2E7PA

Crystal structure of the holo form of glutaredoxin c1 from populus tremula x tremuloides
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
107
structure length
107
Chain Sequence
SKQELDAALKKAKELASSAPVVVFSKTYCGYCNRVKQLLTQVGASYKVVELDELSDGSQLQSALAHWTGRGTVPNVFIGGKQIGGCDTVVEKHQRNELLPLLQDAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin
publication title Functional, structural, and spectroscopic characterization of a glutathione-ligated [2Fe-2S] cluster in poplar glutaredoxin C1
pubmed doi rcsb
source organism Populus tremula x populus tremuloides
molecule tags Electron transport
total genus 35
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2e7pA00
4MCUA 1TK8B 4TVEA 2RM5A 3ZREA 5KN1A 1XWCA 1SKRB 1ERTA 2J23A 2XPEA 4TRXA 1FO5A 5DQYA 4MH2A 2KP1A 1ERWA 3KMOA 3KD0A 2YWNA 5J41A 2LRCA 2DMMA 5H5RA 4HS1A 4ECIA 3VWXA 1ZZYA 4POLA 1K0DA 4NPBA 4IQAA 2GSSA 1V2AA 2E7PA 1JHBA 3QOUA 4O92A 4X1UA 3IK7A 1B4PA 2GZZA 1AUCA 3ZMKA 1F2EA 4TW5A 3IDVA 3RHCA 5AIXA 4RI7A 2VLVA 3CTGA 4JZQA 3N5OA 5EL8A 3HXSA 3F6DA 1V9WA 2HI7A 2IJYA 4EC0A 1XBSA 3HZ8A 4EE0A 1A0FA 4IHUA 2LRTA 1PA3A 2JZTA 1VF3A 2VL3A 3DD3A 4MJEA 1TDIA 1JZDA 5G30A 3TUEA 3K8NA 2IL3A 4ISDA 4MH3A 2K8SA 3FR6A 3ZIJA 2GZYA 1URMA 2MBTA 3EINA 1SU9A 2KOKA 2PGTA 5F0GA 1OC8A 2FCHA 3APQA 3P8WA 3D6IA 4HJ2A 1PGTA 1QFNA 3KH9A 5G31A 4CHSA 4MPGA 6GSYA 4TXOA 2MYGA 3FZAA 3ZZXA 2BJXA 3VWWA 1A2MA 2VCTA 1XPVA 3VPTA 4MA9A 2I1UA 3M8NA 4RQRA 1S3DA 4F0BA 4K1FA 3IBHA 2X64A 5JWOB 4TN8A 2H0IA 5CYYA 1GSQA 1DBYA 1SJIA 1THXA 3LWAA 1RW1A 1HD2A 4K0GA 3G7IA 4NV2A 4GWRA 3UARA 4OWYA 3GTUB 2LJRA 4HU7A 4ZBBA 2AB6A 4GSTA 2X99A 1GULA 4DSRA 1FOVA 1ZMAA 1G7EA 1F37A 1I5GA 4AGSA 4LLRA 1FG4A 4ZBAA 1OAZA 1MEKA 1XWAA 1N8JA 5ECNB 5C00A 3FRCA 1G0TA 2IIYA 3I6AA 1XW9A 2O85A 4PURA 4F9ZA 1FHEA 2KHPA 3GYKA 4MF7A 2E2GA 4QL9A 2VCWA 4WKWA 2DLXA 1C72A 4O5RA 1V57A 4EDYA 1KBNA 4IELA 1Z7RA 2DMLA 2H0GA 3TB2A 4ZL8A 1Z9HA 3O6TA 3JCML 2IPAA 2LS5A 3EMXA 4TR1B 2YWIA 5HFGA 2HRNA 1T00A 2VCXA 2DJ1A 1ZGNA 2ON5A 3GH6A 3F0IA 1G6WA 4MZCA 1K0OA 3NOFA 5F05A 1GUMA 1O8WA 2LJKA 1WP0A 3APOA 1S3AA 5A4UA 2RLIA 2HYXA 1K3OA 3E0UA 2B5EA 2FNOA 3FZ9A 3CSHA 2GT5A 4TR3A 3L0HA 3A2VA 1PKZA 2GS3A 2REMA 1AC1A 7GSSA 4MF5A 5DJMA 4WEYA 4GQCA 4N11A 1G6YA 3GN3A 1J9BA 1JZRA 1B8XA 4N30A 1XOBA 2H73A 4HZ4A 4JU5A 3LYKA 2C1YA 3Q19A 2F8FA 2GSRA 2FY6A 4K0NA 4P3YB 3N9JA 5GZZB 5D73A 3D4TA 3IPZA 1SYXA 1VF1A 1GTBA 2R3XA 2I3YA 1QXHA 2F8AA 1FAAA 1M2BA 2WULA 3F4SA 3FR3A 5FHIA 2ALBA 2H1AA 2PBJA 1OE8A 2IMFA 4K9ZA 3EU4A 3EYTA 1CQHA 5ELAA 2IMIA 2VD0A 2H75A 3ZFLA 4JE1A 4GCIA 4O7HA 3FHKA 1XVWA 4NHZA 5EPFA 1GTAA 5JCWA 4PQHA 1T3BA 3EVIA 5INYA 3FZ4A 1NM3A 2JU5A 3TOTA 2R6KA 1DSBA 1BEDA 3D22A 3IA1A 4BA7A 5IOXA 5JWQB 1FW1A 3LJRA 4KCAA 3KM6A 3IK9A 1GRXA 4XS1A 4D73B 2MZCA 3LFLA 4I2TA 5B8BA 2BTOT 1T4YA 3GIXA 2L59A 1GL8A 2C0FA 4V2LA 3G7JA 3H1NA 3EURA 4J2FA 2L6CA 3C71A 3RBTA 2VL2C 4GQFA 1Z6MA 1TW9A 10GSA 3O3TA 1A2JA 2B5XA 1I9DA 2KUCA 5IMAA 3HJOA 2EIQA 5AGYA 1ZYQB 2HFDA 1U6TA 2WRTA 3VURA 2HLSA 4EDZA 5ECKB 1K0BA 5IPGA 1GTUA 4V1Ag 3E3EA 3GL3A 5FWGA 4RI6A 3C8EA 4KAEA 4IVFA 3WT1A 1XCCA 5D8IA 2IN3A 1GUKA 2DJ2A 3UIWA 3UL3A 3EMPA 2ES7A 4XCSA 2CV4A 1G7OA 1GSEA 2M80A 4V2NA 3GRXA 2YZHA 4LA1A 5DQSA 5IM9A 12GSA 1M2DA 4KA0A 3TJFA 1LJRA 8GSSA 1XIYA 4DSQA 1HNBA 1WMJA 2A2SA 1U3AA 1J0FA 1HNCA 3HJPA 2IFQB 4YH2A 3U5RE 4KDYA 4F03A 1SK2A 1K3LA 2LEGA 4I5QA 5J5NA 1EWXA 3TKQA 3MWHA 3C1SA 3GUSA 3MNGA 3ZL5A 3PINA 3QDNA 3CRUA 1XOAA 3M3MA 3KP8A 4TR4A 2B1KA 3NZNA 2B5YA 2YWMA 2JACA 1PSQA 1ERUA 4OFNA 1EEJA 1AXDA 4HQSA 4L5LA 3BCIA 4EVMA 2LSTA 1PN9A 4NXIA 1H75A 2Z9SA 3UMAA 2P0GA 1O6JA 4MF6A 3KGKA 3VI5A 3DXBA 2CAQA 1GSFA 4FYCA 4NAXA 2JADA 3VI7A 1HQOA 4PGTA 3L78A 4IQ1A 1F9MA 1Z5YE 3CSJA 4HUAA 4MABA 5GSTA 3IXRA 3OR5A 2WS2A 2G2QA 2PVQA 2F3MA 1HNAA 3M9JA 4V2MA 1EP7A 5DALA 3VPQA 3P2AA 1PL2A 3KH7A 4CDOA 2H72A 2L4CA 3H93A 1TRUA 3ZMLA 1EV9A 2CT6A 4ZXGA 1DE1A 1TRWA 2MMZA 3KCMA 1GSYA 4WBRD 1X0RA 2GDRA 3I9V2 1TU8A 1O7UA 1O85A 1R5PA 3QAGA 1JLWA 4HOJA 1WRYA 3RHBA 4NHWA 4ZIJA 1X5DA 3UBKA 1PX7A 4KE3A 1RK4A 5GAPD 4JR6A 1YDKA 1CQGA 2CX3A 4I6XA 4KB3A 4WBJA 1R26A 1FB6A 3F3RA 4MP4A 3GA4A 5AISA 1EOGA 1PRXA 2VIMA 1TOFA 2DC5A 2QC7A 3KIJA 3HVVA 3ME8A 4OFTA 3DYRA 5A5KA 5HQPA 3GH9A 4OO5A 5FT3A 1V40A 5J9CA 1ZYEA 1GTIA 4BWSA 4OCFA 4AJ8A 1O73A 1ST9A 2N5BA 2QGVA 5DALB 3KXOA 3QMXA 4KCEA 4BPYA 3HVXA 3GX8A 2FWEA 18GSA 4ZL7A 5KN3A 1O8XA 5AN1A 4POKA 4Q5RA 1QGVA 4XTSA 1TRVA 3D21A 4PQ1A 4F2IA 4MDCA 2H0HA 2TRXA 1A2LA 2DIZA 1R7HA 4MMMA 4HQZA 3CRTA 4IP1A 4ML6A 2OE3A 4Q5FA 2ZNMA 1DE2A 5B6MA 3G9BA 4ZBDA 4Z7XA 5CRWA 3F3QA 5CREA 3DKSA 3TRXA 2L5OA 1WPIA 2AUVA 4QL7A 1K0NA 1UA5A 3IR4A 2I81A 2FHEA 4MPFA 14GSA 2PU9C 9GSSA 2OE0A 4KH7A 3ZVJA 1ERVA 5IQYA 2I4AA 3APSA 2WFCA 3LSZA 4I2UA 3US3A 3DVXA 1UVZA 5IMFA 3F6FA 2D2ZA 2QSIA 5G5EA 3ISOA 4OMVA 2PUKC 4FYBA 5D9TA 1AQWA 3M0FA 1N2AA 2XBQA 3DMLA 1SL2B 3SBCA 3IV4A 5IO2A 4DSSA 3VLNA 1GLPA 4F82A 2E2MA 4MJAA 3UBLA 4IP6A 3ZVJD 1QQ2A 5HFIA 3A2WA 4HDEA 2H76A 3UOMA 4KW6A 2HSYA 1KEBA 3IAM2 1X9MB 1GNEA 4PX1A 4MK3A 1GH2A 4WF5A 1A8YA 2E0QA 5A4WA 5J3RA 1MD4A 1SJ6A 3CYNA 3SWLA 4PUFC 1JZOA 2WB9A 1TI3A 1OKDA 4TXOB 1DUGA 2H6YA 2FD3A 2HZEA 5E4WA 5LD0A 2OACA 2JZRA 4WXTA 11GSA 4HEA2 4BL7A 4XHMA 3IC4A 5ID2A 1QUWA 2EIRA 1Z3EA 2P31A 4TOPA 1SD8A 3D5JA 1PMTA 4KSMA 5GSSA 3FZ5A 5JWRB 3F8UA 4GTUA 1M2AA 4EKZA 3PH9A 1BG5A 4KUNA 1JZWA 3DEXA 3A2XA 3GMFA 3TOUA 22GSA 4OO4A 4G9HA 3DVWA 3M9KA 2B1LA 2H01A 3CMIA 1MTCA 2VUPA 5H5SA 2J9HA 2ON7A 1M9AA 3PGTA 1WJKA 1B9YC 4JR4A 3QCPA 2R37A 3KMNA 4IJ3A 2WDUA 2K8VA 2L6DA 2HT9A 2V6KA 3TCOA 1FB0A 3H4KA 3EU3A 5KEJA 3GKKA 1V98A 1GSUA 2HXKA 3ERFA 1M9BA 3TKPA 1B48A 1TRSA 1OC3A 5DBQA 4I97A 3BCKA 1F3AA 2L57A 4YAPA 1YF0A 3AY8A 5CRGA 1OYJA 2C4JA 2N5FA 3FY7A 5ID2B 3NIVA 1VF4A 2L5LA 1ILOA 1Y6EA 5ELGA 5ENUA 5F8BA 4Q5NA 3LORA 4PUAA 2ZUPA 3MAKA 4E8EA 5ECQB 3C73A 5D93A 4HU9A 2YCDA 3HKRA 4J57E 2XC2A 1ON4A 1NHYA 2FWHA 2ZCTA 3RPNA 2A4VA 2G0FA 2XPDA 2YN1A 6GSWA 2OBIA 4ECCA 1EV4A 5IMCA 2C3QA 2NPBA 3UEMA 3LGCA 4YQUA 1KNGA 3FYGA 3QPMA 1SL1B 2HSHA 2M72A 4BVYA 4KDUA 1ZCPA 5HR2A 4RUVA 1O81A 1M7TA 4HZ2A 4OFMA 3D4MA 4XS6A 2JSZA 1VF2A 3H79A 4V1Ap 3UAPA 1OC9A 4G2EA 2R4VA 2LUSA 3GSTA 1R4WA 1VRSD 4K6XA 4BWQA 5DJLA 1OVNA 3HDCA 2HRFA 5CRDA 5IMDA 4G10A 5HR3A 3UVTA 2HE3A 2RUFA 2CX4A 3HZ4A 1BYEA 4WR5A 3ZITA 2A2RA 2VCQA 2MBSA 5D9XA 5B8AA 1XVQA 1YJ6A 5JCGA 1ML6A 3GSSA 1H4OA 1A23A 3ZIVA 4YQMA 1SENA 1QMVA 3MSZA 4MLYA 3EWLA 1YKCA 2JL4A 3CTFA 3CXGA 1YEPA 4EF0A 2FWFA 6GSXA 2OA7A 3ZFBA 16GSA 3A5WA 1OC9B 1UN2A 3ME7A 2DJ0A 1AQXA 3VK9A 1AAZA 1YQ1A 1WIKA 2H1GA 2FGXA 2MMOA 3GURA 3IE3A 1HYUA 2GZPA 2F9SA 2O89A 1WE0A 4L0WA 3PR8A 4L0UA 2V6OA 3TKSA 2HZFA 5B6NA 1YZXA 3FR9A 3QFBC 3TJKA 3QFAC 4K7OA 2YZUA 2PPTA 2KLXA 3RDWA 5G1LA 4EO3A 1A0RP 3RPPA 1EOHA 4OCEA 3G7YA 1X5CA 1ZL9A 3I43A 4ULXA 2WCIA 4GRFA 4GSNA 4IJIA 4IW9A 2DSAA 2M46A 5D96A 2RIIA 1B4QA 1NHOA 2CZ2A 2GVPA 4G19A 3KTLA 2H1DA 5CO3A 1SJZA 4N10A 1XWBA 4KGIA 2PMTA 2EIOA 4FIWA 4YQVA 3DWVA 2C8UA 3ZLPA 3WYWA 5D9VA 2NDOA 3V1WA 1SK0A 3E9JB 1MDKA 1XWKA 3TRQA 1TU7A 3Q18A 3GX0A 2B7JA 1Z7PA 3VWUA 4GXZA 2LQQA 4AJ6A 2GQLA 2NTOA 1OE7A 3FW2A 2QKEA 4LL4B 1IYIA 3P7XA 5G5FA 1MD3A 3MDKA 3HHVA 2NBSA 3Q6OA 3LXZA 3BJ5A 3TJBA 3F9UA 1SKSB 17GSA 3J7Yb 1F3BA 3GV1A 3KTBA 3LEFA 5J9BA 2YANA 2C3TA 2WZ9A 1A24A 1E2YA 4LL1B 5COHA 3F63A 2H66A 1EP8A 1M99A 5A4VA 1X5EA 3GKNA 5F07A 1XWGA 3LG6A 4ZB6A 2H19A 2YOIA 3L4NA 3GHAA 1T1VA 2VM1A 1J08A 1GSDA 3S9FA 2R2JA 4JEDA 4F0CA 4OD7A 2LQOA 2YNXA 3TJJA 2H1BA 2X8HA 5CP1A 5G1KA 1MDIA 5CNWA 2FUG2 2LNSA 2YV7A 2YWOA 1PX6A 4LMVA 5ECHB 4WF4A 2VLTA 4ACSA 4ZB9A 3GTUA 4POBA 2NVLA 2LRNA 4JRRA 3WT2A 2CAIA 5IO0A 3UVHA 3LXTA 3WD6A 5IMZA 1YKAA 5DCGA 3HCZA 4IBPA 3DRNA 3VWVA 2O7KA 3IAS2 3C7MA 3GNJA 2IMKA 3HD5A 4ZILA 3I69A 1NSWA 1TXXA 2TIRA 2HNLA 1TK0B 2X8GA 1QK8A 5DCHA 3TJGA 3EE2A 4AJ7A 1NW2A 3EC3A 1JFUA 1SYRA 1U88A 1ACVA 1KTEA 2L4QA 5HFKA 1K0CA 4AF2A 2VO4A 3TRPA 4K2DA 1EGOA 4PNFA 4ZB8A 1BQ7A 1A8LA 3KEBA 3L9VA 2YJHA 4K7NA 2VCZA 1PD21 3QR6A 4TR1A 1BX9A 1THOA 2AAWA 5KN2A 1FVKA 5LCZA 2X8CA 1TKDB 5LNKe 1YF1A 1F6MC 1GUHA 1M0UA 3RAZA 4MJCA 5L71A 2H6XA 1K0AA 2VL9A 2P5QA 1EZKA 2H71A 2OKAA 2OJLA 3ED3A 4NV5A 4FH8A 3TGZA 4KX4A 1K3YA 2I9HA 1ABAA 1TTZA 1YEXA 3ZTLA 4RQXA 1WOUA 5IPHA 2H70A 3LYPA 1V58A 4LMWA 5DAKA 1SL0B 4HJMA 2YP6A 4I8BA 2IMDA 6GSVA 3L9SA 2CVBA 5CRHA 3WGDA 2GT6A 4KNDA 1B9XC 5IIZA 4DSSB 1AIUA 2EC4A 3FK8A 1GP1A 2IWTA 5ECOB 20GSA 2DJJA 1EEMA 4GLTA 2IMEA 1BJXA 1USBA 2CVKA 4CW9A 2K6VA 4GF0A 2PERA 1TK5B 2FLSA 4FO5A 1FVJA 2FA4A 2LJAA 4HI7A 2B6MA 5KN0A 2HZEB 3W8JA 4X0XA 4ECBA 2GQMA 1SD9A 3GL5A 2DIYA 1XZOA 2OE1A 2CZ3A 3WGEA 2BMXA 2AYTA 4D73A 2C3NA 2H8LA 3QAWA 5DAKB 3R2QA 4L8EA 1XFLA 1T4ZA 2AJQB 3HVSA 1RQMA 2C80A 3W6GA 1XW6A 3D0ZA 1AQVA 1GWCA 2YJ7A 4KSOA 3LQ7A 2PWJA 2CVDA 2GLRA 5ECMB 2R5GA 5JCUA 4X43A 4FYUA 4MZWA 2VLUA 2LTKA 2LNTA 4XS4A 1YY7A 4BVXA 1GLQA 2K9FA 2VL2A 4ID0A 4K7IA 4KDXA 4L5OA 1S3CA 4IKHA 2VD1A 4TKYA 2V41A 1Z6NA 4IS0A 5DDLA 2C0DA 3M1GA 13GSA 1PQNA 4JBBA 4NWYA 5IMVA 3Q74A 1T7PB 4IN0A 6GSSA 4IGJA 1LU4A 2IFQA 3KZQA 5H5QA 5EY6A 1Y25A 1JLVA 2JSYA 4XIHA 6GSTA 1IYHA 4MZBA 1PKWA 4DVCA 2TRCP 2LV3A 2CA8A 3KJYA 3J7Yk 3HYPA 3VFIA 2AV4A 2DJ3A 2H30A 3IHQA 4NMUA 1VGLA 2C0GA 5B7CA 2WGRA 4XS4B 1W4VA 3F4RA 1Q98A 4N0VA 2F51A 2WJUA 1GNWA 1OKTA 1MDJA 4ML1A 3DIEA 2H74A 5GAND 5IOWA 2OBKA 1WWJA 5J4UA 3FEUA 1LBKA 2GGTA 4XRDA 2O87A 3A3TA 1BAYA 1U3IA 4E8HA 2B3SA 1X9SB 2N5AA 1X9WB 3BOAA 3GKXA 3IOSA 1XW5A 4QQ7A 5HR1A 2B7KA 5ECRB 3BBYA 4EXJA 3HA9A 5E59A 2MMNA 2K18A 4PNGA 2O8VB 2YV9A 3W8SA 4H86A 4WR4A 3CBUA 4O32A 3O76A 1TP9A 4EUYA 1W89A 2RM6A 4GSSA 4N0ZA 5D9WA 3HJMA 5C04A 5DVBA 1E6BA 1ZOFA 3P90A 3ERWA 5G2ZA 1K0MA 1U87A 1XXUA 2V1MA 1EGRA 2DJKA 3GFKA 4YAVA 2FA8A 4TXVA 2MMAA 2GSQA 4Q5QA 4XRAA 3TKSE 1PL1A 2AHEA 2H6ZA 2VAFA 5ECLB 4DEJA 3GKMA 4WETA 4J56E 5CAXA 3H8QA 5AIVA 2PVOC 4PQIA 2KP2A 3TDGA 1Q4JA 3WGXA 5F06A 4K8MA 2V2GA 1AW9A 3CSIA 3QAVA 3C1RA 3QD9A 5ECPB 1SK1A 1TJDA 2VM2A 2PN8A 4TR0A 5HR0A 4EL1A 3FKFA 4PXOA 3U6VA 3DGQA 2C0EA 3KP9A 1TI1A 3HY2A 2CQ9A 5ECIB 3ZYWA 3BD2A 4ZL9A 2GSTA 1SKWB 2OADA 6GSUA 4POMA 2LKUA 3L9UA 2RUEA 3IRAA 19GSA 3ERGA 1UC7A 5EVOA 2XBIA 4ILFA 3TKRA 3TKSC 2FWGA 4MJBA 3UJ1A 5ABRA 2GTUA 1GSSA 4ECJA 2GQKA 2V32A 2VCVA 3ZRDA 2P5RA 2XHFA 2JZSA 2YPMA 2VOCA 5ECSA 3F4TA 1T8EB 1R5AA 2DBCA
chains in the Genus database with same CATH superfamily
4MCUA 1TK8B 4TVEA 2RM5A 3ZREA 5KN1A 1XWCA 2A2PA 1SKRB 1ERTA 2J23A 2XPEA 4TRXA 1FO5A 5DQYA 4MH2A 2KP1A 1ERWA 3KMOA 3KD0A 2YWNA 5J41A 2LRCA 2DMMA 5H5RA 4HS1A 4ECIA 3VWXA 1ZZYA 1FOHA 4POLA 4HSCX 1K0DA 4NPBA 4IQAA 2GSSA 1V2AA 2E7PA 1JHBA 3QOUA 4O92A 4X1UA 3IK7A 1B4PA 2GZZA 1AUCA 3ZMKA 1F2EA 4TW5A 3IDVA 3RHCA 5AIXA 4RI7A 2VLVA 3CTGA 4JZQA 3N5OA 5EL8A 3HXSA 3F6DA 1V9WA 2HI7A 2IJYA 4EC0A 1XBSA 3HZ8A 4EE0A 1A0FA 4IHUA 2LRTA 1PA3A 2JZTA 1VF3A 2VL3A 3DD3A 4MJEA 1TDIA 1JZDA 5G30A 3TUEA 3K8NA 2IL3A 4ISDA 4MH3A 2K8SA 3FR6A 3ZIJA 2GZYA 1URMA 2MBTA 3EINA 1SU9A 2KOKA 2PGTA 5F0GA 1OC8A 2FCHA 3APQA 3P8WA 3D6IA 4HJ2A 1PGTA 1QFNA 3KH9A 5G31A 4MNNA 4CHSA 4MPGA 6GSYA 4TXOA 2MYGA 3FZAA 3ZZXA 2BJXA 3VWWA 1A2MA 2VCTA 1XPVA 3VPTA 4MA9A 2I1UA 3M8NA 4RQRA 1S3DA 4F0BA 4K1FA 3A5IA 3IBHA 2X64A 5JWOB 4TN8A 2H0IA 5CYYA 4YKGA 1GSQA 1DBYA 1SJIA 1THXA 3LWAA 1RW1A 1HD2A 4K0GA 3G7IA 4NV2A 4GWRA 3UARA 4OWYA 3GTUB 2LJRA 4HU7A 4ZBBA 2AB6A 4GSTA 2X99A 1GULA 4DSRA 1FOVA 1ZMAA 1G7EA 1F37A 1I5GA 4AGSA 4LLRA 1FG4A 4ZBAA 1OAZA 1MEKA 1XWAA 1N8JA 5ECNB 5C00A 3FRCA 1G0TA 2IIYA 3I6AA 1XW9A 2O85A 2DKIA 4PURA 4F9ZA 1FHEA 2KHPA 3GYKA 4MF7A 2E2GA 4QL9A 2VCWA 4WKWA 2DLXA 1C72A 4O5RA 1V57A 4EDYA 1KBNA 4IELA 1Z7RA 2DMLA 2H0GA 3TB2A 4ZL8A 1Z9HA 3O6TA 3JCML 2IPAA 2LS5A 3EMXA 4TR1B 2YWIA 5HFGA 2HRNA 1T00A 2VCXA 2DJ1A 1ZGNA 2ON5A 3GH6A 3F0IA 1G6WA 4MZCA 1K0OA 3NOFA 1GUMA 5F05A 1O8WA 2LJKA 1WP0A 3APOA 1S3AA 5A4UA 2RLIA 2HYXA 1K3OA 3E0UA 2B5EA 2FNOA 3FZ9A 3CSHA 2GT5A 4TR3A 3L0HA 3A2VA 1PKZA 2GS3A 2REMA 1AC1A 7GSSA 4MF5A 5DJMA 4WEYA 4GQCA 2HRKA 4N11A 1G6YA 3GN3A 1J9BA 1JZRA 1B8XA 4N30A 1XOBA 2H73A 4HZ4A 4JU5A 3LYKA 2C1YA 3Q19A 2F8FA 2GSRA 2FY6A 4K0NA 4P3YB 5KOWA 3N9JA 5GZZB 3PPUA 5D73A 3D4TA 3IPZA 1SYXA 1VF1A 1GTBA 2R3XA 2I3YA 1QXHA 2F8AA 1FAAA 1M2BA 2WULA 4FQUA 3F4SA 3FR3A 5FHIA 2ALBA 2H1AA 2PBJA 1OE8A 2IMFA 4K9ZA 3EU4A 3EYTA 1CQHA 5ELAA 2IMIA 2VD0A 2H75A 3ZFLA 4JE1A 4GCIA 4O7HA 2R0GA 3FHKA 1XVWA 4NHZA 5EPFA 1GTAA 5JCWA 4PQHA 1T3BA 3EVIA 5INYA 3FZ4A 1NM3A 2JU5A 4CY8A 3TOTA 2R6KA 1DSBA 1BEDA 3D22A 3IA1A 4BA7A 4Z2TA 5IOXA 5JWQB 1FW1A 3LJRA 4KCAA 3KM6A 3IK9A 1GRXA 4XS1A 4D73B 2MZCA 3LFLA 4I2TA 5B8BA 2BTOT 1T4YA 3GIXA 2L59A 1GL8A 2C0FA 4V2LA 3G7JA 3H1NA 3EURA 4J2FA 2L6CA 3C71A 3RBTA 2VL2C 4GQFA 1Z6MA 1TW9A 10GSA 3O3TA 1A2JA 2B5XA 1I9DA 2KUCA 5IMAA 3HJOA 2EIQA 5AGYA 1ZYQB 2HFDA 1U6TA 2WRTA 3VURA 2HLSA 4EDZA 5ECKB 1K0BA 5IPGA 1GTUA 4V1Ag 3E3EA 3GL3A 5FWGA 4RI6A 3C8EA 4KAEA 4IVFA 3WT1A 1XCCA 5D8IA 2IN3A 1GUKA 2DJ2A 3UIWA 3UL3A 3EMPA 2ES7A 4XCSA 2CV4A 1G7OA 1GSEA 2M80A 4V2NA 3GRXA 2YZHA 4LA1A 5DQSA 5IM9A 12GSA 1M2DA 4KA0A 3TJFA 1LJRA 8GSSA 1XIYA 4DSQA 1HNBA 1WMJA 2A2SA 1U3AA 1J0FA 1HNCA 3HJPA 2IFQB 4YH2A 3U5RE 4KDYA 4F03A 1SK2A 1K3LA 2LEGA 4I5QA 5J5NA 1EWXA 3TKQA 3MWHA 3C1SA 3GUSA 3MNGA 3ZL5A 3PINA 3QDNA 4A5PA 3CRUA 1XOAA 3M3MA 3KP8A 4TR4A 2B1KA 3NZNA 2B5YA 2YWMA 2JACA 1PSQA 1ERUA 4OFNA 1EEJA 1AXDA 4HQSA 4L5LA 3BCIA 4EVMA 2LSTA 1PN9A 4NXIA 1H75A 2Z9SA 3UMAA 1S3RA 2P0GA 1O6JA 4MF6A 3KGKA 3VI5A 3DXBA 2CAQA 1GSFA 4FYCA 4NAXA 2JADA 2X4AA 3VI7A 1HQOA 4PGTA 3L78A 4IQ1A 1F9MA 1Z5YE 3CSJA 4HUAA 4MABA 5GSTA 5BRTA 3IXRA 3OR5A 2WS2A 2G2QA 2PVQA 2F3MA 1HNAA 3M9JA 4V2MA 1EP7A 5DALA 3VPQA 3P2AA 4ICYA 1PL2A 3KH7A 4CDOA 2H72A 2L4CA 3H93A 1TRUA 3ZMLA 4X4JA 1EV9A 2CT6A 4ZXGA 1DE1A 1TRWA 2MMZA 3KCMA 1GSYA 4WBRD 1X0RA 2GDRA 3I9V2 1TU8A 1O7UA 1O85A 1R5PA 3QAGA 1JLWA 4HOJA 1WRYA 3RHBA 4NHWA 4ZIJA 1X5DA 3UBKA 1PX7A 4KE3A 1RK4A 5GAPD 4JR6A 1YDKA 1CQGA 2CX3A 4I6XA 4KB3A 4WBJA 1R26A 1FB6A 3F3RA 4PTSA 4MP4A 3GA4A 5AISA 1EOGA 1PRXA 2VIMA 1TOFA 2DC5A 2QC7A 3KIJA 3HVVA 3ME8A 4OFTA 3DYRA 5A5KA 5HQPA 2QA2A 3GH9A 4OO5A 5FT3A 1V40A 5J9CA 1ZYEA 1GTIA 4BWSA 4OCFA 4AJ8A 4Z2RA 1O73A 1ST9A 2N5BA 2QGVA 5DALB 3KXOA 3QMXA 3MIXA 4KCEA 4BPYA 3HVXA 3GX8A 2FWEA 18GSA 4ZL7A 5KN3A 1O8XA 5AN1A 4POKA 4Q5RA 1QGVA 4XTSA 1TRVA 3D21A 4PQ1A 4F2IA 4MDCA 2H0HA 2TRXA 1A2LA 2DIZA 1R7HA 4MMMA 3LW9A 1PN0A 4HQZA 3CRTA 4IP1A 4ML6A 2OE3A 4Q5FA 2ZNMA 1DE2A 1ZYNA 5B6MA 3G9BA 4ZBDA 4Z7XA 5CRWA 1ZYPA 3F3QA 5CREA 3DKSA 3TRXA 2L5OA 1WPIA 2AUVA 4QL7A 1K0NA 1UA5A 3IR4A 2I81A 2FHEA 4MPFA 14GSA 2PU9C 1PFOA 9GSSA 2OE0A 4KH7A 3ZVJA 1ERVA 5IQYA 2I4AA 3APSA 2WFCA 3LSZA 4I2UA 4YKFA 3US3A 3DVXA 1UVZA 5IMFA 3F6FA 2D2ZA 2QSIA 5G5EA 3ISOA 4OMVA 2PUKC 4FYBA 5D9TA 1AQWA 3M0FA 1N2AA 2XBQA 3DMLA 1SL2B 3SBCA 3IV4A 5IO2A 4DSSA 3VLNA 1GLPA 4F82A 2E2MA 4MJAA 3UBLA 4IP6A 3ZVJD 1QQ2A 4Z2UA 5HFIA 3A2WA 4HDEA 2H76A 3UOMA 4KW6A 2HSYA 1KEBA 3IAM2 1X9MB 1GNEA 4PX1A 4MK3A 1GH2A 4WF5A 1A8YA 2E0QA 5A4WA 5J3RA 1MD4A 1SJ6A 3CYNA 3SWLA 4PUFC 1JZOA 2WB9A 1TI3A 1OKDA 4TXOB 1DUGA 2H6YA 2FD3A 2HZEA 5E4WA 5LD0A 2OACA 2JZRA 4WXTA 11GSA 4HEA2 4BL7A 4XHMA 3IC4A 5ID2A 1QUWA 2EIRA 3R3EA 1Z3EA 2P31A 4TOPA 1SD8A 3D5JA 3HVNA 1PMTA 4KSMA 5GSSA 3FZ5A 5JWRB 3F8UA 4GTUA 1M2AA 4EKZA 3PH9A 1BG5A 4KUNA 1JZWA 3DEXA 3A2XA 3GMFA 3TOUA 22GSA 4OO4A 4G9HA 3DVWA 3M9KA 2B1LA 2H01A 3CMIA 1MTCA 2VUPA 5H5SA 2J9HA 2ON7A 2R0PA 1M9AA 3PGTA 1WJKA 1B9YC 2UZ8A 4JR4A 3QCPA 2R37A 4K5RA 3KMNA 4IJ3A 2WDUA 3CQFA 2K8VA 2L6DA 2HT9A 2V6KA 3TCOA 1FB0A 3H4KA 3EU3A 5KEJA 3GKKA 1V98A 1GSUA 2HXKA 3ERFA 1M9BA 3TKPA 1B48A 1TRSA 1OC3A 5DBQA 4I97A 3BCKA 1F3AA 2L57A 4YAPA 1YF0A 3AY8A 5CRGA 1OYJA 2C4JA 2N5FA 3FY7A 5ID2B 3NIVA 1VF4A 2L5LA 1ILOA 1Y6EA 5ELGA 5ENUA 5F8BA 4Q5NA 3LORA 4PUAA 2ZUPA 3MAKA 4E8EA 5ECQB 3C73A 5D93A 4HU9A 2YCDA 3HKRA 4J57E 2XC2A 1ON4A 1NHYA 2FWHA 2ZCTA 3RPNA 2A4VA 2G0FA 2XPDA 2YN1A 6GSWA 2OBIA 4ECCA 1EV4A 5IMCA 2C3QA 2NPBA 3UEMA 3LGCA 4YQUA 1KNGA 3FYGA 1M3IA 3QPMA 1SL1B 2HSHA 2M72A 4BVYA 4KDUA 1ZCPA 5HR2A 4RUVA 1O81A 1M7TA 4HZ2A 4OFMA 3D4MA 4XS6A 2JSZA 1VF2A 3H79A 4V1Ap 3UAPA 1OC9A 4G2EA 2R4VA 2LUSA 3GSTA 1R4WA 1VRSD 4K6XA 4BWQA 5DJLA 1OVNA 3HDCA 2HRFA 5CRDA 5IMDA 4G10A 5HR3A 3UVTA 2HE3A 2RUFA 2CX4A 3HZ4A 1BYEA 4WR5A 3ZITA 2A2RA 2VCQA 2MBSA 5D9XA 5B8AA 1XVQA 1YJ6A 5JCGA 1ML6A 3GSSA 1H4OA 1A23A 3ZIVA 4YQMA 1SENA 1QMVA 3MSZA 4MLYA 3EWLA 1YKCA 2JL4A 3CTFA 3CXGA 4BVYB 1YEPA 4EF0A 2FWFA 6GSXA 2OA7A 3ZFBA 16GSA 3A5WA 1OC9B 1UN2A 3ME7A 4G0IA 2DJ0A 1AQXA 3VK9A 1AAZA 1YQ1A 1WIKA 2H1GA 2FGXA 2MMOA 3GURA 3IE3A 1HYUA 2GZPA 2F9SA 2O89A 1WE0A 4L0WA 3PR8A 4L0UA 2V6OA 3TKSA 2HZFA 5B6NA 1YZXA 3FR9A 3QFBC 3TJKA 3QFAC 4CY6A 4K7OA 2YZUA 2PPTA 2KLXA 3RDWA 2R0CA 5G1LA 4EO3A 1A0RP 2A4HA 3RPPA 1EOHA 4OCEA 3G7YA 1X5CA 1ZL9A 3I43A 4ULXA 2WCIA 4GRFA 4GSNA 4IJIA 4IW9A 2DSAA 2M46A 5D96A 2RIIA 1B4QA 1NHOA 2CZ2A 2DKHA 2GVPA 4G19A 3KTLA 2H1DA 5CO3A 1SJZA 4N10A 1XWBA 4KGIA 2PMTA 2EIOA 4FIWA 5KOXA 4YQVA 3DWVA 2C8UA 3ZLPA 3WYWA 5D9VA 2NDOA 3V1WA 1SK0A 3E9JB 1MDKA 1XWKA 3TRQA 1TU7A 3Q18A 3GX0A 2B7JA 1Z7PA 3VWUA 4GXZA 4G0KA 2LQQA 4AJ6A 2GQLA 2NTOA 4EIPA 1OE7A 3FW2A 1M3JA 2QKEA 4LL4B 1IYIA 3P7XA 5G5FA 1MD3A 3MDKA 3HHVA 2NBSA 3Q6OA 3LXZA 3BJ5A 3TJBA 3F9UA 1SKSB 17GSA 3J7Yb 1F3BA 3GV1A 3KTBA 3LEFA 5J9BA 2YANA 2C3TA 2WZ9A 1A24A 1E2YA 4LL1B 5COHA 3F63A 2H66A 1EP8A 3IC8A 1M99A 5A4VA 3IHGA 1X5EA 3GKNA 4BIKA 5F07A 1XWGA 3LG6A 4ZB6A 2H19A 2YOIA 3L4NA 3GHAA 1T1VA 2VM1A 1J08A 1GSDA 3S9FA 2R2JA 4JEDA 4F0CA 4OD7A 2LQOA 2YNXA 3TJJA 2H1BA 2X8HA 5CP1A 5G1KA 4O5UA 1MDIA 5CNWA 2FUG2 2LNSA 2YV7A 2YWOA 1PX6A 4LMVA 5ECHB 4WF4A 2VLTA 4ACSA 4ZB9A 3GTUA 4POBA 2NVLA 2LRNA 4JRRA 3WT2A 2CAIA 5IO0A 3UVHA 3LXTA 3WD6A 5IMZA 1YKAA 5DCGA 3HCZA 4IBPA 3DRNA 3VWVA 2O7KA 3IAS2 3C7MA 3FMWA 3GNJA 2IMKA 3HD5A 4ZILA 3I69A 1NSWA 1TXXA 2TIRA 2HNLA 1TK0B 2X8GA 1QK8A 5DCHA 3TJGA 3EE2A 4AJ7A 1NW2A 3EC3A 1JFUA 1SYRA 1U88A 1ACVA 1KTEA 2L4QA 5HFKA 1K0CA 4AF2A 2VO4A 3TRPA 4K2DA 1EGOA 4PNFA 4ZB8A 1BQ7A 1A8LA 3KEBA 3L9VA 2YJHA 4K7NA 2VCZA 1PD21 3QR6A 4TR1A 4USSA 1BX9A 4G0LA 1THOA 2AAWA 5KN2A 1FVKA 5LCZA 2X8CA 1TKDB 5LNKe 1YF1A 1F6MC 1GUHA 1M0UA 3RAZA 4MJCA 5L71A 2H6XA 1K0AA 2VL9A 2P5QA 1EZKA 2H71A 2OKAA 2OJLA 3ED3A 4NV5A 4FH8A 3TGZA 4KX4A 1K3YA 2I9HA 1ABAA 1TTZA 1YEXA 3ZTLA 4RQXA 1WOUA 5IPHA 2H70A 3LYPA 1V58A 4LMWA 5DAKA 1SL0B 4HJMA 2YP6A 2QA1A 4I8BA 2IMDA 6GSVA 3L9SA 2CVBA 5CRHA 3WGDA 2GT6A 4KNDA 1B9XC 5IIZA 2HSMA 4DSSB 1AIUA 2EC4A 3FK8A 1GP1A 2IWTA 5ECOB 20GSA 2DJJA 1EEMA 4GLTA 2IMEA 1BJXA 1USBA 2CVKA 4CW9A 2K6VA 4GF0A 2PERA 1TK5B 2FLSA 4FO5A 1FVJA 2FA4A 2LJAA 4HI7A 2B6MA 5KN0A 2HZEB 3W8JA 4X0XA 4ECBA 2GQMA 1SD9A 3GL5A 2DIYA 1XZOA 2OE1A 2CZ3A 3WGEA 2BMXA 2AYTA 4D73A 2C3NA 2H8LA 3QAWA 5DAKB 3R2QA 4L8EA 1XFLA 1T4ZA 2AJQB 3HVSA 1RQMA 2C80A 3W6GA 1XW6A 4BL7B 3D0ZA 1AQVA 1GWCA 2YJ7A 4KSOA 3LQ7A 2PWJA 2CVDA 2GLRA 5ECMB 2R5GA 5JCUA 4X43A 4FYUA 4MZWA 2VLUA 2LTKA 2LNTA 4XS4A 1YY7A 4BVXA 1GLQA 2K9FA 2VL2A 3EPTA 4ID0A 4K7IA 4KDXA 4L5OA 1S3CA 4IKHA 2VD1A 4TKYA 2X49A 4K2XA 2V41A 1Z6NA 4IS0A 5DDLA 2C0DA 3M1GA 13GSA 1PQNA 4JBBA 4NWYA 5IMVA 3Q74A 1T7PB 4IN0A 6GSSA 4IGJA 1LU4A 2IFQA 3KZQA 5H5QA 5EY6A 1XG8A 1Y25A 1JLVA 2JSYA 4XIHA 6GSTA 1IYHA 4MZBA 1PKWA 4DVCA 5BMUA 2TRCP 2LV3A 2CA8A 3KJYA 3J7Yk 3HYPA 3VFIA 4EIQA 2AV4A 2DJ3A 2H30A 3IHQA 4NMUA 1VGLA 2C0GA 5B7CA 2WGRA 4XS4B 4O5QA 1W4VA 3F4RA 4KF9A 4BVXB 1Q98A 2HRAA 4N0VA 2F51A 2WJUA 1GNWA 1OKTA 1MDJA 4ML1A 3DIEA 2H74A 5GAND 5IOWA 2OBKA 1WWJA 5J4UA 3FEUA 1LBKA 2GGTA 4XRDA 2O87A 3A3TA 1BAYA 1U3IA 4E8HA 2B3SA 1X9SB 2N5AA 1X9WB 3BOAA 3GKXA 3IOSA 1XW5A 4QQ7A 5HR1A 2B7KA 5ECRB 3BBYA 4EXJA 3HA9A 5E59A 2MMNA 2K18A 4PNGA 2O8VB 2YV9A 3W8SA 4H86A 4WR4A 3CBUA 4O32A 3O76A 1TP9A 4EUYA 1W89A 2RM6A 4GSSA 4N0ZA 5D9WA 3HJMA 5C04A 5DVBA 1E6BA 1ZOFA 3P90A 3ERWA 5G2ZA 1K0MA 1U87A 3MYDA 1XXUA 2V1MA 1EGRA 2DJKA 3GFKA 4YAVA 2FA8A 4TXVA 2MMAA 2GSQA 4Q5QA 4XRAA 3TKSE 1PL1A 2AHEA 2H6ZA 2VAFA 5ECLB 4DEJA 3GKMA 4WETA 4J56E 5CAXA 3H8QA 5AIVA 2PVOC 4PQIA 2KP2A 3TDGA 1Q4JA 3WGXA 5F06A 4K8MA 2V2GA 1AW9A 3CSIA 3QAVA 3C1RA 4K5SA 3QD9A 5ECPB 1SK1A 1TJDA 2VM2A 2PN8A 4TR0A 5HR0A 4EL1A 3FKFA 4PXOA 3U6VA 3DGQA 2C0EA 3KP9A 1TI1A 3HY2A 2CQ9A 5ECIB 3ZYWA 3BD2A 4ZL9A 2GSTA 1SKWB 2OADA 6GSUA 4POMA 2LKUA 3L9UA 2RUEA 3IRAA 19GSA 3ERGA 1UC7A 5EVOA 2XBIA 4ILFA 3TKRA 3TKSC 2FWGA 4MJBA 3UJ1A 5ABRA 2GTUA 1GSSA 4ECJA 2GQKA 2V32A 2VCVA 3ZRDA 2P5RA 2XHFA 2JZSA 2YPMA 2VOCA 5ECSA 3F4TA 1T8EB 1R5AA 2DBCA
chains in the Genus database with same CATH topology
4MCUA 1TK8B 4TVEA 2RM5A 3ZREA 5KN1A 1XWCA 2A2PA 1SKRB 1ERTA 2J23A 2XPEA 4TRXA 1FO5A 5DQYA 4MH2A 2KP1A 1ERWA 3KMOA 3KD0A 2YWNA 5J41A 2LRCA 2DMMA 5H5RA 4HS1A 4ECIA 3VWXA 1ZZYA 1FOHA 4POLA 1K0DA 4NPBA 4IQAA 2GSSA 1V2AA 2E7PA 1JHBA 3QOUA 4O92A 4X1UA 3IK7A 1B4PA 2GZZA 1AUCA 3ZMKA 1F2EA 4TW5A 3IDVA 3RHCA 5AIXA 4RI7A 2VLVA 3CTGA 4JZQA 3N5OA 5EL8A 3HXSA 3F6DA 1V9WA 2HI7A 2IJYA 4EC0A 1XBSA 3HZ8A 4EE0A 1A0FA 4IHUA 2LRTA 1PA3A 2JZTA 1VF3A 2VL3A 3DD3A 4MJEA 1TDIA 1JZDA 5G30A 3TUEA 3K8NA 2IL3A 4ISDA 4MH3A 2K8SA 3FR6A 3ZIJA 2GZYA 1URMA 2MBTA 3EINA 1SU9A 2KOKA 2PGTA 5F0GA 1OC8A 2FCHA 3APQA 3P8WA 3D6IA 4HJ2A 1PGTA 1QFNA 3KH9A 5G31A 4MNNA 4CHSA 4MPGA 6GSYA 4TXOA 2MYGA 3FZAA 3ZZXA 2BJXA 3VWWA 1A2MA 2VCTA 1XPVA 3VPTA 4MA9A 2I1UA 3M8NA 4RQRA 1S3DA 4F0BA 4K1FA 3A5IA 3IBHA 2X64A 5JWOB 4TN8A 2H0IA 5CYYA 4YKGA 1GSQA 1DBYA 1SJIA 1THXA 3LWAA 1RW1A 1HD2A 4K0GA 3G7IA 4NV2A 4GWRA 3UARA 4OWYA 3GTUB 2LJRA 4HU7A 4ZBBA 2AB6A 4GSTA 2X99A 1GULA 4DSRA 1FOVA 1ZMAA 1G7EA 1F37A 1I5GA 4AGSA 4LLRA 1FG4A 4ZBAA 1OAZA 1MEKA 1XWAA 1N8JA 5ECNB 5C00A 3FRCA 1G0TA 2IIYA 3I6AA 1XW9A 2O85A 2DKIA 4PURA 4F9ZA 1FHEA 2KHPA 3GYKA 4MF7A 2E2GA 4QL9A 2VCWA 4WKWA 2DLXA 1C72A 4O5RA 1V57A 4EDYA 1KBNA 4IELA 1Z7RA 2DMLA 2H0GA 3TB2A 4ZL8A 1Z9HA 3O6TA 3JCML 2IPAA 2LS5A 3EMXA 4TR1B 2YWIA 5HFGA 2HRNA 1T00A 2VCXA 2DJ1A 1ZGNA 2ON5A 3GH6A 3F0IA 1G6WA 4MZCA 1K0OA 3NOFA 1GUMA 5F05A 1O8WA 2LJKA 1WP0A 3APOA 1S3AA 5A4UA 2RLIA 2HYXA 1K3OA 3E0UA 2B5EA 2FNOA 3FZ9A 3CSHA 2GT5A 4TR3A 3L0HA 3A2VA 1PKZA 2GS3A 2REMA 1AC1A 7GSSA 4MF5A 5DJMA 4WEYA 4GQCA 2HRKA 4N11A 1G6YA 3GN3A 1J9BA 1JZRA 1B8XA 4N30A 1XOBA 2H73A 4HZ4A 4JU5A 3LYKA 2C1YA 3Q19A 2F8FA 2GSRA 2FY6A 4K0NA 4P3YB 5KOWA 3N9JA 5GZZB 3PPUA 5D73A 3D4TA 3IPZA 1SYXA 1VF1A 1GTBA 2R3XA 2I3YA 1QXHA 2F8AA 1FAAA 1M2BA 2WULA 4FQUA 3F4SA 3FR3A 5FHIA 2ALBA 2H1AA 2PBJA 1OE8A 2IMFA 4K9ZA 3EU4A 3EYTA 1CQHA 5ELAA 2IMIA 2VD0A 2H75A 3ZFLA 4JE1A 4GCIA 4O7HA 2R0GA 3FHKA 1XVWA 4NHZA 5EPFA 1GTAA 5JCWA 4PQHA 1T3BA 3EVIA 5INYA 3FZ4A 1NM3A 2JU5A 4CY8A 3TOTA 2R6KA 1DSBA 1BEDA 3D22A 3IA1A 4BA7A 4Z2TA 5IOXA 5JWQB 1FW1A 3LJRA 4KCAA 3KM6A 3IK9A 1GRXA 4XS1A 4D73B 2MZCA 3LFLA 4I2TA 5B8BA 2BTOT 1T4YA 3GIXA 2L59A 1GL8A 2C0FA 4V2LA 3G7JA 3H1NA 3EURA 4J2FA 2L6CA 3C71A 3RBTA 2VL2C 4GQFA 1Z6MA 1TW9A 10GSA 3O3TA 1A2JA 2B5XA 1I9DA 2KUCA 5IMAA 3HJOA 2EIQA 5AGYA 1ZYQB 2HFDA 1U6TA 2WRTA 3VURA 2HLSA 4EDZA 5ECKB 1K0BA 5IPGA 1GTUA 4V1Ag 3E3EA 3GL3A 5FWGA 4RI6A 3C8EA 4KAEA 4IVFA 3WT1A 1XCCA 5D8IA 2IN3A 1GUKA 2DJ2A 3UIWA 3UL3A 3EMPA 2ES7A 4XCSA 2CV4A 1G7OA 1GSEA 2M80A 4V2NA 3GRXA 2YZHA 4LA1A 5DQSA 5IM9A 12GSA 1M2DA 4KA0A 3TJFA 1LJRA 8GSSA 1XIYA 4DSQA 1HNBA 1WMJA 2A2SA 1U3AA 1J0FA 1HNCA 3HJPA 2IFQB 4YH2A 3U5RE 4KDYA 4F03A 1SK2A 1K3LA 2LEGA 4I5QA 5J5NA 1EWXA 3TKQA 3MWHA 3C1SA 3GUSA 3MNGA 3ZL5A 3PINA 3QDNA 4A5PA 3CRUA 1XOAA 3M3MA 3KP8A 4TR4A 2B1KA 3NZNA 2B5YA 2YWMA 2JACA 1PSQA 1ERUA 4OFNA 1EEJA 1AXDA 4HQSA 4L5LA 3BCIA 4EVMA 2LSTA 1PN9A 4NXIA 1H75A 2Z9SA 3UMAA 2P0GA 1O6JA 4MF6A 3KGKA 3VI5A 3DXBA 2CAQA 1GSFA 4FYCA 4NAXA 2JADA 2X4AA 3VI7A 1HQOA 4PGTA 3L78A 4IQ1A 1F9MA 1Z5YE 3CSJA 4HUAA 4MABA 5GSTA 5BRTA 3IXRA 3OR5A 2WS2A 2G2QA 2PVQA 2F3MA 1HNAA 3M9JA 4V2MA 1EP7A 5DALA 3VPQA 3P2AA 4ICYA 1PL2A 3KH7A 4CDOA 2H72A 2L4CA 3H93A 1TRUA 3ZMLA 4X4JA 1EV9A 2CT6A 4ZXGA 1DE1A 1TRWA 2MMZA 3KCMA 1GSYA 4WBRD 1X0RA 2GDRA 3I9V2 1TU8A 1O7UA 1O85A 1R5PA 3QAGA 1JLWA 4HOJA 1WRYA 3RHBA 4NHWA 4ZIJA 1X5DA 3UBKA 1PX7A 4KE3A 1RK4A 5GAPD 4JR6A 1YDKA 1CQGA 2CX3A 4I6XA 4KB3A 4WBJA 1R26A 1FB6A 3F3RA 4PTSA 4MP4A 3GA4A 5AISA 1EOGA 1PRXA 2VIMA 1TOFA 2DC5A 2QC7A 3KIJA 3HVVA 3ME8A 4OFTA 3DYRA 5A5KA 5HQPA 2QA2A 3GH9A 4OO5A 5FT3A 1V40A 5J9CA 1ZYEA 1GTIA 4BWSA 4OCFA 4AJ8A 4Z2RA 1O73A 1ST9A 2N5BA 2QGVA 5DALB 3KXOA 3QMXA 3MIXA 4KCEA 4BPYA 3HVXA 3GX8A 2FWEA 18GSA 4ZL7A 5KN3A 1O8XA 5AN1A 4POKA 4Q5RA 1QGVA 4XTSA 1TRVA 3D21A 4PQ1A 4F2IA 4MDCA 2H0HA 2TRXA 1A2LA 2DIZA 1R7HA 4MMMA 3LW9A 1PN0A 4HQZA 3CRTA 4IP1A 4ML6A 2OE3A 4Q5FA 2ZNMA 1DE2A 1ZYNA 5B6MA 3G9BA 4ZBDA 4Z7XA 5CRWA 1ZYPA 3F3QA 5CREA 3DKSA 3TRXA 2L5OA 1WPIA 2AUVA 4QL7A 1K0NA 1UA5A 3IR4A 2I81A 2FHEA 4MPFA 14GSA 2PU9C 9GSSA 2OE0A 4KH7A 3ZVJA 1ERVA 5IQYA 2I4AA 3APSA 2WFCA 3LSZA 4I2UA 4YKFA 3US3A 3DVXA 1UVZA 5IMFA 3F6FA 2D2ZA 2QSIA 5G5EA 3ISOA 4OMVA 2PUKC 4FYBA 5D9TA 1AQWA 3M0FA 1N2AA 2XBQA 3DMLA 1SL2B 3SBCA 3IV4A 5IO2A 4DSSA 3VLNA 1GLPA 4F82A 2E2MA 4MJAA 3UBLA 4IP6A 3ZVJD 1QQ2A 4Z2UA 5HFIA 3A2WA 4HDEA 2H76A 3UOMA 4KW6A 2HSYA 1KEBA 3IAM2 1X9MB 1GNEA 4PX1A 4MK3A 1GH2A 4WF5A 1A8YA 2E0QA 5A4WA 5J3RA 1MD4A 1SJ6A 3CYNA 3SWLA 4PUFC 1JZOA 2WB9A 1TI3A 1OKDA 4TXOB 1DUGA 2H6YA 2FD3A 2HZEA 5E4WA 5LD0A 2OACA 2JZRA 4WXTA 11GSA 4HEA2 4BL7A 4XHMA 3IC4A 5ID2A 1QUWA 2EIRA 3R3EA 1Z3EA 2P31A 4TOPA 1SD8A 3D5JA 1PMTA 4KSMA 5GSSA 3FZ5A 5JWRB 3F8UA 4GTUA 1M2AA 4EKZA 3PH9A 1BG5A 4KUNA 1JZWA 3DEXA 3A2XA 3GMFA 3TOUA 22GSA 4OO4A 4G9HA 3DVWA 3M9KA 2B1LA 2H01A 3CMIA 1MTCA 2VUPA 5H5SA 2J9HA 2ON7A 2R0PA 1M9AA 3PGTA 1WJKA 1B9YC 2UZ8A 4JR4A 3QCPA 2R37A 4K5RA 3KMNA 4IJ3A 2WDUA 2K8VA 2L6DA 2HT9A 2V6KA 3TCOA 1FB0A 3H4KA 3EU3A 5KEJA 3GKKA 1V98A 1GSUA 2HXKA 3ERFA 1M9BA 3TKPA 1B48A 1TRSA 1OC3A 5DBQA 4I97A 3BCKA 1F3AA 2L57A 4YAPA 1YF0A 3AY8A 5CRGA 1OYJA 2C4JA 2N5FA 3FY7A 5ID2B 3NIVA 1VF4A 2L5LA 1ILOA 1Y6EA 5ELGA 5ENUA 5F8BA 4Q5NA 3LORA 4PUAA 2ZUPA 3MAKA 4E8EA 5ECQB 3C73A 5D93A 4HU9A 2YCDA 3HKRA 4J57E 2XC2A 1ON4A 1NHYA 2FWHA 2ZCTA 3RPNA 2A4VA 2G0FA 2XPDA 2YN1A 6GSWA 2OBIA 4ECCA 1EV4A 5IMCA 2C3QA 2NPBA 3UEMA 3LGCA 4YQUA 1KNGA 3FYGA 3QPMA 1SL1B 2HSHA 2M72A 4BVYA 4KDUA 1ZCPA 5HR2A 4RUVA 1O81A 1M7TA 4HZ2A 4OFMA 3D4MA 4XS6A 2JSZA 1VF2A 3H79A 4V1Ap 3UAPA 1OC9A 4G2EA 2R4VA 2LUSA 3GSTA 1R4WA 1VRSD 4K6XA 4BWQA 5DJLA 1OVNA 3HDCA 2HRFA 5CRDA 5IMDA 4G10A 5HR3A 3UVTA 2HE3A 2RUFA 2CX4A 3HZ4A 1BYEA 4WR5A 3ZITA 2A2RA 2VCQA 2MBSA 5D9XA 5B8AA 1XVQA 1YJ6A 5JCGA 1ML6A 3GSSA 1H4OA 1A23A 3ZIVA 4YQMA 1SENA 1QMVA 3MSZA 4MLYA 3EWLA 1YKCA 2JL4A 3CTFA 3CXGA 4BVYB 1YEPA 4EF0A 2FWFA 6GSXA 2OA7A 3ZFBA 16GSA 3A5WA 1OC9B 1UN2A 3ME7A 4G0IA 2DJ0A 1AQXA 3VK9A 1AAZA 1YQ1A 1WIKA 2H1GA 2FGXA 2MMOA 3GURA 3IE3A 1HYUA 2GZPA 2F9SA 2O89A 1WE0A 4L0WA 3PR8A 4L0UA 2V6OA 3TKSA 2HZFA 5B6NA 1YZXA 3FR9A 3QFBC 3TJKA 3QFAC 4CY6A 4K7OA 2YZUA 2PPTA 2KLXA 3RDWA 2R0CA 5G1LA 4EO3A 1A0RP 2A4HA 3RPPA 1EOHA 4OCEA 3G7YA 1X5CA 1ZL9A 3I43A 4ULXA 2WCIA 4GRFA 4GSNA 4IJIA 4IW9A 2DSAA 2M46A 5D96A 2RIIA 1B4QA 1NHOA 2CZ2A 2DKHA 2GVPA 4G19A 3KTLA 2H1DA 5CO3A 1SJZA 4N10A 1XWBA 4KGIA 2PMTA 2EIOA 4FIWA 5KOXA 4YQVA 3DWVA 2C8UA 3ZLPA 3WYWA 5D9VA 2NDOA 3V1WA 1SK0A 3E9JB 1MDKA 1XWKA 3TRQA 1TU7A 3Q18A 3GX0A 2B7JA 1Z7PA 3VWUA 4GXZA 4G0KA 2LQQA 4AJ6A 2GQLA 2NTOA 4EIPA 1OE7A 3FW2A 2QKEA 4LL4B 1IYIA 3P7XA 5G5FA 1MD3A 3MDKA 3HHVA 2NBSA 3Q6OA 3LXZA 3BJ5A 3TJBA 3F9UA 1SKSB 17GSA 3J7Yb 1F3BA 3GV1A 3KTBA 3LEFA 5J9BA 2YANA 2C3TA 2WZ9A 1A24A 1E2YA 4LL1B 5COHA 3F63A 2H66A 1EP8A 3IC8A 1M99A 5A4VA 3IHGA 1X5EA 3GKNA 5F07A 1XWGA 3LG6A 4ZB6A 2H19A 2YOIA 3L4NA 3GHAA 1T1VA 2VM1A 1J08A 1GSDA 3S9FA 2R2JA 4JEDA 4F0CA 4OD7A 2LQOA 2YNXA 3TJJA 2H1BA 2X8HA 5CP1A 5G1KA 4O5UA 1MDIA 5CNWA 2FUG2 2LNSA 2YV7A 2YWOA 1PX6A 4LMVA 5ECHB 4WF4A 2VLTA 4ACSA 4ZB9A 3GTUA 4POBA 2NVLA 2LRNA 4JRRA 3WT2A 2CAIA 5IO0A 3UVHA 3LXTA 3WD6A 5IMZA 1YKAA 5DCGA 3HCZA 4IBPA 3DRNA 3VWVA 2O7KA 3IAS2 3C7MA 3FMWA 3GNJA 2IMKA 3HD5A 4ZILA 3I69A 1NSWA 1TXXA 2TIRA 2HNLA 1TK0B 2X8GA 1QK8A 5DCHA 3TJGA 3EE2A 4AJ7A 1NW2A 3EC3A 1JFUA 1SYRA 1U88A 1ACVA 1KTEA 2L4QA 5HFKA 1K0CA 4AF2A 2VO4A 3TRPA 4K2DA 1EGOA 4PNFA 4ZB8A 1BQ7A 1A8LA 3KEBA 3L9VA 2YJHA 4K7NA 2VCZA 1PD21 3QR6A 4TR1A 4USSA 1BX9A 4G0LA 1THOA 2AAWA 5KN2A 1FVKA 5LCZA 2X8CA 1TKDB 5LNKe 1YF1A 1F6MC 1GUHA 1M0UA 3RAZA 4MJCA 5L71A 2H6XA 1K0AA 2VL9A 2P5QA 1EZKA 2H71A 2OKAA 2OJLA 3ED3A 4NV5A 4FH8A 3TGZA 4KX4A 1K3YA 2I9HA 1ABAA 1TTZA 1YEXA 3ZTLA 4RQXA 1WOUA 5IPHA 2H70A 3LYPA 1V58A 4LMWA 5DAKA 1SL0B 4HJMA 2YP6A 2QA1A 4I8BA 2IMDA 6GSVA 3L9SA 2CVBA 5CRHA 3WGDA 2GT6A 4KNDA 1B9XC 5IIZA 2HSMA 4DSSB 1AIUA 2EC4A 3FK8A 1GP1A 2IWTA 5ECOB 20GSA 2DJJA 1EEMA 4GLTA 2IMEA 1BJXA 1USBA 2CVKA 4CW9A 2K6VA 4GF0A 2PERA 1TK5B 2FLSA 4FO5A 1FVJA 2FA4A 2LJAA 4HI7A 2B6MA 5KN0A 2HZEB 3W8JA 4X0XA 4ECBA 2GQMA 1SD9A 3GL5A 2DIYA 1XZOA 2OE1A 2CZ3A 3WGEA 2BMXA 2AYTA 4D73A 2C3NA 2H8LA 3QAWA 5DAKB 3R2QA 4L8EA 1XFLA 1T4ZA 2AJQB 3HVSA 1RQMA 2C80A 3W6GA 1XW6A 4BL7B 3D0ZA 1AQVA 1GWCA 2YJ7A 4KSOA 3LQ7A 2PWJA 2CVDA 2GLRA 5ECMB 2R5GA 5JCUA 4X43A 4FYUA 4MZWA 2VLUA 2LTKA 2LNTA 4XS4A 1YY7A 4BVXA 1GLQA 2K9FA 2VL2A 3EPTA 4ID0A 4K7IA 4KDXA 4L5OA 1S3CA 4IKHA 2VD1A 4TKYA 2X49A 4K2XA 2V41A 1Z6NA 4IS0A 5DDLA 2C0DA 3M1GA 13GSA 1PQNA 4JBBA 4NWYA 5IMVA 3Q74A 1T7PB 4IN0A 6GSSA 4IGJA 1LU4A 2IFQA 3KZQA 5H5QA 5EY6A 1Y25A 1JLVA 2JSYA 4XIHA 6GSTA 1IYHA 4MZBA 1PKWA 4DVCA 5BMUA 2TRCP 2LV3A 2CA8A 3KJYA 3J7Yk 3HYPA 3VFIA 4EIQA 2AV4A 2DJ3A 2H30A 3IHQA 4NMUA 1VGLA 2C0GA 5B7CA 2WGRA 4XS4B 4O5QA 1W4VA 3F4RA 4KF9A 4BVXB 1Q98A 2HRAA 4N0VA 2F51A 2WJUA 1GNWA 1OKTA 1MDJA 4ML1A 3DIEA 2H74A 5GAND 5IOWA 2OBKA 1WWJA 5J4UA 3FEUA 1LBKA 2GGTA 4XRDA 2O87A 3A3TA 1BAYA 1U3IA 4E8HA 2B3SA 1X9SB 2N5AA 1X9WB 3BOAA 3GKXA 3IOSA 1XW5A 4QQ7A 5HR1A 2B7KA 5ECRB 3BBYA 4EXJA 3HA9A 5E59A 2MMNA 2K18A 4PNGA 2O8VB 2YV9A 3W8SA 4H86A 4WR4A 3CBUA 4O32A 3O76A 1TP9A 4EUYA 1W89A 2RM6A 4GSSA 4N0ZA 5D9WA 3HJMA 5C04A 5DVBA 1E6BA 1ZOFA 3P90A 3ERWA 5G2ZA 1K0MA 1U87A 3MYDA 1XXUA 2V1MA 1EGRA 2DJKA 3GFKA 4YAVA 2FA8A 4TXVA 2MMAA 2GSQA 4Q5QA 4XRAA 3TKSE 1PL1A 2AHEA 2H6ZA 2VAFA 5ECLB 4DEJA 3GKMA 4WETA 4J56E 5CAXA 3H8QA 5AIVA 2PVOC 4PQIA 2KP2A 3TDGA 1Q4JA 3WGXA 5F06A 4K8MA 2V2GA 1AW9A 3CSIA 3QAVA 3C1RA 4K5SA 3QD9A 5ECPB 1SK1A 1TJDA 2VM2A 2PN8A 4TR0A 5HR0A 4EL1A 3FKFA 4PXOA 3U6VA 3DGQA 2C0EA 3KP9A 1TI1A 3HY2A 2CQ9A 5ECIB 3ZYWA 3BD2A 4ZL9A 2GSTA 1SKWB 2OADA 6GSUA 4POMA 2LKUA 3L9UA 2RUEA 3IRAA 19GSA 3ERGA 1UC7A 5EVOA 2XBIA 4ILFA 3TKRA 3TKSC 2FWGA 4MJBA 3UJ1A 5ABRA 2GTUA 1GSSA 4ECJA 2GQKA 2V32A 2VCVA 3ZRDA 2P5RA 2XHFA 2JZSA 2YPMA 2VOCA 5ECSA 3F4TA 1T8EB 1R5AA 2DBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MCU A;  1TK8 B;  4TVE A;  2RM5 A;  3ZRE A;  5KN1 A;  1XWC A;  1SKR B;  1ERT A;  2J23 A;  2XPE A;  4TRX A;  1FO5 A;  5DQY A;  4MH2 A;  2KP1 A;  1ERW A;  3KMO A;  3KD0 A;  2YWN A;  5J41 A;  2LRC A;  2DMM A;  5H5R A;  4HS1 A;  4ECI A;  3VWX A;  1ZZY A;  4POL A;  1K0D A;  4NPB A;  4IQA A;  2GSS A;  1V2A A;  2E7P A;  1JHB A;  3QOU A;  4O92 A;  4X1U A;  3IK7 A;  1B4P A;  2GZZ A;  1AUC A;  3ZMK A;  1F2E A;  4TW5 A;  3IDV A;  3RHC A;  5AIX A;  4RI7 A;  2VLV A;  3CTG A;  4JZQ A;  3N5O A;  5EL8 A;  3HXS A;  3F6D A;  1V9W A;  2HI7 A;  2IJY A;  4EC0 A;  1XBS A;  3HZ8 A;  4EE0 A;  1A0F A;  4IHU A;  2LRT A;  1PA3 A;  2JZT A;  1VF3 A;  2VL3 A;  3DD3 A;  4MJE A;  1TDI A;  1JZD A;  5G30 A;  3TUE A;  3K8N A;  2IL3 A;  4ISD A;  4MH3 A;  2K8S A;  3FR6 A;  3ZIJ A;  2GZY A;  1URM A;  2MBT A;  3EIN A;  1SU9 A;  2KOK A;  2PGT A;  5F0G A;  1OC8 A;  2FCH A;  3APQ A;  3P8W A;  3D6I A;  4HJ2 A;  1PGT A;  1QFN A;  3KH9 A;  5G31 A;  4CHS A;  4MPG A;  6GSY A;  4TXO A;  2MYG A;  3FZA A;  3ZZX A;  2BJX A;  3VWW A;  1A2M A;  2VCT A;  1XPV A;  3VPT A;  4MA9 A;  2I1U A;  3M8N A;  4RQR A;  1S3D A;  4F0B A;  4K1F A;  3IBH A;  2X64 A;  5JWO B;  4TN8 A;  2H0I A;  5CYY A;  1GSQ A;  1DBY A;  1SJI A;  1THX A;  3LWA A;  1RW1 A;  1HD2 A;  4K0G A;  3G7I A;  4NV2 A;  4GWR A;  3UAR A;  4OWY A;  3GTU B;  2LJR A;  4HU7 A;  4ZBB A;  2AB6 A;  4GST A;  2X99 A;  1GUL A;  4DSR A;  1FOV A;  1ZMA A;  1G7E A;  1F37 A;  1I5G A;  4AGS A;  4LLR A;  1FG4 A;  4ZBA A;  1OAZ A;  1MEK A;  1XWA A;  1N8J A;  5ECN B;  5C00 A;  3FRC A;  1G0T A;  2IIY A;  3I6A A;  1XW9 A;  2O85 A;  4PUR A;  4F9Z A;  1FHE A;  2KHP A;  3GYK A;  4MF7 A;  2E2G A;  4QL9 A;  2VCW A;  4WKW A;  2DLX A;  1C72 A;  4O5R A;  1V57 A;  4EDY A;  1KBN A;  4IEL A;  1Z7R A;  2DML A;  2H0G A;  3TB2 A;  4ZL8 A;  1Z9H A;  3O6T A;  3JCM L;  2IPA A;  2LS5 A;  3EMX A;  4TR1 B;  2YWI A;  5HFG A;  2HRN A;  1T00 A;  2VCX A;  2DJ1 A;  1ZGN A;  2ON5 A;  3GH6 A;  3F0I A;  1G6W A;  4MZC A;  1K0O A;  3NOF A;  5F05 A;  1GUM A;  1O8W A;  2LJK A;  1WP0 A;  3APO A;  1S3A A;  5A4U A;  2RLI A;  2HYX A;  1K3O A;  3E0U A;  2B5E A;  2FNO A;  3FZ9 A;  3CSH A;  2GT5 A;  4TR3 A;  3L0H A;  3A2V A;  1PKZ A;  2GS3 A;  2REM A;  1AC1 A;  7GSS A;  4MF5 A;  5DJM A;  4WEY A;  4GQC A;  4N11 A;  1G6Y A;  3GN3 A;  1J9B A;  1JZR A;  1B8X A;  4N30 A;  1XOB A;  2H73 A;  4HZ4 A;  4JU5 A;  3LYK A;  2C1Y A;  3Q19 A;  2F8F A;  2GSR A;  2FY6 A;  4K0N A;  4P3Y B;  3N9J A;  5GZZ B;  5D73 A;  3D4T A;  3IPZ A;  1SYX A;  1VF1 A;  1GTB A;  2R3X A;  2I3Y A;  1QXH A;  2F8A A;  1FAA A;  1M2B A;  2WUL A;  3F4S A;  3FR3 A;  5FHI A;  2ALB A;  2H1A A;  2PBJ A;  1OE8 A;  2IMF A;  4K9Z A;  3EU4 A;  3EYT A;  1CQH A;  5ELA A;  2IMI A;  2VD0 A;  2H75 A;  3ZFL A;  4JE1 A;  4GCI A;  4O7H A;  3FHK A;  1XVW A;  4NHZ A;  5EPF A;  1GTA A;  5JCW A;  4PQH A;  1T3B A;  3EVI A;  5INY A;  3FZ4 A;  1NM3 A;  2JU5 A;  3TOT A;  2R6K A;  1DSB A;  1BED A;  3D22 A;  3IA1 A;  4BA7 A;  5IOX A;  5JWQ B;  1FW1 A;  3LJR A;  4KCA A;  3KM6 A;  3IK9 A;  1GRX A;  4XS1 A;  4D73 B;  2MZC A;  3LFL A;  4I2T A;  5B8B A;  2BTO T;  1T4Y A;  3GIX A;  2L59 A;  1GL8 A;  2C0F A;  4V2L A;  3G7J A;  3H1N A;  3EUR A;  4J2F A;  2L6C A;  3C71 A;  3RBT A;  2VL2 C;  4GQF A;  1Z6M A;  1TW9 A;  10GS A;  3O3T A;  1A2J A;  2B5X A;  1I9D A;  2KUC A;  5IMA A;  3HJO A;  2EIQ A;  5AGY A;  1ZYQ B;  2HFD A;  1U6T A;  2WRT A;  3VUR A;  2HLS A;  4EDZ A;  5ECK B;  1K0B A;  5IPG A;  1GTU A;  4V1A g;  3E3E A;  3GL3 A;  5FWG A;  4RI6 A;  3C8E A;  4KAE A;  4IVF A;  3WT1 A;  1XCC A;  5D8I A;  2IN3 A;  1GUK A;  2DJ2 A;  3UIW A;  3UL3 A;  3EMP A;  2ES7 A;  4XCS A;  2CV4 A;  1G7O A;  1GSE A;  2M80 A;  4V2N A;  3GRX A;  2YZH A;  4LA1 A;  5DQS A;  5IM9 A;  12GS A;  1M2D A;  4KA0 A;  3TJF A;  1LJR A;  8GSS A;  1XIY A;  4DSQ A;  1HNB A;  1WMJ A;  2A2S A;  1U3A A;  1J0F A;  1HNC A;  3HJP A;  2IFQ B;  4YH2 A;  3U5R E;  4KDY A;  4F03 A;  1SK2 A;  1K3L A;  2LEG A;  4I5Q A;  5J5N A;  1EWX A;  3TKQ A;  3MWH A;  3C1S A;  3GUS A;  3MNG A;  3ZL5 A;  3PIN A;  3QDN A;  3CRU A;  1XOA A;  3M3M A;  3KP8 A;  4TR4 A;  2B1K A;  3NZN A;  2B5Y A;  2YWM A;  2JAC A;  1PSQ A;  1ERU A;  4OFN A;  1EEJ A;  1AXD A;  4HQS A;  4L5L A;  3BCI A;  4EVM A;  2LST A;  1PN9 A;  4NXI A;  1H75 A;  2Z9S A;  3UMA A;  2P0G A;  1O6J A;  4MF6 A;  3KGK A;  3VI5 A;  3DXB A;  2CAQ A;  1GSF A;  4FYC A;  4NAX A;  2JAD A;  3VI7 A;  1HQO A;  4PGT A;  3L78 A;  4IQ1 A;  1F9M A;  1Z5Y E;  3CSJ A;  4HUA A;  4MAB A;  5GST A;  3IXR A;  3OR5 A;  2WS2 A;  2G2Q A;  2PVQ A;  2F3M A;  1HNA A;  3M9J A;  4V2M A;  1EP7 A;  5DAL A;  3VPQ A;  3P2A A;  1PL2 A;  3KH7 A;  4CDO A;  2H72 A;  2L4C A;  3H93 A;  1TRU A;  3ZML A;  1EV9 A;  2CT6 A;  4ZXG A;  1DE1 A;  1TRW A;  2MMZ A;  3KCM A;  1GSY A;  4WBR D;  1X0R A;  2GDR A;  3I9V 2;  1TU8 A;  1O7U A;  1O85 A;  1R5P A;  3QAG A;  1JLW A;  4HOJ A;  1WRY A;  3RHB A;  4NHW A;  4ZIJ A;  1X5D A;  3UBK A;  1PX7 A;  4KE3 A;  1RK4 A;  5GAP D;  4JR6 A;  1YDK A;  1CQG A;  2CX3 A;  4I6X A;  4KB3 A;  4WBJ A;  1R26 A;  1FB6 A;  3F3R A;  4MP4 A;  3GA4 A;  5AIS A;  1EOG A;  1PRX A;  2VIM A;  1TOF A;  2DC5 A;  2QC7 A;  3KIJ A;  3HVV A;  3ME8 A;  4OFT A;  3DYR A;  5A5K A;  5HQP A;  3GH9 A;  4OO5 A;  5FT3 A;  1V40 A;  5J9C A;  1ZYE A;  1GTI A;  4BWS A;  4OCF A;  4AJ8 A;  1O73 A;  1ST9 A;  2N5B A;  2QGV A;  5DAL B;  3KXO A;  3QMX A;  4KCE A;  4BPY A;  3HVX A;  3GX8 A;  2FWE A;  18GS A;  4ZL7 A;  5KN3 A;  1O8X A;  5AN1 A;  4POK A;  4Q5R A;  1QGV A;  4XTS A;  1TRV A;  3D21 A;  4PQ1 A;  4F2I A;  4MDC A;  2H0H A;  2TRX A;  1A2L A;  2DIZ A;  1R7H A;  4MMM A;  4HQZ A;  3CRT A;  4IP1 A;  4ML6 A;  2OE3 A;  4Q5F A;  2ZNM A;  1DE2 A;  5B6M A;  3G9B A;  4ZBD A;  4Z7X A;  5CRW A;  3F3Q A;  5CRE A;  3DKS A;  3TRX A;  2L5O A;  1WPI A;  2AUV A;  4QL7 A;  1K0N A;  1UA5 A;  3IR4 A;  2I81 A;  2FHE A;  4MPF A;  14GS A;  2PU9 C;  9GSS A;  2OE0 A;  4KH7 A;  3ZVJ A;  1ERV A;  5IQY A;  2I4A A;  3APS A;  2WFC A;  3LSZ A;  4I2U A;  3US3 A;  3DVX A;  1UVZ A;  5IMF A;  3F6F A;  2D2Z A;  2QSI A;  5G5E A;  3ISO A;  4OMV A;  2PUK C;  4FYB A;  5D9T A;  1AQW A;  3M0F A;  1N2A A;  2XBQ A;  3DML A;  1SL2 B;  3SBC A;  3IV4 A;  5IO2 A;  4DSS A;  3VLN A;  1GLP A;  4F82 A;  2E2M A;  4MJA A;  3UBL A;  4IP6 A;  3ZVJ D;  1QQ2 A;  5HFI A;  3A2W A;  4HDE A;  2H76 A;  3UOM A;  4KW6 A;  2HSY A;  1KEB A;  3IAM 2;  1X9M B;  1GNE A;  4PX1 A;  4MK3 A;  1GH2 A;  4WF5 A;  1A8Y A;  2E0Q A;  5A4W A;  5J3R A;  1MD4 A;  1SJ6 A;  3CYN A;  3SWL A;  4PUF C;  1JZO A;  2WB9 A;  1TI3 A;  1OKD A;  4TXO B;  1DUG A;  2H6Y A;  2FD3 A;  2HZE A;  5E4W A;  5LD0 A;  2OAC A;  2JZR A;  4WXT A;  11GS A;  4HEA 2;  4BL7 A;  4XHM A;  3IC4 A;  5ID2 A;  1QUW A;  2EIR A;  1Z3E A;  2P31 A;  4TOP A;  1SD8 A;  3D5J A;  1PMT A;  4KSM A;  5GSS A;  3FZ5 A;  5JWR B;  3F8U A;  4GTU A;  1M2A A;  4EKZ A;  3PH9 A;  1BG5 A;  4KUN A;  1JZW A;  3DEX A;  3A2X A;  3GMF A;  3TOU A;  22GS A;  4OO4 A;  4G9H A;  3DVW A;  3M9K A;  2B1L A;  2H01 A;  3CMI A;  1MTC A;  2VUP A;  5H5S A;  2J9H A;  2ON7 A;  1M9A A;  3PGT A;  1WJK A;  1B9Y C;  4JR4 A;  3QCP A;  2R37 A;  3KMN A;  4IJ3 A;  2WDU A;  2K8V A;  2L6D A;  2HT9 A;  2V6K A;  3TCO A;  1FB0 A;  3H4K A;  3EU3 A;  5KEJ A;  3GKK A;  1V98 A;  1GSU A;  2HXK A;  3ERF A;  1M9B A;  3TKP A;  1B48 A;  1TRS A;  1OC3 A;  5DBQ A;  4I97 A;  3BCK A;  1F3A A;  2L57 A;  4YAP A;  1YF0 A;  3AY8 A;  5CRG A;  1OYJ A;  2C4J A;  2N5F A;  3FY7 A;  5ID2 B;  3NIV A;  1VF4 A;  2L5L A;  1ILO A;  1Y6E A;  5ELG A;  5ENU A;  5F8B A;  4Q5N A;  3LOR A;  4PUA A;  2ZUP A;  3MAK A;  4E8E A;  5ECQ B;  3C73 A;  5D93 A;  4HU9 A;  2YCD A;  3HKR A;  4J57 E;  2XC2 A;  1ON4 A;  1NHY A;  2FWH A;  2ZCT A;  3RPN A;  2A4V A;  2G0F A;  2XPD A;  2YN1 A;  6GSW A;  2OBI A;  4ECC A;  1EV4 A;  5IMC A;  2C3Q A;  2NPB A;  3UEM A;  3LGC A;  4YQU A;  1KNG A;  3FYG A;  3QPM A;  1SL1 B;  2HSH A;  2M72 A;  4BVY A;  4KDU A;  1ZCP A;  5HR2 A;  4RUV A;  1O81 A;  1M7T A;  4HZ2 A;  4OFM A;  3D4M A;  4XS6 A;  2JSZ A;  1VF2 A;  3H79 A;  4V1A p;  3UAP A;  1OC9 A;  4G2E A;  2R4V A;  2LUS A;  3GST A;  1R4W A;  1VRS D;  4K6X A;  4BWQ A;  5DJL A;  1OVN A;  3HDC A;  2HRF A;  5CRD A;  5IMD A;  4G10 A;  5HR3 A;  3UVT A;  2HE3 A;  2RUF A;  2CX4 A;  3HZ4 A;  1BYE A;  4WR5 A;  3ZIT A;  2A2R A;  2VCQ A;  2MBS A;  5D9X A;  5B8A A;  1XVQ A;  1YJ6 A;  5JCG A;  1ML6 A;  3GSS A;  1H4O A;  1A23 A;  3ZIV A;  4YQM A;  1SEN A;  1QMV A;  3MSZ A;  4MLY A;  3EWL A;  1YKC A;  2JL4 A;  3CTF A;  3CXG A;  1YEP A;  4EF0 A;  2FWF A;  6GSX A;  2OA7 A;  3ZFB A;  16GS A;  3A5W A;  1OC9 B;  1UN2 A;  3ME7 A;  2DJ0 A;  1AQX A;  3VK9 A;  1AAZ A;  1YQ1 A;  1WIK A;  2H1G A;  2FGX A;  2MMO A;  3GUR A;  3IE3 A;  1HYU A;  2GZP A;  2F9S A;  2O89 A;  1WE0 A;  4L0W A;  3PR8 A;  4L0U A;  2V6O A;  3TKS A;  2HZF A;  5B6N A;  1YZX A;  3FR9 A;  3QFB C;  3TJK A;  3QFA C;  4K7O A;  2YZU A;  2PPT A;  2KLX A;  3RDW A;  5G1L A;  4EO3 A;  1A0R P;  3RPP A;  1EOH A;  4OCE A;  3G7Y A;  1X5C A;  1ZL9 A;  3I43 A;  4ULX A;  2WCI A;  4GRF A;  4GSN A;  4IJI A;  4IW9 A;  2DSA A;  2M46 A;  5D96 A;  2RII A;  1B4Q A;  1NHO A;  2CZ2 A;  2GVP A;  4G19 A;  3KTL A;  2H1D A;  5CO3 A;  1SJZ A;  4N10 A;  1XWB A;  4KGI A;  2PMT A;  2EIO A;  4FIW A;  4YQV A;  3DWV A;  2C8U A;  3ZLP A;  3WYW A;  5D9V A;  2NDO A;  3V1W A;  1SK0 A;  3E9J B;  1MDK A;  1XWK A;  3TRQ A;  1TU7 A;  3Q18 A;  3GX0 A;  2B7J A;  1Z7P A;  3VWU A;  4GXZ A;  2LQQ A;  4AJ6 A;  2GQL A;  2NTO A;  1OE7 A;  3FW2 A;  2QKE A;  4LL4 B;  1IYI A;  3P7X A;  5G5F A;  1MD3 A;  3MDK A;  3HHV A;  2NBS A;  3Q6O A;  3LXZ A;  3BJ5 A;  3TJB A;  3F9U A;  1SKS B;  17GS A;  3J7Y b;  1F3B A;  3GV1 A;  3KTB A;  3LEF A;  5J9B A;  2YAN A;  2C3T A;  2WZ9 A;  1A24 A;  1E2Y A;  4LL1 B;  5COH A;  3F63 A;  2H66 A;  1EP8 A;  1M99 A;  5A4V A;  1X5E A;  3GKN A;  5F07 A;  1XWG A;  3LG6 A;  4ZB6 A;  2H19 A;  2YOI A;  3L4N A;  3GHA A;  1T1V A;  2VM1 A;  1J08 A;  1GSD A;  3S9F A;  2R2J A;  4JED A;  4F0C A;  4OD7 A;  2LQO A;  2YNX A;  3TJJ A;  2H1B A;  2X8H A;  5CP1 A;  5G1K A;  1MDI A;  5CNW A;  2FUG 2;  2LNS A;  2YV7 A;  2YWO A;  1PX6 A;  4LMV A;  5ECH B;  4WF4 A;  2VLT A;  4ACS A;  4ZB9 A;  3GTU A;  4POB A;  2NVL A;  2LRN A;  4JRR A;  3WT2 A;  2CAI A;  5IO0 A;  3UVH A;  3LXT A;  3WD6 A;  5IMZ A;  1YKA A;  5DCG A;  3HCZ A;  4IBP A;  3DRN A;  3VWV A;  2O7K A;  3IAS 2;  3C7M A;  3GNJ A;  2IMK A;  3HD5 A;  4ZIL A;  3I69 A;  1NSW A;  1TXX A;  2TIR A;  2HNL A;  1TK0 B;  2X8G A;  1QK8 A;  5DCH A;  3TJG A;  3EE2 A;  4AJ7 A;  1NW2 A;  3EC3 A;  1JFU A;  1SYR A;  1U88 A;  1ACV A;  1KTE A;  2L4Q A;  5HFK A;  1K0C A;  4AF2 A;  2VO4 A;  3TRP A;  4K2D A;  1EGO A;  4PNF A;  4ZB8 A;  1BQ7 A;  1A8L A;  3KEB A;  3L9V A;  2YJH A;  4K7N A;  2VCZ A;  1PD2 1;  3QR6 A;  4TR1 A;  1BX9 A;  1THO A;  2AAW A;  5KN2 A;  1FVK A;  5LCZ A;  2X8C A;  1TKD B;  5LNK e;  1YF1 A;  1F6M C;  1GUH A;  1M0U A;  3RAZ A;  4MJC A;  5L71 A;  2H6X A;  1K0A A;  2VL9 A;  2P5Q A;  1EZK A;  2H71 A;  2OKA A;  2OJL A;  3ED3 A;  4NV5 A;  4FH8 A;  3TGZ A;  4KX4 A;  1K3Y A;  2I9H A;  1ABA A;  1TTZ A;  1YEX A;  3ZTL A;  4RQX A;  1WOU A;  5IPH A;  2H70 A;  3LYP A;  1V58 A;  4LMW A;  5DAK A;  1SL0 B;  4HJM A;  2YP6 A;  4I8B A;  2IMD A;  6GSV A;  3L9S A;  2CVB A;  5CRH A;  3WGD A;  2GT6 A;  4KND A;  1B9X C;  5IIZ A;  4DSS B;  1AIU A;  2EC4 A;  3FK8 A;  1GP1 A;  2IWT A;  5ECO B;  20GS A;  2DJJ A;  1EEM A;  4GLT A;  2IME A;  1BJX A;  1USB A;  2CVK A;  4CW9 A;  2K6V A;  4GF0 A;  2PER A;  1TK5 B;  2FLS A;  4FO5 A;  1FVJ A;  2FA4 A;  2LJA A;  4HI7 A;  2B6M A;  5KN0 A;  2HZE B;  3W8J A;  4X0X A;  4ECB A;  2GQM A;  1SD9 A;  3GL5 A;  2DIY A;  1XZO A;  2OE1 A;  2CZ3 A;  3WGE A;  2BMX A;  2AYT A;  4D73 A;  2C3N A;  2H8L A;  3QAW A;  5DAK B;  3R2Q A;  4L8E A;  1XFL A;  1T4Z A;  2AJQ B;  3HVS A;  1RQM A;  2C80 A;  3W6G A;  1XW6 A;  3D0Z A;  1AQV A;  1GWC A;  2YJ7 A;  4KSO A;  3LQ7 A;  2PWJ A;  2CVD A;  2GLR A;  5ECM B;  2R5G A;  5JCU A;  4X43 A;  4FYU A;  4MZW A;  2VLU A;  2LTK A;  2LNT A;  4XS4 A;  1YY7 A;  4BVX A;  1GLQ A;  2K9F A;  2VL2 A;  4ID0 A;  4K7I A;  4KDX A;  4L5O A;  1S3C A;  4IKH A;  2VD1 A;  4TKY A;  2V41 A;  1Z6N A;  4IS0 A;  5DDL A;  2C0D A;  3M1G A;  13GS A;  1PQN A;  4JBB A;  4NWY A;  5IMV A;  3Q74 A;  1T7P B;  4IN0 A;  6GSS A;  4IGJ A;  1LU4 A;  2IFQ A;  3KZQ A;  5H5Q A;  5EY6 A;  1Y25 A;  1JLV A;  2JSY A;  4XIH A;  6GST A;  1IYH A;  4MZB A;  1PKW A;  4DVC A;  2TRC P;  2LV3 A;  2CA8 A;  3KJY A;  3J7Y k;  3HYP A;  3VFI A;  2AV4 A;  2DJ3 A;  2H30 A;  3IHQ A;  4NMU A;  1VGL A;  2C0G A;  5B7C A;  2WGR A;  4XS4 B;  1W4V A;  3F4R A;  1Q98 A;  4N0V A;  2F51 A;  2WJU A;  1GNW A;  1OKT A;  1MDJ A;  4ML1 A;  3DIE A;  2H74 A;  5GAN D;  5IOW A;  2OBK A;  1WWJ A;  5J4U A;  3FEU A;  1LBK A;  2GGT A;  4XRD A;  2O87 A;  3A3T A;  1BAY A;  1U3I A;  4E8H A;  2B3S A;  1X9S B;  2N5A A;  1X9W B;  3BOA A;  3GKX A;  3IOS A;  1XW5 A;  4QQ7 A;  5HR1 A;  2B7K A;  5ECR B;  3BBY A;  4EXJ A;  3HA9 A;  5E59 A;  2MMN A;  2K18 A;  4PNG A;  2O8V B;  2YV9 A;  3W8S A;  4H86 A;  4WR4 A;  3CBU A;  4O32 A;  3O76 A;  1TP9 A;  4EUY A;  1W89 A;  2RM6 A;  4GSS A;  4N0Z A;  5D9W A;  3HJM A;  5C04 A;  5DVB A;  1E6B A;  1ZOF A;  3P90 A;  3ERW A;  5G2Z A;  1K0M A;  1U87 A;  1XXU A;  2V1M A;  1EGR A;  2DJK A;  3GFK A;  4YAV A;  2FA8 A;  4TXV A;  2MMA A;  2GSQ A;  4Q5Q A;  4XRA A;  3TKS E;  1PL1 A;  2AHE A;  2H6Z A;  2VAF A;  5ECL B;  4DEJ A;  3GKM A;  4WET A;  4J56 E;  5CAX A;  3H8Q A;  5AIV A;  2PVO C;  4PQI A;  2KP2 A;  3TDG A;  1Q4J A;  3WGX A;  5F06 A;  4K8M A;  2V2G A;  1AW9 A;  3CSI A;  3QAV A;  3C1R A;  3QD9 A;  5ECP B;  1SK1 A;  1TJD A;  2VM2 A;  2PN8 A;  4TR0 A;  5HR0 A;  4EL1 A;  3FKF A;  4PXO A;  3U6V A;  3DGQ A;  2C0E A;  3KP9 A;  1TI1 A;  3HY2 A;  2CQ9 A;  5ECI B;  3ZYW A;  3BD2 A;  4ZL9 A;  2GST A;  1SKW B;  2OAD A;  6GSU A;  4POM A;  2LKU A;  3L9U A;  2RUE A;  3IRA A;  19GS A;  3ERG A;  1UC7 A;  5EVO A;  2XBI A;  4ILF A;  3TKR A;  3TKS C;  2FWG A;  4MJB A;  3UJ1 A;  5ABR A;  2GTU A;  1GSS A;  4ECJ A;  2GQK A;  2V32 A;  2VCV A;  3ZRD A;  2P5R A;  2XHF A;  2JZS A;  2YPM A;  2VOC A;  5ECS A;  3F4T A;  1T8E B;  1R5A A;  2DBC A; 
#chains in the Genus database with same CATH topology
 4MCU A;  1TK8 B;  4TVE A;  2RM5 A;  3ZRE A;  5KN1 A;  1XWC A;  2A2P A;  1SKR B;  1ERT A;  2J23 A;  2XPE A;  4TRX A;  1FO5 A;  5DQY A;  4MH2 A;  2KP1 A;  1ERW A;  3KMO A;  3KD0 A;  2YWN A;  5J41 A;  2LRC A;  2DMM A;  5H5R A;  4HS1 A;  4ECI A;  3VWX A;  1ZZY A;  1FOH A;  4POL A;  4HSC X;  1K0D A;  4NPB A;  4IQA A;  2GSS A;  1V2A A;  2E7P A;  1JHB A;  3QOU A;  4O92 A;  4X1U A;  3IK7 A;  1B4P A;  2GZZ A;  1AUC A;  3ZMK A;  1F2E A;  4TW5 A;  3IDV A;  3RHC A;  5AIX A;  4RI7 A;  2VLV A;  3CTG A;  4JZQ A;  3N5O A;  5EL8 A;  3HXS A;  3F6D A;  1V9W A;  2HI7 A;  2IJY A;  4EC0 A;  1XBS A;  3HZ8 A;  4EE0 A;  1A0F A;  4IHU A;  2LRT A;  1PA3 A;  2JZT A;  1VF3 A;  2VL3 A;  3DD3 A;  4MJE A;  1TDI A;  1JZD A;  5G30 A;  3TUE A;  3K8N A;  2IL3 A;  4ISD A;  4MH3 A;  2K8S A;  3FR6 A;  3ZIJ A;  2GZY A;  1URM A;  2MBT A;  3EIN A;  1SU9 A;  2KOK A;  2PGT A;  5F0G A;  1OC8 A;  2FCH A;  3APQ A;  3P8W A;  3D6I A;  4HJ2 A;  1PGT A;  1QFN A;  3KH9 A;  5G31 A;  4MNN A;  4CHS A;  4MPG A;  6GSY A;  4TXO A;  2MYG A;  3FZA A;  3ZZX A;  2BJX A;  3VWW A;  1A2M A;  2VCT A;  1XPV A;  3VPT A;  4MA9 A;  2I1U A;  3M8N A;  4RQR A;  1S3D A;  4F0B A;  4K1F A;  3A5I A;  3IBH A;  2X64 A;  5JWO B;  4TN8 A;  2H0I A;  5CYY A;  4YKG A;  1GSQ A;  1DBY A;  1SJI A;  1THX A;  3LWA A;  1RW1 A;  1HD2 A;  4K0G A;  3G7I A;  4NV2 A;  4GWR A;  3UAR A;  4OWY A;  3GTU B;  2LJR A;  4HU7 A;  4ZBB A;  2AB6 A;  4GST A;  2X99 A;  1GUL A;  4DSR A;  1FOV A;  1ZMA A;  1G7E A;  1F37 A;  1I5G A;  4AGS A;  4LLR A;  1FG4 A;  4ZBA A;  1OAZ A;  1MEK A;  1XWA A;  1N8J A;  5ECN B;  5C00 A;  3FRC A;  1G0T A;  2IIY A;  3I6A A;  1XW9 A;  2O85 A;  2DKI A;  4PUR A;  4F9Z A;  1FHE A;  2KHP A;  3GYK A;  4MF7 A;  2E2G A;  4QL9 A;  2VCW A;  4WKW A;  2DLX A;  1C72 A;  4O5R A;  1V57 A;  4EDY A;  1KBN A;  4IEL A;  1Z7R A;  2DML A;  2H0G A;  3TB2 A;  4ZL8 A;  1Z9H A;  3O6T A;  3JCM L;  2IPA A;  2LS5 A;  3EMX A;  4TR1 B;  2YWI A;  5HFG A;  2HRN A;  1T00 A;  2VCX A;  2DJ1 A;  1ZGN A;  2ON5 A;  3GH6 A;  3F0I A;  1G6W A;  4MZC A;  1K0O A;  3NOF A;  1GUM A;  5F05 A;  1O8W A;  2LJK A;  1WP0 A;  3APO A;  1S3A A;  5A4U A;  2RLI A;  2HYX A;  1K3O A;  3E0U A;  2B5E A;  2FNO A;  3FZ9 A;  3CSH A;  2GT5 A;  4TR3 A;  3L0H A;  3A2V A;  1PKZ A;  2GS3 A;  2REM A;  1AC1 A;  7GSS A;  4MF5 A;  5DJM A;  4WEY A;  4GQC A;  2HRK A;  4N11 A;  1G6Y A;  3GN3 A;  1J9B A;  1JZR A;  1B8X A;  4N30 A;  1XOB A;  2H73 A;  4HZ4 A;  4JU5 A;  3LYK A;  2C1Y A;  3Q19 A;  2F8F A;  2GSR A;  2FY6 A;  4K0N A;  4P3Y B;  5KOW A;  3N9J A;  5GZZ B;  3PPU A;  5D73 A;  3D4T A;  3IPZ A;  1SYX A;  1VF1 A;  1GTB A;  2R3X A;  2I3Y A;  1QXH A;  2F8A A;  1FAA A;  1M2B A;  2WUL A;  4FQU A;  3F4S A;  3FR3 A;  5FHI A;  2ALB A;  2H1A A;  2PBJ A;  1OE8 A;  2IMF A;  4K9Z A;  3EU4 A;  3EYT A;  1CQH A;  5ELA A;  2IMI A;  2VD0 A;  2H75 A;  3ZFL A;  4JE1 A;  4GCI A;  4O7H A;  2R0G A;  3FHK A;  1XVW A;  4NHZ A;  5EPF A;  1GTA A;  5JCW A;  4PQH A;  1T3B A;  3EVI A;  5INY A;  3FZ4 A;  1NM3 A;  2JU5 A;  4CY8 A;  3TOT A;  2R6K A;  1DSB A;  1BED A;  3D22 A;  3IA1 A;  4BA7 A;  4Z2T A;  5IOX A;  5JWQ B;  1FW1 A;  3LJR A;  4KCA A;  3KM6 A;  3IK9 A;  1GRX A;  4XS1 A;  4D73 B;  2MZC A;  3LFL A;  4I2T A;  5B8B A;  2BTO T;  1T4Y A;  3GIX A;  2L59 A;  1GL8 A;  2C0F A;  4V2L A;  3G7J A;  3H1N A;  3EUR A;  4J2F A;  2L6C A;  3C71 A;  3RBT A;  2VL2 C;  4GQF A;  1Z6M A;  1TW9 A;  10GS A;  3O3T A;  1A2J A;  2B5X A;  1I9D A;  2KUC A;  5IMA A;  3HJO A;  2EIQ A;  5AGY A;  1ZYQ B;  2HFD A;  1U6T A;  2WRT A;  3VUR A;  2HLS A;  4EDZ A;  5ECK B;  1K0B A;  5IPG A;  1GTU A;  4V1A g;  3E3E A;  3GL3 A;  5FWG A;  4RI6 A;  3C8E A;  4KAE A;  4IVF A;  3WT1 A;  1XCC A;  5D8I A;  2IN3 A;  1GUK A;  2DJ2 A;  3UIW A;  3UL3 A;  3EMP A;  2ES7 A;  4XCS A;  2CV4 A;  1G7O A;  1GSE A;  2M80 A;  4V2N A;  3GRX A;  2YZH A;  4LA1 A;  5DQS A;  5IM9 A;  12GS A;  1M2D A;  4KA0 A;  3TJF A;  1LJR A;  8GSS A;  1XIY A;  4DSQ A;  1HNB A;  1WMJ A;  2A2S A;  1U3A A;  1J0F A;  1HNC A;  3HJP A;  2IFQ B;  4YH2 A;  3U5R E;  4KDY A;  4F03 A;  1SK2 A;  1K3L A;  2LEG A;  4I5Q A;  5J5N A;  1EWX A;  3TKQ A;  3MWH A;  3C1S A;  3GUS A;  3MNG A;  3ZL5 A;  3PIN A;  3QDN A;  4A5P A;  3CRU A;  1XOA A;  3M3M A;  3KP8 A;  4TR4 A;  2B1K A;  3NZN A;  2B5Y A;  2YWM A;  2JAC A;  1PSQ A;  1ERU A;  4OFN A;  1EEJ A;  1AXD A;  4HQS A;  4L5L A;  3BCI A;  4EVM A;  2LST A;  1PN9 A;  4NXI A;  1H75 A;  2Z9S A;  3UMA A;  1S3R A;  2P0G A;  1O6J A;  4MF6 A;  3KGK A;  3VI5 A;  3DXB A;  2CAQ A;  1GSF A;  4FYC A;  4NAX A;  2JAD A;  2X4A A;  3VI7 A;  1HQO A;  4PGT A;  3L78 A;  4IQ1 A;  1F9M A;  1Z5Y E;  3CSJ A;  4HUA A;  4MAB A;  5GST A;  5BRT A;  3IXR A;  3OR5 A;  2WS2 A;  2G2Q A;  2PVQ A;  2F3M A;  1HNA A;  3M9J A;  4V2M A;  1EP7 A;  5DAL A;  3VPQ A;  3P2A A;  4ICY A;  1PL2 A;  3KH7 A;  4CDO A;  2H72 A;  2L4C A;  3H93 A;  1TRU A;  3ZML A;  4X4J A;  1EV9 A;  2CT6 A;  4ZXG A;  1DE1 A;  1TRW A;  2MMZ A;  3KCM A;  1GSY A;  4WBR D;  1X0R A;  2GDR A;  3I9V 2;  1TU8 A;  1O7U A;  1O85 A;  1R5P A;  3QAG A;  1JLW A;  4HOJ A;  1WRY A;  3RHB A;  4NHW A;  4ZIJ A;  1X5D A;  3UBK A;  1PX7 A;  4KE3 A;  1RK4 A;  5GAP D;  4JR6 A;  1YDK A;  1CQG A;  2CX3 A;  4I6X A;  4KB3 A;  4WBJ A;  1R26 A;  1FB6 A;  3F3R A;  4PTS A;  4MP4 A;  3GA4 A;  5AIS A;  1EOG A;  1PRX A;  2VIM A;  1TOF A;  2DC5 A;  2QC7 A;  3KIJ A;  3HVV A;  3ME8 A;  4OFT A;  3DYR A;  5A5K A;  5HQP A;  2QA2 A;  3GH9 A;  4OO5 A;  5FT3 A;  1V40 A;  5J9C A;  1ZYE A;  1GTI A;  4BWS A;  4OCF A;  4AJ8 A;  4Z2R A;  1O73 A;  1ST9 A;  2N5B A;  2QGV A;  5DAL B;  3KXO A;  3QMX A;  3MIX A;  4KCE A;  4BPY A;  3HVX A;  3GX8 A;  2FWE A;  18GS A;  4ZL7 A;  5KN3 A;  1O8X A;  5AN1 A;  4POK A;  4Q5R A;  1QGV A;  4XTS A;  1TRV A;  3D21 A;  4PQ1 A;  4F2I A;  4MDC A;  2H0H A;  2TRX A;  1A2L A;  2DIZ A;  1R7H A;  4MMM A;  3LW9 A;  1PN0 A;  4HQZ A;  3CRT A;  4IP1 A;  4ML6 A;  2OE3 A;  4Q5F A;  2ZNM A;  1DE2 A;  1ZYN A;  5B6M A;  3G9B A;  4ZBD A;  4Z7X A;  5CRW A;  1ZYP A;  3F3Q A;  5CRE A;  3DKS A;  3TRX A;  2L5O A;  1WPI A;  2AUV A;  4QL7 A;  1K0N A;  1UA5 A;  3IR4 A;  2I81 A;  2FHE A;  4MPF A;  14GS A;  2PU9 C;  1PFO A;  9GSS A;  2OE0 A;  4KH7 A;  3ZVJ A;  1ERV A;  5IQY A;  2I4A A;  3APS A;  2WFC A;  3LSZ A;  4I2U A;  4YKF A;  3US3 A;  3DVX A;  1UVZ A;  5IMF A;  3F6F A;  2D2Z A;  2QSI A;  5G5E A;  3ISO A;  4OMV A;  2PUK C;  4FYB A;  5D9T A;  1AQW A;  3M0F A;  1N2A A;  2XBQ A;  3DML A;  1SL2 B;  3SBC A;  3IV4 A;  5IO2 A;  4DSS A;  3VLN A;  1GLP A;  4F82 A;  2E2M A;  4MJA A;  3UBL A;  4IP6 A;  3ZVJ D;  1QQ2 A;  4Z2U A;  5HFI A;  3A2W A;  4HDE A;  2H76 A;  3UOM A;  4KW6 A;  2HSY A;  1KEB A;  3IAM 2;  1X9M B;  1GNE A;  4PX1 A;  4MK3 A;  1GH2 A;  4WF5 A;  1A8Y A;  2E0Q A;  5A4W A;  5J3R A;  1MD4 A;  1SJ6 A;  3CYN A;  3SWL A;  4PUF C;  1JZO A;  2WB9 A;  1TI3 A;  1OKD A;  4TXO B;  1DUG A;  2H6Y A;  2FD3 A;  2HZE A;  5E4W A;  5LD0 A;  2OAC A;  2JZR A;  4WXT A;  11GS A;  4HEA 2;  4BL7 A;  4XHM A;  3IC4 A;  5ID2 A;  1QUW A;  2EIR A;  3R3E A;  1Z3E A;  2P31 A;  4TOP A;  1SD8 A;  3D5J A;  3HVN A;  1PMT A;  4KSM A;  5GSS A;  3FZ5 A;  5JWR B;  3F8U A;  4GTU A;  1M2A A;  4EKZ A;  3PH9 A;  1BG5 A;  4KUN A;  1JZW A;  3DEX A;  3A2X A;  3GMF A;  3TOU A;  22GS A;  4OO4 A;  4G9H A;  3DVW A;  3M9K A;  2B1L A;  2H01 A;  3CMI A;  1MTC A;  2VUP A;  5H5S A;  2J9H A;  2ON7 A;  2R0P A;  1M9A A;  3PGT A;  1WJK A;  1B9Y C;  2UZ8 A;  4JR4 A;  3QCP A;  2R37 A;  4K5R A;  3KMN A;  4IJ3 A;  2WDU A;  3CQF A;  2K8V A;  2L6D A;  2HT9 A;  2V6K A;  3TCO A;  1FB0 A;  3H4K A;  3EU3 A;  5KEJ A;  3GKK A;  1V98 A;  1GSU A;  2HXK A;  3ERF A;  1M9B A;  3TKP A;  1B48 A;  1TRS A;  1OC3 A;  5DBQ A;  4I97 A;  3BCK A;  1F3A A;  2L57 A;  4YAP A;  1YF0 A;  3AY8 A;  5CRG A;  1OYJ A;  2C4J A;  2N5F A;  3FY7 A;  5ID2 B;  3NIV A;  1VF4 A;  2L5L A;  1ILO A;  1Y6E A;  5ELG A;  5ENU A;  5F8B A;  4Q5N A;  3LOR A;  4PUA A;  2ZUP A;  3MAK A;  4E8E A;  5ECQ B;  3C73 A;  5D93 A;  4HU9 A;  2YCD A;  3HKR A;  4J57 E;  2XC2 A;  1ON4 A;  1NHY A;  2FWH A;  2ZCT A;  3RPN A;  2A4V A;  2G0F A;  2XPD A;  2YN1 A;  6GSW A;  2OBI A;  4ECC A;  1EV4 A;  5IMC A;  2C3Q A;  2NPB A;  3UEM A;  3LGC A;  4YQU A;  1KNG A;  3FYG A;  1M3I A;  3QPM A;  1SL1 B;  2HSH A;  2M72 A;  4BVY A;  4KDU A;  1ZCP A;  5HR2 A;  4RUV A;  1O81 A;  1M7T A;  4HZ2 A;  4OFM A;  3D4M A;  4XS6 A;  2JSZ A;  1VF2 A;  3H79 A;  4V1A p;  3UAP A;  1OC9 A;  4G2E A;  2R4V A;  2LUS A;  3GST A;  1R4W A;  1VRS D;  4K6X A;  4BWQ A;  5DJL A;  1OVN A;  3HDC A;  2HRF A;  5CRD A;  5IMD A;  4G10 A;  5HR3 A;  3UVT A;  2HE3 A;  2RUF A;  2CX4 A;  3HZ4 A;  1BYE A;  4WR5 A;  3ZIT A;  2A2R A;  2VCQ A;  2MBS A;  5D9X A;  5B8A A;  1XVQ A;  1YJ6 A;  5JCG A;  1ML6 A;  3GSS A;  1H4O A;  1A23 A;  3ZIV A;  4YQM A;  1SEN A;  1QMV A;  3MSZ A;  4MLY A;  3EWL A;  1YKC A;  2JL4 A;  3CTF A;  3CXG A;  4BVY B;  1YEP A;  4EF0 A;  2FWF A;  6GSX A;  2OA7 A;  3ZFB A;  16GS A;  3A5W A;  1OC9 B;  1UN2 A;  3ME7 A;  4G0I A;  2DJ0 A;  1AQX A;  3VK9 A;  1AAZ A;  1YQ1 A;  1WIK A;  2H1G A;  2FGX A;  2MMO A;  3GUR A;  3IE3 A;  1HYU A;  2GZP A;  2F9S A;  2O89 A;  1WE0 A;  4L0W A;  3PR8 A;  4L0U A;  2V6O A;  3TKS A;  2HZF A;  5B6N A;  1YZX A;  3FR9 A;  3QFB C;  3TJK A;  3QFA C;  4CY6 A;  4K7O A;  2YZU A;  2PPT A;  2KLX A;  3RDW A;  2R0C A;  5G1L A;  4EO3 A;  1A0R P;  2A4H A;  3RPP A;  1EOH A;  4OCE A;  3G7Y A;  1X5C A;  1ZL9 A;  3I43 A;  4ULX A;  2WCI A;  4GRF A;  4GSN A;  4IJI A;  4IW9 A;  2DSA A;  2M46 A;  5D96 A;  2RII A;  1B4Q A;  1NHO A;  2CZ2 A;  2DKH A;  2GVP A;  4G19 A;  3KTL A;  2H1D A;  5CO3 A;  1SJZ A;  4N10 A;  1XWB A;  4KGI A;  2PMT A;  2EIO A;  4FIW A;  5KOX A;  4YQV A;  3DWV A;  2C8U A;  3ZLP A;  3WYW A;  5D9V A;  2NDO A;  3V1W A;  1SK0 A;  3E9J B;  1MDK A;  1XWK A;  3TRQ A;  1TU7 A;  3Q18 A;  3GX0 A;  2B7J A;  1Z7P A;  3VWU A;  4GXZ A;  4G0K A;  2LQQ A;  4AJ6 A;  2GQL A;  2NTO A;  4EIP A;  1OE7 A;  3FW2 A;  1M3J A;  2QKE A;  4LL4 B;  1IYI A;  3P7X A;  5G5F A;  1MD3 A;  3MDK A;  3HHV A;  2NBS A;  3Q6O A;  3LXZ A;  3BJ5 A;  3TJB A;  3F9U A;  1SKS B;  17GS A;  3J7Y b;  1F3B A;  3GV1 A;  3KTB A;  3LEF A;  5J9B A;  2YAN A;  2C3T A;  2WZ9 A;  1A24 A;  1E2Y A;  4LL1 B;  5COH A;  3F63 A;  2H66 A;  1EP8 A;  3IC8 A;  1M99 A;  5A4V A;  3IHG A;  1X5E A;  3GKN A;  4BIK A;  5F07 A;  1XWG A;  3LG6 A;  4ZB6 A;  2H19 A;  2YOI A;  3L4N A;  3GHA A;  1T1V A;  2VM1 A;  1J08 A;  1GSD A;  3S9F A;  2R2J A;  4JED A;  4F0C A;  4OD7 A;  2LQO A;  2YNX A;  3TJJ A;  2H1B A;  2X8H A;  5CP1 A;  5G1K A;  4O5U A;  1MDI A;  5CNW A;  2FUG 2;  2LNS A;  2YV7 A;  2YWO A;  1PX6 A;  4LMV A;  5ECH B;  4WF4 A;  2VLT A;  4ACS A;  4ZB9 A;  3GTU A;  4POB A;  2NVL A;  2LRN A;  4JRR A;  3WT2 A;  2CAI A;  5IO0 A;  3UVH A;  3LXT A;  3WD6 A;  5IMZ A;  1YKA A;  5DCG A;  3HCZ A;  4IBP A;  3DRN A;  3VWV A;  2O7K A;  3IAS 2;  3C7M A;  3FMW A;  3GNJ A;  2IMK A;  3HD5 A;  4ZIL A;  3I69 A;  1NSW A;  1TXX A;  2TIR A;  2HNL A;  1TK0 B;  2X8G A;  1QK8 A;  5DCH A;  3TJG A;  3EE2 A;  4AJ7 A;  1NW2 A;  3EC3 A;  1JFU A;  1SYR A;  1U88 A;  1ACV A;  1KTE A;  2L4Q A;  5HFK A;  1K0C A;  4AF2 A;  2VO4 A;  3TRP A;  4K2D A;  1EGO A;  4PNF A;  4ZB8 A;  1BQ7 A;  1A8L A;  3KEB A;  3L9V A;  2YJH A;  4K7N A;  2VCZ A;  1PD2 1;  3QR6 A;  4TR1 A;  4USS A;  1BX9 A;  4G0L A;  1THO A;  2AAW A;  5KN2 A;  1FVK A;  5LCZ A;  2X8C A;  1TKD B;  5LNK e;  1YF1 A;  1F6M C;  1GUH A;  1M0U A;  3RAZ A;  4MJC A;  5L71 A;  2H6X A;  1K0A A;  2VL9 A;  2P5Q A;  1EZK A;  2H71 A;  2OKA A;  2OJL A;  3ED3 A;  4NV5 A;  4FH8 A;  3TGZ A;  4KX4 A;  1K3Y A;  2I9H A;  1ABA A;  1TTZ A;  1YEX A;  3ZTL A;  4RQX A;  1WOU A;  5IPH A;  2H70 A;  3LYP A;  1V58 A;  4LMW A;  5DAK A;  1SL0 B;  4HJM A;  2YP6 A;  2QA1 A;  4I8B A;  2IMD A;  6GSV A;  3L9S A;  2CVB A;  5CRH A;  3WGD A;  2GT6 A;  4KND A;  1B9X C;  5IIZ A;  2HSM A;  4DSS B;  1AIU A;  2EC4 A;  3FK8 A;  1GP1 A;  2IWT A;  5ECO B;  20GS A;  2DJJ A;  1EEM A;  4GLT A;  2IME A;  1BJX A;  1USB A;  2CVK A;  4CW9 A;  2K6V A;  4GF0 A;  2PER A;  1TK5 B;  2FLS A;  4FO5 A;  1FVJ A;  2FA4 A;  2LJA A;  4HI7 A;  2B6M A;  5KN0 A;  2HZE B;  3W8J A;  4X0X A;  4ECB A;  2GQM A;  1SD9 A;  3GL5 A;  2DIY A;  1XZO A;  2OE1 A;  2CZ3 A;  3WGE A;  2BMX A;  2AYT A;  4D73 A;  2C3N A;  2H8L A;  3QAW A;  5DAK B;  3R2Q A;  4L8E A;  1XFL A;  1T4Z A;  2AJQ B;  3HVS A;  1RQM A;  2C80 A;  3W6G A;  1XW6 A;  4BL7 B;  3D0Z A;  1AQV A;  1GWC A;  2YJ7 A;  4KSO A;  3LQ7 A;  2PWJ A;  2CVD A;  2GLR A;  5ECM B;  2R5G A;  5JCU A;  4X43 A;  4FYU A;  4MZW A;  2VLU A;  2LTK A;  2LNT A;  4XS4 A;  1YY7 A;  4BVX A;  1GLQ A;  2K9F A;  2VL2 A;  3EPT A;  4ID0 A;  4K7I A;  4KDX A;  4L5O A;  1S3C A;  4IKH A;  2VD1 A;  4TKY A;  2X49 A;  4K2X A;  2V41 A;  1Z6N A;  4IS0 A;  5DDL A;  2C0D A;  3M1G A;  13GS A;  1PQN A;  4JBB A;  4NWY A;  5IMV A;  3Q74 A;  1T7P B;  4IN0 A;  6GSS A;  4IGJ A;  1LU4 A;  2IFQ A;  3KZQ A;  5H5Q A;  5EY6 A;  1XG8 A;  1Y25 A;  1JLV A;  2JSY A;  4XIH A;  6GST A;  1IYH A;  4MZB A;  1PKW A;  4DVC A;  5BMU A;  2TRC P;  2LV3 A;  2CA8 A;  3KJY A;  3J7Y k;  3HYP A;  3VFI A;  4EIQ A;  2AV4 A;  2DJ3 A;  2H30 A;  3IHQ A;  4NMU A;  1VGL A;  2C0G A;  5B7C A;  2WGR A;  4XS4 B;  4O5Q A;  1W4V A;  3F4R A;  4KF9 A;  4BVX B;  1Q98 A;  2HRA A;  4N0V A;  2F51 A;  2WJU A;  1GNW A;  1OKT A;  1MDJ A;  4ML1 A;  3DIE A;  2H74 A;  5GAN D;  5IOW A;  2OBK A;  1WWJ A;  5J4U A;  3FEU A;  1LBK A;  2GGT A;  4XRD A;  2O87 A;  3A3T A;  1BAY A;  1U3I A;  4E8H A;  2B3S A;  1X9S B;  2N5A A;  1X9W B;  3BOA A;  3GKX A;  3IOS A;  1XW5 A;  4QQ7 A;  5HR1 A;  2B7K A;  5ECR B;  3BBY A;  4EXJ A;  3HA9 A;  5E59 A;  2MMN A;  2K18 A;  4PNG A;  2O8V B;  2YV9 A;  3W8S A;  4H86 A;  4WR4 A;  3CBU A;  4O32 A;  3O76 A;  1TP9 A;  4EUY A;  1W89 A;  2RM6 A;  4GSS A;  4N0Z A;  5D9W A;  3HJM A;  5C04 A;  5DVB A;  1E6B A;  1ZOF A;  3P90 A;  3ERW A;  5G2Z A;  1K0M A;  1U87 A;  3MYD A;  1XXU A;  2V1M A;  1EGR A;  2DJK A;  3GFK A;  4YAV A;  2FA8 A;  4TXV A;  2MMA A;  2GSQ A;  4Q5Q A;  4XRA A;  3TKS E;  1PL1 A;  2AHE A;  2H6Z A;  2VAF A;  5ECL B;  4DEJ A;  3GKM A;  4WET A;  4J56 E;  5CAX A;  3H8Q A;  5AIV A;  2PVO C;  4PQI A;  2KP2 A;  3TDG A;  1Q4J A;  3WGX A;  5F06 A;  4K8M A;  2V2G A;  1AW9 A;  3CSI A;  3QAV A;  3C1R A;  4K5S A;  3QD9 A;  5ECP B;  1SK1 A;  1TJD A;  2VM2 A;  2PN8 A;  4TR0 A;  5HR0 A;  4EL1 A;  3FKF A;  4PXO A;  3U6V A;  3DGQ A;  2C0E A;  3KP9 A;  1TI1 A;  3HY2 A;  2CQ9 A;  5ECI B;  3ZYW A;  3BD2 A;  4ZL9 A;  2GST A;  1SKW B;  2OAD A;  6GSU A;  4POM A;  2LKU A;  3L9U A;  2RUE A;  3IRA A;  19GS A;  3ERG A;  1UC7 A;  5EVO A;  2XBI A;  4ILF A;  3TKR A;  3TKS C;  2FWG A;  4MJB A;  3UJ1 A;  5ABR A;  2GTU A;  1GSS A;  4ECJ A;  2GQK A;  2V32 A;  2VCV A;  3ZRD A;  2P5R A;  2XHF A;  2JZS A;  2YPM A;  2VOC A;  5ECS A;  3F4T A;  1T8E B;  1R5A A;  2DBC A; 
#chains in the Genus database with same CATH homology
 4MCU A;  1TK8 B;  4TVE A;  2RM5 A;  3ZRE A;  5KN1 A;  1XWC A;  2A2P A;  1SKR B;  1ERT A;  2J23 A;  2XPE A;  4TRX A;  1FO5 A;  5DQY A;  4MH2 A;  2KP1 A;  1ERW A;  3KMO A;  3KD0 A;  2YWN A;  5J41 A;  2LRC A;  2DMM A;  5H5R A;  4HS1 A;  4ECI A;  3VWX A;  1ZZY A;  1FOH A;  4POL A;  1K0D A;  4NPB A;  4IQA A;  2GSS A;  1V2A A;  2E7P A;  1JHB A;  3QOU A;  4O92 A;  4X1U A;  3IK7 A;  1B4P A;  2GZZ A;  1AUC A;  3ZMK A;  1F2E A;  4TW5 A;  3IDV A;  3RHC A;  5AIX A;  4RI7 A;  2VLV A;  3CTG A;  4JZQ A;  3N5O A;  5EL8 A;  3HXS A;  3F6D A;  1V9W A;  2HI7 A;  2IJY A;  4EC0 A;  1XBS A;  3HZ8 A;  4EE0 A;  1A0F A;  4IHU A;  2LRT A;  1PA3 A;  2JZT A;  1VF3 A;  2VL3 A;  3DD3 A;  4MJE A;  1TDI A;  1JZD A;  5G30 A;  3TUE A;  3K8N A;  2IL3 A;  4ISD A;  4MH3 A;  2K8S A;  3FR6 A;  3ZIJ A;  2GZY A;  1URM A;  2MBT A;  3EIN A;  1SU9 A;  2KOK A;  2PGT A;  5F0G A;  1OC8 A;  2FCH A;  3APQ A;  3P8W A;  3D6I A;  4HJ2 A;  1PGT A;  1QFN A;  3KH9 A;  5G31 A;  4MNN A;  4CHS A;  4MPG A;  6GSY A;  4TXO A;  2MYG A;  3FZA A;  3ZZX A;  2BJX A;  3VWW A;  1A2M A;  2VCT A;  1XPV A;  3VPT A;  4MA9 A;  2I1U A;  3M8N A;  4RQR A;  1S3D A;  4F0B A;  4K1F A;  3A5I A;  3IBH A;  2X64 A;  5JWO B;  4TN8 A;  2H0I A;  5CYY A;  4YKG A;  1GSQ A;  1DBY A;  1SJI A;  1THX A;  3LWA A;  1RW1 A;  1HD2 A;  4K0G A;  3G7I A;  4NV2 A;  4GWR A;  3UAR A;  4OWY A;  3GTU B;  2LJR A;  4HU7 A;  4ZBB A;  2AB6 A;  4GST A;  2X99 A;  1GUL A;  4DSR A;  1FOV A;  1ZMA A;  1G7E A;  1F37 A;  1I5G A;  4AGS A;  4LLR A;  1FG4 A;  4ZBA A;  1OAZ A;  1MEK A;  1XWA A;  1N8J A;  5ECN B;  5C00 A;  3FRC A;  1G0T A;  2IIY A;  3I6A A;  1XW9 A;  2O85 A;  2DKI A;  4PUR A;  4F9Z A;  1FHE A;  2KHP A;  3GYK A;  4MF7 A;  2E2G A;  4QL9 A;  2VCW A;  4WKW A;  2DLX A;  1C72 A;  4O5R A;  1V57 A;  4EDY A;  1KBN A;  4IEL A;  1Z7R A;  2DML A;  2H0G A;  3TB2 A;  4ZL8 A;  1Z9H A;  3O6T A;  3JCM L;  2IPA A;  2LS5 A;  3EMX A;  4TR1 B;  2YWI A;  5HFG A;  2HRN A;  1T00 A;  2VCX A;  2DJ1 A;  1ZGN A;  2ON5 A;  3GH6 A;  3F0I A;  1G6W A;  4MZC A;  1K0O A;  3NOF A;  1GUM A;  5F05 A;  1O8W A;  2LJK A;  1WP0 A;  3APO A;  1S3A A;  5A4U A;  2RLI A;  2HYX A;  1K3O A;  3E0U A;  2B5E A;  2FNO A;  3FZ9 A;  3CSH A;  2GT5 A;  4TR3 A;  3L0H A;  3A2V A;  1PKZ A;  2GS3 A;  2REM A;  1AC1 A;  7GSS A;  4MF5 A;  5DJM A;  4WEY A;  4GQC A;  2HRK A;  4N11 A;  1G6Y A;  3GN3 A;  1J9B A;  1JZR A;  1B8X A;  4N30 A;  1XOB A;  2H73 A;  4HZ4 A;  4JU5 A;  3LYK A;  2C1Y A;  3Q19 A;  2F8F A;  2GSR A;  2FY6 A;  4K0N A;  4P3Y B;  5KOW A;  3N9J A;  5GZZ B;  3PPU A;  5D73 A;  3D4T A;  3IPZ A;  1SYX A;  1VF1 A;  1GTB A;  2R3X A;  2I3Y A;  1QXH A;  2F8A A;  1FAA A;  1M2B A;  2WUL A;  4FQU A;  3F4S A;  3FR3 A;  5FHI A;  2ALB A;  2H1A A;  2PBJ A;  1OE8 A;  2IMF A;  4K9Z A;  3EU4 A;  3EYT A;  1CQH A;  5ELA A;  2IMI A;  2VD0 A;  2H75 A;  3ZFL A;  4JE1 A;  4GCI A;  4O7H A;  2R0G A;  3FHK A;  1XVW A;  4NHZ A;  5EPF A;  1GTA A;  5JCW A;  4PQH A;  1T3B A;  3EVI A;  5INY A;  3FZ4 A;  1NM3 A;  2JU5 A;  4CY8 A;  3TOT A;  2R6K A;  1DSB A;  1BED A;  3D22 A;  3IA1 A;  4BA7 A;  4Z2T A;  5IOX A;  5JWQ B;  1FW1 A;  3LJR A;  4KCA A;  3KM6 A;  3IK9 A;  1GRX A;  4XS1 A;  4D73 B;  2MZC A;  3LFL A;  4I2T A;  5B8B A;  2BTO T;  1T4Y A;  3GIX A;  2L59 A;  1GL8 A;  2C0F A;  4V2L A;  3G7J A;  3H1N A;  3EUR A;  4J2F A;  2L6C A;  3C71 A;  3RBT A;  2VL2 C;  4GQF A;  1Z6M A;  1TW9 A;  10GS A;  3O3T A;  1A2J A;  2B5X A;  1I9D A;  2KUC A;  5IMA A;  3HJO A;  2EIQ A;  5AGY A;  1ZYQ B;  2HFD A;  1U6T A;  2WRT A;  3VUR A;  2HLS A;  4EDZ A;  5ECK B;  1K0B A;  5IPG A;  1GTU A;  4V1A g;  3E3E A;  3GL3 A;  5FWG A;  4RI6 A;  3C8E A;  4KAE A;  4IVF A;  3WT1 A;  1XCC A;  5D8I A;  2IN3 A;  1GUK A;  2DJ2 A;  3UIW A;  3UL3 A;  3EMP A;  2ES7 A;  4XCS A;  2CV4 A;  1G7O A;  1GSE A;  2M80 A;  4V2N A;  3GRX A;  2YZH A;  4LA1 A;  5DQS A;  5IM9 A;  12GS A;  1M2D A;  4KA0 A;  3TJF A;  1LJR A;  8GSS A;  1XIY A;  4DSQ A;  1HNB A;  1WMJ A;  2A2S A;  1U3A A;  1J0F A;  1HNC A;  3HJP A;  2IFQ B;  4YH2 A;  3U5R E;  4KDY A;  4F03 A;  1SK2 A;  1K3L A;  2LEG A;  4I5Q A;  5J5N A;  1EWX A;  3TKQ A;  3MWH A;  3C1S A;  3GUS A;  3MNG A;  3ZL5 A;  3PIN A;  3QDN A;  4A5P A;  3CRU A;  1XOA A;  3M3M A;  3KP8 A;  4TR4 A;  2B1K A;  3NZN A;  2B5Y A;  2YWM A;  2JAC A;  1PSQ A;  1ERU A;  4OFN A;  1EEJ A;  1AXD A;  4HQS A;  4L5L A;  3BCI A;  4EVM A;  2LST A;  1PN9 A;  4NXI A;  1H75 A;  2Z9S A;  3UMA A;  2P0G A;  1O6J A;  4MF6 A;  3KGK A;  3VI5 A;  3DXB A;  2CAQ A;  1GSF A;  4FYC A;  4NAX A;  2JAD A;  2X4A A;  3VI7 A;  1HQO A;  4PGT A;  3L78 A;  4IQ1 A;  1F9M A;  1Z5Y E;  3CSJ A;  4HUA A;  4MAB A;  5GST A;  5BRT A;  3IXR A;  3OR5 A;  2WS2 A;  2G2Q A;  2PVQ A;  2F3M A;  1HNA A;  3M9J A;  4V2M A;  1EP7 A;  5DAL A;  3VPQ A;  3P2A A;  4ICY A;  1PL2 A;  3KH7 A;  4CDO A;  2H72 A;  2L4C A;  3H93 A;  1TRU A;  3ZML A;  4X4J A;  1EV9 A;  2CT6 A;  4ZXG A;  1DE1 A;  1TRW A;  2MMZ A;  3KCM A;  1GSY A;  4WBR D;  1X0R A;  2GDR A;  3I9V 2;  1TU8 A;  1O7U A;  1O85 A;  1R5P A;  3QAG A;  1JLW A;  4HOJ A;  1WRY A;  3RHB A;  4NHW A;  4ZIJ A;  1X5D A;  3UBK A;  1PX7 A;  4KE3 A;  1RK4 A;  5GAP D;  4JR6 A;  1YDK A;  1CQG A;  2CX3 A;  4I6X A;  4KB3 A;  4WBJ A;  1R26 A;  1FB6 A;  3F3R A;  4PTS A;  4MP4 A;  3GA4 A;  5AIS A;  1EOG A;  1PRX A;  2VIM A;  1TOF A;  2DC5 A;  2QC7 A;  3KIJ A;  3HVV A;  3ME8 A;  4OFT A;  3DYR A;  5A5K A;  5HQP A;  2QA2 A;  3GH9 A;  4OO5 A;  5FT3 A;  1V40 A;  5J9C A;  1ZYE A;  1GTI A;  4BWS A;  4OCF A;  4AJ8 A;  4Z2R A;  1O73 A;  1ST9 A;  2N5B A;  2QGV A;  5DAL B;  3KXO A;  3QMX A;  3MIX A;  4KCE A;  4BPY A;  3HVX A;  3GX8 A;  2FWE A;  18GS A;  4ZL7 A;  5KN3 A;  1O8X A;  5AN1 A;  4POK A;  4Q5R A;  1QGV A;  4XTS A;  1TRV A;  3D21 A;  4PQ1 A;  4F2I A;  4MDC A;  2H0H A;  2TRX A;  1A2L A;  2DIZ A;  1R7H A;  4MMM A;  3LW9 A;  1PN0 A;  4HQZ A;  3CRT A;  4IP1 A;  4ML6 A;  2OE3 A;  4Q5F A;  2ZNM A;  1DE2 A;  1ZYN A;  5B6M A;  3G9B A;  4ZBD A;  4Z7X A;  5CRW A;  1ZYP A;  3F3Q A;  5CRE A;  3DKS A;  3TRX A;  2L5O A;  1WPI A;  2AUV A;  4QL7 A;  1K0N A;  1UA5 A;  3IR4 A;  2I81 A;  2FHE A;  4MPF A;  14GS A;  2PU9 C;  9GSS A;  2OE0 A;  4KH7 A;  3ZVJ A;  1ERV A;  5IQY A;  2I4A A;  3APS A;  2WFC A;  3LSZ A;  4I2U A;  4YKF A;  3US3 A;  3DVX A;  1UVZ A;  5IMF A;  3F6F A;  2D2Z A;  2QSI A;  5G5E A;  3ISO A;  4OMV A;  2PUK C;  4FYB A;  5D9T A;  1AQW A;  3M0F A;  1N2A A;  2XBQ A;  3DML A;  1SL2 B;  3SBC A;  3IV4 A;  5IO2 A;  4DSS A;  3VLN A;  1GLP A;  4F82 A;  2E2M A;  4MJA A;  3UBL A;  4IP6 A;  3ZVJ D;  1QQ2 A;  4Z2U A;  5HFI A;  3A2W A;  4HDE A;  2H76 A;  3UOM A;  4KW6 A;  2HSY A;  1KEB A;  3IAM 2;  1X9M B;  1GNE A;  4PX1 A;  4MK3 A;  1GH2 A;  4WF5 A;  1A8Y A;  2E0Q A;  5A4W A;  5J3R A;  1MD4 A;  1SJ6 A;  3CYN A;  3SWL A;  4PUF C;  1JZO A;  2WB9 A;  1TI3 A;  1OKD A;  4TXO B;  1DUG A;  2H6Y A;  2FD3 A;  2HZE A;  5E4W A;  5LD0 A;  2OAC A;  2JZR A;  4WXT A;  11GS A;  4HEA 2;  4BL7 A;  4XHM A;  3IC4 A;  5ID2 A;  1QUW A;  2EIR A;  3R3E A;  1Z3E A;  2P31 A;  4TOP A;  1SD8 A;  3D5J A;  1PMT A;  4KSM A;  5GSS A;  3FZ5 A;  5JWR B;  3F8U A;  4GTU A;  1M2A A;  4EKZ A;  3PH9 A;  1BG5 A;  4KUN A;  1JZW A;  3DEX A;  3A2X A;  3GMF A;  3TOU A;  22GS A;  4OO4 A;  4G9H A;  3DVW A;  3M9K A;  2B1L A;  2H01 A;  3CMI A;  1MTC A;  2VUP A;  5H5S A;  2J9H A;  2ON7 A;  2R0P A;  1M9A A;  3PGT A;  1WJK A;  1B9Y C;  2UZ8 A;  4JR4 A;  3QCP A;  2R37 A;  4K5R A;  3KMN A;  4IJ3 A;  2WDU A;  2K8V A;  2L6D A;  2HT9 A;  2V6K A;  3TCO A;  1FB0 A;  3H4K A;  3EU3 A;  5KEJ A;  3GKK A;  1V98 A;  1GSU A;  2HXK A;  3ERF A;  1M9B A;  3TKP A;  1B48 A;  1TRS A;  1OC3 A;  5DBQ A;  4I97 A;  3BCK A;  1F3A A;  2L57 A;  4YAP A;  1YF0 A;  3AY8 A;  5CRG A;  1OYJ A;  2C4J A;  2N5F A;  3FY7 A;  5ID2 B;  3NIV A;  1VF4 A;  2L5L A;  1ILO A;  1Y6E A;  5ELG A;  5ENU A;  5F8B A;  4Q5N A;  3LOR A;  4PUA A;  2ZUP A;  3MAK A;  4E8E A;  5ECQ B;  3C73 A;  5D93 A;  4HU9 A;  2YCD A;  3HKR A;  4J57 E;  2XC2 A;  1ON4 A;  1NHY A;  2FWH A;  2ZCT A;  3RPN A;  2A4V A;  2G0F A;  2XPD A;  2YN1 A;  6GSW A;  2OBI A;  4ECC A;  1EV4 A;  5IMC A;  2C3Q A;  2NPB A;  3UEM A;  3LGC A;  4YQU A;  1KNG A;  3FYG A;  3QPM A;  1SL1 B;  2HSH A;  2M72 A;  4BVY A;  4KDU A;  1ZCP A;  5HR2 A;  4RUV A;  1O81 A;  1M7T A;  4HZ2 A;  4OFM A;  3D4M A;  4XS6 A;  2JSZ A;  1VF2 A;  3H79 A;  4V1A p;  3UAP A;  1OC9 A;  4G2E A;  2R4V A;  2LUS A;  3GST A;  1R4W A;  1VRS D;  4K6X A;  4BWQ A;  5DJL A;  1OVN A;  3HDC A;  2HRF A;  5CRD A;  5IMD A;  4G10 A;  5HR3 A;  3UVT A;  2HE3 A;  2RUF A;  2CX4 A;  3HZ4 A;  1BYE A;  4WR5 A;  3ZIT A;  2A2R A;  2VCQ A;  2MBS A;  5D9X A;  5B8A A;  1XVQ A;  1YJ6 A;  5JCG A;  1ML6 A;  3GSS A;  1H4O A;  1A23 A;  3ZIV A;  4YQM A;  1SEN A;  1QMV A;  3MSZ A;  4MLY A;  3EWL A;  1YKC A;  2JL4 A;  3CTF A;  3CXG A;  4BVY B;  1YEP A;  4EF0 A;  2FWF A;  6GSX A;  2OA7 A;  3ZFB A;  16GS A;  3A5W A;  1OC9 B;  1UN2 A;  3ME7 A;  4G0I A;  2DJ0 A;  1AQX A;  3VK9 A;  1AAZ A;  1YQ1 A;  1WIK A;  2H1G A;  2FGX A;  2MMO A;  3GUR A;  3IE3 A;  1HYU A;  2GZP A;  2F9S A;  2O89 A;  1WE0 A;  4L0W A;  3PR8 A;  4L0U A;  2V6O A;  3TKS A;  2HZF A;  5B6N A;  1YZX A;  3FR9 A;  3QFB C;  3TJK A;  3QFA C;  4CY6 A;  4K7O A;  2YZU A;  2PPT A;  2KLX A;  3RDW A;  2R0C A;  5G1L A;  4EO3 A;  1A0R P;  2A4H A;  3RPP A;  1EOH A;  4OCE A;  3G7Y A;  1X5C A;  1ZL9 A;  3I43 A;  4ULX A;  2WCI A;  4GRF A;  4GSN A;  4IJI A;  4IW9 A;  2DSA A;  2M46 A;  5D96 A;  2RII A;  1B4Q A;  1NHO A;  2CZ2 A;  2DKH A;  2GVP A;  4G19 A;  3KTL A;  2H1D A;  5CO3 A;  1SJZ A;  4N10 A;  1XWB A;  4KGI A;  2PMT A;  2EIO A;  4FIW A;  5KOX A;  4YQV A;  3DWV A;  2C8U A;  3ZLP A;  3WYW A;  5D9V A;  2NDO A;  3V1W A;  1SK0 A;  3E9J B;  1MDK A;  1XWK A;  3TRQ A;  1TU7 A;  3Q18 A;  3GX0 A;  2B7J A;  1Z7P A;  3VWU A;  4GXZ A;  4G0K A;  2LQQ A;  4AJ6 A;  2GQL A;  2NTO A;  4EIP A;  1OE7 A;  3FW2 A;  2QKE A;  4LL4 B;  1IYI A;  3P7X A;  5G5F A;  1MD3 A;  3MDK A;  3HHV A;  2NBS A;  3Q6O A;  3LXZ A;  3BJ5 A;  3TJB A;  3F9U A;  1SKS B;  17GS A;  3J7Y b;  1F3B A;  3GV1 A;  3KTB A;  3LEF A;  5J9B A;  2YAN A;  2C3T A;  2WZ9 A;  1A24 A;  1E2Y A;  4LL1 B;  5COH A;  3F63 A;  2H66 A;  1EP8 A;  3IC8 A;  1M99 A;  5A4V A;  3IHG A;  1X5E A;  3GKN A;  5F07 A;  1XWG A;  3LG6 A;  4ZB6 A;  2H19 A;  2YOI A;  3L4N A;  3GHA A;  1T1V A;  2VM1 A;  1J08 A;  1GSD A;  3S9F A;  2R2J A;  4JED A;  4F0C A;  4OD7 A;  2LQO A;  2YNX A;  3TJJ A;  2H1B A;  2X8H A;  5CP1 A;  5G1K A;  4O5U A;  1MDI A;  5CNW A;  2FUG 2;  2LNS A;  2YV7 A;  2YWO A;  1PX6 A;  4LMV A;  5ECH B;  4WF4 A;  2VLT A;  4ACS A;  4ZB9 A;  3GTU A;  4POB A;  2NVL A;  2LRN A;  4JRR A;  3WT2 A;  2CAI A;  5IO0 A;  3UVH A;  3LXT A;  3WD6 A;  5IMZ A;  1YKA A;  5DCG A;  3HCZ A;  4IBP A;  3DRN A;  3VWV A;  2O7K A;  3IAS 2;  3C7M A;  3FMW A;  3GNJ A;  2IMK A;  3HD5 A;  4ZIL A;  3I69 A;  1NSW A;  1TXX A;  2TIR A;  2HNL A;  1TK0 B;  2X8G A;  1QK8 A;  5DCH A;  3TJG A;  3EE2 A;  4AJ7 A;  1NW2 A;  3EC3 A;  1JFU A;  1SYR A;  1U88 A;  1ACV A;  1KTE A;  2L4Q A;  5HFK A;  1K0C A;  4AF2 A;  2VO4 A;  3TRP A;  4K2D A;  1EGO A;  4PNF A;  4ZB8 A;  1BQ7 A;  1A8L A;  3KEB A;  3L9V A;  2YJH A;  4K7N A;  2VCZ A;  1PD2 1;  3QR6 A;  4TR1 A;  4USS A;  1BX9 A;  4G0L A;  1THO A;  2AAW A;  5KN2 A;  1FVK A;  5LCZ A;  2X8C A;  1TKD B;  5LNK e;  1YF1 A;  1F6M C;  1GUH A;  1M0U A;  3RAZ A;  4MJC A;  5L71 A;  2H6X A;  1K0A A;  2VL9 A;  2P5Q A;  1EZK A;  2H71 A;  2OKA A;  2OJL A;  3ED3 A;  4NV5 A;  4FH8 A;  3TGZ A;  4KX4 A;  1K3Y A;  2I9H A;  1ABA A;  1TTZ A;  1YEX A;  3ZTL A;  4RQX A;  1WOU A;  5IPH A;  2H70 A;  3LYP A;  1V58 A;  4LMW A;  5DAK A;  1SL0 B;  4HJM A;  2YP6 A;  2QA1 A;  4I8B A;  2IMD A;  6GSV A;  3L9S A;  2CVB A;  5CRH A;  3WGD A;  2GT6 A;  4KND A;  1B9X C;  5IIZ A;  2HSM A;  4DSS B;  1AIU A;  2EC4 A;  3FK8 A;  1GP1 A;  2IWT A;  5ECO B;  20GS A;  2DJJ A;  1EEM A;  4GLT A;  2IME A;  1BJX A;  1USB A;  2CVK A;  4CW9 A;  2K6V A;  4GF0 A;  2PER A;  1TK5 B;  2FLS A;  4FO5 A;  1FVJ A;  2FA4 A;  2LJA A;  4HI7 A;  2B6M A;  5KN0 A;  2HZE B;  3W8J A;  4X0X A;  4ECB A;  2GQM A;  1SD9 A;  3GL5 A;  2DIY A;  1XZO A;  2OE1 A;  2CZ3 A;  3WGE A;  2BMX A;  2AYT A;  4D73 A;  2C3N A;  2H8L A;  3QAW A;  5DAK B;  3R2Q A;  4L8E A;  1XFL A;  1T4Z A;  2AJQ B;  3HVS A;  1RQM A;  2C80 A;  3W6G A;  1XW6 A;  4BL7 B;  3D0Z A;  1AQV A;  1GWC A;  2YJ7 A;  4KSO A;  3LQ7 A;  2PWJ A;  2CVD A;  2GLR A;  5ECM B;  2R5G A;  5JCU A;  4X43 A;  4FYU A;  4MZW A;  2VLU A;  2LTK A;  2LNT A;  4XS4 A;  1YY7 A;  4BVX A;  1GLQ A;  2K9F A;  2VL2 A;  3EPT A;  4ID0 A;  4K7I A;  4KDX A;  4L5O A;  1S3C A;  4IKH A;  2VD1 A;  4TKY A;  2X49 A;  4K2X A;  2V41 A;  1Z6N A;  4IS0 A;  5DDL A;  2C0D A;  3M1G A;  13GS A;  1PQN A;  4JBB A;  4NWY A;  5IMV A;  3Q74 A;  1T7P B;  4IN0 A;  6GSS A;  4IGJ A;  1LU4 A;  2IFQ A;  3KZQ A;  5H5Q A;  5EY6 A;  1Y25 A;  1JLV A;  2JSY A;  4XIH A;  6GST A;  1IYH A;  4MZB A;  1PKW A;  4DVC A;  5BMU A;  2TRC P;  2LV3 A;  2CA8 A;  3KJY A;  3J7Y k;  3HYP A;  3VFI A;  4EIQ A;  2AV4 A;  2DJ3 A;  2H30 A;  3IHQ A;  4NMU A;  1VGL A;  2C0G A;  5B7C A;  2WGR A;  4XS4 B;  4O5Q A;  1W4V A;  3F4R A;  4KF9 A;  4BVX B;  1Q98 A;  2HRA A;  4N0V A;  2F51 A;  2WJU A;  1GNW A;  1OKT A;  1MDJ A;  4ML1 A;  3DIE A;  2H74 A;  5GAN D;  5IOW A;  2OBK A;  1WWJ A;  5J4U A;  3FEU A;  1LBK A;  2GGT A;  4XRD A;  2O87 A;  3A3T A;  1BAY A;  1U3I A;  4E8H A;  2B3S A;  1X9S B;  2N5A A;  1X9W B;  3BOA A;  3GKX A;  3IOS A;  1XW5 A;  4QQ7 A;  5HR1 A;  2B7K A;  5ECR B;  3BBY A;  4EXJ A;  3HA9 A;  5E59 A;  2MMN A;  2K18 A;  4PNG A;  2O8V B;  2YV9 A;  3W8S A;  4H86 A;  4WR4 A;  3CBU A;  4O32 A;  3O76 A;  1TP9 A;  4EUY A;  1W89 A;  2RM6 A;  4GSS A;  4N0Z A;  5D9W A;  3HJM A;  5C04 A;  5DVB A;  1E6B A;  1ZOF A;  3P90 A;  3ERW A;  5G2Z A;  1K0M A;  1U87 A;  3MYD A;  1XXU A;  2V1M A;  1EGR A;  2DJK A;  3GFK A;  4YAV A;  2FA8 A;  4TXV A;  2MMA A;  2GSQ A;  4Q5Q A;  4XRA A;  3TKS E;  1PL1 A;  2AHE A;  2H6Z A;  2VAF A;  5ECL B;  4DEJ A;  3GKM A;  4WET A;  4J56 E;  5CAX A;  3H8Q A;  5AIV A;  2PVO C;  4PQI A;  2KP2 A;  3TDG A;  1Q4J A;  3WGX A;  5F06 A;  4K8M A;  2V2G A;  1AW9 A;  3CSI A;  3QAV A;  3C1R A;  4K5S A;  3QD9 A;  5ECP B;  1SK1 A;  1TJD A;  2VM2 A;  2PN8 A;  4TR0 A;  5HR0 A;  4EL1 A;  3FKF A;  4PXO A;  3U6V A;  3DGQ A;  2C0E A;  3KP9 A;  1TI1 A;  3HY2 A;  2CQ9 A;  5ECI B;  3ZYW A;  3BD2 A;  4ZL9 A;  2GST A;  1SKW B;  2OAD A;  6GSU A;  4POM A;  2LKU A;  3L9U A;  2RUE A;  3IRA A;  19GS A;  3ERG A;  1UC7 A;  5EVO A;  2XBI A;  4ILF A;  3TKR A;  3TKS C;  2FWG A;  4MJB A;  3UJ1 A;  5ABR A;  2GTU A;  1GSS A;  4ECJ A;  2GQK A;  2V32 A;  2VCV A;  3ZRD A;  2P5R A;  2XHF A;  2JZS A;  2YPM A;  2VOC A;  5ECS A;  3F4T A;  1T8E B;  1R5A A;  2DBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...