1SJIA

Comparing skeletal and cardiac calsequestrin structures and their calcium binding: a proposed mechanism for coupled calcium binding and protein polymerization
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
350
structure length
350
Chain Sequence
GLNFPTYDGKDRVVSLTEKNFKQVLKKYDVLCLYYHESVSSDKVAQKQFQLKEIVLELVAQVLEHKDIGFVMVDAKKEAKLAKKLGFDEEGSLYVLKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIINSKLEVQAFERIEDQIKLIGFFKSEESEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPDKPYTEEELVEFVKEHQRPTLRRLRPEDMFETWEDDLNGIHIVAFAERSDPDGYEFLEILKQVARDNTDNPDLSIVWIDPDDFPLLVAYWEKTFKIDLFKPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calsequestrin, cardiac muscle isoform
publication title Comparing skeletal and cardiac calsequestrin structures and their calcium binding: a proposed mechanism for coupled calcium binding and protein polymerization.
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 87
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1sjiA03
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1sjiA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1sjiA02
4I8BA 2ZNMA 2K18A 2H01A 4X1UA 3LXTA 2VO4A 3I43A 1EOHA 4EDYA 4V2LA 4GF0A 5ECQB 2LQQA 4H86A 4N30A 3ZVJD 3EMXA 3GFKA 3KD0A 1FVKA 1ACVA 2JZTA 3V1WA 3FY7A 4MPFA 1SYXA 3HJPA 1M2AA 3VI5A 2I3YA 3QFBC 5IOWA 3KP8A 4EXJA 1A8YA 3EWLA 4BVYA 4L5LA 2I9HA 4AJ8A 4O7HA 1B4QA 2M72A 4WETA 1E2YA 2YWIA 3DIEA 3GX8A 4MJBA 2ES7A 2ALBA 3IBHA 4RI7A 2H6XA 4L8EA 2Z9SA 4WR5A 2FUG2 2L59A 3LORA 2V6KA 3M8NA 2CX4A 2TRXA 4EF0A 4IKHA 5KN2A 2NVLA 3FK8A 5IMFA 3TJFA 2VL2C 1GH2A 1A8LA 2FY6A 4KUNA 5ECKB 3MWHA 5D93A 3HJOA 4RI6A 2FHEA 1MDJA 5IMVA 3ZFLA 4OCFA 5HR0A 3J7Yb 2C0FA 3F4SA 4KDXA 5DCHA 1UC7A 3FZ9A 4NV5A 4OFTA 1DUGA 2HZFA 3TRXA 3HXSA 3TKSA 1OC3A 1YY7A 4GSSA 1XOAA 3CTGA 5AIVA 5HR2A 3GKKA 4MPGA 4HS1A 5IMZA 4IBPA 2VM1A 5CRGA 1FB0A 2OBIA 2QKEA 1I9DA 3GUSA 1VF4A 4XRDA 2VCWA 4D73B 1GSEA 1YEPA 1AAZA 4PXOA 2XPDA 3EINA 4GSTA 4F0CA 3IR4A 1ERTA 1GLQA 5IQYA 1HD2A 2PGTA 3FEUA 10GSA 2P31A 3LYKA 4X0XA 3TOUA 1XW6A 5DJLA 4HOJA 3DXBA 3EMPA 4JBBA 1H75A 2BJXA 1EEMA 2FCHA 5HR3A 2JZSA 2IMKA 2N5FA 3PH9A 4ID0A 4IHUA 1UVZA 4N10A 5H5SA 1M9AA 3I69A 3KP9A 4QL7A 3F4TA 1J08A 1T00A 1XVQA 2RLIA 2I1UA 1TK5B 2QGVA 3C1RA 5ENUA 3HHVA 1G7EA 2GQKA 4WEYA 2VCTA 2YV9A 3QAWA 1OYJA 1QFNA 4K7NA 3D0ZA 2R3XA 3R2QA 4POMA 1GP1A 5D8IA 11GSA 3L0HA 1GULA 3CXGA 2HI7A 4JE1A 4K7OA 1CQHA 2X8CA 1DSBA 3UVTA 1BG5A 1M2DA 2JSYA 2R37A 4ILFA 4FO5A 2KP2A 1SKSB 1XWBA 2WDUA 5ECOB 1ZOFA 4HDEA 2PUKC 5B7CA 3GNJA 2C0GA 2MMZA 1JLVA 1VRSD 3H93A 2E0QA 4BWQA 2OE1A 2LUSA 3VWVA 1BJXA 3IRAA 4PQ1A 2QC7A 4PUAA 4ECJA 3HY2A 3FRCA 4MCUA 4ULXA 3HZ4A 2GSRA 2E2GA 1F3BA 1AXDA 3NZNA 4HJ2A 4L0UA 2H1DA 2B1KA 4XHMA 2MMAA 3VWWA 3KIJA 5EL8A 1WMJA 5DDLA 2KUCA 3M9JA 1WOUA 1TI1A 1Z6NA 3TKSC 4ZL7A 1PKZA 1SK0A 2P0GA 4WF5A 2L57A 3H79A 3F3RA 3QR6A 3H4KA 2JSZA 3A5WA 4ECCA 3LFLA 5IMAA 3KTBA 1TRSA 1Y6EA 3PGTA 4OCEA 2AAWA 2GZPA 2LJAA 3HVVA 2B7KA 1GSUA 1WWJA 2E2MA 4KDYA 2RUFA 1YKAA 1Z5YE 3ME8A 3HVSA 2ZUPA 4HZ4A 3VPTA 4MMMA 2LKUA 4XIHA 1V58A 1GWCA 4OD7A 3VFIA 4MF5A 2CT6A 3M9KA 1PKWA 3WT2A 3GTUA 2VOCA 1XOBA 7GSSA 2LRNA 3N9JA 3GSSA 2AV4A 1B8XA 1B4PA 4GCIA 5ECSA 2K8VA 2LJKA 2K9FA 4AJ7A 4P3YB 2M46A 3QPMA 18GSA 2L6DA 2F8AA 4FYUA 4PUFC 5A5KA 3QFAC 5F05A 3ERFA 2PBJA 5GSSA 4IELA 2IFQA 3JCML 4DSQA 1T7PB 3HA9A 2HLSA 2ZCTA 1WPIA 1AC1A 3P2AA 5G5FA 3WYWA 2H70A 1GSDA 4TR0A 5E4WA 1A2JA 4EKZA 3TRQA 2TIRA 1TRVA 4KDUA 1MD4A 1R5AA 1MDIA 3UIWA 5G30A 2HZEA 2AUVA 4LMVA 3IAM2 2GDRA 4IQ1A 3ZVJA 1TP9A 3FR9A 2IMDA 3EU3A 2YOIA 1ZYEA 1J9BA 2K6VA 1C72A 3D5JA 1R4WA 1PX6A 4BWSA 5FT3A 5ECHB 2DJ2A 3EURA 2CVDA 2VAFA 5FHIA 2HSHA 1F9MA 5J5NA 5HFGA 3RHBA 3P90A 4TKYA 5DJMA 4XRAA 3FZ5A 2JL4A 2P5RA 1OAZA 3L9UA 2XHFA 1GSQA 3LG6A 1JZDA 2KP1A 2WB9A 2GGTA 1E6BA 5A4WA 1B9XC 4MJEA 2YNXA 3RBTA 5DBQA 1TRWA 1ERUA 3UAPA 1ILOA 3NIVA 1ZCPA 1GUHA 2KLXA 2OADA 2A2RA 5CO3A 4PQHA 1KNGA 1Y25A 1A24A 1T4YA 5CRDA 2YWMA 2HYXA 2YZUA 5D9VA 4KSMA 2N5AA 4N0VA 4OFNA 1M99A 2F51A 3LWAA 1SENA 1PX7A 2LRTA 4QL9A 3TJBA 4XS1A 1EP7A 2NPBA 4NHZA 1RW1A 2N5BA 2IMFA 5G31A 1OVNA 4F82A 2WULA 2EIOA 4CW9A 3KJYA 2FLSA 4K1FA 1XBSA 3TOTA 2IL3A 5EVOA 3HJMA 1YKCA 1Z3EA 1PA3A 2CQ9A 2FD3A 4V2MA 1YDKA 1EV4A 1NHYA 3TGZA 4OO4A 4KGIA 1UN2A 2V1MA 3QAGA 1OKDA 1USBA 2IJYA 2YWOA 4EL1A 1V9WA 5LD0A 5LNKe 1SYRA 4OFMA 4ECIA 3APOA 4TXOB 2FWEA 1Q98A 3GH6A 20GSA 5B8BA 1G6YA 3GX0A 5G5EA 1B9YC 2GLRA 4LL4B 3HZ8A 2VL9A 3MNGA 2H0HA 1GLPA 2IWTA 1NSWA 3IV4A 1S3AA 5J4UA 3QDNA 3DD3A 4Q5QA 1XPVA 5ECPB 2ON7A 4DSSA 3CSHA 1NM3A 2PPTA 2DMMA 3F9UA 4GSNA 1XWKA 5JCGA 1GNEA 4XS4A 3TRPA 2PWJA 4OWYA 2V32A 1XVWA 3DVXA 1TTZA 2WCIA 1QK8A 3VLNA 4HQSA 1ZMAA 1WE0A 3QMXA 2CVKA 2MZCA 3UVHA 3UMAA 4ZL9A 3F4RA 1TW9A 4TRXA 3IXRA 5F07A 2R5GA 1PGTA 5GAND 2AYTA 1SL1B 1LBKA 4LL1B 1K0NA 22GSA 2H30A 3RPPA 3KEBA 1SJ6A 4POLA 3ERWA 5ECMB 4D73A 5CRHA 5KEJA 5FWGA 5E59A 3PINA 2YPMA 1A0RP 4F9ZA 2R2JA 4F0BA 1M2BA 5C04A 3KMNA 5HFIA 4IJ3A 1Z9HA 3UARA 1Q4JA 3RAZA 2VD1A 3IOSA 5IPHA 1MD3A 3ZIVA 1O8XA 1HNBA 4KE3A 3TKPA 3OR5A 1EGOA 1BAYA 3H1NA 2ON5A 2GT6A 1F37A 1HQOA 2B5YA 3TB2A 5HR1A 5D9WA 1THXA 3O3TA 2L6CA 3LQ7A 3VK9A 1K0MA 4EVMA 2PMTA 5F06A 1SKWB 1ABAA 3GIXA 2DC5A 1G7OA 1X5DA 2R4VA 4GQFA 3DRNA 3W6GA 1QUWA 3J7Yk 1K3LA 3Q19A 2GS3A 4I2UA 2H0IA 2IMEA 2RIIA 3ERGA 5IPGA 4HEA2 1O8WA 1URMA 2FWHA 1PQNA 1GUKA 3FZAA 3IE3A 1K0CA 4V1Ap 3I9V2 1B48A 4WBJA 1TK8B 3N5OA 3MAKA 1G6WA 5JCWA 4KX4A 1SU9A 1N2AA 1IYHA 1TU8A 3F0IA 3QD9A 4ECBA 1PL1A 4RUVA 3A3TA 4ZB8A 3TUEA 5IM9A 3KH9A 5D9XA 5A4UA 2XBIA 2BTOT 4O92A 2WZ9A 1MTCA 1BYEA 1AQWA 2KOKA 2GZYA 3UOMA 1RK4A 3VWUA 1SK2A 1SKRB 4JRRA 3TKRA 3GH9A 1KBNA 1YZXA 4LMWA 3C1SA 2JZRA 4Q5NA 4ZL8A 3BD2A 2YJHA 2WJUA 3CSIA 1EP8A 1SL0B 2YN1A 2VCQA 3MSZA 5DALA 1ZZYA 2J9HA 1K0BA 1ML6A 5ABRA 4ZBAA 2H1BA 2C3NA 2M80A 2B5XA 1OE7A 5F0GA 4OO5A 4TR1B 1MDKA 3GN3A 1JLWA 5JWQB 5GZZB 1OC9A 3GYKA 4YAPA 2H8LA 5DAKB 2OJLA 3D21A 3BJ5A 3LXZA 2IN3A 2C1YA 3ED3A 5JCUA 4RQXA 4G19A 3BOAA 1X9MB 1JFUA 1AW9A 2DSAA 5G1KA 2VCZA 1XWGA 4YH2A 16GSA 2L4QA 2O7KA 4NHWA 3GKMA 3BBYA 5IMDA 3ZTLA 1VF1A 4JZQA 4G10A 5AN1A 2C8UA 4J56E 3TCOA 3UJ1A 2HRFA 4LA1A 1U87A 1JZWA 5KN1A 3LEFA 5CNWA 1HYUA 1SL2B 5ECLB 4N11A 2C3TA 4BPYA 2LNTA 2B1LA 3D4TA 4MF6A 2GSTA 4Z7XA 5J41A 1EWXA 13GSA 3S9FA 3M1GA 4IN0A 5JWRB 2YCDA 2B6MA 2CAQA 1YF0A 4NWYA 2X99A 1VF2A 4G2EA 1GTBA 3PR8A 3ZYWA 5IMCA 3FHKA 4GQCA 1O73A 2LJRA 5DQSA 17GSA 2F8FA 1X9WB 2OACA 4MF7A 1OKTA 1GL8A 1XWAA 3ZRDA 2FGXA 4YQVA 2I81A 1G0TA 5ECNB 1X0RA 3VI7A 2A2SA 2FA8A 3Q74A 4TR3A 4NAXA 1ZL9A 2CA8A 4OMVA 1NW2A 2YANA 4EC0A 2O8VB 1U3IA 3D6IA 3AY8A 4ISDA 1TOFA 4XCSA 1F2EA 2C4JA 1GNWA 4DVCA 2FA4A 4PQIA 4WXTA 2WS2A 3DMLA 5IO2A 3F3QA 5EPFA 5ID2A 4IP6A 2X8HA 3TJJA 2J23A 4NXIA 4PNGA 2NDOA 2P5QA 3TKQA 3IK9A 1S3DA 3G7JA 4V2NA 2IFQB 5D73A 3CBUA 5A4VA 3GSTA 3K8NA 4IW9A 3ZITA 1WRYA 4HU9A 1W4VA 3BCKA 2AB6A 2C80A 4ZIJA 3IA1A 4EO3A 2X64A 3EU4A 1BEDA 3P8WA 2H66A 2C0DA 3KMOA 1FO5A 2LV3A 3GRXA 2YJ7A 1PD21 5ELAA 2B3SA 1FOVA 2HZEB 4DEJA 3DYRA 2MBSA 4O32A 3KZQA 1GTAA 2PVQA 1TK0B 4JR6A 3ZLPA 3H8QA 2R6KA 2HNLA 3L9SA 2DMLA 4POBA 1Z7RA 4MH2A 5H5RA 2GQLA 1EOGA 5G2ZA 4AJ6A 3APSA 3TKSE 4CHSA 2X8GA 2H0GA 3F63A 1SK1A 3D22A 1QXHA 1Z7PA 3ZMLA 4I2TA 4TVEA 2DJJA 4WF4A 1CQGA 1ZGNA 4IQAA 2VD0A 4HJMA 4KA0A 4ZB6A 1ERVA 4ZB9A 4JR4A 3APQA 1TJDA 1GSYA 3O76A 3HYPA 4ZXGA 1FG4A 5D9TA 2E7PA 2H76A 2WGRA 5L71A 1PL2A 1GTIA 3ISOA 1JHBA 4JU5A 1HNAA 1GSSA 3E3EA 2V2GA 3C71A 4MDCA 4NV2A 1XW5A 3TDGA 3Q6OA 4FIWA 3KM6A 1FHEA 1AQXA 1U6TA 2HXKA 3RDWA 2CX3A 4GXZA 4K0GA 3F6DA 2G0FA 3O6TA 3ZFBA 2IIYA 4KNDA 1SD8A 5J3RA 1K3OA 3P7XA 1V57A 1V2AA 2IMIA 3BCIA 3L9VA 2D2ZA 1SJIA 4BA7A 2VLTA 4TN8A 1O6JA 6GSWA 3GURA 3GKXA 1XFLA 4AGSA 1NHOA 1VGLA 2GSSA 4MABA 3C7MA 2TRCP 4V1Ag 1Z6MA 2H74A 2OBKA 1BQ7A 1DBYA 4X43A 3IPZA 4KSOA 2MMNA 1A0FA 5AGYA 1K0DA 2YWNA 4NMUA 2DIYA 4O5RA 2AJQB 1V98A 2IPAA 12GSA 4HZ2A 1XXUA 5AIXA 2VCXA 4KCEA 5GSTA 1OE8A 4K2DA 5ECIB 4TW5A 3IAS2 2VUPA 5DVBA 4LLRA 3DVWA 4DSSB 3EE2A 2AHEA 2RUEA 2H72A 1T3BA 5C00A 3VURA 5F8BA 14GSA 5CYYA 4XS4B 5JWOB 2H6ZA 4EE0A 2YV7A 3UEMA 4GWRA 5D96A 1DE1A 4MJAA 1FW1A 1LJRA 4BVXA 3LGCA 4AF2A 1S3CA 5IO0A 1A2MA 4MZCA 1KEBA 3EYTA 3LYPA 3A2XA 2XBQA 1FVJA 3IHQA 2DJKA 2MMOA 2KHPA 1K0AA 3FR3A 5IIZA 4K8MA 4EDZA 4DSRA 1BX9A 2EIQA 2OKAA 3SBCA 3VPQA 1FB6A 3GV1A 6GSTA 2YP6A 4KCAA 3CMIA 3FR6A 3ZIJA 2H71A 1O7UA 4F2IA 2YZHA 2JACA 5CREA 4YQMA 3I6AA 2L5OA 1T4ZA 1F6MC 4MZBA 4PGTA 3ZMKA 2DIZA 3CRTA 3FKFA 1R7HA 1M7TA 4CDOA 1U88A 1GSFA 4ACSA 5DQYA 4K0NA 2LQOA 3EC3A 4MH3A 1FAAA 3HD5A 1X9SB 1QGVA 1TRUA 3DKSA 5AISA 1M0UA 3QCPA 4F03A 4L0WA 1ST9A 3IDVA 5CP1A 3FZ4A 3KGKA 3ZL5A 6GSYA 1O85A 1THOA 2C0EA 1XIYA 4XTSA 4J2FA 2H6YA 2LNSA 2GTUA 4JEDA 1R26A 1LU4A 3CSJA 4MJCA 6GSVA 4IP1A 1ERWA 4EUYA 2GT5A 2RM6A 4TR1A 1QMVA 2EIRA 4MK3A 1V40A 3HVXA 2FNOA 4MZWA 2VM2A 4ZBBA 1WJKA 1H4OA 2L5LA 5DAKA 5DCGA 3W8SA 5HFKA 4K7IA 1M9BA 1XCCA 2FWGA 3US3A 3WT1A 2JU5A 3Q18A 1GRXA 6GSUA 1J0FA 4I97A 8GSSA 1PMTA 4K6XA 1MEKA 5CRWA 2I4AA 2CZ2A 2H75A 1I5GA 2NBSA 1K3YA 4HUAA 4YQUA 5COHA 4PURA 1GTUA 2WFCA 3TJGA 1WP0A 4ZILA 2H1GA 1AQVA 2O89A 1EZKA 1O81A 1TU7A 3CTFA 1WIKA 2MBTA 3MDKA 1KTEA 3G7YA 3QAVA 1F3AA 3GL3A 3LJRA 4WR4A 4TOPA 3QOUA 5EY6A 4G9HA 5DALB 1YQ1A 3DGQA 4PX1A 3FYGA 4BL7A 1GUMA 6GSSA 4TXVA 2G2QA 3DEXA 3TJKA 4IS0A 1PSQA 4HU7A 3UBKA 4ML1A 4ML6A 1OC9B 5IOXA 5H5QA 2A4VA 4FYCA 3UL3A 5LCZA 4KB3A 5G1LA 5KN0A 3GHAA 3M3MA 3ME7A 2REMA 1AUCA 2GQMA 2OE0A 4KW6A 2RM5A 2EC4A 4WKWA 5GAPD 2V41A 2VIMA 2F3MA 2DBCA 4KAEA 9GSSA 2L4CA 1T1VA 4FH8A 3GKNA 2H19A 2XPEA 2GZZA 2DLXA 4IJIA 1JZRA 1VF3A 3E0UA 3KH7A 3KTLA 2DJ3A 3A2WA 2XC2A 3WD6A 1U3AA 2PU9C 3WGEA 4XS6A 4POKA 3CRUA 1TKDB 5CAXA 1XZOA 3C73A 1DE2A 3D4MA 2DJ1A 2GVPA 6GSXA 1EGRA 3GTUB 4PNFA 3L78A 3VWXA 3LSZA 2HRNA 1IYIA 2V6OA 2PVOC 3F8UA 2LEGA 4ZBDA 2FWFA 4K9ZA 1T8EB 3KCMA 1YF1A 4Q5RA 1JZOA 2B7JA 3U5RE 1TI3A 1YJ6A 3GMFA 1PN9A 1TXXA 3RHCA 5KN3A 3HKRA 5B6NA 4TR4A 2H73A 4GTUA 3HDCA 3E9JB 1A23A 5J9CA 3L4NA 4N0ZA 2VL3A 4HQZA 1TDIA 4IGJA 3ZZXA 3C8EA 1OC8A 2B5EA 2K8SA 1AIUA 2LTKA 3WGXA 4MLYA 1QQ2A 4E8HA 4FYBA 1SJZA 3IK7A 1RQMA 3A2VA 4E8EA 2GSQA 1ZYQB 5ID2B 3F6FA 4QQ7A 1XW9A 4NPBA 4Q5FA 1N8JA 5ELGA 2VCVA 2CVBA 2MYGA 5J9BA 1W89A 1HNCA 4GRFA 2HT9A 1PRXA 2JADA 2VL2A 2C3QA 4HI7A 2NTOA 2PN8A 1X5CA 1X5EA 3IC4A 3RPNA 3W8JA 4MA9A 1A2LA 5HQPA 4YAVA 4RQRA 3M0FA 2QSIA 2OE3A 2CAIA 2BMXA 2LS5A 4KH7A 3KXOA 1XWCA 3G7IA 1SD9A 2HFDA 3GL5A 2HE3A 4MP4A 3NOFA 4TXOA 2F9SA 5B8AA 2O87A 3SWLA 4IVFA 1R5PA 3HCZA 2PERA 2OA7A 3G9BA 3GA4A 2CV4A 2H1AA 2O85A 3CYNA 19GSA 5INYA 2HSYA 4WBRD 4I6XA 1EV9A 1ON4A 3UBLA 2VLVA 3EVIA 3ZREA 3WGDA 2LRCA 4J57E 2LSTA 4L5OA 1K0OA 1UA5A 2WRTA 5B6MA 1EEJA 2VLUA 2CZ3A 4GLTA 3FW2A 1YEXA 4I5QA 5ECRB 3U6VA 2DJ0A 3DWVA
chains in the Genus database with same CATH superfamily
4I8BA 2ZNMA 4EIQA 2K18A 2H01A 4X1UA 3LXTA 2VO4A 3I43A 1EOHA 4EDYA 4V2LA 4GF0A 5ECQB 2LQQA 4H86A 4N30A 3ZVJD 3EMXA 3GFKA 3KD0A 1FVKA 1ACVA 2JZTA 3V1WA 3FY7A 4MPFA 1SYXA 3HJPA 1M2AA 3VI5A 2I3YA 3QFBC 5IOWA 3KP8A 4EXJA 1A8YA 3EWLA 4BVYA 4L5LA 2I9HA 4AJ8A 4O7HA 1B4QA 2M72A 4WETA 4FQUA 1E2YA 2YWIA 3DIEA 3GX8A 4MJBA 2ES7A 2ALBA 3IBHA 4RI7A 2H6XA 4L8EA 2Z9SA 4WR5A 2FUG2 2L59A 3LORA 2V6KA 3M8NA 2CX4A 2TRXA 4EF0A 4IKHA 4X4JA 5KN2A 2NVLA 3FK8A 5IMFA 3TJFA 2VL2C 1GH2A 1A8LA 2FY6A 4KUNA 5ECKB 3MWHA 5D93A 3HJOA 4RI6A 2FHEA 1MDJA 5IMVA 3ZFLA 4OCFA 5HR0A 3J7Yb 2C0FA 3F4SA 4KDXA 5DCHA 1UC7A 3FZ9A 4NV5A 4OFTA 1DUGA 2HZFA 3TRXA 3HXSA 3TKSA 1OC3A 1YY7A 4GSSA 1XOAA 3CTGA 5AIVA 5HR2A 3GKKA 4MPGA 4HS1A 5IMZA 4IBPA 2VM1A 5CRGA 1FB0A 2OBIA 2QKEA 1I9DA 3GUSA 1VF4A 4XRDA 2VCWA 4D73B 1GSEA 1YEPA 1AAZA 4PXOA 2XPDA 3EINA 4GSTA 4F0CA 3IR4A 1ERTA 1GLQA 5IQYA 1HD2A 2PGTA 3FEUA 10GSA 2P31A 3LYKA 4X0XA 3TOUA 4BVXB 1XW6A 5DJLA 4HOJA 3DXBA 3EMPA 4JBBA 1H75A 2BJXA 1EEMA 2FCHA 3LW9A 5HR3A 2JZSA 2IMKA 2N5FA 3PH9A 4ID0A 4IHUA 1UVZA 4N10A 5H5SA 1M9AA 3I69A 3KP9A 4QL7A 3F4TA 1J08A 1T00A 1XVQA 2RLIA 2I1UA 1TK5B 2QGVA 3C1RA 5ENUA 3HHVA 1G7EA 2GQKA 4WEYA 2VCTA 2YV9A 3QAWA 1OYJA 1QFNA 4K7NA 3D0ZA 2R3XA 3R2QA 4POMA 1GP1A 5D8IA 11GSA 3L0HA 1GULA 3CXGA 2HI7A 4JE1A 4K7OA 1CQHA 2X8CA 1DSBA 3UVTA 1BG5A 1M2DA 2JSYA 2R37A 4ILFA 3IHGA 4FO5A 2KP2A 1SKSB 1XWBA 2WDUA 5ECOB 1ZOFA 4HDEA 2PUKC 5B7CA 3GNJA 2C0GA 2MMZA 1JLVA 1VRSD 4CY6A 3H93A 2E0QA 2HRAA 4BWQA 2OE1A 2LUSA 3VWVA 1BJXA 3IRAA 4PQ1A 2QC7A 4PUAA 4ECJA 3HY2A 3FRCA 2DKIA 4MCUA 4ULXA 1ZYNA 3HZ4A 2GSRA 2E2GA 1F3BA 1AXDA 3NZNA 4HJ2A 4L0UA 2H1DA 2B1KA 4XHMA 2MMAA 3VWWA 3KIJA 5EL8A 1WMJA 5DDLA 2KUCA 3M9JA 1WOUA 1TI1A 1Z6NA 3TKSC 4ZL7A 1PKZA 1SK0A 2P0GA 4WF5A 2L57A 3H79A 3F3RA 3QR6A 3H4KA 2JSZA 3A5WA 4ECCA 3LFLA 5IMAA 3KTBA 1TRSA 1Y6EA 3PGTA 4G0KA 4OCEA 2AAWA 2GZPA 2LJAA 3HVVA 2B7KA 1GSUA 1WWJA 2E2MA 4KDYA 2RUFA 1YKAA 1Z5YE 3ME8A 3HVSA 2ZUPA 4HZ4A 3A5IA 3VPTA 4MMMA 2LKUA 4XIHA 1V58A 1GWCA 4OD7A 3VFIA 4MF5A 2CT6A 3M9KA 1PKWA 3WT2A 3GTUA 2VOCA 1XOBA 7GSSA 2LRNA 3N9JA 3GSSA 2AV4A 1B8XA 1B4PA 4GCIA 5ECSA 2K8VA 2LJKA 2K9FA 4AJ7A 4P3YB 1PN0A 2M46A 3QPMA 18GSA 2L6DA 4BL7B 2F8AA 4FYUA 4PUFC 5A5KA 3QFAC 5F05A 3ERFA 2PBJA 5GSSA 4IELA 2IFQA 3JCML 4DSQA 1T7PB 3HA9A 2HLSA 2ZCTA 1WPIA 1AC1A 3P2AA 3PPUA 5G5FA 3WYWA 2H70A 1GSDA 4TR0A 5E4WA 1A2JA 4EKZA 3TRQA 2TIRA 1TRVA 4KDUA 1MD4A 1R5AA 1MDIA 3UIWA 5G30A 2HZEA 2AUVA 4LMVA 3IAM2 2GDRA 4IQ1A 3ZVJA 1TP9A 3FR9A 2IMDA 3EU3A 2YOIA 1ZYEA 1J9BA 2K6VA 1C72A 3D5JA 1R4WA 1PX6A 4BWSA 5FT3A 5ECHB 2DJ2A 3EURA 2CVDA 2VAFA 5FHIA 2HSHA 1F9MA 5J5NA 5HFGA 3RHBA 3P90A 4TKYA 5DJMA 4XRAA 3FZ5A 2JL4A 2P5RA 1OAZA 3L9UA 2XHFA 1GSQA 3LG6A 1JZDA 2KP1A 2WB9A 2GGTA 1E6BA 5A4WA 1B9XC 4MJEA 2YNXA 3RBTA 5DBQA 1TRWA 1ERUA 3UAPA 1ILOA 3NIVA 1ZCPA 1GUHA 2KLXA 2OADA 2A2RA 1M3IA 5CO3A 4PQHA 1KNGA 1Y25A 1A24A 1T4YA 5CRDA 2YWMA 2HYXA 2YZUA 5D9VA 4KSMA 2N5AA 4N0VA 4OFNA 5KOXA 1M99A 2F51A 3LWAA 1SENA 1PX7A 2LRTA 4QL9A 3TJBA 4XS1A 1EP7A 2NPBA 4NHZA 1RW1A 2N5BA 2IMFA 4A5PA 5G31A 1OVNA 4F82A 2WULA 2EIOA 4CW9A 3KJYA 2FLSA 4K1FA 1XBSA 3TOTA 2IL3A 5EVOA 3HJMA 4CY8A 1YKCA 1Z3EA 1PA3A 2CQ9A 2FD3A 4V2MA 1YDKA 1EV4A 1NHYA 3TGZA 4OO4A 4KGIA 1UN2A 2V1MA 4BIKA 3QAGA 1OKDA 1USBA 2IJYA 2YWOA 4EL1A 1V9WA 5LD0A 5LNKe 1SYRA 4OFMA 4ECIA 1M3JA 2HSMA 3APOA 4TXOB 2FWEA 1Q98A 3GH6A 20GSA 5B8BA 1G6YA 3GX0A 5G5EA 1B9YC 2GLRA 4LL4B 3HZ8A 2VL9A 3MNGA 2H0HA 1GLPA 2IWTA 1NSWA 3IV4A 1S3AA 5J4UA 3QDNA 3DD3A 4Q5QA 1XPVA 5ECPB 2ON7A 4DSSA 3CSHA 1NM3A 2PPTA 2DMMA 3F9UA 2X4AA 4GSNA 1XWKA 5JCGA 1GNEA 4XS4A 3TRPA 2PWJA 4OWYA 2V32A 1XVWA 3DVXA 1TTZA 2WCIA 1QK8A 3VLNA 4HQSA 1ZMAA 1WE0A 3QMXA 2CVKA 2MZCA 3UVHA 3UMAA 4ZL9A 3F4RA 1TW9A 4TRXA 3IXRA 5F07A 2R5GA 1PGTA 4O5UA 5GAND 2AYTA 1SL1B 1LBKA 4LL1B 1K0NA 22GSA 2H30A 3RPPA 4BVYB 3KEBA 1SJ6A 4POLA 3ERWA 5ECMB 4D73A 5CRHA 5KEJA 5FWGA 5E59A 3PINA 2YPMA 1A0RP 4G0IA 4F9ZA 2R2JA 4F0BA 1M2BA 5C04A 3KMNA 5HFIA 4IJ3A 1Z9HA 3UARA 1Q4JA 3RAZA 2VD1A 3IOSA 5IPHA 1MD3A 3ZIVA 1O8XA 1HNBA 4KE3A 3TKPA 3OR5A 1EGOA 1BAYA 3H1NA 2ON5A 2GT6A 1F37A 1HQOA 2B5YA 3TB2A 5HR1A 5D9WA 1THXA 3O3TA 2L6CA 3LQ7A 3VK9A 1K0MA 4EVMA 2PMTA 5F06A 1SKWB 1ABAA 3GIXA 2DC5A 1G7OA 1X5DA 2R4VA 4GQFA 1PFOA 3DRNA 3W6GA 1QUWA 3J7Yk 1K3LA 3Q19A 2GS3A 4I2UA 2R0CA 4PTSA 2H0IA 2IMEA 2RIIA 3ERGA 5IPGA 4HEA2 1O8WA 1URMA 2FWHA 1PQNA 1GUKA 3FZAA 3IE3A 1K0CA 4V1Ap 3I9V2 1B48A 4WBJA 1TK8B 3N5OA 3MAKA 1G6WA 5JCWA 4KX4A 1SU9A 1N2AA 1IYHA 1TU8A 3F0IA 3QD9A 4ECBA 1PL1A 4RUVA 3A3TA 4ZB8A 3TUEA 5IM9A 3KH9A 5D9XA 5A4UA 2XBIA 2BTOT 4O92A 2WZ9A 1MTCA 1BYEA 1S3RA 1AQWA 2KOKA 2GZYA 3UOMA 1RK4A 3VWUA 1SK2A 1SKRB 4JRRA 3TKRA 3GH9A 1KBNA 5KOWA 1YZXA 4LMWA 3C1SA 2JZRA 4Q5NA 4ZL8A 3BD2A 2R0GA 2YJHA 2WJUA 3CSIA 1EP8A 1SL0B 2YN1A 2VCQA 3MSZA 5DALA 1ZZYA 2QA2A 2J9HA 1K0BA 1ML6A 5ABRA 4ZBAA 2H1BA 2C3NA 2M80A 2B5XA 1OE7A 5F0GA 4OO5A 4TR1B 1MDKA 3GN3A 4ICYA 1JLWA 5JWQB 5GZZB 1OC9A 3GYKA 4YAPA 2H8LA 5DAKB 2OJLA 3D21A 3BJ5A 3LXZA 2IN3A 2C1YA 3ED3A 5JCUA 4RQXA 4G19A 3BOAA 1X9MB 1JFUA 1AW9A 2R0PA 2DSAA 4K2XA 5G1KA 2VCZA 1XWGA 4YH2A 16GSA 2L4QA 2O7KA 3EPTA 4NHWA 3GKMA 1ZYPA 3BBYA 5IMDA 3ZTLA 1VF1A 4JZQA 4G10A 5AN1A 2C8UA 4J56E 3TCOA 3UJ1A 2HRFA 4LA1A 1U87A 1JZWA 5KN1A 3LEFA 5CNWA 1HYUA 1SL2B 5ECLB 4N11A 2C3TA 4BPYA 2LNTA 2B1LA 3D4TA 4MF6A 2GSTA 4Z7XA 5J41A 1EWXA 13GSA 4EIPA 3S9FA 3M1GA 4IN0A 5JWRB 2YCDA 2B6MA 2CAQA 1YF0A 4NWYA 2X99A 1VF2A 4G2EA 1GTBA 3PR8A 3ZYWA 5IMCA 3FHKA 4GQCA 1O73A 2LJRA 5DQSA 17GSA 2F8FA 1X9WB 2OACA 4MF7A 4K5RA 1OKTA 1GL8A 1XWAA 3ZRDA 2FGXA 4O5QA 4YQVA 2I81A 1G0TA 5ECNB 1X0RA 3FMWA 3VI7A 2A2SA 2FA8A 3Q74A 4TR3A 4NAXA 1ZL9A 2CA8A 4OMVA 1NW2A 2YANA 4EC0A 2O8VB 1U3IA 3D6IA 3AY8A 4ISDA 1TOFA 4XCSA 1F2EA 2C4JA 1GNWA 4DVCA 2FA4A 4PQIA 4WXTA 2WS2A 3DMLA 5IO2A 3F3QA 4YKGA 5EPFA 5ID2A 4IP6A 2X8HA 3TJJA 2J23A 4NXIA 4PNGA 2NDOA 2P5QA 3TKQA 3IK9A 1S3DA 3G7JA 4V2NA 2IFQB 5D73A 3CBUA 5A4VA 3GSTA 3K8NA 4IW9A 3ZITA 4G0LA 1WRYA 4HU9A 1W4VA 4YKFA 3BCKA 2AB6A 2C80A 4ZIJA 3IA1A 4EO3A 2X64A 3EU4A 1BEDA 3P8WA 2H66A 2C0DA 3KMOA 1FO5A 2LV3A 3GRXA 2YJ7A 1PD21 5ELAA 2B3SA 1FOVA 2HZEB 4DEJA 3DYRA 2MBSA 4O32A 3KZQA 1GTAA 2PVQA 1TK0B 4JR6A 3ZLPA 3H8QA 2R6KA 2HNLA 3L9SA 2DMLA 4POBA 1Z7RA 4MH2A 5H5RA 2GQLA 1EOGA 5G2ZA 4AJ6A 2A4HA 3APSA 3TKSE 4CHSA 2X8GA 4Z2TA 2H0GA 3F63A 1SK1A 3D22A 1QXHA 1Z7PA 3ZMLA 4I2TA 4TVEA 2DJJA 4WF4A 1CQGA 1ZGNA 4IQAA 2VD0A 4HJMA 4KA0A 4ZB6A 1ERVA 4ZB9A 4JR4A 3APQA 1TJDA 1GSYA 3O76A 3HYPA 4ZXGA 1FG4A 5D9TA 2E7PA 2H76A 2WGRA 5L71A 4USSA 1PL2A 1GTIA 3ISOA 1JHBA 4JU5A 1HNAA 1GSSA 3E3EA 2V2GA 3R3EA 3C71A 4MDCA 4NV2A 1XW5A 3TDGA 3Q6OA 4FIWA 3KM6A 1FHEA 1AQXA 1U6TA 2HXKA 3RDWA 2CX3A 4GXZA 4K0GA 3F6DA 2G0FA 3O6TA 3ZFBA 2IIYA 4KNDA 1SD8A 5J3RA 1K3OA 3P7XA 4K5SA 1V57A 1V2AA 2IMIA 3BCIA 3L9VA 2D2ZA 1SJIA 4BA7A 2VLTA 4TN8A 1O6JA 6GSWA 3GURA 3GKXA 1XFLA 4AGSA 1NHOA 1VGLA 2GSSA 2QA1A 4MABA 3C7MA 2TRCP 5BMUA 4V1Ag 1Z6MA 2H74A 2OBKA 1BQ7A 1DBYA 4X43A 3IPZA 4KSOA 2MMNA 1A0FA 5AGYA 1K0DA 2YWNA 4NMUA 2DIYA 4O5RA 2AJQB 1V98A 2IPAA 12GSA 4HZ2A 1XXUA 5AIXA 2VCXA 4KCEA 5GSTA 1OE8A 4K2DA 5ECIB 4TW5A 3IAS2 2VUPA 5DVBA 4LLRA 3DVWA 4DSSB 3EE2A 2AHEA 2RUEA 2H72A 1T3BA 5C00A 3VURA 5F8BA 14GSA 5CYYA 4XS4B 5JWOB 2H6ZA 4EE0A 2YV7A 3UEMA 4GWRA 5D96A 1DE1A 4MJAA 1FW1A 1LJRA 4BVXA 3LGCA 4AF2A 1S3CA 5IO0A 1A2MA 4MZCA 1KEBA 3EYTA 3LYPA 3A2XA 2XBQA 1FVJA 3IHQA 2DJKA 2MMOA 2KHPA 1K0AA 3FR3A 5IIZA 4K8MA 4EDZA 4DSRA 1BX9A 2EIQA 2OKAA 3SBCA 3VPQA 1FB6A 3GV1A 6GSTA 2YP6A 4KCAA 3CMIA 3FR6A 3ZIJA 2H71A 1O7UA 4F2IA 2YZHA 2JACA 5CREA 4YQMA 3I6AA 2L5OA 2DKHA 1T4ZA 1F6MC 4MZBA 4PGTA 3MIXA 3ZMKA 2DIZA 3CRTA 4Z2RA 4HSCX 3FKFA 2X49A 1R7HA 1M7TA 4CDOA 1U88A 1GSFA 4ACSA 5DQYA 4K0NA 2LQOA 3EC3A 4MH3A 1FAAA 3HD5A 1X9SB 1QGVA 1TRUA 3DKSA 5AISA 1M0UA 3QCPA 4F03A 4L0WA 1ST9A 3IDVA 5CP1A 3FZ4A 3KGKA 3ZL5A 6GSYA 1O85A 1THOA 2C0EA 1XIYA 4XTSA 4J2FA 2H6YA 2LNSA 2GTUA 4JEDA 1R26A 1LU4A 3CSJA 4MJCA 6GSVA 4IP1A 1ERWA 4EUYA 2GT5A 2RM6A 4TR1A 1QMVA 2EIRA 4MK3A 1V40A 3HVXA 2FNOA 4MZWA 2VM2A 4ZBBA 1WJKA 3MYDA 1H4OA 2L5LA 5DAKA 5DCGA 3W8SA 5HFKA 4K7IA 1M9BA 1XCCA 2FWGA 3US3A 3WT1A 2JU5A 3Q18A 1GRXA 4KF9A 6GSUA 1J0FA 4I97A 8GSSA 1PMTA 4K6XA 1MEKA 5CRWA 2I4AA 2CZ2A 2H75A 1I5GA 2NBSA 1K3YA 4HUAA 4YQUA 5COHA 4PURA 1GTUA 2WFCA 3TJGA 1WP0A 4ZILA 2H1GA 1AQVA 2O89A 1EZKA 1O81A 1TU7A 3CTFA 1WIKA 2MBTA 3MDKA 1KTEA 3G7YA 3QAVA 1F3AA 3GL3A 3LJRA 4WR4A 1FOHA 4TOPA 3QOUA 5EY6A 4G9HA 5DALB 1YQ1A 3DGQA 4PX1A 3FYGA 5BRTA 4BL7A 1GUMA 6GSSA 4TXVA 2G2QA 3DEXA 3TJKA 4IS0A 1PSQA 4HU7A 3UBKA 4ML1A 4ML6A 1OC9B 5IOXA 5H5QA 2A4VA 4FYCA 3UL3A 5LCZA 4KB3A 5G1LA 5KN0A 3GHAA 3M3MA 3ME7A 2REMA 1AUCA 2GQMA 2OE0A 4KW6A 2RM5A 2EC4A 4WKWA 5GAPD 2V41A 2VIMA 2F3MA 2DBCA 4KAEA 9GSSA 2L4CA 1T1VA 4FH8A 3GKNA 3HVNA 2H19A 2XPEA 2GZZA 2DLXA 4IJIA 1JZRA 1VF3A 3E0UA 3KH7A 3KTLA 2DJ3A 3CQFA 3A2WA 2XC2A 3WD6A 1U3AA 2PU9C 3WGEA 4XS6A 4POKA 3CRUA 2A2PA 1TKDB 5CAXA 1XZOA 3C73A 1DE2A 3D4MA 2DJ1A 2GVPA 6GSXA 1EGRA 3GTUB 4PNFA 3L78A 3VWXA 3LSZA 2HRNA 1IYIA 2V6OA 2PVOC 3F8UA 2LEGA 4ZBDA 2FWFA 4MNNA 4K9ZA 3IC8A 1T8EB 3KCMA 1YF1A 4Q5RA 1JZOA 2B7JA 3U5RE 1TI3A 1YJ6A 3GMFA 1PN9A 1TXXA 3RHCA 5KN3A 3HKRA 5B6NA 4TR4A 2H73A 4GTUA 3HDCA 3E9JB 1A23A 5J9CA 3L4NA 4N0ZA 2VL3A 4HQZA 1TDIA 4IGJA 3ZZXA 3C8EA 1XG8A 1OC8A 2B5EA 2K8SA 1AIUA 2LTKA 3WGXA 4MLYA 1QQ2A 4E8HA 4FYBA 1SJZA 3IK7A 1RQMA 3A2VA 4E8EA 2GSQA 1ZYQB 5ID2B 3F6FA 4QQ7A 1XW9A 4NPBA 4Q5FA 1N8JA 5ELGA 2VCVA 2CVBA 2MYGA 5J9BA 1W89A 1HNCA 4GRFA 2HT9A 1PRXA 2JADA 2VL2A 2C3QA 4HI7A 2NTOA 2PN8A 1X5CA 1X5EA 3IC4A 3RPNA 3W8JA 4MA9A 1A2LA 5HQPA 4YAVA 4RQRA 3M0FA 2QSIA 2OE3A 2CAIA 2BMXA 2LS5A 4KH7A 3KXOA 1XWCA 3G7IA 1SD9A 2HFDA 3GL5A 2HE3A 4MP4A 3NOFA 4TXOA 2F9SA 2UZ8A 5B8AA 2HRKA 2O87A 3SWLA 4IVFA 4Z2UA 1R5PA 3HCZA 2PERA 2OA7A 3G9BA 3GA4A 2CV4A 2H1AA 2O85A 3CYNA 19GSA 5INYA 2HSYA 4WBRD 4I6XA 1EV9A 1ON4A 3UBLA 2VLVA 3EVIA 3ZREA 3WGDA 2LRCA 4J57E 2LSTA 4L5OA 1K0OA 1UA5A 2WRTA 5B6MA 1EEJA 2VLUA 2CZ3A 4GLTA 3FW2A 1YEXA 4I5QA 5ECRB 3U6VA 2DJ0A 3DWVA
chains in the Genus database with same CATH topology
4I8BA 2ZNMA 4EIQA 2K18A 2H01A 4X1UA 3LXTA 2VO4A 3I43A 1EOHA 4EDYA 4V2LA 4GF0A 5ECQB 2LQQA 4H86A 4N30A 3ZVJD 3EMXA 3GFKA 3KD0A 1FVKA 1ACVA 2JZTA 3V1WA 3FY7A 4MPFA 1SYXA 3HJPA 1M2AA 3VI5A 2I3YA 3QFBC 5IOWA 3KP8A 4EXJA 1A8YA 3EWLA 4BVYA 4L5LA 2I9HA 4AJ8A 4O7HA 1B4QA 2M72A 4WETA 4FQUA 1E2YA 2YWIA 3DIEA 3GX8A 4MJBA 2ES7A 2ALBA 3IBHA 4RI7A 2H6XA 4L8EA 2Z9SA 4WR5A 2FUG2 2L59A 3LORA 2V6KA 3M8NA 2CX4A 2TRXA 4EF0A 4IKHA 4X4JA 5KN2A 2NVLA 3FK8A 5IMFA 3TJFA 2VL2C 1GH2A 1A8LA 2FY6A 4KUNA 5ECKB 3MWHA 5D93A 3HJOA 4RI6A 2FHEA 1MDJA 5IMVA 3ZFLA 4OCFA 5HR0A 3J7Yb 2C0FA 3F4SA 4KDXA 5DCHA 1UC7A 3FZ9A 4NV5A 4OFTA 1DUGA 2HZFA 3TRXA 3HXSA 3TKSA 1OC3A 1YY7A 4GSSA 1XOAA 3CTGA 5AIVA 5HR2A 3GKKA 4MPGA 4HS1A 5IMZA 4IBPA 2VM1A 5CRGA 1FB0A 2OBIA 2QKEA 1I9DA 3GUSA 1VF4A 4XRDA 2VCWA 4D73B 1GSEA 1YEPA 1AAZA 4PXOA 2XPDA 3EINA 4GSTA 4F0CA 3IR4A 1ERTA 1GLQA 5IQYA 1HD2A 2PGTA 3FEUA 10GSA 2P31A 3LYKA 4X0XA 3TOUA 4BVXB 1XW6A 5DJLA 4HOJA 3DXBA 3EMPA 4JBBA 1H75A 2BJXA 1EEMA 2FCHA 3LW9A 5HR3A 2JZSA 2IMKA 2N5FA 3PH9A 4ID0A 4IHUA 1UVZA 4N10A 5H5SA 1M9AA 3I69A 3KP9A 4QL7A 3F4TA 1J08A 1T00A 1XVQA 2RLIA 2I1UA 1TK5B 2QGVA 3C1RA 5ENUA 3HHVA 1G7EA 2GQKA 4WEYA 2VCTA 2YV9A 3QAWA 1OYJA 1QFNA 4K7NA 3D0ZA 2R3XA 3R2QA 4POMA 1GP1A 5D8IA 11GSA 3L0HA 1GULA 3CXGA 2HI7A 4JE1A 4K7OA 1CQHA 2X8CA 1DSBA 3UVTA 1BG5A 1M2DA 2JSYA 2R37A 4ILFA 3IHGA 4FO5A 2KP2A 1SKSB 1XWBA 2WDUA 5ECOB 1ZOFA 4HDEA 2PUKC 5B7CA 3GNJA 2C0GA 2MMZA 1JLVA 1VRSD 4CY6A 3H93A 2E0QA 2HRAA 4BWQA 2OE1A 2LUSA 3VWVA 1BJXA 3IRAA 4PQ1A 2QC7A 4PUAA 4ECJA 3HY2A 3FRCA 2DKIA 4MCUA 4ULXA 1ZYNA 3HZ4A 2GSRA 2E2GA 1F3BA 1AXDA 3NZNA 4HJ2A 4L0UA 2H1DA 2B1KA 4XHMA 2MMAA 3VWWA 3KIJA 5EL8A 1WMJA 5DDLA 2KUCA 3M9JA 1WOUA 1TI1A 1Z6NA 3TKSC 4ZL7A 1PKZA 1SK0A 2P0GA 4WF5A 2L57A 3H79A 3F3RA 3QR6A 3H4KA 2JSZA 3A5WA 4ECCA 3LFLA 5IMAA 3KTBA 1TRSA 1Y6EA 3PGTA 4G0KA 4OCEA 2AAWA 2GZPA 2LJAA 3HVVA 2B7KA 1GSUA 1WWJA 2E2MA 4KDYA 2RUFA 1YKAA 1Z5YE 3ME8A 3HVSA 2ZUPA 4HZ4A 3A5IA 3VPTA 4MMMA 2LKUA 4XIHA 1V58A 1GWCA 4OD7A 3VFIA 4MF5A 2CT6A 3M9KA 1PKWA 3WT2A 3GTUA 2VOCA 1XOBA 7GSSA 2LRNA 3N9JA 3GSSA 2AV4A 1B8XA 1B4PA 4GCIA 5ECSA 2K8VA 2LJKA 2K9FA 4AJ7A 4P3YB 1PN0A 2M46A 3QPMA 18GSA 2L6DA 4BL7B 2F8AA 4FYUA 4PUFC 5A5KA 3QFAC 5F05A 3ERFA 2PBJA 5GSSA 4IELA 2IFQA 3JCML 4DSQA 1T7PB 3HA9A 2HLSA 2ZCTA 1WPIA 1AC1A 3P2AA 3PPUA 5G5FA 3WYWA 2H70A 1GSDA 4TR0A 5E4WA 1A2JA 4EKZA 3TRQA 2TIRA 1TRVA 4KDUA 1MD4A 1R5AA 1MDIA 3UIWA 5G30A 2HZEA 2AUVA 4LMVA 3IAM2 2GDRA 4IQ1A 3ZVJA 1TP9A 3FR9A 2IMDA 3EU3A 2YOIA 1ZYEA 1J9BA 2K6VA 1C72A 3D5JA 1R4WA 1PX6A 4BWSA 5FT3A 5ECHB 2DJ2A 3EURA 2CVDA 2VAFA 5FHIA 2HSHA 1F9MA 5J5NA 5HFGA 3RHBA 3P90A 4TKYA 5DJMA 4XRAA 3FZ5A 2JL4A 2P5RA 1OAZA 3L9UA 2XHFA 1GSQA 3LG6A 1JZDA 2KP1A 2WB9A 2GGTA 1E6BA 5A4WA 1B9XC 4MJEA 2YNXA 3RBTA 5DBQA 1TRWA 1ERUA 3UAPA 1ILOA 3NIVA 1ZCPA 1GUHA 2KLXA 2OADA 2A2RA 5CO3A 4PQHA 1KNGA 1Y25A 1A24A 1T4YA 5CRDA 2YWMA 2HYXA 2YZUA 5D9VA 4KSMA 2N5AA 4N0VA 4OFNA 5KOXA 1M99A 2F51A 3LWAA 1SENA 1PX7A 2LRTA 4QL9A 3TJBA 4XS1A 1EP7A 2NPBA 4NHZA 1RW1A 2N5BA 2IMFA 4A5PA 5G31A 1OVNA 4F82A 2WULA 2EIOA 4CW9A 3KJYA 2FLSA 4K1FA 1XBSA 3TOTA 2IL3A 5EVOA 3HJMA 4CY8A 1YKCA 1Z3EA 1PA3A 2CQ9A 2FD3A 4V2MA 1YDKA 1EV4A 1NHYA 3TGZA 4OO4A 4KGIA 1UN2A 2V1MA 3QAGA 1OKDA 1USBA 2IJYA 2YWOA 4EL1A 1V9WA 5LD0A 5LNKe 1SYRA 4OFMA 4ECIA 2HSMA 3APOA 4TXOB 2FWEA 1Q98A 3GH6A 20GSA 5B8BA 1G6YA 3GX0A 5G5EA 1B9YC 2GLRA 4LL4B 3HZ8A 2VL9A 3MNGA 2H0HA 1GLPA 2IWTA 1NSWA 3IV4A 1S3AA 5J4UA 3QDNA 3DD3A 4Q5QA 1XPVA 5ECPB 2ON7A 4DSSA 3CSHA 1NM3A 2PPTA 2DMMA 3F9UA 2X4AA 4GSNA 1XWKA 5JCGA 1GNEA 4XS4A 3TRPA 2PWJA 4OWYA 2V32A 1XVWA 3DVXA 1TTZA 2WCIA 1QK8A 3VLNA 4HQSA 1ZMAA 1WE0A 3QMXA 2CVKA 2MZCA 3UVHA 3UMAA 4ZL9A 3F4RA 1TW9A 4TRXA 3IXRA 5F07A 2R5GA 1PGTA 4O5UA 5GAND 2AYTA 1SL1B 1LBKA 4LL1B 1K0NA 22GSA 2H30A 3RPPA 4BVYB 3KEBA 1SJ6A 4POLA 3ERWA 5ECMB 4D73A 5CRHA 5KEJA 5FWGA 5E59A 3PINA 2YPMA 1A0RP 4G0IA 4F9ZA 2R2JA 4F0BA 1M2BA 5C04A 3KMNA 5HFIA 4IJ3A 1Z9HA 3UARA 1Q4JA 3RAZA 2VD1A 3IOSA 5IPHA 1MD3A 3ZIVA 1O8XA 1HNBA 4KE3A 3TKPA 3OR5A 1EGOA 1BAYA 3H1NA 2ON5A 2GT6A 1F37A 1HQOA 2B5YA 3TB2A 5HR1A 5D9WA 1THXA 3O3TA 2L6CA 3LQ7A 3VK9A 1K0MA 4EVMA 2PMTA 5F06A 1SKWB 1ABAA 3GIXA 2DC5A 1G7OA 1X5DA 2R4VA 4GQFA 3DRNA 3W6GA 1QUWA 3J7Yk 1K3LA 3Q19A 2GS3A 4I2UA 2R0CA 4PTSA 2H0IA 2IMEA 2RIIA 3ERGA 5IPGA 4HEA2 1O8WA 1URMA 2FWHA 1PQNA 1GUKA 3FZAA 3IE3A 1K0CA 4V1Ap 3I9V2 1B48A 4WBJA 1TK8B 3N5OA 3MAKA 1G6WA 5JCWA 4KX4A 1SU9A 1N2AA 1IYHA 1TU8A 3F0IA 3QD9A 4ECBA 1PL1A 4RUVA 3A3TA 4ZB8A 3TUEA 5IM9A 3KH9A 5D9XA 5A4UA 2XBIA 2BTOT 4O92A 2WZ9A 1MTCA 1BYEA 1AQWA 2KOKA 2GZYA 3UOMA 1RK4A 3VWUA 1SK2A 1SKRB 4JRRA 3TKRA 3GH9A 1KBNA 5KOWA 1YZXA 4LMWA 3C1SA 2JZRA 4Q5NA 4ZL8A 3BD2A 2R0GA 2YJHA 2WJUA 3CSIA 1EP8A 1SL0B 2YN1A 2VCQA 3MSZA 5DALA 1ZZYA 2QA2A 2J9HA 1K0BA 1ML6A 5ABRA 4ZBAA 2H1BA 2C3NA 2M80A 2B5XA 1OE7A 5F0GA 4OO5A 4TR1B 1MDKA 3GN3A 4ICYA 1JLWA 5JWQB 5GZZB 1OC9A 3GYKA 4YAPA 2H8LA 5DAKB 2OJLA 3D21A 3BJ5A 3LXZA 2IN3A 2C1YA 3ED3A 5JCUA 4RQXA 4G19A 3BOAA 1X9MB 1JFUA 1AW9A 2R0PA 2DSAA 4K2XA 5G1KA 2VCZA 1XWGA 4YH2A 16GSA 2L4QA 2O7KA 3EPTA 4NHWA 3GKMA 1ZYPA 3BBYA 5IMDA 3ZTLA 1VF1A 4JZQA 4G10A 5AN1A 2C8UA 4J56E 3TCOA 3UJ1A 2HRFA 4LA1A 1U87A 1JZWA 5KN1A 3LEFA 5CNWA 1HYUA 1SL2B 5ECLB 4N11A 2C3TA 4BPYA 2LNTA 2B1LA 3D4TA 4MF6A 2GSTA 4Z7XA 5J41A 1EWXA 13GSA 4EIPA 3S9FA 3M1GA 4IN0A 5JWRB 2YCDA 2B6MA 2CAQA 1YF0A 4NWYA 2X99A 1VF2A 4G2EA 1GTBA 3PR8A 3ZYWA 5IMCA 3FHKA 4GQCA 1O73A 2LJRA 5DQSA 17GSA 2F8FA 1X9WB 2OACA 4MF7A 4K5RA 1OKTA 1GL8A 1XWAA 3ZRDA 2FGXA 4O5QA 4YQVA 2I81A 1G0TA 5ECNB 1X0RA 3FMWA 3VI7A 2A2SA 2FA8A 3Q74A 4TR3A 4NAXA 1ZL9A 2CA8A 4OMVA 1NW2A 2YANA 4EC0A 2O8VB 1U3IA 3D6IA 3AY8A 4ISDA 1TOFA 4XCSA 1F2EA 2C4JA 1GNWA 4DVCA 2FA4A 4PQIA 4WXTA 2WS2A 3DMLA 5IO2A 3F3QA 4YKGA 5EPFA 5ID2A 4IP6A 2X8HA 3TJJA 2J23A 4NXIA 4PNGA 2NDOA 2P5QA 3TKQA 3IK9A 1S3DA 3G7JA 4V2NA 2IFQB 5D73A 3CBUA 5A4VA 3GSTA 3K8NA 4IW9A 3ZITA 4G0LA 1WRYA 4HU9A 1W4VA 4YKFA 3BCKA 2AB6A 2C80A 4ZIJA 3IA1A 4EO3A 2X64A 3EU4A 1BEDA 3P8WA 2H66A 2C0DA 3KMOA 1FO5A 2LV3A 3GRXA 2YJ7A 1PD21 5ELAA 2B3SA 1FOVA 2HZEB 4DEJA 3DYRA 2MBSA 4O32A 3KZQA 1GTAA 2PVQA 1TK0B 4JR6A 3ZLPA 3H8QA 2R6KA 2HNLA 3L9SA 2DMLA 4POBA 1Z7RA 4MH2A 5H5RA 2GQLA 1EOGA 5G2ZA 4AJ6A 2A4HA 3APSA 3TKSE 4CHSA 2X8GA 4Z2TA 2H0GA 3F63A 1SK1A 3D22A 1QXHA 1Z7PA 3ZMLA 4I2TA 4TVEA 2DJJA 4WF4A 1CQGA 1ZGNA 4IQAA 2VD0A 4HJMA 4KA0A 4ZB6A 1ERVA 4ZB9A 4JR4A 3APQA 1TJDA 1GSYA 3O76A 3HYPA 4ZXGA 1FG4A 5D9TA 2E7PA 2H76A 2WGRA 5L71A 4USSA 1PL2A 1GTIA 3ISOA 1JHBA 4JU5A 1HNAA 1GSSA 3E3EA 2V2GA 3R3EA 3C71A 4MDCA 4NV2A 1XW5A 3TDGA 3Q6OA 4FIWA 3KM6A 1FHEA 1AQXA 1U6TA 2HXKA 3RDWA 2CX3A 4GXZA 4K0GA 3F6DA 2G0FA 3O6TA 3ZFBA 2IIYA 4KNDA 1SD8A 5J3RA 1K3OA 3P7XA 4K5SA 1V57A 1V2AA 2IMIA 3BCIA 3L9VA 2D2ZA 1SJIA 4BA7A 2VLTA 4TN8A 1O6JA 6GSWA 3GURA 3GKXA 1XFLA 4AGSA 1NHOA 1VGLA 2GSSA 2QA1A 4MABA 3C7MA 2TRCP 5BMUA 4V1Ag 1Z6MA 2H74A 2OBKA 1BQ7A 1DBYA 4X43A 3IPZA 4KSOA 2MMNA 1A0FA 5AGYA 1K0DA 2YWNA 4NMUA 2DIYA 4O5RA 2AJQB 1V98A 2IPAA 12GSA 4HZ2A 1XXUA 5AIXA 2VCXA 4KCEA 5GSTA 1OE8A 4K2DA 5ECIB 4TW5A 3IAS2 2VUPA 5DVBA 4LLRA 3DVWA 4DSSB 3EE2A 2AHEA 2RUEA 2H72A 1T3BA 5C00A 3VURA 5F8BA 14GSA 5CYYA 4XS4B 5JWOB 2H6ZA 4EE0A 2YV7A 3UEMA 4GWRA 5D96A 1DE1A 4MJAA 1FW1A 1LJRA 4BVXA 3LGCA 4AF2A 1S3CA 5IO0A 1A2MA 4MZCA 1KEBA 3EYTA 3LYPA 3A2XA 2XBQA 1FVJA 3IHQA 2DJKA 2MMOA 2KHPA 1K0AA 3FR3A 5IIZA 4K8MA 4EDZA 4DSRA 1BX9A 2EIQA 2OKAA 3SBCA 3VPQA 1FB6A 3GV1A 6GSTA 2YP6A 4KCAA 3CMIA 3FR6A 3ZIJA 2H71A 1O7UA 4F2IA 2YZHA 2JACA 5CREA 4YQMA 3I6AA 2L5OA 2DKHA 1T4ZA 1F6MC 4MZBA 4PGTA 3MIXA 3ZMKA 2DIZA 3CRTA 4Z2RA 3FKFA 2X49A 1R7HA 1M7TA 4CDOA 1U88A 1GSFA 4ACSA 5DQYA 4K0NA 2LQOA 3EC3A 4MH3A 1FAAA 3HD5A 1X9SB 1QGVA 1TRUA 3DKSA 5AISA 1M0UA 3QCPA 4F03A 4L0WA 1ST9A 3IDVA 5CP1A 3FZ4A 3KGKA 3ZL5A 6GSYA 1O85A 1THOA 2C0EA 1XIYA 4XTSA 4J2FA 2H6YA 2LNSA 2GTUA 4JEDA 1R26A 1LU4A 3CSJA 4MJCA 6GSVA 4IP1A 1ERWA 4EUYA 2GT5A 2RM6A 4TR1A 1QMVA 2EIRA 4MK3A 1V40A 3HVXA 2FNOA 4MZWA 2VM2A 4ZBBA 1WJKA 3MYDA 1H4OA 2L5LA 5DAKA 5DCGA 3W8SA 5HFKA 4K7IA 1M9BA 1XCCA 2FWGA 3US3A 3WT1A 2JU5A 3Q18A 1GRXA 4KF9A 6GSUA 1J0FA 4I97A 8GSSA 1PMTA 4K6XA 1MEKA 5CRWA 2I4AA 2CZ2A 2H75A 1I5GA 2NBSA 1K3YA 4HUAA 4YQUA 5COHA 4PURA 1GTUA 2WFCA 3TJGA 1WP0A 4ZILA 2H1GA 1AQVA 2O89A 1EZKA 1O81A 1TU7A 3CTFA 1WIKA 2MBTA 3MDKA 1KTEA 3G7YA 3QAVA 1F3AA 3GL3A 3LJRA 4WR4A 1FOHA 4TOPA 3QOUA 5EY6A 4G9HA 5DALB 1YQ1A 3DGQA 4PX1A 3FYGA 5BRTA 4BL7A 1GUMA 6GSSA 4TXVA 2G2QA 3DEXA 3TJKA 4IS0A 1PSQA 4HU7A 3UBKA 4ML1A 4ML6A 1OC9B 5IOXA 5H5QA 2A4VA 4FYCA 3UL3A 5LCZA 4KB3A 5G1LA 5KN0A 3GHAA 3M3MA 3ME7A 2REMA 1AUCA 2GQMA 2OE0A 4KW6A 2RM5A 2EC4A 4WKWA 5GAPD 2V41A 2VIMA 2F3MA 2DBCA 4KAEA 9GSSA 2L4CA 1T1VA 4FH8A 3GKNA 2H19A 2XPEA 2GZZA 2DLXA 4IJIA 1JZRA 1VF3A 3E0UA 3KH7A 3KTLA 2DJ3A 3A2WA 2XC2A 3WD6A 1U3AA 2PU9C 3WGEA 4XS6A 4POKA 3CRUA 2A2PA 1TKDB 5CAXA 1XZOA 3C73A 1DE2A 3D4MA 2DJ1A 2GVPA 6GSXA 1EGRA 3GTUB 4PNFA 3L78A 3VWXA 3LSZA 2HRNA 1IYIA 2V6OA 2PVOC 3F8UA 2LEGA 4ZBDA 2FWFA 4MNNA 4K9ZA 3IC8A 1T8EB 3KCMA 1YF1A 4Q5RA 1JZOA 2B7JA 3U5RE 1TI3A 1YJ6A 3GMFA 1PN9A 1TXXA 3RHCA 5KN3A 3HKRA 5B6NA 4TR4A 2H73A 4GTUA 3HDCA 3E9JB 1A23A 5J9CA 3L4NA 4N0ZA 2VL3A 4HQZA 1TDIA 4IGJA 3ZZXA 3C8EA 1OC8A 2B5EA 2K8SA 1AIUA 2LTKA 3WGXA 4MLYA 1QQ2A 4E8HA 4FYBA 1SJZA 3IK7A 1RQMA 3A2VA 4E8EA 2GSQA 1ZYQB 5ID2B 3F6FA 4QQ7A 1XW9A 4NPBA 4Q5FA 1N8JA 5ELGA 2VCVA 2CVBA 2MYGA 5J9BA 1W89A 1HNCA 4GRFA 2HT9A 1PRXA 2JADA 2VL2A 2C3QA 4HI7A 2NTOA 2PN8A 1X5CA 1X5EA 3IC4A 3RPNA 3W8JA 4MA9A 1A2LA 5HQPA 4YAVA 4RQRA 3M0FA 2QSIA 2OE3A 2CAIA 2BMXA 2LS5A 4KH7A 3KXOA 1XWCA 3G7IA 1SD9A 2HFDA 3GL5A 2HE3A 4MP4A 3NOFA 4TXOA 2F9SA 2UZ8A 5B8AA 2HRKA 2O87A 3SWLA 4IVFA 4Z2UA 1R5PA 3HCZA 2PERA 2OA7A 3G9BA 3GA4A 2CV4A 2H1AA 2O85A 3CYNA 19GSA 5INYA 2HSYA 4WBRD 4I6XA 1EV9A 1ON4A 3UBLA 2VLVA 3EVIA 3ZREA 3WGDA 2LRCA 4J57E 2LSTA 4L5OA 1K0OA 1UA5A 2WRTA 5B6MA 1EEJA 2VLUA 2CZ3A 4GLTA 3FW2A 1YEXA 4I5QA 5ECRB 3U6VA 2DJ0A 3DWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I8B A;  2ZNM A;  2K18 A;  2H01 A;  4X1U A;  3LXT A;  2VO4 A;  3I43 A;  1EOH A;  4EDY A;  4V2L A;  4GF0 A;  5ECQ B;  2LQQ A;  4H86 A;  4N30 A;  3ZVJ D;  3EMX A;  3GFK A;  3KD0 A;  1FVK A;  1ACV A;  2JZT A;  3V1W A;  3FY7 A;  4MPF A;  1SYX A;  3HJP A;  1M2A A;  3VI5 A;  2I3Y A;  3QFB C;  5IOW A;  3KP8 A;  4EXJ A;  1A8Y A;  3EWL A;  4BVY A;  4L5L A;  2I9H A;  4AJ8 A;  4O7H A;  1B4Q A;  2M72 A;  4WET A;  1E2Y A;  2YWI A;  3DIE A;  3GX8 A;  4MJB A;  2ES7 A;  2ALB A;  3IBH A;  4RI7 A;  2H6X A;  4L8E A;  2Z9S A;  4WR5 A;  2FUG 2;  2L59 A;  3LOR A;  2V6K A;  3M8N A;  2CX4 A;  2TRX A;  4EF0 A;  4IKH A;  5KN2 A;  2NVL A;  3FK8 A;  5IMF A;  3TJF A;  2VL2 C;  1GH2 A;  1A8L A;  2FY6 A;  4KUN A;  5ECK B;  3MWH A;  5D93 A;  3HJO A;  4RI6 A;  2FHE A;  1MDJ A;  5IMV A;  3ZFL A;  4OCF A;  5HR0 A;  3J7Y b;  2C0F A;  3F4S A;  4KDX A;  5DCH A;  1UC7 A;  3FZ9 A;  4NV5 A;  4OFT A;  1DUG A;  2HZF A;  3TRX A;  3HXS A;  3TKS A;  1OC3 A;  1YY7 A;  4GSS A;  1XOA A;  3CTG A;  5AIV A;  5HR2 A;  3GKK A;  4MPG A;  4HS1 A;  5IMZ A;  4IBP A;  2VM1 A;  5CRG A;  1FB0 A;  2OBI A;  2QKE A;  1I9D A;  3GUS A;  1VF4 A;  4XRD A;  2VCW A;  4D73 B;  1GSE A;  1YEP A;  1AAZ A;  4PXO A;  2XPD A;  3EIN A;  4GST A;  4F0C A;  3IR4 A;  1ERT A;  1GLQ A;  5IQY A;  1HD2 A;  2PGT A;  3FEU A;  10GS A;  2P31 A;  3LYK A;  4X0X A;  3TOU A;  1XW6 A;  5DJL A;  4HOJ A;  3DXB A;  3EMP A;  4JBB A;  1H75 A;  2BJX A;  1EEM A;  2FCH A;  5HR3 A;  2JZS A;  2IMK A;  2N5F A;  3PH9 A;  4ID0 A;  4IHU A;  1UVZ A;  4N10 A;  5H5S A;  1M9A A;  3I69 A;  3KP9 A;  4QL7 A;  3F4T A;  1J08 A;  1T00 A;  1XVQ A;  2RLI A;  2I1U A;  1TK5 B;  2QGV A;  3C1R A;  5ENU A;  3HHV A;  1G7E A;  2GQK A;  4WEY A;  2VCT A;  2YV9 A;  3QAW A;  1OYJ A;  1QFN A;  4K7N A;  3D0Z A;  2R3X A;  3R2Q A;  4POM A;  1GP1 A;  5D8I A;  11GS A;  3L0H A;  1GUL A;  3CXG A;  2HI7 A;  4JE1 A;  4K7O A;  1CQH A;  2X8C A;  1DSB A;  3UVT A;  1BG5 A;  1M2D A;  2JSY A;  2R37 A;  4ILF A;  4FO5 A;  2KP2 A;  1SKS B;  1XWB A;  2WDU A;  5ECO B;  1ZOF A;  4HDE A;  2PUK C;  5B7C A;  3GNJ A;  2C0G A;  2MMZ A;  1JLV A;  1VRS D;  3H93 A;  2E0Q A;  4BWQ A;  2OE1 A;  2LUS A;  3VWV A;  1BJX A;  3IRA A;  4PQ1 A;  2QC7 A;  4PUA A;  4ECJ A;  3HY2 A;  3FRC A;  4MCU A;  4ULX A;  3HZ4 A;  2GSR A;  2E2G A;  1F3B A;  1AXD A;  3NZN A;  4HJ2 A;  4L0U A;  2H1D A;  2B1K A;  4XHM A;  2MMA A;  3VWW A;  3KIJ A;  5EL8 A;  1WMJ A;  5DDL A;  2KUC A;  3M9J A;  1WOU A;  1TI1 A;  1Z6N A;  3TKS C;  4ZL7 A;  1PKZ A;  1SK0 A;  2P0G A;  4WF5 A;  2L57 A;  3H79 A;  3F3R A;  3QR6 A;  3H4K A;  2JSZ A;  3A5W A;  4ECC A;  3LFL A;  5IMA A;  3KTB A;  1TRS A;  1Y6E A;  3PGT A;  4OCE A;  2AAW A;  2GZP A;  2LJA A;  3HVV A;  2B7K A;  1GSU A;  1WWJ A;  2E2M A;  4KDY A;  2RUF A;  1YKA A;  1Z5Y E;  3ME8 A;  3HVS A;  2ZUP A;  4HZ4 A;  3VPT A;  4MMM A;  2LKU A;  4XIH A;  1V58 A;  1GWC A;  4OD7 A;  3VFI A;  4MF5 A;  2CT6 A;  3M9K A;  1PKW A;  3WT2 A;  3GTU A;  2VOC A;  1XOB A;  7GSS A;  2LRN A;  3N9J A;  3GSS A;  2AV4 A;  1B8X A;  1B4P A;  4GCI A;  5ECS A;  2K8V A;  2LJK A;  2K9F A;  4AJ7 A;  4P3Y B;  2M46 A;  3QPM A;  18GS A;  2L6D A;  2F8A A;  4FYU A;  4PUF C;  5A5K A;  3QFA C;  5F05 A;  3ERF A;  2PBJ A;  5GSS A;  4IEL A;  2IFQ A;  3JCM L;  4DSQ A;  1T7P B;  3HA9 A;  2HLS A;  2ZCT A;  1WPI A;  1AC1 A;  3P2A A;  5G5F A;  3WYW A;  2H70 A;  1GSD A;  4TR0 A;  5E4W A;  1A2J A;  4EKZ A;  3TRQ A;  2TIR A;  1TRV A;  4KDU A;  1MD4 A;  1R5A A;  1MDI A;  3UIW A;  5G30 A;  2HZE A;  2AUV A;  4LMV A;  3IAM 2;  2GDR A;  4IQ1 A;  3ZVJ A;  1TP9 A;  3FR9 A;  2IMD A;  3EU3 A;  2YOI A;  1ZYE A;  1J9B A;  2K6V A;  1C72 A;  3D5J A;  1R4W A;  1PX6 A;  4BWS A;  5FT3 A;  5ECH B;  2DJ2 A;  3EUR A;  2CVD A;  2VAF A;  5FHI A;  2HSH A;  1F9M A;  5J5N A;  5HFG A;  3RHB A;  3P90 A;  4TKY A;  5DJM A;  4XRA A;  3FZ5 A;  2JL4 A;  2P5R A;  1OAZ A;  3L9U A;  2XHF A;  1GSQ A;  3LG6 A;  1JZD A;  2KP1 A;  2WB9 A;  2GGT A;  1E6B A;  5A4W A;  1B9X C;  4MJE A;  2YNX A;  3RBT A;  5DBQ A;  1TRW A;  1ERU A;  3UAP A;  1ILO A;  3NIV A;  1ZCP A;  1GUH A;  2KLX A;  2OAD A;  2A2R A;  5CO3 A;  4PQH A;  1KNG A;  1Y25 A;  1A24 A;  1T4Y A;  5CRD A;  2YWM A;  2HYX A;  2YZU A;  5D9V A;  4KSM A;  2N5A A;  4N0V A;  4OFN A;  1M99 A;  2F51 A;  3LWA A;  1SEN A;  1PX7 A;  2LRT A;  4QL9 A;  3TJB A;  4XS1 A;  1EP7 A;  2NPB A;  4NHZ A;  1RW1 A;  2N5B A;  2IMF A;  5G31 A;  1OVN A;  4F82 A;  2WUL A;  2EIO A;  4CW9 A;  3KJY A;  2FLS A;  4K1F A;  1XBS A;  3TOT A;  2IL3 A;  5EVO A;  3HJM A;  1YKC A;  1Z3E A;  1PA3 A;  2CQ9 A;  2FD3 A;  4V2M A;  1YDK A;  1EV4 A;  1NHY A;  3TGZ A;  4OO4 A;  4KGI A;  1UN2 A;  2V1M A;  3QAG A;  1OKD A;  1USB A;  2IJY A;  2YWO A;  4EL1 A;  1V9W A;  5LD0 A;  5LNK e;  1SYR A;  4OFM A;  4ECI A;  3APO A;  4TXO B;  2FWE A;  1Q98 A;  3GH6 A;  20GS A;  5B8B A;  1G6Y A;  3GX0 A;  5G5E A;  1B9Y C;  2GLR A;  4LL4 B;  3HZ8 A;  2VL9 A;  3MNG A;  2H0H A;  1GLP A;  2IWT A;  1NSW A;  3IV4 A;  1S3A A;  5J4U A;  3QDN A;  3DD3 A;  4Q5Q A;  1XPV A;  5ECP B;  2ON7 A;  4DSS A;  3CSH A;  1NM3 A;  2PPT A;  2DMM A;  3F9U A;  4GSN A;  1XWK A;  5JCG A;  1GNE A;  4XS4 A;  3TRP A;  2PWJ A;  4OWY A;  2V32 A;  1XVW A;  3DVX A;  1TTZ A;  2WCI A;  1QK8 A;  3VLN A;  4HQS A;  1ZMA A;  1WE0 A;  3QMX A;  2CVK A;  2MZC A;  3UVH A;  3UMA A;  4ZL9 A;  3F4R A;  1TW9 A;  4TRX A;  3IXR A;  5F07 A;  2R5G A;  1PGT A;  5GAN D;  2AYT A;  1SL1 B;  1LBK A;  4LL1 B;  1K0N A;  22GS A;  2H30 A;  3RPP A;  3KEB A;  1SJ6 A;  4POL A;  3ERW A;  5ECM B;  4D73 A;  5CRH A;  5KEJ A;  5FWG A;  5E59 A;  3PIN A;  2YPM A;  1A0R P;  4F9Z A;  2R2J A;  4F0B A;  1M2B A;  5C04 A;  3KMN A;  5HFI A;  4IJ3 A;  1Z9H A;  3UAR A;  1Q4J A;  3RAZ A;  2VD1 A;  3IOS A;  5IPH A;  1MD3 A;  3ZIV A;  1O8X A;  1HNB A;  4KE3 A;  3TKP A;  3OR5 A;  1EGO A;  1BAY A;  3H1N A;  2ON5 A;  2GT6 A;  1F37 A;  1HQO A;  2B5Y A;  3TB2 A;  5HR1 A;  5D9W A;  1THX A;  3O3T A;  2L6C A;  3LQ7 A;  3VK9 A;  1K0M A;  4EVM A;  2PMT A;  5F06 A;  1SKW B;  1ABA A;  3GIX A;  2DC5 A;  1G7O A;  1X5D A;  2R4V A;  4GQF A;  3DRN A;  3W6G A;  1QUW A;  3J7Y k;  1K3L A;  3Q19 A;  2GS3 A;  4I2U A;  2H0I A;  2IME A;  2RII A;  3ERG A;  5IPG A;  4HEA 2;  1O8W A;  1URM A;  2FWH A;  1PQN A;  1GUK A;  3FZA A;  3IE3 A;  1K0C A;  4V1A p;  3I9V 2;  1B48 A;  4WBJ A;  1TK8 B;  3N5O A;  3MAK A;  1G6W A;  5JCW A;  4KX4 A;  1SU9 A;  1N2A A;  1IYH A;  1TU8 A;  3F0I A;  3QD9 A;  4ECB A;  1PL1 A;  4RUV A;  3A3T A;  4ZB8 A;  3TUE A;  5IM9 A;  3KH9 A;  5D9X A;  5A4U A;  2XBI A;  2BTO T;  4O92 A;  2WZ9 A;  1MTC A;  1BYE A;  1AQW A;  2KOK A;  2GZY A;  3UOM A;  1RK4 A;  3VWU A;  1SK2 A;  1SKR B;  4JRR A;  3TKR A;  3GH9 A;  1KBN A;  1YZX A;  4LMW A;  3C1S A;  2JZR A;  4Q5N A;  4ZL8 A;  3BD2 A;  2YJH A;  2WJU A;  3CSI A;  1EP8 A;  1SL0 B;  2YN1 A;  2VCQ A;  3MSZ A;  5DAL A;  1ZZY A;  2J9H A;  1K0B A;  1ML6 A;  5ABR A;  4ZBA A;  2H1B A;  2C3N A;  2M80 A;  2B5X A;  1OE7 A;  5F0G A;  4OO5 A;  4TR1 B;  1MDK A;  3GN3 A;  1JLW A;  5JWQ B;  5GZZ B;  1OC9 A;  3GYK A;  4YAP A;  2H8L A;  5DAK B;  2OJL A;  3D21 A;  3BJ5 A;  3LXZ A;  2IN3 A;  2C1Y A;  3ED3 A;  5JCU A;  4RQX A;  4G19 A;  3BOA A;  1X9M B;  1JFU A;  1AW9 A;  2DSA A;  5G1K A;  2VCZ A;  1XWG A;  4YH2 A;  16GS A;  2L4Q A;  2O7K A;  4NHW A;  3GKM A;  3BBY A;  5IMD A;  3ZTL A;  1VF1 A;  4JZQ A;  4G10 A;  5AN1 A;  2C8U A;  4J56 E;  3TCO A;  3UJ1 A;  2HRF A;  4LA1 A;  1U87 A;  1JZW A;  5KN1 A;  3LEF A;  5CNW A;  1HYU A;  1SL2 B;  5ECL B;  4N11 A;  2C3T A;  4BPY A;  2LNT A;  2B1L A;  3D4T A;  4MF6 A;  2GST A;  4Z7X A;  5J41 A;  1EWX A;  13GS A;  3S9F A;  3M1G A;  4IN0 A;  5JWR B;  2YCD A;  2B6M A;  2CAQ A;  1YF0 A;  4NWY A;  2X99 A;  1VF2 A;  4G2E A;  1GTB A;  3PR8 A;  3ZYW A;  5IMC A;  3FHK A;  4GQC A;  1O73 A;  2LJR A;  5DQS A;  17GS A;  2F8F A;  1X9W B;  2OAC A;  4MF7 A;  1OKT A;  1GL8 A;  1XWA A;  3ZRD A;  2FGX A;  4YQV A;  2I81 A;  1G0T A;  5ECN B;  1X0R A;  3VI7 A;  2A2S A;  2FA8 A;  3Q74 A;  4TR3 A;  4NAX A;  1ZL9 A;  2CA8 A;  4OMV A;  1NW2 A;  2YAN A;  4EC0 A;  2O8V B;  1U3I A;  3D6I A;  3AY8 A;  4ISD A;  1TOF A;  4XCS A;  1F2E A;  2C4J A;  1GNW A;  4DVC A;  2FA4 A;  4PQI A;  4WXT A;  2WS2 A;  3DML A;  5IO2 A;  3F3Q A;  5EPF A;  5ID2 A;  4IP6 A;  2X8H A;  3TJJ A;  2J23 A;  4NXI A;  4PNG A;  2NDO A;  2P5Q A;  3TKQ A;  3IK9 A;  1S3D A;  3G7J A;  4V2N A;  2IFQ B;  5D73 A;  3CBU A;  5A4V A;  3GST A;  3K8N A;  4IW9 A;  3ZIT A;  1WRY A;  4HU9 A;  1W4V A;  3BCK A;  2AB6 A;  2C80 A;  4ZIJ A;  3IA1 A;  4EO3 A;  2X64 A;  3EU4 A;  1BED A;  3P8W A;  2H66 A;  2C0D A;  3KMO A;  1FO5 A;  2LV3 A;  3GRX A;  2YJ7 A;  1PD2 1;  5ELA A;  2B3S A;  1FOV A;  2HZE B;  4DEJ A;  3DYR A;  2MBS A;  4O32 A;  3KZQ A;  1GTA A;  2PVQ A;  1TK0 B;  4JR6 A;  3ZLP A;  3H8Q A;  2R6K A;  2HNL A;  3L9S A;  2DML A;  4POB A;  1Z7R A;  4MH2 A;  5H5R A;  2GQL A;  1EOG A;  5G2Z A;  4AJ6 A;  3APS A;  3TKS E;  4CHS A;  2X8G A;  2H0G A;  3F63 A;  1SK1 A;  3D22 A;  1QXH A;  1Z7P A;  3ZML A;  4I2T A;  4TVE A;  2DJJ A;  4WF4 A;  1CQG A;  1ZGN A;  4IQA A;  2VD0 A;  4HJM A;  4KA0 A;  4ZB6 A;  1ERV A;  4ZB9 A;  4JR4 A;  3APQ A;  1TJD A;  1GSY A;  3O76 A;  3HYP A;  4ZXG A;  1FG4 A;  5D9T A;  2E7P A;  2H76 A;  2WGR A;  5L71 A;  1PL2 A;  1GTI A;  3ISO A;  1JHB A;  4JU5 A;  1HNA A;  1GSS A;  3E3E A;  2V2G A;  3C71 A;  4MDC A;  4NV2 A;  1XW5 A;  3TDG A;  3Q6O A;  4FIW A;  3KM6 A;  1FHE A;  1AQX A;  1U6T A;  2HXK A;  3RDW A;  2CX3 A;  4GXZ A;  4K0G A;  3F6D A;  2G0F A;  3O6T A;  3ZFB A;  2IIY A;  4KND A;  1SD8 A;  5J3R A;  1K3O A;  3P7X A;  1V57 A;  1V2A A;  2IMI A;  3BCI A;  3L9V A;  2D2Z A;  1SJI A;  4BA7 A;  2VLT A;  4TN8 A;  1O6J A;  6GSW A;  3GUR A;  3GKX A;  1XFL A;  4AGS A;  1NHO A;  1VGL A;  2GSS A;  4MAB A;  3C7M A;  2TRC P;  4V1A g;  1Z6M A;  2H74 A;  2OBK A;  1BQ7 A;  1DBY A;  4X43 A;  3IPZ A;  4KSO A;  2MMN A;  1A0F A;  5AGY A;  1K0D A;  2YWN A;  4NMU A;  2DIY A;  4O5R A;  2AJQ B;  1V98 A;  2IPA A;  12GS A;  4HZ2 A;  1XXU A;  5AIX A;  2VCX A;  4KCE A;  5GST A;  1OE8 A;  4K2D A;  5ECI B;  4TW5 A;  3IAS 2;  2VUP A;  5DVB A;  4LLR A;  3DVW A;  4DSS B;  3EE2 A;  2AHE A;  2RUE A;  2H72 A;  1T3B A;  5C00 A;  3VUR A;  5F8B A;  14GS A;  5CYY A;  4XS4 B;  5JWO B;  2H6Z A;  4EE0 A;  2YV7 A;  3UEM A;  4GWR A;  5D96 A;  1DE1 A;  4MJA A;  1FW1 A;  1LJR A;  4BVX A;  3LGC A;  4AF2 A;  1S3C A;  5IO0 A;  1A2M A;  4MZC A;  1KEB A;  3EYT A;  3LYP A;  3A2X A;  2XBQ A;  1FVJ A;  3IHQ A;  2DJK A;  2MMO A;  2KHP A;  1K0A A;  3FR3 A;  5IIZ A;  4K8M A;  4EDZ A;  4DSR A;  1BX9 A;  2EIQ A;  2OKA A;  3SBC A;  3VPQ A;  1FB6 A;  3GV1 A;  6GST A;  2YP6 A;  4KCA A;  3CMI A;  3FR6 A;  3ZIJ A;  2H71 A;  1O7U A;  4F2I A;  2YZH A;  2JAC A;  5CRE A;  4YQM A;  3I6A A;  2L5O A;  1T4Z A;  1F6M C;  4MZB A;  4PGT A;  3ZMK A;  2DIZ A;  3CRT A;  3FKF A;  1R7H A;  1M7T A;  4CDO A;  1U88 A;  1GSF A;  4ACS A;  5DQY A;  4K0N A;  2LQO A;  3EC3 A;  4MH3 A;  1FAA A;  3HD5 A;  1X9S B;  1QGV A;  1TRU A;  3DKS A;  5AIS A;  1M0U A;  3QCP A;  4F03 A;  4L0W A;  1ST9 A;  3IDV A;  5CP1 A;  3FZ4 A;  3KGK A;  3ZL5 A;  6GSY A;  1O85 A;  1THO A;  2C0E A;  1XIY A;  4XTS A;  4J2F A;  2H6Y A;  2LNS A;  2GTU A;  4JED A;  1R26 A;  1LU4 A;  3CSJ A;  4MJC A;  6GSV A;  4IP1 A;  1ERW A;  4EUY A;  2GT5 A;  2RM6 A;  4TR1 A;  1QMV A;  2EIR A;  4MK3 A;  1V40 A;  3HVX A;  2FNO A;  4MZW A;  2VM2 A;  4ZBB A;  1WJK A;  1H4O A;  2L5L A;  5DAK A;  5DCG A;  3W8S A;  5HFK A;  4K7I A;  1M9B A;  1XCC A;  2FWG A;  3US3 A;  3WT1 A;  2JU5 A;  3Q18 A;  1GRX A;  6GSU A;  1J0F A;  4I97 A;  8GSS A;  1PMT A;  4K6X A;  1MEK A;  5CRW A;  2I4A A;  2CZ2 A;  2H75 A;  1I5G A;  2NBS A;  1K3Y A;  4HUA A;  4YQU A;  5COH A;  4PUR A;  1GTU A;  2WFC A;  3TJG A;  1WP0 A;  4ZIL A;  2H1G A;  1AQV A;  2O89 A;  1EZK A;  1O81 A;  1TU7 A;  3CTF A;  1WIK A;  2MBT A;  3MDK A;  1KTE A;  3G7Y A;  3QAV A;  1F3A A;  3GL3 A;  3LJR A;  4WR4 A;  4TOP A;  3QOU A;  5EY6 A;  4G9H A;  5DAL B;  1YQ1 A;  3DGQ A;  4PX1 A;  3FYG A;  4BL7 A;  1GUM A;  6GSS A;  4TXV A;  2G2Q A;  3DEX A;  3TJK A;  4IS0 A;  1PSQ A;  4HU7 A;  3UBK A;  4ML1 A;  4ML6 A;  1OC9 B;  5IOX A;  5H5Q A;  2A4V A;  4FYC A;  3UL3 A;  5LCZ A;  4KB3 A;  5G1L A;  5KN0 A;  3GHA A;  3M3M A;  3ME7 A;  2REM A;  1AUC A;  2GQM A;  2OE0 A;  4KW6 A;  2RM5 A;  2EC4 A;  4WKW A;  5GAP D;  2V41 A;  2VIM A;  2F3M A;  2DBC A;  4KAE A;  9GSS A;  2L4C A;  1T1V A;  4FH8 A;  3GKN A;  2H19 A;  2XPE A;  2GZZ A;  2DLX A;  4IJI A;  1JZR A;  1VF3 A;  3E0U A;  3KH7 A;  3KTL A;  2DJ3 A;  3A2W A;  2XC2 A;  3WD6 A;  1U3A A;  2PU9 C;  3WGE A;  4XS6 A;  4POK A;  3CRU A;  1TKD B;  5CAX A;  1XZO A;  3C73 A;  1DE2 A;  3D4M A;  2DJ1 A;  2GVP A;  6GSX A;  1EGR A;  3GTU B;  4PNF A;  3L78 A;  3VWX A;  3LSZ A;  2HRN A;  1IYI A;  2V6O A;  2PVO C;  3F8U A;  2LEG A;  4ZBD A;  2FWF A;  4K9Z A;  1T8E B;  3KCM A;  1YF1 A;  4Q5R A;  1JZO A;  2B7J A;  3U5R E;  1TI3 A;  1YJ6 A;  3GMF A;  1PN9 A;  1TXX A;  3RHC A;  5KN3 A;  3HKR A;  5B6N A;  4TR4 A;  2H73 A;  4GTU A;  3HDC A;  3E9J B;  1A23 A;  5J9C A;  3L4N A;  4N0Z A;  2VL3 A;  4HQZ A;  1TDI A;  4IGJ A;  3ZZX A;  3C8E A;  1OC8 A;  2B5E A;  2K8S A;  1AIU A;  2LTK A;  3WGX A;  4MLY A;  1QQ2 A;  4E8H A;  4FYB A;  1SJZ A;  3IK7 A;  1RQM A;  3A2V A;  4E8E A;  2GSQ A;  1ZYQ B;  5ID2 B;  3F6F A;  4QQ7 A;  1XW9 A;  4NPB A;  4Q5F A;  1N8J A;  5ELG A;  2VCV A;  2CVB A;  2MYG A;  5J9B A;  1W89 A;  1HNC A;  4GRF A;  2HT9 A;  1PRX A;  2JAD A;  2VL2 A;  2C3Q A;  4HI7 A;  2NTO A;  2PN8 A;  1X5C A;  1X5E A;  3IC4 A;  3RPN A;  3W8J A;  4MA9 A;  1A2L A;  5HQP A;  4YAV A;  4RQR A;  3M0F A;  2QSI A;  2OE3 A;  2CAI A;  2BMX A;  2LS5 A;  4KH7 A;  3KXO A;  1XWC A;  3G7I A;  1SD9 A;  2HFD A;  3GL5 A;  2HE3 A;  4MP4 A;  3NOF A;  4TXO A;  2F9S A;  5B8A A;  2O87 A;  3SWL A;  4IVF A;  1R5P A;  3HCZ A;  2PER A;  2OA7 A;  3G9B A;  3GA4 A;  2CV4 A;  2H1A A;  2O85 A;  3CYN A;  19GS A;  5INY A;  2HSY A;  4WBR D;  4I6X A;  1EV9 A;  1ON4 A;  3UBL A;  2VLV A;  3EVI A;  3ZRE A;  3WGD A;  2LRC A;  4J57 E;  2LST A;  4L5O A;  1K0O A;  1UA5 A;  2WRT A;  5B6M A;  1EEJ A;  2VLU A;  2CZ3 A;  4GLT A;  3FW2 A;  1YEX A;  4I5Q A;  5ECR B;  3U6V A;  2DJ0 A;  3DWV A; 
#chains in the Genus database with same CATH topology
 4I8B A;  2ZNM A;  4EIQ A;  2K18 A;  2H01 A;  4X1U A;  3LXT A;  2VO4 A;  3I43 A;  1EOH A;  4EDY A;  4V2L A;  4GF0 A;  5ECQ B;  2LQQ A;  4H86 A;  4N30 A;  3ZVJ D;  3EMX A;  3GFK A;  3KD0 A;  1FVK A;  1ACV A;  2JZT A;  3V1W A;  3FY7 A;  4MPF A;  1SYX A;  3HJP A;  1M2A A;  3VI5 A;  2I3Y A;  3QFB C;  5IOW A;  3KP8 A;  4EXJ A;  1A8Y A;  3EWL A;  4BVY A;  4L5L A;  2I9H A;  4AJ8 A;  4O7H A;  1B4Q A;  2M72 A;  4WET A;  4FQU A;  1E2Y A;  2YWI A;  3DIE A;  3GX8 A;  4MJB A;  2ES7 A;  2ALB A;  3IBH A;  4RI7 A;  2H6X A;  4L8E A;  2Z9S A;  4WR5 A;  2FUG 2;  2L59 A;  3LOR A;  2V6K A;  3M8N A;  2CX4 A;  2TRX A;  4EF0 A;  4IKH A;  4X4J A;  5KN2 A;  2NVL A;  3FK8 A;  5IMF A;  3TJF A;  2VL2 C;  1GH2 A;  1A8L A;  2FY6 A;  4KUN A;  5ECK B;  3MWH A;  5D93 A;  3HJO A;  4RI6 A;  2FHE A;  1MDJ A;  5IMV A;  3ZFL A;  4OCF A;  5HR0 A;  3J7Y b;  2C0F A;  3F4S A;  4KDX A;  5DCH A;  1UC7 A;  3FZ9 A;  4NV5 A;  4OFT A;  1DUG A;  2HZF A;  3TRX A;  3HXS A;  3TKS A;  1OC3 A;  1YY7 A;  4GSS A;  1XOA A;  3CTG A;  5AIV A;  5HR2 A;  3GKK A;  4MPG A;  4HS1 A;  5IMZ A;  4IBP A;  2VM1 A;  5CRG A;  1FB0 A;  2OBI A;  2QKE A;  1I9D A;  3GUS A;  1VF4 A;  4XRD A;  2VCW A;  4D73 B;  1GSE A;  1YEP A;  1AAZ A;  4PXO A;  2XPD A;  3EIN A;  4GST A;  4F0C A;  3IR4 A;  1ERT A;  1GLQ A;  5IQY A;  1HD2 A;  2PGT A;  3FEU A;  10GS A;  2P31 A;  3LYK A;  4X0X A;  3TOU A;  4BVX B;  1XW6 A;  5DJL A;  4HOJ A;  3DXB A;  3EMP A;  4JBB A;  1H75 A;  2BJX A;  1EEM A;  2FCH A;  3LW9 A;  5HR3 A;  2JZS A;  2IMK A;  2N5F A;  3PH9 A;  4ID0 A;  4IHU A;  1UVZ A;  4N10 A;  5H5S A;  1M9A A;  3I69 A;  3KP9 A;  4QL7 A;  3F4T A;  1J08 A;  1T00 A;  1XVQ A;  2RLI A;  2I1U A;  1TK5 B;  2QGV A;  3C1R A;  5ENU A;  3HHV A;  1G7E A;  2GQK A;  4WEY A;  2VCT A;  2YV9 A;  3QAW A;  1OYJ A;  1QFN A;  4K7N A;  3D0Z A;  2R3X A;  3R2Q A;  4POM A;  1GP1 A;  5D8I A;  11GS A;  3L0H A;  1GUL A;  3CXG A;  2HI7 A;  4JE1 A;  4K7O A;  1CQH A;  2X8C A;  1DSB A;  3UVT A;  1BG5 A;  1M2D A;  2JSY A;  2R37 A;  4ILF A;  3IHG A;  4FO5 A;  2KP2 A;  1SKS B;  1XWB A;  2WDU A;  5ECO B;  1ZOF A;  4HDE A;  2PUK C;  5B7C A;  3GNJ A;  2C0G A;  2MMZ A;  1JLV A;  1VRS D;  4CY6 A;  3H93 A;  2E0Q A;  2HRA A;  4BWQ A;  2OE1 A;  2LUS A;  3VWV A;  1BJX A;  3IRA A;  4PQ1 A;  2QC7 A;  4PUA A;  4ECJ A;  3HY2 A;  3FRC A;  2DKI A;  4MCU A;  4ULX A;  1ZYN A;  3HZ4 A;  2GSR A;  2E2G A;  1F3B A;  1AXD A;  3NZN A;  4HJ2 A;  4L0U A;  2H1D A;  2B1K A;  4XHM A;  2MMA A;  3VWW A;  3KIJ A;  5EL8 A;  1WMJ A;  5DDL A;  2KUC A;  3M9J A;  1WOU A;  1TI1 A;  1Z6N A;  3TKS C;  4ZL7 A;  1PKZ A;  1SK0 A;  2P0G A;  4WF5 A;  2L57 A;  3H79 A;  3F3R A;  3QR6 A;  3H4K A;  2JSZ A;  3A5W A;  4ECC A;  3LFL A;  5IMA A;  3KTB A;  1TRS A;  1Y6E A;  3PGT A;  4G0K A;  4OCE A;  2AAW A;  2GZP A;  2LJA A;  3HVV A;  2B7K A;  1GSU A;  1WWJ A;  2E2M A;  4KDY A;  2RUF A;  1YKA A;  1Z5Y E;  3ME8 A;  3HVS A;  2ZUP A;  4HZ4 A;  3A5I A;  3VPT A;  4MMM A;  2LKU A;  4XIH A;  1V58 A;  1GWC A;  4OD7 A;  3VFI A;  4MF5 A;  2CT6 A;  3M9K A;  1PKW A;  3WT2 A;  3GTU A;  2VOC A;  1XOB A;  7GSS A;  2LRN A;  3N9J A;  3GSS A;  2AV4 A;  1B8X A;  1B4P A;  4GCI A;  5ECS A;  2K8V A;  2LJK A;  2K9F A;  4AJ7 A;  4P3Y B;  1PN0 A;  2M46 A;  3QPM A;  18GS A;  2L6D A;  4BL7 B;  2F8A A;  4FYU A;  4PUF C;  5A5K A;  3QFA C;  5F05 A;  3ERF A;  2PBJ A;  5GSS A;  4IEL A;  2IFQ A;  3JCM L;  4DSQ A;  1T7P B;  3HA9 A;  2HLS A;  2ZCT A;  1WPI A;  1AC1 A;  3P2A A;  3PPU A;  5G5F A;  3WYW A;  2H70 A;  1GSD A;  4TR0 A;  5E4W A;  1A2J A;  4EKZ A;  3TRQ A;  2TIR A;  1TRV A;  4KDU A;  1MD4 A;  1R5A A;  1MDI A;  3UIW A;  5G30 A;  2HZE A;  2AUV A;  4LMV A;  3IAM 2;  2GDR A;  4IQ1 A;  3ZVJ A;  1TP9 A;  3FR9 A;  2IMD A;  3EU3 A;  2YOI A;  1ZYE A;  1J9B A;  2K6V A;  1C72 A;  3D5J A;  1R4W A;  1PX6 A;  4BWS A;  5FT3 A;  5ECH B;  2DJ2 A;  3EUR A;  2CVD A;  2VAF A;  5FHI A;  2HSH A;  1F9M A;  5J5N A;  5HFG A;  3RHB A;  3P90 A;  4TKY A;  5DJM A;  4XRA A;  3FZ5 A;  2JL4 A;  2P5R A;  1OAZ A;  3L9U A;  2XHF A;  1GSQ A;  3LG6 A;  1JZD A;  2KP1 A;  2WB9 A;  2GGT A;  1E6B A;  5A4W A;  1B9X C;  4MJE A;  2YNX A;  3RBT A;  5DBQ A;  1TRW A;  1ERU A;  3UAP A;  1ILO A;  3NIV A;  1ZCP A;  1GUH A;  2KLX A;  2OAD A;  2A2R A;  1M3I A;  5CO3 A;  4PQH A;  1KNG A;  1Y25 A;  1A24 A;  1T4Y A;  5CRD A;  2YWM A;  2HYX A;  2YZU A;  5D9V A;  4KSM A;  2N5A A;  4N0V A;  4OFN A;  5KOX A;  1M99 A;  2F51 A;  3LWA A;  1SEN A;  1PX7 A;  2LRT A;  4QL9 A;  3TJB A;  4XS1 A;  1EP7 A;  2NPB A;  4NHZ A;  1RW1 A;  2N5B A;  2IMF A;  4A5P A;  5G31 A;  1OVN A;  4F82 A;  2WUL A;  2EIO A;  4CW9 A;  3KJY A;  2FLS A;  4K1F A;  1XBS A;  3TOT A;  2IL3 A;  5EVO A;  3HJM A;  4CY8 A;  1YKC A;  1Z3E A;  1PA3 A;  2CQ9 A;  2FD3 A;  4V2M A;  1YDK A;  1EV4 A;  1NHY A;  3TGZ A;  4OO4 A;  4KGI A;  1UN2 A;  2V1M A;  4BIK A;  3QAG A;  1OKD A;  1USB A;  2IJY A;  2YWO A;  4EL1 A;  1V9W A;  5LD0 A;  5LNK e;  1SYR A;  4OFM A;  4ECI A;  1M3J A;  2HSM A;  3APO A;  4TXO B;  2FWE A;  1Q98 A;  3GH6 A;  20GS A;  5B8B A;  1G6Y A;  3GX0 A;  5G5E A;  1B9Y C;  2GLR A;  4LL4 B;  3HZ8 A;  2VL9 A;  3MNG A;  2H0H A;  1GLP A;  2IWT A;  1NSW A;  3IV4 A;  1S3A A;  5J4U A;  3QDN A;  3DD3 A;  4Q5Q A;  1XPV A;  5ECP B;  2ON7 A;  4DSS A;  3CSH A;  1NM3 A;  2PPT A;  2DMM A;  3F9U A;  2X4A A;  4GSN A;  1XWK A;  5JCG A;  1GNE A;  4XS4 A;  3TRP A;  2PWJ A;  4OWY A;  2V32 A;  1XVW A;  3DVX A;  1TTZ A;  2WCI A;  1QK8 A;  3VLN A;  4HQS A;  1ZMA A;  1WE0 A;  3QMX A;  2CVK A;  2MZC A;  3UVH A;  3UMA A;  4ZL9 A;  3F4R A;  1TW9 A;  4TRX A;  3IXR A;  5F07 A;  2R5G A;  1PGT A;  4O5U A;  5GAN D;  2AYT A;  1SL1 B;  1LBK A;  4LL1 B;  1K0N A;  22GS A;  2H30 A;  3RPP A;  4BVY B;  3KEB A;  1SJ6 A;  4POL A;  3ERW A;  5ECM B;  4D73 A;  5CRH A;  5KEJ A;  5FWG A;  5E59 A;  3PIN A;  2YPM A;  1A0R P;  4G0I A;  4F9Z A;  2R2J A;  4F0B A;  1M2B A;  5C04 A;  3KMN A;  5HFI A;  4IJ3 A;  1Z9H A;  3UAR A;  1Q4J A;  3RAZ A;  2VD1 A;  3IOS A;  5IPH A;  1MD3 A;  3ZIV A;  1O8X A;  1HNB A;  4KE3 A;  3TKP A;  3OR5 A;  1EGO A;  1BAY A;  3H1N A;  2ON5 A;  2GT6 A;  1F37 A;  1HQO A;  2B5Y A;  3TB2 A;  5HR1 A;  5D9W A;  1THX A;  3O3T A;  2L6C A;  3LQ7 A;  3VK9 A;  1K0M A;  4EVM A;  2PMT A;  5F06 A;  1SKW B;  1ABA A;  3GIX A;  2DC5 A;  1G7O A;  1X5D A;  2R4V A;  4GQF A;  1PFO A;  3DRN A;  3W6G A;  1QUW A;  3J7Y k;  1K3L A;  3Q19 A;  2GS3 A;  4I2U A;  2R0C A;  4PTS A;  2H0I A;  2IME A;  2RII A;  3ERG A;  5IPG A;  4HEA 2;  1O8W A;  1URM A;  2FWH A;  1PQN A;  1GUK A;  3FZA A;  3IE3 A;  1K0C A;  4V1A p;  3I9V 2;  1B48 A;  4WBJ A;  1TK8 B;  3N5O A;  3MAK A;  1G6W A;  5JCW A;  4KX4 A;  1SU9 A;  1N2A A;  1IYH A;  1TU8 A;  3F0I A;  3QD9 A;  4ECB A;  1PL1 A;  4RUV A;  3A3T A;  4ZB8 A;  3TUE A;  5IM9 A;  3KH9 A;  5D9X A;  5A4U A;  2XBI A;  2BTO T;  4O92 A;  2WZ9 A;  1MTC A;  1BYE A;  1S3R A;  1AQW A;  2KOK A;  2GZY A;  3UOM A;  1RK4 A;  3VWU A;  1SK2 A;  1SKR B;  4JRR A;  3TKR A;  3GH9 A;  1KBN A;  5KOW A;  1YZX A;  4LMW A;  3C1S A;  2JZR A;  4Q5N A;  4ZL8 A;  3BD2 A;  2R0G A;  2YJH A;  2WJU A;  3CSI A;  1EP8 A;  1SL0 B;  2YN1 A;  2VCQ A;  3MSZ A;  5DAL A;  1ZZY A;  2QA2 A;  2J9H A;  1K0B A;  1ML6 A;  5ABR A;  4ZBA A;  2H1B A;  2C3N A;  2M80 A;  2B5X A;  1OE7 A;  5F0G A;  4OO5 A;  4TR1 B;  1MDK A;  3GN3 A;  4ICY A;  1JLW A;  5JWQ B;  5GZZ B;  1OC9 A;  3GYK A;  4YAP A;  2H8L A;  5DAK B;  2OJL A;  3D21 A;  3BJ5 A;  3LXZ A;  2IN3 A;  2C1Y A;  3ED3 A;  5JCU A;  4RQX A;  4G19 A;  3BOA A;  1X9M B;  1JFU A;  1AW9 A;  2R0P A;  2DSA A;  4K2X A;  5G1K A;  2VCZ A;  1XWG A;  4YH2 A;  16GS A;  2L4Q A;  2O7K A;  3EPT A;  4NHW A;  3GKM A;  1ZYP A;  3BBY A;  5IMD A;  3ZTL A;  1VF1 A;  4JZQ A;  4G10 A;  5AN1 A;  2C8U A;  4J56 E;  3TCO A;  3UJ1 A;  2HRF A;  4LA1 A;  1U87 A;  1JZW A;  5KN1 A;  3LEF A;  5CNW A;  1HYU A;  1SL2 B;  5ECL B;  4N11 A;  2C3T A;  4BPY A;  2LNT A;  2B1L A;  3D4T A;  4MF6 A;  2GST A;  4Z7X A;  5J41 A;  1EWX A;  13GS A;  4EIP A;  3S9F A;  3M1G A;  4IN0 A;  5JWR B;  2YCD A;  2B6M A;  2CAQ A;  1YF0 A;  4NWY A;  2X99 A;  1VF2 A;  4G2E A;  1GTB A;  3PR8 A;  3ZYW A;  5IMC A;  3FHK A;  4GQC A;  1O73 A;  2LJR A;  5DQS A;  17GS A;  2F8F A;  1X9W B;  2OAC A;  4MF7 A;  4K5R A;  1OKT A;  1GL8 A;  1XWA A;  3ZRD A;  2FGX A;  4O5Q A;  4YQV A;  2I81 A;  1G0T A;  5ECN B;  1X0R A;  3FMW A;  3VI7 A;  2A2S A;  2FA8 A;  3Q74 A;  4TR3 A;  4NAX A;  1ZL9 A;  2CA8 A;  4OMV A;  1NW2 A;  2YAN A;  4EC0 A;  2O8V B;  1U3I A;  3D6I A;  3AY8 A;  4ISD A;  1TOF A;  4XCS A;  1F2E A;  2C4J A;  1GNW A;  4DVC A;  2FA4 A;  4PQI A;  4WXT A;  2WS2 A;  3DML A;  5IO2 A;  3F3Q A;  4YKG A;  5EPF A;  5ID2 A;  4IP6 A;  2X8H A;  3TJJ A;  2J23 A;  4NXI A;  4PNG A;  2NDO A;  2P5Q A;  3TKQ A;  3IK9 A;  1S3D A;  3G7J A;  4V2N A;  2IFQ B;  5D73 A;  3CBU A;  5A4V A;  3GST A;  3K8N A;  4IW9 A;  3ZIT A;  4G0L A;  1WRY A;  4HU9 A;  1W4V A;  4YKF A;  3BCK A;  2AB6 A;  2C80 A;  4ZIJ A;  3IA1 A;  4EO3 A;  2X64 A;  3EU4 A;  1BED A;  3P8W A;  2H66 A;  2C0D A;  3KMO A;  1FO5 A;  2LV3 A;  3GRX A;  2YJ7 A;  1PD2 1;  5ELA A;  2B3S A;  1FOV A;  2HZE B;  4DEJ A;  3DYR A;  2MBS A;  4O32 A;  3KZQ A;  1GTA A;  2PVQ A;  1TK0 B;  4JR6 A;  3ZLP A;  3H8Q A;  2R6K A;  2HNL A;  3L9S A;  2DML A;  4POB A;  1Z7R A;  4MH2 A;  5H5R A;  2GQL A;  1EOG A;  5G2Z A;  4AJ6 A;  2A4H A;  3APS A;  3TKS E;  4CHS A;  2X8G A;  4Z2T A;  2H0G A;  3F63 A;  1SK1 A;  3D22 A;  1QXH A;  1Z7P A;  3ZML A;  4I2T A;  4TVE A;  2DJJ A;  4WF4 A;  1CQG A;  1ZGN A;  4IQA A;  2VD0 A;  4HJM A;  4KA0 A;  4ZB6 A;  1ERV A;  4ZB9 A;  4JR4 A;  3APQ A;  1TJD A;  1GSY A;  3O76 A;  3HYP A;  4ZXG A;  1FG4 A;  5D9T A;  2E7P A;  2H76 A;  2WGR A;  5L71 A;  4USS A;  1PL2 A;  1GTI A;  3ISO A;  1JHB A;  4JU5 A;  1HNA A;  1GSS A;  3E3E A;  2V2G A;  3R3E A;  3C71 A;  4MDC A;  4NV2 A;  1XW5 A;  3TDG A;  3Q6O A;  4FIW A;  3KM6 A;  1FHE A;  1AQX A;  1U6T A;  2HXK A;  3RDW A;  2CX3 A;  4GXZ A;  4K0G A;  3F6D A;  2G0F A;  3O6T A;  3ZFB A;  2IIY A;  4KND A;  1SD8 A;  5J3R A;  1K3O A;  3P7X A;  4K5S A;  1V57 A;  1V2A A;  2IMI A;  3BCI A;  3L9V A;  2D2Z A;  1SJI A;  4BA7 A;  2VLT A;  4TN8 A;  1O6J A;  6GSW A;  3GUR A;  3GKX A;  1XFL A;  4AGS A;  1NHO A;  1VGL A;  2GSS A;  2QA1 A;  4MAB A;  3C7M A;  2TRC P;  5BMU A;  4V1A g;  1Z6M A;  2H74 A;  2OBK A;  1BQ7 A;  1DBY A;  4X43 A;  3IPZ A;  4KSO A;  2MMN A;  1A0F A;  5AGY A;  1K0D A;  2YWN A;  4NMU A;  2DIY A;  4O5R A;  2AJQ B;  1V98 A;  2IPA A;  12GS A;  4HZ2 A;  1XXU A;  5AIX A;  2VCX A;  4KCE A;  5GST A;  1OE8 A;  4K2D A;  5ECI B;  4TW5 A;  3IAS 2;  2VUP A;  5DVB A;  4LLR A;  3DVW A;  4DSS B;  3EE2 A;  2AHE A;  2RUE A;  2H72 A;  1T3B A;  5C00 A;  3VUR A;  5F8B A;  14GS A;  5CYY A;  4XS4 B;  5JWO B;  2H6Z A;  4EE0 A;  2YV7 A;  3UEM A;  4GWR A;  5D96 A;  1DE1 A;  4MJA A;  1FW1 A;  1LJR A;  4BVX A;  3LGC A;  4AF2 A;  1S3C A;  5IO0 A;  1A2M A;  4MZC A;  1KEB A;  3EYT A;  3LYP A;  3A2X A;  2XBQ A;  1FVJ A;  3IHQ A;  2DJK A;  2MMO A;  2KHP A;  1K0A A;  3FR3 A;  5IIZ A;  4K8M A;  4EDZ A;  4DSR A;  1BX9 A;  2EIQ A;  2OKA A;  3SBC A;  3VPQ A;  1FB6 A;  3GV1 A;  6GST A;  2YP6 A;  4KCA A;  3CMI A;  3FR6 A;  3ZIJ A;  2H71 A;  1O7U A;  4F2I A;  2YZH A;  2JAC A;  5CRE A;  4YQM A;  3I6A A;  2L5O A;  2DKH A;  1T4Z A;  1F6M C;  4MZB A;  4PGT A;  3MIX A;  3ZMK A;  2DIZ A;  3CRT A;  4Z2R A;  4HSC X;  3FKF A;  2X49 A;  1R7H A;  1M7T A;  4CDO A;  1U88 A;  1GSF A;  4ACS A;  5DQY A;  4K0N A;  2LQO A;  3EC3 A;  4MH3 A;  1FAA A;  3HD5 A;  1X9S B;  1QGV A;  1TRU A;  3DKS A;  5AIS A;  1M0U A;  3QCP A;  4F03 A;  4L0W A;  1ST9 A;  3IDV A;  5CP1 A;  3FZ4 A;  3KGK A;  3ZL5 A;  6GSY A;  1O85 A;  1THO A;  2C0E A;  1XIY A;  4XTS A;  4J2F A;  2H6Y A;  2LNS A;  2GTU A;  4JED A;  1R26 A;  1LU4 A;  3CSJ A;  4MJC A;  6GSV A;  4IP1 A;  1ERW A;  4EUY A;  2GT5 A;  2RM6 A;  4TR1 A;  1QMV A;  2EIR A;  4MK3 A;  1V40 A;  3HVX A;  2FNO A;  4MZW A;  2VM2 A;  4ZBB A;  1WJK A;  3MYD A;  1H4O A;  2L5L A;  5DAK A;  5DCG A;  3W8S A;  5HFK A;  4K7I A;  1M9B A;  1XCC A;  2FWG A;  3US3 A;  3WT1 A;  2JU5 A;  3Q18 A;  1GRX A;  4KF9 A;  6GSU A;  1J0F A;  4I97 A;  8GSS A;  1PMT A;  4K6X A;  1MEK A;  5CRW A;  2I4A A;  2CZ2 A;  2H75 A;  1I5G A;  2NBS A;  1K3Y A;  4HUA A;  4YQU A;  5COH A;  4PUR A;  1GTU A;  2WFC A;  3TJG A;  1WP0 A;  4ZIL A;  2H1G A;  1AQV A;  2O89 A;  1EZK A;  1O81 A;  1TU7 A;  3CTF A;  1WIK A;  2MBT A;  3MDK A;  1KTE A;  3G7Y A;  3QAV A;  1F3A A;  3GL3 A;  3LJR A;  4WR4 A;  1FOH A;  4TOP A;  3QOU A;  5EY6 A;  4G9H A;  5DAL B;  1YQ1 A;  3DGQ A;  4PX1 A;  3FYG A;  5BRT A;  4BL7 A;  1GUM A;  6GSS A;  4TXV A;  2G2Q A;  3DEX A;  3TJK A;  4IS0 A;  1PSQ A;  4HU7 A;  3UBK A;  4ML1 A;  4ML6 A;  1OC9 B;  5IOX A;  5H5Q A;  2A4V A;  4FYC A;  3UL3 A;  5LCZ A;  4KB3 A;  5G1L A;  5KN0 A;  3GHA A;  3M3M A;  3ME7 A;  2REM A;  1AUC A;  2GQM A;  2OE0 A;  4KW6 A;  2RM5 A;  2EC4 A;  4WKW A;  5GAP D;  2V41 A;  2VIM A;  2F3M A;  2DBC A;  4KAE A;  9GSS A;  2L4C A;  1T1V A;  4FH8 A;  3GKN A;  3HVN A;  2H19 A;  2XPE A;  2GZZ A;  2DLX A;  4IJI A;  1JZR A;  1VF3 A;  3E0U A;  3KH7 A;  3KTL A;  2DJ3 A;  3CQF A;  3A2W A;  2XC2 A;  3WD6 A;  1U3A A;  2PU9 C;  3WGE A;  4XS6 A;  4POK A;  3CRU A;  2A2P A;  1TKD B;  5CAX A;  1XZO A;  3C73 A;  1DE2 A;  3D4M A;  2DJ1 A;  2GVP A;  6GSX A;  1EGR A;  3GTU B;  4PNF A;  3L78 A;  3VWX A;  3LSZ A;  2HRN A;  1IYI A;  2V6O A;  2PVO C;  3F8U A;  2LEG A;  4ZBD A;  2FWF A;  4MNN A;  4K9Z A;  3IC8 A;  1T8E B;  3KCM A;  1YF1 A;  4Q5R A;  1JZO A;  2B7J A;  3U5R E;  1TI3 A;  1YJ6 A;  3GMF A;  1PN9 A;  1TXX A;  3RHC A;  5KN3 A;  3HKR A;  5B6N A;  4TR4 A;  2H73 A;  4GTU A;  3HDC A;  3E9J B;  1A23 A;  5J9C A;  3L4N A;  4N0Z A;  2VL3 A;  4HQZ A;  1TDI A;  4IGJ A;  3ZZX A;  3C8E A;  1XG8 A;  1OC8 A;  2B5E A;  2K8S A;  1AIU A;  2LTK A;  3WGX A;  4MLY A;  1QQ2 A;  4E8H A;  4FYB A;  1SJZ A;  3IK7 A;  1RQM A;  3A2V A;  4E8E A;  2GSQ A;  1ZYQ B;  5ID2 B;  3F6F A;  4QQ7 A;  1XW9 A;  4NPB A;  4Q5F A;  1N8J A;  5ELG A;  2VCV A;  2CVB A;  2MYG A;  5J9B A;  1W89 A;  1HNC A;  4GRF A;  2HT9 A;  1PRX A;  2JAD A;  2VL2 A;  2C3Q A;  4HI7 A;  2NTO A;  2PN8 A;  1X5C A;  1X5E A;  3IC4 A;  3RPN A;  3W8J A;  4MA9 A;  1A2L A;  5HQP A;  4YAV A;  4RQR A;  3M0F A;  2QSI A;  2OE3 A;  2CAI A;  2BMX A;  2LS5 A;  4KH7 A;  3KXO A;  1XWC A;  3G7I A;  1SD9 A;  2HFD A;  3GL5 A;  2HE3 A;  4MP4 A;  3NOF A;  4TXO A;  2F9S A;  2UZ8 A;  5B8A A;  2HRK A;  2O87 A;  3SWL A;  4IVF A;  4Z2U A;  1R5P A;  3HCZ A;  2PER A;  2OA7 A;  3G9B A;  3GA4 A;  2CV4 A;  2H1A A;  2O85 A;  3CYN A;  19GS A;  5INY A;  2HSY A;  4WBR D;  4I6X A;  1EV9 A;  1ON4 A;  3UBL A;  2VLV A;  3EVI A;  3ZRE A;  3WGD A;  2LRC A;  4J57 E;  2LST A;  4L5O A;  1K0O A;  1UA5 A;  2WRT A;  5B6M A;  1EEJ A;  2VLU A;  2CZ3 A;  4GLT A;  3FW2 A;  1YEX A;  4I5Q A;  5ECR B;  3U6V A;  2DJ0 A;  3DWV A; 
#chains in the Genus database with same CATH homology
 4I8B A;  2ZNM A;  4EIQ A;  2K18 A;  2H01 A;  4X1U A;  3LXT A;  2VO4 A;  3I43 A;  1EOH A;  4EDY A;  4V2L A;  4GF0 A;  5ECQ B;  2LQQ A;  4H86 A;  4N30 A;  3ZVJ D;  3EMX A;  3GFK A;  3KD0 A;  1FVK A;  1ACV A;  2JZT A;  3V1W A;  3FY7 A;  4MPF A;  1SYX A;  3HJP A;  1M2A A;  3VI5 A;  2I3Y A;  3QFB C;  5IOW A;  3KP8 A;  4EXJ A;  1A8Y A;  3EWL A;  4BVY A;  4L5L A;  2I9H A;  4AJ8 A;  4O7H A;  1B4Q A;  2M72 A;  4WET A;  4FQU A;  1E2Y A;  2YWI A;  3DIE A;  3GX8 A;  4MJB A;  2ES7 A;  2ALB A;  3IBH A;  4RI7 A;  2H6X A;  4L8E A;  2Z9S A;  4WR5 A;  2FUG 2;  2L59 A;  3LOR A;  2V6K A;  3M8N A;  2CX4 A;  2TRX A;  4EF0 A;  4IKH A;  4X4J A;  5KN2 A;  2NVL A;  3FK8 A;  5IMF A;  3TJF A;  2VL2 C;  1GH2 A;  1A8L A;  2FY6 A;  4KUN A;  5ECK B;  3MWH A;  5D93 A;  3HJO A;  4RI6 A;  2FHE A;  1MDJ A;  5IMV A;  3ZFL A;  4OCF A;  5HR0 A;  3J7Y b;  2C0F A;  3F4S A;  4KDX A;  5DCH A;  1UC7 A;  3FZ9 A;  4NV5 A;  4OFT A;  1DUG A;  2HZF A;  3TRX A;  3HXS A;  3TKS A;  1OC3 A;  1YY7 A;  4GSS A;  1XOA A;  3CTG A;  5AIV A;  5HR2 A;  3GKK A;  4MPG A;  4HS1 A;  5IMZ A;  4IBP A;  2VM1 A;  5CRG A;  1FB0 A;  2OBI A;  2QKE A;  1I9D A;  3GUS A;  1VF4 A;  4XRD A;  2VCW A;  4D73 B;  1GSE A;  1YEP A;  1AAZ A;  4PXO A;  2XPD A;  3EIN A;  4GST A;  4F0C A;  3IR4 A;  1ERT A;  1GLQ A;  5IQY A;  1HD2 A;  2PGT A;  3FEU A;  10GS A;  2P31 A;  3LYK A;  4X0X A;  3TOU A;  4BVX B;  1XW6 A;  5DJL A;  4HOJ A;  3DXB A;  3EMP A;  4JBB A;  1H75 A;  2BJX A;  1EEM A;  2FCH A;  3LW9 A;  5HR3 A;  2JZS A;  2IMK A;  2N5F A;  3PH9 A;  4ID0 A;  4IHU A;  1UVZ A;  4N10 A;  5H5S A;  1M9A A;  3I69 A;  3KP9 A;  4QL7 A;  3F4T A;  1J08 A;  1T00 A;  1XVQ A;  2RLI A;  2I1U A;  1TK5 B;  2QGV A;  3C1R A;  5ENU A;  3HHV A;  1G7E A;  2GQK A;  4WEY A;  2VCT A;  2YV9 A;  3QAW A;  1OYJ A;  1QFN A;  4K7N A;  3D0Z A;  2R3X A;  3R2Q A;  4POM A;  1GP1 A;  5D8I A;  11GS A;  3L0H A;  1GUL A;  3CXG A;  2HI7 A;  4JE1 A;  4K7O A;  1CQH A;  2X8C A;  1DSB A;  3UVT A;  1BG5 A;  1M2D A;  2JSY A;  2R37 A;  4ILF A;  3IHG A;  4FO5 A;  2KP2 A;  1SKS B;  1XWB A;  2WDU A;  5ECO B;  1ZOF A;  4HDE A;  2PUK C;  5B7C A;  3GNJ A;  2C0G A;  2MMZ A;  1JLV A;  1VRS D;  4CY6 A;  3H93 A;  2E0Q A;  2HRA A;  4BWQ A;  2OE1 A;  2LUS A;  3VWV A;  1BJX A;  3IRA A;  4PQ1 A;  2QC7 A;  4PUA A;  4ECJ A;  3HY2 A;  3FRC A;  2DKI A;  4MCU A;  4ULX A;  1ZYN A;  3HZ4 A;  2GSR A;  2E2G A;  1F3B A;  1AXD A;  3NZN A;  4HJ2 A;  4L0U A;  2H1D A;  2B1K A;  4XHM A;  2MMA A;  3VWW A;  3KIJ A;  5EL8 A;  1WMJ A;  5DDL A;  2KUC A;  3M9J A;  1WOU A;  1TI1 A;  1Z6N A;  3TKS C;  4ZL7 A;  1PKZ A;  1SK0 A;  2P0G A;  4WF5 A;  2L57 A;  3H79 A;  3F3R A;  3QR6 A;  3H4K A;  2JSZ A;  3A5W A;  4ECC A;  3LFL A;  5IMA A;  3KTB A;  1TRS A;  1Y6E A;  3PGT A;  4G0K A;  4OCE A;  2AAW A;  2GZP A;  2LJA A;  3HVV A;  2B7K A;  1GSU A;  1WWJ A;  2E2M A;  4KDY A;  2RUF A;  1YKA A;  1Z5Y E;  3ME8 A;  3HVS A;  2ZUP A;  4HZ4 A;  3A5I A;  3VPT A;  4MMM A;  2LKU A;  4XIH A;  1V58 A;  1GWC A;  4OD7 A;  3VFI A;  4MF5 A;  2CT6 A;  3M9K A;  1PKW A;  3WT2 A;  3GTU A;  2VOC A;  1XOB A;  7GSS A;  2LRN A;  3N9J A;  3GSS A;  2AV4 A;  1B8X A;  1B4P A;  4GCI A;  5ECS A;  2K8V A;  2LJK A;  2K9F A;  4AJ7 A;  4P3Y B;  1PN0 A;  2M46 A;  3QPM A;  18GS A;  2L6D A;  4BL7 B;  2F8A A;  4FYU A;  4PUF C;  5A5K A;  3QFA C;  5F05 A;  3ERF A;  2PBJ A;  5GSS A;  4IEL A;  2IFQ A;  3JCM L;  4DSQ A;  1T7P B;  3HA9 A;  2HLS A;  2ZCT A;  1WPI A;  1AC1 A;  3P2A A;  3PPU A;  5G5F A;  3WYW A;  2H70 A;  1GSD A;  4TR0 A;  5E4W A;  1A2J A;  4EKZ A;  3TRQ A;  2TIR A;  1TRV A;  4KDU A;  1MD4 A;  1R5A A;  1MDI A;  3UIW A;  5G30 A;  2HZE A;  2AUV A;  4LMV A;  3IAM 2;  2GDR A;  4IQ1 A;  3ZVJ A;  1TP9 A;  3FR9 A;  2IMD A;  3EU3 A;  2YOI A;  1ZYE A;  1J9B A;  2K6V A;  1C72 A;  3D5J A;  1R4W A;  1PX6 A;  4BWS A;  5FT3 A;  5ECH B;  2DJ2 A;  3EUR A;  2CVD A;  2VAF A;  5FHI A;  2HSH A;  1F9M A;  5J5N A;  5HFG A;  3RHB A;  3P90 A;  4TKY A;  5DJM A;  4XRA A;  3FZ5 A;  2JL4 A;  2P5R A;  1OAZ A;  3L9U A;  2XHF A;  1GSQ A;  3LG6 A;  1JZD A;  2KP1 A;  2WB9 A;  2GGT A;  1E6B A;  5A4W A;  1B9X C;  4MJE A;  2YNX A;  3RBT A;  5DBQ A;  1TRW A;  1ERU A;  3UAP A;  1ILO A;  3NIV A;  1ZCP A;  1GUH A;  2KLX A;  2OAD A;  2A2R A;  5CO3 A;  4PQH A;  1KNG A;  1Y25 A;  1A24 A;  1T4Y A;  5CRD A;  2YWM A;  2HYX A;  2YZU A;  5D9V A;  4KSM A;  2N5A A;  4N0V A;  4OFN A;  5KOX A;  1M99 A;  2F51 A;  3LWA A;  1SEN A;  1PX7 A;  2LRT A;  4QL9 A;  3TJB A;  4XS1 A;  1EP7 A;  2NPB A;  4NHZ A;  1RW1 A;  2N5B A;  2IMF A;  4A5P A;  5G31 A;  1OVN A;  4F82 A;  2WUL A;  2EIO A;  4CW9 A;  3KJY A;  2FLS A;  4K1F A;  1XBS A;  3TOT A;  2IL3 A;  5EVO A;  3HJM A;  4CY8 A;  1YKC A;  1Z3E A;  1PA3 A;  2CQ9 A;  2FD3 A;  4V2M A;  1YDK A;  1EV4 A;  1NHY A;  3TGZ A;  4OO4 A;  4KGI A;  1UN2 A;  2V1M A;  3QAG A;  1OKD A;  1USB A;  2IJY A;  2YWO A;  4EL1 A;  1V9W A;  5LD0 A;  5LNK e;  1SYR A;  4OFM A;  4ECI A;  2HSM A;  3APO A;  4TXO B;  2FWE A;  1Q98 A;  3GH6 A;  20GS A;  5B8B A;  1G6Y A;  3GX0 A;  5G5E A;  1B9Y C;  2GLR A;  4LL4 B;  3HZ8 A;  2VL9 A;  3MNG A;  2H0H A;  1GLP A;  2IWT A;  1NSW A;  3IV4 A;  1S3A A;  5J4U A;  3QDN A;  3DD3 A;  4Q5Q A;  1XPV A;  5ECP B;  2ON7 A;  4DSS A;  3CSH A;  1NM3 A;  2PPT A;  2DMM A;  3F9U A;  2X4A A;  4GSN A;  1XWK A;  5JCG A;  1GNE A;  4XS4 A;  3TRP A;  2PWJ A;  4OWY A;  2V32 A;  1XVW A;  3DVX A;  1TTZ A;  2WCI A;  1QK8 A;  3VLN A;  4HQS A;  1ZMA A;  1WE0 A;  3QMX A;  2CVK A;  2MZC A;  3UVH A;  3UMA A;  4ZL9 A;  3F4R A;  1TW9 A;  4TRX A;  3IXR A;  5F07 A;  2R5G A;  1PGT A;  4O5U A;  5GAN D;  2AYT A;  1SL1 B;  1LBK A;  4LL1 B;  1K0N A;  22GS A;  2H30 A;  3RPP A;  4BVY B;  3KEB A;  1SJ6 A;  4POL A;  3ERW A;  5ECM B;  4D73 A;  5CRH A;  5KEJ A;  5FWG A;  5E59 A;  3PIN A;  2YPM A;  1A0R P;  4G0I A;  4F9Z A;  2R2J A;  4F0B A;  1M2B A;  5C04 A;  3KMN A;  5HFI A;  4IJ3 A;  1Z9H A;  3UAR A;  1Q4J A;  3RAZ A;  2VD1 A;  3IOS A;  5IPH A;  1MD3 A;  3ZIV A;  1O8X A;  1HNB A;  4KE3 A;  3TKP A;  3OR5 A;  1EGO A;  1BAY A;  3H1N A;  2ON5 A;  2GT6 A;  1F37 A;  1HQO A;  2B5Y A;  3TB2 A;  5HR1 A;  5D9W A;  1THX A;  3O3T A;  2L6C A;  3LQ7 A;  3VK9 A;  1K0M A;  4EVM A;  2PMT A;  5F06 A;  1SKW B;  1ABA A;  3GIX A;  2DC5 A;  1G7O A;  1X5D A;  2R4V A;  4GQF A;  3DRN A;  3W6G A;  1QUW A;  3J7Y k;  1K3L A;  3Q19 A;  2GS3 A;  4I2U A;  2R0C A;  4PTS A;  2H0I A;  2IME A;  2RII A;  3ERG A;  5IPG A;  4HEA 2;  1O8W A;  1URM A;  2FWH A;  1PQN A;  1GUK A;  3FZA A;  3IE3 A;  1K0C A;  4V1A p;  3I9V 2;  1B48 A;  4WBJ A;  1TK8 B;  3N5O A;  3MAK A;  1G6W A;  5JCW A;  4KX4 A;  1SU9 A;  1N2A A;  1IYH A;  1TU8 A;  3F0I A;  3QD9 A;  4ECB A;  1PL1 A;  4RUV A;  3A3T A;  4ZB8 A;  3TUE A;  5IM9 A;  3KH9 A;  5D9X A;  5A4U A;  2XBI A;  2BTO T;  4O92 A;  2WZ9 A;  1MTC A;  1BYE A;  1AQW A;  2KOK A;  2GZY A;  3UOM A;  1RK4 A;  3VWU A;  1SK2 A;  1SKR B;  4JRR A;  3TKR A;  3GH9 A;  1KBN A;  5KOW A;  1YZX A;  4LMW A;  3C1S A;  2JZR A;  4Q5N A;  4ZL8 A;  3BD2 A;  2R0G A;  2YJH A;  2WJU A;  3CSI A;  1EP8 A;  1SL0 B;  2YN1 A;  2VCQ A;  3MSZ A;  5DAL A;  1ZZY A;  2QA2 A;  2J9H A;  1K0B A;  1ML6 A;  5ABR A;  4ZBA A;  2H1B A;  2C3N A;  2M80 A;  2B5X A;  1OE7 A;  5F0G A;  4OO5 A;  4TR1 B;  1MDK A;  3GN3 A;  4ICY A;  1JLW A;  5JWQ B;  5GZZ B;  1OC9 A;  3GYK A;  4YAP A;  2H8L A;  5DAK B;  2OJL A;  3D21 A;  3BJ5 A;  3LXZ A;  2IN3 A;  2C1Y A;  3ED3 A;  5JCU A;  4RQX A;  4G19 A;  3BOA A;  1X9M B;  1JFU A;  1AW9 A;  2R0P A;  2DSA A;  4K2X A;  5G1K A;  2VCZ A;  1XWG A;  4YH2 A;  16GS A;  2L4Q A;  2O7K A;  3EPT A;  4NHW A;  3GKM A;  1ZYP A;  3BBY A;  5IMD A;  3ZTL A;  1VF1 A;  4JZQ A;  4G10 A;  5AN1 A;  2C8U A;  4J56 E;  3TCO A;  3UJ1 A;  2HRF A;  4LA1 A;  1U87 A;  1JZW A;  5KN1 A;  3LEF A;  5CNW A;  1HYU A;  1SL2 B;  5ECL B;  4N11 A;  2C3T A;  4BPY A;  2LNT A;  2B1L A;  3D4T A;  4MF6 A;  2GST A;  4Z7X A;  5J41 A;  1EWX A;  13GS A;  4EIP A;  3S9F A;  3M1G A;  4IN0 A;  5JWR B;  2YCD A;  2B6M A;  2CAQ A;  1YF0 A;  4NWY A;  2X99 A;  1VF2 A;  4G2E A;  1GTB A;  3PR8 A;  3ZYW A;  5IMC A;  3FHK A;  4GQC A;  1O73 A;  2LJR A;  5DQS A;  17GS A;  2F8F A;  1X9W B;  2OAC A;  4MF7 A;  4K5R A;  1OKT A;  1GL8 A;  1XWA A;  3ZRD A;  2FGX A;  4O5Q A;  4YQV A;  2I81 A;  1G0T A;  5ECN B;  1X0R A;  3FMW A;  3VI7 A;  2A2S A;  2FA8 A;  3Q74 A;  4TR3 A;  4NAX A;  1ZL9 A;  2CA8 A;  4OMV A;  1NW2 A;  2YAN A;  4EC0 A;  2O8V B;  1U3I A;  3D6I A;  3AY8 A;  4ISD A;  1TOF A;  4XCS A;  1F2E A;  2C4J A;  1GNW A;  4DVC A;  2FA4 A;  4PQI A;  4WXT A;  2WS2 A;  3DML A;  5IO2 A;  3F3Q A;  4YKG A;  5EPF A;  5ID2 A;  4IP6 A;  2X8H A;  3TJJ A;  2J23 A;  4NXI A;  4PNG A;  2NDO A;  2P5Q A;  3TKQ A;  3IK9 A;  1S3D A;  3G7J A;  4V2N A;  2IFQ B;  5D73 A;  3CBU A;  5A4V A;  3GST A;  3K8N A;  4IW9 A;  3ZIT A;  4G0L A;  1WRY A;  4HU9 A;  1W4V A;  4YKF A;  3BCK A;  2AB6 A;  2C80 A;  4ZIJ A;  3IA1 A;  4EO3 A;  2X64 A;  3EU4 A;  1BED A;  3P8W A;  2H66 A;  2C0D A;  3KMO A;  1FO5 A;  2LV3 A;  3GRX A;  2YJ7 A;  1PD2 1;  5ELA A;  2B3S A;  1FOV A;  2HZE B;  4DEJ A;  3DYR A;  2MBS A;  4O32 A;  3KZQ A;  1GTA A;  2PVQ A;  1TK0 B;  4JR6 A;  3ZLP A;  3H8Q A;  2R6K A;  2HNL A;  3L9S A;  2DML A;  4POB A;  1Z7R A;  4MH2 A;  5H5R A;  2GQL A;  1EOG A;  5G2Z A;  4AJ6 A;  2A4H A;  3APS A;  3TKS E;  4CHS A;  2X8G A;  4Z2T A;  2H0G A;  3F63 A;  1SK1 A;  3D22 A;  1QXH A;  1Z7P A;  3ZML A;  4I2T A;  4TVE A;  2DJJ A;  4WF4 A;  1CQG A;  1ZGN A;  4IQA A;  2VD0 A;  4HJM A;  4KA0 A;  4ZB6 A;  1ERV A;  4ZB9 A;  4JR4 A;  3APQ A;  1TJD A;  1GSY A;  3O76 A;  3HYP A;  4ZXG A;  1FG4 A;  5D9T A;  2E7P A;  2H76 A;  2WGR A;  5L71 A;  4USS A;  1PL2 A;  1GTI A;  3ISO A;  1JHB A;  4JU5 A;  1HNA A;  1GSS A;  3E3E A;  2V2G A;  3R3E A;  3C71 A;  4MDC A;  4NV2 A;  1XW5 A;  3TDG A;  3Q6O A;  4FIW A;  3KM6 A;  1FHE A;  1AQX A;  1U6T A;  2HXK A;  3RDW A;  2CX3 A;  4GXZ A;  4K0G A;  3F6D A;  2G0F A;  3O6T A;  3ZFB A;  2IIY A;  4KND A;  1SD8 A;  5J3R A;  1K3O A;  3P7X A;  4K5S A;  1V57 A;  1V2A A;  2IMI A;  3BCI A;  3L9V A;  2D2Z A;  1SJI A;  4BA7 A;  2VLT A;  4TN8 A;  1O6J A;  6GSW A;  3GUR A;  3GKX A;  1XFL A;  4AGS A;  1NHO A;  1VGL A;  2GSS A;  2QA1 A;  4MAB A;  3C7M A;  2TRC P;  5BMU A;  4V1A g;  1Z6M A;  2H74 A;  2OBK A;  1BQ7 A;  1DBY A;  4X43 A;  3IPZ A;  4KSO A;  2MMN A;  1A0F A;  5AGY A;  1K0D A;  2YWN A;  4NMU A;  2DIY A;  4O5R A;  2AJQ B;  1V98 A;  2IPA A;  12GS A;  4HZ2 A;  1XXU A;  5AIX A;  2VCX A;  4KCE A;  5GST A;  1OE8 A;  4K2D A;  5ECI B;  4TW5 A;  3IAS 2;  2VUP A;  5DVB A;  4LLR A;  3DVW A;  4DSS B;  3EE2 A;  2AHE A;  2RUE A;  2H72 A;  1T3B A;  5C00 A;  3VUR A;  5F8B A;  14GS A;  5CYY A;  4XS4 B;  5JWO B;  2H6Z A;  4EE0 A;  2YV7 A;  3UEM A;  4GWR A;  5D96 A;  1DE1 A;  4MJA A;  1FW1 A;  1LJR A;  4BVX A;  3LGC A;  4AF2 A;  1S3C A;  5IO0 A;  1A2M A;  4MZC A;  1KEB A;  3EYT A;  3LYP A;  3A2X A;  2XBQ A;  1FVJ A;  3IHQ A;  2DJK A;  2MMO A;  2KHP A;  1K0A A;  3FR3 A;  5IIZ A;  4K8M A;  4EDZ A;  4DSR A;  1BX9 A;  2EIQ A;  2OKA A;  3SBC A;  3VPQ A;  1FB6 A;  3GV1 A;  6GST A;  2YP6 A;  4KCA A;  3CMI A;  3FR6 A;  3ZIJ A;  2H71 A;  1O7U A;  4F2I A;  2YZH A;  2JAC A;  5CRE A;  4YQM A;  3I6A A;  2L5O A;  2DKH A;  1T4Z A;  1F6M C;  4MZB A;  4PGT A;  3MIX A;  3ZMK A;  2DIZ A;  3CRT A;  4Z2R A;  3FKF A;  2X49 A;  1R7H A;  1M7T A;  4CDO A;  1U88 A;  1GSF A;  4ACS A;  5DQY A;  4K0N A;  2LQO A;  3EC3 A;  4MH3 A;  1FAA A;  3HD5 A;  1X9S B;  1QGV A;  1TRU A;  3DKS A;  5AIS A;  1M0U A;  3QCP A;  4F03 A;  4L0W A;  1ST9 A;  3IDV A;  5CP1 A;  3FZ4 A;  3KGK A;  3ZL5 A;  6GSY A;  1O85 A;  1THO A;  2C0E A;  1XIY A;  4XTS A;  4J2F A;  2H6Y A;  2LNS A;  2GTU A;  4JED A;  1R26 A;  1LU4 A;  3CSJ A;  4MJC A;  6GSV A;  4IP1 A;  1ERW A;  4EUY A;  2GT5 A;  2RM6 A;  4TR1 A;  1QMV A;  2EIR A;  4MK3 A;  1V40 A;  3HVX A;  2FNO A;  4MZW A;  2VM2 A;  4ZBB A;  1WJK A;  3MYD A;  1H4O A;  2L5L A;  5DAK A;  5DCG A;  3W8S A;  5HFK A;  4K7I A;  1M9B A;  1XCC A;  2FWG A;  3US3 A;  3WT1 A;  2JU5 A;  3Q18 A;  1GRX A;  4KF9 A;  6GSU A;  1J0F A;  4I97 A;  8GSS A;  1PMT A;  4K6X A;  1MEK A;  5CRW A;  2I4A A;  2CZ2 A;  2H75 A;  1I5G A;  2NBS A;  1K3Y A;  4HUA A;  4YQU A;  5COH A;  4PUR A;  1GTU A;  2WFC A;  3TJG A;  1WP0 A;  4ZIL A;  2H1G A;  1AQV A;  2O89 A;  1EZK A;  1O81 A;  1TU7 A;  3CTF A;  1WIK A;  2MBT A;  3MDK A;  1KTE A;  3G7Y A;  3QAV A;  1F3A A;  3GL3 A;  3LJR A;  4WR4 A;  1FOH A;  4TOP A;  3QOU A;  5EY6 A;  4G9H A;  5DAL B;  1YQ1 A;  3DGQ A;  4PX1 A;  3FYG A;  5BRT A;  4BL7 A;  1GUM A;  6GSS A;  4TXV A;  2G2Q A;  3DEX A;  3TJK A;  4IS0 A;  1PSQ A;  4HU7 A;  3UBK A;  4ML1 A;  4ML6 A;  1OC9 B;  5IOX A;  5H5Q A;  2A4V A;  4FYC A;  3UL3 A;  5LCZ A;  4KB3 A;  5G1L A;  5KN0 A;  3GHA A;  3M3M A;  3ME7 A;  2REM A;  1AUC A;  2GQM A;  2OE0 A;  4KW6 A;  2RM5 A;  2EC4 A;  4WKW A;  5GAP D;  2V41 A;  2VIM A;  2F3M A;  2DBC A;  4KAE A;  9GSS A;  2L4C A;  1T1V A;  4FH8 A;  3GKN A;  2H19 A;  2XPE A;  2GZZ A;  2DLX A;  4IJI A;  1JZR A;  1VF3 A;  3E0U A;  3KH7 A;  3KTL A;  2DJ3 A;  3A2W A;  2XC2 A;  3WD6 A;  1U3A A;  2PU9 C;  3WGE A;  4XS6 A;  4POK A;  3CRU A;  2A2P A;  1TKD B;  5CAX A;  1XZO A;  3C73 A;  1DE2 A;  3D4M A;  2DJ1 A;  2GVP A;  6GSX A;  1EGR A;  3GTU B;  4PNF A;  3L78 A;  3VWX A;  3LSZ A;  2HRN A;  1IYI A;  2V6O A;  2PVO C;  3F8U A;  2LEG A;  4ZBD A;  2FWF A;  4MNN A;  4K9Z A;  3IC8 A;  1T8E B;  3KCM A;  1YF1 A;  4Q5R A;  1JZO A;  2B7J A;  3U5R E;  1TI3 A;  1YJ6 A;  3GMF A;  1PN9 A;  1TXX A;  3RHC A;  5KN3 A;  3HKR A;  5B6N A;  4TR4 A;  2H73 A;  4GTU A;  3HDC A;  3E9J B;  1A23 A;  5J9C A;  3L4N A;  4N0Z A;  2VL3 A;  4HQZ A;  1TDI A;  4IGJ A;  3ZZX A;  3C8E A;  1OC8 A;  2B5E A;  2K8S A;  1AIU A;  2LTK A;  3WGX A;  4MLY A;  1QQ2 A;  4E8H A;  4FYB A;  1SJZ A;  3IK7 A;  1RQM A;  3A2V A;  4E8E A;  2GSQ A;  1ZYQ B;  5ID2 B;  3F6F A;  4QQ7 A;  1XW9 A;  4NPB A;  4Q5F A;  1N8J A;  5ELG A;  2VCV A;  2CVB A;  2MYG A;  5J9B A;  1W89 A;  1HNC A;  4GRF A;  2HT9 A;  1PRX A;  2JAD A;  2VL2 A;  2C3Q A;  4HI7 A;  2NTO A;  2PN8 A;  1X5C A;  1X5E A;  3IC4 A;  3RPN A;  3W8J A;  4MA9 A;  1A2L A;  5HQP A;  4YAV A;  4RQR A;  3M0F A;  2QSI A;  2OE3 A;  2CAI A;  2BMX A;  2LS5 A;  4KH7 A;  3KXO A;  1XWC A;  3G7I A;  1SD9 A;  2HFD A;  3GL5 A;  2HE3 A;  4MP4 A;  3NOF A;  4TXO A;  2F9S A;  2UZ8 A;  5B8A A;  2HRK A;  2O87 A;  3SWL A;  4IVF A;  4Z2U A;  1R5P A;  3HCZ A;  2PER A;  2OA7 A;  3G9B A;  3GA4 A;  2CV4 A;  2H1A A;  2O85 A;  3CYN A;  19GS A;  5INY A;  2HSY A;  4WBR D;  4I6X A;  1EV9 A;  1ON4 A;  3UBL A;  2VLV A;  3EVI A;  3ZRE A;  3WGD A;  2LRC A;  4J57 E;  2LST A;  4L5O A;  1K0O A;  1UA5 A;  2WRT A;  5B6M A;  1EEJ A;  2VLU A;  2CZ3 A;  4GLT A;  3FW2 A;  1YEX A;  4I5Q A;  5ECR B;  3U6V A;  2DJ0 A;  3DWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...