4DSQA

Crystal structure of peroxiredoxin ahp1 from saccharomyces cerevisiae in oxidized form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
174
structure length
174
Chain Sequence
DLVNKKFPAGDYKFQYIAISQSDADSESCKMPQTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNPGTDVTVSSVESVLAHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin type-2
publication title Structural Snapshots of Yeast Alkyl Hydroperoxide Reductase Ahp1 Peroxiredoxin Reveal a Novel Two-cysteine Mechanism of Electron Transfer to Eliminate Reactive Oxygen Species
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 50
structure length 174
sequence length 174
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4dsqA00
1EWXA 4TXOA 2QC7A 1C72A 3UIWA 4EE0A 4XTSA 3NOFA 2YOIA 1EP7A 2TRCP 2HLSA 5IMZA 2HZEA 2R5GA 3R2QA 2FNOA 3GL5A 2DIZA 2VUPA 1MTCA 2NPBA 1GRXA 3GSSA 3VI7A 2C0EA 4BWQA 2XBQA 1T4YA 2GZYA 5CREA 4RUVA 2VL2C 1FVKA 1YQ1A 1YJ6A 1EOHA 1WPIA 4V2MA 1FOVA 3F4TA 2HRNA 2WCIA 4XS4A 1SU9A 2GQLA 5AGYA 4Q5RA 5IPGA 5G1KA 1CQHA 2VCWA 3LJRA 4DEJA 1N2AA 2C80A 2KUCA 2ZNMA 1GLPA 2RIIA 4TR1A 3JCML 1RK4A 4EVMA 2C0GA 1EEMA 3DMLA 1N8JA 2GSSA 2GZPA 3KD0A 3L4NA 2WZ9A 4PXOA 2YNXA 4BVXA 4MZCA 3D21A 5J5NA 1K3OA 3H79A 2R37A 3S9FA 2E7PA 4ML6A 1JHBA 1ZOFA 1AAZA 4NMUA 1B9XC 1X5CA 3US3A 3G7JA 1GNEA 3RHCA 2WS2A 2K9FA 3HVXA 5D8IA 1KBNA 1S3CA 3C7MA 3HYPA 3KM6A 1M0UA 3GH6A 1UA5A 2LQOA 4DSRA 3O76A 3F4SA 4ZL9A 2PU9C 5J41A 1F3BA 3KIJA 3BBYA 5ECMB 4HEA2 4I6XA 2LTKA 3GX8A 3P2AA 2H75A 3C73A 1UN2A 1F2EA 2C0DA 2GVPA 4MF5A 1SKSB 3LQ7A 4GQCA 2X64A 3H93A 2LRCA 5H5SA 3UMAA 4XHMA 4GXZA 2GTUA 3A5WA 4K2DA 4QL7A 1GSFA 1FVJA 1J0FA 1OC3A 5CRDA 1Y25A 3P8WA 1TTZA 1X9MB 1GUKA 3DIEA 4KE3A 3EINA 1TU7A 4P3YB 5G2ZA 2C4JA 3HVVA 1MDIA 4IW9A 1PKWA 4WF5A 1MEKA 1Q98A 3W8SA 1ERWA 3L0HA 3QMXA 4L5LA 3EMXA 2EIQA 5G5EA 2WJUA 1SJ6A 2VM2A 3LGCA 3UVHA 3TJFA 4MJBA 4YAPA 2Z9SA 2PERA 4O5RA 2KP1A 4TKYA 1XWAA 1XCCA 1BX9A 1FHEA 2ES7A 5A5KA 4G19A 3DVXA 1HNBA 2REMA 2MBTA 1QXHA 3ERGA 2PWJA 2B5YA 1BAYA 9GSSA 1O73A 1SYXA 4CW9A 1OVNA 1GSEA 4KNDA 1XVQA 4N30A 3GN3A 1PQNA 1A23A 1IYHA 22GSA 4OCFA 3F63A 1QK8A 1GSYA 1ON4A 1AXDA 3DRNA 4F82A 3HJPA 4F0BA 3TGZA 2P0GA 1ACVA 1Z6NA 1ERTA 3ZRDA 3DKSA 3WGXA 2XPEA 5C00A 2C3TA 4IHUA 4I8BA 3TKPA 4KCEA 3IK9A 5DVBA 5CYYA 6GSSA 1I5GA 1EV4A 1XZOA 4ZB6A 5ELGA 4ZILA 1EV9A 4KAEA 2MYGA 3FK8A 3H1NA 3P7XA 3O3TA 1JFUA 4AGSA 2DJJA 3FZ9A 3QAVA 1BEDA 4KSMA 2HT9A 13GSA 3FKFA 4KDYA 5JWRB 2CA8A 1SKWB 3L78A 3VWUA 2G0FA 1PA3A 4OFMA 3LG6A 1SK0A 3VWWA 4V2LA 4N0VA 1ST9A 4EF0A 2GZZA 4K7IA 5KN0A 2VO4A 1XW9A 2VCXA 4GWRA 2BMXA 5H5QA 4MA9A 2OKAA 4WETA 3F6DA 2OBIA 2DJKA 3ZZXA 2LNTA 3CRUA 1AUCA 1TDIA 4K8MA 3EMPA 2DSAA 1PGTA 2VLUA 3Q19A 3QFBC 2IMDA 2GT5A 5C04A 3VI5A 2EC4A 3IV4A 4O32A 4O92A 2ALBA 1V9WA 3ME7A 5D9TA 2DIYA 4WXTA 2NBSA 1SL0B 1W89A 4DSQA 1GUHA 1E2YA 1USBA 4K0NA 5J3RA 2H1BA 1F37A 2M80A 4FH8A 1S3AA 5FT3A 5JWQB 4ZIJA 2CAQA 5CRHA 4DVCA 4PQ1A 4WBJA 2FY6A 1PX6A 1T3BA 5COHA 2GQMA 1TKDB 3KMNA 2DMLA 3F0IA 2N5FA 2IFQA 5HR2A 5AN1A 1BYEA 2DJ3A 3GKXA 2RM5A 3ZMKA 3I6AA 10GSA 1X0RA 6GSUA 5HR3A 2GDRA 4Z7XA 1QMVA 5GZZB 1DE1A 1FB6A 2I81A 4OFTA 4MPFA 2H1AA 3QAGA 4I5QA 1A2LA 3IRAA 2J23A 4YH2A 4PQHA 2JADA 2YWNA 1A8YA 5IMFA 5B6NA 3RPPA 4POLA 5ECOB 2CX4A 4HI7A 3MAKA 2IMFA 1LBKA 4PUAA 5ECPB 3GTUA 3GX0A 2A4VA 3VPTA 1X5EA 2H74A 4KSOA 4MP4A 3ED3A 3LFLA 1SYRA 4X1UA 2VOCA 2GLRA 2L59A 3UOMA 4PNGA 1T1VA 1M9AA 1AW9A 2YWIA 3LSZA 1ZYEA 5HFKA 3CSJA 4CHSA 3SBCA 4BPYA 3QOUA 5ENUA 6GSYA 2PPTA 2VL3A 2B7JA 1A2JA 2MMZA 3TKSC 5CAXA 3ZLPA 1MD3A 4GCIA 1TRWA 3APQA 1O8WA 1FB0A 4ZXGA 5EL8A 4MZWA 1TI1A 4YQUA 3IK7A 4RI7A 2GGTA 2LQQA 1G7EA 1GUMA 3CSIA 2I1UA 2P5RA 2FA8A 4IELA 2H0GA 1DE2A 2HXKA 1YEPA 1SJZA 5DALA 4GQFA 4L5OA 2LEGA 2L6DA 5IMVA 1TRSA 1A0RP 3ZTLA 1GSDA 2JZSA 3G9BA 5F06A 3D4MA 4ZBAA 2GQKA 2H1GA 1TP9A 2PGTA 1V98A 2F3MA 4GF0A 1FW1A 4DSSB 3ZMLA 1SD8A 2YANA 4PGTA 1X9WB 5GSTA 3PGTA 3A2VA 3TJJA 1JZDA 4EKZA 2B5EA 5L71A 5ECKB 4IP6A 5HFIA 1GNWA 3FR3A 3D0ZA 2VD1A 2LJKA 3MSZA 2HFDA 3QR6A 4MF7A 4RQXA 1W4VA 1RQMA 2RM6A 4WEYA 2LV3A 2KP2A 2FWGA 2XPDA 2N5BA 1YKCA 3D5JA 1X9SB 5F0GA 5CP1A 4WR5A 2JZTA 1FG4A 2HNLA 4NHZA 2BJXA 1K0BA 1BG5A 2D2ZA 2X99A 1FAAA 3KMOA 1TK5B 4TW5A 2CQ9A 3IC4A 3RPNA 3HD5A 3SWLA 3GKKA 4DSSA 1XOAA 2V32A 1AIUA 3KP8A 1GH2A 2YWOA 5LD0A 3TDGA 4HDEA 4X43A 4NWYA 4IKHA 3WD6A 5IMCA 1Z3EA 3NIVA 1TU8A 20GSA 2RUEA 5ID2A 4POKA 1WP0A 1WJKA 4Q5QA 2E2GA 5IO2A 2PUKC 2OE0A 5EPFA 1M2DA 3EYTA 3IPZA 1G7OA 5D9WA 2FWEA 2H72A 4MK3A 5DAKB 3CYNA 3TRXA 3W6GA 5INYA 16GSA 3M8NA 5GSSA 4L8EA 3TJGA 1WWJA 2LSTA 2GS3A 4IJ3A 3QFAC 4ECIA 3FY7A 5HR1A 2FLSA 1OC9B 2DC5A 2H66A 2L5LA 4YQMA 1TRVA 1PSQA 6GSTA 2LKUA 2O85A 2CV4A 1ERVA 4MZBA 1A0FA 5IPHA 5JWOB 2MMAA 2YV7A 3F8UA 5DDLA 2MZCA 2DMMA 4LLRA 2DLXA 4ECBA 2PVQA 4GLTA 1WE0A 3RBTA 4GSNA 14GSA 3IHQA 3UBKA 4EC0A 3K8NA 2CX3A 3TOTA 4TVEA 2I9HA 1Q4JA 1QQ2A 3G7YA 1QGVA 4ILFA 4YQVA 2ZUPA 1OKDA 2CVKA 1DUGA 4EDYA 4XS6A 3FYGA 2YP6A 1M99A 3M0FA 5IOWA 3ZFBA 1R5AA 1GLQA 1EGOA 4IS0A 2H70A 1Z9HA 1XBSA 2AJQB 1VGLA 1QFNA 1GTUA 3LYPA 1J08A 1ILOA 1KTEA 2E2MA 3IAM2 5IIZA 3QDNA 3KP9A 1XWGA 1DSBA 1KNGA 2IL3A 3PR8A 4MLYA 1ERUA 1GSSA 3QD9A 4XIHA 5D9XA 4V1Ap 3KH7A 1Z7PA 1O85A 1TI3A 5AISA 2FCHA 4E8EA 3RAZA 1Z6MA 1GTBA 2LUSA 4I2UA 1U3IA 1HQOA 3CMIA 4XS1A 5GAPD 4IBPA 1R4WA 2MBSA 4NXIA 5J9BA 2K18A 1ZL9A 2BTOT 2V6OA 4NV2A 3DWVA 2B6MA 2VCZA 4GTUA 3A2WA 2H01A 1URMA 4HZ4A 2WGRA 2E0QA 4HZ2A 1K0NA 2AYTA 3IA1A 2VAFA 3GA4A 4EDZA 4AF2A 1YEXA 2JSYA 3LYKA 3EC3A 1ABAA 1JLWA 1O8XA 2CVBA 1GWCA 3VURA 3GNJA 4PURA 2IMEA 1OKTA 1Z7RA 4TR4A 17GSA 4TR0A 2B1KA 4ECJA 4TR3A 3ERWA 3HKRA 4I2TA 1CQGA 5FWGA 4NV5A 3GHAA 1MDKA 1H4OA 2RUFA 3KZQA 2V41A 4F0CA 4XRAA 5ECIB 2CAIA 5A4WA 2B1LA 3C71A 1YKAA 3IDVA 4H86A 4G10A 4MPGA 4HJ2A 4ZL8A 1SD9A 4BWSA 2O87A 4KUNA 3GURA 4K6XA 2FD3A 1XVWA 4BVYA 5HR0A 1VRSD 2XHFA 2H73A 2PBJA 2TIRA 4QQ7A 2PVOC 3U5RE 3ZIJA 3DD3A 1K0MA 4KDXA 3KXOA 3VWXA 3FW2A 5B8AA 1UC7A 4JU5A 3LXZA 5DQSA 2OBKA 4JRRA 2V2GA 3EWLA 3EVIA 1EGRA 2GSTA 1XXUA 1GSQA 2LJRA 4Q5FA 3J7Yb 1V57A 4ZB9A 1MDJA 2FWFA 2R6KA 1GP1A 1PL2A 4AJ8A 4TOPA 2MMNA 1YY7A 2O8VB 4TRXA 2VL9A 2IIYA 3GMFA 2HI7A 2R3XA 5IM9A 5G5FA 1F3AA 1M2AA 2JU5A 5H5RA 1THXA 3KTLA 3E0UA 2C0FA 2A2RA 2LRNA 3E3EA 2H71A 4XRDA 3ZITA 3CTGA 4MH2A 1OAZA 1SL1B 1JZRA 4PQIA 4MCUA 2K6VA 3BCIA 1F6MC 3WGEA 1UVZA 1ZMAA 3EU3A 2AV4A 3Q6OA 4OMVA 2P31A 2H8LA 3M9KA 3ZIVA 1AC1A 5CRWA 3Q18A 3ZFLA 2H76A 1HNAA 3FZ4A 2WFCA 1SL2B 1VF2A 4G9HA 2K8VA 1OC8A 4K7OA 3W8JA 2X8HA 2O89A 2VLTA 3GRXA 2H19A 5DJLA 3L9VA 1NHOA 2YWMA 3FZAA 1K0OA 1T00A 3GUSA 4HUAA 3MDKA 4POMA 2NTOA 3E9JB 1GSUA 2VL2A 4X0XA 3N5OA 3L9UA 4OFNA 4LMVA 4FO5A 2AUVA 4LA1A 5B7CA 3CRTA 1JZOA 2OE1A 4V1Ag 1M7TA 4IVFA 5KEJA 3HJMA 4EO3A 3HXSA 4ZBBA 2JACA 1LJRA 4NAXA 2H1DA 2XC2A 1NHYA 4YAVA 4WF4A 3APOA 1KEBA 4BL7A 4PUFC 3UL3A 2PMTA 1U3AA 5G30A 2VLVA 3N9JA 5D73A 2OADA 1PD21 1G6WA 3MNGA 4LL4B 3TRQA 2A2SA 1AQVA 3HY2A 1K0DA 1A8LA 4BA7A 2RLIA 3L9SA 1IYIA 5D96A 1Z5YE 2KOKA 4OO4A 2IMKA 4V2NA 3A2XA 3IBHA 1A24A 1NW2A 2YPMA 4J2FA 5ELAA 4KX4A 4F9ZA 3LWAA 2L4QA 1SENA 1U6TA 5DCGA 2ON7A 3F3RA 3APSA 2CVDA 1BQ7A 2R2JA 2AB6A 1X5DA 4XS4B 5ECQB 1WMJA 1VF3A 5CRGA 2LNSA 4OD7A 2F8AA 3I43A 5JCGA 2NVLA 1OYJA 5J9CA 2TRXA 2H30A 5AIXA 1O81A 4HJMA 2K8SA 4MJCA 1HNCA 4TR1B 2QSIA 3KJYA 2QKEA 3J7Yk 1SKRB 2OA7A 2OE3A 3NZNA 1VF1A 1K0AA 5JCUA 1XOBA 1JLVA 2J9HA 4RI6A 1EOGA 1O7UA 3GH9A 2B5XA 3FR6A 2YV9A 3FRCA 2L5OA 3EU4A 3P90A 2VCQA 2QGVA 4LL1B 5HFGA 1R5PA 1R7HA 2YN1A 3ZYWA 3GV1A 1Y6EA 2X8GA 6GSVA 1F9MA 4MDCA 4TXVA 3HHVA 4ULXA 3TKRA 3D22A 3C1SA 5LCZA 2R4VA 3DYRA 1XWBA 1XPVA 1B8XA 2HE3A 4AJ7A 2VM1A 2B7KA 2GT6A 1WOUA 1ZCPA 2IN3A 4MF6A 4RQRA 1U88A 3GYKA 1PKZA 3FZ5A 3DEXA 4ML1A 3CSHA 2I3YA 2L57A 3ME8A 2WB9A 2LRTA 4KCAA 3F6FA 4KGIA 5JCWA 3FR9A 1MD4A 4PNFA 3HA9A 4O7HA 3HVSA 3IR4A 1PX7A 3IAS2 3TKSE 3D4TA 3HZ4A 2C3NA 3TJBA 3HCZA 2FGXA 1G0TA 3DXBA 4CDOA 2VD0A 5G31A 3I9V2 4IQAA 3QCPA 4KH7A 1M9BA 1R26A 3EE2A 3BJ5A 1SJIA 2AHEA 3UBLA 2WRTA 6GSWA 5DAKA 2M46A 1TW9A 2JSZA 5F8BA 2DJ0A 3QAWA 3LXTA 4FYUA 4K7NA 4JZQA 1YDKA 2EIOA 3A3TA 4FYCA 3GKMA 4IQ1A 3C8EA 2F8FA 4JBBA 1OC9A 2HYXA 3KH9A 5IQYA 5ECNB 1K0CA 4HS1A 2O7KA 5A4UA 3CXGA 3LEFA 2JZRA 5KN2A 4J57E 3H4KA 1XWCA 3ISOA 5LNKe 3V1WA 5E59A 3U6VA 3KGKA 5EY6A 2P5QA 2F9SA 1TRUA 3PH9A 4ZBDA 3G7IA 2L4CA 1YZXA 1ML6A 4PX1A 4K0GA 4HQSA 1PN9A 4AJ6A 1V40A 4MABA 4F03A 3UAPA 2CT6A 4ISDA 2KLXA 3OR5A 1K3LA 4NPBA 1ZGNA 4L0UA 7GSSA 3M1GA 1JZWA 5J4UA 3C1RA 2DJ2A 5EVOA 4N0ZA 1YF1A 1RW1A 2V1MA 3UJ1A 1THOA 5IMAA 1WRYA 2AAWA 1ZZYA 4F2IA 1T7PB 1DBYA 2OACA 3ZREA 2G2QA 3ZL5A 5IMDA 3DGQA 2XBIA 2PN8A 2KHPA 2V6KA 2YZHA 1O6JA 4MJEA 4LMWA 1NSWA 5AIVA 1WIKA 2WDUA 3F9UA 4JR6A 2HSYA 2YCDA 3H8QA 4QL9A 2H6ZA 3KEBA 2F51A 5F07A 2DBCA 4XCSA 1J9BA 3M3MA 1AQXA 1K3YA 2YJ7A 3KCMA 4WBRD 1YF0A 4EL1A 5ECHB 2CZ3A 1V2AA 4MH3A 3TUEA 3VK9A 1PRXA 4NHWA 2IFQB 1V58A 4KW6A 3TKSA 2HZFA 4IJIA 2L6CA 1EZKA 2GSQA 4OCEA 4L0WA 5CO3A 4KB3A 4OWYA 1HYUA 4WR4A 2C8UA 3O6TA 4HQZA 5DCHA 1XW6A 5ECRB 3IOSA 2IPAA 2YZUA 1FO5A 2LS5A 1G6YA 3WYWA 3KTBA 18GSA 3TOUA 2WULA 1B9YC 2YJHA 3AY8A 4D73B 2EIRA 3VLNA 5D9VA 19GSA 2FA4A 3GTUB 3LORA 3ZVJD 4ECCA 3WT2A 4IP1A 3UVTA 5CNWA 1AQWA 1OE7A 4ACSA 3F4RA 4N11A 3BOAA 1TK0B 2ZCTA 2I4AA 1GL8A 2VIMA 3TJKA 4ZB8A 3HJOA 4FYBA 4IN0A 4MJAA 2HSHA 3EURA 3TRPA 1LU4A 4IGJA 4WKWA 3TB2A 3WT1A 6GSXA 4ZL7A 1BJXA 1GTAA 1QUWA 1S3DA 1B48A 2H6XA 4EXJA 2ON5A 2VCVA 2LJAA 4MMMA 1T8EB 3IE3A 2JL4A 3CBUA 1EEJA 1PMTA 1SK1A 1T4ZA 3Q74A 5ECLB 5ECSA 5KN1A 1E6BA 5D93A 5IOXA 2IJYA 4D73A 1B4QA 1U87A 5DBQA 1SK2A 4KDUA 5IO0A 12GSA 5DALB 4FIWA 4GSTA 1H75A 2NDOA 5KN3A 2DJ1A 5B8BA 1EP8A 3GKNA 1TJDA 4N10A 3VWVA 4JE1A 2M72A 5G1LA 3UARA 5B6MA 2OJLA 4K1FA 1VF4A 2C3QA 1TOFA 4K9ZA 5F05A 5ABRA 3GL3A 3TKQA 3M9JA 4J56E 1A2MA 4HU7A 1NM3A 4OO5A 1I9DA 4HOJA 3HZ8A 5HQPA 1XWKA 2X8CA 8GSSA 1PL1A 1XFLA 5FHIA 4ID0A 4HU9A 2FWHA 2H0HA 11GSA 1TK8B 1GTIA 2C1YA 3UEMA 2IWTA 2H0IA 3VFIA 4TXOB 2FHEA 3GSTA 2HRFA 2VCTA 5DQYA 2IMIA 4POBA 4E8HA 3GFKA 4Q5NA 1M2BA 4JEDA 3FHKA 2HZEB 4G2EA 2H6YA 3DVWA 2GSRA 1TXXA 3IXRA 3CTFA 3PINA 3GIXA 1OE8A 5DJMA 1B4PA 3VPQA 3ZVJA 1ZYQB 5A4VA 4GRFA 3I69A 4EUYA 3BD2A 3F3QA 5E4WA 5GAND 3BCKA 1XW5A 4I97A 3QPMA 4GSSA 3TCOA 2CZ2A 2MMOA 2N5AA 4TN8A 3ERFA 3HDCA 3MWHA 3WGDA 5ID2B 1GULA 3RHBA 3RDWA 4JR4A 3D6IA 3FEUA 4KA0A 1HD2A 1XIYA 2B3SA 2FUG2
chains in the Genus database with same CATH superfamily
1EWXA 4TXOA 2QC7A 1C72A 3UIWA 4EE0A 4XTSA 3NOFA 2YOIA 1EP7A 2TRCP 2HLSA 5IMZA 2HZEA 2R5GA 3R2QA 2FNOA 3GL5A 2DIZA 2VUPA 1MTCA 2NPBA 1GRXA 3GSSA 3VI7A 2C0EA 4BWQA 2XBQA 1T4YA 2GZYA 5CREA 4RUVA 2VL2C 1FVKA 1YQ1A 1YJ6A 1EOHA 1WPIA 4V2MA 1FOVA 3F4TA 2HRNA 2WCIA 4XS4A 1SU9A 2GQLA 5AGYA 4Q5RA 5IPGA 5G1KA 1CQHA 2VCWA 3LJRA 4DEJA 1N2AA 2C80A 2KUCA 2ZNMA 1GLPA 2RIIA 4TR1A 3JCML 1RK4A 4EVMA 2C0GA 1EEMA 3DMLA 1N8JA 2GSSA 2GZPA 3KD0A 3L4NA 2WZ9A 4PXOA 2YNXA 4BVXA 4MZCA 3D21A 4FQUA 5J5NA 1K3OA 3H79A 2R37A 3S9FA 2E7PA 4ML6A 1JHBA 1ZOFA 1AAZA 4NMUA 1B9XC 1X5CA 3US3A 3G7JA 1GNEA 3RHCA 2WS2A 2K9FA 3HVXA 5D8IA 1KBNA 1S3CA 3C7MA 3HYPA 3KM6A 1M0UA 3GH6A 1UA5A 2LQOA 4DSRA 3O76A 3F4SA 4ZL9A 2PU9C 5J41A 1F3BA 3KIJA 3BBYA 5ECMB 4HEA2 4I6XA 2LTKA 3GX8A 3P2AA 2H75A 4PTSA 3C73A 1UN2A 1F2EA 2C0DA 2GVPA 4MF5A 1SKSB 3LQ7A 4GQCA 2X64A 3H93A 2LRCA 5H5SA 3UMAA 4XHMA 4GXZA 2GTUA 3A5WA 4K2DA 4QL7A 1GSFA 1FVJA 1J0FA 1OC3A 5CRDA 1Y25A 3P8WA 1TTZA 1X9MB 1GUKA 3DIEA 4KE3A 3EINA 1TU7A 4P3YB 5G2ZA 2X49A 2C4JA 3HVVA 1MDIA 3IHGA 4IW9A 1PKWA 4WF5A 1MEKA 1Q98A 3W8SA 1ERWA 3MYDA 3L0HA 3QMXA 4L5LA 3EMXA 2EIQA 3R3EA 5G5EA 2WJUA 1SJ6A 2VM2A 3LGCA 3UVHA 3TJFA 4MJBA 4YAPA 2Z9SA 2PERA 4O5RA 2KP1A 4TKYA 1XWAA 1XCCA 1BX9A 1FHEA 2ES7A 5A5KA 4G19A 3DVXA 1HNBA 2REMA 2MBTA 1QXHA 3ERGA 2PWJA 2B5YA 1BAYA 9GSSA 1O73A 1SYXA 4CW9A 1OVNA 1GSEA 4KNDA 1XVQA 4N30A 3GN3A 1PQNA 1A23A 1IYHA 22GSA 4OCFA 3F63A 1QK8A 1GSYA 1ON4A 1AXDA 3DRNA 4F82A 3HJPA 4F0BA 3TGZA 2P0GA 1ACVA 1Z6NA 1ERTA 3ZRDA 3DKSA 3WGXA 2XPEA 5C00A 2C3TA 4IHUA 4I8BA 3TKPA 4KCEA 3IK9A 5DVBA 5CYYA 4K2XA 6GSSA 1I5GA 1EV4A 1XZOA 4ZB6A 5ELGA 4ZILA 1EV9A 4KAEA 2MYGA 3FK8A 3H1NA 3P7XA 3O3TA 1JFUA 4AGSA 2DJJA 3FZ9A 3QAVA 1BEDA 4KSMA 2HT9A 13GSA 3FKFA 4KDYA 5JWRB 2CA8A 1SKWB 3L78A 2UZ8A 3VWUA 2G0FA 1PA3A 4OFMA 3LG6A 1SK0A 3VWWA 4V2LA 4N0VA 1ST9A 4EF0A 2GZZA 4K7IA 5KN0A 2VO4A 1XW9A 2VCXA 4GWRA 2BMXA 5H5QA 4MA9A 2OKAA 4WETA 3F6DA 2OBIA 2DJKA 3ZZXA 2LNTA 3CRUA 1AUCA 1TDIA 4K8MA 3EMPA 2DSAA 1PGTA 2VLUA 3Q19A 3QFBC 2IMDA 2GT5A 5C04A 3VI5A 2EC4A 3IV4A 4O32A 4O92A 2ALBA 1V9WA 3ME7A 5D9TA 2DIYA 4WXTA 2NBSA 1SL0B 1W89A 3FMWA 4DSQA 1GUHA 1E2YA 1USBA 4K0NA 5J3RA 2H1BA 1F37A 2M80A 4FH8A 1S3AA 5FT3A 5JWQB 4ZIJA 2CAQA 5CRHA 4DVCA 4PQ1A 4WBJA 2FY6A 1PX6A 4K5RA 1T3BA 5COHA 2GQMA 1TKDB 3KMNA 2DMLA 4KF9A 3F0IA 2N5FA 2IFQA 5HR2A 5AN1A 1BYEA 2DJ3A 3GKXA 2RM5A 3ZMKA 3I6AA 10GSA 1X0RA 6GSUA 1ZYNA 5HR3A 2GDRA 4Z7XA 1QMVA 5GZZB 1DE1A 1FB6A 2I81A 4OFTA 4MPFA 2H1AA 3QAGA 4I5QA 1A2LA 3IRAA 2J23A 4YH2A 4PQHA 2JADA 2YWNA 1A8YA 5IMFA 5B6NA 3RPPA 4POLA 5ECOB 2CX4A 4HI7A 3MAKA 2IMFA 1LBKA 4PUAA 3IC8A 5ECPB 3GTUA 4BL7B 3GX0A 2A4VA 3VPTA 1X5EA 2H74A 4KSOA 4MP4A 3ED3A 3LFLA 1SYRA 4X1UA 2VOCA 2GLRA 2L59A 3UOMA 4PNGA 1T1VA 1M9AA 1AW9A 2YWIA 3LSZA 1ZYEA 5HFKA 3CSJA 4CHSA 3SBCA 4BPYA 3QOUA 5ENUA 6GSYA 2PPTA 2VL3A 2B7JA 3EPTA 1A2JA 2MMZA 3TKSC 5CAXA 3ZLPA 1MD3A 4GCIA 1TRWA 3APQA 1O8WA 1FB0A 4ZXGA 5EL8A 4MZWA 1TI1A 4YQUA 3IK7A 4MNNA 4RI7A 2GGTA 2LQQA 1G7EA 1GUMA 3CSIA 2I1UA 2P5RA 2FA8A 4IELA 2H0GA 1DE2A 2HXKA 1YEPA 1SJZA 5DALA 4GQFA 4L5OA 2LEGA 2L6DA 5IMVA 1TRSA 1A0RP 3ZTLA 1GSDA 2JZSA 3G9BA 5F06A 3D4MA 4ZBAA 2GQKA 2H1GA 1TP9A 2PGTA 1V98A 2F3MA 4GF0A 1FW1A 4DSSB 3ZMLA 1SD8A 2YANA 4PGTA 1X9WB 5GSTA 3PGTA 3A2VA 3TJJA 1JZDA 4EKZA 2B5EA 5L71A 5ECKB 4IP6A 5HFIA 2HSMA 1GNWA 3FR3A 4YKFA 3D0ZA 2VD1A 2LJKA 3MSZA 2HFDA 3QR6A 4MF7A 4RQXA 1W4VA 1RQMA 2RM6A 4G0LA 4WEYA 2LV3A 2KP2A 2FWGA 2XPDA 2N5BA 1YKCA 3D5JA 1X9SB 5F0GA 5CP1A 4WR5A 2JZTA 1FG4A 2HNLA 4NHZA 2BJXA 1K0BA 1BG5A 2D2ZA 2X99A 1FAAA 3KMOA 1TK5B 4TW5A 2CQ9A 3IC4A 3RPNA 3HD5A 3SWLA 3GKKA 4DSSA 1XOAA 4O5UA 2V32A 1AIUA 3KP8A 1GH2A 2YWOA 5LD0A 3TDGA 4HDEA 4X43A 5BRTA 4NWYA 2A2PA 4IKHA 3WD6A 2QA2A 5IMCA 1Z3EA 3NIVA 1TU8A 20GSA 2RUEA 5ID2A 4POKA 1WP0A 1WJKA 4Q5QA 5BMUA 2E2GA 5IO2A 2PUKC 2OE0A 5EPFA 1M2DA 3EYTA 3IPZA 1G7OA 5D9WA 2FWEA 2H72A 4MK3A 5DAKB 3CYNA 3TRXA 3W6GA 5INYA 16GSA 3M8NA 5GSSA 4L8EA 3TJGA 1WWJA 2LSTA 2GS3A 4IJ3A 3QFAC 4ECIA 3FY7A 5HR1A 2FLSA 1OC9B 2DC5A 2H66A 2L5LA 4YQMA 1TRVA 1PSQA 4YKGA 6GSTA 2LKUA 2O85A 2CV4A 1ERVA 4MZBA 1A0FA 5IPHA 5JWOB 2MMAA 2YV7A 4G0IA 3F8UA 5DDLA 2MZCA 2DMMA 4LLRA 2DLXA 4ECBA 2PVQA 4GLTA 1WE0A 3RBTA 4GSNA 14GSA 3IHQA 3UBKA 4X4JA 4EC0A 3K8NA 2CX3A 3TOTA 4TVEA 2I9HA 1Q4JA 1QQ2A 3G7YA 1QGVA 4ILFA 4YQVA 1XG8A 2ZUPA 1OKDA 2CVKA 1DUGA 1M3IA 4EDYA 4XS6A 3FYGA 2YP6A 1M99A 3M0FA 5IOWA 3ZFBA 1R5AA 1GLQA 1EGOA 4IS0A 2H70A 1Z9HA 1XBSA 2AJQB 1VGLA 1QFNA 1GTUA 3LYPA 1J08A 1ILOA 1KTEA 2E2MA 3IAM2 5IIZA 3QDNA 3KP9A 1XWGA 1DSBA 1KNGA 2IL3A 3PR8A 4MLYA 1ERUA 1GSSA 3QD9A 4XIHA 5D9XA 4V1Ap 3KH7A 1Z7PA 1O85A 1TI3A 5AISA 2FCHA 4E8EA 3RAZA 1Z6MA 1GTBA 2LUSA 4I2UA 1U3IA 1HQOA 2X4AA 3CMIA 4XS1A 5GAPD 4IBPA 1R4WA 2MBSA 4NXIA 5J9BA 2K18A 1ZL9A 2BTOT 2V6OA 4NV2A 3DWVA 2B6MA 2VCZA 4GTUA 3A2WA 2H01A 1URMA 4HZ4A 2WGRA 4BVYB 2E0QA 4HZ2A 1K0NA 2R0CA 2AYTA 3IA1A 4HSCX 2VAFA 3GA4A 4EDZA 4AF2A 1YEXA 2JSYA 3LYKA 3EC3A 1ABAA 1JLWA 1O8XA 2CVBA 1GWCA 3VURA 3GNJA 4PURA 2IMEA 1OKTA 1Z7RA 4TR4A 17GSA 4TR0A 2B1KA 4ECJA 4TR3A 3CQFA 3ERWA 3HKRA 4I2TA 1CQGA 5FWGA 4NV5A 3GHAA 1MDKA 1H4OA 2RUFA 3KZQA 2V41A 4F0CA 4XRAA 5ECIB 2CAIA 5A4WA 2B1LA 3C71A 1YKAA 3IDVA 4H86A 4G10A 4MPGA 4HJ2A 4ZL8A 1SD9A 4BWSA 2O87A 4KUNA 3GURA 4K6XA 2FD3A 1XVWA 4BVYA 5HR0A 1VRSD 2XHFA 2H73A 2PBJA 2TIRA 4QQ7A 2PVOC 3U5RE 3ZIJA 3DD3A 1K0MA 4KDXA 3KXOA 3VWXA 3FW2A 5B8AA 1UC7A 4JU5A 3LXZA 5DQSA 2OBKA 4Z2UA 4JRRA 2V2GA 4A5PA 3EWLA 3EVIA 1EGRA 2GSTA 1XXUA 1GSQA 2LJRA 4Q5FA 3J7Yb 1V57A 4ZB9A 1MDJA 2FWFA 4Z2TA 2R6KA 1GP1A 1PL2A 4AJ8A 4TOPA 2MMNA 1YY7A 2O8VB 4TRXA 2VL9A 2IIYA 3GMFA 2HI7A 2R3XA 5IM9A 5G5FA 1F3AA 1M2AA 2JU5A 5H5RA 1THXA 3KTLA 3E0UA 2C0FA 2A2RA 2LRNA 3E3EA 3A5IA 2H71A 4XRDA 3ZITA 3CTGA 4MH2A 1OAZA 1SL1B 4O5QA 1JZRA 4PQIA 4MCUA 4Z2RA 2K6VA 3BCIA 1F6MC 3WGEA 1UVZA 1ZMAA 3EU3A 2AV4A 3Q6OA 4OMVA 2P31A 2H8LA 3M9KA 2R0PA 3ZIVA 1AC1A 5CRWA 3Q18A 3ZFLA 2H76A 1HNAA 2HRAA 3FZ4A 2WFCA 1SL2B 1VF2A 4G9HA 2K8VA 1OC8A 4K7OA 3W8JA 2X8HA 2O89A 2VLTA 3GRXA 2H19A 5DJLA 3L9VA 1NHOA 2YWMA 3FZAA 2R0GA 1K0OA 1T00A 3GUSA 4HUAA 3MDKA 4POMA 2NTOA 3E9JB 1GSUA 2VL2A 4X0XA 3N5OA 3L9UA 4OFNA 4LMVA 4FO5A 2AUVA 4LA1A 5B7CA 3CRTA 1JZOA 2OE1A 4V1Ag 1M7TA 4IVFA 5KEJA 3LW9A 4ICYA 3HJMA 4EO3A 3HXSA 4ZBBA 2JACA 1LJRA 4NAXA 4USSA 2H1DA 2XC2A 1NHYA 4YAVA 4WF4A 3APOA 1KEBA 4BL7A 4PUFC 3UL3A 2PMTA 1U3AA 5G30A 2VLVA 3N9JA 5D73A 2OADA 1ZYPA 1PD21 1G6WA 3MNGA 4LL4B 3TRQA 2A2SA 1AQVA 3HY2A 1K0DA 1A8LA 4BA7A 2RLIA 3L9SA 1IYIA 5D96A 1Z5YE 2KOKA 4OO4A 2IMKA 4V2NA 3A2XA 3IBHA 1A24A 1NW2A 2YPMA 4J2FA 5ELAA 4KX4A 4F9ZA 3LWAA 2L4QA 1SENA 1U6TA 5DCGA 2ON7A 3F3RA 3APSA 2CVDA 1BQ7A 2R2JA 2AB6A 1X5DA 4XS4B 5ECQB 1WMJA 1VF3A 5CRGA 2LNSA 4OD7A 2F8AA 3I43A 1PFOA 5JCGA 2NVLA 1OYJA 5J9CA 2TRXA 2H30A 5AIXA 1O81A 4HJMA 2K8SA 3MIXA 4MJCA 1HNCA 4TR1B 2QSIA 3KJYA 2QKEA 3J7Yk 5KOXA 1SKRB 1FOHA 2OA7A 2OE3A 3NZNA 1VF1A 1K0AA 5JCUA 1XOBA 4EIPA 1JLVA 2J9HA 4RI6A 1EOGA 1O7UA 3GH9A 1S3RA 2B5XA 3FR6A 2YV9A 4BVXB 3FRCA 2L5OA 3EU4A 3P90A 2VCQA 2QGVA 4LL1B 5HFGA 1R5PA 1R7HA 2YN1A 3ZYWA 3GV1A 1Y6EA 2X8GA 6GSVA 1F9MA 4MDCA 4TXVA 3HHVA 4ULXA 3TKRA 3D22A 3C1SA 5KOWA 5LCZA 2R4VA 3DYRA 1XWBA 1XPVA 1B8XA 2HE3A 4AJ7A 2VM1A 2B7KA 2GT6A 1WOUA 1ZCPA 2IN3A 4MF6A 4RQRA 1U88A 3GYKA 1PKZA 3FZ5A 3DEXA 4ML1A 3CSHA 2I3YA 2L57A 3ME8A 2WB9A 3HVNA 2LRTA 4KCAA 3F6FA 4KGIA 5JCWA 3FR9A 1MD4A 4PNFA 3HA9A 4O7HA 3HVSA 3IR4A 1PX7A 3IAS2 3TKSE 3D4TA 3HZ4A 2C3NA 3TJBA 3HCZA 2FGXA 1G0TA 3DXBA 4CDOA 2VD0A 5G31A 3I9V2 4IQAA 3QCPA 4KH7A 1M9BA 1R26A 3EE2A 3BJ5A 1SJIA 2AHEA 3UBLA 2WRTA 6GSWA 5DAKA 2M46A 1TW9A 2JSZA 5F8BA 2DJ0A 3QAWA 3LXTA 4FYUA 4K7NA 4JZQA 1YDKA 2EIOA 3A3TA 4FYCA 3GKMA 4IQ1A 3C8EA 2F8FA 4JBBA 1OC9A 2HYXA 3KH9A 5IQYA 5ECNB 1K0CA 4HS1A 2O7KA 5A4UA 3CXGA 3LEFA 2JZRA 1PN0A 4K5SA 5KN2A 4J57E 3H4KA 1XWCA 3ISOA 5LNKe 3V1WA 5E59A 3U6VA 3KGKA 5EY6A 2DKHA 2P5QA 2HRKA 2F9SA 1TRUA 3PH9A 4ZBDA 3G7IA 2L4CA 1YZXA 1ML6A 4PX1A 4K0GA 4HQSA 1PN9A 4AJ6A 1V40A 4MABA 4F03A 3UAPA 2CT6A 4ISDA 2KLXA 3OR5A 1K3LA 4NPBA 1ZGNA 4L0UA 7GSSA 3M1GA 1JZWA 5J4UA 3C1RA 2DJ2A 5EVOA 4N0ZA 3PPUA 1YF1A 1RW1A 2V1MA 3UJ1A 1THOA 5IMAA 2DKIA 1WRYA 2AAWA 1ZZYA 4F2IA 1T7PB 1DBYA 2OACA 3ZREA 2G2QA 3ZL5A 5IMDA 4BIKA 3DGQA 2XBIA 2PN8A 2KHPA 2V6KA 2YZHA 1O6JA 4MJEA 4LMWA 1NSWA 2QA1A 5AIVA 1WIKA 2WDUA 3F9UA 4JR6A 2HSYA 2YCDA 3H8QA 4QL9A 2H6ZA 3KEBA 2F51A 5F07A 2DBCA 4XCSA 1J9BA 3M3MA 4EIQA 1AQXA 1K3YA 2YJ7A 3KCMA 4WBRD 1YF0A 4EL1A 5ECHB 2CZ3A 1V2AA 4MH3A 3TUEA 3VK9A 1PRXA 4NHWA 2IFQB 1V58A 4KW6A 3TKSA 2HZFA 4IJIA 2L6CA 1EZKA 2GSQA 4OCEA 4L0WA 5CO3A 4KB3A 4OWYA 1HYUA 4WR4A 2C8UA 3O6TA 4HQZA 5DCHA 1XW6A 5ECRB 3IOSA 2IPAA 2YZUA 1FO5A 2LS5A 1G6YA 2A4HA 3WYWA 3KTBA 1M3JA 18GSA 3TOUA 2WULA 1B9YC 2YJHA 3AY8A 4D73B 2EIRA 3VLNA 5D9VA 19GSA 2FA4A 3GTUB 3LORA 3ZVJD 4ECCA 3WT2A 4IP1A 3UVTA 5CNWA 1AQWA 1OE7A 4ACSA 4CY6A 3F4RA 4N11A 3BOAA 1TK0B 2ZCTA 2I4AA 1GL8A 2VIMA 3TJKA 4ZB8A 3HJOA 4FYBA 4IN0A 4MJAA 2HSHA 3EURA 3TRPA 1LU4A 4IGJA 4WKWA 3TB2A 3WT1A 6GSXA 4ZL7A 1BJXA 1GTAA 1QUWA 1S3DA 1B48A 2H6XA 4EXJA 2ON5A 2VCVA 2LJAA 4MMMA 1T8EB 3IE3A 2JL4A 3CBUA 1EEJA 1PMTA 1SK1A 1T4ZA 3Q74A 5ECLB 5ECSA 5KN1A 1E6BA 5D93A 5IOXA 2IJYA 4D73A 1B4QA 1U87A 5DBQA 1SK2A 4KDUA 5IO0A 12GSA 5DALB 4FIWA 4GSTA 1H75A 2NDOA 5KN3A 2DJ1A 5B8BA 1EP8A 3GKNA 1TJDA 4N10A 3VWVA 4JE1A 2M72A 5G1LA 3UARA 5B6MA 4G0KA 2OJLA 4K1FA 1VF4A 2C3QA 1TOFA 4K9ZA 5F05A 5ABRA 3GL3A 3TKQA 3M9JA 4J56E 1A2MA 4HU7A 1NM3A 4OO5A 1I9DA 4HOJA 3HZ8A 5HQPA 1XWKA 2X8CA 8GSSA 1PL1A 1XFLA 5FHIA 4ID0A 4HU9A 2FWHA 2H0HA 11GSA 1TK8B 1GTIA 2C1YA 3UEMA 2IWTA 2H0IA 3VFIA 4TXOB 2FHEA 3GSTA 2HRFA 2VCTA 5DQYA 2IMIA 4POBA 4E8HA 3GFKA 4Q5NA 1M2BA 4JEDA 3FHKA 2HZEB 4G2EA 2H6YA 3DVWA 2GSRA 1TXXA 3IXRA 3CTFA 3PINA 3GIXA 1OE8A 5DJMA 1B4PA 3VPQA 3ZVJA 1ZYQB 5A4VA 4GRFA 3I69A 4EUYA 3BD2A 3F3QA 5E4WA 5GAND 3BCKA 1XW5A 4I97A 3QPMA 4GSSA 3TCOA 2CZ2A 2MMOA 2N5AA 4TN8A 3ERFA 3HDCA 3MWHA 3WGDA 5ID2B 1GULA 3RHBA 3RDWA 4JR4A 3D6IA 3FEUA 4KA0A 1HD2A 1XIYA 2B3SA 4CY8A 2FUG2
chains in the Genus database with same CATH topology
1EWXA 4TXOA 2QC7A 1C72A 3UIWA 4EE0A 4XTSA 3NOFA 2YOIA 1EP7A 2TRCP 2HLSA 5IMZA 2HZEA 2R5GA 3R2QA 2FNOA 3GL5A 2DIZA 2VUPA 1MTCA 2NPBA 1GRXA 3GSSA 3VI7A 2C0EA 4BWQA 2XBQA 1T4YA 2GZYA 5CREA 4RUVA 2VL2C 1FVKA 1YQ1A 1YJ6A 1EOHA 1WPIA 4V2MA 1FOVA 3F4TA 2HRNA 2WCIA 4XS4A 1SU9A 2GQLA 5AGYA 4Q5RA 5IPGA 5G1KA 1CQHA 2VCWA 3LJRA 4DEJA 1N2AA 2C80A 2KUCA 2ZNMA 1GLPA 2RIIA 4TR1A 3JCML 1RK4A 4EVMA 2C0GA 1EEMA 3DMLA 1N8JA 2GSSA 2GZPA 3KD0A 3L4NA 2WZ9A 4PXOA 2YNXA 4BVXA 4MZCA 3D21A 4FQUA 5J5NA 1K3OA 3H79A 2R37A 3S9FA 2E7PA 4ML6A 1JHBA 1ZOFA 1AAZA 4NMUA 1B9XC 1X5CA 3US3A 3G7JA 1GNEA 3RHCA 2WS2A 2K9FA 3HVXA 5D8IA 1KBNA 1S3CA 3C7MA 3HYPA 3KM6A 1M0UA 3GH6A 1UA5A 2LQOA 4DSRA 3O76A 3F4SA 4ZL9A 2PU9C 5J41A 1F3BA 3KIJA 3BBYA 5ECMB 4HEA2 4I6XA 2LTKA 3GX8A 3P2AA 2H75A 4PTSA 3C73A 1UN2A 1F2EA 2C0DA 2GVPA 4MF5A 1SKSB 3LQ7A 4GQCA 2X64A 3H93A 2LRCA 5H5SA 3UMAA 4XHMA 4GXZA 2GTUA 3A5WA 4K2DA 4QL7A 1GSFA 1FVJA 1J0FA 1OC3A 5CRDA 1Y25A 3P8WA 1TTZA 1X9MB 1GUKA 3DIEA 4KE3A 3EINA 1TU7A 4P3YB 5G2ZA 2X49A 2C4JA 3HVVA 1MDIA 3IHGA 4IW9A 1PKWA 4WF5A 1MEKA 1Q98A 3W8SA 1ERWA 3MYDA 3L0HA 3QMXA 4L5LA 3EMXA 2EIQA 3R3EA 5G5EA 2WJUA 1SJ6A 2VM2A 3LGCA 3UVHA 3TJFA 4MJBA 4YAPA 2Z9SA 2PERA 4O5RA 2KP1A 4TKYA 1XWAA 1XCCA 1BX9A 1FHEA 2ES7A 5A5KA 4G19A 3DVXA 1HNBA 2REMA 2MBTA 1QXHA 3ERGA 2PWJA 2B5YA 1BAYA 9GSSA 1O73A 1SYXA 4CW9A 1OVNA 1GSEA 4KNDA 1XVQA 4N30A 3GN3A 1PQNA 1A23A 1IYHA 22GSA 4OCFA 3F63A 1QK8A 1GSYA 1ON4A 1AXDA 3DRNA 4F82A 3HJPA 4F0BA 3TGZA 2P0GA 1ACVA 1Z6NA 1ERTA 3ZRDA 3DKSA 3WGXA 2XPEA 5C00A 2C3TA 4IHUA 4I8BA 3TKPA 4KCEA 3IK9A 5DVBA 5CYYA 4K2XA 6GSSA 1I5GA 1EV4A 1XZOA 4ZB6A 5ELGA 4ZILA 1EV9A 4KAEA 2MYGA 3FK8A 3H1NA 3P7XA 3O3TA 1JFUA 4AGSA 2DJJA 3FZ9A 3QAVA 1BEDA 4KSMA 2HT9A 13GSA 3FKFA 4KDYA 5JWRB 2CA8A 1SKWB 3L78A 2UZ8A 3VWUA 2G0FA 1PA3A 4OFMA 3LG6A 1SK0A 3VWWA 4V2LA 4N0VA 1ST9A 4EF0A 2GZZA 4K7IA 5KN0A 2VO4A 1XW9A 2VCXA 4GWRA 2BMXA 5H5QA 4MA9A 2OKAA 4WETA 3F6DA 2OBIA 2DJKA 3ZZXA 2LNTA 3CRUA 1AUCA 1TDIA 4K8MA 3EMPA 2DSAA 1PGTA 2VLUA 3Q19A 3QFBC 2IMDA 2GT5A 5C04A 3VI5A 2EC4A 3IV4A 4O32A 4O92A 2ALBA 1V9WA 3ME7A 5D9TA 2DIYA 4WXTA 2NBSA 1SL0B 1W89A 3FMWA 4DSQA 1GUHA 1E2YA 1USBA 4K0NA 5J3RA 2H1BA 1F37A 2M80A 4FH8A 1S3AA 5FT3A 5JWQB 4ZIJA 2CAQA 5CRHA 4DVCA 4PQ1A 4WBJA 2FY6A 1PX6A 4K5RA 1T3BA 5COHA 2GQMA 1TKDB 3KMNA 2DMLA 4KF9A 3F0IA 2N5FA 2IFQA 5HR2A 5AN1A 1BYEA 2DJ3A 3GKXA 2RM5A 3ZMKA 3I6AA 10GSA 1X0RA 6GSUA 1ZYNA 5HR3A 2GDRA 4Z7XA 1QMVA 5GZZB 1DE1A 1FB6A 2I81A 4OFTA 4MPFA 2H1AA 3QAGA 4I5QA 1A2LA 3IRAA 2J23A 4YH2A 4PQHA 2JADA 2YWNA 1A8YA 5IMFA 5B6NA 3RPPA 4POLA 5ECOB 2CX4A 4HI7A 3MAKA 2IMFA 1LBKA 4PUAA 3IC8A 5ECPB 3GTUA 4BL7B 3GX0A 2A4VA 3VPTA 1X5EA 2H74A 4KSOA 4MP4A 3ED3A 3LFLA 1SYRA 4X1UA 2VOCA 2GLRA 2L59A 3UOMA 4PNGA 1T1VA 1M9AA 1AW9A 2YWIA 3LSZA 1ZYEA 5HFKA 3CSJA 4CHSA 3SBCA 4BPYA 3QOUA 5ENUA 6GSYA 2PPTA 2VL3A 2B7JA 3EPTA 1A2JA 2MMZA 3TKSC 5CAXA 3ZLPA 1MD3A 4GCIA 1TRWA 3APQA 1O8WA 1FB0A 4ZXGA 5EL8A 4MZWA 1TI1A 4YQUA 3IK7A 4MNNA 4RI7A 2GGTA 2LQQA 1G7EA 1GUMA 3CSIA 2I1UA 2P5RA 2FA8A 4IELA 2H0GA 1DE2A 2HXKA 1YEPA 1SJZA 5DALA 4GQFA 4L5OA 2LEGA 2L6DA 5IMVA 1TRSA 1A0RP 3ZTLA 1GSDA 2JZSA 3G9BA 5F06A 3D4MA 4ZBAA 2GQKA 2H1GA 1TP9A 2PGTA 1V98A 2F3MA 4GF0A 1FW1A 4DSSB 3ZMLA 1SD8A 2YANA 4PGTA 1X9WB 5GSTA 3PGTA 3A2VA 3TJJA 1JZDA 4EKZA 2B5EA 5L71A 5ECKB 4IP6A 5HFIA 2HSMA 1GNWA 3FR3A 4YKFA 3D0ZA 2VD1A 2LJKA 3MSZA 2HFDA 3QR6A 4MF7A 4RQXA 1W4VA 1RQMA 2RM6A 4G0LA 4WEYA 2LV3A 2KP2A 2FWGA 2XPDA 2N5BA 1YKCA 3D5JA 1X9SB 5F0GA 5CP1A 4WR5A 2JZTA 1FG4A 2HNLA 4NHZA 2BJXA 1K0BA 1BG5A 2D2ZA 2X99A 1FAAA 3KMOA 1TK5B 4TW5A 2CQ9A 3IC4A 3RPNA 3HD5A 3SWLA 3GKKA 4DSSA 1XOAA 4O5UA 2V32A 1AIUA 3KP8A 1GH2A 2YWOA 5LD0A 3TDGA 4HDEA 4X43A 5BRTA 4NWYA 2A2PA 4IKHA 3WD6A 2QA2A 5IMCA 1Z3EA 3NIVA 1TU8A 20GSA 2RUEA 5ID2A 4POKA 1WP0A 1WJKA 4Q5QA 5BMUA 2E2GA 5IO2A 2PUKC 2OE0A 5EPFA 1M2DA 3EYTA 3IPZA 1G7OA 5D9WA 2FWEA 2H72A 4MK3A 5DAKB 3CYNA 3TRXA 3W6GA 5INYA 16GSA 3M8NA 5GSSA 4L8EA 3TJGA 1WWJA 2LSTA 2GS3A 4IJ3A 3QFAC 4ECIA 3FY7A 5HR1A 2FLSA 1OC9B 2DC5A 2H66A 2L5LA 4YQMA 1TRVA 1PSQA 4YKGA 6GSTA 2LKUA 2O85A 2CV4A 1ERVA 4MZBA 1A0FA 5IPHA 5JWOB 2MMAA 2YV7A 4G0IA 3F8UA 5DDLA 2MZCA 2DMMA 4LLRA 2DLXA 4ECBA 2PVQA 4GLTA 1WE0A 3RBTA 4GSNA 14GSA 3IHQA 3UBKA 4X4JA 4EC0A 3K8NA 2CX3A 3TOTA 4TVEA 2I9HA 1Q4JA 1QQ2A 3G7YA 1QGVA 4ILFA 4YQVA 2ZUPA 1OKDA 2CVKA 1DUGA 4EDYA 4XS6A 3FYGA 2YP6A 1M99A 3M0FA 5IOWA 3ZFBA 1R5AA 1GLQA 1EGOA 4IS0A 2H70A 1Z9HA 1XBSA 2AJQB 1VGLA 1QFNA 1GTUA 3LYPA 1J08A 1ILOA 1KTEA 2E2MA 3IAM2 5IIZA 3QDNA 3KP9A 1XWGA 1DSBA 1KNGA 2IL3A 3PR8A 4MLYA 1ERUA 1GSSA 3QD9A 4XIHA 5D9XA 4V1Ap 3KH7A 1Z7PA 1O85A 1TI3A 5AISA 2FCHA 4E8EA 3RAZA 1Z6MA 1GTBA 2LUSA 4I2UA 1U3IA 1HQOA 2X4AA 3CMIA 4XS1A 5GAPD 4IBPA 1R4WA 2MBSA 4NXIA 5J9BA 2K18A 1ZL9A 2BTOT 2V6OA 4NV2A 3DWVA 2B6MA 2VCZA 4GTUA 3A2WA 2H01A 1URMA 4HZ4A 2WGRA 4BVYB 2E0QA 4HZ2A 1K0NA 2R0CA 2AYTA 3IA1A 2VAFA 3GA4A 4EDZA 4AF2A 1YEXA 2JSYA 3LYKA 3EC3A 1ABAA 1JLWA 1O8XA 2CVBA 1GWCA 3VURA 3GNJA 4PURA 2IMEA 1OKTA 1Z7RA 4TR4A 17GSA 4TR0A 2B1KA 4ECJA 4TR3A 3ERWA 3HKRA 4I2TA 1CQGA 5FWGA 4NV5A 3GHAA 1MDKA 1H4OA 2RUFA 3KZQA 2V41A 4F0CA 4XRAA 5ECIB 2CAIA 5A4WA 2B1LA 3C71A 1YKAA 3IDVA 4H86A 4G10A 4MPGA 4HJ2A 4ZL8A 1SD9A 4BWSA 2O87A 4KUNA 3GURA 4K6XA 2FD3A 1XVWA 4BVYA 5HR0A 1VRSD 2XHFA 2H73A 2PBJA 2TIRA 4QQ7A 2PVOC 3U5RE 3ZIJA 3DD3A 1K0MA 4KDXA 3KXOA 3VWXA 3FW2A 5B8AA 1UC7A 4JU5A 3LXZA 5DQSA 2OBKA 4Z2UA 4JRRA 2V2GA 4A5PA 3EWLA 3EVIA 1EGRA 2GSTA 1XXUA 1GSQA 2LJRA 4Q5FA 3J7Yb 1V57A 4ZB9A 1MDJA 2FWFA 4Z2TA 2R6KA 1GP1A 1PL2A 4AJ8A 4TOPA 2MMNA 1YY7A 2O8VB 4TRXA 2VL9A 2IIYA 3GMFA 2HI7A 2R3XA 5IM9A 5G5FA 1F3AA 1M2AA 2JU5A 5H5RA 1THXA 3KTLA 3E0UA 2C0FA 2A2RA 2LRNA 3E3EA 3A5IA 2H71A 4XRDA 3ZITA 3CTGA 4MH2A 1OAZA 1SL1B 4O5QA 1JZRA 4PQIA 4MCUA 4Z2RA 2K6VA 3BCIA 1F6MC 3WGEA 1UVZA 1ZMAA 3EU3A 2AV4A 3Q6OA 4OMVA 2P31A 2H8LA 3M9KA 2R0PA 3ZIVA 1AC1A 5CRWA 3Q18A 3ZFLA 2H76A 1HNAA 2HRAA 3FZ4A 2WFCA 1SL2B 1VF2A 4G9HA 2K8VA 1OC8A 4K7OA 3W8JA 2X8HA 2O89A 2VLTA 3GRXA 2H19A 5DJLA 3L9VA 1NHOA 2YWMA 3FZAA 2R0GA 1K0OA 1T00A 3GUSA 4HUAA 3MDKA 4POMA 2NTOA 3E9JB 1GSUA 2VL2A 4X0XA 3N5OA 3L9UA 4OFNA 4LMVA 4FO5A 2AUVA 4LA1A 5B7CA 3CRTA 1JZOA 2OE1A 4V1Ag 1M7TA 4IVFA 5KEJA 3LW9A 4ICYA 3HJMA 4EO3A 3HXSA 4ZBBA 2JACA 1LJRA 4NAXA 4USSA 2H1DA 2XC2A 1NHYA 4YAVA 4WF4A 3APOA 1KEBA 4BL7A 4PUFC 3UL3A 2PMTA 1U3AA 5G30A 2VLVA 3N9JA 5D73A 2OADA 1ZYPA 1PD21 1G6WA 3MNGA 4LL4B 3TRQA 2A2SA 1AQVA 3HY2A 1K0DA 1A8LA 4BA7A 2RLIA 3L9SA 1IYIA 5D96A 1Z5YE 2KOKA 4OO4A 2IMKA 4V2NA 3A2XA 3IBHA 1A24A 1NW2A 2YPMA 4J2FA 5ELAA 4KX4A 4F9ZA 3LWAA 2L4QA 1SENA 1U6TA 5DCGA 2ON7A 3F3RA 3APSA 2CVDA 1BQ7A 2R2JA 2AB6A 1X5DA 4XS4B 5ECQB 1WMJA 1VF3A 5CRGA 2LNSA 4OD7A 2F8AA 3I43A 5JCGA 2NVLA 1OYJA 5J9CA 2TRXA 2H30A 5AIXA 1O81A 4HJMA 2K8SA 3MIXA 4MJCA 1HNCA 4TR1B 2QSIA 3KJYA 2QKEA 3J7Yk 5KOXA 1SKRB 1FOHA 2OA7A 2OE3A 3NZNA 1VF1A 1K0AA 5JCUA 1XOBA 4EIPA 1JLVA 2J9HA 4RI6A 1EOGA 1O7UA 3GH9A 2B5XA 3FR6A 2YV9A 4BVXB 3FRCA 2L5OA 3EU4A 3P90A 2VCQA 2QGVA 4LL1B 5HFGA 1R5PA 1R7HA 2YN1A 3ZYWA 3GV1A 1Y6EA 2X8GA 6GSVA 1F9MA 4MDCA 4TXVA 3HHVA 4ULXA 3TKRA 3D22A 3C1SA 5KOWA 5LCZA 2R4VA 3DYRA 1XWBA 1XPVA 1B8XA 2HE3A 4AJ7A 2VM1A 2B7KA 2GT6A 1WOUA 1ZCPA 2IN3A 4MF6A 4RQRA 1U88A 3GYKA 1PKZA 3FZ5A 3DEXA 4ML1A 3CSHA 2I3YA 2L57A 3ME8A 2WB9A 2LRTA 4KCAA 3F6FA 4KGIA 5JCWA 3FR9A 1MD4A 4PNFA 3HA9A 4O7HA 3HVSA 3IR4A 1PX7A 3IAS2 3TKSE 3D4TA 3HZ4A 2C3NA 3TJBA 3HCZA 2FGXA 1G0TA 3DXBA 4CDOA 2VD0A 5G31A 3I9V2 4IQAA 3QCPA 4KH7A 1M9BA 1R26A 3EE2A 3BJ5A 1SJIA 2AHEA 3UBLA 2WRTA 6GSWA 5DAKA 2M46A 1TW9A 2JSZA 5F8BA 2DJ0A 3QAWA 3LXTA 4FYUA 4K7NA 4JZQA 1YDKA 2EIOA 3A3TA 4FYCA 3GKMA 4IQ1A 3C8EA 2F8FA 4JBBA 1OC9A 2HYXA 3KH9A 5IQYA 5ECNB 1K0CA 4HS1A 2O7KA 5A4UA 3CXGA 3LEFA 2JZRA 1PN0A 4K5SA 5KN2A 4J57E 3H4KA 1XWCA 3ISOA 5LNKe 3V1WA 5E59A 3U6VA 3KGKA 5EY6A 2DKHA 2P5QA 2HRKA 2F9SA 1TRUA 3PH9A 4ZBDA 3G7IA 2L4CA 1YZXA 1ML6A 4PX1A 4K0GA 4HQSA 1PN9A 4AJ6A 1V40A 4MABA 4F03A 3UAPA 2CT6A 4ISDA 2KLXA 3OR5A 1K3LA 4NPBA 1ZGNA 4L0UA 7GSSA 3M1GA 1JZWA 5J4UA 3C1RA 2DJ2A 5EVOA 4N0ZA 3PPUA 1YF1A 1RW1A 2V1MA 3UJ1A 1THOA 5IMAA 2DKIA 1WRYA 2AAWA 1ZZYA 4F2IA 1T7PB 1DBYA 2OACA 3ZREA 2G2QA 3ZL5A 5IMDA 3DGQA 2XBIA 2PN8A 2KHPA 2V6KA 2YZHA 1O6JA 4MJEA 4LMWA 1NSWA 2QA1A 5AIVA 1WIKA 2WDUA 3F9UA 4JR6A 2HSYA 2YCDA 3H8QA 4QL9A 2H6ZA 3KEBA 2F51A 5F07A 2DBCA 4XCSA 1J9BA 3M3MA 4EIQA 1AQXA 1K3YA 2YJ7A 3KCMA 4WBRD 1YF0A 4EL1A 5ECHB 2CZ3A 1V2AA 4MH3A 3TUEA 3VK9A 1PRXA 4NHWA 2IFQB 1V58A 4KW6A 3TKSA 2HZFA 4IJIA 2L6CA 1EZKA 2GSQA 4OCEA 4L0WA 5CO3A 4KB3A 4OWYA 1HYUA 4WR4A 2C8UA 3O6TA 4HQZA 5DCHA 1XW6A 5ECRB 3IOSA 2IPAA 2YZUA 1FO5A 2LS5A 1G6YA 2A4HA 3WYWA 3KTBA 18GSA 3TOUA 2WULA 1B9YC 2YJHA 3AY8A 4D73B 2EIRA 3VLNA 5D9VA 19GSA 2FA4A 3GTUB 3LORA 3ZVJD 4ECCA 3WT2A 4IP1A 3UVTA 5CNWA 1AQWA 1OE7A 4ACSA 4CY6A 3F4RA 4N11A 3BOAA 1TK0B 2ZCTA 2I4AA 1GL8A 2VIMA 3TJKA 4ZB8A 3HJOA 4FYBA 4IN0A 4MJAA 2HSHA 3EURA 3TRPA 1LU4A 4IGJA 4WKWA 3TB2A 3WT1A 6GSXA 4ZL7A 1BJXA 1GTAA 1QUWA 1S3DA 1B48A 2H6XA 4EXJA 2ON5A 2VCVA 2LJAA 4MMMA 1T8EB 3IE3A 2JL4A 3CBUA 1EEJA 1PMTA 1SK1A 1T4ZA 3Q74A 5ECLB 5ECSA 5KN1A 1E6BA 5D93A 5IOXA 2IJYA 4D73A 1B4QA 1U87A 5DBQA 1SK2A 4KDUA 5IO0A 12GSA 5DALB 4FIWA 4GSTA 1H75A 2NDOA 5KN3A 2DJ1A 5B8BA 1EP8A 3GKNA 1TJDA 4N10A 3VWVA 4JE1A 2M72A 5G1LA 3UARA 5B6MA 4G0KA 2OJLA 4K1FA 1VF4A 2C3QA 1TOFA 4K9ZA 5F05A 5ABRA 3GL3A 3TKQA 3M9JA 4J56E 1A2MA 4HU7A 1NM3A 4OO5A 1I9DA 4HOJA 3HZ8A 5HQPA 1XWKA 2X8CA 8GSSA 1PL1A 1XFLA 5FHIA 4ID0A 4HU9A 2FWHA 2H0HA 11GSA 1TK8B 1GTIA 2C1YA 3UEMA 2IWTA 2H0IA 3VFIA 4TXOB 2FHEA 3GSTA 2HRFA 2VCTA 5DQYA 2IMIA 4POBA 4E8HA 3GFKA 4Q5NA 1M2BA 4JEDA 3FHKA 2HZEB 4G2EA 2H6YA 3DVWA 2GSRA 1TXXA 3IXRA 3CTFA 3PINA 3GIXA 1OE8A 5DJMA 1B4PA 3VPQA 3ZVJA 1ZYQB 5A4VA 4GRFA 3I69A 4EUYA 3BD2A 3F3QA 5E4WA 5GAND 3BCKA 1XW5A 4I97A 3QPMA 4GSSA 3TCOA 2CZ2A 2MMOA 2N5AA 4TN8A 3ERFA 3HDCA 3MWHA 3WGDA 5ID2B 1GULA 3RHBA 3RDWA 4JR4A 3D6IA 3FEUA 4KA0A 1HD2A 1XIYA 2B3SA 4CY8A 2FUG2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EWX A;  4TXO A;  2QC7 A;  1C72 A;  3UIW A;  4EE0 A;  4XTS A;  3NOF A;  2YOI A;  1EP7 A;  2TRC P;  2HLS A;  5IMZ A;  2HZE A;  2R5G A;  3R2Q A;  2FNO A;  3GL5 A;  2DIZ A;  2VUP A;  1MTC A;  2NPB A;  1GRX A;  3GSS A;  3VI7 A;  2C0E A;  4BWQ A;  2XBQ A;  1T4Y A;  2GZY A;  5CRE A;  4RUV A;  2VL2 C;  1FVK A;  1YQ1 A;  1YJ6 A;  1EOH A;  1WPI A;  4V2M A;  1FOV A;  3F4T A;  2HRN A;  2WCI A;  4XS4 A;  1SU9 A;  2GQL A;  5AGY A;  4Q5R A;  5IPG A;  5G1K A;  1CQH A;  2VCW A;  3LJR A;  4DEJ A;  1N2A A;  2C80 A;  2KUC A;  2ZNM A;  1GLP A;  2RII A;  4TR1 A;  3JCM L;  1RK4 A;  4EVM A;  2C0G A;  1EEM A;  3DML A;  1N8J A;  2GSS A;  2GZP A;  3KD0 A;  3L4N A;  2WZ9 A;  4PXO A;  2YNX A;  4BVX A;  4MZC A;  3D21 A;  5J5N A;  1K3O A;  3H79 A;  2R37 A;  3S9F A;  2E7P A;  4ML6 A;  1JHB A;  1ZOF A;  1AAZ A;  4NMU A;  1B9X C;  1X5C A;  3US3 A;  3G7J A;  1GNE A;  3RHC A;  2WS2 A;  2K9F A;  3HVX A;  5D8I A;  1KBN A;  1S3C A;  3C7M A;  3HYP A;  3KM6 A;  1M0U A;  3GH6 A;  1UA5 A;  2LQO A;  4DSR A;  3O76 A;  3F4S A;  4ZL9 A;  2PU9 C;  5J41 A;  1F3B A;  3KIJ A;  3BBY A;  5ECM B;  4HEA 2;  4I6X A;  2LTK A;  3GX8 A;  3P2A A;  2H75 A;  3C73 A;  1UN2 A;  1F2E A;  2C0D A;  2GVP A;  4MF5 A;  1SKS B;  3LQ7 A;  4GQC A;  2X64 A;  3H93 A;  2LRC A;  5H5S A;  3UMA A;  4XHM A;  4GXZ A;  2GTU A;  3A5W A;  4K2D A;  4QL7 A;  1GSF A;  1FVJ A;  1J0F A;  1OC3 A;  5CRD A;  1Y25 A;  3P8W A;  1TTZ A;  1X9M B;  1GUK A;  3DIE A;  4KE3 A;  3EIN A;  1TU7 A;  4P3Y B;  5G2Z A;  2C4J A;  3HVV A;  1MDI A;  4IW9 A;  1PKW A;  4WF5 A;  1MEK A;  1Q98 A;  3W8S A;  1ERW A;  3L0H A;  3QMX A;  4L5L A;  3EMX A;  2EIQ A;  5G5E A;  2WJU A;  1SJ6 A;  2VM2 A;  3LGC A;  3UVH A;  3TJF A;  4MJB A;  4YAP A;  2Z9S A;  2PER A;  4O5R A;  2KP1 A;  4TKY A;  1XWA A;  1XCC A;  1BX9 A;  1FHE A;  2ES7 A;  5A5K A;  4G19 A;  3DVX A;  1HNB A;  2REM A;  2MBT A;  1QXH A;  3ERG A;  2PWJ A;  2B5Y A;  1BAY A;  9GSS A;  1O73 A;  1SYX A;  4CW9 A;  1OVN A;  1GSE A;  4KND A;  1XVQ A;  4N30 A;  3GN3 A;  1PQN A;  1A23 A;  1IYH A;  22GS A;  4OCF A;  3F63 A;  1QK8 A;  1GSY A;  1ON4 A;  1AXD A;  3DRN A;  4F82 A;  3HJP A;  4F0B A;  3TGZ A;  2P0G A;  1ACV A;  1Z6N A;  1ERT A;  3ZRD A;  3DKS A;  3WGX A;  2XPE A;  5C00 A;  2C3T A;  4IHU A;  4I8B A;  3TKP A;  4KCE A;  3IK9 A;  5DVB A;  5CYY A;  6GSS A;  1I5G A;  1EV4 A;  1XZO A;  4ZB6 A;  5ELG A;  4ZIL A;  1EV9 A;  4KAE A;  2MYG A;  3FK8 A;  3H1N A;  3P7X A;  3O3T A;  1JFU A;  4AGS A;  2DJJ A;  3FZ9 A;  3QAV A;  1BED A;  4KSM A;  2HT9 A;  13GS A;  3FKF A;  4KDY A;  5JWR B;  2CA8 A;  1SKW B;  3L78 A;  3VWU A;  2G0F A;  1PA3 A;  4OFM A;  3LG6 A;  1SK0 A;  3VWW A;  4V2L A;  4N0V A;  1ST9 A;  4EF0 A;  2GZZ A;  4K7I A;  5KN0 A;  2VO4 A;  1XW9 A;  2VCX A;  4GWR A;  2BMX A;  5H5Q A;  4MA9 A;  2OKA A;  4WET A;  3F6D A;  2OBI A;  2DJK A;  3ZZX A;  2LNT A;  3CRU A;  1AUC A;  1TDI A;  4K8M A;  3EMP A;  2DSA A;  1PGT A;  2VLU A;  3Q19 A;  3QFB C;  2IMD A;  2GT5 A;  5C04 A;  3VI5 A;  2EC4 A;  3IV4 A;  4O32 A;  4O92 A;  2ALB A;  1V9W A;  3ME7 A;  5D9T A;  2DIY A;  4WXT A;  2NBS A;  1SL0 B;  1W89 A;  4DSQ A;  1GUH A;  1E2Y A;  1USB A;  4K0N A;  5J3R A;  2H1B A;  1F37 A;  2M80 A;  4FH8 A;  1S3A A;  5FT3 A;  5JWQ B;  4ZIJ A;  2CAQ A;  5CRH A;  4DVC A;  4PQ1 A;  4WBJ A;  2FY6 A;  1PX6 A;  1T3B A;  5COH A;  2GQM A;  1TKD B;  3KMN A;  2DML A;  3F0I A;  2N5F A;  2IFQ A;  5HR2 A;  5AN1 A;  1BYE A;  2DJ3 A;  3GKX A;  2RM5 A;  3ZMK A;  3I6A A;  10GS A;  1X0R A;  6GSU A;  5HR3 A;  2GDR A;  4Z7X A;  1QMV A;  5GZZ B;  1DE1 A;  1FB6 A;  2I81 A;  4OFT A;  4MPF A;  2H1A A;  3QAG A;  4I5Q A;  1A2L A;  3IRA A;  2J23 A;  4YH2 A;  4PQH A;  2JAD A;  2YWN A;  1A8Y A;  5IMF A;  5B6N A;  3RPP A;  4POL A;  5ECO B;  2CX4 A;  4HI7 A;  3MAK A;  2IMF A;  1LBK A;  4PUA A;  5ECP B;  3GTU A;  3GX0 A;  2A4V A;  3VPT A;  1X5E A;  2H74 A;  4KSO A;  4MP4 A;  3ED3 A;  3LFL A;  1SYR A;  4X1U A;  2VOC A;  2GLR A;  2L59 A;  3UOM A;  4PNG A;  1T1V A;  1M9A A;  1AW9 A;  2YWI A;  3LSZ A;  1ZYE A;  5HFK A;  3CSJ A;  4CHS A;  3SBC A;  4BPY A;  3QOU A;  5ENU A;  6GSY A;  2PPT A;  2VL3 A;  2B7J A;  1A2J A;  2MMZ A;  3TKS C;  5CAX A;  3ZLP A;  1MD3 A;  4GCI A;  1TRW A;  3APQ A;  1O8W A;  1FB0 A;  4ZXG A;  5EL8 A;  4MZW A;  1TI1 A;  4YQU A;  3IK7 A;  4RI7 A;  2GGT A;  2LQQ A;  1G7E A;  1GUM A;  3CSI A;  2I1U A;  2P5R A;  2FA8 A;  4IEL A;  2H0G A;  1DE2 A;  2HXK A;  1YEP A;  1SJZ A;  5DAL A;  4GQF A;  4L5O A;  2LEG A;  2L6D A;  5IMV A;  1TRS A;  1A0R P;  3ZTL A;  1GSD A;  2JZS A;  3G9B A;  5F06 A;  3D4M A;  4ZBA A;  2GQK A;  2H1G A;  1TP9 A;  2PGT A;  1V98 A;  2F3M A;  4GF0 A;  1FW1 A;  4DSS B;  3ZML A;  1SD8 A;  2YAN A;  4PGT A;  1X9W B;  5GST A;  3PGT A;  3A2V A;  3TJJ A;  1JZD A;  4EKZ A;  2B5E A;  5L71 A;  5ECK B;  4IP6 A;  5HFI A;  1GNW A;  3FR3 A;  3D0Z A;  2VD1 A;  2LJK A;  3MSZ A;  2HFD A;  3QR6 A;  4MF7 A;  4RQX A;  1W4V A;  1RQM A;  2RM6 A;  4WEY A;  2LV3 A;  2KP2 A;  2FWG A;  2XPD A;  2N5B A;  1YKC A;  3D5J A;  1X9S B;  5F0G A;  5CP1 A;  4WR5 A;  2JZT A;  1FG4 A;  2HNL A;  4NHZ A;  2BJX A;  1K0B A;  1BG5 A;  2D2Z A;  2X99 A;  1FAA A;  3KMO A;  1TK5 B;  4TW5 A;  2CQ9 A;  3IC4 A;  3RPN A;  3HD5 A;  3SWL A;  3GKK A;  4DSS A;  1XOA A;  2V32 A;  1AIU A;  3KP8 A;  1GH2 A;  2YWO A;  5LD0 A;  3TDG A;  4HDE A;  4X43 A;  4NWY A;  4IKH A;  3WD6 A;  5IMC A;  1Z3E A;  3NIV A;  1TU8 A;  20GS A;  2RUE A;  5ID2 A;  4POK A;  1WP0 A;  1WJK A;  4Q5Q A;  2E2G A;  5IO2 A;  2PUK C;  2OE0 A;  5EPF A;  1M2D A;  3EYT A;  3IPZ A;  1G7O A;  5D9W A;  2FWE A;  2H72 A;  4MK3 A;  5DAK B;  3CYN A;  3TRX A;  3W6G A;  5INY A;  16GS A;  3M8N A;  5GSS A;  4L8E A;  3TJG A;  1WWJ A;  2LST A;  2GS3 A;  4IJ3 A;  3QFA C;  4ECI A;  3FY7 A;  5HR1 A;  2FLS A;  1OC9 B;  2DC5 A;  2H66 A;  2L5L A;  4YQM A;  1TRV A;  1PSQ A;  6GST A;  2LKU A;  2O85 A;  2CV4 A;  1ERV A;  4MZB A;  1A0F A;  5IPH A;  5JWO B;  2MMA A;  2YV7 A;  3F8U A;  5DDL A;  2MZC A;  2DMM A;  4LLR A;  2DLX A;  4ECB A;  2PVQ A;  4GLT A;  1WE0 A;  3RBT A;  4GSN A;  14GS A;  3IHQ A;  3UBK A;  4EC0 A;  3K8N A;  2CX3 A;  3TOT A;  4TVE A;  2I9H A;  1Q4J A;  1QQ2 A;  3G7Y A;  1QGV A;  4ILF A;  4YQV A;  2ZUP A;  1OKD A;  2CVK A;  1DUG A;  4EDY A;  4XS6 A;  3FYG A;  2YP6 A;  1M99 A;  3M0F A;  5IOW A;  3ZFB A;  1R5A A;  1GLQ A;  1EGO A;  4IS0 A;  2H70 A;  1Z9H A;  1XBS A;  2AJQ B;  1VGL A;  1QFN A;  1GTU A;  3LYP A;  1J08 A;  1ILO A;  1KTE A;  2E2M A;  3IAM 2;  5IIZ A;  3QDN A;  3KP9 A;  1XWG A;  1DSB A;  1KNG A;  2IL3 A;  3PR8 A;  4MLY A;  1ERU A;  1GSS A;  3QD9 A;  4XIH A;  5D9X A;  4V1A p;  3KH7 A;  1Z7P A;  1O85 A;  1TI3 A;  5AIS A;  2FCH A;  4E8E A;  3RAZ A;  1Z6M A;  1GTB A;  2LUS A;  4I2U A;  1U3I A;  1HQO A;  3CMI A;  4XS1 A;  5GAP D;  4IBP A;  1R4W A;  2MBS A;  4NXI A;  5J9B A;  2K18 A;  1ZL9 A;  2BTO T;  2V6O A;  4NV2 A;  3DWV A;  2B6M A;  2VCZ A;  4GTU A;  3A2W A;  2H01 A;  1URM A;  4HZ4 A;  2WGR A;  2E0Q A;  4HZ2 A;  1K0N A;  2AYT A;  3IA1 A;  2VAF A;  3GA4 A;  4EDZ A;  4AF2 A;  1YEX A;  2JSY A;  3LYK A;  3EC3 A;  1ABA A;  1JLW A;  1O8X A;  2CVB A;  1GWC A;  3VUR A;  3GNJ A;  4PUR A;  2IME A;  1OKT A;  1Z7R A;  4TR4 A;  17GS A;  4TR0 A;  2B1K A;  4ECJ A;  4TR3 A;  3ERW A;  3HKR A;  4I2T A;  1CQG A;  5FWG A;  4NV5 A;  3GHA A;  1MDK A;  1H4O A;  2RUF A;  3KZQ A;  2V41 A;  4F0C A;  4XRA A;  5ECI B;  2CAI A;  5A4W A;  2B1L A;  3C71 A;  1YKA A;  3IDV A;  4H86 A;  4G10 A;  4MPG A;  4HJ2 A;  4ZL8 A;  1SD9 A;  4BWS A;  2O87 A;  4KUN A;  3GUR A;  4K6X A;  2FD3 A;  1XVW A;  4BVY A;  5HR0 A;  1VRS D;  2XHF A;  2H73 A;  2PBJ A;  2TIR A;  4QQ7 A;  2PVO C;  3U5R E;  3ZIJ A;  3DD3 A;  1K0M A;  4KDX A;  3KXO A;  3VWX A;  3FW2 A;  5B8A A;  1UC7 A;  4JU5 A;  3LXZ A;  5DQS A;  2OBK A;  4JRR A;  2V2G A;  3EWL A;  3EVI A;  1EGR A;  2GST A;  1XXU A;  1GSQ A;  2LJR A;  4Q5F A;  3J7Y b;  1V57 A;  4ZB9 A;  1MDJ A;  2FWF A;  2R6K A;  1GP1 A;  1PL2 A;  4AJ8 A;  4TOP A;  2MMN A;  1YY7 A;  2O8V B;  4TRX A;  2VL9 A;  2IIY A;  3GMF A;  2HI7 A;  2R3X A;  5IM9 A;  5G5F A;  1F3A A;  1M2A A;  2JU5 A;  5H5R A;  1THX A;  3KTL A;  3E0U A;  2C0F A;  2A2R A;  2LRN A;  3E3E A;  2H71 A;  4XRD A;  3ZIT A;  3CTG A;  4MH2 A;  1OAZ A;  1SL1 B;  1JZR A;  4PQI A;  4MCU A;  2K6V A;  3BCI A;  1F6M C;  3WGE A;  1UVZ A;  1ZMA A;  3EU3 A;  2AV4 A;  3Q6O A;  4OMV A;  2P31 A;  2H8L A;  3M9K A;  3ZIV A;  1AC1 A;  5CRW A;  3Q18 A;  3ZFL A;  2H76 A;  1HNA A;  3FZ4 A;  2WFC A;  1SL2 B;  1VF2 A;  4G9H A;  2K8V A;  1OC8 A;  4K7O A;  3W8J A;  2X8H A;  2O89 A;  2VLT A;  3GRX A;  2H19 A;  5DJL A;  3L9V A;  1NHO A;  2YWM A;  3FZA A;  1K0O A;  1T00 A;  3GUS A;  4HUA A;  3MDK A;  4POM A;  2NTO A;  3E9J B;  1GSU A;  2VL2 A;  4X0X A;  3N5O A;  3L9U A;  4OFN A;  4LMV A;  4FO5 A;  2AUV A;  4LA1 A;  5B7C A;  3CRT A;  1JZO A;  2OE1 A;  4V1A g;  1M7T A;  4IVF A;  5KEJ A;  3HJM A;  4EO3 A;  3HXS A;  4ZBB A;  2JAC A;  1LJR A;  4NAX A;  2H1D A;  2XC2 A;  1NHY A;  4YAV A;  4WF4 A;  3APO A;  1KEB A;  4BL7 A;  4PUF C;  3UL3 A;  2PMT A;  1U3A A;  5G30 A;  2VLV A;  3N9J A;  5D73 A;  2OAD A;  1PD2 1;  1G6W A;  3MNG A;  4LL4 B;  3TRQ A;  2A2S A;  1AQV A;  3HY2 A;  1K0D A;  1A8L A;  4BA7 A;  2RLI A;  3L9S A;  1IYI A;  5D96 A;  1Z5Y E;  2KOK A;  4OO4 A;  2IMK A;  4V2N A;  3A2X A;  3IBH A;  1A24 A;  1NW2 A;  2YPM A;  4J2F A;  5ELA A;  4KX4 A;  4F9Z A;  3LWA A;  2L4Q A;  1SEN A;  1U6T A;  5DCG A;  2ON7 A;  3F3R A;  3APS A;  2CVD A;  1BQ7 A;  2R2J A;  2AB6 A;  1X5D A;  4XS4 B;  5ECQ B;  1WMJ A;  1VF3 A;  5CRG A;  2LNS A;  4OD7 A;  2F8A A;  3I43 A;  5JCG A;  2NVL A;  1OYJ A;  5J9C A;  2TRX A;  2H30 A;  5AIX A;  1O81 A;  4HJM A;  2K8S A;  4MJC A;  1HNC A;  4TR1 B;  2QSI A;  3KJY A;  2QKE A;  3J7Y k;  1SKR B;  2OA7 A;  2OE3 A;  3NZN A;  1VF1 A;  1K0A A;  5JCU A;  1XOB A;  1JLV A;  2J9H A;  4RI6 A;  1EOG A;  1O7U A;  3GH9 A;  2B5X A;  3FR6 A;  2YV9 A;  3FRC A;  2L5O A;  3EU4 A;  3P90 A;  2VCQ A;  2QGV A;  4LL1 B;  5HFG A;  1R5P A;  1R7H A;  2YN1 A;  3ZYW A;  3GV1 A;  1Y6E A;  2X8G A;  6GSV A;  1F9M A;  4MDC A;  4TXV A;  3HHV A;  4ULX A;  3TKR A;  3D22 A;  3C1S A;  5LCZ A;  2R4V A;  3DYR A;  1XWB A;  1XPV A;  1B8X A;  2HE3 A;  4AJ7 A;  2VM1 A;  2B7K A;  2GT6 A;  1WOU A;  1ZCP A;  2IN3 A;  4MF6 A;  4RQR A;  1U88 A;  3GYK A;  1PKZ A;  3FZ5 A;  3DEX A;  4ML1 A;  3CSH A;  2I3Y A;  2L57 A;  3ME8 A;  2WB9 A;  2LRT A;  4KCA A;  3F6F A;  4KGI A;  5JCW A;  3FR9 A;  1MD4 A;  4PNF A;  3HA9 A;  4O7H A;  3HVS A;  3IR4 A;  1PX7 A;  3IAS 2;  3TKS E;  3D4T A;  3HZ4 A;  2C3N A;  3TJB A;  3HCZ A;  2FGX A;  1G0T A;  3DXB A;  4CDO A;  2VD0 A;  5G31 A;  3I9V 2;  4IQA A;  3QCP A;  4KH7 A;  1M9B A;  1R26 A;  3EE2 A;  3BJ5 A;  1SJI A;  2AHE A;  3UBL A;  2WRT A;  6GSW A;  5DAK A;  2M46 A;  1TW9 A;  2JSZ A;  5F8B A;  2DJ0 A;  3QAW A;  3LXT A;  4FYU A;  4K7N A;  4JZQ A;  1YDK A;  2EIO A;  3A3T A;  4FYC A;  3GKM A;  4IQ1 A;  3C8E A;  2F8F A;  4JBB A;  1OC9 A;  2HYX A;  3KH9 A;  5IQY A;  5ECN B;  1K0C A;  4HS1 A;  2O7K A;  5A4U A;  3CXG A;  3LEF A;  2JZR A;  5KN2 A;  4J57 E;  3H4K A;  1XWC A;  3ISO A;  5LNK e;  3V1W A;  5E59 A;  3U6V A;  3KGK A;  5EY6 A;  2P5Q A;  2F9S A;  1TRU A;  3PH9 A;  4ZBD A;  3G7I A;  2L4C A;  1YZX A;  1ML6 A;  4PX1 A;  4K0G A;  4HQS A;  1PN9 A;  4AJ6 A;  1V40 A;  4MAB A;  4F03 A;  3UAP A;  2CT6 A;  4ISD A;  2KLX A;  3OR5 A;  1K3L A;  4NPB A;  1ZGN A;  4L0U A;  7GSS A;  3M1G A;  1JZW A;  5J4U A;  3C1R A;  2DJ2 A;  5EVO A;  4N0Z A;  1YF1 A;  1RW1 A;  2V1M A;  3UJ1 A;  1THO A;  5IMA A;  1WRY A;  2AAW A;  1ZZY A;  4F2I A;  1T7P B;  1DBY A;  2OAC A;  3ZRE A;  2G2Q A;  3ZL5 A;  5IMD A;  3DGQ A;  2XBI A;  2PN8 A;  2KHP A;  2V6K A;  2YZH A;  1O6J A;  4MJE A;  4LMW A;  1NSW A;  5AIV A;  1WIK A;  2WDU A;  3F9U A;  4JR6 A;  2HSY A;  2YCD A;  3H8Q A;  4QL9 A;  2H6Z A;  3KEB A;  2F51 A;  5F07 A;  2DBC A;  4XCS A;  1J9B A;  3M3M A;  1AQX A;  1K3Y A;  2YJ7 A;  3KCM A;  4WBR D;  1YF0 A;  4EL1 A;  5ECH B;  2CZ3 A;  1V2A A;  4MH3 A;  3TUE A;  3VK9 A;  1PRX A;  4NHW A;  2IFQ B;  1V58 A;  4KW6 A;  3TKS A;  2HZF A;  4IJI A;  2L6C A;  1EZK A;  2GSQ A;  4OCE A;  4L0W A;  5CO3 A;  4KB3 A;  4OWY A;  1HYU A;  4WR4 A;  2C8U A;  3O6T A;  4HQZ A;  5DCH A;  1XW6 A;  5ECR B;  3IOS A;  2IPA A;  2YZU A;  1FO5 A;  2LS5 A;  1G6Y A;  3WYW A;  3KTB A;  18GS A;  3TOU A;  2WUL A;  1B9Y C;  2YJH A;  3AY8 A;  4D73 B;  2EIR A;  3VLN A;  5D9V A;  19GS A;  2FA4 A;  3GTU B;  3LOR A;  3ZVJ D;  4ECC A;  3WT2 A;  4IP1 A;  3UVT A;  5CNW A;  1AQW A;  1OE7 A;  4ACS A;  3F4R A;  4N11 A;  3BOA A;  1TK0 B;  2ZCT A;  2I4A A;  1GL8 A;  2VIM A;  3TJK A;  4ZB8 A;  3HJO A;  4FYB A;  4IN0 A;  4MJA A;  2HSH A;  3EUR A;  3TRP A;  1LU4 A;  4IGJ A;  4WKW A;  3TB2 A;  3WT1 A;  6GSX A;  4ZL7 A;  1BJX A;  1GTA A;  1QUW A;  1S3D A;  1B48 A;  2H6X A;  4EXJ A;  2ON5 A;  2VCV A;  2LJA A;  4MMM A;  1T8E B;  3IE3 A;  2JL4 A;  3CBU A;  1EEJ A;  1PMT A;  1SK1 A;  1T4Z A;  3Q74 A;  5ECL B;  5ECS A;  5KN1 A;  1E6B A;  5D93 A;  5IOX A;  2IJY A;  4D73 A;  1B4Q A;  1U87 A;  5DBQ A;  1SK2 A;  4KDU A;  5IO0 A;  12GS A;  5DAL B;  4FIW A;  4GST A;  1H75 A;  2NDO A;  5KN3 A;  2DJ1 A;  5B8B A;  1EP8 A;  3GKN A;  1TJD A;  4N10 A;  3VWV A;  4JE1 A;  2M72 A;  5G1L A;  3UAR A;  5B6M A;  2OJL A;  4K1F A;  1VF4 A;  2C3Q A;  1TOF A;  4K9Z A;  5F05 A;  5ABR A;  3GL3 A;  3TKQ A;  3M9J A;  4J56 E;  1A2M A;  4HU7 A;  1NM3 A;  4OO5 A;  1I9D A;  4HOJ A;  3HZ8 A;  5HQP A;  1XWK A;  2X8C A;  8GSS A;  1PL1 A;  1XFL A;  5FHI A;  4ID0 A;  4HU9 A;  2FWH A;  2H0H A;  11GS A;  1TK8 B;  1GTI A;  2C1Y A;  3UEM A;  2IWT A;  2H0I A;  3VFI A;  4TXO B;  2FHE A;  3GST A;  2HRF A;  2VCT A;  5DQY A;  2IMI A;  4POB A;  4E8H A;  3GFK A;  4Q5N A;  1M2B A;  4JED A;  3FHK A;  2HZE B;  4G2E A;  2H6Y A;  3DVW A;  2GSR A;  1TXX A;  3IXR A;  3CTF A;  3PIN A;  3GIX A;  1OE8 A;  5DJM A;  1B4P A;  3VPQ A;  3ZVJ A;  1ZYQ B;  5A4V A;  4GRF A;  3I69 A;  4EUY A;  3BD2 A;  3F3Q A;  5E4W A;  5GAN D;  3BCK A;  1XW5 A;  4I97 A;  3QPM A;  4GSS A;  3TCO A;  2CZ2 A;  2MMO A;  2N5A A;  4TN8 A;  3ERF A;  3HDC A;  3MWH A;  3WGD A;  5ID2 B;  1GUL A;  3RHB A;  3RDW A;  4JR4 A;  3D6I A;  3FEU A;  4KA0 A;  1HD2 A;  1XIY A;  2B3S A;  2FUG 2; 
#chains in the Genus database with same CATH topology
 1EWX A;  4TXO A;  2QC7 A;  1C72 A;  3UIW A;  4EE0 A;  4XTS A;  3NOF A;  2YOI A;  1EP7 A;  2TRC P;  2HLS A;  5IMZ A;  2HZE A;  2R5G A;  3R2Q A;  2FNO A;  3GL5 A;  2DIZ A;  2VUP A;  1MTC A;  2NPB A;  1GRX A;  3GSS A;  3VI7 A;  2C0E A;  4BWQ A;  2XBQ A;  1T4Y A;  2GZY A;  5CRE A;  4RUV A;  2VL2 C;  1FVK A;  1YQ1 A;  1YJ6 A;  1EOH A;  1WPI A;  4V2M A;  1FOV A;  3F4T A;  2HRN A;  2WCI A;  4XS4 A;  1SU9 A;  2GQL A;  5AGY A;  4Q5R A;  5IPG A;  5G1K A;  1CQH A;  2VCW A;  3LJR A;  4DEJ A;  1N2A A;  2C80 A;  2KUC A;  2ZNM A;  1GLP A;  2RII A;  4TR1 A;  3JCM L;  1RK4 A;  4EVM A;  2C0G A;  1EEM A;  3DML A;  1N8J A;  2GSS A;  2GZP A;  3KD0 A;  3L4N A;  2WZ9 A;  4PXO A;  2YNX A;  4BVX A;  4MZC A;  3D21 A;  4FQU A;  5J5N A;  1K3O A;  3H79 A;  2R37 A;  3S9F A;  2E7P A;  4ML6 A;  1JHB A;  1ZOF A;  1AAZ A;  4NMU A;  1B9X C;  1X5C A;  3US3 A;  3G7J A;  1GNE A;  3RHC A;  2WS2 A;  2K9F A;  3HVX A;  5D8I A;  1KBN A;  1S3C A;  3C7M A;  3HYP A;  3KM6 A;  1M0U A;  3GH6 A;  1UA5 A;  2LQO A;  4DSR A;  3O76 A;  3F4S A;  4ZL9 A;  2PU9 C;  5J41 A;  1F3B A;  3KIJ A;  3BBY A;  5ECM B;  4HEA 2;  4I6X A;  2LTK A;  3GX8 A;  3P2A A;  2H75 A;  4PTS A;  3C73 A;  1UN2 A;  1F2E A;  2C0D A;  2GVP A;  4MF5 A;  1SKS B;  3LQ7 A;  4GQC A;  2X64 A;  3H93 A;  2LRC A;  5H5S A;  3UMA A;  4XHM A;  4GXZ A;  2GTU A;  3A5W A;  4K2D A;  4QL7 A;  1GSF A;  1FVJ A;  1J0F A;  1OC3 A;  5CRD A;  1Y25 A;  3P8W A;  1TTZ A;  1X9M B;  1GUK A;  3DIE A;  4KE3 A;  3EIN A;  1TU7 A;  4P3Y B;  5G2Z A;  2X49 A;  2C4J A;  3HVV A;  1MDI A;  3IHG A;  4IW9 A;  1PKW A;  4WF5 A;  1MEK A;  1Q98 A;  3W8S A;  1ERW A;  3MYD A;  3L0H A;  3QMX A;  4L5L A;  3EMX A;  2EIQ A;  3R3E A;  5G5E A;  2WJU A;  1SJ6 A;  2VM2 A;  3LGC A;  3UVH A;  3TJF A;  4MJB A;  4YAP A;  2Z9S A;  2PER A;  4O5R A;  2KP1 A;  4TKY A;  1XWA A;  1XCC A;  1BX9 A;  1FHE A;  2ES7 A;  5A5K A;  4G19 A;  3DVX A;  1HNB A;  2REM A;  2MBT A;  1QXH A;  3ERG A;  2PWJ A;  2B5Y A;  1BAY A;  9GSS A;  1O73 A;  1SYX A;  4CW9 A;  1OVN A;  1GSE A;  4KND A;  1XVQ A;  4N30 A;  3GN3 A;  1PQN A;  1A23 A;  1IYH A;  22GS A;  4OCF A;  3F63 A;  1QK8 A;  1GSY A;  1ON4 A;  1AXD A;  3DRN A;  4F82 A;  3HJP A;  4F0B A;  3TGZ A;  2P0G A;  1ACV A;  1Z6N A;  1ERT A;  3ZRD A;  3DKS A;  3WGX A;  2XPE A;  5C00 A;  2C3T A;  4IHU A;  4I8B A;  3TKP A;  4KCE A;  3IK9 A;  5DVB A;  5CYY A;  4K2X A;  6GSS A;  1I5G A;  1EV4 A;  1XZO A;  4ZB6 A;  5ELG A;  4ZIL A;  1EV9 A;  4KAE A;  2MYG A;  3FK8 A;  3H1N A;  3P7X A;  3O3T A;  1JFU A;  4AGS A;  2DJJ A;  3FZ9 A;  3QAV A;  1BED A;  4KSM A;  2HT9 A;  13GS A;  3FKF A;  4KDY A;  5JWR B;  2CA8 A;  1SKW B;  3L78 A;  2UZ8 A;  3VWU A;  2G0F A;  1PA3 A;  4OFM A;  3LG6 A;  1SK0 A;  3VWW A;  4V2L A;  4N0V A;  1ST9 A;  4EF0 A;  2GZZ A;  4K7I A;  5KN0 A;  2VO4 A;  1XW9 A;  2VCX A;  4GWR A;  2BMX A;  5H5Q A;  4MA9 A;  2OKA A;  4WET A;  3F6D A;  2OBI A;  2DJK A;  3ZZX A;  2LNT A;  3CRU A;  1AUC A;  1TDI A;  4K8M A;  3EMP A;  2DSA A;  1PGT A;  2VLU A;  3Q19 A;  3QFB C;  2IMD A;  2GT5 A;  5C04 A;  3VI5 A;  2EC4 A;  3IV4 A;  4O32 A;  4O92 A;  2ALB A;  1V9W A;  3ME7 A;  5D9T A;  2DIY A;  4WXT A;  2NBS A;  1SL0 B;  1W89 A;  3FMW A;  4DSQ A;  1GUH A;  1E2Y A;  1USB A;  4K0N A;  5J3R A;  2H1B A;  1F37 A;  2M80 A;  4FH8 A;  1S3A A;  5FT3 A;  5JWQ B;  4ZIJ A;  2CAQ A;  5CRH A;  4DVC A;  4PQ1 A;  4WBJ A;  2FY6 A;  1PX6 A;  4K5R A;  1T3B A;  5COH A;  2GQM A;  1TKD B;  3KMN A;  2DML A;  4KF9 A;  3F0I A;  2N5F A;  2IFQ A;  5HR2 A;  5AN1 A;  1BYE A;  2DJ3 A;  3GKX A;  2RM5 A;  3ZMK A;  3I6A A;  10GS A;  1X0R A;  6GSU A;  1ZYN A;  5HR3 A;  2GDR A;  4Z7X A;  1QMV A;  5GZZ B;  1DE1 A;  1FB6 A;  2I81 A;  4OFT A;  4MPF A;  2H1A A;  3QAG A;  4I5Q A;  1A2L A;  3IRA A;  2J23 A;  4YH2 A;  4PQH A;  2JAD A;  2YWN A;  1A8Y A;  5IMF A;  5B6N A;  3RPP A;  4POL A;  5ECO B;  2CX4 A;  4HI7 A;  3MAK A;  2IMF A;  1LBK A;  4PUA A;  3IC8 A;  5ECP B;  3GTU A;  4BL7 B;  3GX0 A;  2A4V A;  3VPT A;  1X5E A;  2H74 A;  4KSO A;  4MP4 A;  3ED3 A;  3LFL A;  1SYR A;  4X1U A;  2VOC A;  2GLR A;  2L59 A;  3UOM A;  4PNG A;  1T1V A;  1M9A A;  1AW9 A;  2YWI A;  3LSZ A;  1ZYE A;  5HFK A;  3CSJ A;  4CHS A;  3SBC A;  4BPY A;  3QOU A;  5ENU A;  6GSY A;  2PPT A;  2VL3 A;  2B7J A;  3EPT A;  1A2J A;  2MMZ A;  3TKS C;  5CAX A;  3ZLP A;  1MD3 A;  4GCI A;  1TRW A;  3APQ A;  1O8W A;  1FB0 A;  4ZXG A;  5EL8 A;  4MZW A;  1TI1 A;  4YQU A;  3IK7 A;  4MNN A;  4RI7 A;  2GGT A;  2LQQ A;  1G7E A;  1GUM A;  3CSI A;  2I1U A;  2P5R A;  2FA8 A;  4IEL A;  2H0G A;  1DE2 A;  2HXK A;  1YEP A;  1SJZ A;  5DAL A;  4GQF A;  4L5O A;  2LEG A;  2L6D A;  5IMV A;  1TRS A;  1A0R P;  3ZTL A;  1GSD A;  2JZS A;  3G9B A;  5F06 A;  3D4M A;  4ZBA A;  2GQK A;  2H1G A;  1TP9 A;  2PGT A;  1V98 A;  2F3M A;  4GF0 A;  1FW1 A;  4DSS B;  3ZML A;  1SD8 A;  2YAN A;  4PGT A;  1X9W B;  5GST A;  3PGT A;  3A2V A;  3TJJ A;  1JZD A;  4EKZ A;  2B5E A;  5L71 A;  5ECK B;  4IP6 A;  5HFI A;  2HSM A;  1GNW A;  3FR3 A;  4YKF A;  3D0Z A;  2VD1 A;  2LJK A;  3MSZ A;  2HFD A;  3QR6 A;  4MF7 A;  4RQX A;  1W4V A;  1RQM A;  2RM6 A;  4G0L A;  4WEY A;  2LV3 A;  2KP2 A;  2FWG A;  2XPD A;  2N5B A;  1YKC A;  3D5J A;  1X9S B;  5F0G A;  5CP1 A;  4WR5 A;  2JZT A;  1FG4 A;  2HNL A;  4NHZ A;  2BJX A;  1K0B A;  1BG5 A;  2D2Z A;  2X99 A;  1FAA A;  3KMO A;  1TK5 B;  4TW5 A;  2CQ9 A;  3IC4 A;  3RPN A;  3HD5 A;  3SWL A;  3GKK A;  4DSS A;  1XOA A;  4O5U A;  2V32 A;  1AIU A;  3KP8 A;  1GH2 A;  2YWO A;  5LD0 A;  3TDG A;  4HDE A;  4X43 A;  5BRT A;  4NWY A;  2A2P A;  4IKH A;  3WD6 A;  2QA2 A;  5IMC A;  1Z3E A;  3NIV A;  1TU8 A;  20GS A;  2RUE A;  5ID2 A;  4POK A;  1WP0 A;  1WJK A;  4Q5Q A;  5BMU A;  2E2G A;  5IO2 A;  2PUK C;  2OE0 A;  5EPF A;  1M2D A;  3EYT A;  3IPZ A;  1G7O A;  5D9W A;  2FWE A;  2H72 A;  4MK3 A;  5DAK B;  3CYN A;  3TRX A;  3W6G A;  5INY A;  16GS A;  3M8N A;  5GSS A;  4L8E A;  3TJG A;  1WWJ A;  2LST A;  2GS3 A;  4IJ3 A;  3QFA C;  4ECI A;  3FY7 A;  5HR1 A;  2FLS A;  1OC9 B;  2DC5 A;  2H66 A;  2L5L A;  4YQM A;  1TRV A;  1PSQ A;  4YKG A;  6GST A;  2LKU A;  2O85 A;  2CV4 A;  1ERV A;  4MZB A;  1A0F A;  5IPH A;  5JWO B;  2MMA A;  2YV7 A;  4G0I A;  3F8U A;  5DDL A;  2MZC A;  2DMM A;  4LLR A;  2DLX A;  4ECB A;  2PVQ A;  4GLT A;  1WE0 A;  3RBT A;  4GSN A;  14GS A;  3IHQ A;  3UBK A;  4X4J A;  4EC0 A;  3K8N A;  2CX3 A;  3TOT A;  4TVE A;  2I9H A;  1Q4J A;  1QQ2 A;  3G7Y A;  1QGV A;  4ILF A;  4YQV A;  1XG8 A;  2ZUP A;  1OKD A;  2CVK A;  1DUG A;  1M3I A;  4EDY A;  4XS6 A;  3FYG A;  2YP6 A;  1M99 A;  3M0F A;  5IOW A;  3ZFB A;  1R5A A;  1GLQ A;  1EGO A;  4IS0 A;  2H70 A;  1Z9H A;  1XBS A;  2AJQ B;  1VGL A;  1QFN A;  1GTU A;  3LYP A;  1J08 A;  1ILO A;  1KTE A;  2E2M A;  3IAM 2;  5IIZ A;  3QDN A;  3KP9 A;  1XWG A;  1DSB A;  1KNG A;  2IL3 A;  3PR8 A;  4MLY A;  1ERU A;  1GSS A;  3QD9 A;  4XIH A;  5D9X A;  4V1A p;  3KH7 A;  1Z7P A;  1O85 A;  1TI3 A;  5AIS A;  2FCH A;  4E8E A;  3RAZ A;  1Z6M A;  1GTB A;  2LUS A;  4I2U A;  1U3I A;  1HQO A;  2X4A A;  3CMI A;  4XS1 A;  5GAP D;  4IBP A;  1R4W A;  2MBS A;  4NXI A;  5J9B A;  2K18 A;  1ZL9 A;  2BTO T;  2V6O A;  4NV2 A;  3DWV A;  2B6M A;  2VCZ A;  4GTU A;  3A2W A;  2H01 A;  1URM A;  4HZ4 A;  2WGR A;  4BVY B;  2E0Q A;  4HZ2 A;  1K0N A;  2R0C A;  2AYT A;  3IA1 A;  4HSC X;  2VAF A;  3GA4 A;  4EDZ A;  4AF2 A;  1YEX A;  2JSY A;  3LYK A;  3EC3 A;  1ABA A;  1JLW A;  1O8X A;  2CVB A;  1GWC A;  3VUR A;  3GNJ A;  4PUR A;  2IME A;  1OKT A;  1Z7R A;  4TR4 A;  17GS A;  4TR0 A;  2B1K A;  4ECJ A;  4TR3 A;  3CQF A;  3ERW A;  3HKR A;  4I2T A;  1CQG A;  5FWG A;  4NV5 A;  3GHA A;  1MDK A;  1H4O A;  2RUF A;  3KZQ A;  2V41 A;  4F0C A;  4XRA A;  5ECI B;  2CAI A;  5A4W A;  2B1L A;  3C71 A;  1YKA A;  3IDV A;  4H86 A;  4G10 A;  4MPG A;  4HJ2 A;  4ZL8 A;  1SD9 A;  4BWS A;  2O87 A;  4KUN A;  3GUR A;  4K6X A;  2FD3 A;  1XVW A;  4BVY A;  5HR0 A;  1VRS D;  2XHF A;  2H73 A;  2PBJ A;  2TIR A;  4QQ7 A;  2PVO C;  3U5R E;  3ZIJ A;  3DD3 A;  1K0M A;  4KDX A;  3KXO A;  3VWX A;  3FW2 A;  5B8A A;  1UC7 A;  4JU5 A;  3LXZ A;  5DQS A;  2OBK A;  4Z2U A;  4JRR A;  2V2G A;  4A5P A;  3EWL A;  3EVI A;  1EGR A;  2GST A;  1XXU A;  1GSQ A;  2LJR A;  4Q5F A;  3J7Y b;  1V57 A;  4ZB9 A;  1MDJ A;  2FWF A;  4Z2T A;  2R6K A;  1GP1 A;  1PL2 A;  4AJ8 A;  4TOP A;  2MMN A;  1YY7 A;  2O8V B;  4TRX A;  2VL9 A;  2IIY A;  3GMF A;  2HI7 A;  2R3X A;  5IM9 A;  5G5F A;  1F3A A;  1M2A A;  2JU5 A;  5H5R A;  1THX A;  3KTL A;  3E0U A;  2C0F A;  2A2R A;  2LRN A;  3E3E A;  3A5I A;  2H71 A;  4XRD A;  3ZIT A;  3CTG A;  4MH2 A;  1OAZ A;  1SL1 B;  4O5Q A;  1JZR A;  4PQI A;  4MCU A;  4Z2R A;  2K6V A;  3BCI A;  1F6M C;  3WGE A;  1UVZ A;  1ZMA A;  3EU3 A;  2AV4 A;  3Q6O A;  4OMV A;  2P31 A;  2H8L A;  3M9K A;  2R0P A;  3ZIV A;  1AC1 A;  5CRW A;  3Q18 A;  3ZFL A;  2H76 A;  1HNA A;  2HRA A;  3FZ4 A;  2WFC A;  1SL2 B;  1VF2 A;  4G9H A;  2K8V A;  1OC8 A;  4K7O A;  3W8J A;  2X8H A;  2O89 A;  2VLT A;  3GRX A;  2H19 A;  5DJL A;  3L9V A;  1NHO A;  2YWM A;  3FZA A;  2R0G A;  1K0O A;  1T00 A;  3GUS A;  4HUA A;  3MDK A;  4POM A;  2NTO A;  3E9J B;  1GSU A;  2VL2 A;  4X0X A;  3N5O A;  3L9U A;  4OFN A;  4LMV A;  4FO5 A;  2AUV A;  4LA1 A;  5B7C A;  3CRT A;  1JZO A;  2OE1 A;  4V1A g;  1M7T A;  4IVF A;  5KEJ A;  3LW9 A;  4ICY A;  3HJM A;  4EO3 A;  3HXS A;  4ZBB A;  2JAC A;  1LJR A;  4NAX A;  4USS A;  2H1D A;  2XC2 A;  1NHY A;  4YAV A;  4WF4 A;  3APO A;  1KEB A;  4BL7 A;  4PUF C;  3UL3 A;  2PMT A;  1U3A A;  5G30 A;  2VLV A;  3N9J A;  5D73 A;  2OAD A;  1ZYP A;  1PD2 1;  1G6W A;  3MNG A;  4LL4 B;  3TRQ A;  2A2S A;  1AQV A;  3HY2 A;  1K0D A;  1A8L A;  4BA7 A;  2RLI A;  3L9S A;  1IYI A;  5D96 A;  1Z5Y E;  2KOK A;  4OO4 A;  2IMK A;  4V2N A;  3A2X A;  3IBH A;  1A24 A;  1NW2 A;  2YPM A;  4J2F A;  5ELA A;  4KX4 A;  4F9Z A;  3LWA A;  2L4Q A;  1SEN A;  1U6T A;  5DCG A;  2ON7 A;  3F3R A;  3APS A;  2CVD A;  1BQ7 A;  2R2J A;  2AB6 A;  1X5D A;  4XS4 B;  5ECQ B;  1WMJ A;  1VF3 A;  5CRG A;  2LNS A;  4OD7 A;  2F8A A;  3I43 A;  1PFO A;  5JCG A;  2NVL A;  1OYJ A;  5J9C A;  2TRX A;  2H30 A;  5AIX A;  1O81 A;  4HJM A;  2K8S A;  3MIX A;  4MJC A;  1HNC A;  4TR1 B;  2QSI A;  3KJY A;  2QKE A;  3J7Y k;  5KOX A;  1SKR B;  1FOH A;  2OA7 A;  2OE3 A;  3NZN A;  1VF1 A;  1K0A A;  5JCU A;  1XOB A;  4EIP A;  1JLV A;  2J9H A;  4RI6 A;  1EOG A;  1O7U A;  3GH9 A;  1S3R A;  2B5X A;  3FR6 A;  2YV9 A;  4BVX B;  3FRC A;  2L5O A;  3EU4 A;  3P90 A;  2VCQ A;  2QGV A;  4LL1 B;  5HFG A;  1R5P A;  1R7H A;  2YN1 A;  3ZYW A;  3GV1 A;  1Y6E A;  2X8G A;  6GSV A;  1F9M A;  4MDC A;  4TXV A;  3HHV A;  4ULX A;  3TKR A;  3D22 A;  3C1S A;  5KOW A;  5LCZ A;  2R4V A;  3DYR A;  1XWB A;  1XPV A;  1B8X A;  2HE3 A;  4AJ7 A;  2VM1 A;  2B7K A;  2GT6 A;  1WOU A;  1ZCP A;  2IN3 A;  4MF6 A;  4RQR A;  1U88 A;  3GYK A;  1PKZ A;  3FZ5 A;  3DEX A;  4ML1 A;  3CSH A;  2I3Y A;  2L57 A;  3ME8 A;  2WB9 A;  3HVN A;  2LRT A;  4KCA A;  3F6F A;  4KGI A;  5JCW A;  3FR9 A;  1MD4 A;  4PNF A;  3HA9 A;  4O7H A;  3HVS A;  3IR4 A;  1PX7 A;  3IAS 2;  3TKS E;  3D4T A;  3HZ4 A;  2C3N A;  3TJB A;  3HCZ A;  2FGX A;  1G0T A;  3DXB A;  4CDO A;  2VD0 A;  5G31 A;  3I9V 2;  4IQA A;  3QCP A;  4KH7 A;  1M9B A;  1R26 A;  3EE2 A;  3BJ5 A;  1SJI A;  2AHE A;  3UBL A;  2WRT A;  6GSW A;  5DAK A;  2M46 A;  1TW9 A;  2JSZ A;  5F8B A;  2DJ0 A;  3QAW A;  3LXT A;  4FYU A;  4K7N A;  4JZQ A;  1YDK A;  2EIO A;  3A3T A;  4FYC A;  3GKM A;  4IQ1 A;  3C8E A;  2F8F A;  4JBB A;  1OC9 A;  2HYX A;  3KH9 A;  5IQY A;  5ECN B;  1K0C A;  4HS1 A;  2O7K A;  5A4U A;  3CXG A;  3LEF A;  2JZR A;  1PN0 A;  4K5S A;  5KN2 A;  4J57 E;  3H4K A;  1XWC A;  3ISO A;  5LNK e;  3V1W A;  5E59 A;  3U6V A;  3KGK A;  5EY6 A;  2DKH A;  2P5Q A;  2HRK A;  2F9S A;  1TRU A;  3PH9 A;  4ZBD A;  3G7I A;  2L4C A;  1YZX A;  1ML6 A;  4PX1 A;  4K0G A;  4HQS A;  1PN9 A;  4AJ6 A;  1V40 A;  4MAB A;  4F03 A;  3UAP A;  2CT6 A;  4ISD A;  2KLX A;  3OR5 A;  1K3L A;  4NPB A;  1ZGN A;  4L0U A;  7GSS A;  3M1G A;  1JZW A;  5J4U A;  3C1R A;  2DJ2 A;  5EVO A;  4N0Z A;  3PPU A;  1YF1 A;  1RW1 A;  2V1M A;  3UJ1 A;  1THO A;  5IMA A;  2DKI A;  1WRY A;  2AAW A;  1ZZY A;  4F2I A;  1T7P B;  1DBY A;  2OAC A;  3ZRE A;  2G2Q A;  3ZL5 A;  5IMD A;  4BIK A;  3DGQ A;  2XBI A;  2PN8 A;  2KHP A;  2V6K A;  2YZH A;  1O6J A;  4MJE A;  4LMW A;  1NSW A;  2QA1 A;  5AIV A;  1WIK A;  2WDU A;  3F9U A;  4JR6 A;  2HSY A;  2YCD A;  3H8Q A;  4QL9 A;  2H6Z A;  3KEB A;  2F51 A;  5F07 A;  2DBC A;  4XCS A;  1J9B A;  3M3M A;  4EIQ A;  1AQX A;  1K3Y A;  2YJ7 A;  3KCM A;  4WBR D;  1YF0 A;  4EL1 A;  5ECH B;  2CZ3 A;  1V2A A;  4MH3 A;  3TUE A;  3VK9 A;  1PRX A;  4NHW A;  2IFQ B;  1V58 A;  4KW6 A;  3TKS A;  2HZF A;  4IJI A;  2L6C A;  1EZK A;  2GSQ A;  4OCE A;  4L0W A;  5CO3 A;  4KB3 A;  4OWY A;  1HYU A;  4WR4 A;  2C8U A;  3O6T A;  4HQZ A;  5DCH A;  1XW6 A;  5ECR B;  3IOS A;  2IPA A;  2YZU A;  1FO5 A;  2LS5 A;  1G6Y A;  2A4H A;  3WYW A;  3KTB A;  1M3J A;  18GS A;  3TOU A;  2WUL A;  1B9Y C;  2YJH A;  3AY8 A;  4D73 B;  2EIR A;  3VLN A;  5D9V A;  19GS A;  2FA4 A;  3GTU B;  3LOR A;  3ZVJ D;  4ECC A;  3WT2 A;  4IP1 A;  3UVT A;  5CNW A;  1AQW A;  1OE7 A;  4ACS A;  4CY6 A;  3F4R A;  4N11 A;  3BOA A;  1TK0 B;  2ZCT A;  2I4A A;  1GL8 A;  2VIM A;  3TJK A;  4ZB8 A;  3HJO A;  4FYB A;  4IN0 A;  4MJA A;  2HSH A;  3EUR A;  3TRP A;  1LU4 A;  4IGJ A;  4WKW A;  3TB2 A;  3WT1 A;  6GSX A;  4ZL7 A;  1BJX A;  1GTA A;  1QUW A;  1S3D A;  1B48 A;  2H6X A;  4EXJ A;  2ON5 A;  2VCV A;  2LJA A;  4MMM A;  1T8E B;  3IE3 A;  2JL4 A;  3CBU A;  1EEJ A;  1PMT A;  1SK1 A;  1T4Z A;  3Q74 A;  5ECL B;  5ECS A;  5KN1 A;  1E6B A;  5D93 A;  5IOX A;  2IJY A;  4D73 A;  1B4Q A;  1U87 A;  5DBQ A;  1SK2 A;  4KDU A;  5IO0 A;  12GS A;  5DAL B;  4FIW A;  4GST A;  1H75 A;  2NDO A;  5KN3 A;  2DJ1 A;  5B8B A;  1EP8 A;  3GKN A;  1TJD A;  4N10 A;  3VWV A;  4JE1 A;  2M72 A;  5G1L A;  3UAR A;  5B6M A;  4G0K A;  2OJL A;  4K1F A;  1VF4 A;  2C3Q A;  1TOF A;  4K9Z A;  5F05 A;  5ABR A;  3GL3 A;  3TKQ A;  3M9J A;  4J56 E;  1A2M A;  4HU7 A;  1NM3 A;  4OO5 A;  1I9D A;  4HOJ A;  3HZ8 A;  5HQP A;  1XWK A;  2X8C A;  8GSS A;  1PL1 A;  1XFL A;  5FHI A;  4ID0 A;  4HU9 A;  2FWH A;  2H0H A;  11GS A;  1TK8 B;  1GTI A;  2C1Y A;  3UEM A;  2IWT A;  2H0I A;  3VFI A;  4TXO B;  2FHE A;  3GST A;  2HRF A;  2VCT A;  5DQY A;  2IMI A;  4POB A;  4E8H A;  3GFK A;  4Q5N A;  1M2B A;  4JED A;  3FHK A;  2HZE B;  4G2E A;  2H6Y A;  3DVW A;  2GSR A;  1TXX A;  3IXR A;  3CTF A;  3PIN A;  3GIX A;  1OE8 A;  5DJM A;  1B4P A;  3VPQ A;  3ZVJ A;  1ZYQ B;  5A4V A;  4GRF A;  3I69 A;  4EUY A;  3BD2 A;  3F3Q A;  5E4W A;  5GAN D;  3BCK A;  1XW5 A;  4I97 A;  3QPM A;  4GSS A;  3TCO A;  2CZ2 A;  2MMO A;  2N5A A;  4TN8 A;  3ERF A;  3HDC A;  3MWH A;  3WGD A;  5ID2 B;  1GUL A;  3RHB A;  3RDW A;  4JR4 A;  3D6I A;  3FEU A;  4KA0 A;  1HD2 A;  1XIY A;  2B3S A;  4CY8 A;  2FUG 2; 
#chains in the Genus database with same CATH homology
 1EWX A;  4TXO A;  2QC7 A;  1C72 A;  3UIW A;  4EE0 A;  4XTS A;  3NOF A;  2YOI A;  1EP7 A;  2TRC P;  2HLS A;  5IMZ A;  2HZE A;  2R5G A;  3R2Q A;  2FNO A;  3GL5 A;  2DIZ A;  2VUP A;  1MTC A;  2NPB A;  1GRX A;  3GSS A;  3VI7 A;  2C0E A;  4BWQ A;  2XBQ A;  1T4Y A;  2GZY A;  5CRE A;  4RUV A;  2VL2 C;  1FVK A;  1YQ1 A;  1YJ6 A;  1EOH A;  1WPI A;  4V2M A;  1FOV A;  3F4T A;  2HRN A;  2WCI A;  4XS4 A;  1SU9 A;  2GQL A;  5AGY A;  4Q5R A;  5IPG A;  5G1K A;  1CQH A;  2VCW A;  3LJR A;  4DEJ A;  1N2A A;  2C80 A;  2KUC A;  2ZNM A;  1GLP A;  2RII A;  4TR1 A;  3JCM L;  1RK4 A;  4EVM A;  2C0G A;  1EEM A;  3DML A;  1N8J A;  2GSS A;  2GZP A;  3KD0 A;  3L4N A;  2WZ9 A;  4PXO A;  2YNX A;  4BVX A;  4MZC A;  3D21 A;  4FQU A;  5J5N A;  1K3O A;  3H79 A;  2R37 A;  3S9F A;  2E7P A;  4ML6 A;  1JHB A;  1ZOF A;  1AAZ A;  4NMU A;  1B9X C;  1X5C A;  3US3 A;  3G7J A;  1GNE A;  3RHC A;  2WS2 A;  2K9F A;  3HVX A;  5D8I A;  1KBN A;  1S3C A;  3C7M A;  3HYP A;  3KM6 A;  1M0U A;  3GH6 A;  1UA5 A;  2LQO A;  4DSR A;  3O76 A;  3F4S A;  4ZL9 A;  2PU9 C;  5J41 A;  1F3B A;  3KIJ A;  3BBY A;  5ECM B;  4HEA 2;  4I6X A;  2LTK A;  3GX8 A;  3P2A A;  2H75 A;  4PTS A;  3C73 A;  1UN2 A;  1F2E A;  2C0D A;  2GVP A;  4MF5 A;  1SKS B;  3LQ7 A;  4GQC A;  2X64 A;  3H93 A;  2LRC A;  5H5S A;  3UMA A;  4XHM A;  4GXZ A;  2GTU A;  3A5W A;  4K2D A;  4QL7 A;  1GSF A;  1FVJ A;  1J0F A;  1OC3 A;  5CRD A;  1Y25 A;  3P8W A;  1TTZ A;  1X9M B;  1GUK A;  3DIE A;  4KE3 A;  3EIN A;  1TU7 A;  4P3Y B;  5G2Z A;  2X49 A;  2C4J A;  3HVV A;  1MDI A;  3IHG A;  4IW9 A;  1PKW A;  4WF5 A;  1MEK A;  1Q98 A;  3W8S A;  1ERW A;  3MYD A;  3L0H A;  3QMX A;  4L5L A;  3EMX A;  2EIQ A;  3R3E A;  5G5E A;  2WJU A;  1SJ6 A;  2VM2 A;  3LGC A;  3UVH A;  3TJF A;  4MJB A;  4YAP A;  2Z9S A;  2PER A;  4O5R A;  2KP1 A;  4TKY A;  1XWA A;  1XCC A;  1BX9 A;  1FHE A;  2ES7 A;  5A5K A;  4G19 A;  3DVX A;  1HNB A;  2REM A;  2MBT A;  1QXH A;  3ERG A;  2PWJ A;  2B5Y A;  1BAY A;  9GSS A;  1O73 A;  1SYX A;  4CW9 A;  1OVN A;  1GSE A;  4KND A;  1XVQ A;  4N30 A;  3GN3 A;  1PQN A;  1A23 A;  1IYH A;  22GS A;  4OCF A;  3F63 A;  1QK8 A;  1GSY A;  1ON4 A;  1AXD A;  3DRN A;  4F82 A;  3HJP A;  4F0B A;  3TGZ A;  2P0G A;  1ACV A;  1Z6N A;  1ERT A;  3ZRD A;  3DKS A;  3WGX A;  2XPE A;  5C00 A;  2C3T A;  4IHU A;  4I8B A;  3TKP A;  4KCE A;  3IK9 A;  5DVB A;  5CYY A;  4K2X A;  6GSS A;  1I5G A;  1EV4 A;  1XZO A;  4ZB6 A;  5ELG A;  4ZIL A;  1EV9 A;  4KAE A;  2MYG A;  3FK8 A;  3H1N A;  3P7X A;  3O3T A;  1JFU A;  4AGS A;  2DJJ A;  3FZ9 A;  3QAV A;  1BED A;  4KSM A;  2HT9 A;  13GS A;  3FKF A;  4KDY A;  5JWR B;  2CA8 A;  1SKW B;  3L78 A;  2UZ8 A;  3VWU A;  2G0F A;  1PA3 A;  4OFM A;  3LG6 A;  1SK0 A;  3VWW A;  4V2L A;  4N0V A;  1ST9 A;  4EF0 A;  2GZZ A;  4K7I A;  5KN0 A;  2VO4 A;  1XW9 A;  2VCX A;  4GWR A;  2BMX A;  5H5Q A;  4MA9 A;  2OKA A;  4WET A;  3F6D A;  2OBI A;  2DJK A;  3ZZX A;  2LNT A;  3CRU A;  1AUC A;  1TDI A;  4K8M A;  3EMP A;  2DSA A;  1PGT A;  2VLU A;  3Q19 A;  3QFB C;  2IMD A;  2GT5 A;  5C04 A;  3VI5 A;  2EC4 A;  3IV4 A;  4O32 A;  4O92 A;  2ALB A;  1V9W A;  3ME7 A;  5D9T A;  2DIY A;  4WXT A;  2NBS A;  1SL0 B;  1W89 A;  3FMW A;  4DSQ A;  1GUH A;  1E2Y A;  1USB A;  4K0N A;  5J3R A;  2H1B A;  1F37 A;  2M80 A;  4FH8 A;  1S3A A;  5FT3 A;  5JWQ B;  4ZIJ A;  2CAQ A;  5CRH A;  4DVC A;  4PQ1 A;  4WBJ A;  2FY6 A;  1PX6 A;  4K5R A;  1T3B A;  5COH A;  2GQM A;  1TKD B;  3KMN A;  2DML A;  4KF9 A;  3F0I A;  2N5F A;  2IFQ A;  5HR2 A;  5AN1 A;  1BYE A;  2DJ3 A;  3GKX A;  2RM5 A;  3ZMK A;  3I6A A;  10GS A;  1X0R A;  6GSU A;  1ZYN A;  5HR3 A;  2GDR A;  4Z7X A;  1QMV A;  5GZZ B;  1DE1 A;  1FB6 A;  2I81 A;  4OFT A;  4MPF A;  2H1A A;  3QAG A;  4I5Q A;  1A2L A;  3IRA A;  2J23 A;  4YH2 A;  4PQH A;  2JAD A;  2YWN A;  1A8Y A;  5IMF A;  5B6N A;  3RPP A;  4POL A;  5ECO B;  2CX4 A;  4HI7 A;  3MAK A;  2IMF A;  1LBK A;  4PUA A;  3IC8 A;  5ECP B;  3GTU A;  4BL7 B;  3GX0 A;  2A4V A;  3VPT A;  1X5E A;  2H74 A;  4KSO A;  4MP4 A;  3ED3 A;  3LFL A;  1SYR A;  4X1U A;  2VOC A;  2GLR A;  2L59 A;  3UOM A;  4PNG A;  1T1V A;  1M9A A;  1AW9 A;  2YWI A;  3LSZ A;  1ZYE A;  5HFK A;  3CSJ A;  4CHS A;  3SBC A;  4BPY A;  3QOU A;  5ENU A;  6GSY A;  2PPT A;  2VL3 A;  2B7J A;  3EPT A;  1A2J A;  2MMZ A;  3TKS C;  5CAX A;  3ZLP A;  1MD3 A;  4GCI A;  1TRW A;  3APQ A;  1O8W A;  1FB0 A;  4ZXG A;  5EL8 A;  4MZW A;  1TI1 A;  4YQU A;  3IK7 A;  4MNN A;  4RI7 A;  2GGT A;  2LQQ A;  1G7E A;  1GUM A;  3CSI A;  2I1U A;  2P5R A;  2FA8 A;  4IEL A;  2H0G A;  1DE2 A;  2HXK A;  1YEP A;  1SJZ A;  5DAL A;  4GQF A;  4L5O A;  2LEG A;  2L6D A;  5IMV A;  1TRS A;  1A0R P;  3ZTL A;  1GSD A;  2JZS A;  3G9B A;  5F06 A;  3D4M A;  4ZBA A;  2GQK A;  2H1G A;  1TP9 A;  2PGT A;  1V98 A;  2F3M A;  4GF0 A;  1FW1 A;  4DSS B;  3ZML A;  1SD8 A;  2YAN A;  4PGT A;  1X9W B;  5GST A;  3PGT A;  3A2V A;  3TJJ A;  1JZD A;  4EKZ A;  2B5E A;  5L71 A;  5ECK B;  4IP6 A;  5HFI A;  2HSM A;  1GNW A;  3FR3 A;  4YKF A;  3D0Z A;  2VD1 A;  2LJK A;  3MSZ A;  2HFD A;  3QR6 A;  4MF7 A;  4RQX A;  1W4V A;  1RQM A;  2RM6 A;  4G0L A;  4WEY A;  2LV3 A;  2KP2 A;  2FWG A;  2XPD A;  2N5B A;  1YKC A;  3D5J A;  1X9S B;  5F0G A;  5CP1 A;  4WR5 A;  2JZT A;  1FG4 A;  2HNL A;  4NHZ A;  2BJX A;  1K0B A;  1BG5 A;  2D2Z A;  2X99 A;  1FAA A;  3KMO A;  1TK5 B;  4TW5 A;  2CQ9 A;  3IC4 A;  3RPN A;  3HD5 A;  3SWL A;  3GKK A;  4DSS A;  1XOA A;  4O5U A;  2V32 A;  1AIU A;  3KP8 A;  1GH2 A;  2YWO A;  5LD0 A;  3TDG A;  4HDE A;  4X43 A;  5BRT A;  4NWY A;  2A2P A;  4IKH A;  3WD6 A;  2QA2 A;  5IMC A;  1Z3E A;  3NIV A;  1TU8 A;  20GS A;  2RUE A;  5ID2 A;  4POK A;  1WP0 A;  1WJK A;  4Q5Q A;  5BMU A;  2E2G A;  5IO2 A;  2PUK C;  2OE0 A;  5EPF A;  1M2D A;  3EYT A;  3IPZ A;  1G7O A;  5D9W A;  2FWE A;  2H72 A;  4MK3 A;  5DAK B;  3CYN A;  3TRX A;  3W6G A;  5INY A;  16GS A;  3M8N A;  5GSS A;  4L8E A;  3TJG A;  1WWJ A;  2LST A;  2GS3 A;  4IJ3 A;  3QFA C;  4ECI A;  3FY7 A;  5HR1 A;  2FLS A;  1OC9 B;  2DC5 A;  2H66 A;  2L5L A;  4YQM A;  1TRV A;  1PSQ A;  4YKG A;  6GST A;  2LKU A;  2O85 A;  2CV4 A;  1ERV A;  4MZB A;  1A0F A;  5IPH A;  5JWO B;  2MMA A;  2YV7 A;  4G0I A;  3F8U A;  5DDL A;  2MZC A;  2DMM A;  4LLR A;  2DLX A;  4ECB A;  2PVQ A;  4GLT A;  1WE0 A;  3RBT A;  4GSN A;  14GS A;  3IHQ A;  3UBK A;  4X4J A;  4EC0 A;  3K8N A;  2CX3 A;  3TOT A;  4TVE A;  2I9H A;  1Q4J A;  1QQ2 A;  3G7Y A;  1QGV A;  4ILF A;  4YQV A;  2ZUP A;  1OKD A;  2CVK A;  1DUG A;  4EDY A;  4XS6 A;  3FYG A;  2YP6 A;  1M99 A;  3M0F A;  5IOW A;  3ZFB A;  1R5A A;  1GLQ A;  1EGO A;  4IS0 A;  2H70 A;  1Z9H A;  1XBS A;  2AJQ B;  1VGL A;  1QFN A;  1GTU A;  3LYP A;  1J08 A;  1ILO A;  1KTE A;  2E2M A;  3IAM 2;  5IIZ A;  3QDN A;  3KP9 A;  1XWG A;  1DSB A;  1KNG A;  2IL3 A;  3PR8 A;  4MLY A;  1ERU A;  1GSS A;  3QD9 A;  4XIH A;  5D9X A;  4V1A p;  3KH7 A;  1Z7P A;  1O85 A;  1TI3 A;  5AIS A;  2FCH A;  4E8E A;  3RAZ A;  1Z6M A;  1GTB A;  2LUS A;  4I2U A;  1U3I A;  1HQO A;  2X4A A;  3CMI A;  4XS1 A;  5GAP D;  4IBP A;  1R4W A;  2MBS A;  4NXI A;  5J9B A;  2K18 A;  1ZL9 A;  2BTO T;  2V6O A;  4NV2 A;  3DWV A;  2B6M A;  2VCZ A;  4GTU A;  3A2W A;  2H01 A;  1URM A;  4HZ4 A;  2WGR A;  4BVY B;  2E0Q A;  4HZ2 A;  1K0N A;  2R0C A;  2AYT A;  3IA1 A;  2VAF A;  3GA4 A;  4EDZ A;  4AF2 A;  1YEX A;  2JSY A;  3LYK A;  3EC3 A;  1ABA A;  1JLW A;  1O8X A;  2CVB A;  1GWC A;  3VUR A;  3GNJ A;  4PUR A;  2IME A;  1OKT A;  1Z7R A;  4TR4 A;  17GS A;  4TR0 A;  2B1K A;  4ECJ A;  4TR3 A;  3ERW A;  3HKR A;  4I2T A;  1CQG A;  5FWG A;  4NV5 A;  3GHA A;  1MDK A;  1H4O A;  2RUF A;  3KZQ A;  2V41 A;  4F0C A;  4XRA A;  5ECI B;  2CAI A;  5A4W A;  2B1L A;  3C71 A;  1YKA A;  3IDV A;  4H86 A;  4G10 A;  4MPG A;  4HJ2 A;  4ZL8 A;  1SD9 A;  4BWS A;  2O87 A;  4KUN A;  3GUR A;  4K6X A;  2FD3 A;  1XVW A;  4BVY A;  5HR0 A;  1VRS D;  2XHF A;  2H73 A;  2PBJ A;  2TIR A;  4QQ7 A;  2PVO C;  3U5R E;  3ZIJ A;  3DD3 A;  1K0M A;  4KDX A;  3KXO A;  3VWX A;  3FW2 A;  5B8A A;  1UC7 A;  4JU5 A;  3LXZ A;  5DQS A;  2OBK A;  4Z2U A;  4JRR A;  2V2G A;  4A5P A;  3EWL A;  3EVI A;  1EGR A;  2GST A;  1XXU A;  1GSQ A;  2LJR A;  4Q5F A;  3J7Y b;  1V57 A;  4ZB9 A;  1MDJ A;  2FWF A;  4Z2T A;  2R6K A;  1GP1 A;  1PL2 A;  4AJ8 A;  4TOP A;  2MMN A;  1YY7 A;  2O8V B;  4TRX A;  2VL9 A;  2IIY A;  3GMF A;  2HI7 A;  2R3X A;  5IM9 A;  5G5F A;  1F3A A;  1M2A A;  2JU5 A;  5H5R A;  1THX A;  3KTL A;  3E0U A;  2C0F A;  2A2R A;  2LRN A;  3E3E A;  3A5I A;  2H71 A;  4XRD A;  3ZIT A;  3CTG A;  4MH2 A;  1OAZ A;  1SL1 B;  4O5Q A;  1JZR A;  4PQI A;  4MCU A;  4Z2R A;  2K6V A;  3BCI A;  1F6M C;  3WGE A;  1UVZ A;  1ZMA A;  3EU3 A;  2AV4 A;  3Q6O A;  4OMV A;  2P31 A;  2H8L A;  3M9K A;  2R0P A;  3ZIV A;  1AC1 A;  5CRW A;  3Q18 A;  3ZFL A;  2H76 A;  1HNA A;  2HRA A;  3FZ4 A;  2WFC A;  1SL2 B;  1VF2 A;  4G9H A;  2K8V A;  1OC8 A;  4K7O A;  3W8J A;  2X8H A;  2O89 A;  2VLT A;  3GRX A;  2H19 A;  5DJL A;  3L9V A;  1NHO A;  2YWM A;  3FZA A;  2R0G A;  1K0O A;  1T00 A;  3GUS A;  4HUA A;  3MDK A;  4POM A;  2NTO A;  3E9J B;  1GSU A;  2VL2 A;  4X0X A;  3N5O A;  3L9U A;  4OFN A;  4LMV A;  4FO5 A;  2AUV A;  4LA1 A;  5B7C A;  3CRT A;  1JZO A;  2OE1 A;  4V1A g;  1M7T A;  4IVF A;  5KEJ A;  3LW9 A;  4ICY A;  3HJM A;  4EO3 A;  3HXS A;  4ZBB A;  2JAC A;  1LJR A;  4NAX A;  4USS A;  2H1D A;  2XC2 A;  1NHY A;  4YAV A;  4WF4 A;  3APO A;  1KEB A;  4BL7 A;  4PUF C;  3UL3 A;  2PMT A;  1U3A A;  5G30 A;  2VLV A;  3N9J A;  5D73 A;  2OAD A;  1ZYP A;  1PD2 1;  1G6W A;  3MNG A;  4LL4 B;  3TRQ A;  2A2S A;  1AQV A;  3HY2 A;  1K0D A;  1A8L A;  4BA7 A;  2RLI A;  3L9S A;  1IYI A;  5D96 A;  1Z5Y E;  2KOK A;  4OO4 A;  2IMK A;  4V2N A;  3A2X A;  3IBH A;  1A24 A;  1NW2 A;  2YPM A;  4J2F A;  5ELA A;  4KX4 A;  4F9Z A;  3LWA A;  2L4Q A;  1SEN A;  1U6T A;  5DCG A;  2ON7 A;  3F3R A;  3APS A;  2CVD A;  1BQ7 A;  2R2J A;  2AB6 A;  1X5D A;  4XS4 B;  5ECQ B;  1WMJ A;  1VF3 A;  5CRG A;  2LNS A;  4OD7 A;  2F8A A;  3I43 A;  5JCG A;  2NVL A;  1OYJ A;  5J9C A;  2TRX A;  2H30 A;  5AIX A;  1O81 A;  4HJM A;  2K8S A;  3MIX A;  4MJC A;  1HNC A;  4TR1 B;  2QSI A;  3KJY A;  2QKE A;  3J7Y k;  5KOX A;  1SKR B;  1FOH A;  2OA7 A;  2OE3 A;  3NZN A;  1VF1 A;  1K0A A;  5JCU A;  1XOB A;  4EIP A;  1JLV A;  2J9H A;  4RI6 A;  1EOG A;  1O7U A;  3GH9 A;  2B5X A;  3FR6 A;  2YV9 A;  4BVX B;  3FRC A;  2L5O A;  3EU4 A;  3P90 A;  2VCQ A;  2QGV A;  4LL1 B;  5HFG A;  1R5P A;  1R7H A;  2YN1 A;  3ZYW A;  3GV1 A;  1Y6E A;  2X8G A;  6GSV A;  1F9M A;  4MDC A;  4TXV A;  3HHV A;  4ULX A;  3TKR A;  3D22 A;  3C1S A;  5KOW A;  5LCZ A;  2R4V A;  3DYR A;  1XWB A;  1XPV A;  1B8X A;  2HE3 A;  4AJ7 A;  2VM1 A;  2B7K A;  2GT6 A;  1WOU A;  1ZCP A;  2IN3 A;  4MF6 A;  4RQR A;  1U88 A;  3GYK A;  1PKZ A;  3FZ5 A;  3DEX A;  4ML1 A;  3CSH A;  2I3Y A;  2L57 A;  3ME8 A;  2WB9 A;  2LRT A;  4KCA A;  3F6F A;  4KGI A;  5JCW A;  3FR9 A;  1MD4 A;  4PNF A;  3HA9 A;  4O7H A;  3HVS A;  3IR4 A;  1PX7 A;  3IAS 2;  3TKS E;  3D4T A;  3HZ4 A;  2C3N A;  3TJB A;  3HCZ A;  2FGX A;  1G0T A;  3DXB A;  4CDO A;  2VD0 A;  5G31 A;  3I9V 2;  4IQA A;  3QCP A;  4KH7 A;  1M9B A;  1R26 A;  3EE2 A;  3BJ5 A;  1SJI A;  2AHE A;  3UBL A;  2WRT A;  6GSW A;  5DAK A;  2M46 A;  1TW9 A;  2JSZ A;  5F8B A;  2DJ0 A;  3QAW A;  3LXT A;  4FYU A;  4K7N A;  4JZQ A;  1YDK A;  2EIO A;  3A3T A;  4FYC A;  3GKM A;  4IQ1 A;  3C8E A;  2F8F A;  4JBB A;  1OC9 A;  2HYX A;  3KH9 A;  5IQY A;  5ECN B;  1K0C A;  4HS1 A;  2O7K A;  5A4U A;  3CXG A;  3LEF A;  2JZR A;  1PN0 A;  4K5S A;  5KN2 A;  4J57 E;  3H4K A;  1XWC A;  3ISO A;  5LNK e;  3V1W A;  5E59 A;  3U6V A;  3KGK A;  5EY6 A;  2DKH A;  2P5Q A;  2HRK A;  2F9S A;  1TRU A;  3PH9 A;  4ZBD A;  3G7I A;  2L4C A;  1YZX A;  1ML6 A;  4PX1 A;  4K0G A;  4HQS A;  1PN9 A;  4AJ6 A;  1V40 A;  4MAB A;  4F03 A;  3UAP A;  2CT6 A;  4ISD A;  2KLX A;  3OR5 A;  1K3L A;  4NPB A;  1ZGN A;  4L0U A;  7GSS A;  3M1G A;  1JZW A;  5J4U A;  3C1R A;  2DJ2 A;  5EVO A;  4N0Z A;  3PPU A;  1YF1 A;  1RW1 A;  2V1M A;  3UJ1 A;  1THO A;  5IMA A;  2DKI A;  1WRY A;  2AAW A;  1ZZY A;  4F2I A;  1T7P B;  1DBY A;  2OAC A;  3ZRE A;  2G2Q A;  3ZL5 A;  5IMD A;  3DGQ A;  2XBI A;  2PN8 A;  2KHP A;  2V6K A;  2YZH A;  1O6J A;  4MJE A;  4LMW A;  1NSW A;  2QA1 A;  5AIV A;  1WIK A;  2WDU A;  3F9U A;  4JR6 A;  2HSY A;  2YCD A;  3H8Q A;  4QL9 A;  2H6Z A;  3KEB A;  2F51 A;  5F07 A;  2DBC A;  4XCS A;  1J9B A;  3M3M A;  4EIQ A;  1AQX A;  1K3Y A;  2YJ7 A;  3KCM A;  4WBR D;  1YF0 A;  4EL1 A;  5ECH B;  2CZ3 A;  1V2A A;  4MH3 A;  3TUE A;  3VK9 A;  1PRX A;  4NHW A;  2IFQ B;  1V58 A;  4KW6 A;  3TKS A;  2HZF A;  4IJI A;  2L6C A;  1EZK A;  2GSQ A;  4OCE A;  4L0W A;  5CO3 A;  4KB3 A;  4OWY A;  1HYU A;  4WR4 A;  2C8U A;  3O6T A;  4HQZ A;  5DCH A;  1XW6 A;  5ECR B;  3IOS A;  2IPA A;  2YZU A;  1FO5 A;  2LS5 A;  1G6Y A;  2A4H A;  3WYW A;  3KTB A;  18GS A;  3TOU A;  2WUL A;  1B9Y C;  2YJH A;  3AY8 A;  4D73 B;  2EIR A;  3VLN A;  5D9V A;  19GS A;  2FA4 A;  3GTU B;  3LOR A;  3ZVJ D;  4ECC A;  3WT2 A;  4IP1 A;  3UVT A;  5CNW A;  1AQW A;  1OE7 A;  4ACS A;  4CY6 A;  3F4R A;  4N11 A;  3BOA A;  1TK0 B;  2ZCT A;  2I4A A;  1GL8 A;  2VIM A;  3TJK A;  4ZB8 A;  3HJO A;  4FYB A;  4IN0 A;  4MJA A;  2HSH A;  3EUR A;  3TRP A;  1LU4 A;  4IGJ A;  4WKW A;  3TB2 A;  3WT1 A;  6GSX A;  4ZL7 A;  1BJX A;  1GTA A;  1QUW A;  1S3D A;  1B48 A;  2H6X A;  4EXJ A;  2ON5 A;  2VCV A;  2LJA A;  4MMM A;  1T8E B;  3IE3 A;  2JL4 A;  3CBU A;  1EEJ A;  1PMT A;  1SK1 A;  1T4Z A;  3Q74 A;  5ECL B;  5ECS A;  5KN1 A;  1E6B A;  5D93 A;  5IOX A;  2IJY A;  4D73 A;  1B4Q A;  1U87 A;  5DBQ A;  1SK2 A;  4KDU A;  5IO0 A;  12GS A;  5DAL B;  4FIW A;  4GST A;  1H75 A;  2NDO A;  5KN3 A;  2DJ1 A;  5B8B A;  1EP8 A;  3GKN A;  1TJD A;  4N10 A;  3VWV A;  4JE1 A;  2M72 A;  5G1L A;  3UAR A;  5B6M A;  4G0K A;  2OJL A;  4K1F A;  1VF4 A;  2C3Q A;  1TOF A;  4K9Z A;  5F05 A;  5ABR A;  3GL3 A;  3TKQ A;  3M9J A;  4J56 E;  1A2M A;  4HU7 A;  1NM3 A;  4OO5 A;  1I9D A;  4HOJ A;  3HZ8 A;  5HQP A;  1XWK A;  2X8C A;  8GSS A;  1PL1 A;  1XFL A;  5FHI A;  4ID0 A;  4HU9 A;  2FWH A;  2H0H A;  11GS A;  1TK8 B;  1GTI A;  2C1Y A;  3UEM A;  2IWT A;  2H0I A;  3VFI A;  4TXO B;  2FHE A;  3GST A;  2HRF A;  2VCT A;  5DQY A;  2IMI A;  4POB A;  4E8H A;  3GFK A;  4Q5N A;  1M2B A;  4JED A;  3FHK A;  2HZE B;  4G2E A;  2H6Y A;  3DVW A;  2GSR A;  1TXX A;  3IXR A;  3CTF A;  3PIN A;  3GIX A;  1OE8 A;  5DJM A;  1B4P A;  3VPQ A;  3ZVJ A;  1ZYQ B;  5A4V A;  4GRF A;  3I69 A;  4EUY A;  3BD2 A;  3F3Q A;  5E4W A;  5GAN D;  3BCK A;  1XW5 A;  4I97 A;  3QPM A;  4GSS A;  3TCO A;  2CZ2 A;  2MMO A;  2N5A A;  4TN8 A;  3ERF A;  3HDC A;  3MWH A;  3WGD A;  5ID2 B;  1GUL A;  3RHB A;  3RDW A;  4JR4 A;  3D6I A;  3FEU A;  4KA0 A;  1HD2 A;  1XIY A;  2B3S A;  4CY8 A;  2FUG 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...