;  5ENU A;  2HE3 A;  5ECS A;  2YWM A;  3QAW A;  4PNG A;  3ZFB A;  3APQ A;  3R3E A;  5CRE A;  5IMC A;  3EU4 A;  3LYK A;  4V2L A;  1T1V A;  1K3O A;  3C1R A;  1GSY A;  2VL9 A;  1E6B A;  1O8W A;  1U3A A;  1FW1 A;  4PX1 A;  1ZYP A;  3TJG A;  1GL8 A;  4K7I A;  2CT6 A;  2FA4 A;  2K18 A;  2R0C A;  3WGX A;  1M2D A;  4Z2T A;  2REM A;  4XIH A;  4CHS A;  1SK0 A;  1UC7 A;  3ZRE A;  2HRK A;  3QOU A;  2LV3 A;  1AQX A;  3RPP A;  4QL7 A;  1JZW A;  3LOR A;  3VK9 A;  4MCU A;  2YWI A;  3ME7 A;  2I1U A;  3D4M A;  4KND A;  1PD2 1;  4HOJ A;  2M72 A;  3LG6 A;  3D0Z A;  2IMK A;  4EDY A;  2LRT A;  1XPV A;  1NHO A;  4IQ1 A;  3F3Q A;  2GZP A;  1QK8 A;  2I4A A;  1SYX A;  5IO0 A;  3FKF A;  3UEM A;  2CAQ A;  4TOP A;  2FWF A;  22GS A;  1K0A A;  5EPF A;  2H76 A;  1OC9 A;  5F8B A;  1OVN A;  4USS A;  4BL7 A;  2PU9 C;  2OBK A;  4G10 A;  5EY6 A;  2HSH A;  3DD3 A;  4TXO B;  4K6X A;  5DCG A;  1EEM A;  2VCQ A;  4I97 A;  2ZUP A;  3BJ5 A;  4ZIJ A;  1U87 A;  2HYX A;  3HVS A;  2PBJ A;  5AIV A;  5HQP A;  3LXT A;  1EV4 A;  2CA8 A;  3ZMK A;  3GTU B;  4OO4 A;  1G6Y A;  2EIR A;  4IW9 A;  4ZBB A;  3TKS A;  1UVZ A;  1ZGN A;  2RM6 A;  5JWQ B;  2DKH A;  4X43 A;  1EOG A;  3PR8 A;  1HNB A;  5GZZ B;  2RM5 A;  1XCC A;  1AC1 A;  1SL2 B;  5J41 A;  3VI7 A;  2ZNM A;  2H75 A;  4MK3 A;  1ON4 A;  1W89 A;  3DEX A;  4G0K A;  1CQG A;  4JU5 A;  4YKG A;  2J23 A;  3TRQ A;  2HNL A;  2R0P A;  5H5R A;  3LXZ A;  5ECN B;  1MDK A;  4ML1 A;  4WXT A;  2O89 A;  2HRA A;  1K0C A;  2LRC A;  4YAP A;  4PQI A;  1EOH A;  1TI1 A;  3DWV A;  5G5E A;  3A2X A;  3NZN A;  1ST9 A;  2IPA A;  3KGK A;  5L71 A;  2VLT A;  2YZU A;  1NSW A;  4O5R A;  1SJI A;  1GLP A;  5CO3 A;  4JR6 A;  6GSV A;  3RHB A;  1PN0 A;  4HJ2 A;  1TTZ A;  4EIP A;  1MTC A;  2VCW A;  3GMF A;  3GRX A;  2MZC A;  1Z7R A;  4XCS A;  3P8W A;  5H5Q A;  1ILO A;  3HDC A;  4ZB6 A;  2F51 A;  4QQ7 A;  2C3N A;  4GQF A;  3TKP A;  1M2A A;  2VL2 C;  3A2W A;  3KD0 A;  1HYU A;  1LJR A;  4KCE A;  1OE8 A;  4DSS B;  1XOA A;  4EF0 A;  3IHQ A;  3EU3 A;  2B3S A;  1FOH A;  5ECL B;  3DKS A;  3I6A A;  5IQY A;  1CQH A;  2H70 A;  3ZML A;  4YAV A;  2NPB A;  2JU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...