1W89A

Structure of the reduced form of human thioredoxin 2
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
110
structure length
110
Chain Sequence
b'HGSTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Crystal Structures of Oxidized and Reduced Forms of Human Mitochondrial Thioredoxin 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 33
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1w89A00
4WXTA 3RBTA 3LGCA 4GXZA 1WWJA 4ZB9A 2FY6A 5L71A 4WBRD 1M99A 1GULA 1JZOA 2I3YA 3M8NA 3LJRA 2VLUA 2WFCA 1T4YA 4GSSA 4OO4A 3TJGA 2YNXA 1IYHA 1SL2B 2LRTA 5IOWA 4AJ8A 3IR4A 2HZFA 1O8XA 3HKRA 3M9KA 4TR1B 5ECPB 4XS1A 2IL3A 4HU7A 2XPEA 5D9WA 2V41A 2L6CA 3GRXA 2K18A 4PURA 3RPNA 1THXA 2VL2C 2H01A 1O6JA 2OBKA 5DBQA 5CRGA 1THOA 2GT5A 5F05A 2WB9A 4MJAA 4MP4A 5F06A 2ON7A 4PUAA 2DJ0A 1V58A 2H70A 2BJXA 2O85A 3GL3A 3HJPA 1VF4A 2P0GA 1X0RA 3QR6A 2PGTA 1AW9A 2YANA 4JR4A 3LXZA 2GSTA 3M9JA 4V1Ag 2NDOA 2LJAA 2K9FA 4CDOA 4ILFA 2MMNA 2FWEA 2WRTA 2G0FA 2VCVA 2Z9SA 5IIZA 3L78A 2MBSA 4RUVA 4EXJA 1Y6EA 2VCWA 3FZ4A 4LA1A 2C3NA 2C4JA 2AYTA 5DJLA 2JL4A 2H0GA 3EURA 3M3MA 2KOKA 1XW5A 2LUSA 2FWHA 3F0IA 3DD3A 1VGLA 1FVJA 5EPFA 4HQSA 2J23A 2VL9A 4TW5A 2R6KA 4NV2A 3LORA 2PMTA 4EC0A 3DVWA 5IM9A 3W8JA 4KAEA 1GTIA 3EU3A 4MH3A 2JZTA 2FUG2 4K6XA 1YZXA 1XW9A 5GSTA 1GSQA 1ZGNA 1V9WA 1VRSD 1O85A 2RLIA 3D22A 3IDVA 2OE0A 1GLPA 4N30A 3CTGA 3EC3A 4XRDA 3VPQA 3UVHA 1SYXA 1PGTA 4HZ2A 2F9SA 4ECCA 1T7PB 3ZYWA 4OFTA 3UOMA 2YJHA 1ZL9A 1FB0A 2V6KA 4HJ2A 5A4WA 1LU4A 3U6VA 1HYUA 5EL8A 2F8FA 4KE3A 5H5QA 3ZREA 1K3YA 1PRXA 2B5YA 7GSSA 1E2YA 4WF4A 3F9UA 3L9VA 2V6OA 5GAPD 3VI5A 3FZ9A 4JZQA 5AN1A 2XHFA 5G2ZA 2H0HA 2IMDA 3IXRA 4GTUA 4OFMA 1U87A 1BAYA 1OE8A 4LLRA 1ACVA 4QL7A 2JSZA 4PUFC 1N8JA 2IWTA 4KNDA 2BTOT 4EKZA 1AIUA 3KCMA 4LMWA 4FO5A 3IA1A 1UA5A 3IV4A 3SBCA 3F3RA 2RM5A 5ID2A 3GNJA 5J3RA 2J9HA 2O7KA 4NHWA 2RUFA 1A2MA 1QQ2A 1XVWA 3WGEA 3ZITA 4V2LA 4BL7A 3F4SA 4AGSA 3I6AA 1FG4A 3TJKA 1YKAA 5ECKB 2FHEA 2GGTA 1TDIA 4J56E 4HS1A 2VM2A 2GSRA 4Z7XA 4MDCA 5ENUA 4KB3A 3LSZA 2JADA 3D0ZA 1ERVA 4OO5A 4ML1A 5ECOB 1PQNA 2OE1A 4LMVA 1EGOA 1GUKA 3E0UA 2I81A 2C3QA 1F9MA 1O8WA 4F0CA 2RUEA 3IK7A 4QQ7A 1TI1A 2H19A 5CP1A 1JLWA 3NIVA 2HRNA 1TU8A 4BVXA 3TB2A 3VURA 4PNGA 3N5OA 2X8CA 3EVIA 2F3MA 4G2EA 4YQUA 4WEYA 1ST9A 2O87A 3WGXA 4ZBDA 2LNSA 2V32A 4I6XA 5H5SA 3KTBA 4MJEA 2H6YA 2V2GA 2WULA 3VFIA 2H0IA 2XC2A 1CQGA 4GQFA 1F2EA 1YJ6A 4BWQA 2B5XA 4KCEA 2D2ZA 2FCHA 2GQLA 1SENA 2DIYA 1XWGA 3IK9A 4HZ4A 2YOIA 2VD1A 2KP2A 1T1VA 3CRTA 5DAKB 4MMMA 2GZPA 5D9XA 1PA3A 2HT9A 4TR1A 1JHBA 4J57E 4P3YB 5IOXA 3IC4A 4F82A 1SKRB 5DDLA 1HQOA 4Q5NA 2H30A 4ML6A 3KZQA 2VD0A 5IO2A 3HJOA 2R5GA 4NV5A 4F2IA 4GLTA 5IPGA 4CW9A 3W8SA 1TRVA 3Q18A 1B8XA 3KIJA 4AJ7A 3PGTA 4PQIA 5ELAA 2F8AA 3Q6OA 19GSA 1Z5YE 4GQCA 4KW6A 1KTEA 2PWJA 2FA8A 4RQXA 5ECLB 3D6IA 5AISA 5IQYA 2H1AA 2VAFA 1TRWA 1WIKA 4HQZA 4E8EA 1AC1A 5CRHA 2YZHA 4MPGA 5KN3A 6GSSA 3V1WA 2L4CA 4CHSA 3UMAA 1U3AA 1Z6MA 3BCKA 3IRAA 4WKWA 6GSVA 5G5EA 4ZB8A 2DSAA 3F4TA 2CAIA 1XWAA 2ZUPA 1IYIA 4NMUA 2VL2A 3VI7A 4IGJA 5DJMA 2LJRA 1WMJA 3I69A 3HHVA 1PX7A 4IHUA 4YQVA 3US3A 2MYGA 1W4VA 3TJJA 1UVZA 4D73B 1KEBA 1OC3A 2HFDA 1GH2A 3ERFA 2YJ7A 3EMPA 4WF5A 5IMZA 1MDJA 5LCZA 1ZCPA 1G7OA 3M1GA 1QFNA 3UJ1A 3K8NA 4JEDA 2HXKA 1NM3A 4MZCA 4N0ZA 2EIQA 5DVBA 4XRAA 4QL9A 3FEUA 1O81A 1A24A 5FWGA 2MMZA 4AF2A 2G2QA 2TIRA 4MCUA 1XXUA 4TOPA 3FZ5A 1X5CA 3ERGA 4ZL8A 4RQRA 2PUKC 2O8VB 2IIYA 2YV9A 5IMVA 1SK0A 3J7Yk 2AUVA 6GSYA 3DMLA 12GSA 2H66A 2L59A 3FYGA 3H4KA 3O3TA 3RPPA 1S3CA 2DIZA 2YN1A 3R2QA 5HFGA 5GSSA 1A2JA 5J9CA 2FLSA 2YWOA 1F3BA 1Y25A 3TRQA 2R4VA 3D21A 3NZNA 4OWYA 4MF5A 2H71A 3ZLPA 2CX3A 5B8BA 3ZFBA 1GSYA 2B3SA 2YZUA 1URMA 4DSQA 5CAXA 3P90A 4HEA2 4OCFA 2B7JA 6GSXA 5JWQB 1OAZA 3E3EA 3N9JA 3ZL5A 4EO3A 2PERA 2GTUA 2VM1A 3F8UA 1KBNA 3A3TA 1A8LA 1TJDA 3L4NA 1HNCA 3PR8A 1FHEA 3Q74A 3DWVA 4ZL9A 3L0HA 3F3QA 3UARA 1TRUA 3HVXA 3L9UA 4DSRA 3TKPA 1A2LA 3TJBA 5J4UA 2OE3A 1ZZYA 4MH2A 1MEKA 2AAWA 1R5AA 2AB6A 4N11A 2PBJA 4L5LA 3HY2A 4OMVA 2EC4A 2CV4A 3J7Yb 3A2VA 1CQHA 4TR3A 3VWXA 4KGIA 2PVOC 2HYXA 2GSQA 4EDYA 2GSSA 5DCGA 4EDZA 1ON4A 3HCZA 5D9TA 2FNOA 3GL5A 3VK9A 2HZEB 1G6WA 3DXBA 3GKKA 5LD0A 4HDEA 1GLQA 3KP9A 1XCCA 1A0RP 5IPHA 3HDCA 1I9DA 1SJIA 3WT2A 1BG5A 2GS3A 4IBPA 4KSMA 4I5QA 3ZMKA 5KN2A 5D96A 2OBIA 3H93A 2HRFA 4V1Ap 4AJ6A 3ME8A 3TKSE 5IMFA 2C3TA 2VL3A 2VCXA 20GSA 1XBSA 2CVKA 2FWGA 1GWCA 2XBQA 2QKEA 3I9V2 4IN0A 1YEPA 2VCQA 2K8SA 2CZ3A 5IMAA 4XS4A 2P5QA 3UL3A 2P5RA 2JACA 2PPTA 4G9HA 5DAKA 4MABA 1OC9B 2H6ZA 5EY6A 1RQMA 2B1LA 1K0NA 3QAWA 1JFUA 2VUPA 1XOAA 2X99A 3TCOA 1EP7A 3ZRDA 2DMMA 1ZOFA 5D73A 2LQQA 4WBJA 2MBTA 5G1LA 1DBYA 4JU5A 3F4RA 2XPDA 1XWCA 2H73A 1K0OA 5AIVA 4K1FA 3C1SA 2XBIA 5F0GA 5A4VA 3IPZA 4O5RA 2GVPA 2I9HA 2JU5A 1FOVA 4X1UA 1TK8B 1QK8A 3HXSA 1GUHA 2NPBA 1TTZA 3TKQA 3S9FA 2H74A 1T8EB 3MSZA 5J41A 3A2WA 3OR5A 3D4MA 1EV9A 3A2XA 3KH9A 2WZ9A 4O32A 2N5BA 1M9BA 3GYKA 2HLSA 2GLRA 5E59A 1DSBA 1T3BA 1R7HA 18GSA 5DQSA 3NOFA 5G5FA 5ECQB 1W89A 1K0BA 2QC7A 6GSTA 1GSEA 4Q5FA 1M2BA 3CYNA 4EUYA 3DRNA 1G6YA 2L5LA 4ECJA 4KUNA 3H8QA 4HOJA 16GSA 4ZBAA 3A5WA 3BBYA 4D73A 2N5FA 1X9WB 2IFQA 3BD2A 3HVVA 2LEGA 3GX0A 3HA9A 4TR0A 3GA4A 4MK3A 3FK8A 4G19A 4K7OA 3QMXA 2GZZA 2REMA 2WS2A 3VWWA 1TK0B 2IMKA 4IQ1A 3TOTA 2DLXA 3TDGA 3GX8A 1G0TA 4XS6A 3TRXA 2NBSA 1XWKA 2I4AA 3UBKA 3ZFLA 1ABAA 2QSIA 2NVLA 4IP1A 5JCUA 4FH8A 2PN8A 4DEJA 2YWMA 1R26A 2DC5A 4ZB6A 5IMDA 4KX4A 2BMXA 1UN2A 4NWYA 3ZTLA 1XZOA 1PD21 1WRYA 3P8WA 2JZSA 2L5OA 1J9BA 1OC8A 5F07A 4PQ1A 3PH9A 2YP6A 3FR6A 1EV4A 1GNWA 4XCSA 2H6XA 3KJYA 4MLYA 5HQPA 4NHZA 1PL1A 1MDKA 4N10A 2TRXA 1GP1A 2WJUA 1TRSA 5IO0A 2X8GA 3GIXA 4RI6A 4GRFA 1QMVA 3FHKA 4F9ZA 3M0FA 1ERUA 4OFNA 5FHIA 1VF3A 4XS4B 3G7IA 5HFIA 22GSA 2VOCA 1DUGA 1M7TA 5G1KA 3CBUA 2DJKA 3C1RA 3TKRA 2VCTA 1YY7A 4I97A 3QAVA 3RAZA 3IAS2 1QXHA 3ZZXA 3FRCA 5JWRB 3TGZA 2LQOA 2YPMA 4K0NA 5EVOA 4NPBA 2ON5A 5KN1A 4BWSA 1GSFA 4MF7A 5HR2A 1MD4A 3ME7A 2H72A 1TP9A 1EGRA 1X5DA 4X0XA 3ZIJA 5LNKe 5AIXA 1GUMA 1HNAA 4ECIA 1XFLA 2L6DA 1EZKA 11GSA 3DEXA 3LWAA 1N2AA 1WJKA 3LG6A 2CAQA 3KM6A 1EOGA 4KSOA 3EWLA 3D5JA 4FYUA 4HJMA 3GUSA 4RI7A 3W6GA 5KN0A 3GHAA 1NHYA 1XWBA 1PKWA 1G7EA 3GV1A 4L0UA 4KH7A 4FYCA 1K3LA 4K7IA 4DVCA 2X64A 4K2DA 3HD5A 4Q5QA 5HR0A 1GNEA 3KMNA 1HD2A 1K0CA 1ERTA 4G10A 1ZYQB 3KEBA 2HZEA 4BVYA 2R2JA 1OKDA 1XVQA 1ZMAA 2IFQB 2CVDA 5J5NA 2M80A 1RK4A 5ECRB 3D4TA 1FW1A 3DKSA 2WDUA 4ZL7A 4GSNA 4PX1A 5H5RA 4K0GA 3GN3A 3C71A 1U88A 4GWRA 3KMOA 5ABRA 4PGTA 3G7YA 4TXVA 4XHMA 2IMEA 4IJIA 1YDKA 4WETA 2TRCP 2H1DA 1XW6A 4MPFA 4IELA 1V40A 3LQ7A 3HZ4A 1AQXA 2A2SA 2LSTA 1J08A 4PNFA 2B7KA 2VIMA 2JSYA 4TXOA 2RM6A 4TRXA 3LYKA 5GAND 3F6DA 1WPIA 1MTCA 1V98A 3FZAA 4POBA 1V2AA 1B9YC 1GSDA 1OC9A 2C0EA 4XIHA 1U3IA 4LL1B 1XPVA 2H1GA 5CRWA 2ZCTA 3P7XA 4GSTA 4K8MA 4POKA 5DALA 3TKSC 1Z3EA 1S3AA 2JZRA 1DE1A 3CSHA 1GTAA 3G7JA 4L8EA 1FB6A 2KP1A 4IKHA 2CQ9A 1GTBA 2WGRA 3RHCA 1KNGA 3BOAA 4YAVA 4POMA 2DJJA 2OACA 2YWIA 4ISDA 3I43A 2H8LA 13GSA 1EEJA 3CSJA 4DSSA 4I8BA 1AAZA 4GCIA 2H76A 1A0FA 1PL2A 4H86A 1QGVA 3RHBA 4F0BA 2HSHA 3FW2A 1R4WA 3KH7A 1SD8A 3WGDA 2LV3A 2OJLA 1VF2A 4Q5RA 1EOHA 4FYBA 2GDRA 1XOBA 3BCIA 3O76A 4WR4A 1F6MC 3CRUA 2YV7A 2E2MA 5JWOB 1MD3A 3LFLA 1JZRA 3KP8A 1WP0A 5ECMB 3HYPA 2DJ3A 2GT6A 2OKAA 1TW9A 1K0DA 3EE2A 2R3XA 2LS5A 4LL4B 1X9SB 1BX9A 4JRRA 1BYEA 3GTUA 3VWVA 4MA9A 3KTLA 3ZVJA 1H4OA 1M2DA 2OA7A 3H79A 1A8YA 2K6VA 1AXDA 2IJYA 3TRPA 1SK1A 1GL8A 2AHEA 5CNWA 3WT1A 3GURA 3QOUA 2DJ1A 3VWUA 1AQWA 3GKXA 1GRXA 2KHPA 2VLTA 1TKDB 2FGXA 3FR9A 5A4UA 2IN3A 2ALBA 1S3DA 1NHOA 6GSWA 5G30A 3UVTA 1FVKA 5HR3A 3O6TA 2GZYA 2F51A 4K7NA 3QFAC 5ECIB 1Q4JA 1EWXA 14GSA 4N0VA 3UBLA 1AUCA 4ZILA 2O89A 1PKZA 3GSTA 2AV4A 5C00A 1R5PA 3HJMA 3KD0A 1YF1A 3UIWA 2IPAA 3APSA 1X9MB 4EF0A 3FY7A 4L0WA 5COHA 2I1UA 2LRCA 4O92A 3VPTA 4KDUA 3VLNA 1T4ZA 2E0QA 1ERWA 2OADA 4E8HA 3QFBC 4TXOB 2PVQA 5G31A 1JZDA 1SKSB 3CTFA 3QPMA 4ZIJA 1SJZA 2E7PA 4F03A 4KDYA 4JBBA 2B5EA 3DIEA 1F37A 1OE7A 2B6MA 4IS0A 2C80A 2ZNMA 4ID0A 1Z9HA 5DALB 3IE3A 3TUEA 1XIYA 1O73A 1F3AA 4OD7A 2DMLA 5B6NA 4X43A 1M9AA 4I2TA 1SL0B 1SK2A 1QUWA 1LJRA 5HFKA 4EE0A 2V1MA 1M2AA 2R37A 3C73A 5F8BA 5A5KA 4HUAA 4DSSB 5DCHA 3U5RE 2CA8A 4NAXA 1GSUA 2CVBA 5CYYA 1BJXA 1GTUA 5CREA 1PX6A 1OYJA 1ML6A 4BPYA 4MJBA 1M0UA 4ECBA 2HI7A 1I5GA 2GQMA 4HI7A 8GSSA 5FT3A 2A4VA 3UEMA 3APQA 1V57A 3ERWA 1B4PA 17GSA 3RDWA 1PMTA 5JCWA 3FKFA 1SD9A 3FR3A 4JE1A 4TVEA 4J2FA 3GTUB 5HR1A 1TI3A 2LKUA 1K0MA 2M46A 1WE0A 3QDNA 3JCML 3APOA 4IW9A 4OCEA 3UAPA 2QGVA 1B48A 3IBHA 3KXOA 3PINA 5JCGA 4ZBBA 2FWFA 4XTSA 3HVSA 1K0AA 4MZWA 3CSIA 3L9SA 1U6TA 2LRNA 4TR4A 3QD9A 3LXTA 1AQVA 3DVXA 4BA7A 5GZZB 2X8HA 1JLVA 3ISOA 2LJKA 3QAGA 4YH2A 2VCZA 1BEDA 3CXGA 4JR6A 4TN8A 5E4WA 1USBA 4IVFA 1NW2A 5KEJA 4KA0A 2N5AA 3LYPA 1TXXA 4PQHA 5D9VA 5DQYA 1DE2A 3IOSA 3DGQA 5ELGA 2C1YA 3C8EA 4MF6A 4POLA 1MDIA 1ZYEA 2RIIA 3TJFA 3DYRA 5ECNB 1C72A 4V2NA 5CO3A 2IMIA 5B7CA 2DJ2A 2LTKA 3IHQA 5IMCA 3ZIVA 1HNBA 3GH9A 1SL1B 10GSA 3LEFA 4GF0A 3ED3A 1GSSA 5D8IA 3E9JB 2K8VA 3F63A 3Q19A 2PU9C 2L4QA 5ECSA 5AGYA 1FO5A 5C04A 3BJ5A 2IMFA 4MZBA 1JZWA 2C0DA 3F6FA 1K3OA 4ZXGA 2C0GA 2E2GA 4KDXA 1Z7RA 4L5OA 2ES7A 1PSQA 5B8AA 1ILOA 2MMAA 4O7HA 3ZVJD 3CMIA 4NXIA 2NTOA 4IP6A 4EVMA 4ULXA 3TOUA 1BQ7A 4WR5A 4YQMA 1YKCA 5INYA 3SWLA 4MJCA 4HU9A 3GFKA 2CT6A 2P31A 1YF0A 2CX4A 3GKMA 1Z6NA 1Z7PA 2B1KA 2FA4A 3MNGA 3TKSA 6GSUA 3GMFA 5ID2B 2HE3A 3P2AA 3EINA 3EYTA 1VF1A 2C8UA 2MZCA 3AY8A 3C7MA 3IAM2 2A2RA 1YQ1A 1O7UA 1J0FA 4V2MA 4YAPA 5J9BA 5D93A 5B6MA 2C0FA 1WOUA 4TKYA 1SKWB 1OVNA 3GKNA 1TK5B 3GH6A 2L57A 2H75A 1LBKA 4IQAA 3WD6A 3MDKA 3HZ8A 2EIOA 2HNLA 1SU9A 1B4QA 2LNTA 1Q98A 2AJQB 3QCPA 3EU4A 2VO4A 4IJ3A 1TU7A 2FD3A 4KCAA 3ZMLA 2GQKA 1X5EA 1E6BA 2MMOA 2WCIA 2VLVA 3G9BA 1YEXA 3MWHA 4ACSA 2H1BA 1SYRA 1H75A 2EIRA 4EL1A 2KUCA 1SJ6A 1B9XC 2YWNA 1A23A 2CZ2A 2DBCA 1EEMA 2M72A 4I2UA 3MAKA 3EMXA 4K9ZA 3GSSA 2KLXA 1TOFA 2HSYA 1T00A 9GSSA 1PN9A 3KGKA 4PXOA 1FAAA 3WYWA 1OKTA 1EP8A 1RW1A 1NSWA 1UC7A 2YCDA 5ECHB 3H1NA 5CRDA 4FIWA
chains in the Genus database with same CATH superfamily
4WXTA 3RBTA 3LGCA 4GXZA 1WWJA 4ZB9A 2FY6A 5L71A 4WBRD 1M99A 1GULA 1JZOA 2I3YA 3M8NA 3LJRA 2VLUA 2WFCA 1T4YA 4GSSA 4OO4A 3TJGA 2YNXA 1IYHA 1M3IA 1S3RA 1SL2B 2LRTA 5IOWA 4AJ8A 3IR4A 2HZFA 1O8XA 3HKRA 3M9KA 4TR1B 5ECPB 4XS1A 2IL3A 4HU7A 2XPEA 5D9WA 2V41A 2L6CA 3GRXA 2K18A 4PURA 3RPNA 1THXA 2VL2C 2H01A 1O6JA 2OBKA 5DBQA 5CRGA 1THOA 2GT5A 5F05A 2WB9A 4MJAA 4MP4A 5F06A 2ON7A 4PUAA 2DJ0A 1V58A 2H70A 2BJXA 2O85A 3GL3A 3HJPA 1VF4A 2P0GA 1X0RA 3QR6A 2PGTA 1AW9A 2YANA 4JR4A 3LXZA 2GSTA 3M9JA 4V1Ag 2NDOA 2LJAA 2K9FA 4CDOA 4ILFA 2MMNA 2FWEA 2WRTA 2G0FA 2VCVA 2Z9SA 5IIZA 3L78A 2MBSA 4A5PA 4RUVA 4EXJA 1Y6EA 2VCWA 3FZ4A 4LA1A 2C3NA 2C4JA 2AYTA 5DJLA 2JL4A 2H0GA 3EURA 3M3MA 2KOKA 1XW5A 2LUSA 2FWHA 3F0IA 3DD3A 1VGLA 1FVJA 5EPFA 4HQSA 2J23A 2VL9A 4TW5A 2R6KA 4NV2A 3LORA 2PMTA 4EC0A 3DVWA 5IM9A 3W8JA 4KAEA 1GTIA 3EU3A 4MH3A 2JZTA 2FUG2 4K6XA 1YZXA 1XW9A 5GSTA 1GSQA 1ZGNA 1V9WA 2A4HA 1VRSD 1O85A 2RLIA 3D22A 3IDVA 2OE0A 1GLPA 4K2XA 4N30A 3CTGA 3EC3A 4X4JA 4XRDA 4EIPA 3VPQA 3UVHA 1SYXA 1PGTA 4HZ2A 2F9SA 4ECCA 1T7PB 3ZYWA 4OFTA 3UOMA 2YJHA 1ZL9A 1FB0A 2V6KA 4HJ2A 5A4WA 1LU4A 3U6VA 1HYUA 5EL8A 2F8FA 2R0GA 4KE3A 5H5QA 3ZREA 1K3YA 1PRXA 2B5YA 7GSSA 1E2YA 4WF4A 3F9UA 3L9VA 2V6OA 5GAPD 3VI5A 3FZ9A 4JZQA 5AN1A 2XHFA 5G2ZA 2H0HA 2IMDA 3IXRA 4GTUA 4OFMA 1U87A 1BAYA 1OE8A 4LLRA 1ACVA 4QL7A 2JSZA 4PUFC 5BRTA 1N8JA 2IWTA 4KNDA 2BTOT 4EKZA 1AIUA 3KCMA 4LMWA 4FO5A 3IA1A 1UA5A 3IV4A 3SBCA 3F3RA 2RM5A 5ID2A 3GNJA 5J3RA 2J9HA 2O7KA 4NHWA 2RUFA 1A2MA 1QQ2A 1XVWA 3WGEA 3ZITA 4V2LA 4BL7A 3F4SA 4AGSA 3I6AA 1FG4A 3TJKA 1YKAA 5ECKB 2FHEA 2GGTA 1TDIA 4J56E 4HS1A 2VM2A 2GSRA 4Z7XA 4MDCA 5ENUA 4KB3A 3LSZA 2JADA 3D0ZA 1ERVA 3HVNA 4OO5A 4ML1A 5ECOB 1PQNA 4EIQA 2OE1A 4LMVA 1EGOA 1GUKA 3E0UA 2I81A 2C3QA 1F9MA 1O8WA 4F0CA 2RUEA 3IK7A 4QQ7A 1TI1A 2H19A 5CP1A 1JLWA 3NIVA 4HSCX 2HRNA 1TU8A 4BVXA 3TB2A 3VURA 4PNGA 3N5OA 2X8CA 3EVIA 4G0IA 2F3MA 4G2EA 4YQUA 4WEYA 1ST9A 2O87A 3WGXA 4ZBDA 4Z2RA 2LNSA 2V32A 4I6XA 5H5SA 3KTBA 4MJEA 2H6YA 2V2GA 2WULA 3VFIA 2H0IA 2XC2A 1CQGA 4GQFA 1F2EA 1YJ6A 4BWQA 2B5XA 4KCEA 2D2ZA 2FCHA 2GQLA 1SENA 2DIYA 1XWGA 3IK9A 4HZ4A 2YOIA 2VD1A 2KP2A 1T1VA 3CRTA 5DAKB 4MMMA 2GZPA 5D9XA 4USSA 4K5SA 1PA3A 2HT9A 4TR1A 1JHBA 4J57E 4P3YB 5IOXA 3IC4A 4F82A 1SKRB 5DDLA 1HQOA 4Q5NA 2H30A 4ML6A 3KZQA 2VD0A 5IO2A 3HJOA 2R5GA 4NV5A 4F2IA 4GLTA 5IPGA 3IHGA 4CW9A 3W8SA 1TRVA 3Q18A 1B8XA 3KIJA 4AJ7A 3PGTA 4PQIA 5ELAA 2F8AA 3Q6OA 3PPUA 19GSA 1Z5YE 4GQCA 4KW6A 1KTEA 2PWJA 2FA8A 4RQXA 5ECLB 3D6IA 5AISA 5IQYA 2H1AA 2VAFA 1TRWA 1WIKA 4BL7B 4HQZA 4E8EA 1AC1A 5CRHA 2YZHA 4MPGA 5KN3A 6GSSA 3V1WA 2L4CA 4CHSA 2DKIA 4BIKA 3UMAA 1U3AA 1Z6MA 3BCKA 3IRAA 4WKWA 6GSVA 5G5EA 4ZB8A 2DSAA 3F4TA 2CAIA 1XWAA 2ZUPA 3A5IA 1IYIA 4NMUA 2VL2A 3VI7A 4IGJA 5DJMA 2LJRA 1WMJA 3I69A 3HHVA 1PX7A 4IHUA 4YQVA 3US3A 2MYGA 1W4VA 3TJJA 1UVZA 4D73B 1KEBA 1OC3A 2HFDA 1GH2A 3ERFA 2YJ7A 3EMPA 4WF5A 5IMZA 1MDJA 5LCZA 1ZCPA 1G7OA 3M1GA 1QFNA 3UJ1A 3K8NA 4JEDA 2HXKA 1NM3A 4MZCA 4N0ZA 2EIQA 5DVBA 4XRAA 4QL9A 3FEUA 1O81A 1A24A 5FWGA 2MMZA 4AF2A 2G2QA 2TIRA 4MCUA 1XXUA 4TOPA 3FZ5A 1X5CA 3ERGA 4ZL8A 4RQRA 2PUKC 2O8VB 2IIYA 2YV9A 5IMVA 1SK0A 3J7Yk 2AUVA 6GSYA 3DMLA 12GSA 2H66A 2L59A 3FYGA 3H4KA 3O3TA 4ICYA 3RPPA 1ZYNA 1S3CA 3MIXA 2DIZA 2YN1A 3R2QA 5HFGA 5GSSA 1A2JA 5J9CA 2FLSA 2YWOA 1F3BA 1Y25A 3TRQA 2R4VA 3D21A 3NZNA 4OWYA 4MF5A 2H71A 3ZLPA 2CX3A 3R3EA 5B8BA 3ZFBA 1GSYA 2B3SA 2YZUA 2R0CA 1PFOA 1URMA 4DSQA 5CAXA 3P90A 4HEA2 4OCFA 2B7JA 6GSXA 5JWQB 1OAZA 3E3EA 3N9JA 3ZL5A 4EO3A 2PERA 2GTUA 2QA1A 2VM1A 3F8UA 1KBNA 3A3TA 1A8LA 1TJDA 3L4NA 1HNCA 3PR8A 1FHEA 3CQFA 3Q74A 3DWVA 4ZL9A 3L0HA 1ZYPA 3F3QA 3UARA 1TRUA 3LW9A 3HVXA 3L9UA 4DSRA 3TKPA 1A2LA 3TJBA 5J4UA 2OE3A 1ZZYA 4MH2A 1MEKA 2AAWA 1R5AA 2AB6A 4N11A 2PBJA 4FQUA 4CY6A 4L5LA 3HY2A 4OMVA 2EC4A 2CV4A 3J7Yb 3A2VA 1CQHA 4TR3A 1M3JA 3VWXA 4KGIA 2PVOC 2HYXA 2GSQA 4EDYA 2GSSA 5DCGA 4EDZA 1ON4A 3HCZA 5D9TA 2FNOA 3GL5A 3VK9A 2HZEB 1G6WA 3DXBA 3GKKA 5LD0A 4HDEA 1GLQA 3KP9A 1XCCA 1A0RP 5IPHA 3HDCA 1I9DA 1SJIA 3WT2A 1BG5A 2GS3A 4IBPA 4KSMA 4I5QA 3ZMKA 5KN2A 5D96A 2OBIA 3H93A 2HRFA 4V1Ap 4AJ6A 3ME8A 3TKSE 5IMFA 2C3TA 2VL3A 2VCXA 20GSA 1XBSA 2CVKA 2FWGA 1GWCA 2XBQA 2QKEA 3I9V2 4IN0A 1YEPA 2VCQA 2K8SA 2CZ3A 5IMAA 4XS4A 2P5QA 3UL3A 2P5RA 2JACA 2PPTA 4G9HA 5DAKA 4MABA 1OC9B 2H6ZA 5EY6A 1RQMA 2B1LA 1K0NA 3QAWA 1JFUA 2VUPA 1XOAA 2X99A 3TCOA 1EP7A 2R0PA 3ZRDA 2DMMA 1ZOFA 5D73A 2LQQA 4WBJA 2MBTA 5G1LA 1DBYA 4JU5A 3F4RA 2XPDA 1XWCA 2H73A 1K0OA 5AIVA 4K1FA 3C1SA 2XBIA 5F0GA 5A4VA 3IPZA 4O5RA 2GVPA 2I9HA 2JU5A 1FOVA 4X1UA 1TK8B 1QK8A 3HXSA 1GUHA 2NPBA 1TTZA 3TKQA 3S9FA 2H74A 1T8EB 3MSZA 5J41A 3A2WA 3OR5A 3D4MA 4K5RA 1EV9A 3A2XA 3KH9A 2WZ9A 4O32A 2N5BA 1M9BA 3GYKA 2HLSA 2GLRA 5E59A 1DSBA 1T3BA 2A2PA 1R7HA 18GSA 5DQSA 3NOFA 5G5FA 5ECQB 1W89A 1K0BA 2QC7A 6GSTA 1GSEA 4Q5FA 1M2BA 3CYNA 4EUYA 3DRNA 1G6YA 1FOHA 2L5LA 4ECJA 4KUNA 3H8QA 4HOJA 16GSA 4ZBAA 3A5WA 3BBYA 4D73A 2N5FA 1X9WB 2IFQA 3BD2A 3HVVA 2LEGA 3GX0A 3HA9A 4TR0A 3GA4A 4MK3A 3FK8A 4G19A 4K7OA 3QMXA 2GZZA 2REMA 2WS2A 3VWWA 1TK0B 2IMKA 4IQ1A 3TOTA 2DLXA 3TDGA 3GX8A 1G0TA 4XS6A 3TRXA 2NBSA 1XWKA 2I4AA 3UBKA 3ZFLA 1ABAA 2QSIA 2NVLA 4IP1A 5JCUA 4FH8A 2PN8A 4DEJA 2YWMA 1R26A 3EPTA 2DC5A 4ZB6A 5IMDA 4KX4A 2BMXA 1UN2A 4NWYA 3ZTLA 1XZOA 1PD21 1WRYA 3P8WA 2JZSA 2L5OA 1J9BA 1OC8A 5F07A 4PQ1A 3PH9A 2YP6A 3FR6A 1EV4A 1GNWA 4XCSA 2H6XA 3KJYA 4MLYA 5HQPA 4NHZA 1PL1A 1MDKA 4N10A 2TRXA 1GP1A 2WJUA 1TRSA 5IO0A 2X8GA 3GIXA 4RI6A 4O5QA 4GRFA 1QMVA 3FHKA 4G0KA 4F9ZA 3M0FA 1ERUA 4OFNA 5FHIA 1VF3A 4XS4B 4G0LA 3G7IA 5HFIA 22GSA 2VOCA 1DUGA 1M7TA 5G1KA 3CBUA 2DJKA 3C1RA 3TKRA 2VCTA 1YY7A 4I97A 3QAVA 3RAZA 3IAS2 1QXHA 3ZZXA 3FRCA 5JWRB 3TGZA 2LQOA 2YPMA 4K0NA 5EVOA 4NPBA 2ON5A 5KN1A 4BWSA 1GSFA 4MF7A 5HR2A 1MD4A 3ME7A 2H72A 1TP9A 1EGRA 1X5DA 4X0XA 3ZIJA 5LNKe 5AIXA 1GUMA 1HNAA 4ECIA 1XFLA 2L6DA 1EZKA 11GSA 3DEXA 3LWAA 1N2AA 3MYDA 1WJKA 3LG6A 2CAQA 3KM6A 1EOGA 4KSOA 3EWLA 3D5JA 4FYUA 4HJMA 3GUSA 4RI7A 4MNNA 3W6GA 5KN0A 3GHAA 1NHYA 1XWBA 4PTSA 1PKWA 1G7EA 3GV1A 4L0UA 4KH7A 4Z2TA 4FYCA 1K3LA 4K7IA 4DVCA 2X64A 4K2DA 3HD5A 4Q5QA 5HR0A 1GNEA 5KOXA 3KMNA 1HD2A 1K0CA 1ERTA 4G10A 1ZYQB 3KEBA 2HZEA 4BVYA 2R2JA 1OKDA 1XVQA 1ZMAA 2IFQB 2CVDA 5J5NA 2M80A 1RK4A 5ECRB 3D4TA 1FW1A 3DKSA 2WDUA 4ZL7A 2X49A 4GSNA 4PX1A 5H5RA 4K0GA 3GN3A 3C71A 1U88A 4GWRA 3KMOA 5ABRA 4PGTA 3G7YA 4TXVA 4XHMA 2IMEA 4IJIA 1YDKA 4WETA 2TRCP 2H1DA 1XW6A 4MPFA 4IELA 1V40A 3LQ7A 3HZ4A 1AQXA 2A2SA 2LSTA 4YKFA 1J08A 4PNFA 2B7KA 2VIMA 2JSYA 4TXOA 2RM6A 2HSMA 4TRXA 3LYKA 5GAND 3F6DA 1WPIA 1MTCA 1V98A 3FZAA 4POBA 1V2AA 1B9YC 1GSDA 1OC9A 2C0EA 4XIHA 1U3IA 4LL1B 1XPVA 2H1GA 5CRWA 2ZCTA 3P7XA 4GSTA 4K8MA 4POKA 5DALA 3TKSC 1Z3EA 1S3AA 2JZRA 1DE1A 3CSHA 1GTAA 3G7JA 4L8EA 1FB6A 2KP1A 4IKHA 2CQ9A 1GTBA 2WGRA 3RHCA 1KNGA 3BOAA 4YAVA 4POMA 2DJJA 2OACA 2YWIA 4ISDA 3I43A 2H8LA 13GSA 1EEJA 3CSJA 4DSSA 4I8BA 1AAZA 4GCIA 2H76A 1A0FA 1PL2A 4H86A 1QGVA 3RHBA 4F0BA 2HSHA 3FW2A 1R4WA 3KH7A 1SD8A 3WGDA 2LV3A 2OJLA 1VF2A 4Q5RA 2UZ8A 1EOHA 4FYBA 2GDRA 1XOBA 2HRKA 3BCIA 3O76A 4WR4A 1F6MC 3CRUA 2YV7A 2E2MA 5JWOB 1MD3A 3LFLA 1JZRA 4Z2UA 3KP8A 1WP0A 3HYPA 5ECMB 2DJ3A 2GT6A 2OKAA 1TW9A 1K0DA 3EE2A 2R3XA 2LS5A 4LL4B 1X9SB 1BX9A 4JRRA 1BYEA 3GTUA 3VWVA 4MA9A 3KTLA 3ZVJA 1H4OA 1M2DA 2OA7A 3H79A 1A8YA 2K6VA 1AXDA 2IJYA 3TRPA 1SK1A 1GL8A 2AHEA 2DKHA 5CNWA 3WT1A 3GURA 3QOUA 2DJ1A 3VWUA 1AQWA 3GKXA 1GRXA 2KHPA 2VLTA 1TKDB 2FGXA 3FR9A 5A4UA 3IC8A 2IN3A 2ALBA 1S3DA 1NHOA 6GSWA 5G30A 3UVTA 4BVYB 1FVKA 5HR3A 3O6TA 2GZYA 2F51A 4K7NA 3QFAC 5ECIB 1Q4JA 1PN0A 1EWXA 14GSA 4N0VA 3UBLA 1AUCA 4ZILA 2O89A 1PKZA 3GSTA 2AV4A 5C00A 1R5PA 3HJMA 3KD0A 1YF1A 3UIWA 2IPAA 3APSA 1X9MB 4EF0A 3FY7A 4L0WA 5COHA 2I1UA 2LRCA 4O92A 3VPTA 4KDUA 3VLNA 1T4ZA 2E0QA 1ERWA 2OADA 4E8HA 3QFBC 4TXOB 2PVQA 5G31A 1JZDA 1SKSB 3CTFA 3QPMA 4ZIJA 1SJZA 2E7PA 4F03A 4KDYA 4JBBA 2B5EA 3DIEA 1F37A 1OE7A 2B6MA 4IS0A 2C80A 2ZNMA 4ID0A 1Z9HA 5DALB 3IE3A 4KF9A 3TUEA 1XIYA 1O73A 1F3AA 4OD7A 2DMLA 5B6NA 4X43A 1M9AA 4I2TA 1SL0B 1SK2A 1QUWA 1LJRA 5HFKA 4EE0A 2V1MA 1M2AA 2R37A 3C73A 5F8BA 5A5KA 4HUAA 4DSSB 5DCHA 3U5RE 2CA8A 4NAXA 1GSUA 2CVBA 5CYYA 1BJXA 1GTUA 5CREA 1PX6A 1OYJA 1ML6A 4BPYA 4MJBA 1M0UA 4ECBA 2HI7A 1I5GA 2GQMA 4HI7A 8GSSA 5FT3A 2A4VA 3UEMA 3APQA 5KOWA 1V57A 3ERWA 1B4PA 17GSA 3RDWA 1PMTA 5JCWA 3FKFA 1SD9A 3FR3A 4JE1A 4TVEA 4J2FA 3GTUB 5HR1A 1TI3A 2LKUA 1K0MA 2M46A 1WE0A 3QDNA 3JCML 3APOA 3FMWA 4IW9A 4OCEA 3UAPA 2QGVA 1B48A 3IBHA 3KXOA 3PINA 5JCGA 4ZBBA 2FWFA 4XTSA 3HVSA 1K0AA 4MZWA 3CSIA 3L9SA 1U6TA 2LRNA 4TR4A 3QD9A 3LXTA 1AQVA 3DVXA 4BA7A 5GZZB 2X8HA 1JLVA 3ISOA 2LJKA 3QAGA 4YH2A 2VCZA 1BEDA 3CXGA 4JR6A 4TN8A 5E4WA 1USBA 4IVFA 1NW2A 5KEJA 4KA0A 2N5AA 2HRAA 3LYPA 1TXXA 4PQHA 5D9VA 5DQYA 1DE2A 3IOSA 3DGQA 5ELGA 2QA2A 2C1YA 3C8EA 4MF6A 4POLA 1MDIA 1ZYEA 2RIIA 3TJFA 3DYRA 5ECNB 4O5UA 1C72A 4V2NA 5CO3A 2IMIA 5B7CA 2DJ2A 2LTKA 3IHQA 5IMCA 3ZIVA 1HNBA 3GH9A 1SL1B 10GSA 3LEFA 4GF0A 3ED3A 1GSSA 2X4AA 5D8IA 3E9JB 2K8VA 3F63A 3Q19A 2PU9C 2L4QA 5ECSA 5AGYA 1FO5A 5C04A 3BJ5A 2IMFA 4MZBA 1JZWA 2C0DA 3F6FA 1K3OA 4ZXGA 2C0GA 2E2GA 4KDXA 1Z7RA 4L5OA 2ES7A 1PSQA 5B8AA 1ILOA 2MMAA 4O7HA 3ZVJD 3CMIA 4NXIA 2NTOA 4IP6A 4EVMA 4ULXA 3TOUA 1BQ7A 4WR5A 4YQMA 1YKCA 5INYA 3SWLA 1XG8A 4MJCA 4HU9A 3GFKA 2CT6A 2P31A 1YF0A 2CX4A 3GKMA 1Z6NA 1Z7PA 2B1KA 2FA4A 3MNGA 3TKSA 6GSUA 3GMFA 5ID2B 2HE3A 3P2AA 3EINA 3EYTA 1VF1A 2C8UA 2MZCA 3AY8A 3C7MA 3IAM2 2A2RA 1YQ1A 1O7UA 1J0FA 4V2MA 4YAPA 5J9BA 5D93A 5B6MA 2C0FA 1WOUA 4TKYA 1SKWB 1OVNA 3GKNA 1TK5B 3GH6A 2L57A 2H75A 1LBKA 4IQAA 3WD6A 3MDKA 3HZ8A 2EIOA 2HNLA 1SU9A 1B4QA 2LNTA 1Q98A 2AJQB 3QCPA 3EU4A 2VO4A 4IJ3A 1TU7A 2FD3A 4KCAA 3ZMLA 2GQKA 1X5EA 1E6BA 2MMOA 2WCIA 2VLVA 3G9BA 1YEXA 3MWHA 4ACSA 2H1BA 1SYRA 1H75A 2EIRA 4EL1A 2KUCA 1SJ6A 1B9XC 2YWNA 1A23A 2CZ2A 2DBCA 1EEMA 2M72A 4I2UA 4BVXB 3MAKA 3EMXA 4K9ZA 3GSSA 2KLXA 1TOFA 2HSYA 1T00A 9GSSA 1PN9A 4YKGA 4CY8A 3KGKA 4PXOA 1FAAA 3WYWA 1OKTA 1EP8A 1RW1A 1NSWA 1UC7A 2YCDA 5ECHB 5BMUA 3H1NA 5CRDA 4FIWA
chains in the Genus database with same CATH topology
4WXTA 3RBTA 3LGCA 4GXZA 1WWJA 4ZB9A 2FY6A 5L71A 4WBRD 1M99A 1GULA 1JZOA 2I3YA 3M8NA 3LJRA 2VLUA 2WFCA 1T4YA 4GSSA 4OO4A 3TJGA 2YNXA 1IYHA 1SL2B 2LRTA 5IOWA 4AJ8A 3IR4A 2HZFA 1O8XA 3HKRA 3M9KA 4TR1B 5ECPB 4XS1A 2IL3A 4HU7A 2XPEA 5D9WA 2V41A 2L6CA 3GRXA 2K18A 4PURA 3RPNA 1THXA 2VL2C 2H01A 1O6JA 2OBKA 5DBQA 5CRGA 1THOA 2GT5A 5F05A 2WB9A 4MJAA 4MP4A 5F06A 2ON7A 4PUAA 2DJ0A 1V58A 2H70A 2BJXA 2O85A 3GL3A 3HJPA 1VF4A 2P0GA 1X0RA 3QR6A 2PGTA 1AW9A 2YANA 4JR4A 3LXZA 2GSTA 3M9JA 4V1Ag 2NDOA 2LJAA 2K9FA 4CDOA 4ILFA 2MMNA 2FWEA 2WRTA 2G0FA 2VCVA 2Z9SA 5IIZA 3L78A 2MBSA 4A5PA 4RUVA 4EXJA 1Y6EA 2VCWA 3FZ4A 4LA1A 2C3NA 2C4JA 2AYTA 5DJLA 2JL4A 2H0GA 3EURA 3M3MA 2KOKA 1XW5A 2LUSA 2FWHA 3F0IA 3DD3A 1VGLA 1FVJA 5EPFA 4HQSA 2J23A 2VL9A 4TW5A 2R6KA 4NV2A 3LORA 2PMTA 4EC0A 3DVWA 5IM9A 3W8JA 4KAEA 1GTIA 3EU3A 4MH3A 2JZTA 2FUG2 4K6XA 1YZXA 1XW9A 5GSTA 1GSQA 1ZGNA 1V9WA 2A4HA 1VRSD 1O85A 2RLIA 3D22A 3IDVA 2OE0A 1GLPA 4K2XA 4N30A 3CTGA 3EC3A 4X4JA 4XRDA 4EIPA 3VPQA 3UVHA 1SYXA 1PGTA 4HZ2A 2F9SA 4ECCA 1T7PB 3ZYWA 4OFTA 3UOMA 2YJHA 1ZL9A 1FB0A 2V6KA 4HJ2A 5A4WA 1LU4A 3U6VA 1HYUA 5EL8A 2F8FA 2R0GA 4KE3A 5H5QA 3ZREA 1K3YA 1PRXA 2B5YA 7GSSA 1E2YA 4WF4A 3F9UA 3L9VA 2V6OA 5GAPD 3VI5A 3FZ9A 4JZQA 5AN1A 2XHFA 5G2ZA 2H0HA 2IMDA 3IXRA 4GTUA 4OFMA 1U87A 1BAYA 1OE8A 4LLRA 1ACVA 4QL7A 2JSZA 4PUFC 5BRTA 1N8JA 2IWTA 4KNDA 2BTOT 4EKZA 1AIUA 3KCMA 4LMWA 4FO5A 3IA1A 1UA5A 3IV4A 3SBCA 3F3RA 2RM5A 5ID2A 3GNJA 5J3RA 2J9HA 2O7KA 4NHWA 2RUFA 1A2MA 1QQ2A 1XVWA 3WGEA 3ZITA 4V2LA 4BL7A 3F4SA 4AGSA 3I6AA 1FG4A 3TJKA 1YKAA 5ECKB 2FHEA 2GGTA 1TDIA 4J56E 4HS1A 2VM2A 2GSRA 4Z7XA 4MDCA 5ENUA 4KB3A 3LSZA 2JADA 3D0ZA 1ERVA 4OO5A 4ML1A 5ECOB 1PQNA 4EIQA 2OE1A 4LMVA 1EGOA 1GUKA 3E0UA 2I81A 2C3QA 1F9MA 1O8WA 4F0CA 2RUEA 3IK7A 4QQ7A 1TI1A 2H19A 5CP1A 1JLWA 3NIVA 2HRNA 1TU8A 4BVXA 3TB2A 3VURA 4PNGA 3N5OA 2X8CA 3EVIA 4G0IA 2F3MA 4G2EA 4YQUA 4WEYA 1ST9A 2O87A 3WGXA 4ZBDA 4Z2RA 2LNSA 2V32A 4I6XA 5H5SA 3KTBA 4MJEA 2H6YA 2V2GA 2WULA 3VFIA 2H0IA 2XC2A 1CQGA 4GQFA 1F2EA 1YJ6A 4BWQA 2B5XA 4KCEA 2D2ZA 2FCHA 2GQLA 1SENA 2DIYA 1XWGA 3IK9A 4HZ4A 2YOIA 2VD1A 2KP2A 1T1VA 3CRTA 5DAKB 4MMMA 2GZPA 5D9XA 4USSA 4K5SA 1PA3A 2HT9A 4TR1A 1JHBA 4J57E 4P3YB 5IOXA 3IC4A 4F82A 1SKRB 5DDLA 1HQOA 4Q5NA 2H30A 4ML6A 3KZQA 2VD0A 5IO2A 3HJOA 2R5GA 4NV5A 4F2IA 4GLTA 5IPGA 3IHGA 4CW9A 3W8SA 1TRVA 3Q18A 1B8XA 3KIJA 4AJ7A 3PGTA 4PQIA 5ELAA 2F8AA 3Q6OA 3PPUA 19GSA 1Z5YE 4GQCA 4KW6A 1KTEA 2PWJA 2FA8A 4RQXA 5ECLB 3D6IA 5AISA 5IQYA 2H1AA 2VAFA 1TRWA 1WIKA 4BL7B 4HQZA 4E8EA 1AC1A 5CRHA 2YZHA 4MPGA 5KN3A 6GSSA 3V1WA 2L4CA 4CHSA 2DKIA 3UMAA 1U3AA 1Z6MA 3BCKA 3IRAA 4WKWA 6GSVA 5G5EA 4ZB8A 2DSAA 3F4TA 2CAIA 1XWAA 2ZUPA 3A5IA 1IYIA 4NMUA 2VL2A 3VI7A 4IGJA 5DJMA 2LJRA 1WMJA 3I69A 3HHVA 1PX7A 4IHUA 4YQVA 3US3A 2MYGA 1W4VA 3TJJA 1UVZA 4D73B 1KEBA 1OC3A 2HFDA 1GH2A 3ERFA 2YJ7A 3EMPA 4WF5A 5IMZA 1MDJA 5LCZA 1ZCPA 1G7OA 3M1GA 1QFNA 3UJ1A 3K8NA 4JEDA 2HXKA 1NM3A 4MZCA 4N0ZA 2EIQA 5DVBA 4XRAA 4QL9A 3FEUA 1O81A 1A24A 5FWGA 2MMZA 4AF2A 2G2QA 2TIRA 4MCUA 1XXUA 4TOPA 3FZ5A 1X5CA 3ERGA 4ZL8A 4RQRA 2PUKC 2O8VB 2IIYA 2YV9A 5IMVA 1SK0A 3J7Yk 2AUVA 6GSYA 3DMLA 12GSA 2H66A 2L59A 3FYGA 3H4KA 3O3TA 4ICYA 3RPPA 1ZYNA 1S3CA 3MIXA 2DIZA 2YN1A 3R2QA 5HFGA 5GSSA 1A2JA 5J9CA 2FLSA 2YWOA 1F3BA 1Y25A 3TRQA 2R4VA 3D21A 3NZNA 4OWYA 4MF5A 2H71A 3ZLPA 2CX3A 3R3EA 5B8BA 3ZFBA 1GSYA 2B3SA 2YZUA 2R0CA 1URMA 4DSQA 5CAXA 3P90A 4HEA2 4OCFA 2B7JA 6GSXA 5JWQB 1OAZA 3E3EA 3N9JA 3ZL5A 4EO3A 2PERA 2GTUA 2QA1A 2VM1A 3F8UA 1KBNA 3A3TA 1A8LA 1TJDA 3L4NA 1HNCA 3PR8A 1FHEA 3Q74A 3DWVA 4ZL9A 3L0HA 1ZYPA 3F3QA 3UARA 1TRUA 3LW9A 3HVXA 3L9UA 4DSRA 3TKPA 1A2LA 3TJBA 5J4UA 2OE3A 1ZZYA 4MH2A 1MEKA 2AAWA 1R5AA 2AB6A 4N11A 2PBJA 4FQUA 4CY6A 4L5LA 3HY2A 4OMVA 2EC4A 2CV4A 3J7Yb 3A2VA 1CQHA 4TR3A 3VWXA 4KGIA 2PVOC 2HYXA 2GSQA 4EDYA 2GSSA 5DCGA 4EDZA 1ON4A 3HCZA 5D9TA 2FNOA 3GL5A 3VK9A 2HZEB 1G6WA 3DXBA 3GKKA 5LD0A 4HDEA 1GLQA 3KP9A 1XCCA 1A0RP 5IPHA 3HDCA 1I9DA 1SJIA 3WT2A 1BG5A 2GS3A 4IBPA 4KSMA 4I5QA 3ZMKA 5KN2A 5D96A 2OBIA 3H93A 2HRFA 4V1Ap 4AJ6A 3ME8A 3TKSE 5IMFA 2C3TA 2VL3A 2VCXA 20GSA 1XBSA 2CVKA 2FWGA 1GWCA 2XBQA 2QKEA 3I9V2 4IN0A 1YEPA 2VCQA 2K8SA 2CZ3A 5IMAA 4XS4A 2P5QA 3UL3A 2P5RA 2JACA 2PPTA 4G9HA 5DAKA 4MABA 1OC9B 2H6ZA 5EY6A 1RQMA 2B1LA 1K0NA 3QAWA 1JFUA 2VUPA 1XOAA 2X99A 3TCOA 1EP7A 2R0PA 3ZRDA 2DMMA 1ZOFA 5D73A 2LQQA 4WBJA 2MBTA 5G1LA 1DBYA 4JU5A 3F4RA 2XPDA 1XWCA 2H73A 1K0OA 5AIVA 4K1FA 3C1SA 2XBIA 5F0GA 5A4VA 3IPZA 4O5RA 2GVPA 2I9HA 2JU5A 1FOVA 4X1UA 1TK8B 1QK8A 3HXSA 1GUHA 2NPBA 1TTZA 3TKQA 3S9FA 2H74A 1T8EB 3MSZA 5J41A 3A2WA 3OR5A 3D4MA 4K5RA 1EV9A 3A2XA 3KH9A 2WZ9A 4O32A 2N5BA 1M9BA 3GYKA 2HLSA 2GLRA 5E59A 1DSBA 1T3BA 2A2PA 1R7HA 18GSA 5DQSA 3NOFA 5G5FA 5ECQB 1W89A 1K0BA 2QC7A 6GSTA 1GSEA 4Q5FA 1M2BA 3CYNA 4EUYA 3DRNA 1G6YA 1FOHA 2L5LA 4ECJA 4KUNA 3H8QA 4HOJA 16GSA 4ZBAA 3A5WA 3BBYA 4D73A 2N5FA 1X9WB 2IFQA 3BD2A 3HVVA 2LEGA 3GX0A 3HA9A 4TR0A 3GA4A 4MK3A 3FK8A 4G19A 4K7OA 3QMXA 2GZZA 2REMA 2WS2A 3VWWA 1TK0B 2IMKA 4IQ1A 3TOTA 2DLXA 3TDGA 3GX8A 1G0TA 4XS6A 3TRXA 2NBSA 1XWKA 2I4AA 3UBKA 3ZFLA 1ABAA 2QSIA 2NVLA 4IP1A 5JCUA 4FH8A 2PN8A 4DEJA 2YWMA 1R26A 3EPTA 2DC5A 4ZB6A 5IMDA 4KX4A 2BMXA 1UN2A 4NWYA 3ZTLA 1XZOA 1PD21 1WRYA 3P8WA 2JZSA 2L5OA 1J9BA 1OC8A 5F07A 4PQ1A 3PH9A 2YP6A 3FR6A 1EV4A 1GNWA 4XCSA 2H6XA 3KJYA 4MLYA 5HQPA 4NHZA 1PL1A 1MDKA 4N10A 2TRXA 1GP1A 2WJUA 1TRSA 5IO0A 2X8GA 3GIXA 4RI6A 4O5QA 4GRFA 1QMVA 3FHKA 4G0KA 4F9ZA 3M0FA 1ERUA 4OFNA 5FHIA 1VF3A 4XS4B 4G0LA 3G7IA 5HFIA 22GSA 2VOCA 1DUGA 1M7TA 5G1KA 3CBUA 2DJKA 3C1RA 3TKRA 2VCTA 1YY7A 4I97A 3QAVA 3RAZA 3IAS2 1QXHA 3ZZXA 3FRCA 5JWRB 3TGZA 2LQOA 2YPMA 4K0NA 5EVOA 4NPBA 2ON5A 5KN1A 4BWSA 1GSFA 4MF7A 5HR2A 1MD4A 3ME7A 2H72A 1TP9A 1EGRA 1X5DA 4X0XA 3ZIJA 5LNKe 5AIXA 1GUMA 1HNAA 4ECIA 1XFLA 2L6DA 1EZKA 11GSA 3DEXA 3LWAA 1N2AA 3MYDA 1WJKA 3LG6A 2CAQA 3KM6A 1EOGA 4KSOA 3EWLA 3D5JA 4FYUA 4HJMA 3GUSA 4RI7A 4MNNA 3W6GA 5KN0A 3GHAA 1NHYA 1XWBA 4PTSA 1PKWA 1G7EA 3GV1A 4L0UA 4KH7A 4Z2TA 4FYCA 1K3LA 4K7IA 4DVCA 2X64A 4K2DA 3HD5A 4Q5QA 5HR0A 1GNEA 5KOXA 3KMNA 1HD2A 1K0CA 1ERTA 4G10A 1ZYQB 3KEBA 2HZEA 4BVYA 2R2JA 1OKDA 1XVQA 1ZMAA 2IFQB 2CVDA 5J5NA 2M80A 1RK4A 5ECRB 3D4TA 1FW1A 3DKSA 2WDUA 4ZL7A 2X49A 4GSNA 4PX1A 5H5RA 4K0GA 3GN3A 3C71A 1U88A 4GWRA 3KMOA 5ABRA 4PGTA 3G7YA 4TXVA 4XHMA 2IMEA 4IJIA 1YDKA 4WETA 2TRCP 2H1DA 1XW6A 4MPFA 4IELA 1V40A 3LQ7A 3HZ4A 1AQXA 2A2SA 2LSTA 4YKFA 1J08A 4PNFA 2B7KA 2VIMA 2JSYA 4TXOA 2RM6A 2HSMA 4TRXA 3LYKA 5GAND 3F6DA 1WPIA 1MTCA 1V98A 3FZAA 4POBA 1V2AA 1B9YC 1GSDA 1OC9A 2C0EA 4XIHA 1U3IA 4LL1B 1XPVA 2H1GA 5CRWA 2ZCTA 3P7XA 4GSTA 4K8MA 4POKA 5DALA 3TKSC 1Z3EA 1S3AA 2JZRA 1DE1A 3CSHA 1GTAA 3G7JA 4L8EA 1FB6A 2KP1A 4IKHA 2CQ9A 1GTBA 2WGRA 3RHCA 1KNGA 3BOAA 4YAVA 4POMA 2DJJA 2OACA 2YWIA 4ISDA 3I43A 2H8LA 13GSA 1EEJA 3CSJA 4DSSA 4I8BA 1AAZA 4GCIA 2H76A 1A0FA 1PL2A 4H86A 1QGVA 3RHBA 4F0BA 2HSHA 3FW2A 1R4WA 3KH7A 1SD8A 3WGDA 2LV3A 2OJLA 1VF2A 4Q5RA 2UZ8A 1EOHA 4FYBA 2GDRA 1XOBA 2HRKA 3BCIA 3O76A 4WR4A 1F6MC 3CRUA 2YV7A 2E2MA 5JWOB 1MD3A 3LFLA 1JZRA 4Z2UA 3KP8A 1WP0A 3HYPA 5ECMB 2DJ3A 2GT6A 2OKAA 1TW9A 1K0DA 3EE2A 2R3XA 2LS5A 4LL4B 1X9SB 1BX9A 4JRRA 1BYEA 3GTUA 3VWVA 4MA9A 3KTLA 3ZVJA 1H4OA 1M2DA 2OA7A 3H79A 1A8YA 2K6VA 1AXDA 2IJYA 3TRPA 1SK1A 1GL8A 2AHEA 2DKHA 5CNWA 3WT1A 3GURA 3QOUA 2DJ1A 3VWUA 1AQWA 3GKXA 1GRXA 2KHPA 2VLTA 1TKDB 2FGXA 3FR9A 5A4UA 3IC8A 2IN3A 2ALBA 1S3DA 1NHOA 6GSWA 5G30A 3UVTA 4BVYB 1FVKA 5HR3A 3O6TA 2GZYA 2F51A 4K7NA 3QFAC 5ECIB 1Q4JA 1PN0A 1EWXA 14GSA 4N0VA 3UBLA 1AUCA 4ZILA 2O89A 1PKZA 3GSTA 2AV4A 5C00A 1R5PA 3HJMA 3KD0A 1YF1A 3UIWA 2IPAA 3APSA 1X9MB 4EF0A 3FY7A 4L0WA 5COHA 2I1UA 2LRCA 4O92A 3VPTA 4KDUA 3VLNA 1T4ZA 2E0QA 1ERWA 2OADA 4E8HA 3QFBC 4TXOB 2PVQA 5G31A 1JZDA 1SKSB 3CTFA 3QPMA 4ZIJA 1SJZA 2E7PA 4F03A 4KDYA 4JBBA 2B5EA 3DIEA 1F37A 1OE7A 2B6MA 4IS0A 2C80A 2ZNMA 4ID0A 1Z9HA 5DALB 3IE3A 4KF9A 3TUEA 1XIYA 1O73A 1F3AA 4OD7A 2DMLA 5B6NA 4X43A 1M9AA 4I2TA 1SL0B 1SK2A 1QUWA 1LJRA 5HFKA 4EE0A 2V1MA 1M2AA 2R37A 3C73A 5F8BA 5A5KA 4HUAA 4DSSB 5DCHA 3U5RE 2CA8A 4NAXA 1GSUA 2CVBA 5CYYA 1BJXA 1GTUA 5CREA 1PX6A 1OYJA 1ML6A 4BPYA 4MJBA 1M0UA 4ECBA 2HI7A 1I5GA 2GQMA 4HI7A 8GSSA 5FT3A 2A4VA 3UEMA 3APQA 5KOWA 1V57A 3ERWA 1B4PA 17GSA 3RDWA 1PMTA 5JCWA 3FKFA 1SD9A 3FR3A 4JE1A 4TVEA 4J2FA 3GTUB 5HR1A 1TI3A 2LKUA 1K0MA 2M46A 1WE0A 3QDNA 3JCML 3APOA 3FMWA 4IW9A 4OCEA 3UAPA 2QGVA 1B48A 3IBHA 3KXOA 3PINA 5JCGA 4ZBBA 2FWFA 4XTSA 3HVSA 1K0AA 4MZWA 3CSIA 3L9SA 1U6TA 2LRNA 4TR4A 3QD9A 3LXTA 1AQVA 3DVXA 4BA7A 5GZZB 2X8HA 1JLVA 3ISOA 2LJKA 3QAGA 4YH2A 2VCZA 1BEDA 3CXGA 4JR6A 4TN8A 5E4WA 1USBA 4IVFA 1NW2A 5KEJA 4KA0A 2N5AA 2HRAA 3LYPA 1TXXA 4PQHA 5D9VA 5DQYA 1DE2A 3IOSA 3DGQA 5ELGA 2QA2A 2C1YA 3C8EA 4MF6A 4POLA 1MDIA 1ZYEA 2RIIA 3TJFA 3DYRA 5ECNB 4O5UA 1C72A 4V2NA 5CO3A 2IMIA 5B7CA 2DJ2A 2LTKA 3IHQA 5IMCA 3ZIVA 1HNBA 3GH9A 1SL1B 10GSA 3LEFA 4GF0A 3ED3A 1GSSA 2X4AA 5D8IA 3E9JB 2K8VA 3F63A 3Q19A 2PU9C 2L4QA 5ECSA 5AGYA 1FO5A 5C04A 3BJ5A 2IMFA 4MZBA 1JZWA 2C0DA 3F6FA 1K3OA 4ZXGA 2C0GA 2E2GA 4KDXA 1Z7RA 4L5OA 2ES7A 1PSQA 5B8AA 1ILOA 2MMAA 4O7HA 3ZVJD 3CMIA 4NXIA 2NTOA 4IP6A 4EVMA 4ULXA 3TOUA 1BQ7A 4WR5A 4YQMA 1YKCA 5INYA 3SWLA 4MJCA 4HU9A 3GFKA 2CT6A 2P31A 1YF0A 2CX4A 3GKMA 1Z6NA 1Z7PA 2B1KA 2FA4A 3MNGA 3TKSA 6GSUA 3GMFA 5ID2B 2HE3A 3P2AA 3EINA 3EYTA 1VF1A 2C8UA 2MZCA 3AY8A 3C7MA 3IAM2 2A2RA 1YQ1A 1O7UA 1J0FA 4V2MA 4YAPA 5J9BA 5D93A 5B6MA 2C0FA 1WOUA 4TKYA 1SKWB 1OVNA 3GKNA 1TK5B 3GH6A 2L57A 2H75A 1LBKA 4IQAA 3WD6A 3MDKA 3HZ8A 2EIOA 2HNLA 1SU9A 1B4QA 2LNTA 1Q98A 2AJQB 3QCPA 3EU4A 2VO4A 4IJ3A 1TU7A 2FD3A 4KCAA 3ZMLA 2GQKA 1X5EA 1E6BA 2MMOA 2WCIA 2VLVA 3G9BA 1YEXA 3MWHA 4ACSA 2H1BA 1SYRA 1H75A 2EIRA 4EL1A 2KUCA 1SJ6A 1B9XC 2YWNA 1A23A 2CZ2A 2DBCA 1EEMA 2M72A 4I2UA 4BVXB 3MAKA 3EMXA 4K9ZA 3GSSA 2KLXA 1TOFA 2HSYA 1T00A 9GSSA 1PN9A 4YKGA 4CY8A 3KGKA 4PXOA 1FAAA 3WYWA 1OKTA 1EP8A 1RW1A 1NSWA 1UC7A 2YCDA 5ECHB 5BMUA 3H1NA 5CRDA 4FIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WXT A;  3RBT A;  3LGC A;  4GXZ A;  1WWJ A;  4ZB9 A;  2FY6 A;  5L71 A;  4WBR D;  1M99 A;  1GUL A;  1JZO A;  2I3Y A;  3M8N A;  3LJR A;  2VLU A;  2WFC A;  1T4Y A;  4GSS A;  4OO4 A;  3TJG A;  2YNX A;  1IYH A;  1SL2 B;  2LRT A;  5IOW A;  4AJ8 A;  3IR4 A;  2HZF A;  1O8X A;  3HKR A;  3M9K A;  4TR1 B;  5ECP B;  4XS1 A;  2IL3 A;  4HU7 A;  2XPE A;  5D9W A;  2V41 A;  2L6C A;  3GRX A;  2K18 A;  4PUR A;  3RPN A;  1THX A;  2VL2 C;  2H01 A;  1O6J A;  2OBK A;  5DBQ A;  5CRG A;  1THO A;  2GT5 A;  5F05 A;  2WB9 A;  4MJA A;  4MP4 A;  5F06 A;  2ON7 A;  4PUA A;  2DJ0 A;  1V58 A;  2H70 A;  2BJX A;  2O85 A;  3GL3 A;  3HJP A;  1VF4 A;  2P0G A;  1X0R A;  3QR6 A;  2PGT A;  1AW9 A;  2YAN A;  4JR4 A;  3LXZ A;  2GST A;  3M9J A;  4V1A g;  2NDO A;  2LJA A;  2K9F A;  4CDO A;  4ILF A;  2MMN A;  2FWE A;  2WRT A;  2G0F A;  2VCV A;  2Z9S A;  5IIZ A;  3L78 A;  2MBS A;  4RUV A;  4EXJ A;  1Y6E A;  2VCW A;  3FZ4 A;  4LA1 A;  2C3N A;  2C4J A;  2AYT A;  5DJL A;  2JL4 A;  2H0G A;  3EUR A;  3M3M A;  2KOK A;  1XW5 A;  2LUS A;  2FWH A;  3F0I A;  3DD3 A;  1VGL A;  1FVJ A;  5EPF A;  4HQS A;  2J23 A;  2VL9 A;  4TW5 A;  2R6K A;  4NV2 A;  3LOR A;  2PMT A;  4EC0 A;  3DVW A;  5IM9 A;  3W8J A;  4KAE A;  1GTI A;  3EU3 A;  4MH3 A;  2JZT A;  2FUG 2;  4K6X A;  1YZX A;  1XW9 A;  5GST A;  1GSQ A;  1ZGN A;  1V9W A;  1VRS D;  1O85 A;  2RLI A;  3D22 A;  3IDV A;  2OE0 A;  1GLP A;  4N30 A;  3CTG A;  3EC3 A;  4XRD A;  3VPQ A;  3UVH A;  1SYX A;  1PGT A;  4HZ2 A;  2F9S A;  4ECC A;  1T7P B;  3ZYW A;  4OFT A;  3UOM A;  2YJH A;  1ZL9 A;  1FB0 A;  2V6K A;  4HJ2 A;  5A4W A;  1LU4 A;  3U6V A;  1HYU A;  5EL8 A;  2F8F A;  4KE3 A;  5H5Q A;  3ZRE A;  1K3Y A;  1PRX A;  2B5Y A;  7GSS A;  1E2Y A;  4WF4 A;  3F9U A;  3L9V A;  2V6O A;  5GAP D;  3VI5 A;  3FZ9 A;  4JZQ A;  5AN1 A;  2XHF A;  5G2Z A;  2H0H A;  2IMD A;  3IXR A;  4GTU A;  4OFM A;  1U87 A;  1BAY A;  1OE8 A;  4LLR A;  1ACV A;  4QL7 A;  2JSZ A;  4PUF C;  1N8J A;  2IWT A;  4KND A;  2BTO T;  4EKZ A;  1AIU A;  3KCM A;  4LMW A;  4FO5 A;  3IA1 A;  1UA5 A;  3IV4 A;  3SBC A;  3F3R A;  2RM5 A;  5ID2 A;  3GNJ A;  5J3R A;  2J9H A;  2O7K A;  4NHW A;  2RUF A;  1A2M A;  1QQ2 A;  1XVW A;  3WGE A;  3ZIT A;  4V2L A;  4BL7 A;  3F4S A;  4AGS A;  3I6A A;  1FG4 A;  3TJK A;  1YKA A;  5ECK B;  2FHE A;  2GGT A;  1TDI A;  4J56 E;  4HS1 A;  2VM2 A;  2GSR A;  4Z7X A;  4MDC A;  5ENU A;  4KB3 A;  3LSZ A;  2JAD A;  3D0Z A;  1ERV A;  4OO5 A;  4ML1 A;  5ECO B;  1PQN A;  2OE1 A;  4LMV A;  1EGO A;  1GUK A;  3E0U A;  2I81 A;  2C3Q A;  1F9M A;  1O8W A;  4F0C A;  2RUE A;  3IK7 A;  4QQ7 A;  1TI1 A;  2H19 A;  5CP1 A;  1JLW A;  3NIV A;  2HRN A;  1TU8 A;  4BVX A;  3TB2 A;  3VUR A;  4PNG A;  3N5O A;  2X8C A;  3EVI A;  2F3M A;  4G2E A;  4YQU A;  4WEY A;  1ST9 A;  2O87 A;  3WGX A;  4ZBD A;  2LNS A;  2V32 A;  4I6X A;  5H5S A;  3KTB A;  4MJE A;  2H6Y A;  2V2G A;  2WUL A;  3VFI A;  2H0I A;  2XC2 A;  1CQG A;  4GQF A;  1F2E A;  1YJ6 A;  4BWQ A;  2B5X A;  4KCE A;  2D2Z A;  2FCH A;  2GQL A;  1SEN A;  2DIY A;  1XWG A;  3IK9 A;  4HZ4 A;  2YOI A;  2VD1 A;  2KP2 A;  1T1V A;  3CRT A;  5DAK B;  4MMM A;  2GZP A;  5D9X A;  1PA3 A;  2HT9 A;  4TR1 A;  1JHB A;  4J57 E;  4P3Y B;  5IOX A;  3IC4 A;  4F82 A;  1SKR B;  5DDL A;  1HQO A;  4Q5N A;  2H30 A;  4ML6 A;  3KZQ A;  2VD0 A;  5IO2 A;  3HJO A;  2R5G A;  4NV5 A;  4F2I A;  4GLT A;  5IPG A;  4CW9 A;  3W8S A;  1TRV A;  3Q18 A;  1B8X A;  3KIJ A;  4AJ7 A;  3PGT A;  4PQI A;  5ELA A;  2F8A A;  3Q6O A;  19GS A;  1Z5Y E;  4GQC A;  4KW6 A;  1KTE A;  2PWJ A;  2FA8 A;  4RQX A;  5ECL B;  3D6I A;  5AIS A;  5IQY A;  2H1A A;  2VAF A;  1TRW A;  1WIK A;  4HQZ A;  4E8E A;  1AC1 A;  5CRH A;  2YZH A;  4MPG A;  5KN3 A;  6GSS A;  3V1W A;  2L4C A;  4CHS A;  3UMA A;  1U3A A;  1Z6M A;  3BCK A;  3IRA A;  4WKW A;  6GSV A;  5G5E A;  4ZB8 A;  2DSA A;  3F4T A;  2CAI A;  1XWA A;  2ZUP A;  1IYI A;  4NMU A;  2VL2 A;  3VI7 A;  4IGJ A;  5DJM A;  2LJR A;  1WMJ A;  3I69 A;  3HHV A;  1PX7 A;  4IHU A;  4YQV A;  3US3 A;  2MYG A;  1W4V A;  3TJJ A;  1UVZ A;  4D73 B;  1KEB A;  1OC3 A;  2HFD A;  1GH2 A;  3ERF A;  2YJ7 A;  3EMP A;  4WF5 A;  5IMZ A;  1MDJ A;  5LCZ A;  1ZCP A;  1G7O A;  3M1G A;  1QFN A;  3UJ1 A;  3K8N A;  4JED A;  2HXK A;  1NM3 A;  4MZC A;  4N0Z A;  2EIQ A;  5DVB A;  4XRA A;  4QL9 A;  3FEU A;  1O81 A;  1A24 A;  5FWG A;  2MMZ A;  4AF2 A;  2G2Q A;  2TIR A;  4MCU A;  1XXU A;  4TOP A;  3FZ5 A;  1X5C A;  3ERG A;  4ZL8 A;  4RQR A;  2PUK C;  2O8V B;  2IIY A;  2YV9 A;  5IMV A;  1SK0 A;  3J7Y k;  2AUV A;  6GSY A;  3DML A;  12GS A;  2H66 A;  2L59 A;  3FYG A;  3H4K A;  3O3T A;  3RPP A;  1S3C A;  2DIZ A;  2YN1 A;  3R2Q A;  5HFG A;  5GSS A;  1A2J A;  5J9C A;  2FLS A;  2YWO A;  1F3B A;  1Y25 A;  3TRQ A;  2R4V A;  3D21 A;  3NZN A;  4OWY A;  4MF5 A;  2H71 A;  3ZLP A;  2CX3 A;  5B8B A;  3ZFB A;  1GSY A;  2B3S A;  2YZU A;  1URM A;  4DSQ A;  5CAX A;  3P90 A;  4HEA 2;  4OCF A;  2B7J A;  6GSX A;  5JWQ B;  1OAZ A;  3E3E A;  3N9J A;  3ZL5 A;  4EO3 A;  2PER A;  2GTU A;  2VM1 A;  3F8U A;  1KBN A;  3A3T A;  1A8L A;  1TJD A;  3L4N A;  1HNC A;  3PR8 A;  1FHE A;  3Q74 A;  3DWV A;  4ZL9 A;  3L0H A;  3F3Q A;  3UAR A;  1TRU A;  3HVX A;  3L9U A;  4DSR A;  3TKP A;  1A2L A;  3TJB A;  5J4U A;  2OE3 A;  1ZZY A;  4MH2 A;  1MEK A;  2AAW A;  1R5A A;  2AB6 A;  4N11 A;  2PBJ A;  4L5L A;  3HY2 A;  4OMV A;  2EC4 A;  2CV4 A;  3J7Y b;  3A2V A;  1CQH A;  4TR3 A;  3VWX A;  4KGI A;  2PVO C;  2HYX A;  2GSQ A;  4EDY A;  2GSS A;  5DCG A;  4EDZ A;  1ON4 A;  3HCZ A;  5D9T A;  2FNO A;  3GL5 A;  3VK9 A;  2HZE B;  1G6W A;  3DXB A;  3GKK A;  5LD0 A;  4HDE A;  1GLQ A;  3KP9 A;  1XCC A;  1A0R P;  5IPH A;  3HDC A;  1I9D A;  1SJI A;  3WT2 A;  1BG5 A;  2GS3 A;  4IBP A;  4KSM A;  4I5Q A;  3ZMK A;  5KN2 A;  5D96 A;  2OBI A;  3H93 A;  2HRF A;  4V1A p;  4AJ6 A;  3ME8 A;  3TKS E;  5IMF A;  2C3T A;  2VL3 A;  2VCX A;  20GS A;  1XBS A;  2CVK A;  2FWG A;  1GWC A;  2XBQ A;  2QKE A;  3I9V 2;  4IN0 A;  1YEP A;  2VCQ A;  2K8S A;  2CZ3 A;  5IMA A;  4XS4 A;  2P5Q A;  3UL3 A;  2P5R A;  2JAC A;  2PPT A;  4G9H A;  5DAK A;  4MAB A;  1OC9 B;  2H6Z A;  5EY6 A;  1RQM A;  2B1L A;  1K0N A;  3QAW A;  1JFU A;  2VUP A;  1XOA A;  2X99 A;  3TCO A;  1EP7 A;  3ZRD A;  2DMM A;  1ZOF A;  5D73 A;  2LQQ A;  4WBJ A;  2MBT A;  5G1L A;  1DBY A;  4JU5 A;  3F4R A;  2XPD A;  1XWC A;  2H73 A;  1K0O A;  5AIV A;  4K1F A;  3C1S A;  2XBI A;  5F0G A;  5A4V A;  3IPZ A;  4O5R A;  2GVP A;  2I9H A;  2JU5 A;  1FOV A;  4X1U A;  1TK8 B;  1QK8 A;  3HXS A;  1GUH A;  2NPB A;  1TTZ A;  3TKQ A;  3S9F A;  2H74 A;  1T8E B;  3MSZ A;  5J41 A;  3A2W A;  3OR5 A;  3D4M A;  1EV9 A;  3A2X A;  3KH9 A;  2WZ9 A;  4O32 A;  2N5B A;  1M9B A;  3GYK A;  2HLS A;  2GLR A;  5E59 A;  1DSB A;  1T3B A;  1R7H A;  18GS A;  5DQS A;  3NOF A;  5G5F A;  5ECQ B;  1W89 A;  1K0B A;  2QC7 A;  6GST A;  1GSE A;  4Q5F A;  1M2B A;  3CYN A;  4EUY A;  3DRN A;  1G6Y A;  2L5L A;  4ECJ A;  4KUN A;  3H8Q A;  4HOJ A;  16GS A;  4ZBA A;  3A5W A;  3BBY A;  4D73 A;  2N5F A;  1X9W B;  2IFQ A;  3BD2 A;  3HVV A;  2LEG A;  3GX0 A;  3HA9 A;  4TR0 A;  3GA4 A;  4MK3 A;  3FK8 A;  4G19 A;  4K7O A;  3QMX A;  2GZZ A;  2REM A;  2WS2 A;  3VWW A;  1TK0 B;  2IMK A;  4IQ1 A;  3TOT A;  2DLX A;  3TDG A;  3GX8 A;  1G0T A;  4XS6 A;  3TRX A;  2NBS A;  1XWK A;  2I4A A;  3UBK A;  3ZFL A;  1ABA A;  2QSI A;  2NVL A;  4IP1 A;  5JCU A;  4FH8 A;  2PN8 A;  4DEJ A;  2YWM A;  1R26 A;  2DC5 A;  4ZB6 A;  5IMD A;  4KX4 A;  2BMX A;  1UN2 A;  4NWY A;  3ZTL A;  1XZO A;  1PD2 1;  1WRY A;  3P8W A;  2JZS A;  2L5O A;  1J9B A;  1OC8 A;  5F07 A;  4PQ1 A;  3PH9 A;  2YP6 A;  3FR6 A;  1EV4 A;  1GNW A;  4XCS A;  2H6X A;  3KJY A;  4MLY A;  5HQP A;  4NHZ A;  1PL1 A;  1MDK A;  4N10 A;  2TRX A;  1GP1 A;  2WJU A;  1TRS A;  5IO0 A;  2X8G A;  3GIX A;  4RI6 A;  4GRF A;  1QMV A;  3FHK A;  4F9Z A;  3M0F A;  1ERU A;  4OFN A;  5FHI A;  1VF3 A;  4XS4 B;  3G7I A;  5HFI A;  22GS A;  2VOC A;  1DUG A;  1M7T A;  5G1K A;  3CBU A;  2DJK A;  3C1R A;  3TKR A;  2VCT A;  1YY7 A;  4I97 A;  3QAV A;  3RAZ A;  3IAS 2;  1QXH A;  3ZZX A;  3FRC A;  5JWR B;  3TGZ A;  2LQO A;  2YPM A;  4K0N A;  5EVO A;  4NPB A;  2ON5 A;  5KN1 A;  4BWS A;  1GSF A;  4MF7 A;  5HR2 A;  1MD4 A;  3ME7 A;  2H72 A;  1TP9 A;  1EGR A;  1X5D A;  4X0X A;  3ZIJ A;  5LNK e;  5AIX A;  1GUM A;  1HNA A;  4ECI A;  1XFL A;  2L6D A;  1EZK A;  11GS A;  3DEX A;  3LWA A;  1N2A A;  1WJK A;  3LG6 A;  2CAQ A;  3KM6 A;  1EOG A;  4KSO A;  3EWL A;  3D5J A;  4FYU A;  4HJM A;  3GUS A;  4RI7 A;  3W6G A;  5KN0 A;  3GHA A;  1NHY A;  1XWB A;  1PKW A;  1G7E A;  3GV1 A;  4L0U A;  4KH7 A;  4FYC A;  1K3L A;  4K7I A;  4DVC A;  2X64 A;  4K2D A;  3HD5 A;  4Q5Q A;  5HR0 A;  1GNE A;  3KMN A;  1HD2 A;  1K0C A;  1ERT A;  4G10 A;  1ZYQ B;  3KEB A;  2HZE A;  4BVY A;  2R2J A;  1OKD A;  1XVQ A;  1ZMA A;  2IFQ B;  2CVD A;  5J5N A;  2M80 A;  1RK4 A;  5ECR B;  3D4T A;  1FW1 A;  3DKS A;  2WDU A;  4ZL7 A;  4GSN A;  4PX1 A;  5H5R A;  4K0G A;  3GN3 A;  3C71 A;  1U88 A;  4GWR A;  3KMO A;  5ABR A;  4PGT A;  3G7Y A;  4TXV A;  4XHM A;  2IME A;  4IJI A;  1YDK A;  4WET A;  2TRC P;  2H1D A;  1XW6 A;  4MPF A;  4IEL A;  1V40 A;  3LQ7 A;  3HZ4 A;  1AQX A;  2A2S A;  2LST A;  1J08 A;  4PNF A;  2B7K A;  2VIM A;  2JSY A;  4TXO A;  2RM6 A;  4TRX A;  3LYK A;  5GAN D;  3F6D A;  1WPI A;  1MTC A;  1V98 A;  3FZA A;  4POB A;  1V2A A;  1B9Y C;  1GSD A;  1OC9 A;  2C0E A;  4XIH A;  1U3I A;  4LL1 B;  1XPV A;  2H1G A;  5CRW A;  2ZCT A;  3P7X A;  4GST A;  4K8M A;  4POK A;  5DAL A;  3TKS C;  1Z3E A;  1S3A A;  2JZR A;  1DE1 A;  3CSH A;  1GTA A;  3G7J A;  4L8E A;  1FB6 A;  2KP1 A;  4IKH A;  2CQ9 A;  1GTB A;  2WGR A;  3RHC A;  1KNG A;  3BOA A;  4YAV A;  4POM A;  2DJJ A;  2OAC A;  2YWI A;  4ISD A;  3I43 A;  2H8L A;  13GS A;  1EEJ A;  3CSJ A;  4DSS A;  4I8B A;  1AAZ A;  4GCI A;  2H76 A;  1A0F A;  1PL2 A;  4H86 A;  1QGV A;  3RHB A;  4F0B A;  2HSH A;  3FW2 A;  1R4W A;  3KH7 A;  1SD8 A;  3WGD A;  2LV3 A;  2OJL A;  1VF2 A;  4Q5R A;  1EOH A;  4FYB A;  2GDR A;  1XOB A;  3BCI A;  3O76 A;  4WR4 A;  1F6M C;  3CRU A;  2YV7 A;  2E2M A;  5JWO B;  1MD3 A;  3LFL A;  1JZR A;  3KP8 A;  1WP0 A;  5ECM B;  3HYP A;  2DJ3 A;  2GT6 A;  2OKA A;  1TW9 A;  1K0D A;  3EE2 A;  2R3X A;  2LS5 A;  4LL4 B;  1X9S B;  1BX9 A;  4JRR A;  1BYE A;  3GTU A;  3VWV A;  4MA9 A;  3KTL A;  3ZVJ A;  1H4O A;  1M2D A;  2OA7 A;  3H79 A;  1A8Y A;  2K6V A;  1AXD A;  2IJY A;  3TRP A;  1SK1 A;  1GL8 A;  2AHE A;  5CNW A;  3WT1 A;  3GUR A;  3QOU A;  2DJ1 A;  3VWU A;  1AQW A;  3GKX A;  1GRX A;  2KHP A;  2VLT A;  1TKD B;  2FGX A;  3FR9 A;  5A4U A;  2IN3 A;  2ALB A;  1S3D A;  1NHO A;  6GSW A;  5G30 A;  3UVT A;  1FVK A;  5HR3 A;  3O6T A;  2GZY A;  2F51 A;  4K7N A;  3QFA C;  5ECI B;  1Q4J A;  1EWX A;  14GS A;  4N0V A;  3UBL A;  1AUC A;  4ZIL A;  2O89 A;  1PKZ A;  3GST A;  2AV4 A;  5C00 A;  1R5P A;  3HJM A;  3KD0 A;  1YF1 A;  3UIW A;  2IPA A;  3APS A;  1X9M B;  4EF0 A;  3FY7 A;  4L0W A;  5COH A;  2I1U A;  2LRC A;  4O92 A;  3VPT A;  4KDU A;  3VLN A;  1T4Z A;  2E0Q A;  1ERW A;  2OAD A;  4E8H A;  3QFB C;  4TXO B;  2PVQ A;  5G31 A;  1JZD A;  1SKS B;  3CTF A;  3QPM A;  4ZIJ A;  1SJZ A;  2E7P A;  4F03 A;  4KDY A;  4JBB A;  2B5E A;  3DIE A;  1F37 A;  1OE7 A;  2B6M A;  4IS0 A;  2C80 A;  2ZNM A;  4ID0 A;  1Z9H A;  5DAL B;  3IE3 A;  3TUE A;  1XIY A;  1O73 A;  1F3A A;  4OD7 A;  2DML A;  5B6N A;  4X43 A;  1M9A A;  4I2T A;  1SL0 B;  1SK2 A;  1QUW A;  1LJR A;  5HFK A;  4EE0 A;  2V1M A;  1M2A A;  2R37 A;  3C73 A;  5F8B A;  5A5K A;  4HUA A;  4DSS B;  5DCH A;  3U5R E;  2CA8 A;  4NAX A;  1GSU A;  2CVB A;  5CYY A;  1BJX A;  1GTU A;  5CRE A;  1PX6 A;  1OYJ A;  1ML6 A;  4BPY A;  4MJB A;  1M0U A;  4ECB A;  2HI7 A;  1I5G A;  2GQM A;  4HI7 A;  8GSS A;  5FT3 A;  2A4V A;  3UEM A;  3APQ A;  1V57 A;  3ERW A;  1B4P A;  17GS A;  3RDW A;  1PMT A;  5JCW A;  3FKF A;  1SD9 A;  3FR3 A;  4JE1 A;  4TVE A;  4J2F A;  3GTU B;  5HR1 A;  1TI3 A;  2LKU A;  1K0M A;  2M46 A;  1WE0 A;  3QDN A;  3JCM L;  3APO A;  4IW9 A;  4OCE A;  3UAP A;  2QGV A;  1B48 A;  3IBH A;  3KXO A;  3PIN A;  5JCG A;  4ZBB A;  2FWF A;  4XTS A;  3HVS A;  1K0A A;  4MZW A;  3CSI A;  3L9S A;  1U6T A;  2LRN A;  4TR4 A;  3QD9 A;  3LXT A;  1AQV A;  3DVX A;  4BA7 A;  5GZZ B;  2X8H A;  1JLV A;  3ISO A;  2LJK A;  3QAG A;  4YH2 A;  2VCZ A;  1BED A;  3CXG A;  4JR6 A;  4TN8 A;  5E4W A;  1USB A;  4IVF A;  1NW2 A;  5KEJ A;  4KA0 A;  2N5A A;  3LYP A;  1TXX A;  4PQH A;  5D9V A;  5DQY A;  1DE2 A;  3IOS A;  3DGQ A;  5ELG A;  2C1Y A;  3C8E A;  4MF6 A;  4POL A;  1MDI A;  1ZYE A;  2RII A;  3TJF A;  3DYR A;  5ECN B;  1C72 A;  4V2N A;  5CO3 A;  2IMI A;  5B7C A;  2DJ2 A;  2LTK A;  3IHQ A;  5IMC A;  3ZIV A;  1HNB A;  3GH9 A;  1SL1 B;  10GS A;  3LEF A;  4GF0 A;  3ED3 A;  1GSS A;  5D8I A;  3E9J B;  2K8V A;  3F63 A;  3Q19 A;  2PU9 C;  2L4Q A;  5ECS A;  5AGY A;  1FO5 A;  5C04 A;  3BJ5 A;  2IMF A;  4MZB A;  1JZW A;  2C0D A;  3F6F A;  1K3O A;  4ZXG A;  2C0G A;  2E2G A;  4KDX A;  1Z7R A;  4L5O A;  2ES7 A;  1PSQ A;  5B8A A;  1ILO A;  2MMA A;  4O7H A;  3ZVJ D;  3CMI A;  4NXI A;  2NTO A;  4IP6 A;  4EVM A;  4ULX A;  3TOU A;  1BQ7 A;  4WR5 A;  4YQM A;  1YKC A;  5INY A;  3SWL A;  4MJC A;  4HU9 A;  3GFK A;  2CT6 A;  2P31 A;  1YF0 A;  2CX4 A;  3GKM A;  1Z6N A;  1Z7P A;  2B1K A;  2FA4 A;  3MNG A;  3TKS A;  6GSU A;  3GMF A;  5ID2 B;  2HE3 A;  3P2A A;  3EIN A;  3EYT A;  1VF1 A;  2C8U A;  2MZC A;  3AY8 A;  3C7M A;  3IAM 2;  2A2R A;  1YQ1 A;  1O7U A;  1J0F A;  4V2M A;  4YAP A;  5J9B A;  5D93 A;  5B6M A;  2C0F A;  1WOU A;  4TKY A;  1SKW B;  1OVN A;  3GKN A;  1TK5 B;  3GH6 A;  2L57 A;  2H75 A;  1LBK A;  4IQA A;  3WD6 A;  3MDK A;  3HZ8 A;  2EIO A;  2HNL A;  1SU9 A;  1B4Q A;  2LNT A;  1Q98 A;  2AJQ B;  3QCP A;  3EU4 A;  2VO4 A;  4IJ3 A;  1TU7 A;  2FD3 A;  4KCA A;  3ZML A;  2GQK A;  1X5E A;  1E6B A;  2MMO A;  2WCI A;  2VLV A;  3G9B A;  1YEX A;  3MWH A;  4ACS A;  2H1B A;  1SYR A;  1H75 A;  2EIR A;  4EL1 A;  2KUC A;  1SJ6 A;  1B9X C;  2YWN A;  1A23 A;  2CZ2 A;  2DBC A;  1EEM A;  2M72 A;  4I2U A;  3MAK A;  3EMX A;  4K9Z A;  3GSS A;  2KLX A;  1TOF A;  2HSY A;  1T00 A;  9GSS A;  1PN9 A;  3KGK A;  4PXO A;  1FAA A;  3WYW A;  1OKT A;  1EP8 A;  1RW1 A;  1NSW A;  1UC7 A;  2YCD A;  5ECH B;  3H1N A;  5CRD A;  4FIW A; 
#chains in the Genus database with same CATH topology
 4WXT A;  3RBT A;  3LGC A;  4GXZ A;  1WWJ A;  4ZB9 A;  2FY6 A;  5L71 A;  4WBR D;  1M99 A;  1GUL A;  1JZO A;  2I3Y A;  3M8N A;  3LJR A;  2VLU A;  2WFC A;  1T4Y A;  4GSS A;  4OO4 A;  3TJG A;  2YNX A;  1IYH A;  1M3I A;  1S3R A;  1SL2 B;  2LRT A;  5IOW A;  4AJ8 A;  3IR4 A;  2HZF A;  1O8X A;  3HKR A;  3M9K A;  4TR1 B;  5ECP B;  4XS1 A;  2IL3 A;  4HU7 A;  2XPE A;  5D9W A;  2V41 A;  2L6C A;  3GRX A;  2K18 A;  4PUR A;  3RPN A;  1THX A;  2VL2 C;  2H01 A;  1O6J A;  2OBK A;  5DBQ A;  5CRG A;  1THO A;  2GT5 A;  5F05 A;  2WB9 A;  4MJA A;  4MP4 A;  5F06 A;  2ON7 A;  4PUA A;  2DJ0 A;  1V58 A;  2H70 A;  2BJX A;  2O85 A;  3GL3 A;  3HJP A;  1VF4 A;  2P0G A;  1X0R A;  3QR6 A;  2PGT A;  1AW9 A;  2YAN A;  4JR4 A;  3LXZ A;  2GST A;  3M9J A;  4V1A g;  2NDO A;  2LJA A;  2K9F A;  4CDO A;  4ILF A;  2MMN A;  2FWE A;  2WRT A;  2G0F A;  2VCV A;  2Z9S A;  5IIZ A;  3L78 A;  2MBS A;  4A5P A;  4RUV A;  4EXJ A;  1Y6E A;  2VCW A;  3FZ4 A;  4LA1 A;  2C3N A;  2C4J A;  2AYT A;  5DJL A;  2JL4 A;  2H0G A;  3EUR A;  3M3M A;  2KOK A;  1XW5 A;  2LUS A;  2FWH A;  3F0I A;  3DD3 A;  1VGL A;  1FVJ A;  5EPF A;  4HQS A;  2J23 A;  2VL9 A;  4TW5 A;  2R6K A;  4NV2 A;  3LOR A;  2PMT A;  4EC0 A;  3DVW A;  5IM9 A;  3W8J A;  4KAE A;  1GTI A;  3EU3 A;  4MH3 A;  2JZT A;  2FUG 2;  4K6X A;  1YZX A;  1XW9 A;  5GST A;  1GSQ A;  1ZGN A;  1V9W A;  2A4H A;  1VRS D;  1O85 A;  2RLI A;  3D22 A;  3IDV A;  2OE0 A;  1GLP A;  4K2X A;  4N30 A;  3CTG A;  3EC3 A;  4X4J A;  4XRD A;  4EIP A;  3VPQ A;  3UVH A;  1SYX A;  1PGT A;  4HZ2 A;  2F9S A;  4ECC A;  1T7P B;  3ZYW A;  4OFT A;  3UOM A;  2YJH A;  1ZL9 A;  1FB0 A;  2V6K A;  4HJ2 A;  5A4W A;  1LU4 A;  3U6V A;  1HYU A;  5EL8 A;  2F8F A;  2R0G A;  4KE3 A;  5H5Q A;  3ZRE A;  1K3Y A;  1PRX A;  2B5Y A;  7GSS A;  1E2Y A;  4WF4 A;  3F9U A;  3L9V A;  2V6O A;  5GAP D;  3VI5 A;  3FZ9 A;  4JZQ A;  5AN1 A;  2XHF A;  5G2Z A;  2H0H A;  2IMD A;  3IXR A;  4GTU A;  4OFM A;  1U87 A;  1BAY A;  1OE8 A;  4LLR A;  1ACV A;  4QL7 A;  2JSZ A;  4PUF C;  5BRT A;  1N8J A;  2IWT A;  4KND A;  2BTO T;  4EKZ A;  1AIU A;  3KCM A;  4LMW A;  4FO5 A;  3IA1 A;  1UA5 A;  3IV4 A;  3SBC A;  3F3R A;  2RM5 A;  5ID2 A;  3GNJ A;  5J3R A;  2J9H A;  2O7K A;  4NHW A;  2RUF A;  1A2M A;  1QQ2 A;  1XVW A;  3WGE A;  3ZIT A;  4V2L A;  4BL7 A;  3F4S A;  4AGS A;  3I6A A;  1FG4 A;  3TJK A;  1YKA A;  5ECK B;  2FHE A;  2GGT A;  1TDI A;  4J56 E;  4HS1 A;  2VM2 A;  2GSR A;  4Z7X A;  4MDC A;  5ENU A;  4KB3 A;  3LSZ A;  2JAD A;  3D0Z A;  1ERV A;  3HVN A;  4OO5 A;  4ML1 A;  5ECO B;  1PQN A;  4EIQ A;  2OE1 A;  4LMV A;  1EGO A;  1GUK A;  3E0U A;  2I81 A;  2C3Q A;  1F9M A;  1O8W A;  4F0C A;  2RUE A;  3IK7 A;  4QQ7 A;  1TI1 A;  2H19 A;  5CP1 A;  1JLW A;  3NIV A;  4HSC X;  2HRN A;  1TU8 A;  4BVX A;  3TB2 A;  3VUR A;  4PNG A;  3N5O A;  2X8C A;  3EVI A;  4G0I A;  2F3M A;  4G2E A;  4YQU A;  4WEY A;  1ST9 A;  2O87 A;  3WGX A;  4ZBD A;  4Z2R A;  2LNS A;  2V32 A;  4I6X A;  5H5S A;  3KTB A;  4MJE A;  2H6Y A;  2V2G A;  2WUL A;  3VFI A;  2H0I A;  2XC2 A;  1CQG A;  4GQF A;  1F2E A;  1YJ6 A;  4BWQ A;  2B5X A;  4KCE A;  2D2Z A;  2FCH A;  2GQL A;  1SEN A;  2DIY A;  1XWG A;  3IK9 A;  4HZ4 A;  2YOI A;  2VD1 A;  2KP2 A;  1T1V A;  3CRT A;  5DAK B;  4MMM A;  2GZP A;  5D9X A;  4USS A;  4K5S A;  1PA3 A;  2HT9 A;  4TR1 A;  1JHB A;  4J57 E;  4P3Y B;  5IOX A;  3IC4 A;  4F82 A;  1SKR B;  5DDL A;  1HQO A;  4Q5N A;  2H30 A;  4ML6 A;  3KZQ A;  2VD0 A;  5IO2 A;  3HJO A;  2R5G A;  4NV5 A;  4F2I A;  4GLT A;  5IPG A;  3IHG A;  4CW9 A;  3W8S A;  1TRV A;  3Q18 A;  1B8X A;  3KIJ A;  4AJ7 A;  3PGT A;  4PQI A;  5ELA A;  2F8A A;  3Q6O A;  3PPU A;  19GS A;  1Z5Y E;  4GQC A;  4KW6 A;  1KTE A;  2PWJ A;  2FA8 A;  4RQX A;  5ECL B;  3D6I A;  5AIS A;  5IQY A;  2H1A A;  2VAF A;  1TRW A;  1WIK A;  4BL7 B;  4HQZ A;  4E8E A;  1AC1 A;  5CRH A;  2YZH A;  4MPG A;  5KN3 A;  6GSS A;  3V1W A;  2L4C A;  4CHS A;  2DKI A;  4BIK A;  3UMA A;  1U3A A;  1Z6M A;  3BCK A;  3IRA A;  4WKW A;  6GSV A;  5G5E A;  4ZB8 A;  2DSA A;  3F4T A;  2CAI A;  1XWA A;  2ZUP A;  3A5I A;  1IYI A;  4NMU A;  2VL2 A;  3VI7 A;  4IGJ A;  5DJM A;  2LJR A;  1WMJ A;  3I69 A;  3HHV A;  1PX7 A;  4IHU A;  4YQV A;  3US3 A;  2MYG A;  1W4V A;  3TJJ A;  1UVZ A;  4D73 B;  1KEB A;  1OC3 A;  2HFD A;  1GH2 A;  3ERF A;  2YJ7 A;  3EMP A;  4WF5 A;  5IMZ A;  1MDJ A;  5LCZ A;  1ZCP A;  1G7O A;  3M1G A;  1QFN A;  3UJ1 A;  3K8N A;  4JED A;  2HXK A;  1NM3 A;  4MZC A;  4N0Z A;  2EIQ A;  5DVB A;  4XRA A;  4QL9 A;  3FEU A;  1O81 A;  1A24 A;  5FWG A;  2MMZ A;  4AF2 A;  2G2Q A;  2TIR A;  4MCU A;  1XXU A;  4TOP A;  3FZ5 A;  1X5C A;  3ERG A;  4ZL8 A;  4RQR A;  2PUK C;  2O8V B;  2IIY A;  2YV9 A;  5IMV A;  1SK0 A;  3J7Y k;  2AUV A;  6GSY A;  3DML A;  12GS A;  2H66 A;  2L59 A;  3FYG A;  3H4K A;  3O3T A;  4ICY A;  3RPP A;  1ZYN A;  1S3C A;  3MIX A;  2DIZ A;  2YN1 A;  3R2Q A;  5HFG A;  5GSS A;  1A2J A;  5J9C A;  2FLS A;  2YWO A;  1F3B A;  1Y25 A;  3TRQ A;  2R4V A;  3D21 A;  3NZN A;  4OWY A;  4MF5 A;  2H71 A;  3ZLP A;  2CX3 A;  3R3E A;  5B8B A;  3ZFB A;  1GSY A;  2B3S A;  2YZU A;  2R0C A;  1PFO A;  1URM A;  4DSQ A;  5CAX A;  3P90 A;  4HEA 2;  4OCF A;  2B7J A;  6GSX A;  5JWQ B;  1OAZ A;  3E3E A;  3N9J A;  3ZL5 A;  4EO3 A;  2PER A;  2GTU A;  2QA1 A;  2VM1 A;  3F8U A;  1KBN A;  3A3T A;  1A8L A;  1TJD A;  3L4N A;  1HNC A;  3PR8 A;  1FHE A;  3CQF A;  3Q74 A;  3DWV A;  4ZL9 A;  3L0H A;  1ZYP A;  3F3Q A;  3UAR A;  1TRU A;  3LW9 A;  3HVX A;  3L9U A;  4DSR A;  3TKP A;  1A2L A;  3TJB A;  5J4U A;  2OE3 A;  1ZZY A;  4MH2 A;  1MEK A;  2AAW A;  1R5A A;  2AB6 A;  4N11 A;  2PBJ A;  4FQU A;  4CY6 A;  4L5L A;  3HY2 A;  4OMV A;  2EC4 A;  2CV4 A;  3J7Y b;  3A2V A;  1CQH A;  4TR3 A;  1M3J A;  3VWX A;  4KGI A;  2PVO C;  2HYX A;  2GSQ A;  4EDY A;  2GSS A;  5DCG A;  4EDZ A;  1ON4 A;  3HCZ A;  5D9T A;  2FNO A;  3GL5 A;  3VK9 A;  2HZE B;  1G6W A;  3DXB A;  3GKK A;  5LD0 A;  4HDE A;  1GLQ A;  3KP9 A;  1XCC A;  1A0R P;  5IPH A;  3HDC A;  1I9D A;  1SJI A;  3WT2 A;  1BG5 A;  2GS3 A;  4IBP A;  4KSM A;  4I5Q A;  3ZMK A;  5KN2 A;  5D96 A;  2OBI A;  3H93 A;  2HRF A;  4V1A p;  4AJ6 A;  3ME8 A;  3TKS E;  5IMF A;  2C3T A;  2VL3 A;  2VCX A;  20GS A;  1XBS A;  2CVK A;  2FWG A;  1GWC A;  2XBQ A;  2QKE A;  3I9V 2;  4IN0 A;  1YEP A;  2VCQ A;  2K8S A;  2CZ3 A;  5IMA A;  4XS4 A;  2P5Q A;  3UL3 A;  2P5R A;  2JAC A;  2PPT A;  4G9H A;  5DAK A;  4MAB A;  1OC9 B;  2H6Z A;  5EY6 A;  1RQM A;  2B1L A;  1K0N A;  3QAW A;  1JFU A;  2VUP A;  1XOA A;  2X99 A;  3TCO A;  1EP7 A;  2R0P A;  3ZRD A;  2DMM A;  1ZOF A;  5D73 A;  2LQQ A;  4WBJ A;  2MBT A;  5G1L A;  1DBY A;  4JU5 A;  3F4R A;  2XPD A;  1XWC A;  2H73 A;  1K0O A;  5AIV A;  4K1F A;  3C1S A;  2XBI A;  5F0G A;  5A4V A;  3IPZ A;  4O5R A;  2GVP A;  2I9H A;  2JU5 A;  1FOV A;  4X1U A;  1TK8 B;  1QK8 A;  3HXS A;  1GUH A;  2NPB A;  1TTZ A;  3TKQ A;  3S9F A;  2H74 A;  1T8E B;  3MSZ A;  5J41 A;  3A2W A;  3OR5 A;  3D4M A;  4K5R A;  1EV9 A;  3A2X A;  3KH9 A;  2WZ9 A;  4O32 A;  2N5B A;  1M9B A;  3GYK A;  2HLS A;  2GLR A;  5E59 A;  1DSB A;  1T3B A;  2A2P A;  1R7H A;  18GS A;  5DQS A;  3NOF A;  5G5F A;  5ECQ B;  1W89 A;  1K0B A;  2QC7 A;  6GST A;  1GSE A;  4Q5F A;  1M2B A;  3CYN A;  4EUY A;  3DRN A;  1G6Y A;  1FOH A;  2L5L A;  4ECJ A;  4KUN A;  3H8Q A;  4HOJ A;  16GS A;  4ZBA A;  3A5W A;  3BBY A;  4D73 A;  2N5F A;  1X9W B;  2IFQ A;  3BD2 A;  3HVV A;  2LEG A;  3GX0 A;  3HA9 A;  4TR0 A;  3GA4 A;  4MK3 A;  3FK8 A;  4G19 A;  4K7O A;  3QMX A;  2GZZ A;  2REM A;  2WS2 A;  3VWW A;  1TK0 B;  2IMK A;  4IQ1 A;  3TOT A;  2DLX A;  3TDG A;  3GX8 A;  1G0T A;  4XS6 A;  3TRX A;  2NBS A;  1XWK A;  2I4A A;  3UBK A;  3ZFL A;  1ABA A;  2QSI A;  2NVL A;  4IP1 A;  5JCU A;  4FH8 A;  2PN8 A;  4DEJ A;  2YWM A;  1R26 A;  3EPT A;  2DC5 A;  4ZB6 A;  5IMD A;  4KX4 A;  2BMX A;  1UN2 A;  4NWY A;  3ZTL A;  1XZO A;  1PD2 1;  1WRY A;  3P8W A;  2JZS A;  2L5O A;  1J9B A;  1OC8 A;  5F07 A;  4PQ1 A;  3PH9 A;  2YP6 A;  3FR6 A;  1EV4 A;  1GNW A;  4XCS A;  2H6X A;  3KJY A;  4MLY A;  5HQP A;  4NHZ A;  1PL1 A;  1MDK A;  4N10 A;  2TRX A;  1GP1 A;  2WJU A;  1TRS A;  5IO0 A;  2X8G A;  3GIX A;  4RI6 A;  4O5Q A;  4GRF A;  1QMV A;  3FHK A;  4G0K A;  4F9Z A;  3M0F A;  1ERU A;  4OFN A;  5FHI A;  1VF3 A;  4XS4 B;  4G0L A;  3G7I A;  5HFI A;  22GS A;  2VOC A;  1DUG A;  1M7T A;  5G1K A;  3CBU A;  2DJK A;  3C1R A;  3TKR A;  2VCT A;  1YY7 A;  4I97 A;  3QAV A;  3RAZ A;  3IAS 2;  1QXH A;  3ZZX A;  3FRC A;  5JWR B;  3TGZ A;  2LQO A;  2YPM A;  4K0N A;  5EVO A;  4NPB A;  2ON5 A;  5KN1 A;  4BWS A;  1GSF A;  4MF7 A;  5HR2 A;  1MD4 A;  3ME7 A;  2H72 A;  1TP9 A;  1EGR A;  1X5D A;  4X0X A;  3ZIJ A;  5LNK e;  5AIX A;  1GUM A;  1HNA A;  4ECI A;  1XFL A;  2L6D A;  1EZK A;  11GS A;  3DEX A;  3LWA A;  1N2A A;  3MYD A;  1WJK A;  3LG6 A;  2CAQ A;  3KM6 A;  1EOG A;  4KSO A;  3EWL A;  3D5J A;  4FYU A;  4HJM A;  3GUS A;  4RI7 A;  4MNN A;  3W6G A;  5KN0 A;  3GHA A;  1NHY A;  1XWB A;  4PTS A;  1PKW A;  1G7E A;  3GV1 A;  4L0U A;  4KH7 A;  4Z2T A;  4FYC A;  1K3L A;  4K7I A;  4DVC A;  2X64 A;  4K2D A;  3HD5 A;  4Q5Q A;  5HR0 A;  1GNE A;  5KOX A;  3KMN A;  1HD2 A;  1K0C A;  1ERT A;  4G10 A;  1ZYQ B;  3KEB A;  2HZE A;  4BVY A;  2R2J A;  1OKD A;  1XVQ A;  1ZMA A;  2IFQ B;  2CVD A;  5J5N A;  2M80 A;  1RK4 A;  5ECR B;  3D4T A;  1FW1 A;  3DKS A;  2WDU A;  4ZL7 A;  2X49 A;  4GSN A;  4PX1 A;  5H5R A;  4K0G A;  3GN3 A;  3C71 A;  1U88 A;  4GWR A;  3KMO A;  5ABR A;  4PGT A;  3G7Y A;  4TXV A;  4XHM A;  2IME A;  4IJI A;  1YDK A;  4WET A;  2TRC P;  2H1D A;  1XW6 A;  4MPF A;  4IEL A;  1V40 A;  3LQ7 A;  3HZ4 A;  1AQX A;  2A2S A;  2LST A;  4YKF A;  1J08 A;  4PNF A;  2B7K A;  2VIM A;  2JSY A;  4TXO A;  2RM6 A;  2HSM A;  4TRX A;  3LYK A;  5GAN D;  3F6D A;  1WPI A;  1MTC A;  1V98 A;  3FZA A;  4POB A;  1V2A A;  1B9Y C;  1GSD A;  1OC9 A;  2C0E A;  4XIH A;  1U3I A;  4LL1 B;  1XPV A;  2H1G A;  5CRW A;  2ZCT A;  3P7X A;  4GST A;  4K8M A;  4POK A;  5DAL A;  3TKS C;  1Z3E A;  1S3A A;  2JZR A;  1DE1 A;  3CSH A;  1GTA A;  3G7J A;  4L8E A;  1FB6 A;  2KP1 A;  4IKH A;  2CQ9 A;  1GTB A;  2WGR A;  3RHC A;  1KNG A;  3BOA A;  4YAV A;  4POM A;  2DJJ A;  2OAC A;  2YWI A;  4ISD A;  3I43 A;  2H8L A;  13GS A;  1EEJ A;  3CSJ A;  4DSS A;  4I8B A;  1AAZ A;  4GCI A;  2H76 A;  1A0F A;  1PL2 A;  4H86 A;  1QGV A;  3RHB A;  4F0B A;  2HSH A;  3FW2 A;  1R4W A;  3KH7 A;  1SD8 A;  3WGD A;  2LV3 A;  2OJL A;  1VF2 A;  4Q5R A;  2UZ8 A;  1EOH A;  4FYB A;  2GDR A;  1XOB A;  2HRK A;  3BCI A;  3O76 A;  4WR4 A;  1F6M C;  3CRU A;  2YV7 A;  2E2M A;  5JWO B;  1MD3 A;  3LFL A;  1JZR A;  4Z2U A;  3KP8 A;  1WP0 A;  3HYP A;  5ECM B;  2DJ3 A;  2GT6 A;  2OKA A;  1TW9 A;  1K0D A;  3EE2 A;  2R3X A;  2LS5 A;  4LL4 B;  1X9S B;  1BX9 A;  4JRR A;  1BYE A;  3GTU A;  3VWV A;  4MA9 A;  3KTL A;  3ZVJ A;  1H4O A;  1M2D A;  2OA7 A;  3H79 A;  1A8Y A;  2K6V A;  1AXD A;  2IJY A;  3TRP A;  1SK1 A;  1GL8 A;  2AHE A;  2DKH A;  5CNW A;  3WT1 A;  3GUR A;  3QOU A;  2DJ1 A;  3VWU A;  1AQW A;  3GKX A;  1GRX A;  2KHP A;  2VLT A;  1TKD B;  2FGX A;  3FR9 A;  5A4U A;  3IC8 A;  2IN3 A;  2ALB A;  1S3D A;  1NHO A;  6GSW A;  5G30 A;  3UVT A;  4BVY B;  1FVK A;  5HR3 A;  3O6T A;  2GZY A;  2F51 A;  4K7N A;  3QFA C;  5ECI B;  1Q4J A;  1PN0 A;  1EWX A;  14GS A;  4N0V A;  3UBL A;  1AUC A;  4ZIL A;  2O89 A;  1PKZ A;  3GST A;  2AV4 A;  5C00 A;  1R5P A;  3HJM A;  3KD0 A;  1YF1 A;  3UIW A;  2IPA A;  3APS A;  1X9M B;  4EF0 A;  3FY7 A;  4L0W A;  5COH A;  2I1U A;  2LRC A;  4O92 A;  3VPT A;  4KDU A;  3VLN A;  1T4Z A;  2E0Q A;  1ERW A;  2OAD A;  4E8H A;  3QFB C;  4TXO B;  2PVQ A;  5G31 A;  1JZD A;  1SKS B;  3CTF A;  3QPM A;  4ZIJ A;  1SJZ A;  2E7P A;  4F03 A;  4KDY A;  4JBB A;  2B5E A;  3DIE A;  1F37 A;  1OE7 A;  2B6M A;  4IS0 A;  2C80 A;  2ZNM A;  4ID0 A;  1Z9H A;  5DAL B;  3IE3 A;  4KF9 A;  3TUE A;  1XIY A;  1O73 A;  1F3A A;  4OD7 A;  2DML A;  5B6N A;  4X43 A;  1M9A A;  4I2T A;  1SL0 B;  1SK2 A;  1QUW A;  1LJR A;  5HFK A;  4EE0 A;  2V1M A;  1M2A A;  2R37 A;  3C73 A;  5F8B A;  5A5K A;  4HUA A;  4DSS B;  5DCH A;  3U5R E;  2CA8 A;  4NAX A;  1GSU A;  2CVB A;  5CYY A;  1BJX A;  1GTU A;  5CRE A;  1PX6 A;  1OYJ A;  1ML6 A;  4BPY A;  4MJB A;  1M0U A;  4ECB A;  2HI7 A;  1I5G A;  2GQM A;  4HI7 A;  8GSS A;  5FT3 A;  2A4V A;  3UEM A;  3APQ A;  5KOW A;  1V57 A;  3ERW A;  1B4P A;  17GS A;  3RDW A;  1PMT A;  5JCW A;  3FKF A;  1SD9 A;  3FR3 A;  4JE1 A;  4TVE A;  4J2F A;  3GTU B;  5HR1 A;  1TI3 A;  2LKU A;  1K0M A;  2M46 A;  1WE0 A;  3QDN A;  3JCM L;  3APO A;  3FMW A;  4IW9 A;  4OCE A;  3UAP A;  2QGV A;  1B48 A;  3IBH A;  3KXO A;  3PIN A;  5JCG A;  4ZBB A;  2FWF A;  4XTS A;  3HVS A;  1K0A A;  4MZW A;  3CSI A;  3L9S A;  1U6T A;  2LRN A;  4TR4 A;  3QD9 A;  3LXT A;  1AQV A;  3DVX A;  4BA7 A;  5GZZ B;  2X8H A;  1JLV A;  3ISO A;  2LJK A;  3QAG A;  4YH2 A;  2VCZ A;  1BED A;  3CXG A;  4JR6 A;  4TN8 A;  5E4W A;  1USB A;  4IVF A;  1NW2 A;  5KEJ A;  4KA0 A;  2N5A A;  2HRA A;  3LYP A;  1TXX A;  4PQH A;  5D9V A;  5DQY A;  1DE2 A;  3IOS A;  3DGQ A;  5ELG A;  2QA2 A;  2C1Y A;  3C8E A;  4MF6 A;  4POL A;  1MDI A;  1ZYE A;  2RII A;  3TJF A;  3DYR A;  5ECN B;  4O5U A;  1C72 A;  4V2N A;  5CO3 A;  2IMI A;  5B7C A;  2DJ2 A;  2LTK A;  3IHQ A;  5IMC A;  3ZIV A;  1HNB A;  3GH9 A;  1SL1 B;  10GS A;  3LEF A;  4GF0 A;  3ED3 A;  1GSS A;  2X4A A;  5D8I A;  3E9J B;  2K8V A;  3F63 A;  3Q19 A;  2PU9 C;  2L4Q A;  5ECS A;  5AGY A;  1FO5 A;  5C04 A;  3BJ5 A;  2IMF A;  4MZB A;  1JZW A;  2C0D A;  3F6F A;  1K3O A;  4ZXG A;  2C0G A;  2E2G A;  4KDX A;  1Z7R A;  4L5O A;  2ES7 A;  1PSQ A;  5B8A A;  1ILO A;  2MMA A;  4O7H A;  3ZVJ D;  3CMI A;  4NXI A;  2NTO A;  4IP6 A;  4EVM A;  4ULX A;  3TOU A;  1BQ7 A;  4WR5 A;  4YQM A;  1YKC A;  5INY A;  3SWL A;  1XG8 A;  4MJC A;  4HU9 A;  3GFK A;  2CT6 A;  2P31 A;  1YF0 A;  2CX4 A;  3GKM A;  1Z6N A;  1Z7P A;  2B1K A;  2FA4 A;  3MNG A;  3TKS A;  6GSU A;  3GMF A;  5ID2 B;  2HE3 A;  3P2A A;  3EIN A;  3EYT A;  1VF1 A;  2C8U A;  2MZC A;  3AY8 A;  3C7M A;  3IAM 2;  2A2R A;  1YQ1 A;  1O7U A;  1J0F A;  4V2M A;  4YAP A;  5J9B A;  5D93 A;  5B6M A;  2C0F A;  1WOU A;  4TKY A;  1SKW B;  1OVN A;  3GKN A;  1TK5 B;  3GH6 A;  2L57 A;  2H75 A;  1LBK A;  4IQA A;  3WD6 A;  3MDK A;  3HZ8 A;  2EIO A;  2HNL A;  1SU9 A;  1B4Q A;  2LNT A;  1Q98 A;  2AJQ B;  3QCP A;  3EU4 A;  2VO4 A;  4IJ3 A;  1TU7 A;  2FD3 A;  4KCA A;  3ZML A;  2GQK A;  1X5E A;  1E6B A;  2MMO A;  2WCI A;  2VLV A;  3G9B A;  1YEX A;  3MWH A;  4ACS A;  2H1B A;  1SYR A;  1H75 A;  2EIR A;  4EL1 A;  2KUC A;  1SJ6 A;  1B9X C;  2YWN A;  1A23 A;  2CZ2 A;  2DBC A;  1EEM A;  2M72 A;  4I2U A;  4BVX B;  3MAK A;  3EMX A;  4K9Z A;  3GSS A;  2KLX A;  1TOF A;  2HSY A;  1T00 A;  9GSS A;  1PN9 A;  4YKG A;  4CY8 A;  3KGK A;  4PXO A;  1FAA A;  3WYW A;  1OKT A;  1EP8 A;  1RW1 A;  1NSW A;  1UC7 A;  2YCD A;  5ECH B;  5BMU A;  3H1N A;  5CRD A;  4FIW A; 
#chains in the Genus database with same CATH homology
 4WXT A;  3RBT A;  3LGC A;  4GXZ A;  1WWJ A;  4ZB9 A;  2FY6 A;  5L71 A;  4WBR D;  1M99 A;  1GUL A;  1JZO A;  2I3Y A;  3M8N A;  3LJR A;  2VLU A;  2WFC A;  1T4Y A;  4GSS A;  4OO4 A;  3TJG A;  2YNX A;  1IYH A;  1SL2 B;  2LRT A;  5IOW A;  4AJ8 A;  3IR4 A;  2HZF A;  1O8X A;  3HKR A;  3M9K A;  4TR1 B;  5ECP B;  4XS1 A;  2IL3 A;  4HU7 A;  2XPE A;  5D9W A;  2V41 A;  2L6C A;  3GRX A;  2K18 A;  4PUR A;  3RPN A;  1THX A;  2VL2 C;  2H01 A;  1O6J A;  2OBK A;  5DBQ A;  5CRG A;  1THO A;  2GT5 A;  5F05 A;  2WB9 A;  4MJA A;  4MP4 A;  5F06 A;  2ON7 A;  4PUA A;  2DJ0 A;  1V58 A;  2H70 A;  2BJX A;  2O85 A;  3GL3 A;  3HJP A;  1VF4 A;  2P0G A;  1X0R A;  3QR6 A;  2PGT A;  1AW9 A;  2YAN A;  4JR4 A;  3LXZ A;  2GST A;  3M9J A;  4V1A g;  2NDO A;  2LJA A;  2K9F A;  4CDO A;  4ILF A;  2MMN A;  2FWE A;  2WRT A;  2G0F A;  2VCV A;  2Z9S A;  5IIZ A;  3L78 A;  2MBS A;  4A5P A;  4RUV A;  4EXJ A;  1Y6E A;  2VCW A;  3FZ4 A;  4LA1 A;  2C3N A;  2C4J A;  2AYT A;  5DJL A;  2JL4 A;  2H0G A;  3EUR A;  3M3M A;  2KOK A;  1XW5 A;  2LUS A;  2FWH A;  3F0I A;  3DD3 A;  1VGL A;  1FVJ A;  5EPF A;  4HQS A;  2J23 A;  2VL9 A;  4TW5 A;  2R6K A;  4NV2 A;  3LOR A;  2PMT A;  4EC0 A;  3DVW A;  5IM9 A;  3W8J A;  4KAE A;  1GTI A;  3EU3 A;  4MH3 A;  2JZT A;  2FUG 2;  4K6X A;  1YZX A;  1XW9 A;  5GST A;  1GSQ A;  1ZGN A;  1V9W A;  2A4H A;  1VRS D;  1O85 A;  2RLI A;  3D22 A;  3IDV A;  2OE0 A;  1GLP A;  4K2X A;  4N30 A;  3CTG A;  3EC3 A;  4X4J A;  4XRD A;  4EIP A;  3VPQ A;  3UVH A;  1SYX A;  1PGT A;  4HZ2 A;  2F9S A;  4ECC A;  1T7P B;  3ZYW A;  4OFT A;  3UOM A;  2YJH A;  1ZL9 A;  1FB0 A;  2V6K A;  4HJ2 A;  5A4W A;  1LU4 A;  3U6V A;  1HYU A;  5EL8 A;  2F8F A;  2R0G A;  4KE3 A;  5H5Q A;  3ZRE A;  1K3Y A;  1PRX A;  2B5Y A;  7GSS A;  1E2Y A;  4WF4 A;  3F9U A;  3L9V A;  2V6O A;  5GAP D;  3VI5 A;  3FZ9 A;  4JZQ A;  5AN1 A;  2XHF A;  5G2Z A;  2H0H A;  2IMD A;  3IXR A;  4GTU A;  4OFM A;  1U87 A;  1BAY A;  1OE8 A;  4LLR A;  1ACV A;  4QL7 A;  2JSZ A;  4PUF C;  5BRT A;  1N8J A;  2IWT A;  4KND A;  2BTO T;  4EKZ A;  1AIU A;  3KCM A;  4LMW A;  4FO5 A;  3IA1 A;  1UA5 A;  3IV4 A;  3SBC A;  3F3R A;  2RM5 A;  5ID2 A;  3GNJ A;  5J3R A;  2J9H A;  2O7K A;  4NHW A;  2RUF A;  1A2M A;  1QQ2 A;  1XVW A;  3WGE A;  3ZIT A;  4V2L A;  4BL7 A;  3F4S A;  4AGS A;  3I6A A;  1FG4 A;  3TJK A;  1YKA A;  5ECK B;  2FHE A;  2GGT A;  1TDI A;  4J56 E;  4HS1 A;  2VM2 A;  2GSR A;  4Z7X A;  4MDC A;  5ENU A;  4KB3 A;  3LSZ A;  2JAD A;  3D0Z A;  1ERV A;  4OO5 A;  4ML1 A;  5ECO B;  1PQN A;  4EIQ A;  2OE1 A;  4LMV A;  1EGO A;  1GUK A;  3E0U A;  2I81 A;  2C3Q A;  1F9M A;  1O8W A;  4F0C A;  2RUE A;  3IK7 A;  4QQ7 A;  1TI1 A;  2H19 A;  5CP1 A;  1JLW A;  3NIV A;  2HRN A;  1TU8 A;  4BVX A;  3TB2 A;  3VUR A;  4PNG A;  3N5O A;  2X8C A;  3EVI A;  4G0I A;  2F3M A;  4G2E A;  4YQU A;  4WEY A;  1ST9 A;  2O87 A;  3WGX A;  4ZBD A;  4Z2R A;  2LNS A;  2V32 A;  4I6X A;  5H5S A;  3KTB A;  4MJE A;  2H6Y A;  2V2G A;  2WUL A;  3VFI A;  2H0I A;  2XC2 A;  1CQG A;  4GQF A;  1F2E A;  1YJ6 A;  4BWQ A;  2B5X A;  4KCE A;  2D2Z A;  2FCH A;  2GQL A;  1SEN A;  2DIY A;  1XWG A;  3IK9 A;  4HZ4 A;  2YOI A;  2VD1 A;  2KP2 A;  1T1V A;  3CRT A;  5DAK B;  4MMM A;  2GZP A;  5D9X A;  4USS A;  4K5S A;  1PA3 A;  2HT9 A;  4TR1 A;  1JHB A;  4J57 E;  4P3Y B;  5IOX A;  3IC4 A;  4F82 A;  1SKR B;  5DDL A;  1HQO A;  4Q5N A;  2H30 A;  4ML6 A;  3KZQ A;  2VD0 A;  5IO2 A;  3HJO A;  2R5G A;  4NV5 A;  4F2I A;  4GLT A;  5IPG A;  3IHG A;  4CW9 A;  3W8S A;  1TRV A;  3Q18 A;  1B8X A;  3KIJ A;  4AJ7 A;  3PGT A;  4PQI A;  5ELA A;  2F8A A;  3Q6O A;  3PPU A;  19GS A;  1Z5Y E;  4GQC A;  4KW6 A;  1KTE A;  2PWJ A;  2FA8 A;  4RQX A;  5ECL B;  3D6I A;  5AIS A;  5IQY A;  2H1A A;  2VAF A;  1TRW A;  1WIK A;  4BL7 B;  4HQZ A;  4E8E A;  1AC1 A;  5CRH A;  2YZH A;  4MPG A;  5KN3 A;  6GSS A;  3V1W A;  2L4C A;  4CHS A;  2DKI A;  3UMA A;  1U3A A;  1Z6M A;  3BCK A;  3IRA A;  4WKW A;  6GSV A;  5G5E A;  4ZB8 A;  2DSA A;  3F4T A;  2CAI A;  1XWA A;  2ZUP A;  3A5I A;  1IYI A;  4NMU A;  2VL2 A;  3VI7 A;  4IGJ A;  5DJM A;  2LJR A;  1WMJ A;  3I69 A;  3HHV A;  1PX7 A;  4IHU A;  4YQV A;  3US3 A;  2MYG A;  1W4V A;  3TJJ A;  1UVZ A;  4D73 B;  1KEB A;  1OC3 A;  2HFD A;  1GH2 A;  3ERF A;  2YJ7 A;  3EMP A;  4WF5 A;  5IMZ A;  1MDJ A;  5LCZ A;  1ZCP A;  1G7O A;  3M1G A;  1QFN A;  3UJ1 A;  3K8N A;  4JED A;  2HXK A;  1NM3 A;  4MZC A;  4N0Z A;  2EIQ A;  5DVB A;  4XRA A;  4QL9 A;  3FEU A;  1O81 A;  1A24 A;  5FWG A;  2MMZ A;  4AF2 A;  2G2Q A;  2TIR A;  4MCU A;  1XXU A;  4TOP A;  3FZ5 A;  1X5C A;  3ERG A;  4ZL8 A;  4RQR A;  2PUK C;  2O8V B;  2IIY A;  2YV9 A;  5IMV A;  1SK0 A;  3J7Y k;  2AUV A;  6GSY A;  3DML A;  12GS A;  2H66 A;  2L59 A;  3FYG A;  3H4K A;  3O3T A;  4ICY A;  3RPP A;  1ZYN A;  1S3C A;  3MIX A;  2DIZ A;  2YN1 A;  3R2Q A;  5HFG A;  5GSS A;  1A2J A;  5J9C A;  2FLS A;  2YWO A;  1F3B A;  1Y25 A;  3TRQ A;  2R4V A;  3D21 A;  3NZN A;  4OWY A;  4MF5 A;  2H71 A;  3ZLP A;  2CX3 A;  3R3E A;  5B8B A;  3ZFB A;  1GSY A;  2B3S A;  2YZU A;  2R0C A;  1URM A;  4DSQ A;  5CAX A;  3P90 A;  4HEA 2;  4OCF A;  2B7J A;  6GSX A;  5JWQ B;  1OAZ A;  3E3E A;  3N9J A;  3ZL5 A;  4EO3 A;  2PER A;  2GTU A;  2QA1 A;  2VM1 A;  3F8U A;  1KBN A;  3A3T A;  1A8L A;  1TJD A;  3L4N A;  1HNC A;  3PR8 A;  1FHE A;  3Q74 A;  3DWV A;  4ZL9 A;  3L0H A;  1ZYP A;  3F3Q A;  3UAR A;  1TRU A;  3LW9 A;  3HVX A;  3L9U A;  4DSR A;  3TKP A;  1A2L A;  3TJB A;  5J4U A;  2OE3 A;  1ZZY A;  4MH2 A;  1MEK A;  2AAW A;  1R5A A;  2AB6 A;  4N11 A;  2PBJ A;  4FQU A;  4CY6 A;  4L5L A;  3HY2 A;  4OMV A;  2EC4 A;  2CV4 A;  3J7Y b;  3A2V A;  1CQH A;  4TR3 A;  3VWX A;  4KGI A;  2PVO C;  2HYX A;  2GSQ A;  4EDY A;  2GSS A;  5DCG A;  4EDZ A;  1ON4 A;  3HCZ A;  5D9T A;  2FNO A;  3GL5 A;  3VK9 A;  2HZE B;  1G6W A;  3DXB A;  3GKK A;  5LD0 A;  4HDE A;  1GLQ A;  3KP9 A;  1XCC A;  1A0R P;  5IPH A;  3HDC A;  1I9D A;  1SJI A;  3WT2 A;  1BG5 A;  2GS3 A;  4IBP A;  4KSM A;  4I5Q A;  3ZMK A;  5KN2 A;  5D96 A;  2OBI A;  3H93 A;  2HRF A;  4V1A p;  4AJ6 A;  3ME8 A;  3TKS E;  5IMF A;  2C3T A;  2VL3 A;  2VCX A;  20GS A;  1XBS A;  2CVK A;  2FWG A;  1GWC A;  2XBQ A;  2QKE A;  3I9V 2;  4IN0 A;  1YEP A;  2VCQ A;  2K8S A;  2CZ3 A;  5IMA A;  4XS4 A;  2P5Q A;  3UL3 A;  2P5R A;  2JAC A;  2PPT A;  4G9H A;  5DAK A;  4MAB A;  1OC9 B;  2H6Z A;  5EY6 A;  1RQM A;  2B1L A;  1K0N A;  3QAW A;  1JFU A;  2VUP A;  1XOA A;  2X99 A;  3TCO A;  1EP7 A;  2R0P A;  3ZRD A;  2DMM A;  1ZOF A;  5D73 A;  2LQQ A;  4WBJ A;  2MBT A;  5G1L A;  1DBY A;  4JU5 A;  3F4R A;  2XPD A;  1XWC A;  2H73 A;  1K0O A;  5AIV A;  4K1F A;  3C1S A;  2XBI A;  5F0G A;  5A4V A;  3IPZ A;  4O5R A;  2GVP A;  2I9H A;  2JU5 A;  1FOV A;  4X1U A;  1TK8 B;  1QK8 A;  3HXS A;  1GUH A;  2NPB A;  1TTZ A;  3TKQ A;  3S9F A;  2H74 A;  1T8E B;  3MSZ A;  5J41 A;  3A2W A;  3OR5 A;  3D4M A;  4K5R A;  1EV9 A;  3A2X A;  3KH9 A;  2WZ9 A;  4O32 A;  2N5B A;  1M9B A;  3GYK A;  2HLS A;  2GLR A;  5E59 A;  1DSB A;  1T3B A;  2A2P A;  1R7H A;  18GS A;  5DQS A;  3NOF A;  5G5F A;  5ECQ B;  1W89 A;  1K0B A;  2QC7 A;  6GST A;  1GSE A;  4Q5F A;  1M2B A;  3CYN A;  4EUY A;  3DRN A;  1G6Y A;  1FOH A;  2L5L A;  4ECJ A;  4KUN A;  3H8Q A;  4HOJ A;  16GS A;  4ZBA A;  3A5W A;  3BBY A;  4D73 A;  2N5F A;  1X9W B;  2IFQ A;  3BD2 A;  3HVV A;  2LEG A;  3GX0 A;  3HA9 A;  4TR0 A;  3GA4 A;  4MK3 A;  3FK8 A;  4G19 A;  4K7O A;  3QMX A;  2GZZ A;  2REM A;  2WS2 A;  3VWW A;  1TK0 B;  2IMK A;  4IQ1 A;  3TOT A;  2DLX A;  3TDG A;  3GX8 A;  1G0T A;  4XS6 A;  3TRX A;  2NBS A;  1XWK A;  2I4A A;  3UBK A;  3ZFL A;  1ABA A;  2QSI A;  2NVL A;  4IP1 A;  5JCU A;  4FH8 A;  2PN8 A;  4DEJ A;  2YWM A;  1R26 A;  3EPT A;  2DC5 A;  4ZB6 A;  5IMD A;  4KX4 A;  2BMX A;  1UN2 A;  4NWY A;  3ZTL A;  1XZO A;  1PD2 1;  1WRY A;  3P8W A;  2JZS A;  2L5O A;  1J9B A;  1OC8 A;  5F07 A;  4PQ1 A;  3PH9 A;  2YP6 A;  3FR6 A;  1EV4 A;  1GNW A;  4XCS A;  2H6X A;  3KJY A;  4MLY A;  5HQP A;  4NHZ A;  1PL1 A;  1MDK A;  4N10 A;  2TRX A;  1GP1 A;  2WJU A;  1TRS A;  5IO0 A;  2X8G A;  3GIX A;  4RI6 A;  4O5Q A;  4GRF A;  1QMV A;  3FHK A;  4G0K A;  4F9Z A;  3M0F A;  1ERU A;  4OFN A;  5FHI A;  1VF3 A;  4XS4 B;  4G0L A;  3G7I A;  5HFI A;  22GS A;  2VOC A;  1DUG A;  1M7T A;  5G1K A;  3CBU A;  2DJK A;  3C1R A;  3TKR A;  2VCT A;  1YY7 A;  4I97 A;  3QAV A;  3RAZ A;  3IAS 2;  1QXH A;  3ZZX A;  3FRC A;  5JWR B;  3TGZ A;  2LQO A;  2YPM A;  4K0N A;  5EVO A;  4NPB A;  2ON5 A;  5KN1 A;  4BWS A;  1GSF A;  4MF7 A;  5HR2 A;  1MD4 A;  3ME7 A;  2H72 A;  1TP9 A;  1EGR A;  1X5D A;  4X0X A;  3ZIJ A;  5LNK e;  5AIX A;  1GUM A;  1HNA A;  4ECI A;  1XFL A;  2L6D A;  1EZK A;  11GS A;  3DEX A;  3LWA A;  1N2A A;  3MYD A;  1WJK A;  3LG6 A;  2CAQ A;  3KM6 A;  1EOG A;  4KSO A;  3EWL A;  3D5J A;  4FYU A;  4HJM A;  3GUS A;  4RI7 A;  4MNN A;  3W6G A;  5KN0 A;  3GHA A;  1NHY A;  1XWB A;  4PTS A;  1PKW A;  1G7E A;  3GV1 A;  4L0U A;  4KH7 A;  4Z2T A;  4FYC A;  1K3L A;  4K7I A;  4DVC A;  2X64 A;  4K2D A;  3HD5 A;  4Q5Q A;  5HR0 A;  1GNE A;  5KOX A;  3KMN A;  1HD2 A;  1K0C A;  1ERT A;  4G10 A;  1ZYQ B;  3KEB A;  2HZE A;  4BVY A;  2R2J A;  1OKD A;  1XVQ A;  1ZMA A;  2IFQ B;  2CVD A;  5J5N A;  2M80 A;  1RK4 A;  5ECR B;  3D4T A;  1FW1 A;  3DKS A;  2WDU A;  4ZL7 A;  2X49 A;  4GSN A;  4PX1 A;  5H5R A;  4K0G A;  3GN3 A;  3C71 A;  1U88 A;  4GWR A;  3KMO A;  5ABR A;  4PGT A;  3G7Y A;  4TXV A;  4XHM A;  2IME A;  4IJI A;  1YDK A;  4WET A;  2TRC P;  2H1D A;  1XW6 A;  4MPF A;  4IEL A;  1V40 A;  3LQ7 A;  3HZ4 A;  1AQX A;  2A2S A;  2LST A;  4YKF A;  1J08 A;  4PNF A;  2B7K A;  2VIM A;  2JSY A;  4TXO A;  2RM6 A;  2HSM A;  4TRX A;  3LYK A;  5GAN D;  3F6D A;  1WPI A;  1MTC A;  1V98 A;  3FZA A;  4POB A;  1V2A A;  1B9Y C;  1GSD A;  1OC9 A;  2C0E A;  4XIH A;  1U3I A;  4LL1 B;  1XPV A;  2H1G A;  5CRW A;  2ZCT A;  3P7X A;  4GST A;  4K8M A;  4POK A;  5DAL A;  3TKS C;  1Z3E A;  1S3A A;  2JZR A;  1DE1 A;  3CSH A;  1GTA A;  3G7J A;  4L8E A;  1FB6 A;  2KP1 A;  4IKH A;  2CQ9 A;  1GTB A;  2WGR A;  3RHC A;  1KNG A;  3BOA A;  4YAV A;  4POM A;  2DJJ A;  2OAC A;  2YWI A;  4ISD A;  3I43 A;  2H8L A;  13GS A;  1EEJ A;  3CSJ A;  4DSS A;  4I8B A;  1AAZ A;  4GCI A;  2H76 A;  1A0F A;  1PL2 A;  4H86 A;  1QGV A;  3RHB A;  4F0B A;  2HSH A;  3FW2 A;  1R4W A;  3KH7 A;  1SD8 A;  3WGD A;  2LV3 A;  2OJL A;  1VF2 A;  4Q5R A;  2UZ8 A;  1EOH A;  4FYB A;  2GDR A;  1XOB A;  2HRK A;  3BCI A;  3O76 A;  4WR4 A;  1F6M C;  3CRU A;  2YV7 A;  2E2M A;  5JWO B;  1MD3 A;  3LFL A;  1JZR A;  4Z2U A;  3KP8 A;  1WP0 A;  3HYP A;  5ECM B;  2DJ3 A;  2GT6 A;  2OKA A;  1TW9 A;  1K0D A;  3EE2 A;  2R3X A;  2LS5 A;  4LL4 B;  1X9S B;  1BX9 A;  4JRR A;  1BYE A;  3GTU A;  3VWV A;  4MA9 A;  3KTL A;  3ZVJ A;  1H4O A;  1M2D A;  2OA7 A;  3H79 A;  1A8Y A;  2K6V A;  1AXD A;  2IJY A;  3TRP A;  1SK1 A;  1GL8 A;  2AHE A;  2DKH A;  5CNW A;  3WT1 A;  3GUR A;  3QOU A;  2DJ1 A;  3VWU A;  1AQW A;  3GKX A;  1GRX A;  2KHP A;  2VLT A;  1TKD B;  2FGX A;  3FR9 A;  5A4U A;  3IC8 A;  2IN3 A;  2ALB A;  1S3D A;  1NHO A;  6GSW A;  5G30 A;  3UVT A;  4BVY B;  1FVK A;  5HR3 A;  3O6T A;  2GZY A;  2F51 A;  4K7N A;  3QFA C;  5ECI B;  1Q4J A;  1PN0 A;  1EWX A;  14GS A;  4N0V A;  3UBL A;  1AUC A;  4ZIL A;  2O89 A;  1PKZ A;  3GST A;  2AV4 A;  5C00 A;  1R5P A;  3HJM A;  3KD0 A;  1YF1 A;  3UIW A;  2IPA A;  3APS A;  1X9M B;  4EF0 A;  3FY7 A;  4L0W A;  5COH A;  2I1U A;  2LRC A;  4O92 A;  3VPT A;  4KDU A;  3VLN A;  1T4Z A;  2E0Q A;  1ERW A;  2OAD A;  4E8H A;  3QFB C;  4TXO B;  2PVQ A;  5G31 A;  1JZD A;  1SKS B;  3CTF A;  3QPM A;  4ZIJ A;  1SJZ A;  2E7P A;  4F03 A;  4KDY A;  4JBB A;  2B5E A;  3DIE A;  1F37 A;  1OE7 A;  2B6M A;  4IS0 A;  2C80 A;  2ZNM A;  4ID0 A;  1Z9H A;  5DAL B;  3IE3 A;  4KF9 A;  3TUE A;  1XIY A;  1O73 A;  1F3A A;  4OD7 A;  2DML A;  5B6N A;  4X43 A;  1M9A A;  4I2T A;  1SL0 B;  1SK2 A;  1QUW A;  1LJR A;  5HFK A;  4EE0 A;  2V1M A;  1M2A A;  2R37 A;  3C73 A;  5F8B A;  5A5K A;  4HUA A;  4DSS B;  5DCH A;  3U5R E;  2CA8 A;  4NAX A;  1GSU A;  2CVB A;  5CYY A;  1BJX A;  1GTU A;  5CRE A;  1PX6 A;  1OYJ A;  1ML6 A;  4BPY A;  4MJB A;  1M0U A;  4ECB A;  2HI7 A;  1I5G A;  2GQM A;  4HI7 A;  8GSS A;  5FT3 A;  2A4V A;  3UEM A;  3APQ A;  5KOW A;  1V57 A;  3ERW A;  1B4P A;  17GS A;  3RDW A;  1PMT A;  5JCW A;  3FKF A;  1SD9 A;  3FR3 A;  4JE1 A;  4TVE A;  4J2F A;  3GTU B;  5HR1 A;  1TI3 A;  2LKU A;  1K0M A;  2M46 A;  1WE0 A;  3QDN A;  3JCM L;  3APO A;  3FMW A;  4IW9 A;  4OCE A;  3UAP A;  2QGV A;  1B48 A;  3IBH A;  3KXO A;  3PIN A;  5JCG A;  4ZBB A;  2FWF A;  4XTS A;  3HVS A;  1K0A A;  4MZW A;  3CSI A;  3L9S A;  1U6T A;  2LRN A;  4TR4 A;  3QD9 A;  3LXT A;  1AQV A;  3DVX A;  4BA7 A;  5GZZ B;  2X8H A;  1JLV A;  3ISO A;  2LJK A;  3QAG A;  4YH2 A;  2VCZ A;  1BED A;  3CXG A;  4JR6 A;  4TN8 A;  5E4W A;  1USB A;  4IVF A;  1NW2 A;  5KEJ A;  4KA0 A;  2N5A A;  2HRA A;  3LYP A;  1TXX A;  4PQH A;  5D9V A;  5DQY A;  1DE2 A;  3IOS A;  3DGQ A;  5ELG A;  2QA2 A;  2C1Y A;  3C8E A;  4MF6 A;  4POL A;  1MDI A;  1ZYE A;  2RII A;  3TJF A;  3DYR A;  5ECN B;  4O5U A;  1C72 A;  4V2N A;  5CO3 A;  2IMI A;  5B7C A;  2DJ2 A;  2LTK A;  3IHQ A;  5IMC A;  3ZIV A;  1HNB A;  3GH9 A;  1SL1 B;  10GS A;  3LEF A;  4GF0 A;  3ED3 A;  1GSS A;  2X4A A;  5D8I A;  3E9J B;  2K8V A;  3F63 A;  3Q19 A;  2PU9 C;  2L4Q A;  5ECS A;  5AGY A;  1FO5 A;  5C04 A;  3BJ5 A;  2IMF A;  4MZB A;  1JZW A;  2C0D A;  3F6F A;  1K3O A;  4ZXG A;  2C0G A;  2E2G A;  4KDX A;  1Z7R A;  4L5O A;  2ES7 A;  1PSQ A;  5B8A A;  1ILO A;  2MMA A;  4O7H A;  3ZVJ D;  3CMI A;  4NXI A;  2NTO A;  4IP6 A;  4EVM A;  4ULX A;  3TOU A;  1BQ7 A;  4WR5 A;  4YQM A;  1YKC A;  5INY A;  3SWL A;  4MJC A;  4HU9 A;  3GFK A;  2CT6 A;  2P31 A;  1YF0 A;  2CX4 A;  3GKM A;  1Z6N A;  1Z7P A;  2B1K A;  2FA4 A;  3MNG A;  3TKS A;  6GSU A;  3GMF A;  5ID2 B;  2HE3 A;  3P2A A;  3EIN A;  3EYT A;  1VF1 A;  2C8U A;  2MZC A;  3AY8 A;  3C7M A;  3IAM 2;  2A2R A;  1YQ1 A;  1O7U A;  1J0F A;  4V2M A;  4YAP A;  5J9B A;  5D93 A;  5B6M A;  2C0F A;  1WOU A;  4TKY A;  1SKW B;  1OVN A;  3GKN A;  1TK5 B;  3GH6 A;  2L57 A;  2H75 A;  1LBK A;  4IQA A;  3WD6 A;  3MDK A;  3HZ8 A;  2EIO A;  2HNL A;  1SU9 A;  1B4Q A;  2LNT A;  1Q98 A;  2AJQ B;  3QCP A;  3EU4 A;  2VO4 A;  4IJ3 A;  1TU7 A;  2FD3 A;  4KCA A;  3ZML A;  2GQK A;  1X5E A;  1E6B A;  2MMO A;  2WCI A;  2VLV A;  3G9B A;  1YEX A;  3MWH A;  4ACS A;  2H1B A;  1SYR A;  1H75 A;  2EIR A;  4EL1 A;  2KUC A;  1SJ6 A;  1B9X C;  2YWN A;  1A23 A;  2CZ2 A;  2DBC A;  1EEM A;  2M72 A;  4I2U A;  4BVX B;  3MAK A;  3EMX A;  4K9Z A;  3GSS A;  2KLX A;  1TOF A;  2HSY A;  1T00 A;  9GSS A;  1PN9 A;  4YKG A;  4CY8 A;  3KGK A;  4PXO A;  1FAA A;  3WYW A;  1OKT A;  1EP8 A;  1RW1 A;  1NSW A;  1UC7 A;  2YCD A;  5ECH B;  5BMU A;  3H1N A;  5CRD A;  4FIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...