1W89A

Structure of the reduced form of human thioredoxin 2
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
110
structure length
110
Chain Sequence
HGSTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords THIOREDOXIN
publication title Crystal Structures of Oxidized and Reduced Forms of Human Mitochondrial Thioredoxin 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1w89A00
2B6MA 5B8AA 1OVNA 1ZYEA 4MLYA 3MNGA 4EVMA 2V6OA 5G1LA 2IMFA 1XIYA 2YCDA 3V1WA 1T4ZA 5JCGA 1BJXA 1TOFA 4PNFA 4DSSB 4BWSA 1BAYA 4KH7A 1KBNA 3GHAA 2DJ3A 5HR3A 1WJKA 4WR5A 1PL1A 2N5BA 3NIVA 4HEA2 3M8NA 3EU3A 4MZCA 5GAND 1M7TA 3C7MA 2MYGA 4HJMA 3GTUB 4GQFA 1PX6A 1VF2A 2B1LA 2XC2A 3M1GA 5B8BA 1ML6A 2WZ9A 4EC0A 2IFQB 4IJ3A 3TJGA 4JEDA 3F6FA 2VCZA 3C1SA 3G7JA 1R5PA 3P90A 16GSA 3CSHA 2ON5A 1E6BA 2H6YA 4MJAA 3FK8A 3DD3A 2LTKA 3GFKA 2BMXA 2K9FA 3ZVJA 3KM6A 4I2UA 5ECHB 2GT5A 5CRHA 1HD2A 4TW5A 3D6IA 1XW6A 3KD0A 1GSYA 5B7CA 2RLIA 4GSTA 3RBTA 5J9BA 1TK5B 4ZBDA 4F82A 3R2QA 3EVIA 3LEFA 4OCEA 1HQOA 2VLTA 2VL2A 5E59A 2WCIA 5IM9A 5IMCA 4O32A 2F8FA 1YKCA 4OO5A 3EMPA 3RHCA 1G7EA 2C0GA 1GTAA 1TKDB 2FWHA 3TRPA 5GAPD 3DEXA 5KN2A 8GSSA 1RK4A 4YH2A 4TR1A 3IOSA 1W4VA 3C1RA 4N0ZA 2NTOA 4ZBAA 5ID2A 2WULA 4POLA 3A2XA 5IO2A 3ZLPA 3TKSA 4NWYA 4NV2A 2TRXA 3EU4A 4ZXGA 4FIWA 2H6XA 1YKAA 3UEMA 1PRXA 1K0DA 5D9TA 3GMFA 3GL3A 1R5AA 2HRFA 4EDZA 4ECCA 5CRGA 2L6CA 4MPGA 2KLXA 3IR4A 1CQGA 1RW1A 1U88A 2YZHA 4MF7A 3M3MA 4BL7A 3KCMA 3WD6A 3HCZA 2O87A 1EV4A 3AY8A 4XS1A 3UL3A 3LXTA 4IVFA 4HZ2A 2N5AA 1ERWA 3GKKA 1G6WA 1GULA 3C73A 2H01A 3ZITA 3DVWA 5ECPB 1SD8A 4MDCA 5DCGA 3BJ5A 1V57A 4D73A 1B9YC 4PXOA 1M9BA 5AGYA 3GH9A 3VK9A 3ZREA 1OKTA 3IBHA 3ZRDA 1XWKA 3PGTA 4XRAA 1S3CA 4YAVA 2IMEA 2FY6A 4Q5NA 7GSSA 1AXDA 4L0WA 1X5DA 2B1KA 3DRNA 4KE3A 1BG5A 4X43A 6GSXA 3FEUA 4K0GA 2LJAA 4X0XA 19GSA 4HU9A 1ILOA 2BJXA 3H93A 1T4YA 2C0FA 1SYRA 1ON4A 1V58A 1B4QA 1FG4A 2IN3A 13GSA 2X8CA 4AJ6A 4CHSA 2LJKA 3HDCA 1UA5A 4POBA 4V1Ag 4H86A 4K7OA 4LMWA 1A2LA 4FO5A 2YJHA 5KN0A 2YWOA 1J08A 2FLSA 1TK8B 4MH3A 1Z5YE 3MAKA 4BWQA 4E8EA 4Q5QA 2LRTA 4BVXA 4DVCA 3HZ4A 3QDNA 3KXOA 2AJQB 1K0CA 4NMUA 2B5EA 5H5RA 1X9MB 1JZRA 4TR3A 1AIUA 2PMTA 5IMAA 2GQMA 2IPAA 4OCFA 1MD4A 3N5OA 4QL9A 1GTIA 3VPTA 1F3BA 1K0MA 5LD0A 2V6KA 2K8VA 4GXZA 4HZ4A 1O73A 5ELGA 3J7Yk 1T7PB 1GUHA 2HNLA 1A2MA 5GZZB 4TXOA 1EOGA 2CZ2A 4EE0A 1PMTA 1YF1A 4MA9A 4FYUA 3E0UA 5IMVA 1O6JA 4MCUA 4MPFA 4PQ1A 4LA1A 1DUGA 3I6AA 3ERGA 2IMIA 4KX4A 2KUCA 5HR1A 5F05A 2L4CA 4HS1A 1F6MC 1ZL9A 1EOHA 2H0IA 4I97A 5J41A 1MDJA 2CQ9A 2HLSA 2HZFA 2O85A 4LMVA 3FR6A 3BOAA 3W8SA 4IS0A 2NBSA 1FVKA 4KGIA 2HZEA 3RHBA 5FT3A 2CX4A 1KTEA 2L5LA 1T3BA 1UN2A 3TDGA 1AUCA 2R4VA 5DJLA 1FAAA 3W8JA 1NSWA 2PUKC 4YAPA 4NXIA 3F3QA 5JCWA 5IQYA 4F0BA 1G0TA 4DSRA 2FWGA 1YQ1A 1ERUA 1WOUA 1PSQA 4G2EA 3CBUA 5AN1A 3IV4A 2DJJA 1WMJA 4PQHA 3J7Yb 4IBPA 4J57E 1BQ7A 2QSIA 3C8EA 1M99A 2VL9A 5DALA 3P2AA 2WGRA 2L5OA 3VLNA 5J4UA 3CTFA 3IK7A 6GSYA 3DWVA 1ZYQB 3UVHA 4KCEA 3VI7A 2OE3A 1GSDA 2GZYA 4OD7A 1OE7A 4RUVA 1FVJA 4RQRA 4ILFA 2YJ7A 1IYIA 3G7IA 2YP6A 2NVLA 1GNEA 1DSBA 1PL2A 1TDIA 4WR4A 1THOA 3O3TA 4PGTA 3GX8A 4O7HA 4V2NA 2L57A 4MJCA 2REMA 1EP8A 3APOA 3D0ZA 1R4WA 4V2LA 4XIHA 2VCXA 4F2IA 1WP0A 3I43A 1ZCPA 2CX3A 2CVKA 2JADA 4NV5A 1LJRA 5G30A 5JWOB 2MMNA 1PD21 4ML6A 2GT6A 4AF2A 1ZZYA 4Q5RA 4ZB6A 4ZILA 1GTUA 1T8EB 3VFIA 4EKZA 1T1VA 1MD3A 1FOVA 1USBA 5E4WA 3UARA 2KHPA 3CTGA 4BA7A 5CAXA 3UIWA 1XPVA 4O5RA 2JZTA 1V40A 4I2TA 1UC7A 3RPNA 3PINA 2F51A 1B8XA 3D22A 2LNTA 2P5RA 5AIVA 3UMAA 1XFLA 2VCVA 4MP4A 2H1BA 2IL3A 4RI6A 1K0NA 3GX0A 5B6MA 4Z7XA 1Z7PA 2C0DA 3H8QA 3O6TA 3CRUA 2EIRA 3ZYWA 4HJ2A 2GSSA 1GL8A 5J3RA 3A2WA 1N2AA 1XVQA 4L5OA 2I81A 3TOTA 2HFDA 3IDVA 2ALBA 4K6XA 2MMZA 4KSMA 5KN1A 3FHKA 5G5FA 2G0FA 2B5XA 1B4PA 1MTCA 1SJZA 4I8BA 1B9XC 3GKMA 5FWGA 3JCML 2HI7A 3WGXA 2V32A 1BX9A 3L9UA 3KZQA 3S9FA 2XPEA 4IKHA 1SKRB 5ECNB 1AQWA 5G5EA 2FA8A 2CA8A 2GTUA 3GKNA 1TRSA 5D96A 3FZ5A 2YV9A 1YEXA 4X1UA 3KP9A 3WT1A 2R37A 2B7JA 1PA3A 2YNXA 2VLUA 4ZL7A 3LFLA 4NPBA 1KNGA 4JR4A 4BVYA 3HY2A 2V41A 5D93A 4XS6A 5ECOB 18GSA 1QUWA 3SBCA 1X0RA 2LSTA 4IHUA 1Q98A 1SL2B 2H76A 1YEPA 1OYJA 4KNDA 5D9WA 1XCCA 4OO4A 3QD9A 2V2GA 5A4WA 4K8MA 3K8NA 3TRQA 2H74A 5GSTA 2LV3A 5DQYA 1V98A 3CXGA 3DIEA 4MZBA 1HYUA 1TXXA 3H1NA 1PN9A 1GSFA 4EF0A 5H5QA 3G7YA 4ML1A 1PKZA 3VWVA 4XRDA 3P7XA 4CDOA 3LWAA 4XS4A 1WRYA 3DXBA 2XHFA 1O8XA 2I9HA 3P8WA 4JBBA 4ULXA 3TCOA 1FB0A 5G2ZA 4AJ7A 4WKWA 1J9BA 3VWUA 1ST9A 2A2RA 4HQZA 3RDWA 3IXRA 1GRXA 1SK2A 1EGOA 3EYTA 2TRCP 4ECBA 4IJIA 4PNGA 3GSSA 4TVEA 4J56E 5H5SA 3IPZA 5FHIA 1TI1A 1WE0A 3FR9A 1SJ6A 4GWRA 3ME7A 4V1Ap 1A23A 3KH7A 4K1FA 1GSEA 2VCQA 4KDXA 4ZB8A 3ZIVA 1THXA 2HE3A 2JZRA 4KCAA 2TIRA 1G7OA 1XBSA 2NPBA 1OKDA 2VL2C 3UOMA 1A8YA 3ZIJA 3QFBC 4ISDA 2FGXA 3TUEA 4EL1A 5HFIA 1GNWA 4ZIJA 3NZNA 10GSA 2FWFA 5F06A 2H71A 1K3LA 3IK9A 3TB2A 3VWWA 3LQ7A 5A4VA 2XBQA 3QAVA 2C3TA 4I5QA 3KMOA 1MDIA 3CSIA 2LUSA 4L0UA 3TKQA 5HR0A 1Q4JA 1TJDA 2M80A 3FYGA 4TXVA 4ZBBA 2O7KA 1I9DA 2F8AA 2VUPA 1WPIA 3H4KA 4ZB9A 3TKSC 2DLXA 5LCZA 3GV1A 3F9UA 1GUMA 4N0VA 3QR6A 3GL5A 3EWLA 2F9SA 1EZKA 1X9SB 1OC9B 1GSQA 4IN0A 5LNKe 3UVTA 4TR1B 3F4RA 1Y25A 3IAS2 1YDKA 3KP8A 2H0GA 2ZCTA 3GUSA 1A0FA 3GNJA 4G9HA 4K7NA 5CRDA 1C72A 5CO3A 2I4AA 4YQUA 2KP2A 5ID2B 2VLVA 4LLRA 1RQMA 5J5NA 3SWLA 3DGQA 4JU5A 4GRFA 2C80A 2H8LA 2B5YA 1EEMA 1YY7A 3LSZA 3KMNA 4MABA 3PR8A 2C3QA 4MJBA 2CVBA 1WWJA 3BBYA 1DE2A 3I9V2 3L9SA 4QQ7A 1FO5A 1U6TA 3A3TA 1HNBA 4OFMA 4PUAA 1TTZA 2QC7A 5IMFA 5IO0A 2Z9SA 1GP1A 3GRXA 2AYTA 2GSRA 1TRVA 5IMZA 1Y6EA 4D73B 3FRCA 3TJFA 2HRNA 3FZAA 4AGSA 3EC3A 3TJKA 2J9HA 2KP1A 1VRSD 3Q19A 3EINA 1VF3A 5DAKB 2H66A 1K0AA 3ERWA 1AAZA 3DYRA 3U6VA 3Q18A 2VIMA 4TR0A 5INYA 1ABAA 5IOXA 4QL7A 3CYNA 1Z9HA 5HFKA 5GSSA 2P5QA 2RM6A 2QGVA 1GSSA 1CQHA 2WFCA 4MK3A 3MWHA 4IQ1A 5CP1A 2PVOC 1XWCA 2WS2A 3FZ4A 3E9JB 2GS3A 3F4TA 3MDKA 1XW9A 1ZOFA 2H1AA 4WETA 3PH9A 3HA9A 2IMKA 4MF5A 2H73A 3FKFA 1ERVA 5HQPA 5ECRB 3WYWA 1V9WA 2OBIA 4N10A 1NHOA 5IPGA 3KIJA 1JLVA 1Z6NA 2M72A 5IPHA 4OMVA 2BTOT 1Z6MA 4OFNA 2A2SA 1DE1A 4DSSA 5EPFA 2LNSA 1SL0B 2H30A 3GN3A 4WF5A 3ERFA 2DMMA 2OE1A 4YQVA 1XVWA 4TXOB 2R3XA 1SENA 3IAM2 3OR5A 3KGKA 1HNAA 3GTUA 20GSA 9GSSA 1PX7A 4ZL9A 3TGZA 4HU7A 4GTUA 3DVXA 1O85A 1FW1A 4F0CA 2GQKA 3F0IA 1FB6A 2QKEA 4FYBA 2IFQA 1XOAA 3GYKA 3ME8A 1JZDA 4KAEA 2IWTA 1DBYA 2YWIA 2RM5A 5JWRB 4BPYA 6GSUA 4G10A 1XZOA 1Z3EA 2EC4A 3ZMLA 4KUNA 14GSA 2FA4A 1H75A 2PERA 2PU9C 1U3AA 4GLTA 3TOUA 2H70A 5DBQA 2JSYA 3RAZA 1AQVA 1M2DA 3L9VA 3HYPA 5ELAA 4TKYA 5ECLB 2CVDA 3ZTLA 2PPTA 1GSUA 2C1YA 2OA7A 1GH2A 5AIXA 3QOUA 1YJ6A 1NM3A 2P31A 5EL8A 2FWEA 6GSVA 2CT6A 1GTBA 2YWMA 3LYKA 3M0FA 5DJMA 1GUKA 5A5KA 2AAWA 3LXZA 3ZZXA 4WBJA 1SKWB 4ECIA 4JR6A 4O92A 3IC4A 4HDEA 11GSA 4PURA 5EY6A 5CYYA 1F9MA 5KEJA 2AV4A 4GSSA 3O76A 3F6DA 4XCSA 1SK0A 4MF6A 5EVOA 2C3NA 2R2JA 5DALB 1PKWA 4IQAA 2DSAA 4NAXA 4J2FA 4POKA 1XWGA 2FUG2 4KA0A 2IMDA 3F3RA 1TP9A 4FYCA 2JSZA 4TOPA 4L5LA 3VPQA 1FHEA 3FW2A 3WGDA 1S3AA 1QQ2A 4MJEA 4ID0A 2I1UA 3QMXA 6GSWA 4WXTA 3HZ8A 3FY7A 2A4VA 1PGTA 3ZVJD 5JWQB 5B6NA 1G6YA 2FD3A 6GSSA 2K6VA 3QAWA 3Q6OA 4RQXA 1NHYA 1A24A 1VF1A 2YANA 3EE2A 1V2AA 4K0NA 3CMIA 1O8WA 2DIZA 2AUVA 4KDUA 2C4JA 1PQNA 4LL4B 2YWNA 4KDYA 5ECSA 4NHWA 3ZFBA 2E2GA 3NOFA 1XWBA 2D2ZA 3C71A 2HSHA 2EIQA 3TJBA 4XHMA 3VWXA 2JU5A 1MEKA 3GA4A 2VCWA 3WT2A 1O81A 2VL3A 1LBKA 2VD0A 3ED3A 5HR2A 3FZ9A 4IELA 2B3SA 2GZZA 3LGCA 4XTSA 1EWXA 3HKRA 3E3EA 3TKSE 2PN8A 1QXHA 2RIIA 2LEGA 2DJ2A 4WEYA 3TKPA 1NW2A 2HT9A 4GSNA 2MBTA 3WGEA 1HNCA 1VF4A 1SD9A 1SL1B 1SU9A 5ENUA 1VGLA 4KSOA 1U3IA 1OC9A 2CV4A 4CW9A 1URMA 2H72A 2ES7A 2K18A 5F0GA 3QFAC 1X5EA 3CSJA 3ZL5A 1F37A 4POMA 5C00A 1TI3A 1E2YA 3H79A 2OADA 2H1DA 1TU8A 5D73A 4NHZA 3HD5A 4N30A 2ZNMA 1LU4A 4Q5FA 3ISOA 2K8SA 1ERTA 6GSTA 2XPDA 2YOIA 3M9KA 2H75A 3D5JA 2E0QA 1AC1A 5CRWA 3BD2A 3BCIA 3F63A 4WBRD 1K0OA 2X8GA 17GSA 3US3A 2WJUA 2NDOA 5D8IA 2M46A 4MZWA 1SKSB 2ON7A 3I69A 5J9CA 3DKSA 1GWCA 2MMOA 5G1KA 1K0BA 1MDKA 1SJIA 2WRTA 4OFTA 4EUYA 4TR4A 1ZMAA 1QMVA 2J23A 2JZSA 3TRXA 1K3OA 2RUEA 1XXUA 1K3YA 3HHVA 1GLQA 4ZL8A 2PVQA 1JZOA 2GZPA 4TRXA 1TK0B 3IHQA 2WDUA 2IIYA 2YPMA 3W6GA 4KB3A 1EGRA 1JFUA 5JCUA 1Z7RA 4HI7A 3LG6A 5DQSA 2GDRA 5D9VA 3GURA 2FHEA 1O7UA 1F2EA 4ACSA 5HFGA 3KJYA 4EDYA 3HVSA 5F07A 1YF0A 2EIOA 2LRNA 5KN3A 5DAKA 2X64A 4P3YB 2L59A 1SYXA 5CREA 4HUAA 4DEJA 4OWYA 1J0FA 4DSQA 2VO4A 2MZCA 4FH8A 12GSA 2LJRA 4HQSA 5IMDA 4AJ8A 1I5GA 1IYHA 3L0HA 2AB6A 4JZQA 4XS4B 3GSTA 3D21A 3L78A 2OKAA 4IP6A 2O89A 1AQXA 3QAGA 4YQMA 1OE8A 1TRWA 2GGTA 2VOCA 5L71A 5C04A 2HYXA 1QGVA 1JZWA 4N11A 3IA1A 2E7PA 2GQLA 2OE0A 4K2DA 2FNOA 3IRAA 2X99A 2R5GA 2AHEA 1XOBA 1EEJA 2YV7A 4LL1B 2DJ0A 3UBLA 3HJOA 3UAPA 22GSA 2H0HA 2C8UA 2V1MA 1KEBA 1S3DA 4MH2A 3IE3A 4GCIA 2CAIA 2LKUA 3FR3A 2PWJA 1EV9A 2X8HA 3ZFLA 4PUFC 2DJ1A 4MMMA 4GQCA 4ECJA 1BEDA 1BYEA 4PX1A 2VM2A 3G9BA 2GVPA 1AW9A 1OAZA 2ZUPA 5IIZA 4K9ZA 5G31A 3D4TA 3A5WA 1OC3A 4EXJA 1M9AA 2DBCA 1XW5A 2KOKA 3KH9A 2F3MA 3KEBA 3TKRA 2MMAA 2GLRA 5D9XA 1OC8A 4F03A 3F8UA 1H4OA 2CAQA 3GIXA 3MSZA 2LS5A 5AISA 2LQQA 2P0GA 4IGJA 5ECIB 2WB9A 4EO3A 1JLWA 3HXSA 4F9ZA 1X9WB 3GKXA 1T00A 1W89A 3GH6A 1TU7A 3RPPA 2LQOA 1GLPA 5CNWA 2VCTA 3KTBA 1TW9A 1A2JA 2YZUA 2DJKA 2H6ZA 1F3AA 2IJYA 4I6XA 4E8HA 5A4UA 4K7IA 2FCHA 5IOWA 1B48A 4G19A 3D4MA 3LORA 2XBIA 3M9JA 5ABRA 3EURA 2PBJA 3HJMA 1EP7A 3VURA 4HOJA 2RUFA 2N5FA 2VD1A 2GSTA 2OACA 4JRRA 2HXKA 3F4SA 1SK1A 2E2MA 2CZ3A 5COHA 2I3YA 2LRCA 3APSA 1UVZA 3CRTA 2JACA 3APQA 4RI7A 3QCPA 3UBKA 4PQIA 2B7KA 2YN1A 4L8EA 1M2AA 1YZXA 2DC5A 5DCHA 1ACVA 3LJRA 4IP1A 2DMLA 4JE1A 1A8LA 2O8VB 5DDLA 5DVBA 2G2QA 3N9JA 2L4QA 2OBKA 1M0UA 3L4NA 3LYPA 3A2VA 3EMXA 3Q74A 4WF4A 2VM1A 2JL4A 3HJPA 3VI5A 4TN8A 4GF0A 2PGTA 1JHBA 2HZEB 5ECMB 2OJLA 3QPMA 3ZMKA 1R26A 1M2BA 1QFNA 5ECKB 5F8BA 1WIKA 2DIYA 3U5RE 1R7HA 1X5CA 2MBSA 5ECQB 1ZGNA 3KTLA 2HSYA 2VAFA 1TRUA 2H19A 3HVVA 3DMLA 1QK8A 2C0EA 2GSQA 2R6KA 1XWAA 3TJJA 2H1GA 2L6DA 3UJ1A 4IW9A 1A0RP 3BCKA 1N8JA 4KW6A 3HVXA 1U87A 4V2MA
chains in the Genus database with same CATH superfamily
2B6MA 5B8AA 1OVNA 1M3IA 1ZYEA 4MLYA 3MNGA 4EVMA 4K2XA 2V6OA 5G1LA 2IMFA 1XIYA 2YCDA 3V1WA 1T4ZA 5JCGA 1BJXA 1TOFA 4PNFA 4DSSB 4BWSA 1BAYA 4KH7A 1KBNA 3GHAA 2DJ3A 5HR3A 1WJKA 4WR5A 1PL1A 2N5BA 3NIVA 4HEA2 3M8NA 3EU3A 4MZCA 5GAND 1M7TA 3C7MA 2MYGA 4HJMA 3GTUB 4GQFA 1PX6A 1VF2A 5BMUA 2B1LA 2XC2A 3M1GA 5B8BA 1ML6A 2WZ9A 4EC0A 2IFQB 4IJ3A 3TJGA 4JEDA 3F6FA 2VCZA 3C1SA 3G7JA 1R5PA 3P90A 16GSA 3CSHA 2ON5A 1E6BA 2H6YA 4MJAA 3FK8A 3DD3A 2LTKA 3GFKA 2BMXA 2K9FA 3ZVJA 3KM6A 4I2UA 5ECHB 2GT5A 5CRHA 1HD2A 4TW5A 3D6IA 1XW6A 3KD0A 1GSYA 5B7CA 2RLIA 4GSTA 3RBTA 5J9BA 1TK5B 4ZBDA 4F82A 3R2QA 3EVIA 3LEFA 4OCEA 1HQOA 2VLTA 2VL2A 5E59A 2WCIA 5IM9A 5IMCA 4O32A 2F8FA 1YKCA 4OO5A 2A4HA 3EMPA 3RHCA 1G7EA 2C0GA 1GTAA 1TKDB 2FWHA 3TRPA 5GAPD 3DEXA 5KN2A 8GSSA 1RK4A 4YH2A 4TR1A 3IOSA 1W4VA 3C1RA 4N0ZA 2NTOA 4ZBAA 5ID2A 2WULA 4POLA 3A2XA 5IO2A 3ZLPA 3TKSA 4NWYA 4NV2A 2TRXA 3EU4A 4ZXGA 4FIWA 2H6XA 1YKAA 3UEMA 1PRXA 1K0DA 4FQUA 5D9TA 3GMFA 3GL3A 1R5AA 2HRFA 4EDZA 4ECCA 5CRGA 2L6CA 4MPGA 2KLXA 3IR4A 1CQGA 1RW1A 1U88A 2YZHA 4MF7A 3M3MA 4BL7A 3KCMA 3WD6A 3HCZA 2O87A 1EV4A 3AY8A 4XS1A 3UL3A 3LXTA 4IVFA 4HZ2A 2N5AA 1ERWA 3GKKA 1G6WA 1GULA 3C73A 2H01A 3ZITA 3DVWA 5ECPB 1SD8A 4BVYB 4MDCA 5DCGA 3BJ5A 1V57A 4D73A 1B9YC 4PXOA 1M9BA 5AGYA 3GH9A 3VK9A 3ZREA 1OKTA 3IBHA 3ZRDA 1XWKA 3PGTA 4XRAA 1S3CA 4YAVA 2IMEA 2FY6A 4Q5NA 7GSSA 1AXDA 4L0WA 1X5DA 2B1KA 3DRNA 4KE3A 1BG5A 4X43A 2DKHA 6GSXA 3FEUA 4K0GA 2LJAA 4X0XA 19GSA 4HU9A 1ILOA 2BJXA 3H93A 1T4YA 2C0FA 1SYRA 1ON4A 1V58A 1B4QA 1FG4A 2IN3A 13GSA 2X8CA 2R0GA 4AJ6A 4CHSA 2LJKA 3HDCA 1UA5A 4POBA 4V1Ag 4H86A 4K7OA 4LMWA 1A2LA 4FO5A 2YJHA 5KN0A 2YWOA 1J08A 2FLSA 1TK8B 4MH3A 1Z5YE 4X4JA 3MAKA 4BWQA 4E8EA 4Q5QA 2LRTA 4BVXA 4DVCA 3HZ4A 3QDNA 3KXOA 2AJQB 1K0CA 4NMUA 2B5EA 4EIPA 5H5RA 1X9MB 1JZRA 4TR3A 1AIUA 2PMTA 5IMAA 2GQMA 2IPAA 4OCFA 1MD4A 3N5OA 4QL9A 1GTIA 3VPTA 1F3BA 1K0MA 5LD0A 2V6KA 2K8VA 4GXZA 4HZ4A 1O73A 5ELGA 3J7Yk 1T7PB 1GUHA 2HNLA 1A2MA 5GZZB 4TXOA 1EOGA 2CZ2A 4EE0A 1PMTA 1YF1A 4MA9A 4FYUA 3E0UA 5IMVA 1O6JA 4MCUA 4MPFA 4PQ1A 4LA1A 1DUGA 3I6AA 3ERGA 2IMIA 4KX4A 2KUCA 5HR1A 5F05A 2L4CA 4HS1A 1F6MC 1ZL9A 1EOHA 2H0IA 4I97A 5J41A 1MDJA 2CQ9A 2HLSA 2HZFA 2O85A 4LMVA 3FR6A 3BOAA 3W8SA 1PN0A 4IS0A 2NBSA 1FVKA 4KGIA 2HZEA 3RHBA 5FT3A 2CX4A 1KTEA 2L5LA 1T3BA 1UN2A 2R0CA 3TDGA 2QA2A 1AUCA 2R4VA 5DJLA 1FAAA 3W8JA 1NSWA 2PUKC 4YAPA 4NXIA 3F3QA 5JCWA 5IQYA 4F0BA 1G0TA 4DSRA 2FWGA 1YQ1A 1ERUA 1WOUA 1PSQA 4G2EA 3CBUA 5AN1A 3IV4A 2DJJA 2QA1A 1WMJA 4PQHA 3J7Yb 4IBPA 4J57E 1BQ7A 2QSIA 3C8EA 1M99A 2VL9A 5DALA 3P2AA 2WGRA 2L5OA 3VLNA 5J4UA 3CTFA 3IK7A 6GSYA 3DWVA 1ZYQB 3UVHA 4KCEA 3VI7A 2OE3A 1GSDA 2GZYA 1ZYPA 4OD7A 1OE7A 4RUVA 1FVJA 4RQRA 4ILFA 2YJ7A 1IYIA 3G7IA 2YP6A 2NVLA 1GNEA 1DSBA 1PL2A 1TDIA 4WR4A 4BIKA 1THOA 3O3TA 4PGTA 3GX8A 4O7HA 4V2NA 2L57A 4MJCA 2REMA 1EP8A 3APOA 3D0ZA 1R4WA 4V2LA 4XIHA 4ICYA 2VCXA 4F2IA 1WP0A 3I43A 1ZCPA 2CX3A 2CVKA 2JADA 4NV5A 1LJRA 5G30A 5JWOB 2MMNA 3IHGA 1PD21 4ML6A 2GT6A 4AF2A 1ZZYA 4Q5RA 4ZB6A 4ZILA 1GTUA 1T8EB 3VFIA 4EKZA 1T1VA 1MD3A 1FOVA 1USBA 5E4WA 3UARA 4G0KA 2KHPA 3CTGA 4BA7A 5CAXA 3UIWA 1XPVA 4O5RA 2JZTA 1V40A 4I2TA 1UC7A 3RPNA 3PINA 2F51A 1B8XA 2HRAA 3D22A 2LNTA 2P5RA 5KOWA 1XG8A 5AIVA 3UMAA 1XFLA 2VCVA 4MP4A 2H1BA 4KF9A 2IL3A 4RI6A 1K0NA 3GX0A 5B6MA 4Z7XA 1Z7PA 2C0DA 3PPUA 3H8QA 3O6TA 3CRUA 2EIRA 3ZYWA 4HJ2A 2GSSA 1GL8A 5J3RA 3A2WA 1N2AA 1XVQA 4L5OA 2I81A 3TOTA 2HFDA 3IDVA 2ALBA 4K6XA 2MMZA 4KSMA 5KN1A 3FHKA 5G5FA 2G0FA 2B5XA 1B4PA 1MTCA 1SJZA 4I8BA 1B9XC 3GKMA 5FWGA 3JCML 2HI7A 3WGXA 2V32A 1BX9A 3L9UA 3KZQA 3S9FA 2XPEA 4IKHA 1SKRB 5ECNB 1AQWA 5G5EA 2FA8A 2CA8A 2GTUA 3GKNA 1TRSA 5D96A 3FZ5A 2YV9A 1YEXA 4X1UA 3KP9A 3WT1A 2R37A 2B7JA 1PA3A 3FMWA 2YNXA 2VLUA 4ZL7A 3LFLA 4NPBA 1KNGA 4JR4A 4BVYA 3HY2A 2V41A 5D93A 4XS6A 5ECOB 18GSA 1QUWA 3SBCA 1X0RA 2LSTA 4IHUA 1Q98A 1SL2B 2H76A 4CY8A 1YEPA 1OYJA 3A5IA 4KNDA 5D9WA 1XCCA 4OO4A 3QD9A 2V2GA 5A4WA 4K8MA 3K8NA 3TRQA 2H74A 5GSTA 2LV3A 5DQYA 1V98A 3CXGA 3DIEA 4MZBA 1HYUA 1TXXA 3H1NA 1PN9A 1GSFA 4EF0A 5H5QA 3G7YA 4ML1A 1PKZA 3VWVA 4XRDA 3P7XA 4CDOA 3LWAA 4XS4A 1WRYA 3DXBA 2XHFA 1O8XA 2I9HA 3P8WA 4JBBA 4ULXA 3TCOA 1FB0A 5G2ZA 4AJ7A 4USSA 4WKWA 1J9BA 3VWUA 1ST9A 2A2RA 4HQZA 3RDWA 3IXRA 1GRXA 1SK2A 1EGOA 3EYTA 2TRCP 4ECBA 4IJIA 4EIQA 4PNGA 3GSSA 4TVEA 4J56E 5H5SA 3IPZA 5FHIA 1TI1A 1WE0A 3FR9A 1SJ6A 4GWRA 3ME7A 2HRKA 4V1Ap 1A23A 3KH7A 4K1FA 1GSEA 2R0PA 2VCQA 4KDXA 4ZB8A 3ZIVA 1THXA 2HE3A 2JZRA 4KCAA 2TIRA 1G7OA 1XBSA 2NPBA 1OKDA 2VL2C 3UOMA 1A8YA 3ZIJA 3QFBC 4ISDA 2FGXA 3TUEA 4EL1A 5HFIA 1GNWA 4ZIJA 3NZNA 10GSA 2FWFA 5F06A 2H71A 1K3LA 3IK9A 3TB2A 3VWWA 3LQ7A 5A4VA 2XBQA 3QAVA 2C3TA 4I5QA 3KMOA 1MDIA 3CSIA 2LUSA 4L0UA 3TKQA 5HR0A 1Q4JA 1TJDA 2M80A 3FYGA 4TXVA 4ZBBA 2O7KA 1I9DA 2F8AA 2VUPA 1WPIA 3H4KA 4ZB9A 3TKSC 2DLXA 5LCZA 3GV1A 3F9UA 1GUMA 4N0VA 3QR6A 3GL5A 3EWLA 2F9SA 1EZKA 1X9SB 1OC9B 1GSQA 4IN0A 5LNKe 3UVTA 4TR1B 3F4RA 1Y25A 3IAS2 1YDKA 3KP8A 2H0GA 2ZCTA 3GUSA 1A0FA 2UZ8A 3GNJA 4G9HA 4K7NA 5CRDA 1C72A 5CO3A 2I4AA 4YQUA 2KP2A 5ID2B 4HSCX 2VLVA 4LLRA 1RQMA 3HVNA 5J5NA 3SWLA 3DGQA 4JU5A 4GRFA 2C80A 2H8LA 2B5YA 1EEMA 4K5SA 1YY7A 3LSZA 3KMNA 4MABA 3PR8A 2C3QA 4MJBA 2CVBA 1WWJA 3CQFA 3BBYA 1DE2A 3I9V2 3L9SA 4QQ7A 1FO5A 4BL7B 1U6TA 3A3TA 1HNBA 4OFMA 4PUAA 1TTZA 2QC7A 5IMFA 5IO0A 2Z9SA 1GP1A 3GRXA 2AYTA 2GSRA 1TRVA 5IMZA 1Y6EA 1S3RA 4D73B 3FRCA 3TJFA 2HRNA 3FZAA 4AGSA 3EC3A 3TJKA 2J9HA 2KP1A 1VRSD 3Q19A 3EINA 1VF3A 5DAKB 2H66A 1K0AA 3ERWA 1AAZA 3DYRA 3U6VA 3Q18A 2VIMA 4TR0A 5INYA 4PTSA 1ABAA 5IOXA 2DKIA 4QL7A 3CYNA 1Z9HA 5HFKA 5GSSA 2P5QA 2RM6A 2QGVA 1GSSA 1CQHA 2WFCA 4MK3A 3MWHA 4IQ1A 5CP1A 2PVOC 1XWCA 2WS2A 3FZ4A 3E9JB 2GS3A 3F4TA 3MDKA 1XW9A 1ZOFA 2H1AA 1PFOA 4WETA 3PH9A 3HA9A 2IMKA 4MF5A 2H73A 3FKFA 4BVXB 1ERVA 5HQPA 5ECRB 3WYWA 1V9WA 2OBIA 4N10A 1NHOA 5IPGA 3KIJA 1JLVA 1Z6NA 2M72A 5IPHA 4OMVA 2BTOT 1Z6MA 3IC8A 4G0LA 4OFNA 2A2SA 1DE1A 4DSSA 5EPFA 2LNSA 1SL0B 2H30A 3GN3A 4WF5A 3ERFA 2DMMA 2OE1A 4YQVA 1XVWA 4TXOB 2R3XA 1SENA 3IAM2 3OR5A 3KGKA 1HNAA 3GTUA 20GSA 9GSSA 1PX7A 4ZL9A 3TGZA 4HU7A 4GTUA 3DVXA 1O85A 1FW1A 4F0CA 2GQKA 3F0IA 1FB6A 2QKEA 4FYBA 2IFQA 1XOAA 3GYKA 3ME8A 1JZDA 4KAEA 2IWTA 1DBYA 2YWIA 2RM5A 5JWRB 4BPYA 6GSUA 4G10A 1XZOA 1Z3EA 2EC4A 3ZMLA 4KUNA 14GSA 2FA4A 1H75A 2PERA 2PU9C 1U3AA 4GLTA 3TOUA 2H70A 5DBQA 2JSYA 3RAZA 1AQVA 1M2DA 3L9VA 3HYPA 5ELAA 4TKYA 5ECLB 1FOHA 2CVDA 3ZTLA 2PPTA 1GSUA 2C1YA 2OA7A 1GH2A 5AIXA 3QOUA 1YJ6A 1NM3A 2P31A 5EL8A 2FWEA 6GSVA 2CT6A 1M3JA 1GTBA 2YWMA 3LYKA 3M0FA 5DJMA 1GUKA 5A5KA 2AAWA 3LXZA 3ZZXA 4WBJA 5BRTA 1SKWB 4ECIA 4K5RA 4JR6A 4O92A 3IC4A 4HDEA 11GSA 4PURA 4G0IA 1F9MA 5CYYA 5EY6A 5KEJA 2AV4A 4GSSA 3O76A 3F6DA 4XCSA 1SK0A 4MF6A 5EVOA 2C3NA 2R2JA 5DALB 1PKWA 4IQAA 2DSAA 4NAXA 4J2FA 4POKA 1XWGA 2FUG2 4KA0A 2IMDA 3F3RA 1TP9A 4FYCA 2JSZA 4TOPA 4L5LA 3VPQA 1FHEA 3FW2A 1ZYNA 3WGDA 1S3AA 1QQ2A 4Z2TA 4MJEA 4ID0A 2I1UA 3QMXA 6GSWA 4WXTA 3HZ8A 3FY7A 2A4VA 1PGTA 3ZVJD 5JWQB 5B6NA 1G6YA 2FD3A 6GSSA 2K6VA 3QAWA 3Q6OA 4RQXA 1NHYA 1A24A 1VF1A 2YANA 3EE2A 1V2AA 4K0NA 3CMIA 1O8WA 2DIZA 2AUVA 3R3EA 4KDUA 2C4JA 1PQNA 4LL4B 2YWNA 4KDYA 5ECSA 4NHWA 3ZFBA 2E2GA 3NOFA 1XWBA 2D2ZA 3C71A 2HSHA 2EIQA 3TJBA 4XHMA 3VWXA 2JU5A 1MEKA 3GA4A 2VCWA 3WT2A 1O81A 2VL3A 1LBKA 2VD0A 3ED3A 5HR2A 3FZ9A 4IELA 2B3SA 2GZZA 3LGCA 4XTSA 1EWXA 3HKRA 3E3EA 3TKSE 2PN8A 1QXHA 2RIIA 2LEGA 2DJ2A 4WEYA 3TKPA 5KOXA 1NW2A 2HT9A 4GSNA 2MBTA 3WGEA 1HNCA 1VF4A 1SD9A 1SL1B 1SU9A 5ENUA 1VGLA 4KSOA 1U3IA 3MYDA 1OC9A 4Z2RA 2CV4A 4CW9A 1URMA 2H72A 2ES7A 2K18A 5F0GA 3QFAC 1X5EA 3CSJA 3ZL5A 1F37A 4POMA 5C00A 1TI3A 1E2YA 3H79A 2OADA 2H1DA 1TU8A 5D73A 4NHZA 3HD5A 4N30A 2ZNMA 1LU4A 4Q5FA 3ISOA 2K8SA 1ERTA 6GSTA 2XPDA 2YOIA 3M9KA 2H75A 3D5JA 2E0QA 1AC1A 5CRWA 3BD2A 3BCIA 3F63A 4WBRD 1K0OA 2X8GA 17GSA 3US3A 2WJUA 2NDOA 2M46A 5D8IA 4MZWA 1SKSB 2ON7A 3I69A 5J9CA 3DKSA 1GWCA 2MMOA 5G1KA 1K0BA 1MDKA 1SJIA 2WRTA 4OFTA 4EUYA 4TR4A 1ZMAA 1QMVA 3MIXA 2J23A 2JZSA 3EPTA 4YKFA 3TRXA 1K3OA 2RUEA 1XXUA 1K3YA 3HHVA 1GLQA 4ZL8A 2PVQA 1JZOA 2GZPA 4TRXA 1TK0B 2X4AA 3IHQA 2WDUA 2IIYA 2YPMA 3W6GA 4KB3A 1EGRA 2A2PA 1JFUA 5JCUA 1Z7RA 4HI7A 3LG6A 5DQSA 2GDRA 5D9VA 3GURA 2FHEA 1O7UA 1F2EA 4ACSA 5HFGA 3KJYA 4EDYA 3HVSA 5F07A 1YF0A 2EIOA 2LRNA 5KN3A 5DAKA 2X64A 4MNNA 4P3YB 2L59A 1SYXA 5CREA 4HUAA 4DEJA 4OWYA 1J0FA 4DSQA 2VO4A 2MZCA 4FH8A 12GSA 2LJRA 4HQSA 5IMDA 4AJ8A 1I5GA 1IYHA 3L0HA 2AB6A 4JZQA 3LW9A 3GSTA 3D21A 3L78A 4XS4B 2OKAA 4IP6A 2O89A 1AQXA 3QAGA 4YQMA 1OE8A 1TRWA 2GGTA 2VOCA 5L71A 5C04A 2HYXA 1QGVA 1JZWA 4N11A 3IA1A 2E7PA 2GQLA 2OE0A 4K2DA 2FNOA 3IRAA 2X99A 2R5GA 2AHEA 1XOBA 1EEJA 2YV7A 4LL1B 2DJ0A 3UBLA 3HJOA 3UAPA 22GSA 2H0HA 2C8UA 2V1MA 1KEBA 1S3DA 4MH2A 4O5UA 3IE3A 4GCIA 2CAIA 2LKUA 3FR3A 2PWJA 1EV9A 2X8HA 3ZFLA 4PUFC 2DJ1A 4MMMA 4GQCA 4ECJA 4A5PA 1BEDA 1BYEA 4PX1A 2VM2A 3G9BA 2GVPA 1AW9A 1OAZA 2ZUPA 5IIZA 4K9ZA 5G31A 3D4TA 3A5WA 4CY6A 1OC3A 4EXJA 1M9AA 2DBCA 1XW5A 2KOKA 3KH9A 2F3MA 3KEBA 3TKRA 2MMAA 2GLRA 2X49A 1OC8A 5D9XA 4F03A 3F8UA 1H4OA 2CAQA 3GIXA 3MSZA 2LS5A 5AISA 2LQQA 2P0GA 4IGJA 5ECIB 2WB9A 4EO3A 1JLWA 3HXSA 4F9ZA 1X9WB 3GKXA 1T00A 1W89A 3GH6A 1TU7A 3RPPA 2LQOA 1GLPA 5CNWA 2VCTA 3KTBA 1TW9A 1A2JA 2YZUA 2DJKA 2H6ZA 1F3AA 2IJYA 4I6XA 4E8HA 5A4UA 4K7IA 2FCHA 5IOWA 1B48A 4G19A 3D4MA 3LORA 2XBIA 3M9JA 5ABRA 3EURA 2PBJA 3HJMA 1EP7A 3VURA 4HOJA 2RUFA 2N5FA 2VD1A 2GSTA 2OACA 4JRRA 2HXKA 3F4SA 1SK1A 4O5QA 2E2MA 2CZ3A 5COHA 2I3YA 2LRCA 3APSA 1UVZA 3CRTA 2JACA 3APQA 4RI7A 3QCPA 3UBKA 4PQIA 2B7KA 2YN1A 4YKGA 4L8EA 1M2AA 1YZXA 2DC5A 1ACVA 3LJRA 4IP1A 5DCHA 2DMLA 4JE1A 1A8LA 2O8VB 5DDLA 5DVBA 2G2QA 3N9JA 2L4QA 2OBKA 1M0UA 3L4NA 3LYPA 3A2VA 3EMXA 3Q74A 4WF4A 2VM1A 2JL4A 3HJPA 3VI5A 4TN8A 4GF0A 2PGTA 1JHBA 2HZEB 2HSMA 5ECMB 2OJLA 3QPMA 3ZMKA 1R26A 1M2BA 1QFNA 5ECKB 5F8BA 1WIKA 2DIYA 3U5RE 1R7HA 1X5CA 2MBSA 5ECQB 1ZGNA 3KTLA 2HSYA 2VAFA 1TRUA 2H19A 3HVVA 3DMLA 1QK8A 2C0EA 2GSQA 2R6KA 1XWAA 3TJJA 2H1GA 2L6DA 3UJ1A 4IW9A 1A0RP 3BCKA 1N8JA 4KW6A 4Z2UA 3HVXA 1U87A 4V2MA
chains in the Genus database with same CATH topology
2B6MA 5B8AA 1OVNA 1ZYEA 4MLYA 3MNGA 4EVMA 4K2XA 2V6OA 5G1LA 2IMFA 1XIYA 2YCDA 3V1WA 1T4ZA 5JCGA 1BJXA 1TOFA 4PNFA 4DSSB 4BWSA 1BAYA 4KH7A 1KBNA 3GHAA 2DJ3A 5HR3A 1WJKA 4WR5A 1PL1A 2N5BA 3NIVA 4HEA2 3M8NA 3EU3A 4MZCA 5GAND 1M7TA 3C7MA 2MYGA 4HJMA 3GTUB 4GQFA 1PX6A 1VF2A 5BMUA 2B1LA 2XC2A 3M1GA 5B8BA 1ML6A 2WZ9A 4EC0A 2IFQB 4IJ3A 3TJGA 4JEDA 3F6FA 2VCZA 3C1SA 3G7JA 1R5PA 3P90A 16GSA 3CSHA 2ON5A 1E6BA 2H6YA 4MJAA 3FK8A 3DD3A 2LTKA 3GFKA 2BMXA 2K9FA 3ZVJA 3KM6A 4I2UA 5ECHB 2GT5A 5CRHA 1HD2A 4TW5A 3D6IA 1XW6A 3KD0A 1GSYA 5B7CA 2RLIA 4GSTA 3RBTA 5J9BA 1TK5B 4ZBDA 4F82A 3R2QA 3EVIA 3LEFA 4OCEA 1HQOA 2VLTA 2VL2A 5E59A 2WCIA 5IM9A 5IMCA 4O32A 2F8FA 1YKCA 4OO5A 2A4HA 3EMPA 3RHCA 1G7EA 2C0GA 1GTAA 1TKDB 2FWHA 3TRPA 5GAPD 3DEXA 5KN2A 8GSSA 1RK4A 4YH2A 4TR1A 3IOSA 1W4VA 3C1RA 4N0ZA 2NTOA 4ZBAA 5ID2A 2WULA 4POLA 3A2XA 5IO2A 3ZLPA 3TKSA 4NWYA 4NV2A 2TRXA 3EU4A 4ZXGA 4FIWA 2H6XA 1YKAA 3UEMA 1PRXA 1K0DA 4FQUA 5D9TA 3GMFA 3GL3A 1R5AA 2HRFA 4EDZA 4ECCA 5CRGA 2L6CA 4MPGA 2KLXA 3IR4A 1CQGA 1RW1A 1U88A 2YZHA 4MF7A 3M3MA 4BL7A 3KCMA 3WD6A 3HCZA 2O87A 1EV4A 3AY8A 4XS1A 3UL3A 3LXTA 4IVFA 4HZ2A 2N5AA 1ERWA 3GKKA 1G6WA 1GULA 3C73A 2H01A 3ZITA 3DVWA 5ECPB 1SD8A 4BVYB 4MDCA 5DCGA 3BJ5A 1V57A 4D73A 1B9YC 4PXOA 1M9BA 5AGYA 3GH9A 3VK9A 3ZREA 1OKTA 3IBHA 3ZRDA 1XWKA 3PGTA 4XRAA 1S3CA 4YAVA 2IMEA 2FY6A 4Q5NA 7GSSA 1AXDA 4L0WA 1X5DA 2B1KA 3DRNA 4KE3A 1BG5A 4X43A 2DKHA 6GSXA 3FEUA 4K0GA 2LJAA 4X0XA 19GSA 4HU9A 1ILOA 2BJXA 3H93A 1T4YA 2C0FA 1SYRA 1ON4A 1V58A 1B4QA 1FG4A 2IN3A 13GSA 2X8CA 2R0GA 4AJ6A 4CHSA 2LJKA 3HDCA 1UA5A 4POBA 4V1Ag 4H86A 4K7OA 4LMWA 1A2LA 4FO5A 2YJHA 5KN0A 2YWOA 1J08A 2FLSA 1TK8B 4MH3A 1Z5YE 4X4JA 3MAKA 4BWQA 4E8EA 4Q5QA 2LRTA 4BVXA 4DVCA 3HZ4A 3QDNA 3KXOA 2AJQB 1K0CA 4NMUA 2B5EA 4EIPA 5H5RA 1X9MB 1JZRA 4TR3A 1AIUA 2PMTA 5IMAA 2GQMA 2IPAA 4OCFA 1MD4A 3N5OA 4QL9A 1GTIA 3VPTA 1F3BA 1K0MA 5LD0A 2V6KA 2K8VA 4GXZA 4HZ4A 1O73A 5ELGA 3J7Yk 1T7PB 1GUHA 2HNLA 1A2MA 5GZZB 4TXOA 1EOGA 2CZ2A 4EE0A 1PMTA 1YF1A 4MA9A 4FYUA 3E0UA 5IMVA 1O6JA 4MCUA 4MPFA 4PQ1A 4LA1A 1DUGA 3I6AA 3ERGA 2IMIA 4KX4A 2KUCA 5HR1A 5F05A 2L4CA 4HS1A 1F6MC 1ZL9A 1EOHA 2H0IA 4I97A 5J41A 1MDJA 2CQ9A 2HLSA 2HZFA 2O85A 4LMVA 3FR6A 3BOAA 3W8SA 1PN0A 4IS0A 2NBSA 1FVKA 4KGIA 2HZEA 3RHBA 5FT3A 2CX4A 1KTEA 2L5LA 1T3BA 1UN2A 2R0CA 3TDGA 2QA2A 1AUCA 2R4VA 5DJLA 1FAAA 3W8JA 1NSWA 2PUKC 4YAPA 4NXIA 3F3QA 5JCWA 5IQYA 4F0BA 1G0TA 4DSRA 2FWGA 1YQ1A 1ERUA 1WOUA 1PSQA 4G2EA 3CBUA 5AN1A 3IV4A 2DJJA 2QA1A 1WMJA 4PQHA 3J7Yb 4IBPA 4J57E 1BQ7A 2QSIA 3C8EA 1M99A 2VL9A 5DALA 3P2AA 2WGRA 2L5OA 3VLNA 5J4UA 3CTFA 3IK7A 6GSYA 3DWVA 1ZYQB 3UVHA 4KCEA 3VI7A 2OE3A 1GSDA 2GZYA 1ZYPA 4OD7A 1OE7A 4RUVA 1FVJA 4RQRA 4ILFA 2YJ7A 1IYIA 3G7IA 2YP6A 2NVLA 1GNEA 1DSBA 1PL2A 1TDIA 4WR4A 1THOA 3O3TA 4PGTA 3GX8A 4O7HA 4V2NA 2L57A 4MJCA 2REMA 1EP8A 3APOA 3D0ZA 1R4WA 4V2LA 4XIHA 4ICYA 2VCXA 4F2IA 1WP0A 3I43A 1ZCPA 2CX3A 2CVKA 2JADA 4NV5A 1LJRA 5G30A 5JWOB 2MMNA 3IHGA 1PD21 4ML6A 2GT6A 4AF2A 1ZZYA 4Q5RA 4ZB6A 4ZILA 1GTUA 1T8EB 3VFIA 4EKZA 1T1VA 1MD3A 1FOVA 1USBA 5E4WA 3UARA 4G0KA 2KHPA 3CTGA 4BA7A 5CAXA 3UIWA 1XPVA 4O5RA 2JZTA 1V40A 4I2TA 1UC7A 3RPNA 3PINA 2F51A 1B8XA 2HRAA 3D22A 2LNTA 2P5RA 5KOWA 5AIVA 3UMAA 1XFLA 2VCVA 4MP4A 2H1BA 4KF9A 2IL3A 4RI6A 1K0NA 3GX0A 5B6MA 4Z7XA 1Z7PA 2C0DA 3PPUA 3H8QA 3O6TA 3CRUA 2EIRA 3ZYWA 4HJ2A 2GSSA 1GL8A 5J3RA 3A2WA 1N2AA 1XVQA 4L5OA 2I81A 3TOTA 2HFDA 3IDVA 2ALBA 4K6XA 2MMZA 4KSMA 5KN1A 3FHKA 5G5FA 2G0FA 2B5XA 1B4PA 1MTCA 1SJZA 4I8BA 1B9XC 3GKMA 5FWGA 3JCML 2HI7A 3WGXA 2V32A 1BX9A 3L9UA 3KZQA 3S9FA 2XPEA 4IKHA 1SKRB 5ECNB 1AQWA 5G5EA 2FA8A 2CA8A 2GTUA 3GKNA 1TRSA 5D96A 3FZ5A 2YV9A 1YEXA 4X1UA 3KP9A 3WT1A 2R37A 2B7JA 1PA3A 3FMWA 2YNXA 2VLUA 4ZL7A 3LFLA 4NPBA 1KNGA 4JR4A 4BVYA 3HY2A 2V41A 5D93A 4XS6A 5ECOB 18GSA 1QUWA 3SBCA 1X0RA 2LSTA 4IHUA 1Q98A 1SL2B 2H76A 4CY8A 1YEPA 1OYJA 3A5IA 4KNDA 5D9WA 1XCCA 4OO4A 3QD9A 2V2GA 5A4WA 4K8MA 3K8NA 3TRQA 2H74A 5GSTA 2LV3A 5DQYA 1V98A 3CXGA 3DIEA 4MZBA 1HYUA 1TXXA 3H1NA 1PN9A 1GSFA 4EF0A 5H5QA 3G7YA 4ML1A 1PKZA 3VWVA 4XRDA 3P7XA 4CDOA 3LWAA 4XS4A 1WRYA 3DXBA 2XHFA 1O8XA 2I9HA 3P8WA 4JBBA 4ULXA 3TCOA 1FB0A 5G2ZA 4AJ7A 4USSA 4WKWA 1J9BA 3VWUA 1ST9A 2A2RA 4HQZA 3RDWA 3IXRA 1GRXA 1SK2A 1EGOA 3EYTA 2TRCP 4ECBA 4IJIA 4EIQA 4PNGA 3GSSA 4TVEA 4J56E 5H5SA 3IPZA 5FHIA 1TI1A 1WE0A 3FR9A 1SJ6A 4GWRA 3ME7A 2HRKA 4V1Ap 1A23A 3KH7A 4K1FA 1GSEA 2R0PA 2VCQA 4KDXA 4ZB8A 3ZIVA 1THXA 2HE3A 2JZRA 4KCAA 2TIRA 1G7OA 1XBSA 2NPBA 1OKDA 2VL2C 3UOMA 1A8YA 3ZIJA 3QFBC 4ISDA 2FGXA 3TUEA 4EL1A 5HFIA 1GNWA 4ZIJA 3NZNA 10GSA 2FWFA 5F06A 2H71A 1K3LA 3IK9A 3TB2A 3VWWA 3LQ7A 5A4VA 2XBQA 3QAVA 2C3TA 4I5QA 3KMOA 1MDIA 3CSIA 2LUSA 4L0UA 3TKQA 5HR0A 1Q4JA 1TJDA 2M80A 3FYGA 4TXVA 4ZBBA 2O7KA 1I9DA 2F8AA 2VUPA 1WPIA 3H4KA 4ZB9A 3TKSC 2DLXA 5LCZA 3GV1A 3F9UA 1GUMA 4N0VA 3QR6A 3GL5A 3EWLA 2F9SA 1EZKA 1X9SB 1OC9B 1GSQA 4IN0A 5LNKe 3UVTA 4TR1B 3F4RA 1Y25A 3IAS2 1YDKA 3KP8A 2H0GA 2ZCTA 3GUSA 1A0FA 2UZ8A 3GNJA 4G9HA 4K7NA 5CRDA 1C72A 5CO3A 2I4AA 4YQUA 2KP2A 5ID2B 2VLVA 4LLRA 1RQMA 5J5NA 3SWLA 3DGQA 4JU5A 4GRFA 2C80A 2H8LA 2B5YA 1EEMA 4K5SA 1YY7A 3LSZA 3KMNA 4MABA 3PR8A 2C3QA 4MJBA 2CVBA 1WWJA 3BBYA 1DE2A 3I9V2 3L9SA 4QQ7A 1FO5A 4BL7B 1U6TA 3A3TA 1HNBA 4OFMA 4PUAA 1TTZA 2QC7A 5IMFA 5IO0A 2Z9SA 1GP1A 3GRXA 2AYTA 2GSRA 1TRVA 5IMZA 1Y6EA 4D73B 3FRCA 3TJFA 2HRNA 3FZAA 4AGSA 3EC3A 3TJKA 2J9HA 2KP1A 1VRSD 3Q19A 3EINA 1VF3A 5DAKB 2H66A 1K0AA 3ERWA 1AAZA 3DYRA 3U6VA 3Q18A 2VIMA 4TR0A 5INYA 4PTSA 1ABAA 5IOXA 2DKIA 4QL7A 3CYNA 1Z9HA 5HFKA 5GSSA 2P5QA 2RM6A 2QGVA 1GSSA 1CQHA 2WFCA 4MK3A 3MWHA 4IQ1A 5CP1A 2PVOC 1XWCA 2WS2A 3FZ4A 3E9JB 2GS3A 3F4TA 3MDKA 1XW9A 1ZOFA 2H1AA 4WETA 3PH9A 3HA9A 2IMKA 4MF5A 2H73A 3FKFA 4BVXB 1ERVA 5HQPA 5ECRB 3WYWA 1V9WA 2OBIA 4N10A 1NHOA 5IPGA 3KIJA 1JLVA 1Z6NA 2M72A 5IPHA 4OMVA 2BTOT 1Z6MA 3IC8A 4G0LA 4OFNA 2A2SA 1DE1A 4DSSA 5EPFA 2LNSA 1SL0B 2H30A 3GN3A 4WF5A 3ERFA 2DMMA 2OE1A 4YQVA 1XVWA 4TXOB 2R3XA 1SENA 3IAM2 3OR5A 3KGKA 1HNAA 3GTUA 20GSA 9GSSA 1PX7A 4ZL9A 3TGZA 4HU7A 4GTUA 3DVXA 1O85A 1FW1A 4F0CA 2GQKA 3F0IA 1FB6A 2QKEA 4FYBA 2IFQA 1XOAA 3GYKA 3ME8A 1JZDA 4KAEA 2IWTA 1DBYA 2YWIA 2RM5A 5JWRB 4BPYA 6GSUA 4G10A 1XZOA 1Z3EA 2EC4A 3ZMLA 4KUNA 14GSA 2FA4A 1H75A 2PERA 2PU9C 1U3AA 4GLTA 3TOUA 2H70A 5DBQA 2JSYA 3RAZA 1AQVA 1M2DA 3L9VA 3HYPA 5ELAA 4TKYA 5ECLB 1FOHA 2CVDA 3ZTLA 2PPTA 1GSUA 2C1YA 2OA7A 1GH2A 5AIXA 3QOUA 1YJ6A 1NM3A 2P31A 5EL8A 2FWEA 6GSVA 2CT6A 1GTBA 2YWMA 3LYKA 3M0FA 5DJMA 1GUKA 5A5KA 2AAWA 3LXZA 3ZZXA 4WBJA 5BRTA 1SKWB 4ECIA 4K5RA 4JR6A 4O92A 3IC4A 4HDEA 11GSA 4PURA 4G0IA 5CYYA 1F9MA 5EY6A 5KEJA 2AV4A 4GSSA 3O76A 3F6DA 4XCSA 1SK0A 4MF6A 5EVOA 2C3NA 2R2JA 5DALB 1PKWA 4IQAA 2DSAA 4NAXA 4J2FA 4POKA 1XWGA 2FUG2 4KA0A 2IMDA 3F3RA 1TP9A 4FYCA 2JSZA 4TOPA 4L5LA 3VPQA 1FHEA 3FW2A 1ZYNA 3WGDA 1S3AA 1QQ2A 4Z2TA 4MJEA 4ID0A 2I1UA 3QMXA 6GSWA 4WXTA 3HZ8A 3FY7A 2A4VA 1PGTA 3ZVJD 5JWQB 5B6NA 1G6YA 2FD3A 6GSSA 2K6VA 3QAWA 3Q6OA 4RQXA 1NHYA 1A24A 1VF1A 2YANA 3EE2A 1V2AA 4K0NA 3CMIA 1O8WA 2DIZA 2AUVA 3R3EA 4KDUA 2C4JA 1PQNA 4LL4B 2YWNA 4KDYA 5ECSA 4NHWA 3ZFBA 2E2GA 3NOFA 1XWBA 2D2ZA 3C71A 2HSHA 2EIQA 3TJBA 4XHMA 3VWXA 2JU5A 1MEKA 3GA4A 2VCWA 3WT2A 1O81A 2VL3A 1LBKA 2VD0A 3ED3A 5HR2A 3FZ9A 4IELA 2B3SA 2GZZA 3LGCA 4XTSA 1EWXA 3HKRA 3E3EA 3TKSE 2PN8A 1QXHA 2RIIA 2LEGA 2DJ2A 4WEYA 3TKPA 5KOXA 1NW2A 2HT9A 4GSNA 2MBTA 3WGEA 1HNCA 1VF4A 1SD9A 1SL1B 1SU9A 5ENUA 1VGLA 4KSOA 1U3IA 3MYDA 1OC9A 4Z2RA 2CV4A 4CW9A 1URMA 2H72A 2ES7A 2K18A 5F0GA 3QFAC 1X5EA 3CSJA 3ZL5A 1F37A 4POMA 5C00A 1TI3A 1E2YA 3H79A 2OADA 2H1DA 1TU8A 5D73A 4NHZA 3HD5A 4N30A 2ZNMA 1LU4A 4Q5FA 3ISOA 2K8SA 1ERTA 6GSTA 2XPDA 2YOIA 3M9KA 2H75A 3D5JA 2E0QA 1AC1A 5CRWA 3BD2A 3BCIA 3F63A 4WBRD 1K0OA 2X8GA 17GSA 3US3A 2WJUA 2NDOA 2M46A 5D8IA 4MZWA 1SKSB 2ON7A 3I69A 5J9CA 3DKSA 1GWCA 2MMOA 5G1KA 1K0BA 1MDKA 1SJIA 2WRTA 4OFTA 4EUYA 4TR4A 1ZMAA 1QMVA 3MIXA 2J23A 2JZSA 3EPTA 4YKFA 3TRXA 1K3OA 2RUEA 1XXUA 1K3YA 3HHVA 1GLQA 4ZL8A 2PVQA 1JZOA 2GZPA 4TRXA 1TK0B 2X4AA 3IHQA 2WDUA 2IIYA 2YPMA 3W6GA 4KB3A 1EGRA 2A2PA 1JFUA 5JCUA 1Z7RA 4HI7A 3LG6A 5DQSA 2GDRA 5D9VA 3GURA 2FHEA 1O7UA 1F2EA 4ACSA 5HFGA 3KJYA 4EDYA 3HVSA 5F07A 1YF0A 2EIOA 2LRNA 5KN3A 5DAKA 2X64A 4MNNA 4P3YB 2L59A 1SYXA 5CREA 4HUAA 4DEJA 4OWYA 1J0FA 4DSQA 2VO4A 2MZCA 4FH8A 12GSA 2LJRA 4HQSA 5IMDA 4AJ8A 1I5GA 1IYHA 3L0HA 2AB6A 4JZQA 3LW9A 3GSTA 3D21A 3L78A 4XS4B 2OKAA 4IP6A 2O89A 1AQXA 3QAGA 4YQMA 1OE8A 1TRWA 2GGTA 2VOCA 5L71A 5C04A 2HYXA 1QGVA 1JZWA 4N11A 3IA1A 2E7PA 2GQLA 2OE0A 4K2DA 2FNOA 3IRAA 2X99A 2R5GA 2AHEA 1XOBA 1EEJA 2YV7A 4LL1B 2DJ0A 3UBLA 3HJOA 3UAPA 22GSA 2H0HA 2C8UA 2V1MA 1KEBA 1S3DA 4MH2A 4O5UA 3IE3A 4GCIA 2CAIA 2LKUA 3FR3A 2PWJA 1EV9A 2X8HA 3ZFLA 4PUFC 2DJ1A 4MMMA 4GQCA 4ECJA 4A5PA 1BEDA 1BYEA 4PX1A 2VM2A 3G9BA 2GVPA 1AW9A 1OAZA 2ZUPA 5IIZA 4K9ZA 5G31A 3D4TA 3A5WA 4CY6A 1OC3A 4EXJA 1M9AA 2DBCA 1XW5A 2KOKA 3KH9A 2F3MA 3KEBA 3TKRA 2MMAA 2GLRA 2X49A 1OC8A 5D9XA 4F03A 3F8UA 1H4OA 2CAQA 3GIXA 3MSZA 2LS5A 5AISA 2LQQA 2P0GA 4IGJA 5ECIB 2WB9A 4EO3A 1JLWA 3HXSA 4F9ZA 1X9WB 3GKXA 1T00A 1W89A 3GH6A 1TU7A 3RPPA 2LQOA 1GLPA 5CNWA 2VCTA 3KTBA 1TW9A 1A2JA 2YZUA 2DJKA 2H6ZA 1F3AA 2IJYA 4I6XA 4E8HA 5A4UA 4K7IA 2FCHA 5IOWA 1B48A 4G19A 3D4MA 3LORA 2XBIA 3M9JA 5ABRA 3EURA 2PBJA 3HJMA 1EP7A 3VURA 4HOJA 2RUFA 2N5FA 2VD1A 2GSTA 2OACA 4JRRA 2HXKA 3F4SA 1SK1A 4O5QA 2E2MA 2CZ3A 5COHA 2I3YA 2LRCA 3APSA 1UVZA 3CRTA 2JACA 3APQA 4RI7A 3QCPA 3UBKA 4PQIA 2B7KA 2YN1A 4YKGA 4L8EA 1M2AA 1YZXA 2DC5A 1ACVA 3LJRA 4IP1A 5DCHA 2DMLA 4JE1A 1A8LA 2O8VB 5DDLA 5DVBA 2G2QA 3N9JA 2L4QA 2OBKA 1M0UA 3L4NA 3LYPA 3A2VA 3EMXA 3Q74A 4WF4A 2VM1A 2JL4A 3HJPA 3VI5A 4TN8A 4GF0A 2PGTA 1JHBA 2HZEB 2HSMA 5ECMB 2OJLA 3QPMA 3ZMKA 1R26A 1M2BA 1QFNA 5ECKB 5F8BA 1WIKA 2DIYA 3U5RE 1R7HA 1X5CA 2MBSA 5ECQB 1ZGNA 3KTLA 2HSYA 2VAFA 1TRUA 2H19A 3HVVA 3DMLA 1QK8A 2C0EA 2GSQA 2R6KA 1XWAA 3TJJA 2H1GA 2L6DA 3UJ1A 4IW9A 1A0RP 3BCKA 1N8JA 4KW6A 4Z2UA 3HVXA 1U87A 4V2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B6M A;  5B8A A;  1OVN A;  1ZYE A;  4MLY A;  3MNG A;  4EVM A;  2V6O A;  5G1L A;  2IMF A;  1XIY A;  2YCD A;  3V1W A;  1T4Z A;  5JCG A;  1BJX A;  1TOF A;  4PNF A;  4DSS B;  4BWS A;  1BAY A;  4KH7 A;  1KBN A;  3GHA A;  2DJ3 A;  5HR3 A;  1WJK A;  4WR5 A;  1PL1 A;  2N5B A;  3NIV A;  4HEA 2;  3M8N A;  3EU3 A;  4MZC A;  5GAN D;  1M7T A;  3C7M A;  2MYG A;  4HJM A;  3GTU B;  4GQF A;  1PX6 A;  1VF2 A;  2B1L A;  2XC2 A;  3M1G A;  5B8B A;  1ML6 A;  2WZ9 A;  4EC0 A;  2IFQ B;  4IJ3 A;  3TJG A;  4JED A;  3F6F A;  2VCZ A;  3C1S A;  3G7J A;  1R5P A;  3P90 A;  16GS A;  3CSH A;  2ON5 A;  1E6B A;  2H6Y A;  4MJA A;  3FK8 A;  3DD3 A;  2LTK A;  3GFK A;  2BMX A;  2K9F A;  3ZVJ A;  3KM6 A;  4I2U A;  5ECH B;  2GT5 A;  5CRH A;  1HD2 A;  4TW5 A;  3D6I A;  1XW6 A;  3KD0 A;  1GSY A;  5B7C A;  2RLI A;  4GST A;  3RBT A;  5J9B A;  1TK5 B;  4ZBD A;  4F82 A;  3R2Q A;  3EVI A;  3LEF A;  4OCE A;  1HQO A;  2VLT A;  2VL2 A;  5E59 A;  2WCI A;  5IM9 A;  5IMC A;  4O32 A;  2F8F A;  1YKC A;  4OO5 A;  3EMP A;  3RHC A;  1G7E A;  2C0G A;  1GTA A;  1TKD B;  2FWH A;  3TRP A;  5GAP D;  3DEX A;  5KN2 A;  8GSS A;  1RK4 A;  4YH2 A;  4TR1 A;  3IOS A;  1W4V A;  3C1R A;  4N0Z A;  2NTO A;  4ZBA A;  5ID2 A;  2WUL A;  4POL A;  3A2X A;  5IO2 A;  3ZLP A;  3TKS A;  4NWY A;  4NV2 A;  2TRX A;  3EU4 A;  4ZXG A;  4FIW A;  2H6X A;  1YKA A;  3UEM A;  1PRX A;  1K0D A;  5D9T A;  3GMF A;  3GL3 A;  1R5A A;  2HRF A;  4EDZ A;  4ECC A;  5CRG A;  2L6C A;  4MPG A;  2KLX A;  3IR4 A;  1CQG A;  1RW1 A;  1U88 A;  2YZH A;  4MF7 A;  3M3M A;  4BL7 A;  3KCM A;  3WD6 A;  3HCZ A;  2O87 A;  1EV4 A;  3AY8 A;  4XS1 A;  3UL3 A;  3LXT A;  4IVF A;  4HZ2 A;  2N5A A;  1ERW A;  3GKK A;  1G6W A;  1GUL A;  3C73 A;  2H01 A;  3ZIT A;  3DVW A;  5ECP B;  1SD8 A;  4MDC A;  5DCG A;  3BJ5 A;  1V57 A;  4D73 A;  1B9Y C;  4PXO A;  1M9B A;  5AGY A;  3GH9 A;  3VK9 A;  3ZRE A;  1OKT A;  3IBH A;  3ZRD A;  1XWK A;  3PGT A;  4XRA A;  1S3C A;  4YAV A;  2IME A;  2FY6 A;  4Q5N A;  7GSS A;  1AXD A;  4L0W A;  1X5D A;  2B1K A;  3DRN A;  4KE3 A;  1BG5 A;  4X43 A;  6GSX A;  3FEU A;  4K0G A;  2LJA A;  4X0X A;  19GS A;  4HU9 A;  1ILO A;  2BJX A;  3H93 A;  1T4Y A;  2C0F A;  1SYR A;  1ON4 A;  1V58 A;  1B4Q A;  1FG4 A;  2IN3 A;  13GS A;  2X8C A;  4AJ6 A;  4CHS A;  2LJK A;  3HDC A;  1UA5 A;  4POB A;  4V1A g;  4H86 A;  4K7O A;  4LMW A;  1A2L A;  4FO5 A;  2YJH A;  5KN0 A;  2YWO A;  1J08 A;  2FLS A;  1TK8 B;  4MH3 A;  1Z5Y E;  3MAK A;  4BWQ A;  4E8E A;  4Q5Q A;  2LRT A;  4BVX A;  4DVC A;  3HZ4 A;  3QDN A;  3KXO A;  2AJQ B;  1K0C A;  4NMU A;  2B5E A;  5H5R A;  1X9M B;  1JZR A;  4TR3 A;  1AIU A;  2PMT A;  5IMA A;  2GQM A;  2IPA A;  4OCF A;  1MD4 A;  3N5O A;  4QL9 A;  1GTI A;  3VPT A;  1F3B A;  1K0M A;  5LD0 A;  2V6K A;  2K8V A;  4GXZ A;  4HZ4 A;  1O73 A;  5ELG A;  3J7Y k;  1T7P B;  1GUH A;  2HNL A;  1A2M A;  5GZZ B;  4TXO A;  1EOG A;  2CZ2 A;  4EE0 A;  1PMT A;  1YF1 A;  4MA9 A;  4FYU A;  3E0U A;  5IMV A;  1O6J A;  4MCU A;  4MPF A;  4PQ1 A;  4LA1 A;  1DUG A;  3I6A A;  3ERG A;  2IMI A;  4KX4 A;  2KUC A;  5HR1 A;  5F05 A;  2L4C A;  4HS1 A;  1F6M C;  1ZL9 A;  1EOH A;  2H0I A;  4I97 A;  5J41 A;  1MDJ A;  2CQ9 A;  2HLS A;  2HZF A;  2O85 A;  4LMV A;  3FR6 A;  3BOA A;  3W8S A;  4IS0 A;  2NBS A;  1FVK A;  4KGI A;  2HZE A;  3RHB A;  5FT3 A;  2CX4 A;  1KTE A;  2L5L A;  1T3B A;  1UN2 A;  3TDG A;  1AUC A;  2R4V A;  5DJL A;  1FAA A;  3W8J A;  1NSW A;  2PUK C;  4YAP A;  4NXI A;  3F3Q A;  5JCW A;  5IQY A;  4F0B A;  1G0T A;  4DSR A;  2FWG A;  1YQ1 A;  1ERU A;  1WOU A;  1PSQ A;  4G2E A;  3CBU A;  5AN1 A;  3IV4 A;  2DJJ A;  1WMJ A;  4PQH A;  3J7Y b;  4IBP A;  4J57 E;  1BQ7 A;  2QSI A;  3C8E A;  1M99 A;  2VL9 A;  5DAL A;  3P2A A;  2WGR A;  2L5O A;  3VLN A;  5J4U A;  3CTF A;  3IK7 A;  6GSY A;  3DWV A;  1ZYQ B;  3UVH A;  4KCE A;  3VI7 A;  2OE3 A;  1GSD A;  2GZY A;  4OD7 A;  1OE7 A;  4RUV A;  1FVJ A;  4RQR A;  4ILF A;  2YJ7 A;  1IYI A;  3G7I A;  2YP6 A;  2NVL A;  1GNE A;  1DSB A;  1PL2 A;  1TDI A;  4WR4 A;  1THO A;  3O3T A;  4PGT A;  3GX8 A;  4O7H A;  4V2N A;  2L57 A;  4MJC A;  2REM A;  1EP8 A;  3APO A;  3D0Z A;  1R4W A;  4V2L A;  4XIH A;  2VCX A;  4F2I A;  1WP0 A;  3I43 A;  1ZCP A;  2CX3 A;  2CVK A;  2JAD A;  4NV5 A;  1LJR A;  5G30 A;  5JWO B;  2MMN A;  1PD2 1;  4ML6 A;  2GT6 A;  4AF2 A;  1ZZY A;  4Q5R A;  4ZB6 A;  4ZIL A;  1GTU A;  1T8E B;  3VFI A;  4EKZ A;  1T1V A;  1MD3 A;  1FOV A;  1USB A;  5E4W A;  3UAR A;  2KHP A;  3CTG A;  4BA7 A;  5CAX A;  3UIW A;  1XPV A;  4O5R A;  2JZT A;  1V40 A;  4I2T A;  1UC7 A;  3RPN A;  3PIN A;  2F51 A;  1B8X A;  3D22 A;  2LNT A;  2P5R A;  5AIV A;  3UMA A;  1XFL A;  2VCV A;  4MP4 A;  2H1B A;  2IL3 A;  4RI6 A;  1K0N A;  3GX0 A;  5B6M A;  4Z7X A;  1Z7P A;  2C0D A;  3H8Q A;  3O6T A;  3CRU A;  2EIR A;  3ZYW A;  4HJ2 A;  2GSS A;  1GL8 A;  5J3R A;  3A2W A;  1N2A A;  1XVQ A;  4L5O A;  2I81 A;  3TOT A;  2HFD A;  3IDV A;  2ALB A;  4K6X A;  2MMZ A;  4KSM A;  5KN1 A;  3FHK A;  5G5F A;  2G0F A;  2B5X A;  1B4P A;  1MTC A;  1SJZ A;  4I8B A;  1B9X C;  3GKM A;  5FWG A;  3JCM L;  2HI7 A;  3WGX A;  2V32 A;  1BX9 A;  3L9U A;  3KZQ A;  3S9F A;  2XPE A;  4IKH A;  1SKR B;  5ECN B;  1AQW A;  5G5E A;  2FA8 A;  2CA8 A;  2GTU A;  3GKN A;  1TRS A;  5D96 A;  3FZ5 A;  2YV9 A;  1YEX A;  4X1U A;  3KP9 A;  3WT1 A;  2R37 A;  2B7J A;  1PA3 A;  2YNX A;  2VLU A;  4ZL7 A;  3LFL A;  4NPB A;  1KNG A;  4JR4 A;  4BVY A;  3HY2 A;  2V41 A;  5D93 A;  4XS6 A;  5ECO B;  18GS A;  1QUW A;  3SBC A;  1X0R A;  2LST A;  4IHU A;  1Q98 A;  1SL2 B;  2H76 A;  1YEP A;  1OYJ A;  4KND A;  5D9W A;  1XCC A;  4OO4 A;  3QD9 A;  2V2G A;  5A4W A;  4K8M A;  3K8N A;  3TRQ A;  2H74 A;  5GST A;  2LV3 A;  5DQY A;  1V98 A;  3CXG A;  3DIE A;  4MZB A;  1HYU A;  1TXX A;  3H1N A;  1PN9 A;  1GSF A;  4EF0 A;  5H5Q A;  3G7Y A;  4ML1 A;  1PKZ A;  3VWV A;  4XRD A;  3P7X A;  4CDO A;  3LWA A;  4XS4 A;  1WRY A;  3DXB A;  2XHF A;  1O8X A;  2I9H A;  3P8W A;  4JBB A;  4ULX A;  3TCO A;  1FB0 A;  5G2Z A;  4AJ7 A;  4WKW A;  1J9B A;  3VWU A;  1ST9 A;  2A2R A;  4HQZ A;  3RDW A;  3IXR A;  1GRX A;  1SK2 A;  1EGO A;  3EYT A;  2TRC P;  4ECB A;  4IJI A;  4PNG A;  3GSS A;  4TVE A;  4J56 E;  5H5S A;  3IPZ A;  5FHI A;  1TI1 A;  1WE0 A;  3FR9 A;  1SJ6 A;  4GWR A;  3ME7 A;  4V1A p;  1A23 A;  3KH7 A;  4K1F A;  1GSE A;  2VCQ A;  4KDX A;  4ZB8 A;  3ZIV A;  1THX A;  2HE3 A;  2JZR A;  4KCA A;  2TIR A;  1G7O A;  1XBS A;  2NPB A;  1OKD A;  2VL2 C;  3UOM A;  1A8Y A;  3ZIJ A;  3QFB C;  4ISD A;  2FGX A;  3TUE A;  4EL1 A;  5HFI A;  1GNW A;  4ZIJ A;  3NZN A;  10GS A;  2FWF A;  5F06 A;  2H71 A;  1K3L A;  3IK9 A;  3TB2 A;  3VWW A;  3LQ7 A;  5A4V A;  2XBQ A;  3QAV A;  2C3T A;  4I5Q A;  3KMO A;  1MDI A;  3CSI A;  2LUS A;  4L0U A;  3TKQ A;  5HR0 A;  1Q4J A;  1TJD A;  2M80 A;  3FYG A;  4TXV A;  4ZBB A;  2O7K A;  1I9D A;  2F8A A;  2VUP A;  1WPI A;  3H4K A;  4ZB9 A;  3TKS C;  2DLX A;  5LCZ A;  3GV1 A;  3F9U A;  1GUM A;  4N0V A;  3QR6 A;  3GL5 A;  3EWL A;  2F9S A;  1EZK A;  1X9S B;  1OC9 B;  1GSQ A;  4IN0 A;  5LNK e;  3UVT A;  4TR1 B;  3F4R A;  1Y25 A;  3IAS 2;  1YDK A;  3KP8 A;  2H0G A;  2ZCT A;  3GUS A;  1A0F A;  3GNJ A;  4G9H A;  4K7N A;  5CRD A;  1C72 A;  5CO3 A;  2I4A A;  4YQU A;  2KP2 A;  5ID2 B;  2VLV A;  4LLR A;  1RQM A;  5J5N A;  3SWL A;  3DGQ A;  4JU5 A;  4GRF A;  2C80 A;  2H8L A;  2B5Y A;  1EEM A;  1YY7 A;  3LSZ A;  3KMN A;  4MAB A;  3PR8 A;  2C3Q A;  4MJB A;  2CVB A;  1WWJ A;  3BBY A;  1DE2 A;  3I9V 2;  3L9S A;  4QQ7 A;  1FO5 A;  1U6T A;  3A3T A;  1HNB A;  4OFM A;  4PUA A;  1TTZ A;  2QC7 A;  5IMF A;  5IO0 A;  2Z9S A;  1GP1 A;  3GRX A;  2AYT A;  2GSR A;  1TRV A;  5IMZ A;  1Y6E A;  4D73 B;  3FRC A;  3TJF A;  2HRN A;  3FZA A;  4AGS A;  3EC3 A;  3TJK A;  2J9H A;  2KP1 A;  1VRS D;  3Q19 A;  3EIN A;  1VF3 A;  5DAK B;  2H66 A;  1K0A A;  3ERW A;  1AAZ A;  3DYR A;  3U6V A;  3Q18 A;  2VIM A;  4TR0 A;  5INY A;  1ABA A;  5IOX A;  4QL7 A;  3CYN A;  1Z9H A;  5HFK A;  5GSS A;  2P5Q A;  2RM6 A;  2QGV A;  1GSS A;  1CQH A;  2WFC A;  4MK3 A;  3MWH A;  4IQ1 A;  5CP1 A;  2PVO C;  1XWC A;  2WS2 A;  3FZ4 A;  3E9J B;  2GS3 A;  3F4T A;  3MDK A;  1XW9 A;  1ZOF A;  2H1A A;  4WET A;  3PH9 A;  3HA9 A;  2IMK A;  4MF5 A;  2H73 A;  3FKF A;  1ERV A;  5HQP A;  5ECR B;  3WYW A;  1V9W A;  2OBI A;  4N10 A;  1NHO A;  5IPG A;  3KIJ A;  1JLV A;  1Z6N A;  2M72 A;  5IPH A;  4OMV A;  2BTO T;  1Z6M A;  4OFN A;  2A2S A;  1DE1 A;  4DSS A;  5EPF A;  2LNS A;  1SL0 B;  2H30 A;  3GN3 A;  4WF5 A;  3ERF A;  2DMM A;  2OE1 A;  4YQV A;  1XVW A;  4TXO B;  2R3X A;  1SEN A;  3IAM 2;  3OR5 A;  3KGK A;  1HNA A;  3GTU A;  20GS A;  9GSS A;  1PX7 A;  4ZL9 A;  3TGZ A;  4HU7 A;  4GTU A;  3DVX A;  1O85 A;  1FW1 A;  4F0C A;  2GQK A;  3F0I A;  1FB6 A;  2QKE A;  4FYB A;  2IFQ A;  1XOA A;  3GYK A;  3ME8 A;  1JZD A;  4KAE A;  2IWT A;  1DBY A;  2YWI A;  2RM5 A;  5JWR B;  4BPY A;  6GSU A;  4G10 A;  1XZO A;  1Z3E A;  2EC4 A;  3ZML A;  4KUN A;  14GS A;  2FA4 A;  1H75 A;  2PER A;  2PU9 C;  1U3A A;  4GLT A;  3TOU A;  2H70 A;  5DBQ A;  2JSY A;  3RAZ A;  1AQV A;  1M2D A;  3L9V A;  3HYP A;  5ELA A;  4TKY A;  5ECL B;  2CVD A;  3ZTL A;  2PPT A;  1GSU A;  2C1Y A;  2OA7 A;  1GH2 A;  5AIX A;  3QOU A;  1YJ6 A;  1NM3 A;  2P31 A;  5EL8 A;  2FWE A;  6GSV A;  2CT6 A;  1GTB A;  2YWM A;  3LYK A;  3M0F A;  5DJM A;  1GUK A;  5A5K A;  2AAW A;  3LXZ A;  3ZZX A;  4WBJ A;  1SKW B;  4ECI A;  4JR6 A;  4O92 A;  3IC4 A;  4HDE A;  11GS A;  4PUR A;  5EY6 A;  5CYY A;  1F9M A;  5KEJ A;  2AV4 A;  4GSS A;  3O76 A;  3F6D A;  4XCS A;  1SK0 A;  4MF6 A;  5EVO A;  2C3N A;  2R2J A;  5DAL B;  1PKW A;  4IQA A;  2DSA A;  4NAX A;  4J2F A;  4POK A;  1XWG A;  2FUG 2;  4KA0 A;  2IMD A;  3F3R A;  1TP9 A;  4FYC A;  2JSZ A;  4TOP A;  4L5L A;  3VPQ A;  1FHE A;  3FW2 A;  3WGD A;  1S3A A;  1QQ2 A;  4MJE A;  4ID0 A;  2I1U A;  3QMX A;  6GSW A;  4WXT A;  3HZ8 A;  3FY7 A;  2A4V A;  1PGT A;  3ZVJ D;  5JWQ B;  5B6N A;  1G6Y A;  2FD3 A;  6GSS A;  2K6V A;  3QAW A;  3Q6O A;  4RQX A;  1NHY A;  1A24 A;  1VF1 A;  2YAN A;  3EE2 A;  1V2A A;  4K0N A;  3CMI A;  1O8W A;  2DIZ A;  2AUV A;  4KDU A;  2C4J A;  1PQN A;  4LL4 B;  2YWN A;  4KDY A;  5ECS A;  4NHW A;  3ZFB A;  2E2G A;  3NOF A;  1XWB A;  2D2Z A;  3C71 A;  2HSH A;  2EIQ A;  3TJB A;  4XHM A;  3VWX A;  2JU5 A;  1MEK A;  3GA4 A;  2VCW A;  3WT2 A;  1O81 A;  2VL3 A;  1LBK A;  2VD0 A;  3ED3 A;  5HR2 A;  3FZ9 A;  4IEL A;  2B3S A;  2GZZ A;  3LGC A;  4XTS A;  1EWX A;  3HKR A;  3E3E A;  3TKS E;  2PN8 A;  1QXH A;  2RII A;  2LEG A;  2DJ2 A;  4WEY A;  3TKP A;  1NW2 A;  2HT9 A;  4GSN A;  2MBT A;  3WGE A;  1HNC A;  1VF4 A;  1SD9 A;  1SL1 B;  1SU9 A;  5ENU A;  1VGL A;  4KSO A;  1U3I A;  1OC9 A;  2CV4 A;  4CW9 A;  1URM A;  2H72 A;  2ES7 A;  2K18 A;  5F0G A;  3QFA C;  1X5E A;  3CSJ A;  3ZL5 A;  1F37 A;  4POM A;  5C00 A;  1TI3 A;  1E2Y A;  3H79 A;  2OAD A;  2H1D A;  1TU8 A;  5D73 A;  4NHZ A;  3HD5 A;  4N30 A;  2ZNM A;  1LU4 A;  4Q5F A;  3ISO A;  2K8S A;  1ERT A;  6GST A;  2XPD A;  2YOI A;  3M9K A;  2H75 A;  3D5J A;  2E0Q A;  1AC1 A;  5CRW A;  3BD2 A;  3BCI A;  3F63 A;  4WBR D;  1K0O A;  2X8G A;  17GS A;  3US3 A;  2WJU A;  2NDO A;  5D8I A;  2M46 A;  4MZW A;  1SKS B;  2ON7 A;  3I69 A;  5J9C A;  3DKS A;  1GWC A;  2MMO A;  5G1K A;  1K0B A;  1MDK A;  1SJI A;  2WRT A;  4OFT A;  4EUY A;  4TR4 A;  1ZMA A;  1QMV A;  2J23 A;  2JZS A;  3TRX A;  1K3O A;  2RUE A;  1XXU A;  1K3Y A;  3HHV A;  1GLQ A;  4ZL8 A;  2PVQ A;  1JZO A;  2GZP A;  4TRX A;  1TK0 B;  3IHQ A;  2WDU A;  2IIY A;  2YPM A;  3W6G A;  4KB3 A;  1EGR A;  1JFU A;  5JCU A;  1Z7R A;  4HI7 A;  3LG6 A;  5DQS A;  2GDR A;  5D9V A;  3GUR A;  2FHE A;  1O7U A;  1F2E A;  4ACS A;  5HFG A;  3KJY A;  4EDY A;  3HVS A;  5F07 A;  1YF0 A;  2EIO A;  2LRN A;  5KN3 A;  5DAK A;  2X64 A;  4P3Y B;  2L59 A;  1SYX A;  5CRE A;  4HUA A;  4DEJ A;  4OWY A;  1J0F A;  4DSQ A;  2VO4 A;  2MZC A;  4FH8 A;  12GS A;  2LJR A;  4HQS A;  5IMD A;  4AJ8 A;  1I5G A;  1IYH A;  3L0H A;  2AB6 A;  4JZQ A;  4XS4 B;  3GST A;  3D21 A;  3L78 A;  2OKA A;  4IP6 A;  2O89 A;  1AQX A;  3QAG A;  4YQM A;  1OE8 A;  1TRW A;  2GGT A;  2VOC A;  5L71 A;  5C04 A;  2HYX A;  1QGV A;  1JZW A;  4N11 A;  3IA1 A;  2E7P A;  2GQL A;  2OE0 A;  4K2D A;  2FNO A;  3IRA A;  2X99 A;  2R5G A;  2AHE A;  1XOB A;  1EEJ A;  2YV7 A;  4LL1 B;  2DJ0 A;  3UBL A;  3HJO A;  3UAP A;  22GS A;  2H0H A;  2C8U A;  2V1M A;  1KEB A;  1S3D A;  4MH2 A;  3IE3 A;  4GCI A;  2CAI A;  2LKU A;  3FR3 A;  2PWJ A;  1EV9 A;  2X8H A;  3ZFL A;  4PUF C;  2DJ1 A;  4MMM A;  4GQC A;  4ECJ A;  1BED A;  1BYE A;  4PX1 A;  2VM2 A;  3G9B A;  2GVP A;  1AW9 A;  1OAZ A;  2ZUP A;  5IIZ A;  4K9Z A;  5G31 A;  3D4T A;  3A5W A;  1OC3 A;  4EXJ A;  1M9A A;  2DBC A;  1XW5 A;  2KOK A;  3KH9 A;  2F3M A;  3KEB A;  3TKR A;  2MMA A;  2GLR A;  5D9X A;  1OC8 A;  4F03 A;  3F8U A;  1H4O A;  2CAQ A;  3GIX A;  3MSZ A;  2LS5 A;  5AIS A;  2LQQ A;  2P0G A;  4IGJ A;  5ECI B;  2WB9 A;  4EO3 A;  1JLW A;  3HXS A;  4F9Z A;  1X9W B;  3GKX A;  1T00 A;  1W89 A;  3GH6 A;  1TU7 A;  3RPP A;  2LQO A;  1GLP A;  5CNW A;  2VCT A;  3KTB A;  1TW9 A;  1A2J A;  2YZU A;  2DJK A;  2H6Z A;  1F3A A;  2IJY A;  4I6X A;  4E8H A;  5A4U A;  4K7I A;  2FCH A;  5IOW A;  1B48 A;  4G19 A;  3D4M A;  3LOR A;  2XBI A;  3M9J A;  5ABR A;  3EUR A;  2PBJ A;  3HJM A;  1EP7 A;  3VUR A;  4HOJ A;  2RUF A;  2N5F A;  2VD1 A;  2GST A;  2OAC A;  4JRR A;  2HXK A;  3F4S A;  1SK1 A;  2E2M A;  2CZ3 A;  5COH A;  2I3Y A;  2LRC A;  3APS A;  1UVZ A;  3CRT A;  2JAC A;  3APQ A;  4RI7 A;  3QCP A;  3UBK A;  4PQI A;  2B7K A;  2YN1 A;  4L8E A;  1M2A A;  1YZX A;  2DC5 A;  5DCH A;  1ACV A;  3LJR A;  4IP1 A;  2DML A;  4JE1 A;  1A8L A;  2O8V B;  5DDL A;  5DVB A;  2G2Q A;  3N9J A;  2L4Q A;  2OBK A;  1M0U A;  3L4N A;  3LYP A;  3A2V A;  3EMX A;  3Q74 A;  4WF4 A;  2VM1 A;  2JL4 A;  3HJP A;  3VI5 A;  4TN8 A;  4GF0 A;  2PGT A;  1JHB A;  2HZE B;  5ECM B;  2OJL A;  3QPM A;  3ZMK A;  1R26 A;  1M2B A;  1QFN A;  5ECK B;  5F8B A;  1WIK A;  2DIY A;  3U5R E;  1R7H A;  1X5C A;  2MBS A;  5ECQ B;  1ZGN A;  3KTL A;  2HSY A;  2VAF A;  1TRU A;  2H19 A;  3HVV A;  3DML A;  1QK8 A;  2C0E A;  2GSQ A;  2R6K A;  1XWA A;  3TJJ A;  2H1G A;  2L6D A;  3UJ1 A;  4IW9 A;  1A0R P;  3BCK A;  1N8J A;  4KW6 A;  3HVX A;  1U87 A;  4V2M A; 
#chains in the Genus database with same CATH topology
 2B6M A;  5B8A A;  1OVN A;  1M3I A;  1ZYE A;  4MLY A;  3MNG A;  4EVM A;  4K2X A;  2V6O A;  5G1L A;  2IMF A;  1XIY A;  2YCD A;  3V1W A;  1T4Z A;  5JCG A;  1BJX A;  1TOF A;  4PNF A;  4DSS B;  4BWS A;  1BAY A;  4KH7 A;  1KBN A;  3GHA A;  2DJ3 A;  5HR3 A;  1WJK A;  4WR5 A;  1PL1 A;  2N5B A;  3NIV A;  4HEA 2;  3M8N A;  3EU3 A;  4MZC A;  5GAN D;  1M7T A;  3C7M A;  2MYG A;  4HJM A;  3GTU B;  4GQF A;  1PX6 A;  1VF2 A;  5BMU A;  2B1L A;  2XC2 A;  3M1G A;  5B8B A;  1ML6 A;  2WZ9 A;  4EC0 A;  2IFQ B;  4IJ3 A;  3TJG A;  4JED A;  3F6F A;  2VCZ A;  3C1S A;  3G7J A;  1R5P A;  3P90 A;  16GS A;  3CSH A;  2ON5 A;  1E6B A;  2H6Y A;  4MJA A;  3FK8 A;  3DD3 A;  2LTK A;  3GFK A;  2BMX A;  2K9F A;  3ZVJ A;  3KM6 A;  4I2U A;  5ECH B;  2GT5 A;  5CRH A;  1HD2 A;  4TW5 A;  3D6I A;  1XW6 A;  3KD0 A;  1GSY A;  5B7C A;  2RLI A;  4GST A;  3RBT A;  5J9B A;  1TK5 B;  4ZBD A;  4F82 A;  3R2Q A;  3EVI A;  3LEF A;  4OCE A;  1HQO A;  2VLT A;  2VL2 A;  5E59 A;  2WCI A;  5IM9 A;  5IMC A;  4O32 A;  2F8F A;  1YKC A;  4OO5 A;  2A4H A;  3EMP A;  3RHC A;  1G7E A;  2C0G A;  1GTA A;  1TKD B;  2FWH A;  3TRP A;  5GAP D;  3DEX A;  5KN2 A;  8GSS A;  1RK4 A;  4YH2 A;  4TR1 A;  3IOS A;  1W4V A;  3C1R A;  4N0Z A;  2NTO A;  4ZBA A;  5ID2 A;  2WUL A;  4POL A;  3A2X A;  5IO2 A;  3ZLP A;  3TKS A;  4NWY A;  4NV2 A;  2TRX A;  3EU4 A;  4ZXG A;  4FIW A;  2H6X A;  1YKA A;  3UEM A;  1PRX A;  1K0D A;  4FQU A;  5D9T A;  3GMF A;  3GL3 A;  1R5A A;  2HRF A;  4EDZ A;  4ECC A;  5CRG A;  2L6C A;  4MPG A;  2KLX A;  3IR4 A;  1CQG A;  1RW1 A;  1U88 A;  2YZH A;  4MF7 A;  3M3M A;  4BL7 A;  3KCM A;  3WD6 A;  3HCZ A;  2O87 A;  1EV4 A;  3AY8 A;  4XS1 A;  3UL3 A;  3LXT A;  4IVF A;  4HZ2 A;  2N5A A;  1ERW A;  3GKK A;  1G6W A;  1GUL A;  3C73 A;  2H01 A;  3ZIT A;  3DVW A;  5ECP B;  1SD8 A;  4BVY B;  4MDC A;  5DCG A;  3BJ5 A;  1V57 A;  4D73 A;  1B9Y C;  4PXO A;  1M9B A;  5AGY A;  3GH9 A;  3VK9 A;  3ZRE A;  1OKT A;  3IBH A;  3ZRD A;  1XWK A;  3PGT A;  4XRA A;  1S3C A;  4YAV A;  2IME A;  2FY6 A;  4Q5N A;  7GSS A;  1AXD A;  4L0W A;  1X5D A;  2B1K A;  3DRN A;  4KE3 A;  1BG5 A;  4X43 A;  2DKH A;  6GSX A;  3FEU A;  4K0G A;  2LJA A;  4X0X A;  19GS A;  4HU9 A;  1ILO A;  2BJX A;  3H93 A;  1T4Y A;  2C0F A;  1SYR A;  1ON4 A;  1V58 A;  1B4Q A;  1FG4 A;  2IN3 A;  13GS A;  2X8C A;  2R0G A;  4AJ6 A;  4CHS A;  2LJK A;  3HDC A;  1UA5 A;  4POB A;  4V1A g;  4H86 A;  4K7O A;  4LMW A;  1A2L A;  4FO5 A;  2YJH A;  5KN0 A;  2YWO A;  1J08 A;  2FLS A;  1TK8 B;  4MH3 A;  1Z5Y E;  4X4J A;  3MAK A;  4BWQ A;  4E8E A;  4Q5Q A;  2LRT A;  4BVX A;  4DVC A;  3HZ4 A;  3QDN A;  3KXO A;  2AJQ B;  1K0C A;  4NMU A;  2B5E A;  4EIP A;  5H5R A;  1X9M B;  1JZR A;  4TR3 A;  1AIU A;  2PMT A;  5IMA A;  2GQM A;  2IPA A;  4OCF A;  1MD4 A;  3N5O A;  4QL9 A;  1GTI A;  3VPT A;  1F3B A;  1K0M A;  5LD0 A;  2V6K A;  2K8V A;  4GXZ A;  4HZ4 A;  1O73 A;  5ELG A;  3J7Y k;  1T7P B;  1GUH A;  2HNL A;  1A2M A;  5GZZ B;  4TXO A;  1EOG A;  2CZ2 A;  4EE0 A;  1PMT A;  1YF1 A;  4MA9 A;  4FYU A;  3E0U A;  5IMV A;  1O6J A;  4MCU A;  4MPF A;  4PQ1 A;  4LA1 A;  1DUG A;  3I6A A;  3ERG A;  2IMI A;  4KX4 A;  2KUC A;  5HR1 A;  5F05 A;  2L4C A;  4HS1 A;  1F6M C;  1ZL9 A;  1EOH A;  2H0I A;  4I97 A;  5J41 A;  1MDJ A;  2CQ9 A;  2HLS A;  2HZF A;  2O85 A;  4LMV A;  3FR6 A;  3BOA A;  3W8S A;  1PN0 A;  4IS0 A;  2NBS A;  1FVK A;  4KGI A;  2HZE A;  3RHB A;  5FT3 A;  2CX4 A;  1KTE A;  2L5L A;  1T3B A;  1UN2 A;  2R0C A;  3TDG A;  2QA2 A;  1AUC A;  2R4V A;  5DJL A;  1FAA A;  3W8J A;  1NSW A;  2PUK C;  4YAP A;  4NXI A;  3F3Q A;  5JCW A;  5IQY A;  4F0B A;  1G0T A;  4DSR A;  2FWG A;  1YQ1 A;  1ERU A;  1WOU A;  1PSQ A;  4G2E A;  3CBU A;  5AN1 A;  3IV4 A;  2DJJ A;  2QA1 A;  1WMJ A;  4PQH A;  3J7Y b;  4IBP A;  4J57 E;  1BQ7 A;  2QSI A;  3C8E A;  1M99 A;  2VL9 A;  5DAL A;  3P2A A;  2WGR A;  2L5O A;  3VLN A;  5J4U A;  3CTF A;  3IK7 A;  6GSY A;  3DWV A;  1ZYQ B;  3UVH A;  4KCE A;  3VI7 A;  2OE3 A;  1GSD A;  2GZY A;  1ZYP A;  4OD7 A;  1OE7 A;  4RUV A;  1FVJ A;  4RQR A;  4ILF A;  2YJ7 A;  1IYI A;  3G7I A;  2YP6 A;  2NVL A;  1GNE A;  1DSB A;  1PL2 A;  1TDI A;  4WR4 A;  4BIK A;  1THO A;  3O3T A;  4PGT A;  3GX8 A;  4O7H A;  4V2N A;  2L57 A;  4MJC A;  2REM A;  1EP8 A;  3APO A;  3D0Z A;  1R4W A;  4V2L A;  4XIH A;  4ICY A;  2VCX A;  4F2I A;  1WP0 A;  3I43 A;  1ZCP A;  2CX3 A;  2CVK A;  2JAD A;  4NV5 A;  1LJR A;  5G30 A;  5JWO B;  2MMN A;  3IHG A;  1PD2 1;  4ML6 A;  2GT6 A;  4AF2 A;  1ZZY A;  4Q5R A;  4ZB6 A;  4ZIL A;  1GTU A;  1T8E B;  3VFI A;  4EKZ A;  1T1V A;  1MD3 A;  1FOV A;  1USB A;  5E4W A;  3UAR A;  4G0K A;  2KHP A;  3CTG A;  4BA7 A;  5CAX A;  3UIW A;  1XPV A;  4O5R A;  2JZT A;  1V40 A;  4I2T A;  1UC7 A;  3RPN A;  3PIN A;  2F51 A;  1B8X A;  2HRA A;  3D22 A;  2LNT A;  2P5R A;  5KOW A;  1XG8 A;  5AIV A;  3UMA A;  1XFL A;  2VCV A;  4MP4 A;  2H1B A;  4KF9 A;  2IL3 A;  4RI6 A;  1K0N A;  3GX0 A;  5B6M A;  4Z7X A;  1Z7P A;  2C0D A;  3PPU A;  3H8Q A;  3O6T A;  3CRU A;  2EIR A;  3ZYW A;  4HJ2 A;  2GSS A;  1GL8 A;  5J3R A;  3A2W A;  1N2A A;  1XVQ A;  4L5O A;  2I81 A;  3TOT A;  2HFD A;  3IDV A;  2ALB A;  4K6X A;  2MMZ A;  4KSM A;  5KN1 A;  3FHK A;  5G5F A;  2G0F A;  2B5X A;  1B4P A;  1MTC A;  1SJZ A;  4I8B A;  1B9X C;  3GKM A;  5FWG A;  3JCM L;  2HI7 A;  3WGX A;  2V32 A;  1BX9 A;  3L9U A;  3KZQ A;  3S9F A;  2XPE A;  4IKH A;  1SKR B;  5ECN B;  1AQW A;  5G5E A;  2FA8 A;  2CA8 A;  2GTU A;  3GKN A;  1TRS A;  5D96 A;  3FZ5 A;  2YV9 A;  1YEX A;  4X1U A;  3KP9 A;  3WT1 A;  2R37 A;  2B7J A;  1PA3 A;  3FMW A;  2YNX A;  2VLU A;  4ZL7 A;  3LFL A;  4NPB A;  1KNG A;  4JR4 A;  4BVY A;  3HY2 A;  2V41 A;  5D93 A;  4XS6 A;  5ECO B;  18GS A;  1QUW A;  3SBC A;  1X0R A;  2LST A;  4IHU A;  1Q98 A;  1SL2 B;  2H76 A;  4CY8 A;  1YEP A;  1OYJ A;  3A5I A;  4KND A;  5D9W A;  1XCC A;  4OO4 A;  3QD9 A;  2V2G A;  5A4W A;  4K8M A;  3K8N A;  3TRQ A;  2H74 A;  5GST A;  2LV3 A;  5DQY A;  1V98 A;  3CXG A;  3DIE A;  4MZB A;  1HYU A;  1TXX A;  3H1N A;  1PN9 A;  1GSF A;  4EF0 A;  5H5Q A;  3G7Y A;  4ML1 A;  1PKZ A;  3VWV A;  4XRD A;  3P7X A;  4CDO A;  3LWA A;  4XS4 A;  1WRY A;  3DXB A;  2XHF A;  1O8X A;  2I9H A;  3P8W A;  4JBB A;  4ULX A;  3TCO A;  1FB0 A;  5G2Z A;  4AJ7 A;  4USS A;  4WKW A;  1J9B A;  3VWU A;  1ST9 A;  2A2R A;  4HQZ A;  3RDW A;  3IXR A;  1GRX A;  1SK2 A;  1EGO A;  3EYT A;  2TRC P;  4ECB A;  4IJI A;  4EIQ A;  4PNG A;  3GSS A;  4TVE A;  4J56 E;  5H5S A;  3IPZ A;  5FHI A;  1TI1 A;  1WE0 A;  3FR9 A;  1SJ6 A;  4GWR A;  3ME7 A;  2HRK A;  4V1A p;  1A23 A;  3KH7 A;  4K1F A;  1GSE A;  2R0P A;  2VCQ A;  4KDX A;  4ZB8 A;  3ZIV A;  1THX A;  2HE3 A;  2JZR A;  4KCA A;  2TIR A;  1G7O A;  1XBS A;  2NPB A;  1OKD A;  2VL2 C;  3UOM A;  1A8Y A;  3ZIJ A;  3QFB C;  4ISD A;  2FGX A;  3TUE A;  4EL1 A;  5HFI A;  1GNW A;  4ZIJ A;  3NZN A;  10GS A;  2FWF A;  5F06 A;  2H71 A;  1K3L A;  3IK9 A;  3TB2 A;  3VWW A;  3LQ7 A;  5A4V A;  2XBQ A;  3QAV A;  2C3T A;  4I5Q A;  3KMO A;  1MDI A;  3CSI A;  2LUS A;  4L0U A;  3TKQ A;  5HR0 A;  1Q4J A;  1TJD A;  2M80 A;  3FYG A;  4TXV A;  4ZBB A;  2O7K A;  1I9D A;  2F8A A;  2VUP A;  1WPI A;  3H4K A;  4ZB9 A;  3TKS C;  2DLX A;  5LCZ A;  3GV1 A;  3F9U A;  1GUM A;  4N0V A;  3QR6 A;  3GL5 A;  3EWL A;  2F9S A;  1EZK A;  1X9S B;  1OC9 B;  1GSQ A;  4IN0 A;  5LNK e;  3UVT A;  4TR1 B;  3F4R A;  1Y25 A;  3IAS 2;  1YDK A;  3KP8 A;  2H0G A;  2ZCT A;  3GUS A;  1A0F A;  2UZ8 A;  3GNJ A;  4G9H A;  4K7N A;  5CRD A;  1C72 A;  5CO3 A;  2I4A A;  4YQU A;  2KP2 A;  5ID2 B;  4HSC X;  2VLV A;  4LLR A;  1RQM A;  3HVN A;  5J5N A;  3SWL A;  3DGQ A;  4JU5 A;  4GRF A;  2C80 A;  2H8L A;  2B5Y A;  1EEM A;  4K5S A;  1YY7 A;  3LSZ A;  3KMN A;  4MAB A;  3PR8 A;  2C3Q A;  4MJB A;  2CVB A;  1WWJ A;  3CQF A;  3BBY A;  1DE2 A;  3I9V 2;  3L9S A;  4QQ7 A;  1FO5 A;  4BL7 B;  1U6T A;  3A3T A;  1HNB A;  4OFM A;  4PUA A;  1TTZ A;  2QC7 A;  5IMF A;  5IO0 A;  2Z9S A;  1GP1 A;  3GRX A;  2AYT A;  2GSR A;  1TRV A;  5IMZ A;  1Y6E A;  1S3R A;  4D73 B;  3FRC A;  3TJF A;  2HRN A;  3FZA A;  4AGS A;  3EC3 A;  3TJK A;  2J9H A;  2KP1 A;  1VRS D;  3Q19 A;  3EIN A;  1VF3 A;  5DAK B;  2H66 A;  1K0A A;  3ERW A;  1AAZ A;  3DYR A;  3U6V A;  3Q18 A;  2VIM A;  4TR0 A;  5INY A;  4PTS A;  1ABA A;  5IOX A;  2DKI A;  4QL7 A;  3CYN A;  1Z9H A;  5HFK A;  5GSS A;  2P5Q A;  2RM6 A;  2QGV A;  1GSS A;  1CQH A;  2WFC A;  4MK3 A;  3MWH A;  4IQ1 A;  5CP1 A;  2PVO C;  1XWC A;  2WS2 A;  3FZ4 A;  3E9J B;  2GS3 A;  3F4T A;  3MDK A;  1XW9 A;  1ZOF A;  2H1A A;  1PFO A;  4WET A;  3PH9 A;  3HA9 A;  2IMK A;  4MF5 A;  2H73 A;  3FKF A;  4BVX B;  1ERV A;  5HQP A;  5ECR B;  3WYW A;  1V9W A;  2OBI A;  4N10 A;  1NHO A;  5IPG A;  3KIJ A;  1JLV A;  1Z6N A;  2M72 A;  5IPH A;  4OMV A;  2BTO T;  1Z6M A;  3IC8 A;  4G0L A;  4OFN A;  2A2S A;  1DE1 A;  4DSS A;  5EPF A;  2LNS A;  1SL0 B;  2H30 A;  3GN3 A;  4WF5 A;  3ERF A;  2DMM A;  2OE1 A;  4YQV A;  1XVW A;  4TXO B;  2R3X A;  1SEN A;  3IAM 2;  3OR5 A;  3KGK A;  1HNA A;  3GTU A;  20GS A;  9GSS A;  1PX7 A;  4ZL9 A;  3TGZ A;  4HU7 A;  4GTU A;  3DVX A;  1O85 A;  1FW1 A;  4F0C A;  2GQK A;  3F0I A;  1FB6 A;  2QKE A;  4FYB A;  2IFQ A;  1XOA A;  3GYK A;  3ME8 A;  1JZD A;  4KAE A;  2IWT A;  1DBY A;  2YWI A;  2RM5 A;  5JWR B;  4BPY A;  6GSU A;  4G10 A;  1XZO A;  1Z3E A;  2EC4 A;  3ZML A;  4KUN A;  14GS A;  2FA4 A;  1H75 A;  2PER A;  2PU9 C;  1U3A A;  4GLT A;  3TOU A;  2H70 A;  5DBQ A;  2JSY A;  3RAZ A;  1AQV A;  1M2D A;  3L9V A;  3HYP A;  5ELA A;  4TKY A;  5ECL B;  1FOH A;  2CVD A;  3ZTL A;  2PPT A;  1GSU A;  2C1Y A;  2OA7 A;  1GH2 A;  5AIX A;  3QOU A;  1YJ6 A;  1NM3 A;  2P31 A;  5EL8 A;  2FWE A;  6GSV A;  2CT6 A;  1M3J A;  1GTB A;  2YWM A;  3LYK A;  3M0F A;  5DJM A;  1GUK A;  5A5K A;  2AAW A;  3LXZ A;  3ZZX A;  4WBJ A;  5BRT A;  1SKW B;  4ECI A;  4K5R A;  4JR6 A;  4O92 A;  3IC4 A;  4HDE A;  11GS A;  4PUR A;  4G0I A;  1F9M A;  5CYY A;  5EY6 A;  5KEJ A;  2AV4 A;  4GSS A;  3O76 A;  3F6D A;  4XCS A;  1SK0 A;  4MF6 A;  5EVO A;  2C3N A;  2R2J A;  5DAL B;  1PKW A;  4IQA A;  2DSA A;  4NAX A;  4J2F A;  4POK A;  1XWG A;  2FUG 2;  4KA0 A;  2IMD A;  3F3R A;  1TP9 A;  4FYC A;  2JSZ A;  4TOP A;  4L5L A;  3VPQ A;  1FHE A;  3FW2 A;  1ZYN A;  3WGD A;  1S3A A;  1QQ2 A;  4Z2T A;  4MJE A;  4ID0 A;  2I1U A;  3QMX A;  6GSW A;  4WXT A;  3HZ8 A;  3FY7 A;  2A4V A;  1PGT A;  3ZVJ D;  5JWQ B;  5B6N A;  1G6Y A;  2FD3 A;  6GSS A;  2K6V A;  3QAW A;  3Q6O A;  4RQX A;  1NHY A;  1A24 A;  1VF1 A;  2YAN A;  3EE2 A;  1V2A A;  4K0N A;  3CMI A;  1O8W A;  2DIZ A;  2AUV A;  3R3E A;  4KDU A;  2C4J A;  1PQN A;  4LL4 B;  2YWN A;  4KDY A;  5ECS A;  4NHW A;  3ZFB A;  2E2G A;  3NOF A;  1XWB A;  2D2Z A;  3C71 A;  2HSH A;  2EIQ A;  3TJB A;  4XHM A;  3VWX A;  2JU5 A;  1MEK A;  3GA4 A;  2VCW A;  3WT2 A;  1O81 A;  2VL3 A;  1LBK A;  2VD0 A;  3ED3 A;  5HR2 A;  3FZ9 A;  4IEL A;  2B3S A;  2GZZ A;  3LGC A;  4XTS A;  1EWX A;  3HKR A;  3E3E A;  3TKS E;  2PN8 A;  1QXH A;  2RII A;  2LEG A;  2DJ2 A;  4WEY A;  3TKP A;  5KOX A;  1NW2 A;  2HT9 A;  4GSN A;  2MBT A;  3WGE A;  1HNC A;  1VF4 A;  1SD9 A;  1SL1 B;  1SU9 A;  5ENU A;  1VGL A;  4KSO A;  1U3I A;  3MYD A;  1OC9 A;  4Z2R A;  2CV4 A;  4CW9 A;  1URM A;  2H72 A;  2ES7 A;  2K18 A;  5F0G A;  3QFA C;  1X5E A;  3CSJ A;  3ZL5 A;  1F37 A;  4POM A;  5C00 A;  1TI3 A;  1E2Y A;  3H79 A;  2OAD A;  2H1D A;  1TU8 A;  5D73 A;  4NHZ A;  3HD5 A;  4N30 A;  2ZNM A;  1LU4 A;  4Q5F A;  3ISO A;  2K8S A;  1ERT A;  6GST A;  2XPD A;  2YOI A;  3M9K A;  2H75 A;  3D5J A;  2E0Q A;  1AC1 A;  5CRW A;  3BD2 A;  3BCI A;  3F63 A;  4WBR D;  1K0O A;  2X8G A;  17GS A;  3US3 A;  2WJU A;  2NDO A;  2M46 A;  5D8I A;  4MZW A;  1SKS B;  2ON7 A;  3I69 A;  5J9C A;  3DKS A;  1GWC A;  2MMO A;  5G1K A;  1K0B A;  1MDK A;  1SJI A;  2WRT A;  4OFT A;  4EUY A;  4TR4 A;  1ZMA A;  1QMV A;  3MIX A;  2J23 A;  2JZS A;  3EPT A;  4YKF A;  3TRX A;  1K3O A;  2RUE A;  1XXU A;  1K3Y A;  3HHV A;  1GLQ A;  4ZL8 A;  2PVQ A;  1JZO A;  2GZP A;  4TRX A;  1TK0 B;  2X4A A;  3IHQ A;  2WDU A;  2IIY A;  2YPM A;  3W6G A;  4KB3 A;  1EGR A;  2A2P A;  1JFU A;  5JCU A;  1Z7R A;  4HI7 A;  3LG6 A;  5DQS A;  2GDR A;  5D9V A;  3GUR A;  2FHE A;  1O7U A;  1F2E A;  4ACS A;  5HFG A;  3KJY A;  4EDY A;  3HVS A;  5F07 A;  1YF0 A;  2EIO A;  2LRN A;  5KN3 A;  5DAK A;  2X64 A;  4MNN A;  4P3Y B;  2L59 A;  1SYX A;  5CRE A;  4HUA A;  4DEJ A;  4OWY A;  1J0F A;  4DSQ A;  2VO4 A;  2MZC A;  4FH8 A;  12GS A;  2LJR A;  4HQS A;  5IMD A;  4AJ8 A;  1I5G A;  1IYH A;  3L0H A;  2AB6 A;  4JZQ A;  3LW9 A;  3GST A;  3D21 A;  3L78 A;  4XS4 B;  2OKA A;  4IP6 A;  2O89 A;  1AQX A;  3QAG A;  4YQM A;  1OE8 A;  1TRW A;  2GGT A;  2VOC A;  5L71 A;  5C04 A;  2HYX A;  1QGV A;  1JZW A;  4N11 A;  3IA1 A;  2E7P A;  2GQL A;  2OE0 A;  4K2D A;  2FNO A;  3IRA A;  2X99 A;  2R5G A;  2AHE A;  1XOB A;  1EEJ A;  2YV7 A;  4LL1 B;  2DJ0 A;  3UBL A;  3HJO A;  3UAP A;  22GS A;  2H0H A;  2C8U A;  2V1M A;  1KEB A;  1S3D A;  4MH2 A;  4O5U A;  3IE3 A;  4GCI A;  2CAI A;  2LKU A;  3FR3 A;  2PWJ A;  1EV9 A;  2X8H A;  3ZFL A;  4PUF C;  2DJ1 A;  4MMM A;  4GQC A;  4ECJ A;  4A5P A;  1BED A;  1BYE A;  4PX1 A;  2VM2 A;  3G9B A;  2GVP A;  1AW9 A;  1OAZ A;  2ZUP A;  5IIZ A;  4K9Z A;  5G31 A;  3D4T A;  3A5W A;  4CY6 A;  1OC3 A;  4EXJ A;  1M9A A;  2DBC A;  1XW5 A;  2KOK A;  3KH9 A;  2F3M A;  3KEB A;  3TKR A;  2MMA A;  2GLR A;  2X49 A;  1OC8 A;  5D9X A;  4F03 A;  3F8U A;  1H4O A;  2CAQ A;  3GIX A;  3MSZ A;  2LS5 A;  5AIS A;  2LQQ A;  2P0G A;  4IGJ A;  5ECI B;  2WB9 A;  4EO3 A;  1JLW A;  3HXS A;  4F9Z A;  1X9W B;  3GKX A;  1T00 A;  1W89 A;  3GH6 A;  1TU7 A;  3RPP A;  2LQO A;  1GLP A;  5CNW A;  2VCT A;  3KTB A;  1TW9 A;  1A2J A;  2YZU A;  2DJK A;  2H6Z A;  1F3A A;  2IJY A;  4I6X A;  4E8H A;  5A4U A;  4K7I A;  2FCH A;  5IOW A;  1B48 A;  4G19 A;  3D4M A;  3LOR A;  2XBI A;  3M9J A;  5ABR A;  3EUR A;  2PBJ A;  3HJM A;  1EP7 A;  3VUR A;  4HOJ A;  2RUF A;  2N5F A;  2VD1 A;  2GST A;  2OAC A;  4JRR A;  2HXK A;  3F4S A;  1SK1 A;  4O5Q A;  2E2M A;  2CZ3 A;  5COH A;  2I3Y A;  2LRC A;  3APS A;  1UVZ A;  3CRT A;  2JAC A;  3APQ A;  4RI7 A;  3QCP A;  3UBK A;  4PQI A;  2B7K A;  2YN1 A;  4YKG A;  4L8E A;  1M2A A;  1YZX A;  2DC5 A;  1ACV A;  3LJR A;  4IP1 A;  5DCH A;  2DML A;  4JE1 A;  1A8L A;  2O8V B;  5DDL A;  5DVB A;  2G2Q A;  3N9J A;  2L4Q A;  2OBK A;  1M0U A;  3L4N A;  3LYP A;  3A2V A;  3EMX A;  3Q74 A;  4WF4 A;  2VM1 A;  2JL4 A;  3HJP A;  3VI5 A;  4TN8 A;  4GF0 A;  2PGT A;  1JHB A;  2HZE B;  2HSM A;  5ECM B;  2OJL A;  3QPM A;  3ZMK A;  1R26 A;  1M2B A;  1QFN A;  5ECK B;  5F8B A;  1WIK A;  2DIY A;  3U5R E;  1R7H A;  1X5C A;  2MBS A;  5ECQ B;  1ZGN A;  3KTL A;  2HSY A;  2VAF A;  1TRU A;  2H19 A;  3HVV A;  3DML A;  1QK8 A;  2C0E A;  2GSQ A;  2R6K A;  1XWA A;  3TJJ A;  2H1G A;  2L6D A;  3UJ1 A;  4IW9 A;  1A0R P;  3BCK A;  1N8J A;  4KW6 A;  4Z2U A;  3HVX A;  1U87 A;  4V2M A; 
#chains in the Genus database with same CATH homology
 2B6M A;  5B8A A;  1OVN A;  1ZYE A;  4MLY A;  3MNG A;  4EVM A;  4K2X A;  2V6O A;  5G1L A;  2IMF A;  1XIY A;  2YCD A;  3V1W A;  1T4Z A;  5JCG A;  1BJX A;  1TOF A;  4PNF A;  4DSS B;  4BWS A;  1BAY A;  4KH7 A;  1KBN A;  3GHA A;  2DJ3 A;  5HR3 A;  1WJK A;  4WR5 A;  1PL1 A;  2N5B A;  3NIV A;  4HEA 2;  3M8N A;  3EU3 A;  4MZC A;  5GAN D;  1M7T A;  3C7M A;  2MYG A;  4HJM A;  3GTU B;  4GQF A;  1PX6 A;  1VF2 A;  5BMU A;  2B1L A;  2XC2 A;  3M1G A;  5B8B A;  1ML6 A;  2WZ9 A;  4EC0 A;  2IFQ B;  4IJ3 A;  3TJG A;  4JED A;  3F6F A;  2VCZ A;  3C1S A;  3G7J A;  1R5P A;  3P90 A;  16GS A;  3CSH A;  2ON5 A;  1E6B A;  2H6Y A;  4MJA A;  3FK8 A;  3DD3 A;  2LTK A;  3GFK A;  2BMX A;  2K9F A;  3ZVJ A;  3KM6 A;  4I2U A;  5ECH B;  2GT5 A;  5CRH A;  1HD2 A;  4TW5 A;  3D6I A;  1XW6 A;  3KD0 A;  1GSY A;  5B7C A;  2RLI A;  4GST A;  3RBT A;  5J9B A;  1TK5 B;  4ZBD A;  4F82 A;  3R2Q A;  3EVI A;  3LEF A;  4OCE A;  1HQO A;  2VLT A;  2VL2 A;  5E59 A;  2WCI A;  5IM9 A;  5IMC A;  4O32 A;  2F8F A;  1YKC A;  4OO5 A;  2A4H A;  3EMP A;  3RHC A;  1G7E A;  2C0G A;  1GTA A;  1TKD B;  2FWH A;  3TRP A;  5GAP D;  3DEX A;  5KN2 A;  8GSS A;  1RK4 A;  4YH2 A;  4TR1 A;  3IOS A;  1W4V A;  3C1R A;  4N0Z A;  2NTO A;  4ZBA A;  5ID2 A;  2WUL A;  4POL A;  3A2X A;  5IO2 A;  3ZLP A;  3TKS A;  4NWY A;  4NV2 A;  2TRX A;  3EU4 A;  4ZXG A;  4FIW A;  2H6X A;  1YKA A;  3UEM A;  1PRX A;  1K0D A;  4FQU A;  5D9T A;  3GMF A;  3GL3 A;  1R5A A;  2HRF A;  4EDZ A;  4ECC A;  5CRG A;  2L6C A;  4MPG A;  2KLX A;  3IR4 A;  1CQG A;  1RW1 A;  1U88 A;  2YZH A;  4MF7 A;  3M3M A;  4BL7 A;  3KCM A;  3WD6 A;  3HCZ A;  2O87 A;  1EV4 A;  3AY8 A;  4XS1 A;  3UL3 A;  3LXT A;  4IVF A;  4HZ2 A;  2N5A A;  1ERW A;  3GKK A;  1G6W A;  1GUL A;  3C73 A;  2H01 A;  3ZIT A;  3DVW A;  5ECP B;  1SD8 A;  4BVY B;  4MDC A;  5DCG A;  3BJ5 A;  1V57 A;  4D73 A;  1B9Y C;  4PXO A;  1M9B A;  5AGY A;  3GH9 A;  3VK9 A;  3ZRE A;  1OKT A;  3IBH A;  3ZRD A;  1XWK A;  3PGT A;  4XRA A;  1S3C A;  4YAV A;  2IME A;  2FY6 A;  4Q5N A;  7GSS A;  1AXD A;  4L0W A;  1X5D A;  2B1K A;  3DRN A;  4KE3 A;  1BG5 A;  4X43 A;  2DKH A;  6GSX A;  3FEU A;  4K0G A;  2LJA A;  4X0X A;  19GS A;  4HU9 A;  1ILO A;  2BJX A;  3H93 A;  1T4Y A;  2C0F A;  1SYR A;  1ON4 A;  1V58 A;  1B4Q A;  1FG4 A;  2IN3 A;  13GS A;  2X8C A;  2R0G A;  4AJ6 A;  4CHS A;  2LJK A;  3HDC A;  1UA5 A;  4POB A;  4V1A g;  4H86 A;  4K7O A;  4LMW A;  1A2L A;  4FO5 A;  2YJH A;  5KN0 A;  2YWO A;  1J08 A;  2FLS A;  1TK8 B;  4MH3 A;  1Z5Y E;  4X4J A;  3MAK A;  4BWQ A;  4E8E A;  4Q5Q A;  2LRT A;  4BVX A;  4DVC A;  3HZ4 A;  3QDN A;  3KXO A;  2AJQ B;  1K0C A;  4NMU A;  2B5E A;  4EIP A;  5H5R A;  1X9M B;  1JZR A;  4TR3 A;  1AIU A;  2PMT A;  5IMA A;  2GQM A;  2IPA A;  4OCF A;  1MD4 A;  3N5O A;  4QL9 A;  1GTI A;  3VPT A;  1F3B A;  1K0M A;  5LD0 A;  2V6K A;  2K8V A;  4GXZ A;  4HZ4 A;  1O73 A;  5ELG A;  3J7Y k;  1T7P B;  1GUH A;  2HNL A;  1A2M A;  5GZZ B;  4TXO A;  1EOG A;  2CZ2 A;  4EE0 A;  1PMT A;  1YF1 A;  4MA9 A;  4FYU A;  3E0U A;  5IMV A;  1O6J A;  4MCU A;  4MPF A;  4PQ1 A;  4LA1 A;  1DUG A;  3I6A A;  3ERG A;  2IMI A;  4KX4 A;  2KUC A;  5HR1 A;  5F05 A;  2L4C A;  4HS1 A;  1F6M C;  1ZL9 A;  1EOH A;  2H0I A;  4I97 A;  5J41 A;  1MDJ A;  2CQ9 A;  2HLS A;  2HZF A;  2O85 A;  4LMV A;  3FR6 A;  3BOA A;  3W8S A;  1PN0 A;  4IS0 A;  2NBS A;  1FVK A;  4KGI A;  2HZE A;  3RHB A;  5FT3 A;  2CX4 A;  1KTE A;  2L5L A;  1T3B A;  1UN2 A;  2R0C A;  3TDG A;  2QA2 A;  1AUC A;  2R4V A;  5DJL A;  1FAA A;  3W8J A;  1NSW A;  2PUK C;  4YAP A;  4NXI A;  3F3Q A;  5JCW A;  5IQY A;  4F0B A;  1G0T A;  4DSR A;  2FWG A;  1YQ1 A;  1ERU A;  1WOU A;  1PSQ A;  4G2E A;  3CBU A;  5AN1 A;  3IV4 A;  2DJJ A;  2QA1 A;  1WMJ A;  4PQH A;  3J7Y b;  4IBP A;  4J57 E;  1BQ7 A;  2QSI A;  3C8E A;  1M99 A;  2VL9 A;  5DAL A;  3P2A A;  2WGR A;  2L5O A;  3VLN A;  5J4U A;  3CTF A;  3IK7 A;  6GSY A;  3DWV A;  1ZYQ B;  3UVH A;  4KCE A;  3VI7 A;  2OE3 A;  1GSD A;  2GZY A;  1ZYP A;  4OD7 A;  1OE7 A;  4RUV A;  1FVJ A;  4RQR A;  4ILF A;  2YJ7 A;  1IYI A;  3G7I A;  2YP6 A;  2NVL A;  1GNE A;  1DSB A;  1PL2 A;  1TDI A;  4WR4 A;  1THO A;  3O3T A;  4PGT A;  3GX8 A;  4O7H A;  4V2N A;  2L57 A;  4MJC A;  2REM A;  1EP8 A;  3APO A;  3D0Z A;  1R4W A;  4V2L A;  4XIH A;  4ICY A;  2VCX A;  4F2I A;  1WP0 A;  3I43 A;  1ZCP A;  2CX3 A;  2CVK A;  2JAD A;  4NV5 A;  1LJR A;  5G30 A;  5JWO B;  2MMN A;  3IHG A;  1PD2 1;  4ML6 A;  2GT6 A;  4AF2 A;  1ZZY A;  4Q5R A;  4ZB6 A;  4ZIL A;  1GTU A;  1T8E B;  3VFI A;  4EKZ A;  1T1V A;  1MD3 A;  1FOV A;  1USB A;  5E4W A;  3UAR A;  4G0K A;  2KHP A;  3CTG A;  4BA7 A;  5CAX A;  3UIW A;  1XPV A;  4O5R A;  2JZT A;  1V40 A;  4I2T A;  1UC7 A;  3RPN A;  3PIN A;  2F51 A;  1B8X A;  2HRA A;  3D22 A;  2LNT A;  2P5R A;  5KOW A;  5AIV A;  3UMA A;  1XFL A;  2VCV A;  4MP4 A;  2H1B A;  4KF9 A;  2IL3 A;  4RI6 A;  1K0N A;  3GX0 A;  5B6M A;  4Z7X A;  1Z7P A;  2C0D A;  3PPU A;  3H8Q A;  3O6T A;  3CRU A;  2EIR A;  3ZYW A;  4HJ2 A;  2GSS A;  1GL8 A;  5J3R A;  3A2W A;  1N2A A;  1XVQ A;  4L5O A;  2I81 A;  3TOT A;  2HFD A;  3IDV A;  2ALB A;  4K6X A;  2MMZ A;  4KSM A;  5KN1 A;  3FHK A;  5G5F A;  2G0F A;  2B5X A;  1B4P A;  1MTC A;  1SJZ A;  4I8B A;  1B9X C;  3GKM A;  5FWG A;  3JCM L;  2HI7 A;  3WGX A;  2V32 A;  1BX9 A;  3L9U A;  3KZQ A;  3S9F A;  2XPE A;  4IKH A;  1SKR B;  5ECN B;  1AQW A;  5G5E A;  2FA8 A;  2CA8 A;  2GTU A;  3GKN A;  1TRS A;  5D96 A;  3FZ5 A;  2YV9 A;  1YEX A;  4X1U A;  3KP9 A;  3WT1 A;  2R37 A;  2B7J A;  1PA3 A;  3FMW A;  2YNX A;  2VLU A;  4ZL7 A;  3LFL A;  4NPB A;  1KNG A;  4JR4 A;  4BVY A;  3HY2 A;  2V41 A;  5D93 A;  4XS6 A;  5ECO B;  18GS A;  1QUW A;  3SBC A;  1X0R A;  2LST A;  4IHU A;  1Q98 A;  1SL2 B;  2H76 A;  4CY8 A;  1YEP A;  1OYJ A;  3A5I A;  4KND A;  5D9W A;  1XCC A;  4OO4 A;  3QD9 A;  2V2G A;  5A4W A;  4K8M A;  3K8N A;  3TRQ A;  2H74 A;  5GST A;  2LV3 A;  5DQY A;  1V98 A;  3CXG A;  3DIE A;  4MZB A;  1HYU A;  1TXX A;  3H1N A;  1PN9 A;  1GSF A;  4EF0 A;  5H5Q A;  3G7Y A;  4ML1 A;  1PKZ A;  3VWV A;  4XRD A;  3P7X A;  4CDO A;  3LWA A;  4XS4 A;  1WRY A;  3DXB A;  2XHF A;  1O8X A;  2I9H A;  3P8W A;  4JBB A;  4ULX A;  3TCO A;  1FB0 A;  5G2Z A;  4AJ7 A;  4USS A;  4WKW A;  1J9B A;  3VWU A;  1ST9 A;  2A2R A;  4HQZ A;  3RDW A;  3IXR A;  1GRX A;  1SK2 A;  1EGO A;  3EYT A;  2TRC P;  4ECB A;  4IJI A;  4EIQ A;  4PNG A;  3GSS A;  4TVE A;  4J56 E;  5H5S A;  3IPZ A;  5FHI A;  1TI1 A;  1WE0 A;  3FR9 A;  1SJ6 A;  4GWR A;  3ME7 A;  2HRK A;  4V1A p;  1A23 A;  3KH7 A;  4K1F A;  1GSE A;  2R0P A;  2VCQ A;  4KDX A;  4ZB8 A;  3ZIV A;  1THX A;  2HE3 A;  2JZR A;  4KCA A;  2TIR A;  1G7O A;  1XBS A;  2NPB A;  1OKD A;  2VL2 C;  3UOM A;  1A8Y A;  3ZIJ A;  3QFB C;  4ISD A;  2FGX A;  3TUE A;  4EL1 A;  5HFI A;  1GNW A;  4ZIJ A;  3NZN A;  10GS A;  2FWF A;  5F06 A;  2H71 A;  1K3L A;  3IK9 A;  3TB2 A;  3VWW A;  3LQ7 A;  5A4V A;  2XBQ A;  3QAV A;  2C3T A;  4I5Q A;  3KMO A;  1MDI A;  3CSI A;  2LUS A;  4L0U A;  3TKQ A;  5HR0 A;  1Q4J A;  1TJD A;  2M80 A;  3FYG A;  4TXV A;  4ZBB A;  2O7K A;  1I9D A;  2F8A A;  2VUP A;  1WPI A;  3H4K A;  4ZB9 A;  3TKS C;  2DLX A;  5LCZ A;  3GV1 A;  3F9U A;  1GUM A;  4N0V A;  3QR6 A;  3GL5 A;  3EWL A;  2F9S A;  1EZK A;  1X9S B;  1OC9 B;  1GSQ A;  4IN0 A;  5LNK e;  3UVT A;  4TR1 B;  3F4R A;  1Y25 A;  3IAS 2;  1YDK A;  3KP8 A;  2H0G A;  2ZCT A;  3GUS A;  1A0F A;  2UZ8 A;  3GNJ A;  4G9H A;  4K7N A;  5CRD A;  1C72 A;  5CO3 A;  2I4A A;  4YQU A;  2KP2 A;  5ID2 B;  2VLV A;  4LLR A;  1RQM A;  5J5N A;  3SWL A;  3DGQ A;  4JU5 A;  4GRF A;  2C80 A;  2H8L A;  2B5Y A;  1EEM A;  4K5S A;  1YY7 A;  3LSZ A;  3KMN A;  4MAB A;  3PR8 A;  2C3Q A;  4MJB A;  2CVB A;  1WWJ A;  3BBY A;  1DE2 A;  3I9V 2;  3L9S A;  4QQ7 A;  1FO5 A;  4BL7 B;  1U6T A;  3A3T A;  1HNB A;  4OFM A;  4PUA A;  1TTZ A;  2QC7 A;  5IMF A;  5IO0 A;  2Z9S A;  1GP1 A;  3GRX A;  2AYT A;  2GSR A;  1TRV A;  5IMZ A;  1Y6E A;  4D73 B;  3FRC A;  3TJF A;  2HRN A;  3FZA A;  4AGS A;  3EC3 A;  3TJK A;  2J9H A;  2KP1 A;  1VRS D;  3Q19 A;  3EIN A;  1VF3 A;  5DAK B;  2H66 A;  1K0A A;  3ERW A;  1AAZ A;  3DYR A;  3U6V A;  3Q18 A;  2VIM A;  4TR0 A;  5INY A;  4PTS A;  1ABA A;  5IOX A;  2DKI A;  4QL7 A;  3CYN A;  1Z9H A;  5HFK A;  5GSS A;  2P5Q A;  2RM6 A;  2QGV A;  1GSS A;  1CQH A;  2WFC A;  4MK3 A;  3MWH A;  4IQ1 A;  5CP1 A;  2PVO C;  1XWC A;  2WS2 A;  3FZ4 A;  3E9J B;  2GS3 A;  3F4T A;  3MDK A;  1XW9 A;  1ZOF A;  2H1A A;  4WET A;  3PH9 A;  3HA9 A;  2IMK A;  4MF5 A;  2H73 A;  3FKF A;  4BVX B;  1ERV A;  5HQP A;  5ECR B;  3WYW A;  1V9W A;  2OBI A;  4N10 A;  1NHO A;  5IPG A;  3KIJ A;  1JLV A;  1Z6N A;  2M72 A;  5IPH A;  4OMV A;  2BTO T;  1Z6M A;  3IC8 A;  4G0L A;  4OFN A;  2A2S A;  1DE1 A;  4DSS A;  5EPF A;  2LNS A;  1SL0 B;  2H30 A;  3GN3 A;  4WF5 A;  3ERF A;  2DMM A;  2OE1 A;  4YQV A;  1XVW A;  4TXO B;  2R3X A;  1SEN A;  3IAM 2;  3OR5 A;  3KGK A;  1HNA A;  3GTU A;  20GS A;  9GSS A;  1PX7 A;  4ZL9 A;  3TGZ A;  4HU7 A;  4GTU A;  3DVX A;  1O85 A;  1FW1 A;  4F0C A;  2GQK A;  3F0I A;  1FB6 A;  2QKE A;  4FYB A;  2IFQ A;  1XOA A;  3GYK A;  3ME8 A;  1JZD A;  4KAE A;  2IWT A;  1DBY A;  2YWI A;  2RM5 A;  5JWR B;  4BPY A;  6GSU A;  4G10 A;  1XZO A;  1Z3E A;  2EC4 A;  3ZML A;  4KUN A;  14GS A;  2FA4 A;  1H75 A;  2PER A;  2PU9 C;  1U3A A;  4GLT A;  3TOU A;  2H70 A;  5DBQ A;  2JSY A;  3RAZ A;  1AQV A;  1M2D A;  3L9V A;  3HYP A;  5ELA A;  4TKY A;  5ECL B;  1FOH A;  2CVD A;  3ZTL A;  2PPT A;  1GSU A;  2C1Y A;  2OA7 A;  1GH2 A;  5AIX A;  3QOU A;  1YJ6 A;  1NM3 A;  2P31 A;  5EL8 A;  2FWE A;  6GSV A;  2CT6 A;  1GTB A;  2YWM A;  3LYK A;  3M0F A;  5DJM A;  1GUK A;  5A5K A;  2AAW A;  3LXZ A;  3ZZX A;  4WBJ A;  5BRT A;  1SKW B;  4ECI A;  4K5R A;  4JR6 A;  4O92 A;  3IC4 A;  4HDE A;  11GS A;  4PUR A;  4G0I A;  5CYY A;  1F9M A;  5EY6 A;  5KEJ A;  2AV4 A;  4GSS A;  3O76 A;  3F6D A;  4XCS A;  1SK0 A;  4MF6 A;  5EVO A;  2C3N A;  2R2J A;  5DAL B;  1PKW A;  4IQA A;  2DSA A;  4NAX A;  4J2F A;  4POK A;  1XWG A;  2FUG 2;  4KA0 A;  2IMD A;  3F3R A;  1TP9 A;  4FYC A;  2JSZ A;  4TOP A;  4L5L A;  3VPQ A;  1FHE A;  3FW2 A;  1ZYN A;  3WGD A;  1S3A A;  1QQ2 A;  4Z2T A;  4MJE A;  4ID0 A;  2I1U A;  3QMX A;  6GSW A;  4WXT A;  3HZ8 A;  3FY7 A;  2A4V A;  1PGT A;  3ZVJ D;  5JWQ B;  5B6N A;  1G6Y A;  2FD3 A;  6GSS A;  2K6V A;  3QAW A;  3Q6O A;  4RQX A;  1NHY A;  1A24 A;  1VF1 A;  2YAN A;  3EE2 A;  1V2A A;  4K0N A;  3CMI A;  1O8W A;  2DIZ A;  2AUV A;  3R3E A;  4KDU A;  2C4J A;  1PQN A;  4LL4 B;  2YWN A;  4KDY A;  5ECS A;  4NHW A;  3ZFB A;  2E2G A;  3NOF A;  1XWB A;  2D2Z A;  3C71 A;  2HSH A;  2EIQ A;  3TJB A;  4XHM A;  3VWX A;  2JU5 A;  1MEK A;  3GA4 A;  2VCW A;  3WT2 A;  1O81 A;  2VL3 A;  1LBK A;  2VD0 A;  3ED3 A;  5HR2 A;  3FZ9 A;  4IEL A;  2B3S A;  2GZZ A;  3LGC A;  4XTS A;  1EWX A;  3HKR A;  3E3E A;  3TKS E;  2PN8 A;  1QXH A;  2RII A;  2LEG A;  2DJ2 A;  4WEY A;  3TKP A;  5KOX A;  1NW2 A;  2HT9 A;  4GSN A;  2MBT A;  3WGE A;  1HNC A;  1VF4 A;  1SD9 A;  1SL1 B;  1SU9 A;  5ENU A;  1VGL A;  4KSO A;  1U3I A;  3MYD A;  1OC9 A;  4Z2R A;  2CV4 A;  4CW9 A;  1URM A;  2H72 A;  2ES7 A;  2K18 A;  5F0G A;  3QFA C;  1X5E A;  3CSJ A;  3ZL5 A;  1F37 A;  4POM A;  5C00 A;  1TI3 A;  1E2Y A;  3H79 A;  2OAD A;  2H1D A;  1TU8 A;  5D73 A;  4NHZ A;  3HD5 A;  4N30 A;  2ZNM A;  1LU4 A;  4Q5F A;  3ISO A;  2K8S A;  1ERT A;  6GST A;  2XPD A;  2YOI A;  3M9K A;  2H75 A;  3D5J A;  2E0Q A;  1AC1 A;  5CRW A;  3BD2 A;  3BCI A;  3F63 A;  4WBR D;  1K0O A;  2X8G A;  17GS A;  3US3 A;  2WJU A;  2NDO A;  2M46 A;  5D8I A;  4MZW A;  1SKS B;  2ON7 A;  3I69 A;  5J9C A;  3DKS A;  1GWC A;  2MMO A;  5G1K A;  1K0B A;  1MDK A;  1SJI A;  2WRT A;  4OFT A;  4EUY A;  4TR4 A;  1ZMA A;  1QMV A;  3MIX A;  2J23 A;  2JZS A;  3EPT A;  4YKF A;  3TRX A;  1K3O A;  2RUE A;  1XXU A;  1K3Y A;  3HHV A;  1GLQ A;  4ZL8 A;  2PVQ A;  1JZO A;  2GZP A;  4TRX A;  1TK0 B;  2X4A A;  3IHQ A;  2WDU A;  2IIY A;  2YPM A;  3W6G A;  4KB3 A;  1EGR A;  2A2P A;  1JFU A;  5JCU A;  1Z7R A;  4HI7 A;  3LG6 A;  5DQS A;  2GDR A;  5D9V A;  3GUR A;  2FHE A;  1O7U A;  1F2E A;  4ACS A;  5HFG A;  3KJY A;  4EDY A;  3HVS A;  5F07 A;  1YF0 A;  2EIO A;  2LRN A;  5KN3 A;  5DAK A;  2X64 A;  4MNN A;  4P3Y B;  2L59 A;  1SYX A;  5CRE A;  4HUA A;  4DEJ A;  4OWY A;  1J0F A;  4DSQ A;  2VO4 A;  2MZC A;  4FH8 A;  12GS A;  2LJR A;  4HQS A;  5IMD A;  4AJ8 A;  1I5G A;  1IYH A;  3L0H A;  2AB6 A;  4JZQ A;  3LW9 A;  3GST A;  3D21 A;  3L78 A;  4XS4 B;  2OKA A;  4IP6 A;  2O89 A;  1AQX A;  3QAG A;  4YQM A;  1OE8 A;  1TRW A;  2GGT A;  2VOC A;  5L71 A;  5C04 A;  2HYX A;  1QGV A;  1JZW A;  4N11 A;  3IA1 A;  2E7P A;  2GQL A;  2OE0 A;  4K2D A;  2FNO A;  3IRA A;  2X99 A;  2R5G A;  2AHE A;  1XOB A;  1EEJ A;  2YV7 A;  4LL1 B;  2DJ0 A;  3UBL A;  3HJO A;  3UAP A;  22GS A;  2H0H A;  2C8U A;  2V1M A;  1KEB A;  1S3D A;  4MH2 A;  4O5U A;  3IE3 A;  4GCI A;  2CAI A;  2LKU A;  3FR3 A;  2PWJ A;  1EV9 A;  2X8H A;  3ZFL A;  4PUF C;  2DJ1 A;  4MMM A;  4GQC A;  4ECJ A;  4A5P A;  1BED A;  1BYE A;  4PX1 A;  2VM2 A;  3G9B A;  2GVP A;  1AW9 A;  1OAZ A;  2ZUP A;  5IIZ A;  4K9Z A;  5G31 A;  3D4T A;  3A5W A;  4CY6 A;  1OC3 A;  4EXJ A;  1M9A A;  2DBC A;  1XW5 A;  2KOK A;  3KH9 A;  2F3M A;  3KEB A;  3TKR A;  2MMA A;  2GLR A;  2X49 A;  1OC8 A;  5D9X A;  4F03 A;  3F8U A;  1H4O A;  2CAQ A;  3GIX A;  3MSZ A;  2LS5 A;  5AIS A;  2LQQ A;  2P0G A;  4IGJ A;  5ECI B;  2WB9 A;  4EO3 A;  1JLW A;  3HXS A;  4F9Z A;  1X9W B;  3GKX A;  1T00 A;  1W89 A;  3GH6 A;  1TU7 A;  3RPP A;  2LQO A;  1GLP A;  5CNW A;  2VCT A;  3KTB A;  1TW9 A;  1A2J A;  2YZU A;  2DJK A;  2H6Z A;  1F3A A;  2IJY A;  4I6X A;  4E8H A;  5A4U A;  4K7I A;  2FCH A;  5IOW A;  1B48 A;  4G19 A;  3D4M A;  3LOR A;  2XBI A;  3M9J A;  5ABR A;  3EUR A;  2PBJ A;  3HJM A;  1EP7 A;  3VUR A;  4HOJ A;  2RUF A;  2N5F A;  2VD1 A;  2GST A;  2OAC A;  4JRR A;  2HXK A;  3F4S A;  1SK1 A;  4O5Q A;  2E2M A;  2CZ3 A;  5COH A;  2I3Y A;  2LRC A;  3APS A;  1UVZ A;  3CRT A;  2JAC A;  3APQ A;  4RI7 A;  3QCP A;  3UBK A;  4PQI A;  2B7K A;  2YN1 A;  4YKG A;  4L8E A;  1M2A A;  1YZX A;  2DC5 A;  1ACV A;  3LJR A;  4IP1 A;  5DCH A;  2DML A;  4JE1 A;  1A8L A;  2O8V B;  5DDL A;  5DVB A;  2G2Q A;  3N9J A;  2L4Q A;  2OBK A;  1M0U A;  3L4N A;  3LYP A;  3A2V A;  3EMX A;  3Q74 A;  4WF4 A;  2VM1 A;  2JL4 A;  3HJP A;  3VI5 A;  4TN8 A;  4GF0 A;  2PGT A;  1JHB A;  2HZE B;  2HSM A;  5ECM B;  2OJL A;  3QPM A;  3ZMK A;  1R26 A;  1M2B A;  1QFN A;  5ECK B;  5F8B A;  1WIK A;  2DIY A;  3U5R E;  1R7H A;  1X5C A;  2MBS A;  5ECQ B;  1ZGN A;  3KTL A;  2HSY A;  2VAF A;  1TRU A;  2H19 A;  3HVV A;  3DML A;  1QK8 A;  2C0E A;  2GSQ A;  2R6K A;  1XWA A;  3TJJ A;  2H1G A;  2L6D A;  3UJ1 A;  4IW9 A;  1A0R P;  3BCK A;  1N8J A;  4KW6 A;  4Z2U A;  3HVX A;  1U87 A;  4V2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...