2E7PA

Crystal structure of the holo form of glutaredoxin c1 from populus tremula x tremuloides
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
107
structure length
107
Chain Sequence
SKQELDAALKKAKELASSAPVVVFSKTYCGYCNRVKQLLTQVGASYKVVELDELSDGSQLQSALAHWTGRGTVPNVFIGGKQIGGCDTVVEKHQRNELLPLLQDAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Glutaredoxin
publication title Functional, structural, and spectroscopic characterization of a glutathione-ligated [2Fe-2S] cluster in poplar glutaredoxin C1
pubmed doi rcsb
source organism Populus tremula x populus tremuloides
total genus 35
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2e7pA00
2VL3A 1ZYQB 2H74A 4KE3A 4Q5QA 3KTLA 3FW2A 2DJ2A 4WBJA 1WOUA 3HYPA 5F0GA 1FVJA 3FZAA 1ZOFA 3VWWA 5IMCA 1KEBA 2VLVA 3MWHA 4K7IA 1K0AA 3F3QA 3KZQA 2CA8A 5ECHB 5IMVA 1T8EB 1HQOA 1VGLA 1FVKA 3IE3A 4MF5A 4LMVA 2L6DA 1M2DA 1HYUA 3F4RA 4I2TA 1JLWA 2VCXA 1XW6A 3NOFA 3GKXA 5DDLA 8GSSA 1PMTA 5LD0A 3A2VA 2LRCA 1USBA 1ZYEA 1TK5B 3G7IA 11GSA 4NPBA 1GTUA 3HJPA 4G10A 3J7Yk 1X9WB 4IS0A 1BX9A 3CXGA 5A4WA 2VLTA 5HR0A 1OAZA 2B5EA 4EDYA 1M99A 3EVIA 5GSTA 1PL2A 1M7TA 3ZTLA 1F6MC 1A0RP 3TKSA 4JZQA 4HQZA 1TRVA 1JFUA 3EURA 1M0UA 2C0FA 4OFNA 1GSQA 5EVOA 1V58A 2H1GA 2I3YA 3L4NA 3OR5A 2GZYA 2B3SA 4Q5NA 4TXOB 2A2SA 4QL9A 4PQ1A 3TKRA 3O6TA 4HOJA 4K2DA 2V6KA 4V2LA 1S3AA 3MDKA 1Z7PA 5L71A 2J23A 2HRFA 1TRWA 4IHUA 2F8AA 4XS6A 2YV9A 2VOCA 2C4JA 4MMMA 3DXBA 3VWUA 4YH2A 1XWGA 5HR3A 2XPEA 3F6FA 1QUWA 1OE7A 4HU7A 2OBIA 2V1MA 3ZITA 1VRSD 3I6AA 4MZBA 5KN2A 3TRXA 5JWQB 2DC5A 3L78A 1YKAA 4J56E 4OMVA 3FRCA 2MMOA 2H6ZA 2D2ZA 3DWVA 2LTKA 4K0GA 2GZZA 1NM3A 1GRXA 4V1Ap 4MK3A 5DCHA 3TKSE 3UBLA 2RUEA 1A24A 4BL7A 2B7KA 3QMXA 1GSSA 5B7CA 2ALBA 3KCMA 3HZ8A 5DCGA 2AB6A 4L5OA 3CBUA 4WEYA 5DALB 4N0VA 1TW9A 2IN3A 4HJMA 4ULXA 2DSAA 2H1BA 2HZEA 1SU9A 3QDNA 2L57A 3EMXA 4D73A 3TJGA 5C04A 1HNAA 2WGRA 2OE3A 1TXXA 4MZWA 4FYUA 1OKTA 2JACA 2X8CA 3UL3A 1TOFA 2VCTA 4K9ZA 4PURA 1YDKA 1TK0B 1QQ2A 3C7MA 4TN8A 2OE0A 2YOIA 4KB3A 5COHA 1EGRA 1M9BA 3C71A 3VWVA 4ECJA 1B48A 3ZYWA 5GSSA 3GYKA 4JR6A 4EO3A 2VL2C 4ML1A 3KP8A 3LSZA 2DIZA 2H19A 5D9WA 4F0BA 4IKHA 2LQQA 4HUAA 1W89A 1OC9A 1E2YA 4L0UA 1G7EA 4IN0A 5C00A 3IK9A 1GTBA 1TTZA 3DGQA 4NHWA 3GFKA 3WGDA 3RHCA 5JCWA 1J0FA 4GLTA 4DSSA 4HZ4A 3ISOA 1S3CA 4BA7A 2A4VA 2MYGA 3LXTA 3LYPA 3NIVA 1XVWA 2OJLA 3IBHA 4ECCA 3DVXA 3APOA 5HFIA 3EMPA 2C0EA 1Z9HA 1RQMA 1SK1A 5LCZA 1JLVA 1SYRA 2IIYA 4OD7A 5LNKe 4I97A 2VCQA 3F0IA 1XWKA 2IMFA 4GQCA 4AJ8A 4YQUA 3CSHA 1XCCA 2E2GA 1A2JA 1AW9A 1VF4A 1IYIA 4G9HA 4MLYA 3Q19A 3GTUA 2H1AA 3ZL5A 4Q5RA 1OC9B 1SL0B 1UC7A 19GSA 1ERUA 5JWRB 2ON5A 2VO4A 4JBBA 1XXUA 1BG5A 2KP1A 1QGVA 1PD21 2EIRA 1T4YA 5CRDA 5DAKB 1JZRA 3ZMLA 4H86A 4BPYA 4DSSB 1H4OA 2GLRA 4J2FA 1OYJA 1TJDA 2MMZA 2DJ1A 2HT9A 2H0IA 4IP1A 2XBQA 4L5LA 5IO2A 1WIKA 5HR2A 4GSNA 1U88A 4EC0A 1DE1A 2HSYA 5G31A 2E7PA 2H0GA 4FYBA 1TRSA 2M46A 4GWRA 1EEMA 4QL7A 1SENA 1FAAA 2AHEA 2VL9A 3UVTA 3IK7A 2L5OA 3VPTA 2HRNA 3IA1A 4MA9A 3Q6OA 1SL1B 5H5QA 5B8BA 2RM5A 4MCUA 2ON7A 3TRQA 2X8HA 1EP8A 1MDKA 4MJCA 1OVNA 1GNEA 3GTUB 1K0NA 4GTUA 4XRDA 1B9YC 2I1UA 2VIMA 3GL5A 3M9KA 1EOHA 1PX7A 18GSA 1A2LA 4XIHA 5IPGA 1KBNA 1FHEA 3D22A 3GH6A 1HNCA 2XC2A 1X9SB 4N10A 2VM2A 4F0CA 2C3NA 4AJ7A 3FR9A 1XBSA 2VAFA 4FYCA 1OC8A 1TDIA 4MPGA 3HCZA 3DVWA 1SJZA 1Q98A 2DJKA 3HY2A 22GSA 3UJ1A 5HFKA 4F2IA 2WJUA 4V1Ag 2CV4A 4FIWA 3UOMA 1ERTA 3R2QA 5CO3A 1R4WA 5KN3A 4GRFA 3ERWA 4ID0A 1SKWB 2I4AA 1O7UA 4BWSA 4K7OA 2IFQA 2O87A 4TR0A 1TU7A 3WD6A 3M0FA 3D21A 1GUHA 1QXHA 3FYGA 2C3TA 3IC4A 2FY6A 2GGTA 1XZOA 1Y25A 4ECIA 1T1VA 2MMNA 4ECBA 3DD3A 3BCIA 1K0BA 3FZ9A 1V98A 2VD0A 4CHSA 3I69A 2TIRA 2GSRA 3GKMA 4WBRD 4WXTA 4WKWA 2CX3A 1GTAA 3KGKA 2JZTA 2L6CA 4POLA 1ZGNA 4TVEA 6GSSA 5FT3A 4MABA 1I9DA 3LWAA 2YNXA 2F3MA 1X5EA 3V1WA 1JZOA 1EOGA 2R5GA 4TXOA 3G7JA 3W6GA 3PINA 1MDIA 4P3YB 1BQ7A 3H4KA 3D6IA 1XW5A 4TR1B 1A2MA 5HFGA 3QOUA 4CW9A 4WF5A 4IVFA 4XS4B 1GSUA 5ECKB 3P7XA 1DE2A 3DYRA 4GCIA 2H71A 4E8EA 3GKNA 4EXJA 4BVXA 2DJ0A 3O76A 3EC3A 1K3OA 2IFQB 1UA5A 2JL4A 2N5BA 1GSDA 5IMFA 2NPBA 4KAEA 1B9XC 1K0CA 1K3YA 4XCSA 1MD4A 3QAWA 2KUCA 1EEJA 5G1KA 2R6KA 2FUG2 3FZ4A 1RW1A 4OCEA 3RHBA 3LORA 3LQ7A 1A23A 3KIJA 3HZ4A 5B6NA 2QKEA 1PN9A 13GSA 3QFBC 3PGTA 5GAPD 3QR6A 1GUKA 2H72A 4N11A 2PU9C 2TRCP 5B6MA 3QAVA 1B8XA 5A5KA 4F9ZA 1Z7RA 5DALA 2FWGA 3CTGA 1C72A 2PN8A 3S9FA 5ELAA 5CYYA 1O85A 2KP2A 1YKCA 1YZXA 2H76A 4KDYA 3EU3A 2N5AA 3LGCA 1A8YA 3KEBA 1GSEA 2C1YA 1NSWA 2DMMA 1ABAA 4AGSA 1SL2B 5F05A 4NAXA 2LNSA 5ECIB 4ZB9A 4XHMA 1GL8A 3BBYA 1T7PB 1BEDA 1O6JA 5GZZB 3P90A 1AC1A 1GNWA 4I6XA 5IPHA 4RUVA 2DJJA 3P2AA 2GS3A 3HJOA 5ECMB 5E4WA 5G2ZA 2P5RA 2QC7A 3CSIA 2YCDA 1UVZA 2PVOC 2BJXA 1W4VA 5CP1A 2C3QA 1AIUA 4HZ2A 5KN0A 3IOSA 2REMA 3WT2A 1AUCA 1J08A 1GWCA 1U6TA 4NHZA 4IJ3A 3GSTA 3KH9A 1QMVA 2EIQA 3KH7A 4TOPA 4YQVA 3C1RA 2CVDA 2C0DA 1SYXA 5IOWA 1MTCA 2YJ7A 1WPIA 1WP0A 3TOTA 5AGYA 4G19A 3EE2A 2O8VB 3VFIA 3D4MA 3TRPA 2X64A 3APQA 4KSOA 1YEPA 2GTUA 3VK9A 1BAYA 2FHEA 3GMFA 5DBQA 3QCPA 2PMTA 2K6VA 1A0FA 2FLSA 2B5XA 4ZXGA 3F63A 1SK0A 4O92A 5IOXA 4ACSA 3KMNA 2HYXA 3F3RA 1O73A 3DKSA 5F06A 3E3EA 2F51A 1XWBA 1X9MB 16GSA 3QPMA 7GSSA 1XFLA 1AQWA 1PL1A 3ERFA 3TCOA 5AISA 3GHAA 4MJEA 4ML6A 4PXOA 2XHFA 2GSTA 3F8UA 4RQXA 2PVQA 1RK4A 2YWOA 1K3LA 3TGZA 4EVMA 1V57A 5FWGA 2YV7A 4TR4A 2NDOA 3HDCA 4RI7A 3UARA 3GNJA 3ZMKA 4LMWA 2GQLA 3GX8A 2H75A 5DAKA 3VI7A 2V41A 4KSMA 2HZFA 4TXVA 3EWLA 2F9SA 3KJYA 3IXRA 3Q74A 5CRGA 4EDZA 1T00A 5EL8A 2MMAA 4J57E 2VLUA 3CTFA 1QK8A 4YAPA 2LQOA 3GURA 4RQRA 4DEJA 4ZBDA 1PRXA 4ZIJA 3G9BA 2B6MA 5KN1A 3ZIJA 4NV2A 2FA4A 1TRUA 2CT6A 4MPFA 1WWJA 4KDUA 3L9VA 4IQAA 4YQMA 1GULA 4BVYA 5IMDA 2I81A 6GSWA 4DVCA 6GSTA 1YY7A 3TKQA 3ZRDA 3NZNA 4KGIA 1DSBA 4PUFC 5ELGA 3UEMA 5CAXA 3VLNA 1F2EA 2EIOA 2JSZA 1M2BA 1GLPA 2CX4A 1TKDB 3GH9A 3N9JA 3L9UA 4JEDA 6GSVA 3TKSC 1GSYA 4GSSA 4NV5A 2CVBA 1YEXA 4I2UA 4K1FA 3H1NA 2B1LA 2P31A 2L5LA 2LRNA 1TI1A 5ENUA 4AF2A 1SJ6A 4DSRA 3QFAC 2FD3A 1YQ1A 3GRXA 3J7Yb 4EE0A 3ZZXA 4XS1A 1K0OA 4HQSA 1BJXA 1EGOA 1PGTA 1F9MA 2HNLA 3EYTA 4ILFA 1H75A 2E2MA 2YWNA 3DRNA 2N5FA 5G5FA 2NBSA 2XPDA 4QQ7A 1CQHA 2WRTA 5HQPA 1KTEA 1HNBA 1VF2A 3MSZA 3HVVA 1YF0A 1ZZYA 5D9TA 1GP1A 5D96A 2LNTA 2L4QA 2CVKA 2WFCA 3VWXA 6GSYA 1G6YA 3KP9A 1B4QA 4ZBBA 2K9FA 3ZFLA 3HKRA 5ECOB 3MNGA 2IPAA 1PKWA 1XIYA 2AV4A 3CSJA 3HXSA 3UBKA 1NHYA 2HLSA 12GSA 3UMAA 3LEFA 4O7HA 4E8HA 2AAWA 2ES7A 2YPMA 2RM6A 3FK8A 3FZ5A 2GQMA 3CYNA 2CAIA 2QSIA 1UN2A 4FH8A 1G0TA 3KXOA 4POMA 4HU9A 3BJ5A 3RBTA 4PGTA 3RAZA 2JU5A 1XWAA 2O7KA 1PKZA 2LRTA 2VCWA 3JCML 2CZ3A 2H01A 2GVPA 1Z6MA 3C8EA 1QFNA 4L8EA 1N2AA 4TR1A 2M72A 4XS4A 1AQVA 3GX0A 1WJKA 1HD2A 1SD8A 4OCFA 5ECRB 2JSYA 20GSA 3F9UA 5J4UA 5JWOB 2AJQB 3UIWA 2DLXA 4KH7A 3SWLA 2PERA 1XPVA 2ZCTA 1TK8B 2A2RA 2P5QA 4EL1A 1U3AA 2HSHA 5J41A 5G5EA 3GL3A 3FR6A 3HA9A 1SKSB 4HS1A 2MBTA 5ID2A 2OBKA 1GTIA 1XVQA 2V32A 1PX6A 1CQGA 1K0DA 1JZDA 4IQ1A 5G1LA 3TOUA 3WGXA 4EF0A 2OE1A 2VL2A 3F4TA 4TRXA 2MZCA 1PSQA 3DIEA 4K8MA 4ISDA 2CAQA 3M8NA 4JU5A 1V9WA 2K18A 4LL4B 1YF1A 1MDJA 1F3AA 1WMJA 4I5QA 3D4TA 5ECNB 5CREA 1XOAA 3H8QA 5FHIA 5DJLA 5HR1A 5A4UA 3HJMA 5F07A 1F37A 2IL3A 4I8BA 4ZL7A 2L4CA 3TJFA 2B1KA 3QD9A 4MJBA 2VCVA 4WR4A 2BMXA 2H6XA 3A5WA 1IYHA 3GIXA 3I9V2 5J5NA 3ZLPA 4ZL8A 2B7JA 1WE0A 2LEGA 3GA4A 2VCZA 2DMLA 1G7OA 3GUSA 1FB0A 4TKYA 1FG4A 2AUVA 4DSQA 4X43A 1TI3A 3EINA 3PH9A 4GQFA 1M2AA 2JZSA 4K7NA 1SD9A 2WS2A 2AYTA 3M3MA 4HEA2 2IMKA 3C73A 10GSA 2IMEA 2NVLA 1T3BA 3PR8A 2JADA 1O8WA 5ID2B 5IM9A 3D5JA 2QGVA 3VURA 3WT1A 3I43A 2R37A 5CRHA 5H5RA 4ZB8A 2YP6A 3IR4A 1A8LA 5JCUA 4OFTA 1MD3A 5ECSA 3FKFA 1GH2A 1URMA 4X1UA 3RDWA 5AIXA 2IJYA 4POBA 3F4SA 2WULA 4IJIA 4EUYA 1R26A 3M1GA 3F6DA 1GSFA 3IRAA 2JZRA 1BYEA 2I9HA 4PNFA 3M9JA 3MAKA 2RIIA 5ECLB 1LBKA 2WB9A 2G2QA 1X0RA 4MH2A 2YJHA 3HHVA 4KW6A 4PUAA 2O89A 4FO5A 4AJ6A 2GZPA 2LV3A 1U87A 4Z7XA 3LFLA 2LUSA 3IDVA 5J9BA 1AQXA 3BCKA 1LU4A 4Q5FA 1ZL9A 3H93A 3KM6A 2ZUPA 2BTOT 1R5AA 2LS5A 1B4PA 3N5OA 2PGTA 4NXIA 3ME7A 2GT5A 4PQHA 5EY6A 5J9CA 1ON4A 4ZBAA 3D0ZA 3O3TA 3VPQA 1VF3A 4MH3A 4BWQA 4V2MA 2WCIA 5DVBA 1ZMAA 4N0ZA 3K8NA 2K8VA 1THOA 2HFDA 4WETA 6GSXA 2IMIA 1MEKA 3US3A 2B5YA 4O32A 1K0MA 2X8GA 4KX4A 3ZREA 2FGXA 1Q4JA 4KNDA 4MF6A 1N8JA 2R2JA 2MBSA 3L9SA 3QAGA 2V6OA 4F82A 2R3XA 1O8XA 1YJ6A 1X5DA 3U5RE 3H79A 3UVHA 4EKZA 2YN1A 4YAVA 2X99A 1M9AA 4NMUA 3BOAA 2GSQA 1Y6EA 3A2XA 3APSA 1NW2A 2J9HA 2KOKA 2NTOA 2LJRA 3RPNA 17GSA 2H1DA 4MJAA 4XRAA 5CNWA 2IWTA 5INYA 4IGJA 4KCAA 2DJ3A 1Z6NA 4RI6A 2HI7A 1F3BA 2H6YA 5ECQB 5G30A 5ECPB 1EWXA 4PX1A 1V2AA 2LKUA 1FOVA 2FWHA 3A2WA 5D9VA 4JR4A 1TU8A 4HDEA 1G6WA 5IQYA 2TRXA 2RLIA 4OO4A 4IELA 5B8AA 4V2NA 1T4ZA 2LJKA 3LYKA 3TJKA 3IAS2 1DBYA 2H0HA 2L59A 3CMIA 4KCEA 1GLQA 1EP7A 3GKKA 3ED3A 3RPPA 4LL1B 3HVSA 14GSA 2YZUA 1ML6A 5DQSA 4IW9A 1LJRA 3TUEA 5IO0A 1J9BA 1U3IA 3TJBA 4MP4A 1V40A 4JRRA 4HI7A 2HZEB 2F8FA 2H8LA 2Z9SA 4G2EA 3KTBA 4D73B 1JZWA 1AAZA 5EPFA 1S3DA 2VUPA 2G0FA 5D73A 3ME8A 1FO5A 1XW9A 3IV4A 5F8BA 2R4VA 9GSSA 5KEJA 1OKDA 2CZ2A 5IMAA 1GUMA 3IAM2 4GF0A 3A3TA 3E0UA 3FHKA 2LJAA 1XWCA 1SK2A 1AXDA 1ACVA 4N30A 1ERWA 1E6BA 3ERGA 1ERVA 2C8UA 1JHBA 2XBIA 2EC4A 3L0HA 4CDOA 5D8IA 5CRWA 3AY8A 4IBPA 2K8SA 2FWEA 3ZVJA 2RUFA 2P0GA 2ZNMA 4X0XA 4L0WA 3C1SA 2FCHA 4MDCA 1X5CA 4HJ2A 3ZIVA 5ABRA 2PWJA 4PNGA 5DQYA 5AIVA 3IHQA 4LLRA 3ZVJD 3HVXA 3W8SA 1FB6A 2H66A 3LXZA 1VF1A 2VM1A 3GV1A 5IMZA 2OACA 2YWMA 1DUGA 3KMOA 1R7HA 3FR3A 2GSSA 5J3RA 1I5GA 2DBCA 3G7YA 3TDGA 2C0GA 1EV4A 4KA0A 2FWFA 1SKRB 3TB2A 2LSTA 1ST9A 3ZFBA 3LJRA 5AN1A 4OWYA 1TP9A 3E9JB 1Z5YE 1O81A 3SBCA 6GSUA 3CRTA 4JE1A 1R5PA 2H73A 2PBJA 5JCGA 2HXKA 3P8WA 1ILOA 4XTSA 3DMLA 2FNOA 3FEUA 3UAPA 1PA3A 4K0NA 4GSTA 2HE3A 1EV9A 2V2GA 3EU4A 4K6XA 2OADA 4KDXA 2H30A 5DJMA 5A4VA 2OA7A 2O85A 4KUNA 1WRYA 1THXA 4LA1A 2H70A 3VI5A 2OKAA 2FA8A 2YANA 2GQKA 2WZ9A 4MZCA 2E0QA 5D9XA 2C80A 3GSSA 1KNGA 1OC3A 4OFMA 3TJJA 4IP6A 5E59A 1Z3EA 3GN3A 1XOBA 1EZKA 4WR5A 2YZHA 3LG6A 4OO5A 2VD1A 3DEXA 4ZL9A 4O5RA 5H5SA 1OE8A 4ZILA 2CQ9A 2KLXA 1FW1A 3Q18A 2YWIA 3W8JA 5GAND 2PPTA 2DIYA 2GDRA 1SJIA 3IPZA 4TW5A 4PQIA 2M80A 3BD2A 1PQNA 4GXZA 4TR3A 3KD0A 1NHOA 3U6VA 4WF4A 2PUKC 4ZB6A 3CRUA 5IIZA 3WYWA 2GT6A 4NWYA 2IMDA 4MF7A 4F03A 2WDUA 5D93A 3HD5A 4POKA 1ZCPA 2KHPA 3WGEA 3FY7A 3TKPA
chains in the Genus database with same CATH superfamily
2VL3A 1ZYQB 2H74A 4KE3A 4Q5QA 3KTLA 3FW2A 2DJ2A 4WBJA 1WOUA 3HYPA 5F0GA 1FVJA 3FZAA 1ZOFA 3VWWA 5IMCA 1KEBA 2VLVA 3MIXA 3MWHA 4K7IA 1K0AA 3F3QA 3KZQA 2CA8A 5ECHB 5IMVA 1T8EB 1HQOA 1VGLA 1FVKA 3IE3A 4MF5A 4LMVA 2L6DA 1M2DA 1HYUA 3R3EA 3F4RA 4I2TA 1JLWA 2VCXA 1XW6A 3NOFA 3GKXA 5DDLA 8GSSA 1PMTA 5LD0A 3A2VA 2LRCA 1USBA 1ZYEA 1TK5B 3G7IA 11GSA 4NPBA 1GTUA 3HJPA 4G10A 3J7Yk 1X9WB 4IS0A 1BX9A 3CXGA 5A4WA 2VLTA 5HR0A 1OAZA 2B5EA 4EDYA 1M99A 3EVIA 5GSTA 1PL2A 1M7TA 3ZTLA 1F6MC 1A0RP 3TKSA 4JZQA 4HQZA 1TRVA 1JFUA 3EURA 1M0UA 2C0FA 4OFNA 1GSQA 5EVOA 1V58A 2H1GA 2I3YA 3L4NA 3PPUA 3OR5A 2GZYA 2B3SA 4Q5NA 4TXOB 2A2SA 4QL9A 4PQ1A 3TKRA 3O6TA 4HOJA 4K2DA 2V6KA 4V2LA 1S3AA 3MDKA 1Z7PA 5L71A 2J23A 2HRFA 1TRWA 4IHUA 4YKGA 2F8AA 4XS6A 2YV9A 2VOCA 2C4JA 4MMMA 3DXBA 3VWUA 4YH2A 1XWGA 5HR3A 2XPEA 3F6FA 4BVXB 1QUWA 1OE7A 4HU7A 2OBIA 2V1MA 3ZITA 1S3RA 1VRSD 2R0GA 3I6AA 4MZBA 5KN2A 3TRXA 5JWQB 2DC5A 3L78A 1YKAA 4J56E 4OMVA 3FRCA 2MMOA 2H6ZA 2D2ZA 3DWVA 2LTKA 4K0GA 2GZZA 1NM3A 1GRXA 4V1Ap 4MK3A 5DCHA 3TKSE 3UBLA 2RUEA 1A24A 4BL7A 2B7KA 3QMXA 1GSSA 5B7CA 2ALBA 3KCMA 3HZ8A 5DCGA 2AB6A 4L5OA 3CBUA 4WEYA 5DALB 4N0VA 1TW9A 2IN3A 4HJMA 4ULXA 2DSAA 2H1BA 2HZEA 1SU9A 3QDNA 2L57A 3EMXA 4D73A 3TJGA 5C04A 1HNAA 2WGRA 2OE3A 1TXXA 4MZWA 4FYUA 5BMUA 1OKTA 2JACA 2X8CA 3UL3A 1TOFA 2VCTA 4K9ZA 4PURA 1YDKA 1TK0B 1QQ2A 3C7MA 4TN8A 2OE0A 2YOIA 4KB3A 4CY8A 5COHA 1EGRA 1M9BA 3C71A 3VWVA 4ECJA 1B48A 3ZYWA 5GSSA 3GYKA 4JR6A 4EO3A 2VL2C 4ML1A 3KP8A 3LSZA 2DIZA 2H19A 5D9WA 4F0BA 4IKHA 2LQQA 4HUAA 1W89A 1OC9A 1E2YA 4L0UA 1G7EA 4IN0A 5C00A 3IK9A 1GTBA 1TTZA 3DGQA 4NHWA 3GFKA 3WGDA 3RHCA 5JCWA 1J0FA 4GLTA 4DSSA 4HZ4A 3ISOA 1S3CA 4BA7A 2A4VA 2MYGA 3LXTA 3LYPA 4Z2UA 3NIVA 1XVWA 2OJLA 3IBHA 4ECCA 4Z2RA 3DVXA 3APOA 4O5UA 5HFIA 3EMPA 2C0EA 2HSMA 1Z9HA 1RQMA 1SK1A 5LCZA 1JLVA 1SYRA 2IIYA 4OD7A 5LNKe 4I97A 2VCQA 3F0IA 1XWKA 2IMFA 4GQCA 4AJ8A 4YQUA 3CSHA 1XCCA 2E2GA 1A2JA 2R0CA 1AW9A 1VF4A 1IYIA 4G9HA 4MLYA 3Q19A 3GTUA 2H1AA 3FMWA 3ZL5A 4Q5RA 1OC9B 1SL0B 1UC7A 19GSA 1ERUA 5JWRB 2ON5A 2VO4A 4JBBA 1XXUA 1BG5A 2KP1A 1QGVA 1PD21 2EIRA 1T4YA 5CRDA 5DAKB 1JZRA 3ZMLA 4H86A 4BPYA 4DSSB 1H4OA 2GLRA 4J2FA 1OYJA 1TJDA 2MMZA 2DJ1A 2HT9A 2H0IA 4IP1A 2XBQA 2QA1A 4L5LA 5IO2A 1WIKA 5HR2A 4GSNA 1U88A 4EC0A 1DE1A 2HSYA 5G31A 2E7PA 2H0GA 4FYBA 1TRSA 2M46A 4GWRA 1EEMA 4QL7A 1SENA 1FAAA 2AHEA 2VL9A 3UVTA 3IK7A 2L5OA 3VPTA 2HRNA 3IA1A 4MA9A 3Q6OA 1SL1B 2QA2A 5H5QA 5B8BA 2RM5A 1ZYPA 4BVYB 4MCUA 2ON7A 3TRQA 2X8HA 1EP8A 1MDKA 4MJCA 1OVNA 1GNEA 3IHGA 3GTUB 1K0NA 4GTUA 4XRDA 1B9YC 2I1UA 2VIMA 3GL5A 3M9KA 1ZYNA 5BRTA 1EOHA 1PX7A 18GSA 1A2LA 4XIHA 5IPGA 1KBNA 1FHEA 3D22A 3GH6A 1HNCA 2XC2A 1X9SB 4N10A 2VM2A 4F0CA 2C3NA 4AJ7A 3FR9A 1XBSA 2VAFA 4FYCA 1OC8A 1TDIA 4MPGA 3HCZA 3DVWA 1SJZA 1Q98A 2DJKA 3HY2A 22GSA 3UJ1A 5HFKA 4F2IA 2WJUA 4V1Ag 2CV4A 4FIWA 3UOMA 1ERTA 3R2QA 5CO3A 1R4WA 5KN3A 4GRFA 3ERWA 4ID0A 1SKWB 2I4AA 1O7UA 4BWSA 4K7OA 2IFQA 2O87A 4TR0A 1TU7A 3WD6A 3M0FA 3D21A 1GUHA 1QXHA 3FYGA 2C3TA 3IC4A 2FY6A 2GGTA 1XZOA 1Y25A 4ECIA 1T1VA 2MMNA 4ECBA 3DD3A 3BCIA 1K0BA 3FZ9A 1V98A 2VD0A 4CHSA 3I69A 2TIRA 2GSRA 3GKMA 4WBRD 4WXTA 4WKWA 2CX3A 1GTAA 3KGKA 2JZTA 2L6CA 4POLA 1ZGNA 4TVEA 6GSSA 5FT3A 4MABA 1I9DA 3LWAA 2YNXA 2F3MA 1X5EA 3V1WA 1JZOA 1EOGA 2R5GA 4TXOA 3G7JA 3W6GA 3PINA 1MDIA 4P3YB 1BQ7A 2A4HA 3H4KA 3D6IA 1XW5A 4TR1B 1A2MA 5HFGA 3QOUA 4CW9A 4WF5A 4IVFA 4XS4B 1GSUA 5ECKB 3P7XA 1DE2A 5KOWA 3DYRA 4GCIA 2H71A 4E8EA 3GKNA 4EXJA 4BVXA 2DJ0A 3O76A 3EC3A 1K3OA 2IFQB 1UA5A 2JL4A 2N5BA 1GSDA 5IMFA 2NPBA 4KAEA 1B9XC 1K0CA 3MYDA 1K3YA 4XCSA 1MD4A 3QAWA 2KUCA 1EEJA 5G1KA 2R6KA 2FUG2 3FZ4A 1RW1A 4OCEA 5KOXA 3RHBA 3LORA 3LQ7A 1A23A 3KIJA 3HZ4A 5B6NA 2QKEA 1PN9A 13GSA 3QFBC 3PGTA 5GAPD 3QR6A 1GUKA 2H72A 2HRAA 4N11A 2PU9C 2TRCP 5B6MA 3QAVA 1B8XA 5A5KA 4F9ZA 1Z7RA 5DALA 2FWGA 3CTGA 1C72A 2PN8A 3S9FA 5ELAA 5CYYA 1O85A 2KP2A 3IC8A 1YKCA 1YZXA 2H76A 4KDYA 3EU3A 2N5AA 3LGCA 1A8YA 3KEBA 1GSEA 2C1YA 1NSWA 2DMMA 1ABAA 4AGSA 1SL2B 5F05A 4NAXA 2LNSA 5ECIB 4ZB9A 4XHMA 1GL8A 3BBYA 1T7PB 1BEDA 1O6JA 5GZZB 3P90A 1AC1A 1GNWA 4I6XA 5IPHA 4RUVA 2DJJA 3P2AA 2GS3A 3HJOA 5ECMB 5E4WA 5G2ZA 2P5RA 2QC7A 3CSIA 2YCDA 2R0PA 1UVZA 2PVOC 2BJXA 1W4VA 4USSA 5CP1A 2C3QA 1AIUA 4HZ2A 5KN0A 3IOSA 2REMA 3WT2A 1AUCA 1J08A 1GWCA 1U6TA 4NHZA 4IJ3A 3GSTA 3KH9A 1QMVA 2EIQA 3KH7A 4TOPA 4YQVA 3C1RA 2X4AA 2CVDA 2C0DA 1SYXA 5IOWA 1MTCA 2YJ7A 1WPIA 1WP0A 3TOTA 5AGYA 4G19A 3EE2A 2O8VB 3VFIA 3D4MA 3TRPA 2X64A 3APQA 4KSOA 1YEPA 2GTUA 3VK9A 1BAYA 2FHEA 3GMFA 5DBQA 3QCPA 2PMTA 2K6VA 1A0FA 2FLSA 2B5XA 4ZXGA 3F63A 1SK0A 4O92A 5IOXA 4ACSA 2A2PA 1PFOA 3KMNA 2HYXA 3F3RA 1O73A 3DKSA 5F06A 1FOHA 3E3EA 2F51A 1XWBA 4K5SA 4MNNA 1X9MB 16GSA 3QPMA 7GSSA 1XFLA 1AQWA 1PL1A 3ERFA 3TCOA 5AISA 3GHAA 4MJEA 4ML6A 4PXOA 2XHFA 2GSTA 3F8UA 4RQXA 2PVQA 1RK4A 2YWOA 1K3LA 3TGZA 4EVMA 1V57A 5FWGA 2YV7A 4TR4A 2NDOA 3HDCA 4RI7A 3UARA 3GNJA 4PTSA 3ZMKA 4LMWA 2GQLA 3GX8A 2H75A 5DAKA 3VI7A 2V41A 4KSMA 2HZFA 4TXVA 3EWLA 2F9SA 3KJYA 3IXRA 3Q74A 5CRGA 4EDZA 1T00A 5EL8A 2MMAA 4J57E 2VLUA 3CTFA 1QK8A 4YAPA 2LQOA 3GURA 4RQRA 4DEJA 4ZBDA 4YKFA 1PRXA 4ZIJA 3G9BA 2B6MA 3LW9A 5KN1A 3ZIJA 4NV2A 2FA4A 1TRUA 4X4JA 2CT6A 4MPFA 1WWJA 4KDUA 3L9VA 4IQAA 4YQMA 1GULA 4BVYA 5IMDA 2I81A 6GSWA 4DVCA 6GSTA 1YY7A 3TKQA 3ZRDA 3NZNA 4KGIA 1DSBA 4PUFC 5ELGA 3UEMA 5CAXA 3VLNA 1F2EA 2EIOA 2JSZA 1M2BA 1GLPA 2CX4A 1TKDB 3GH9A 3N9JA 3L9UA 3CQFA 4JEDA 3TKSC 6GSVA 1GSYA 4GSSA 4NV5A 2CVBA 1YEXA 4I2UA 4K1FA 3H1NA 2B1LA 2P31A 2L5LA 2LRNA 1TI1A 4FQUA 5ENUA 4AF2A 1SJ6A 4DSRA 1M3JA 3QFAC 2FD3A 1YQ1A 3GRXA 3J7Yb 4EE0A 3ZZXA 4XS1A 1K0OA 4HQSA 1BJXA 1EGOA 1PGTA 1F9MA 2HNLA 3EYTA 4ILFA 1H75A 2E2MA 2YWNA 3DRNA 2N5FA 5G5FA 2NBSA 2XPDA 4QQ7A 1CQHA 2WRTA 5HQPA 1KTEA 1HNBA 1VF2A 3MSZA 3HVVA 1YF0A 1ZZYA 5D9TA 1GP1A 5D96A 2LNTA 2L4QA 2CVKA 2WFCA 3VWXA 6GSYA 1G6YA 3KP9A 1B4QA 4ZBBA 2K9FA 3ZFLA 3HKRA 5ECOB 3MNGA 2IPAA 1PKWA 1XIYA 2AV4A 3CSJA 3HXSA 3UBKA 1NHYA 4K5RA 2HLSA 2HRKA 12GSA 3UMAA 3LEFA 4O7HA 4E8HA 2AAWA 2ES7A 2YPMA 2RM6A 3FK8A 3FZ5A 2GQMA 3CYNA 2CAIA 2QSIA 1UN2A 4FH8A 1G0TA 3KXOA 4POMA 4HU9A 3BJ5A 3RBTA 4PGTA 3RAZA 2JU5A 1XWAA 2O7KA 1PKZA 2LRTA 2VCWA 3JCML 2CZ3A 2X49A 2H01A 2GVPA 1Z6MA 3C8EA 1QFNA 4L8EA 1N2AA 4TR1A 2M72A 4XS4A 1AQVA 3GX0A 1WJKA 1HD2A 1SD8A 4OCFA 5ECRB 2JSYA 20GSA 3F9UA 4BIKA 5J4UA 5JWOB 2AJQB 3UIWA 4G0IA 2DLXA 4KH7A 3SWLA 2PERA 1XPVA 2ZCTA 1TK8B 2A2RA 2P5QA 4EL1A 1U3AA 2HSHA 5J41A 5G5EA 3GL3A 3FR6A 3HA9A 1SKSB 4HS1A 2MBTA 5ID2A 2OBKA 1GTIA 1XVQA 2V32A 1PX6A 1CQGA 1K0DA 1JZDA 4IQ1A 5G1LA 3TOUA 3WGXA 4EF0A 2OE1A 2VL2A 3F4TA 4TRXA 2MZCA 1PSQA 3DIEA 4K8MA 3EPTA 4ISDA 2CAQA 3M8NA 4JU5A 1V9WA 2K18A 4LL4B 1YF1A 1MDJA 1F3AA 1WMJA 4I5QA 3D4TA 5ECNB 5CREA 1XOAA 3H8QA 5FHIA 5DJLA 5HR1A 5A4UA 3HJMA 5F07A 1F37A 2IL3A 4I8BA 4ZL7A 2L4CA 3TJFA 2B1KA 3QD9A 4CY6A 4MJBA 4ICYA 2VCVA 4K2XA 4WR4A 2BMXA 2H6XA 3A5WA 1IYHA 3GIXA 3I9V2 5J5NA 3ZLPA 4ZL8A 2B7JA 1WE0A 2LEGA 3GA4A 2VCZA 2DMLA 1G7OA 3GUSA 1FB0A 4TKYA 1FG4A 2AUVA 4DSQA 4X43A 1TI3A 3EINA 3PH9A 4GQFA 1M2AA 2JZSA 4K7NA 1SD9A 4Z2TA 2WS2A 2AYTA 3M3MA 4HEA2 2IMKA 3C73A 10GSA 2IMEA 2NVLA 4G0KA 1T3BA 3PR8A 2JADA 4EIPA 1O8WA 5ID2B 5IM9A 3D5JA 2QGVA 3VURA 3WT1A 3I43A 2R37A 5CRHA 5H5RA 4ZB8A 2YP6A 3IR4A 1A8LA 5JCUA 4OFTA 1MD3A 5ECSA 3FKFA 1GH2A 1URMA 4X1UA 3RDWA 5AIXA 2IJYA 4POBA 3F4SA 2WULA 4IJIA 4EUYA 1R26A 3M1GA 3F6DA 1GSFA 3IRAA 2DKIA 2JZRA 1BYEA 2I9HA 4PNFA 3M9JA 3MAKA 2RIIA 5ECLB 1LBKA 2WB9A 2G2QA 1X0RA 4MH2A 2YJHA 3HHVA 4KW6A 4PUAA 2O89A 4FO5A 4AJ6A 2GZPA 2LV3A 1U87A 4Z7XA 3LFLA 2LUSA 3IDVA 5J9BA 1AQXA 3BCKA 1LU4A 4Q5FA 1ZL9A 3H93A 3KM6A 2ZUPA 2BTOT 1R5AA 2LS5A 1B4PA 3N5OA 2PGTA 4NXIA 3ME7A 2GT5A 4PQHA 5EY6A 5J9CA 1ON4A 4ZBAA 3D0ZA 3O3TA 3VPQA 1VF3A 4MH3A 4BWQA 4V2MA 2WCIA 5DVBA 1ZMAA 4N0ZA 3K8NA 2K8VA 1THOA 2HFDA 4WETA 6GSXA 2IMIA 1MEKA 3US3A 2B5YA 4O32A 1K0MA 2X8GA 4KX4A 3ZREA 2FGXA 1Q4JA 4KNDA 4MF6A 1N8JA 2R2JA 2MBSA 3L9SA 3QAGA 2V6OA 4F82A 2R3XA 1O8XA 1YJ6A 1X5DA 4G0LA 3U5RE 3H79A 3UVHA 4EKZA 2YN1A 4YAVA 2X99A 1M9AA 4NMUA 3BOAA 2GSQA 1Y6EA 3A2XA 3APSA 1NW2A 2J9HA 2KOKA 2NTOA 2LJRA 3RPNA 17GSA 2H1DA 4MJAA 4XRAA 5CNWA 2IWTA 5INYA 4IGJA 4KCAA 2DJ3A 1Z6NA 4RI6A 3A5IA 2HI7A 1F3BA 4EIQA 2H6YA 5ECQB 5G30A 5ECPB 1EWXA 4PX1A 1V2AA 2LKUA 1FOVA 2FWHA 3A2WA 5D9VA 4JR4A 1TU8A 4HDEA 1G6WA 5IQYA 2TRXA 2RLIA 4OO4A 4IELA 5B8AA 4V2NA 1T4ZA 2LJKA 3LYKA 3TJKA 3IAS2 1DBYA 2H0HA 2L59A 3CMIA 4KCEA 1GLQA 1EP7A 3GKKA 4BL7B 3ED3A 3RPPA 4LL1B 3HVSA 14GSA 2YZUA 1ML6A 5DQSA 4IW9A 1LJRA 3TUEA 5IO0A 1J9BA 1U3IA 3TJBA 4MP4A 1V40A 4JRRA 4HI7A 2DKHA 2HZEB 2F8FA 2H8LA 2Z9SA 1M3IA 4G2EA 3KTBA 4D73B 1JZWA 1AAZA 5EPFA 1S3DA 2VUPA 2G0FA 5D73A 3ME8A 1FO5A 1XW9A 3IV4A 5F8BA 2R4VA 9GSSA 5KEJA 1OKDA 4HSCX 2CZ2A 5IMAA 1GUMA 3IAM2 4GF0A 3A3TA 3E0UA 3FHKA 2LJAA 1XWCA 1SK2A 1AXDA 1ACVA 4N30A 1ERWA 1E6BA 3ERGA 1ERVA 2C8UA 1JHBA 2XBIA 2EC4A 3L0HA 4CDOA 5D8IA 5CRWA 3AY8A 4IBPA 2K8SA 2FWEA 3ZVJA 2RUFA 2P0GA 2ZNMA 4X0XA 4L0WA 3C1SA 2FCHA 4MDCA 1X5CA 4HJ2A 3ZIVA 5ABRA 2PWJA 4PNGA 5DQYA 5AIVA 3IHQA 4LLRA 3ZVJD 3HVXA 3W8SA 2UZ8A 4O5QA 1FB6A 2H66A 3LXZA 1VF1A 1XG8A 2VM1A 3GV1A 5IMZA 2OACA 2YWMA 1DUGA 3KMOA 1R7HA 3FR3A 2GSSA 5J3RA 1I5GA 2DBCA 3G7YA 3TDGA 2C0GA 1EV4A 4KA0A 2FWFA 1SKRB 4KF9A 3TB2A 2LSTA 1ST9A 3ZFBA 3LJRA 5AN1A 4OWYA 1TP9A 3E9JB 1Z5YE 1O81A 3SBCA 6GSUA 3CRTA 4JE1A 1R5PA 3HVNA 2H73A 2PBJA 5JCGA 2HXKA 3P8WA 1ILOA 4XTSA 3DMLA 2FNOA 3FEUA 3UAPA 1PA3A 4K0NA 4GSTA 2HE3A 1EV9A 2V2GA 3EU4A 4K6XA 1PN0A 2OADA 4KDXA 2H30A 5DJMA 5A4VA 2OA7A 2O85A 4KUNA 4A5PA 1WRYA 1THXA 4LA1A 2H70A 3VI5A 2OKAA 2FA8A 2YANA 2GQKA 2WZ9A 4MZCA 2E0QA 5D9XA 2C80A 3GSSA 1KNGA 1OC3A 4OFMA 3TJJA 4IP6A 5E59A 1Z3EA 3GN3A 1XOBA 1EZKA 4WR5A 2YZHA 3LG6A 4OO5A 2VD1A 3DEXA 4ZL9A 4O5RA 5H5SA 1OE8A 4ZILA 2CQ9A 2KLXA 1FW1A 3Q18A 2YWIA 3W8JA 5GAND 2PPTA 2DIYA 2GDRA 1SJIA 3IPZA 4TW5A 4PQIA 2M80A 3BD2A 1PQNA 4GXZA 4TR3A 3KD0A 1NHOA 3U6VA 4WF4A 2PUKC 4ZB6A 3CRUA 5IIZA 3WYWA 2GT6A 4NWYA 2IMDA 4MF7A 4F03A 2WDUA 5D93A 3HD5A 4POKA 1ZCPA 2KHPA 3WGEA 3FY7A 3TKPA
chains in the Genus database with same CATH topology
2VL3A 1ZYQB 2H74A 4KE3A 4Q5QA 3KTLA 3FW2A 2DJ2A 4WBJA 1WOUA 3HYPA 5F0GA 1FVJA 3FZAA 1ZOFA 3VWWA 5IMCA 1KEBA 2VLVA 3MIXA 3MWHA 4K7IA 1K0AA 3F3QA 3KZQA 2CA8A 5ECHB 5IMVA 1T8EB 1HQOA 1VGLA 1FVKA 3IE3A 4MF5A 4LMVA 2L6DA 1M2DA 1HYUA 3R3EA 3F4RA 4I2TA 1JLWA 2VCXA 1XW6A 3NOFA 3GKXA 5DDLA 8GSSA 1PMTA 5LD0A 3A2VA 2LRCA 1USBA 1ZYEA 1TK5B 3G7IA 11GSA 4NPBA 1GTUA 3HJPA 4G10A 3J7Yk 1X9WB 4IS0A 1BX9A 3CXGA 5A4WA 2VLTA 5HR0A 1OAZA 2B5EA 4EDYA 1M99A 3EVIA 5GSTA 1PL2A 1M7TA 3ZTLA 1F6MC 1A0RP 3TKSA 4JZQA 4HQZA 1TRVA 1JFUA 3EURA 1M0UA 2C0FA 4OFNA 1GSQA 5EVOA 1V58A 2H1GA 2I3YA 3L4NA 3PPUA 3OR5A 2GZYA 2B3SA 4Q5NA 4TXOB 2A2SA 4QL9A 4PQ1A 3TKRA 3O6TA 4HOJA 4K2DA 2V6KA 4V2LA 1S3AA 3MDKA 1Z7PA 5L71A 2J23A 2HRFA 1TRWA 4IHUA 4YKGA 2F8AA 4XS6A 2YV9A 2VOCA 2C4JA 4MMMA 3DXBA 3VWUA 4YH2A 1XWGA 5HR3A 2XPEA 3F6FA 4BVXB 1QUWA 1OE7A 4HU7A 2OBIA 2V1MA 3ZITA 1VRSD 2R0GA 3I6AA 4MZBA 5KN2A 3TRXA 5JWQB 2DC5A 3L78A 1YKAA 4J56E 4OMVA 3FRCA 2MMOA 2H6ZA 2D2ZA 3DWVA 2LTKA 4K0GA 2GZZA 1NM3A 1GRXA 4V1Ap 4MK3A 5DCHA 3TKSE 3UBLA 2RUEA 1A24A 4BL7A 2B7KA 3QMXA 1GSSA 5B7CA 2ALBA 3KCMA 3HZ8A 5DCGA 2AB6A 4L5OA 3CBUA 4WEYA 5DALB 4N0VA 1TW9A 2IN3A 4HJMA 4ULXA 2DSAA 2H1BA 2HZEA 1SU9A 3QDNA 2L57A 3EMXA 4D73A 3TJGA 5C04A 1HNAA 2WGRA 2OE3A 1TXXA 4MZWA 4FYUA 5BMUA 1OKTA 2JACA 2X8CA 3UL3A 1TOFA 2VCTA 4K9ZA 4PURA 1YDKA 1TK0B 1QQ2A 3C7MA 4TN8A 2OE0A 2YOIA 4KB3A 4CY8A 5COHA 1EGRA 1M9BA 3C71A 3VWVA 4ECJA 1B48A 3ZYWA 5GSSA 3GYKA 4JR6A 4EO3A 2VL2C 4ML1A 3KP8A 3LSZA 2DIZA 2H19A 5D9WA 4F0BA 4IKHA 2LQQA 4HUAA 1W89A 1OC9A 1E2YA 4L0UA 1G7EA 4IN0A 5C00A 3IK9A 1GTBA 1TTZA 3DGQA 4NHWA 3GFKA 3WGDA 3RHCA 5JCWA 1J0FA 4GLTA 4DSSA 4HZ4A 3ISOA 1S3CA 4BA7A 2A4VA 2MYGA 3LXTA 3LYPA 4Z2UA 3NIVA 1XVWA 2OJLA 3IBHA 4ECCA 4Z2RA 3DVXA 3APOA 4O5UA 5HFIA 3EMPA 2C0EA 2HSMA 1Z9HA 1RQMA 1SK1A 5LCZA 1JLVA 1SYRA 2IIYA 4OD7A 5LNKe 4I97A 2VCQA 3F0IA 1XWKA 2IMFA 4GQCA 4AJ8A 4YQUA 3CSHA 1XCCA 2E2GA 1A2JA 2R0CA 1AW9A 1VF4A 1IYIA 4G9HA 4MLYA 3Q19A 3GTUA 2H1AA 3FMWA 3ZL5A 4Q5RA 1OC9B 1SL0B 1UC7A 19GSA 1ERUA 5JWRB 2ON5A 2VO4A 4JBBA 1XXUA 1BG5A 2KP1A 1QGVA 1PD21 2EIRA 1T4YA 5CRDA 5DAKB 1JZRA 3ZMLA 4H86A 4BPYA 4DSSB 1H4OA 2GLRA 4J2FA 1OYJA 1TJDA 2MMZA 2DJ1A 2HT9A 2H0IA 4IP1A 2XBQA 2QA1A 4L5LA 5IO2A 1WIKA 5HR2A 4GSNA 1U88A 4EC0A 1DE1A 2HSYA 5G31A 2E7PA 2H0GA 4FYBA 1TRSA 2M46A 4GWRA 1EEMA 4QL7A 1SENA 1FAAA 2AHEA 2VL9A 3UVTA 3IK7A 2L5OA 3VPTA 2HRNA 3IA1A 4MA9A 3Q6OA 1SL1B 2QA2A 5H5QA 5B8BA 2RM5A 1ZYPA 4BVYB 4MCUA 2ON7A 3TRQA 2X8HA 1EP8A 1MDKA 4MJCA 1OVNA 1GNEA 3IHGA 3GTUB 1K0NA 4GTUA 4XRDA 1B9YC 2I1UA 2VIMA 3GL5A 3M9KA 1ZYNA 5BRTA 1EOHA 1PX7A 18GSA 1A2LA 4XIHA 5IPGA 1KBNA 1FHEA 3D22A 3GH6A 1HNCA 2XC2A 1X9SB 4N10A 2VM2A 4F0CA 2C3NA 4AJ7A 3FR9A 1XBSA 2VAFA 4FYCA 1OC8A 1TDIA 4MPGA 3HCZA 3DVWA 1SJZA 1Q98A 2DJKA 3HY2A 22GSA 3UJ1A 5HFKA 4F2IA 2WJUA 4V1Ag 2CV4A 4FIWA 3UOMA 1ERTA 3R2QA 5CO3A 1R4WA 5KN3A 4GRFA 3ERWA 4ID0A 1SKWB 2I4AA 1O7UA 4BWSA 4K7OA 2IFQA 2O87A 4TR0A 1TU7A 3WD6A 3M0FA 3D21A 1GUHA 1QXHA 3FYGA 2C3TA 3IC4A 2FY6A 2GGTA 1XZOA 1Y25A 4ECIA 1T1VA 2MMNA 4ECBA 3DD3A 3BCIA 1K0BA 3FZ9A 1V98A 2VD0A 4CHSA 3I69A 2TIRA 2GSRA 3GKMA 4WBRD 4WXTA 4WKWA 2CX3A 1GTAA 3KGKA 2JZTA 2L6CA 4POLA 1ZGNA 4TVEA 6GSSA 5FT3A 4MABA 1I9DA 3LWAA 2YNXA 2F3MA 1X5EA 3V1WA 1JZOA 1EOGA 2R5GA 4TXOA 3G7JA 3W6GA 3PINA 1MDIA 4P3YB 1BQ7A 2A4HA 3H4KA 3D6IA 1XW5A 4TR1B 1A2MA 5HFGA 3QOUA 4CW9A 4WF5A 4IVFA 4XS4B 1GSUA 5ECKB 3P7XA 1DE2A 5KOWA 3DYRA 4GCIA 2H71A 4E8EA 3GKNA 4EXJA 4BVXA 2DJ0A 3O76A 3EC3A 1K3OA 2IFQB 1UA5A 2JL4A 2N5BA 1GSDA 5IMFA 2NPBA 4KAEA 1B9XC 1K0CA 3MYDA 1K3YA 4XCSA 1MD4A 3QAWA 2KUCA 1EEJA 5G1KA 2R6KA 2FUG2 3FZ4A 1RW1A 4OCEA 5KOXA 3RHBA 3LORA 3LQ7A 1A23A 3KIJA 3HZ4A 5B6NA 2QKEA 1PN9A 13GSA 3QFBC 3PGTA 5GAPD 3QR6A 1GUKA 2H72A 2HRAA 4N11A 2PU9C 2TRCP 5B6MA 3QAVA 1B8XA 5A5KA 4F9ZA 1Z7RA 5DALA 2FWGA 3CTGA 1C72A 2PN8A 3S9FA 5ELAA 5CYYA 1O85A 2KP2A 3IC8A 1YKCA 1YZXA 2H76A 4KDYA 3EU3A 2N5AA 3LGCA 1A8YA 3KEBA 1GSEA 2C1YA 1NSWA 2DMMA 1ABAA 4AGSA 1SL2B 5F05A 4NAXA 2LNSA 5ECIB 4ZB9A 4XHMA 1GL8A 3BBYA 1T7PB 1BEDA 1O6JA 5GZZB 3P90A 1AC1A 1GNWA 4I6XA 5IPHA 4RUVA 2DJJA 3P2AA 2GS3A 3HJOA 5ECMB 5E4WA 5G2ZA 2P5RA 2QC7A 3CSIA 2YCDA 2R0PA 1UVZA 2PVOC 2BJXA 1W4VA 4USSA 5CP1A 2C3QA 1AIUA 4HZ2A 5KN0A 3IOSA 2REMA 3WT2A 1AUCA 1J08A 1GWCA 1U6TA 4NHZA 4IJ3A 3GSTA 3KH9A 1QMVA 2EIQA 3KH7A 4TOPA 4YQVA 3C1RA 2X4AA 2CVDA 2C0DA 1SYXA 5IOWA 1MTCA 2YJ7A 1WPIA 1WP0A 3TOTA 5AGYA 4G19A 3EE2A 2O8VB 3VFIA 3D4MA 3TRPA 2X64A 3APQA 4KSOA 1YEPA 2GTUA 3VK9A 1BAYA 2FHEA 3GMFA 5DBQA 3QCPA 2PMTA 2K6VA 1A0FA 2FLSA 2B5XA 4ZXGA 3F63A 1SK0A 4O92A 5IOXA 4ACSA 2A2PA 3KMNA 2HYXA 3F3RA 1O73A 3DKSA 5F06A 1FOHA 3E3EA 2F51A 1XWBA 4K5SA 4MNNA 1X9MB 16GSA 3QPMA 7GSSA 1XFLA 1AQWA 1PL1A 3ERFA 3TCOA 5AISA 3GHAA 4MJEA 4ML6A 4PXOA 2XHFA 2GSTA 3F8UA 4RQXA 2PVQA 1RK4A 2YWOA 1K3LA 3TGZA 4EVMA 1V57A 5FWGA 2YV7A 4TR4A 2NDOA 3HDCA 4RI7A 3UARA 3GNJA 4PTSA 3ZMKA 4LMWA 2GQLA 3GX8A 2H75A 5DAKA 3VI7A 2V41A 4KSMA 2HZFA 4TXVA 3EWLA 2F9SA 3KJYA 3IXRA 3Q74A 5CRGA 4EDZA 1T00A 5EL8A 2MMAA 4J57E 2VLUA 3CTFA 1QK8A 4YAPA 2LQOA 3GURA 4RQRA 4DEJA 4ZBDA 4YKFA 1PRXA 4ZIJA 3G9BA 2B6MA 3LW9A 5KN1A 3ZIJA 4NV2A 2FA4A 1TRUA 4X4JA 2CT6A 4MPFA 1WWJA 4KDUA 3L9VA 4IQAA 4YQMA 1GULA 4BVYA 5IMDA 2I81A 6GSWA 4DVCA 6GSTA 1YY7A 3TKQA 3ZRDA 3NZNA 4KGIA 1DSBA 4PUFC 5ELGA 3UEMA 5CAXA 3VLNA 1F2EA 2EIOA 2JSZA 1M2BA 1GLPA 2CX4A 1TKDB 3GH9A 3N9JA 3L9UA 4JEDA 6GSVA 3TKSC 1GSYA 4GSSA 4NV5A 2CVBA 1YEXA 4I2UA 4K1FA 3H1NA 2B1LA 2P31A 2L5LA 2LRNA 1TI1A 4FQUA 5ENUA 4AF2A 1SJ6A 4DSRA 3QFAC 2FD3A 1YQ1A 3GRXA 3J7Yb 4EE0A 3ZZXA 4XS1A 1K0OA 4HQSA 1BJXA 1EGOA 1PGTA 1F9MA 2HNLA 3EYTA 4ILFA 1H75A 2E2MA 2YWNA 3DRNA 2N5FA 5G5FA 2NBSA 2XPDA 4QQ7A 1CQHA 2WRTA 5HQPA 1KTEA 1HNBA 1VF2A 3MSZA 3HVVA 1YF0A 1ZZYA 5D9TA 1GP1A 5D96A 2LNTA 2L4QA 2CVKA 2WFCA 3VWXA 6GSYA 1G6YA 3KP9A 1B4QA 4ZBBA 2K9FA 3ZFLA 3HKRA 5ECOB 3MNGA 2IPAA 1PKWA 1XIYA 2AV4A 3CSJA 3HXSA 3UBKA 1NHYA 4K5RA 2HLSA 2HRKA 12GSA 3UMAA 3LEFA 4O7HA 4E8HA 2AAWA 2ES7A 2YPMA 2RM6A 3FK8A 3FZ5A 2GQMA 3CYNA 2CAIA 2QSIA 1UN2A 4FH8A 1G0TA 3KXOA 4POMA 4HU9A 3BJ5A 3RBTA 4PGTA 3RAZA 2JU5A 1XWAA 2O7KA 1PKZA 2LRTA 2VCWA 3JCML 2CZ3A 2X49A 2H01A 2GVPA 1Z6MA 3C8EA 1QFNA 4L8EA 1N2AA 4TR1A 2M72A 4XS4A 1AQVA 3GX0A 1WJKA 1HD2A 1SD8A 4OCFA 5ECRB 2JSYA 20GSA 3F9UA 5J4UA 5JWOB 2AJQB 3UIWA 4G0IA 2DLXA 4KH7A 3SWLA 2PERA 1XPVA 2ZCTA 1TK8B 2A2RA 2P5QA 4EL1A 1U3AA 2HSHA 5J41A 5G5EA 3GL3A 3FR6A 3HA9A 1SKSB 4HS1A 2MBTA 5ID2A 2OBKA 1GTIA 1XVQA 2V32A 1PX6A 1CQGA 1K0DA 1JZDA 4IQ1A 5G1LA 3TOUA 3WGXA 4EF0A 2OE1A 2VL2A 3F4TA 4TRXA 2MZCA 1PSQA 3DIEA 4K8MA 3EPTA 4ISDA 2CAQA 3M8NA 4JU5A 1V9WA 2K18A 4LL4B 1YF1A 1MDJA 1F3AA 1WMJA 4I5QA 3D4TA 5ECNB 5CREA 1XOAA 3H8QA 5FHIA 5DJLA 5HR1A 5A4UA 3HJMA 5F07A 1F37A 2IL3A 4I8BA 4ZL7A 2L4CA 3TJFA 2B1KA 3QD9A 4CY6A 4MJBA 4ICYA 2VCVA 4K2XA 4WR4A 2BMXA 2H6XA 3A5WA 1IYHA 3GIXA 3I9V2 5J5NA 3ZLPA 4ZL8A 2B7JA 1WE0A 2LEGA 3GA4A 2VCZA 2DMLA 1G7OA 3GUSA 1FB0A 4TKYA 1FG4A 2AUVA 4DSQA 4X43A 1TI3A 3EINA 3PH9A 4GQFA 1M2AA 2JZSA 4K7NA 1SD9A 4Z2TA 2WS2A 2AYTA 3M3MA 4HEA2 2IMKA 3C73A 10GSA 2IMEA 2NVLA 4G0KA 1T3BA 3PR8A 2JADA 4EIPA 1O8WA 5ID2B 5IM9A 3D5JA 2QGVA 3VURA 3WT1A 3I43A 2R37A 5CRHA 5H5RA 4ZB8A 2YP6A 3IR4A 1A8LA 5JCUA 4OFTA 1MD3A 5ECSA 3FKFA 1GH2A 1URMA 4X1UA 3RDWA 5AIXA 2IJYA 4POBA 3F4SA 2WULA 4IJIA 4EUYA 1R26A 3M1GA 3F6DA 1GSFA 3IRAA 2DKIA 2JZRA 1BYEA 2I9HA 4PNFA 3M9JA 3MAKA 2RIIA 5ECLB 1LBKA 2WB9A 2G2QA 1X0RA 4MH2A 2YJHA 3HHVA 4KW6A 4PUAA 2O89A 4FO5A 4AJ6A 2GZPA 2LV3A 1U87A 4Z7XA 3LFLA 2LUSA 3IDVA 5J9BA 1AQXA 3BCKA 1LU4A 4Q5FA 1ZL9A 3H93A 3KM6A 2ZUPA 2BTOT 1R5AA 2LS5A 1B4PA 3N5OA 2PGTA 4NXIA 3ME7A 2GT5A 4PQHA 5EY6A 5J9CA 1ON4A 4ZBAA 3D0ZA 3O3TA 3VPQA 1VF3A 4MH3A 4BWQA 4V2MA 2WCIA 5DVBA 1ZMAA 4N0ZA 3K8NA 2K8VA 1THOA 2HFDA 4WETA 6GSXA 2IMIA 1MEKA 3US3A 2B5YA 4O32A 1K0MA 2X8GA 4KX4A 3ZREA 2FGXA 1Q4JA 4KNDA 4MF6A 1N8JA 2R2JA 2MBSA 3L9SA 3QAGA 2V6OA 4F82A 2R3XA 1O8XA 1YJ6A 1X5DA 4G0LA 3U5RE 3H79A 3UVHA 4EKZA 2YN1A 4YAVA 2X99A 1M9AA 4NMUA 3BOAA 2GSQA 1Y6EA 3A2XA 3APSA 1NW2A 2J9HA 2KOKA 2NTOA 2LJRA 3RPNA 17GSA 2H1DA 4MJAA 4XRAA 5CNWA 2IWTA 5INYA 4IGJA 4KCAA 2DJ3A 1Z6NA 4RI6A 3A5IA 2HI7A 1F3BA 4EIQA 2H6YA 5ECQB 5G30A 5ECPB 1EWXA 4PX1A 1V2AA 2LKUA 1FOVA 2FWHA 3A2WA 5D9VA 4JR4A 1TU8A 4HDEA 1G6WA 5IQYA 2TRXA 2RLIA 4OO4A 4IELA 5B8AA 4V2NA 1T4ZA 2LJKA 3LYKA 3TJKA 3IAS2 1DBYA 2H0HA 2L59A 3CMIA 4KCEA 1GLQA 1EP7A 3GKKA 4BL7B 3ED3A 3RPPA 4LL1B 3HVSA 14GSA 2YZUA 1ML6A 5DQSA 4IW9A 1LJRA 3TUEA 5IO0A 1J9BA 1U3IA 3TJBA 4MP4A 1V40A 4JRRA 4HI7A 2DKHA 2HZEB 2F8FA 2H8LA 2Z9SA 4G2EA 3KTBA 4D73B 1JZWA 1AAZA 5EPFA 1S3DA 2VUPA 2G0FA 5D73A 3ME8A 1FO5A 1XW9A 3IV4A 5F8BA 2R4VA 9GSSA 5KEJA 1OKDA 2CZ2A 5IMAA 1GUMA 3IAM2 4GF0A 3A3TA 3E0UA 3FHKA 2LJAA 1XWCA 1SK2A 1AXDA 1ACVA 4N30A 1ERWA 1E6BA 3ERGA 1ERVA 2C8UA 1JHBA 2XBIA 2EC4A 3L0HA 4CDOA 5D8IA 5CRWA 3AY8A 4IBPA 2K8SA 2FWEA 3ZVJA 2RUFA 2P0GA 2ZNMA 4X0XA 4L0WA 3C1SA 2FCHA 4MDCA 1X5CA 4HJ2A 3ZIVA 5ABRA 2PWJA 4PNGA 5DQYA 5AIVA 3IHQA 4LLRA 3ZVJD 3HVXA 3W8SA 2UZ8A 4O5QA 1FB6A 2H66A 3LXZA 1VF1A 2VM1A 3GV1A 5IMZA 2OACA 2YWMA 1DUGA 3KMOA 1R7HA 3FR3A 2GSSA 5J3RA 1I5GA 2DBCA 3G7YA 3TDGA 2C0GA 1EV4A 4KA0A 2FWFA 1SKRB 4KF9A 3TB2A 2LSTA 1ST9A 3ZFBA 3LJRA 5AN1A 4OWYA 1TP9A 3E9JB 1Z5YE 1O81A 3SBCA 6GSUA 3CRTA 4JE1A 1R5PA 2H73A 2PBJA 5JCGA 2HXKA 3P8WA 1ILOA 4XTSA 3DMLA 2FNOA 3FEUA 3UAPA 1PA3A 4K0NA 4GSTA 2HE3A 1EV9A 2V2GA 3EU4A 4K6XA 1PN0A 2OADA 4KDXA 2H30A 5DJMA 5A4VA 2OA7A 2O85A 4KUNA 4A5PA 1WRYA 1THXA 4LA1A 2H70A 3VI5A 2OKAA 2FA8A 2YANA 2GQKA 2WZ9A 4MZCA 2E0QA 5D9XA 2C80A 3GSSA 1KNGA 1OC3A 4OFMA 3TJJA 4IP6A 5E59A 1Z3EA 3GN3A 1XOBA 1EZKA 4WR5A 2YZHA 3LG6A 4OO5A 2VD1A 3DEXA 4ZL9A 4O5RA 5H5SA 1OE8A 4ZILA 2CQ9A 2KLXA 1FW1A 3Q18A 2YWIA 3W8JA 5GAND 2PPTA 2DIYA 2GDRA 1SJIA 3IPZA 4TW5A 4PQIA 2M80A 3BD2A 1PQNA 4GXZA 4TR3A 3KD0A 1NHOA 3U6VA 4WF4A 2PUKC 4ZB6A 3CRUA 5IIZA 3WYWA 2GT6A 4NWYA 2IMDA 4MF7A 4F03A 2WDUA 5D93A 3HD5A 4POKA 1ZCPA 2KHPA 3WGEA 3FY7A 3TKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VL3 A;  1ZYQ B;  2H74 A;  4KE3 A;  4Q5Q A;  3KTL A;  3FW2 A;  2DJ2 A;  4WBJ A;  1WOU A;  3HYP A;  5F0G A;  1FVJ A;  3FZA A;  1ZOF A;  3VWW A;  5IMC A;  1KEB A;  2VLV A;  3MWH A;  4K7I A;  1K0A A;  3F3Q A;  3KZQ A;  2CA8 A;  5ECH B;  5IMV A;  1T8E B;  1HQO A;  1VGL A;  1FVK A;  3IE3 A;  4MF5 A;  4LMV A;  2L6D A;  1M2D A;  1HYU A;  3F4R A;  4I2T A;  1JLW A;  2VCX A;  1XW6 A;  3NOF A;  3GKX A;  5DDL A;  8GSS A;  1PMT A;  5LD0 A;  3A2V A;  2LRC A;  1USB A;  1ZYE A;  1TK5 B;  3G7I A;  11GS A;  4NPB A;  1GTU A;  3HJP A;  4G10 A;  3J7Y k;  1X9W B;  4IS0 A;  1BX9 A;  3CXG A;  5A4W A;  2VLT A;  5HR0 A;  1OAZ A;  2B5E A;  4EDY A;  1M99 A;  3EVI A;  5GST A;  1PL2 A;  1M7T A;  3ZTL A;  1F6M C;  1A0R P;  3TKS A;  4JZQ A;  4HQZ A;  1TRV A;  1JFU A;  3EUR A;  1M0U A;  2C0F A;  4OFN A;  1GSQ A;  5EVO A;  1V58 A;  2H1G A;  2I3Y A;  3L4N A;  3OR5 A;  2GZY A;  2B3S A;  4Q5N A;  4TXO B;  2A2S A;  4QL9 A;  4PQ1 A;  3TKR A;  3O6T A;  4HOJ A;  4K2D A;  2V6K A;  4V2L A;  1S3A A;  3MDK A;  1Z7P A;  5L71 A;  2J23 A;  2HRF A;  1TRW A;  4IHU A;  2F8A A;  4XS6 A;  2YV9 A;  2VOC A;  2C4J A;  4MMM A;  3DXB A;  3VWU A;  4YH2 A;  1XWG A;  5HR3 A;  2XPE A;  3F6F A;  1QUW A;  1OE7 A;  4HU7 A;  2OBI A;  2V1M A;  3ZIT A;  1VRS D;  3I6A A;  4MZB A;  5KN2 A;  3TRX A;  5JWQ B;  2DC5 A;  3L78 A;  1YKA A;  4J56 E;  4OMV A;  3FRC A;  2MMO A;  2H6Z A;  2D2Z A;  3DWV A;  2LTK A;  4K0G A;  2GZZ A;  1NM3 A;  1GRX A;  4V1A p;  4MK3 A;  5DCH A;  3TKS E;  3UBL A;  2RUE A;  1A24 A;  4BL7 A;  2B7K A;  3QMX A;  1GSS A;  5B7C A;  2ALB A;  3KCM A;  3HZ8 A;  5DCG A;  2AB6 A;  4L5O A;  3CBU A;  4WEY A;  5DAL B;  4N0V A;  1TW9 A;  2IN3 A;  4HJM A;  4ULX A;  2DSA A;  2H1B A;  2HZE A;  1SU9 A;  3QDN A;  2L57 A;  3EMX A;  4D73 A;  3TJG A;  5C04 A;  1HNA A;  2WGR A;  2OE3 A;  1TXX A;  4MZW A;  4FYU A;  1OKT A;  2JAC A;  2X8C A;  3UL3 A;  1TOF A;  2VCT A;  4K9Z A;  4PUR A;  1YDK A;  1TK0 B;  1QQ2 A;  3C7M A;  4TN8 A;  2OE0 A;  2YOI A;  4KB3 A;  5COH A;  1EGR A;  1M9B A;  3C71 A;  3VWV A;  4ECJ A;  1B48 A;  3ZYW A;  5GSS A;  3GYK A;  4JR6 A;  4EO3 A;  2VL2 C;  4ML1 A;  3KP8 A;  3LSZ A;  2DIZ A;  2H19 A;  5D9W A;  4F0B A;  4IKH A;  2LQQ A;  4HUA A;  1W89 A;  1OC9 A;  1E2Y A;  4L0U A;  1G7E A;  4IN0 A;  5C00 A;  3IK9 A;  1GTB A;  1TTZ A;  3DGQ A;  4NHW A;  3GFK A;  3WGD A;  3RHC A;  5JCW A;  1J0F A;  4GLT A;  4DSS A;  4HZ4 A;  3ISO A;  1S3C A;  4BA7 A;  2A4V A;  2MYG A;  3LXT A;  3LYP A;  3NIV A;  1XVW A;  2OJL A;  3IBH A;  4ECC A;  3DVX A;  3APO A;  5HFI A;  3EMP A;  2C0E A;  1Z9H A;  1RQM A;  1SK1 A;  5LCZ A;  1JLV A;  1SYR A;  2IIY A;  4OD7 A;  5LNK e;  4I97 A;  2VCQ A;  3F0I A;  1XWK A;  2IMF A;  4GQC A;  4AJ8 A;  4YQU A;  3CSH A;  1XCC A;  2E2G A;  1A2J A;  1AW9 A;  1VF4 A;  1IYI A;  4G9H A;  4MLY A;  3Q19 A;  3GTU A;  2H1A A;  3ZL5 A;  4Q5R A;  1OC9 B;  1SL0 B;  1UC7 A;  19GS A;  1ERU A;  5JWR B;  2ON5 A;  2VO4 A;  4JBB A;  1XXU A;  1BG5 A;  2KP1 A;  1QGV A;  1PD2 1;  2EIR A;  1T4Y A;  5CRD A;  5DAK B;  1JZR A;  3ZML A;  4H86 A;  4BPY A;  4DSS B;  1H4O A;  2GLR A;  4J2F A;  1OYJ A;  1TJD A;  2MMZ A;  2DJ1 A;  2HT9 A;  2H0I A;  4IP1 A;  2XBQ A;  4L5L A;  5IO2 A;  1WIK A;  5HR2 A;  4GSN A;  1U88 A;  4EC0 A;  1DE1 A;  2HSY A;  5G31 A;  2E7P A;  2H0G A;  4FYB A;  1TRS A;  2M46 A;  4GWR A;  1EEM A;  4QL7 A;  1SEN A;  1FAA A;  2AHE A;  2VL9 A;  3UVT A;  3IK7 A;  2L5O A;  3VPT A;  2HRN A;  3IA1 A;  4MA9 A;  3Q6O A;  1SL1 B;  5H5Q A;  5B8B A;  2RM5 A;  4MCU A;  2ON7 A;  3TRQ A;  2X8H A;  1EP8 A;  1MDK A;  4MJC A;  1OVN A;  1GNE A;  3GTU B;  1K0N A;  4GTU A;  4XRD A;  1B9Y C;  2I1U A;  2VIM A;  3GL5 A;  3M9K A;  1EOH A;  1PX7 A;  18GS A;  1A2L A;  4XIH A;  5IPG A;  1KBN A;  1FHE A;  3D22 A;  3GH6 A;  1HNC A;  2XC2 A;  1X9S B;  4N10 A;  2VM2 A;  4F0C A;  2C3N A;  4AJ7 A;  3FR9 A;  1XBS A;  2VAF A;  4FYC A;  1OC8 A;  1TDI A;  4MPG A;  3HCZ A;  3DVW A;  1SJZ A;  1Q98 A;  2DJK A;  3HY2 A;  22GS A;  3UJ1 A;  5HFK A;  4F2I A;  2WJU A;  4V1A g;  2CV4 A;  4FIW A;  3UOM A;  1ERT A;  3R2Q A;  5CO3 A;  1R4W A;  5KN3 A;  4GRF A;  3ERW A;  4ID0 A;  1SKW B;  2I4A A;  1O7U A;  4BWS A;  4K7O A;  2IFQ A;  2O87 A;  4TR0 A;  1TU7 A;  3WD6 A;  3M0F A;  3D21 A;  1GUH A;  1QXH A;  3FYG A;  2C3T A;  3IC4 A;  2FY6 A;  2GGT A;  1XZO A;  1Y25 A;  4ECI A;  1T1V A;  2MMN A;  4ECB A;  3DD3 A;  3BCI A;  1K0B A;  3FZ9 A;  1V98 A;  2VD0 A;  4CHS A;  3I69 A;  2TIR A;  2GSR A;  3GKM A;  4WBR D;  4WXT A;  4WKW A;  2CX3 A;  1GTA A;  3KGK A;  2JZT A;  2L6C A;  4POL A;  1ZGN A;  4TVE A;  6GSS A;  5FT3 A;  4MAB A;  1I9D A;  3LWA A;  2YNX A;  2F3M A;  1X5E A;  3V1W A;  1JZO A;  1EOG A;  2R5G A;  4TXO A;  3G7J A;  3W6G A;  3PIN A;  1MDI A;  4P3Y B;  1BQ7 A;  3H4K A;  3D6I A;  1XW5 A;  4TR1 B;  1A2M A;  5HFG A;  3QOU A;  4CW9 A;  4WF5 A;  4IVF A;  4XS4 B;  1GSU A;  5ECK B;  3P7X A;  1DE2 A;  3DYR A;  4GCI A;  2H71 A;  4E8E A;  3GKN A;  4EXJ A;  4BVX A;  2DJ0 A;  3O76 A;  3EC3 A;  1K3O A;  2IFQ B;  1UA5 A;  2JL4 A;  2N5B A;  1GSD A;  5IMF A;  2NPB A;  4KAE A;  1B9X C;  1K0C A;  1K3Y A;  4XCS A;  1MD4 A;  3QAW A;  2KUC A;  1EEJ A;  5G1K A;  2R6K A;  2FUG 2;  3FZ4 A;  1RW1 A;  4OCE A;  3RHB A;  3LOR A;  3LQ7 A;  1A23 A;  3KIJ A;  3HZ4 A;  5B6N A;  2QKE A;  1PN9 A;  13GS A;  3QFB C;  3PGT A;  5GAP D;  3QR6 A;  1GUK A;  2H72 A;  4N11 A;  2PU9 C;  2TRC P;  5B6M A;  3QAV A;  1B8X A;  5A5K A;  4F9Z A;  1Z7R A;  5DAL A;  2FWG A;  3CTG A;  1C72 A;  2PN8 A;  3S9F A;  5ELA A;  5CYY A;  1O85 A;  2KP2 A;  1YKC A;  1YZX A;  2H76 A;  4KDY A;  3EU3 A;  2N5A A;  3LGC A;  1A8Y A;  3KEB A;  1GSE A;  2C1Y A;  1NSW A;  2DMM A;  1ABA A;  4AGS A;  1SL2 B;  5F05 A;  4NAX A;  2LNS A;  5ECI B;  4ZB9 A;  4XHM A;  1GL8 A;  3BBY A;  1T7P B;  1BED A;  1O6J A;  5GZZ B;  3P90 A;  1AC1 A;  1GNW A;  4I6X A;  5IPH A;  4RUV A;  2DJJ A;  3P2A A;  2GS3 A;  3HJO A;  5ECM B;  5E4W A;  5G2Z A;  2P5R A;  2QC7 A;  3CSI A;  2YCD A;  1UVZ A;  2PVO C;  2BJX A;  1W4V A;  5CP1 A;  2C3Q A;  1AIU A;  4HZ2 A;  5KN0 A;  3IOS A;  2REM A;  3WT2 A;  1AUC A;  1J08 A;  1GWC A;  1U6T A;  4NHZ A;  4IJ3 A;  3GST A;  3KH9 A;  1QMV A;  2EIQ A;  3KH7 A;  4TOP A;  4YQV A;  3C1R A;  2CVD A;  2C0D A;  1SYX A;  5IOW A;  1MTC A;  2YJ7 A;  1WPI A;  1WP0 A;  3TOT A;  5AGY A;  4G19 A;  3EE2 A;  2O8V B;  3VFI A;  3D4M A;  3TRP A;  2X64 A;  3APQ A;  4KSO A;  1YEP A;  2GTU A;  3VK9 A;  1BAY A;  2FHE A;  3GMF A;  5DBQ A;  3QCP A;  2PMT A;  2K6V A;  1A0F A;  2FLS A;  2B5X A;  4ZXG A;  3F63 A;  1SK0 A;  4O92 A;  5IOX A;  4ACS A;  3KMN A;  2HYX A;  3F3R A;  1O73 A;  3DKS A;  5F06 A;  3E3E A;  2F51 A;  1XWB A;  1X9M B;  16GS A;  3QPM A;  7GSS A;  1XFL A;  1AQW A;  1PL1 A;  3ERF A;  3TCO A;  5AIS A;  3GHA A;  4MJE A;  4ML6 A;  4PXO A;  2XHF A;  2GST A;  3F8U A;  4RQX A;  2PVQ A;  1RK4 A;  2YWO A;  1K3L A;  3TGZ A;  4EVM A;  1V57 A;  5FWG A;  2YV7 A;  4TR4 A;  2NDO A;  3HDC A;  4RI7 A;  3UAR A;  3GNJ A;  3ZMK A;  4LMW A;  2GQL A;  3GX8 A;  2H75 A;  5DAK A;  3VI7 A;  2V41 A;  4KSM A;  2HZF A;  4TXV A;  3EWL A;  2F9S A;  3KJY A;  3IXR A;  3Q74 A;  5CRG A;  4EDZ A;  1T00 A;  5EL8 A;  2MMA A;  4J57 E;  2VLU A;  3CTF A;  1QK8 A;  4YAP A;  2LQO A;  3GUR A;  4RQR A;  4DEJ A;  4ZBD A;  1PRX A;  4ZIJ A;  3G9B A;  2B6M A;  5KN1 A;  3ZIJ A;  4NV2 A;  2FA4 A;  1TRU A;  2CT6 A;  4MPF A;  1WWJ A;  4KDU A;  3L9V A;  4IQA A;  4YQM A;  1GUL A;  4BVY A;  5IMD A;  2I81 A;  6GSW A;  4DVC A;  6GST A;  1YY7 A;  3TKQ A;  3ZRD A;  3NZN A;  4KGI A;  1DSB A;  4PUF C;  5ELG A;  3UEM A;  5CAX A;  3VLN A;  1F2E A;  2EIO A;  2JSZ A;  1M2B A;  1GLP A;  2CX4 A;  1TKD B;  3GH9 A;  3N9J A;  3L9U A;  4JED A;  6GSV A;  3TKS C;  1GSY A;  4GSS A;  4NV5 A;  2CVB A;  1YEX A;  4I2U A;  4K1F A;  3H1N A;  2B1L A;  2P31 A;  2L5L A;  2LRN A;  1TI1 A;  5ENU A;  4AF2 A;  1SJ6 A;  4DSR A;  3QFA C;  2FD3 A;  1YQ1 A;  3GRX A;  3J7Y b;  4EE0 A;  3ZZX A;  4XS1 A;  1K0O A;  4HQS A;  1BJX A;  1EGO A;  1PGT A;  1F9M A;  2HNL A;  3EYT A;  4ILF A;  1H75 A;  2E2M A;  2YWN A;  3DRN A;  2N5F A;  5G5F A;  2NBS A;  2XPD A;  4QQ7 A;  1CQH A;  2WRT A;  5HQP A;  1KTE A;  1HNB A;  1VF2 A;  3MSZ A;  3HVV A;  1YF0 A;  1ZZY A;  5D9T A;  1GP1 A;  5D96 A;  2LNT A;  2L4Q A;  2CVK A;  2WFC A;  3VWX A;  6GSY A;  1G6Y A;  3KP9 A;  1B4Q A;  4ZBB A;  2K9F A;  3ZFL A;  3HKR A;  5ECO B;  3MNG A;  2IPA A;  1PKW A;  1XIY A;  2AV4 A;  3CSJ A;  3HXS A;  3UBK A;  1NHY A;  2HLS A;  12GS A;  3UMA A;  3LEF A;  4O7H A;  4E8H A;  2AAW A;  2ES7 A;  2YPM A;  2RM6 A;  3FK8 A;  3FZ5 A;  2GQM A;  3CYN A;  2CAI A;  2QSI A;  1UN2 A;  4FH8 A;  1G0T A;  3KXO A;  4POM A;  4HU9 A;  3BJ5 A;  3RBT A;  4PGT A;  3RAZ A;  2JU5 A;  1XWA A;  2O7K A;  1PKZ A;  2LRT A;  2VCW A;  3JCM L;  2CZ3 A;  2H01 A;  2GVP A;  1Z6M A;  3C8E A;  1QFN A;  4L8E A;  1N2A A;  4TR1 A;  2M72 A;  4XS4 A;  1AQV A;  3GX0 A;  1WJK A;  1HD2 A;  1SD8 A;  4OCF A;  5ECR B;  2JSY A;  20GS A;  3F9U A;  5J4U A;  5JWO B;  2AJQ B;  3UIW A;  2DLX A;  4KH7 A;  3SWL A;  2PER A;  1XPV A;  2ZCT A;  1TK8 B;  2A2R A;  2P5Q A;  4EL1 A;  1U3A A;  2HSH A;  5J41 A;  5G5E A;  3GL3 A;  3FR6 A;  3HA9 A;  1SKS B;  4HS1 A;  2MBT A;  5ID2 A;  2OBK A;  1GTI A;  1XVQ A;  2V32 A;  1PX6 A;  1CQG A;  1K0D A;  1JZD A;  4IQ1 A;  5G1L A;  3TOU A;  3WGX A;  4EF0 A;  2OE1 A;  2VL2 A;  3F4T A;  4TRX A;  2MZC A;  1PSQ A;  3DIE A;  4K8M A;  4ISD A;  2CAQ A;  3M8N A;  4JU5 A;  1V9W A;  2K18 A;  4LL4 B;  1YF1 A;  1MDJ A;  1F3A A;  1WMJ A;  4I5Q A;  3D4T A;  5ECN B;  5CRE A;  1XOA A;  3H8Q A;  5FHI A;  5DJL A;  5HR1 A;  5A4U A;  3HJM A;  5F07 A;  1F37 A;  2IL3 A;  4I8B A;  4ZL7 A;  2L4C A;  3TJF A;  2B1K A;  3QD9 A;  4MJB A;  2VCV A;  4WR4 A;  2BMX A;  2H6X A;  3A5W A;  1IYH A;  3GIX A;  3I9V 2;  5J5N A;  3ZLP A;  4ZL8 A;  2B7J A;  1WE0 A;  2LEG A;  3GA4 A;  2VCZ A;  2DML A;  1G7O A;  3GUS A;  1FB0 A;  4TKY A;  1FG4 A;  2AUV A;  4DSQ A;  4X43 A;  1TI3 A;  3EIN A;  3PH9 A;  4GQF A;  1M2A A;  2JZS A;  4K7N A;  1SD9 A;  2WS2 A;  2AYT A;  3M3M A;  4HEA 2;  2IMK A;  3C73 A;  10GS A;  2IME A;  2NVL A;  1T3B A;  3PR8 A;  2JAD A;  1O8W A;  5ID2 B;  5IM9 A;  3D5J A;  2QGV A;  3VUR A;  3WT1 A;  3I43 A;  2R37 A;  5CRH A;  5H5R A;  4ZB8 A;  2YP6 A;  3IR4 A;  1A8L A;  5JCU A;  4OFT A;  1MD3 A;  5ECS A;  3FKF A;  1GH2 A;  1URM A;  4X1U A;  3RDW A;  5AIX A;  2IJY A;  4POB A;  3F4S A;  2WUL A;  4IJI A;  4EUY A;  1R26 A;  3M1G A;  3F6D A;  1GSF A;  3IRA A;  2JZR A;  1BYE A;  2I9H A;  4PNF A;  3M9J A;  3MAK A;  2RII A;  5ECL B;  1LBK A;  2WB9 A;  2G2Q A;  1X0R A;  4MH2 A;  2YJH A;  3HHV A;  4KW6 A;  4PUA A;  2O89 A;  4FO5 A;  4AJ6 A;  2GZP A;  2LV3 A;  1U87 A;  4Z7X A;  3LFL A;  2LUS A;  3IDV A;  5J9B A;  1AQX A;  3BCK A;  1LU4 A;  4Q5F A;  1ZL9 A;  3H93 A;  3KM6 A;  2ZUP A;  2BTO T;  1R5A A;  2LS5 A;  1B4P A;  3N5O A;  2PGT A;  4NXI A;  3ME7 A;  2GT5 A;  4PQH A;  5EY6 A;  5J9C A;  1ON4 A;  4ZBA A;  3D0Z A;  3O3T A;  3VPQ A;  1VF3 A;  4MH3 A;  4BWQ A;  4V2M A;  2WCI A;  5DVB A;  1ZMA A;  4N0Z A;  3K8N A;  2K8V A;  1THO A;  2HFD A;  4WET A;  6GSX A;  2IMI A;  1MEK A;  3US3 A;  2B5Y A;  4O32 A;  1K0M A;  2X8G A;  4KX4 A;  3ZRE A;  2FGX A;  1Q4J A;  4KND A;  4MF6 A;  1N8J A;  2R2J A;  2MBS A;  3L9S A;  3QAG A;  2V6O A;  4F82 A;  2R3X A;  1O8X A;  1YJ6 A;  1X5D A;  3U5R E;  3H79 A;  3UVH A;  4EKZ A;  2YN1 A;  4YAV A;  2X99 A;  1M9A A;  4NMU A;  3BOA A;  2GSQ A;  1Y6E A;  3A2X A;  3APS A;  1NW2 A;  2J9H A;  2KOK A;  2NTO A;  2LJR A;  3RPN A;  17GS A;  2H1D A;  4MJA A;  4XRA A;  5CNW A;  2IWT A;  5INY A;  4IGJ A;  4KCA A;  2DJ3 A;  1Z6N A;  4RI6 A;  2HI7 A;  1F3B A;  2H6Y A;  5ECQ B;  5G30 A;  5ECP B;  1EWX A;  4PX1 A;  1V2A A;  2LKU A;  1FOV A;  2FWH A;  3A2W A;  5D9V A;  4JR4 A;  1TU8 A;  4HDE A;  1G6W A;  5IQY A;  2TRX A;  2RLI A;  4OO4 A;  4IEL A;  5B8A A;  4V2N A;  1T4Z A;  2LJK A;  3LYK A;  3TJK A;  3IAS 2;  1DBY A;  2H0H A;  2L59 A;  3CMI A;  4KCE A;  1GLQ A;  1EP7 A;  3GKK A;  3ED3 A;  3RPP A;  4LL1 B;  3HVS A;  14GS A;  2YZU A;  1ML6 A;  5DQS A;  4IW9 A;  1LJR A;  3TUE A;  5IO0 A;  1J9B A;  1U3I A;  3TJB A;  4MP4 A;  1V40 A;  4JRR A;  4HI7 A;  2HZE B;  2F8F A;  2H8L A;  2Z9S A;  4G2E A;  3KTB A;  4D73 B;  1JZW A;  1AAZ A;  5EPF A;  1S3D A;  2VUP A;  2G0F A;  5D73 A;  3ME8 A;  1FO5 A;  1XW9 A;  3IV4 A;  5F8B A;  2R4V A;  9GSS A;  5KEJ A;  1OKD A;  2CZ2 A;  5IMA A;  1GUM A;  3IAM 2;  4GF0 A;  3A3T A;  3E0U A;  3FHK A;  2LJA A;  1XWC A;  1SK2 A;  1AXD A;  1ACV A;  4N30 A;  1ERW A;  1E6B A;  3ERG A;  1ERV A;  2C8U A;  1JHB A;  2XBI A;  2EC4 A;  3L0H A;  4CDO A;  5D8I A;  5CRW A;  3AY8 A;  4IBP A;  2K8S A;  2FWE A;  3ZVJ A;  2RUF A;  2P0G A;  2ZNM A;  4X0X A;  4L0W A;  3C1S A;  2FCH A;  4MDC A;  1X5C A;  4HJ2 A;  3ZIV A;  5ABR A;  2PWJ A;  4PNG A;  5DQY A;  5AIV A;  3IHQ A;  4LLR A;  3ZVJ D;  3HVX A;  3W8S A;  1FB6 A;  2H66 A;  3LXZ A;  1VF1 A;  2VM1 A;  3GV1 A;  5IMZ A;  2OAC A;  2YWM A;  1DUG A;  3KMO A;  1R7H A;  3FR3 A;  2GSS A;  5J3R A;  1I5G A;  2DBC A;  3G7Y A;  3TDG A;  2C0G A;  1EV4 A;  4KA0 A;  2FWF A;  1SKR B;  3TB2 A;  2LST A;  1ST9 A;  3ZFB A;  3LJR A;  5AN1 A;  4OWY A;  1TP9 A;  3E9J B;  1Z5Y E;  1O81 A;  3SBC A;  6GSU A;  3CRT A;  4JE1 A;  1R5P A;  2H73 A;  2PBJ A;  5JCG A;  2HXK A;  3P8W A;  1ILO A;  4XTS A;  3DML A;  2FNO A;  3FEU A;  3UAP A;  1PA3 A;  4K0N A;  4GST A;  2HE3 A;  1EV9 A;  2V2G A;  3EU4 A;  4K6X A;  2OAD A;  4KDX A;  2H30 A;  5DJM A;  5A4V A;  2OA7 A;  2O85 A;  4KUN A;  1WRY A;  1THX A;  4LA1 A;  2H70 A;  3VI5 A;  2OKA A;  2FA8 A;  2YAN A;  2GQK A;  2WZ9 A;  4MZC A;  2E0Q A;  5D9X A;  2C80 A;  3GSS A;  1KNG A;  1OC3 A;  4OFM A;  3TJJ A;  4IP6 A;  5E59 A;  1Z3E A;  3GN3 A;  1XOB A;  1EZK A;  4WR5 A;  2YZH A;  3LG6 A;  4OO5 A;  2VD1 A;  3DEX A;  4ZL9 A;  4O5R A;  5H5S A;  1OE8 A;  4ZIL A;  2CQ9 A;  2KLX A;  1FW1 A;  3Q18 A;  2YWI A;  3W8J A;  5GAN D;  2PPT A;  2DIY A;  2GDR A;  1SJI A;  3IPZ A;  4TW5 A;  4PQI A;  2M80 A;  3BD2 A;  1PQN A;  4GXZ A;  4TR3 A;  3KD0 A;  1NHO A;  3U6V A;  4WF4 A;  2PUK C;  4ZB6 A;  3CRU A;  5IIZ A;  3WYW A;  2GT6 A;  4NWY A;  2IMD A;  4MF7 A;  4F03 A;  2WDU A;  5D93 A;  3HD5 A;  4POK A;  1ZCP A;  2KHP A;  3WGE A;  3FY7 A;  3TKP A; 
#chains in the Genus database with same CATH topology
 2VL3 A;  1ZYQ B;  2H74 A;  4KE3 A;  4Q5Q A;  3KTL A;  3FW2 A;  2DJ2 A;  4WBJ A;  1WOU A;  3HYP A;  5F0G A;  1FVJ A;  3FZA A;  1ZOF A;  3VWW A;  5IMC A;  1KEB A;  2VLV A;  3MIX A;  3MWH A;  4K7I A;  1K0A A;  3F3Q A;  3KZQ A;  2CA8 A;  5ECH B;  5IMV A;  1T8E B;  1HQO A;  1VGL A;  1FVK A;  3IE3 A;  4MF5 A;  4LMV A;  2L6D A;  1M2D A;  1HYU A;  3R3E A;  3F4R A;  4I2T A;  1JLW A;  2VCX A;  1XW6 A;  3NOF A;  3GKX A;  5DDL A;  8GSS A;  1PMT A;  5LD0 A;  3A2V A;  2LRC A;  1USB A;  1ZYE A;  1TK5 B;  3G7I A;  11GS A;  4NPB A;  1GTU A;  3HJP A;  4G10 A;  3J7Y k;  1X9W B;  4IS0 A;  1BX9 A;  3CXG A;  5A4W A;  2VLT A;  5HR0 A;  1OAZ A;  2B5E A;  4EDY A;  1M99 A;  3EVI A;  5GST A;  1PL2 A;  1M7T A;  3ZTL A;  1F6M C;  1A0R P;  3TKS A;  4JZQ A;  4HQZ A;  1TRV A;  1JFU A;  3EUR A;  1M0U A;  2C0F A;  4OFN A;  1GSQ A;  5EVO A;  1V58 A;  2H1G A;  2I3Y A;  3L4N A;  3PPU A;  3OR5 A;  2GZY A;  2B3S A;  4Q5N A;  4TXO B;  2A2S A;  4QL9 A;  4PQ1 A;  3TKR A;  3O6T A;  4HOJ A;  4K2D A;  2V6K A;  4V2L A;  1S3A A;  3MDK A;  1Z7P A;  5L71 A;  2J23 A;  2HRF A;  1TRW A;  4IHU A;  4YKG A;  2F8A A;  4XS6 A;  2YV9 A;  2VOC A;  2C4J A;  4MMM A;  3DXB A;  3VWU A;  4YH2 A;  1XWG A;  5HR3 A;  2XPE A;  3F6F A;  4BVX B;  1QUW A;  1OE7 A;  4HU7 A;  2OBI A;  2V1M A;  3ZIT A;  1S3R A;  1VRS D;  2R0G A;  3I6A A;  4MZB A;  5KN2 A;  3TRX A;  5JWQ B;  2DC5 A;  3L78 A;  1YKA A;  4J56 E;  4OMV A;  3FRC A;  2MMO A;  2H6Z A;  2D2Z A;  3DWV A;  2LTK A;  4K0G A;  2GZZ A;  1NM3 A;  1GRX A;  4V1A p;  4MK3 A;  5DCH A;  3TKS E;  3UBL A;  2RUE A;  1A24 A;  4BL7 A;  2B7K A;  3QMX A;  1GSS A;  5B7C A;  2ALB A;  3KCM A;  3HZ8 A;  5DCG A;  2AB6 A;  4L5O A;  3CBU A;  4WEY A;  5DAL B;  4N0V A;  1TW9 A;  2IN3 A;  4HJM A;  4ULX A;  2DSA A;  2H1B A;  2HZE A;  1SU9 A;  3QDN A;  2L57 A;  3EMX A;  4D73 A;  3TJG A;  5C04 A;  1HNA A;  2WGR A;  2OE3 A;  1TXX A;  4MZW A;  4FYU A;  5BMU A;  1OKT A;  2JAC A;  2X8C A;  3UL3 A;  1TOF A;  2VCT A;  4K9Z A;  4PUR A;  1YDK A;  1TK0 B;  1QQ2 A;  3C7M A;  4TN8 A;  2OE0 A;  2YOI A;  4KB3 A;  4CY8 A;  5COH A;  1EGR A;  1M9B A;  3C71 A;  3VWV A;  4ECJ A;  1B48 A;  3ZYW A;  5GSS A;  3GYK A;  4JR6 A;  4EO3 A;  2VL2 C;  4ML1 A;  3KP8 A;  3LSZ A;  2DIZ A;  2H19 A;  5D9W A;  4F0B A;  4IKH A;  2LQQ A;  4HUA A;  1W89 A;  1OC9 A;  1E2Y A;  4L0U A;  1G7E A;  4IN0 A;  5C00 A;  3IK9 A;  1GTB A;  1TTZ A;  3DGQ A;  4NHW A;  3GFK A;  3WGD A;  3RHC A;  5JCW A;  1J0F A;  4GLT A;  4DSS A;  4HZ4 A;  3ISO A;  1S3C A;  4BA7 A;  2A4V A;  2MYG A;  3LXT A;  3LYP A;  4Z2U A;  3NIV A;  1XVW A;  2OJL A;  3IBH A;  4ECC A;  4Z2R A;  3DVX A;  3APO A;  4O5U A;  5HFI A;  3EMP A;  2C0E A;  2HSM A;  1Z9H A;  1RQM A;  1SK1 A;  5LCZ A;  1JLV A;  1SYR A;  2IIY A;  4OD7 A;  5LNK e;  4I97 A;  2VCQ A;  3F0I A;  1XWK A;  2IMF A;  4GQC A;  4AJ8 A;  4YQU A;  3CSH A;  1XCC A;  2E2G A;  1A2J A;  2R0C A;  1AW9 A;  1VF4 A;  1IYI A;  4G9H A;  4MLY A;  3Q19 A;  3GTU A;  2H1A A;  3FMW A;  3ZL5 A;  4Q5R A;  1OC9 B;  1SL0 B;  1UC7 A;  19GS A;  1ERU A;  5JWR B;  2ON5 A;  2VO4 A;  4JBB A;  1XXU A;  1BG5 A;  2KP1 A;  1QGV A;  1PD2 1;  2EIR A;  1T4Y A;  5CRD A;  5DAK B;  1JZR A;  3ZML A;  4H86 A;  4BPY A;  4DSS B;  1H4O A;  2GLR A;  4J2F A;  1OYJ A;  1TJD A;  2MMZ A;  2DJ1 A;  2HT9 A;  2H0I A;  4IP1 A;  2XBQ A;  2QA1 A;  4L5L A;  5IO2 A;  1WIK A;  5HR2 A;  4GSN A;  1U88 A;  4EC0 A;  1DE1 A;  2HSY A;  5G31 A;  2E7P A;  2H0G A;  4FYB A;  1TRS A;  2M46 A;  4GWR A;  1EEM A;  4QL7 A;  1SEN A;  1FAA A;  2AHE A;  2VL9 A;  3UVT A;  3IK7 A;  2L5O A;  3VPT A;  2HRN A;  3IA1 A;  4MA9 A;  3Q6O A;  1SL1 B;  2QA2 A;  5H5Q A;  5B8B A;  2RM5 A;  1ZYP A;  4BVY B;  4MCU A;  2ON7 A;  3TRQ A;  2X8H A;  1EP8 A;  1MDK A;  4MJC A;  1OVN A;  1GNE A;  3IHG A;  3GTU B;  1K0N A;  4GTU A;  4XRD A;  1B9Y C;  2I1U A;  2VIM A;  3GL5 A;  3M9K A;  1ZYN A;  5BRT A;  1EOH A;  1PX7 A;  18GS A;  1A2L A;  4XIH A;  5IPG A;  1KBN A;  1FHE A;  3D22 A;  3GH6 A;  1HNC A;  2XC2 A;  1X9S B;  4N10 A;  2VM2 A;  4F0C A;  2C3N A;  4AJ7 A;  3FR9 A;  1XBS A;  2VAF A;  4FYC A;  1OC8 A;  1TDI A;  4MPG A;  3HCZ A;  3DVW A;  1SJZ A;  1Q98 A;  2DJK A;  3HY2 A;  22GS A;  3UJ1 A;  5HFK A;  4F2I A;  2WJU A;  4V1A g;  2CV4 A;  4FIW A;  3UOM A;  1ERT A;  3R2Q A;  5CO3 A;  1R4W A;  5KN3 A;  4GRF A;  3ERW A;  4ID0 A;  1SKW B;  2I4A A;  1O7U A;  4BWS A;  4K7O A;  2IFQ A;  2O87 A;  4TR0 A;  1TU7 A;  3WD6 A;  3M0F A;  3D21 A;  1GUH A;  1QXH A;  3FYG A;  2C3T A;  3IC4 A;  2FY6 A;  2GGT A;  1XZO A;  1Y25 A;  4ECI A;  1T1V A;  2MMN A;  4ECB A;  3DD3 A;  3BCI A;  1K0B A;  3FZ9 A;  1V98 A;  2VD0 A;  4CHS A;  3I69 A;  2TIR A;  2GSR A;  3GKM A;  4WBR D;  4WXT A;  4WKW A;  2CX3 A;  1GTA A;  3KGK A;  2JZT A;  2L6C A;  4POL A;  1ZGN A;  4TVE A;  6GSS A;  5FT3 A;  4MAB A;  1I9D A;  3LWA A;  2YNX A;  2F3M A;  1X5E A;  3V1W A;  1JZO A;  1EOG A;  2R5G A;  4TXO A;  3G7J A;  3W6G A;  3PIN A;  1MDI A;  4P3Y B;  1BQ7 A;  2A4H A;  3H4K A;  3D6I A;  1XW5 A;  4TR1 B;  1A2M A;  5HFG A;  3QOU A;  4CW9 A;  4WF5 A;  4IVF A;  4XS4 B;  1GSU A;  5ECK B;  3P7X A;  1DE2 A;  5KOW A;  3DYR A;  4GCI A;  2H71 A;  4E8E A;  3GKN A;  4EXJ A;  4BVX A;  2DJ0 A;  3O76 A;  3EC3 A;  1K3O A;  2IFQ B;  1UA5 A;  2JL4 A;  2N5B A;  1GSD A;  5IMF A;  2NPB A;  4KAE A;  1B9X C;  1K0C A;  3MYD A;  1K3Y A;  4XCS A;  1MD4 A;  3QAW A;  2KUC A;  1EEJ A;  5G1K A;  2R6K A;  2FUG 2;  3FZ4 A;  1RW1 A;  4OCE A;  5KOX A;  3RHB A;  3LOR A;  3LQ7 A;  1A23 A;  3KIJ A;  3HZ4 A;  5B6N A;  2QKE A;  1PN9 A;  13GS A;  3QFB C;  3PGT A;  5GAP D;  3QR6 A;  1GUK A;  2H72 A;  2HRA A;  4N11 A;  2PU9 C;  2TRC P;  5B6M A;  3QAV A;  1B8X A;  5A5K A;  4F9Z A;  1Z7R A;  5DAL A;  2FWG A;  3CTG A;  1C72 A;  2PN8 A;  3S9F A;  5ELA A;  5CYY A;  1O85 A;  2KP2 A;  3IC8 A;  1YKC A;  1YZX A;  2H76 A;  4KDY A;  3EU3 A;  2N5A A;  3LGC A;  1A8Y A;  3KEB A;  1GSE A;  2C1Y A;  1NSW A;  2DMM A;  1ABA A;  4AGS A;  1SL2 B;  5F05 A;  4NAX A;  2LNS A;  5ECI B;  4ZB9 A;  4XHM A;  1GL8 A;  3BBY A;  1T7P B;  1BED A;  1O6J A;  5GZZ B;  3P90 A;  1AC1 A;  1GNW A;  4I6X A;  5IPH A;  4RUV A;  2DJJ A;  3P2A A;  2GS3 A;  3HJO A;  5ECM B;  5E4W A;  5G2Z A;  2P5R A;  2QC7 A;  3CSI A;  2YCD A;  2R0P A;  1UVZ A;  2PVO C;  2BJX A;  1W4V A;  4USS A;  5CP1 A;  2C3Q A;  1AIU A;  4HZ2 A;  5KN0 A;  3IOS A;  2REM A;  3WT2 A;  1AUC A;  1J08 A;  1GWC A;  1U6T A;  4NHZ A;  4IJ3 A;  3GST A;  3KH9 A;  1QMV A;  2EIQ A;  3KH7 A;  4TOP A;  4YQV A;  3C1R A;  2X4A A;  2CVD A;  2C0D A;  1SYX A;  5IOW A;  1MTC A;  2YJ7 A;  1WPI A;  1WP0 A;  3TOT A;  5AGY A;  4G19 A;  3EE2 A;  2O8V B;  3VFI A;  3D4M A;  3TRP A;  2X64 A;  3APQ A;  4KSO A;  1YEP A;  2GTU A;  3VK9 A;  1BAY A;  2FHE A;  3GMF A;  5DBQ A;  3QCP A;  2PMT A;  2K6V A;  1A0F A;  2FLS A;  2B5X A;  4ZXG A;  3F63 A;  1SK0 A;  4O92 A;  5IOX A;  4ACS A;  2A2P A;  1PFO A;  3KMN A;  2HYX A;  3F3R A;  1O73 A;  3DKS A;  5F06 A;  1FOH A;  3E3E A;  2F51 A;  1XWB A;  4K5S A;  4MNN A;  1X9M B;  16GS A;  3QPM A;  7GSS A;  1XFL A;  1AQW A;  1PL1 A;  3ERF A;  3TCO A;  5AIS A;  3GHA A;  4MJE A;  4ML6 A;  4PXO A;  2XHF A;  2GST A;  3F8U A;  4RQX A;  2PVQ A;  1RK4 A;  2YWO A;  1K3L A;  3TGZ A;  4EVM A;  1V57 A;  5FWG A;  2YV7 A;  4TR4 A;  2NDO A;  3HDC A;  4RI7 A;  3UAR A;  3GNJ A;  4PTS A;  3ZMK A;  4LMW A;  2GQL A;  3GX8 A;  2H75 A;  5DAK A;  3VI7 A;  2V41 A;  4KSM A;  2HZF A;  4TXV A;  3EWL A;  2F9S A;  3KJY A;  3IXR A;  3Q74 A;  5CRG A;  4EDZ A;  1T00 A;  5EL8 A;  2MMA A;  4J57 E;  2VLU A;  3CTF A;  1QK8 A;  4YAP A;  2LQO A;  3GUR A;  4RQR A;  4DEJ A;  4ZBD A;  4YKF A;  1PRX A;  4ZIJ A;  3G9B A;  2B6M A;  3LW9 A;  5KN1 A;  3ZIJ A;  4NV2 A;  2FA4 A;  1TRU A;  4X4J A;  2CT6 A;  4MPF A;  1WWJ A;  4KDU A;  3L9V A;  4IQA A;  4YQM A;  1GUL A;  4BVY A;  5IMD A;  2I81 A;  6GSW A;  4DVC A;  6GST A;  1YY7 A;  3TKQ A;  3ZRD A;  3NZN A;  4KGI A;  1DSB A;  4PUF C;  5ELG A;  3UEM A;  5CAX A;  3VLN A;  1F2E A;  2EIO A;  2JSZ A;  1M2B A;  1GLP A;  2CX4 A;  1TKD B;  3GH9 A;  3N9J A;  3L9U A;  3CQF A;  4JED A;  3TKS C;  6GSV A;  1GSY A;  4GSS A;  4NV5 A;  2CVB A;  1YEX A;  4I2U A;  4K1F A;  3H1N A;  2B1L A;  2P31 A;  2L5L A;  2LRN A;  1TI1 A;  4FQU A;  5ENU A;  4AF2 A;  1SJ6 A;  4DSR A;  1M3J A;  3QFA C;  2FD3 A;  1YQ1 A;  3GRX A;  3J7Y b;  4EE0 A;  3ZZX A;  4XS1 A;  1K0O A;  4HQS A;  1BJX A;  1EGO A;  1PGT A;  1F9M A;  2HNL A;  3EYT A;  4ILF A;  1H75 A;  2E2M A;  2YWN A;  3DRN A;  2N5F A;  5G5F A;  2NBS A;  2XPD A;  4QQ7 A;  1CQH A;  2WRT A;  5HQP A;  1KTE A;  1HNB A;  1VF2 A;  3MSZ A;  3HVV A;  1YF0 A;  1ZZY A;  5D9T A;  1GP1 A;  5D96 A;  2LNT A;  2L4Q A;  2CVK A;  2WFC A;  3VWX A;  6GSY A;  1G6Y A;  3KP9 A;  1B4Q A;  4ZBB A;  2K9F A;  3ZFL A;  3HKR A;  5ECO B;  3MNG A;  2IPA A;  1PKW A;  1XIY A;  2AV4 A;  3CSJ A;  3HXS A;  3UBK A;  1NHY A;  4K5R A;  2HLS A;  2HRK A;  12GS A;  3UMA A;  3LEF A;  4O7H A;  4E8H A;  2AAW A;  2ES7 A;  2YPM A;  2RM6 A;  3FK8 A;  3FZ5 A;  2GQM A;  3CYN A;  2CAI A;  2QSI A;  1UN2 A;  4FH8 A;  1G0T A;  3KXO A;  4POM A;  4HU9 A;  3BJ5 A;  3RBT A;  4PGT A;  3RAZ A;  2JU5 A;  1XWA A;  2O7K A;  1PKZ A;  2LRT A;  2VCW A;  3JCM L;  2CZ3 A;  2X49 A;  2H01 A;  2GVP A;  1Z6M A;  3C8E A;  1QFN A;  4L8E A;  1N2A A;  4TR1 A;  2M72 A;  4XS4 A;  1AQV A;  3GX0 A;  1WJK A;  1HD2 A;  1SD8 A;  4OCF A;  5ECR B;  2JSY A;  20GS A;  3F9U A;  4BIK A;  5J4U A;  5JWO B;  2AJQ B;  3UIW A;  4G0I A;  2DLX A;  4KH7 A;  3SWL A;  2PER A;  1XPV A;  2ZCT A;  1TK8 B;  2A2R A;  2P5Q A;  4EL1 A;  1U3A A;  2HSH A;  5J41 A;  5G5E A;  3GL3 A;  3FR6 A;  3HA9 A;  1SKS B;  4HS1 A;  2MBT A;  5ID2 A;  2OBK A;  1GTI A;  1XVQ A;  2V32 A;  1PX6 A;  1CQG A;  1K0D A;  1JZD A;  4IQ1 A;  5G1L A;  3TOU A;  3WGX A;  4EF0 A;  2OE1 A;  2VL2 A;  3F4T A;  4TRX A;  2MZC A;  1PSQ A;  3DIE A;  4K8M A;  3EPT A;  4ISD A;  2CAQ A;  3M8N A;  4JU5 A;  1V9W A;  2K18 A;  4LL4 B;  1YF1 A;  1MDJ A;  1F3A A;  1WMJ A;  4I5Q A;  3D4T A;  5ECN B;  5CRE A;  1XOA A;  3H8Q A;  5FHI A;  5DJL A;  5HR1 A;  5A4U A;  3HJM A;  5F07 A;  1F37 A;  2IL3 A;  4I8B A;  4ZL7 A;  2L4C A;  3TJF A;  2B1K A;  3QD9 A;  4CY6 A;  4MJB A;  4ICY A;  2VCV A;  4K2X A;  4WR4 A;  2BMX A;  2H6X A;  3A5W A;  1IYH A;  3GIX A;  3I9V 2;  5J5N A;  3ZLP A;  4ZL8 A;  2B7J A;  1WE0 A;  2LEG A;  3GA4 A;  2VCZ A;  2DML A;  1G7O A;  3GUS A;  1FB0 A;  4TKY A;  1FG4 A;  2AUV A;  4DSQ A;  4X43 A;  1TI3 A;  3EIN A;  3PH9 A;  4GQF A;  1M2A A;  2JZS A;  4K7N A;  1SD9 A;  4Z2T A;  2WS2 A;  2AYT A;  3M3M A;  4HEA 2;  2IMK A;  3C73 A;  10GS A;  2IME A;  2NVL A;  4G0K A;  1T3B A;  3PR8 A;  2JAD A;  4EIP A;  1O8W A;  5ID2 B;  5IM9 A;  3D5J A;  2QGV A;  3VUR A;  3WT1 A;  3I43 A;  2R37 A;  5CRH A;  5H5R A;  4ZB8 A;  2YP6 A;  3IR4 A;  1A8L A;  5JCU A;  4OFT A;  1MD3 A;  5ECS A;  3FKF A;  1GH2 A;  1URM A;  4X1U A;  3RDW A;  5AIX A;  2IJY A;  4POB A;  3F4S A;  2WUL A;  4IJI A;  4EUY A;  1R26 A;  3M1G A;  3F6D A;  1GSF A;  3IRA A;  2DKI A;  2JZR A;  1BYE A;  2I9H A;  4PNF A;  3M9J A;  3MAK A;  2RII A;  5ECL B;  1LBK A;  2WB9 A;  2G2Q A;  1X0R A;  4MH2 A;  2YJH A;  3HHV A;  4KW6 A;  4PUA A;  2O89 A;  4FO5 A;  4AJ6 A;  2GZP A;  2LV3 A;  1U87 A;  4Z7X A;  3LFL A;  2LUS A;  3IDV A;  5J9B A;  1AQX A;  3BCK A;  1LU4 A;  4Q5F A;  1ZL9 A;  3H93 A;  3KM6 A;  2ZUP A;  2BTO T;  1R5A A;  2LS5 A;  1B4P A;  3N5O A;  2PGT A;  4NXI A;  3ME7 A;  2GT5 A;  4PQH A;  5EY6 A;  5J9C A;  1ON4 A;  4ZBA A;  3D0Z A;  3O3T A;  3VPQ A;  1VF3 A;  4MH3 A;  4BWQ A;  4V2M A;  2WCI A;  5DVB A;  1ZMA A;  4N0Z A;  3K8N A;  2K8V A;  1THO A;  2HFD A;  4WET A;  6GSX A;  2IMI A;  1MEK A;  3US3 A;  2B5Y A;  4O32 A;  1K0M A;  2X8G A;  4KX4 A;  3ZRE A;  2FGX A;  1Q4J A;  4KND A;  4MF6 A;  1N8J A;  2R2J A;  2MBS A;  3L9S A;  3QAG A;  2V6O A;  4F82 A;  2R3X A;  1O8X A;  1YJ6 A;  1X5D A;  4G0L A;  3U5R E;  3H79 A;  3UVH A;  4EKZ A;  2YN1 A;  4YAV A;  2X99 A;  1M9A A;  4NMU A;  3BOA A;  2GSQ A;  1Y6E A;  3A2X A;  3APS A;  1NW2 A;  2J9H A;  2KOK A;  2NTO A;  2LJR A;  3RPN A;  17GS A;  2H1D A;  4MJA A;  4XRA A;  5CNW A;  2IWT A;  5INY A;  4IGJ A;  4KCA A;  2DJ3 A;  1Z6N A;  4RI6 A;  3A5I A;  2HI7 A;  1F3B A;  4EIQ A;  2H6Y A;  5ECQ B;  5G30 A;  5ECP B;  1EWX A;  4PX1 A;  1V2A A;  2LKU A;  1FOV A;  2FWH A;  3A2W A;  5D9V A;  4JR4 A;  1TU8 A;  4HDE A;  1G6W A;  5IQY A;  2TRX A;  2RLI A;  4OO4 A;  4IEL A;  5B8A A;  4V2N A;  1T4Z A;  2LJK A;  3LYK A;  3TJK A;  3IAS 2;  1DBY A;  2H0H A;  2L59 A;  3CMI A;  4KCE A;  1GLQ A;  1EP7 A;  3GKK A;  4BL7 B;  3ED3 A;  3RPP A;  4LL1 B;  3HVS A;  14GS A;  2YZU A;  1ML6 A;  5DQS A;  4IW9 A;  1LJR A;  3TUE A;  5IO0 A;  1J9B A;  1U3I A;  3TJB A;  4MP4 A;  1V40 A;  4JRR A;  4HI7 A;  2DKH A;  2HZE B;  2F8F A;  2H8L A;  2Z9S A;  1M3I A;  4G2E A;  3KTB A;  4D73 B;  1JZW A;  1AAZ A;  5EPF A;  1S3D A;  2VUP A;  2G0F A;  5D73 A;  3ME8 A;  1FO5 A;  1XW9 A;  3IV4 A;  5F8B A;  2R4V A;  9GSS A;  5KEJ A;  1OKD A;  4HSC X;  2CZ2 A;  5IMA A;  1GUM A;  3IAM 2;  4GF0 A;  3A3T A;  3E0U A;  3FHK A;  2LJA A;  1XWC A;  1SK2 A;  1AXD A;  1ACV A;  4N30 A;  1ERW A;  1E6B A;  3ERG A;  1ERV A;  2C8U A;  1JHB A;  2XBI A;  2EC4 A;  3L0H A;  4CDO A;  5D8I A;  5CRW A;  3AY8 A;  4IBP A;  2K8S A;  2FWE A;  3ZVJ A;  2RUF A;  2P0G A;  2ZNM A;  4X0X A;  4L0W A;  3C1S A;  2FCH A;  4MDC A;  1X5C A;  4HJ2 A;  3ZIV A;  5ABR A;  2PWJ A;  4PNG A;  5DQY A;  5AIV A;  3IHQ A;  4LLR A;  3ZVJ D;  3HVX A;  3W8S A;  2UZ8 A;  4O5Q A;  1FB6 A;  2H66 A;  3LXZ A;  1VF1 A;  1XG8 A;  2VM1 A;  3GV1 A;  5IMZ A;  2OAC A;  2YWM A;  1DUG A;  3KMO A;  1R7H A;  3FR3 A;  2GSS A;  5J3R A;  1I5G A;  2DBC A;  3G7Y A;  3TDG A;  2C0G A;  1EV4 A;  4KA0 A;  2FWF A;  1SKR B;  4KF9 A;  3TB2 A;  2LST A;  1ST9 A;  3ZFB A;  3LJR A;  5AN1 A;  4OWY A;  1TP9 A;  3E9J B;  1Z5Y E;  1O81 A;  3SBC A;  6GSU A;  3CRT A;  4JE1 A;  1R5P A;  3HVN A;  2H73 A;  2PBJ A;  5JCG A;  2HXK A;  3P8W A;  1ILO A;  4XTS A;  3DML A;  2FNO A;  3FEU A;  3UAP A;  1PA3 A;  4K0N A;  4GST A;  2HE3 A;  1EV9 A;  2V2G A;  3EU4 A;  4K6X A;  1PN0 A;  2OAD A;  4KDX A;  2H30 A;  5DJM A;  5A4V A;  2OA7 A;  2O85 A;  4KUN A;  4A5P A;  1WRY A;  1THX A;  4LA1 A;  2H70 A;  3VI5 A;  2OKA A;  2FA8 A;  2YAN A;  2GQK A;  2WZ9 A;  4MZC A;  2E0Q A;  5D9X A;  2C80 A;  3GSS A;  1KNG A;  1OC3 A;  4OFM A;  3TJJ A;  4IP6 A;  5E59 A;  1Z3E A;  3GN3 A;  1XOB A;  1EZK A;  4WR5 A;  2YZH A;  3LG6 A;  4OO5 A;  2VD1 A;  3DEX A;  4ZL9 A;  4O5R A;  5H5S A;  1OE8 A;  4ZIL A;  2CQ9 A;  2KLX A;  1FW1 A;  3Q18 A;  2YWI A;  3W8J A;  5GAN D;  2PPT A;  2DIY A;  2GDR A;  1SJI A;  3IPZ A;  4TW5 A;  4PQI A;  2M80 A;  3BD2 A;  1PQN A;  4GXZ A;  4TR3 A;  3KD0 A;  1NHO A;  3U6V A;  4WF4 A;  2PUK C;  4ZB6 A;  3CRU A;  5IIZ A;  3WYW A;  2GT6 A;  4NWY A;  2IMD A;  4MF7 A;  4F03 A;  2WDU A;  5D93 A;  3HD5 A;  4POK A;  1ZCP A;  2KHP A;  3WGE A;  3FY7 A;  3TKP A; 
#chains in the Genus database with same CATH homology
 2VL3 A;  1ZYQ B;  2H74 A;  4KE3 A;  4Q5Q A;  3KTL A;  3FW2 A;  2DJ2 A;  4WBJ A;  1WOU A;  3HYP A;  5F0G A;  1FVJ A;  3FZA A;  1ZOF A;  3VWW A;  5IMC A;  1KEB A;  2VLV A;  3MIX A;  3MWH A;  4K7I A;  1K0A A;  3F3Q A;  3KZQ A;  2CA8 A;  5ECH B;  5IMV A;  1T8E B;  1HQO A;  1VGL A;  1FVK A;  3IE3 A;  4MF5 A;  4LMV A;  2L6D A;  1M2D A;  1HYU A;  3R3E A;  3F4R A;  4I2T A;  1JLW A;  2VCX A;  1XW6 A;  3NOF A;  3GKX A;  5DDL A;  8GSS A;  1PMT A;  5LD0 A;  3A2V A;  2LRC A;  1USB A;  1ZYE A;  1TK5 B;  3G7I A;  11GS A;  4NPB A;  1GTU A;  3HJP A;  4G10 A;  3J7Y k;  1X9W B;  4IS0 A;  1BX9 A;  3CXG A;  5A4W A;  2VLT A;  5HR0 A;  1OAZ A;  2B5E A;  4EDY A;  1M99 A;  3EVI A;  5GST A;  1PL2 A;  1M7T A;  3ZTL A;  1F6M C;  1A0R P;  3TKS A;  4JZQ A;  4HQZ A;  1TRV A;  1JFU A;  3EUR A;  1M0U A;  2C0F A;  4OFN A;  1GSQ A;  5EVO A;  1V58 A;  2H1G A;  2I3Y A;  3L4N A;  3PPU A;  3OR5 A;  2GZY A;  2B3S A;  4Q5N A;  4TXO B;  2A2S A;  4QL9 A;  4PQ1 A;  3TKR A;  3O6T A;  4HOJ A;  4K2D A;  2V6K A;  4V2L A;  1S3A A;  3MDK A;  1Z7P A;  5L71 A;  2J23 A;  2HRF A;  1TRW A;  4IHU A;  4YKG A;  2F8A A;  4XS6 A;  2YV9 A;  2VOC A;  2C4J A;  4MMM A;  3DXB A;  3VWU A;  4YH2 A;  1XWG A;  5HR3 A;  2XPE A;  3F6F A;  4BVX B;  1QUW A;  1OE7 A;  4HU7 A;  2OBI A;  2V1M A;  3ZIT A;  1VRS D;  2R0G A;  3I6A A;  4MZB A;  5KN2 A;  3TRX A;  5JWQ B;  2DC5 A;  3L78 A;  1YKA A;  4J56 E;  4OMV A;  3FRC A;  2MMO A;  2H6Z A;  2D2Z A;  3DWV A;  2LTK A;  4K0G A;  2GZZ A;  1NM3 A;  1GRX A;  4V1A p;  4MK3 A;  5DCH A;  3TKS E;  3UBL A;  2RUE A;  1A24 A;  4BL7 A;  2B7K A;  3QMX A;  1GSS A;  5B7C A;  2ALB A;  3KCM A;  3HZ8 A;  5DCG A;  2AB6 A;  4L5O A;  3CBU A;  4WEY A;  5DAL B;  4N0V A;  1TW9 A;  2IN3 A;  4HJM A;  4ULX A;  2DSA A;  2H1B A;  2HZE A;  1SU9 A;  3QDN A;  2L57 A;  3EMX A;  4D73 A;  3TJG A;  5C04 A;  1HNA A;  2WGR A;  2OE3 A;  1TXX A;  4MZW A;  4FYU A;  5BMU A;  1OKT A;  2JAC A;  2X8C A;  3UL3 A;  1TOF A;  2VCT A;  4K9Z A;  4PUR A;  1YDK A;  1TK0 B;  1QQ2 A;  3C7M A;  4TN8 A;  2OE0 A;  2YOI A;  4KB3 A;  4CY8 A;  5COH A;  1EGR A;  1M9B A;  3C71 A;  3VWV A;  4ECJ A;  1B48 A;  3ZYW A;  5GSS A;  3GYK A;  4JR6 A;  4EO3 A;  2VL2 C;  4ML1 A;  3KP8 A;  3LSZ A;  2DIZ A;  2H19 A;  5D9W A;  4F0B A;  4IKH A;  2LQQ A;  4HUA A;  1W89 A;  1OC9 A;  1E2Y A;  4L0U A;  1G7E A;  4IN0 A;  5C00 A;  3IK9 A;  1GTB A;  1TTZ A;  3DGQ A;  4NHW A;  3GFK A;  3WGD A;  3RHC A;  5JCW A;  1J0F A;  4GLT A;  4DSS A;  4HZ4 A;  3ISO A;  1S3C A;  4BA7 A;  2A4V A;  2MYG A;  3LXT A;  3LYP A;  4Z2U A;  3NIV A;  1XVW A;  2OJL A;  3IBH A;  4ECC A;  4Z2R A;  3DVX A;  3APO A;  4O5U A;  5HFI A;  3EMP A;  2C0E A;  2HSM A;  1Z9H A;  1RQM A;  1SK1 A;  5LCZ A;  1JLV A;  1SYR A;  2IIY A;  4OD7 A;  5LNK e;  4I97 A;  2VCQ A;  3F0I A;  1XWK A;  2IMF A;  4GQC A;  4AJ8 A;  4YQU A;  3CSH A;  1XCC A;  2E2G A;  1A2J A;  2R0C A;  1AW9 A;  1VF4 A;  1IYI A;  4G9H A;  4MLY A;  3Q19 A;  3GTU A;  2H1A A;  3FMW A;  3ZL5 A;  4Q5R A;  1OC9 B;  1SL0 B;  1UC7 A;  19GS A;  1ERU A;  5JWR B;  2ON5 A;  2VO4 A;  4JBB A;  1XXU A;  1BG5 A;  2KP1 A;  1QGV A;  1PD2 1;  2EIR A;  1T4Y A;  5CRD A;  5DAK B;  1JZR A;  3ZML A;  4H86 A;  4BPY A;  4DSS B;  1H4O A;  2GLR A;  4J2F A;  1OYJ A;  1TJD A;  2MMZ A;  2DJ1 A;  2HT9 A;  2H0I A;  4IP1 A;  2XBQ A;  2QA1 A;  4L5L A;  5IO2 A;  1WIK A;  5HR2 A;  4GSN A;  1U88 A;  4EC0 A;  1DE1 A;  2HSY A;  5G31 A;  2E7P A;  2H0G A;  4FYB A;  1TRS A;  2M46 A;  4GWR A;  1EEM A;  4QL7 A;  1SEN A;  1FAA A;  2AHE A;  2VL9 A;  3UVT A;  3IK7 A;  2L5O A;  3VPT A;  2HRN A;  3IA1 A;  4MA9 A;  3Q6O A;  1SL1 B;  2QA2 A;  5H5Q A;  5B8B A;  2RM5 A;  1ZYP A;  4BVY B;  4MCU A;  2ON7 A;  3TRQ A;  2X8H A;  1EP8 A;  1MDK A;  4MJC A;  1OVN A;  1GNE A;  3IHG A;  3GTU B;  1K0N A;  4GTU A;  4XRD A;  1B9Y C;  2I1U A;  2VIM A;  3GL5 A;  3M9K A;  1ZYN A;  5BRT A;  1EOH A;  1PX7 A;  18GS A;  1A2L A;  4XIH A;  5IPG A;  1KBN A;  1FHE A;  3D22 A;  3GH6 A;  1HNC A;  2XC2 A;  1X9S B;  4N10 A;  2VM2 A;  4F0C A;  2C3N A;  4AJ7 A;  3FR9 A;  1XBS A;  2VAF A;  4FYC A;  1OC8 A;  1TDI A;  4MPG A;  3HCZ A;  3DVW A;  1SJZ A;  1Q98 A;  2DJK A;  3HY2 A;  22GS A;  3UJ1 A;  5HFK A;  4F2I A;  2WJU A;  4V1A g;  2CV4 A;  4FIW A;  3UOM A;  1ERT A;  3R2Q A;  5CO3 A;  1R4W A;  5KN3 A;  4GRF A;  3ERW A;  4ID0 A;  1SKW B;  2I4A A;  1O7U A;  4BWS A;  4K7O A;  2IFQ A;  2O87 A;  4TR0 A;  1TU7 A;  3WD6 A;  3M0F A;  3D21 A;  1GUH A;  1QXH A;  3FYG A;  2C3T A;  3IC4 A;  2FY6 A;  2GGT A;  1XZO A;  1Y25 A;  4ECI A;  1T1V A;  2MMN A;  4ECB A;  3DD3 A;  3BCI A;  1K0B A;  3FZ9 A;  1V98 A;  2VD0 A;  4CHS A;  3I69 A;  2TIR A;  2GSR A;  3GKM A;  4WBR D;  4WXT A;  4WKW A;  2CX3 A;  1GTA A;  3KGK A;  2JZT A;  2L6C A;  4POL A;  1ZGN A;  4TVE A;  6GSS A;  5FT3 A;  4MAB A;  1I9D A;  3LWA A;  2YNX A;  2F3M A;  1X5E A;  3V1W A;  1JZO A;  1EOG A;  2R5G A;  4TXO A;  3G7J A;  3W6G A;  3PIN A;  1MDI A;  4P3Y B;  1BQ7 A;  2A4H A;  3H4K A;  3D6I A;  1XW5 A;  4TR1 B;  1A2M A;  5HFG A;  3QOU A;  4CW9 A;  4WF5 A;  4IVF A;  4XS4 B;  1GSU A;  5ECK B;  3P7X A;  1DE2 A;  5KOW A;  3DYR A;  4GCI A;  2H71 A;  4E8E A;  3GKN A;  4EXJ A;  4BVX A;  2DJ0 A;  3O76 A;  3EC3 A;  1K3O A;  2IFQ B;  1UA5 A;  2JL4 A;  2N5B A;  1GSD A;  5IMF A;  2NPB A;  4KAE A;  1B9X C;  1K0C A;  3MYD A;  1K3Y A;  4XCS A;  1MD4 A;  3QAW A;  2KUC A;  1EEJ A;  5G1K A;  2R6K A;  2FUG 2;  3FZ4 A;  1RW1 A;  4OCE A;  5KOX A;  3RHB A;  3LOR A;  3LQ7 A;  1A23 A;  3KIJ A;  3HZ4 A;  5B6N A;  2QKE A;  1PN9 A;  13GS A;  3QFB C;  3PGT A;  5GAP D;  3QR6 A;  1GUK A;  2H72 A;  2HRA A;  4N11 A;  2PU9 C;  2TRC P;  5B6M A;  3QAV A;  1B8X A;  5A5K A;  4F9Z A;  1Z7R A;  5DAL A;  2FWG A;  3CTG A;  1C72 A;  2PN8 A;  3S9F A;  5ELA A;  5CYY A;  1O85 A;  2KP2 A;  3IC8 A;  1YKC A;  1YZX A;  2H76 A;  4KDY A;  3EU3 A;  2N5A A;  3LGC A;  1A8Y A;  3KEB A;  1GSE A;  2C1Y A;  1NSW A;  2DMM A;  1ABA A;  4AGS A;  1SL2 B;  5F05 A;  4NAX A;  2LNS A;  5ECI B;  4ZB9 A;  4XHM A;  1GL8 A;  3BBY A;  1T7P B;  1BED A;  1O6J A;  5GZZ B;  3P90 A;  1AC1 A;  1GNW A;  4I6X A;  5IPH A;  4RUV A;  2DJJ A;  3P2A A;  2GS3 A;  3HJO A;  5ECM B;  5E4W A;  5G2Z A;  2P5R A;  2QC7 A;  3CSI A;  2YCD A;  2R0P A;  1UVZ A;  2PVO C;  2BJX A;  1W4V A;  4USS A;  5CP1 A;  2C3Q A;  1AIU A;  4HZ2 A;  5KN0 A;  3IOS A;  2REM A;  3WT2 A;  1AUC A;  1J08 A;  1GWC A;  1U6T A;  4NHZ A;  4IJ3 A;  3GST A;  3KH9 A;  1QMV A;  2EIQ A;  3KH7 A;  4TOP A;  4YQV A;  3C1R A;  2X4A A;  2CVD A;  2C0D A;  1SYX A;  5IOW A;  1MTC A;  2YJ7 A;  1WPI A;  1WP0 A;  3TOT A;  5AGY A;  4G19 A;  3EE2 A;  2O8V B;  3VFI A;  3D4M A;  3TRP A;  2X64 A;  3APQ A;  4KSO A;  1YEP A;  2GTU A;  3VK9 A;  1BAY A;  2FHE A;  3GMF A;  5DBQ A;  3QCP A;  2PMT A;  2K6V A;  1A0F A;  2FLS A;  2B5X A;  4ZXG A;  3F63 A;  1SK0 A;  4O92 A;  5IOX A;  4ACS A;  2A2P A;  3KMN A;  2HYX A;  3F3R A;  1O73 A;  3DKS A;  5F06 A;  1FOH A;  3E3E A;  2F51 A;  1XWB A;  4K5S A;  4MNN A;  1X9M B;  16GS A;  3QPM A;  7GSS A;  1XFL A;  1AQW A;  1PL1 A;  3ERF A;  3TCO A;  5AIS A;  3GHA A;  4MJE A;  4ML6 A;  4PXO A;  2XHF A;  2GST A;  3F8U A;  4RQX A;  2PVQ A;  1RK4 A;  2YWO A;  1K3L A;  3TGZ A;  4EVM A;  1V57 A;  5FWG A;  2YV7 A;  4TR4 A;  2NDO A;  3HDC A;  4RI7 A;  3UAR A;  3GNJ A;  4PTS A;  3ZMK A;  4LMW A;  2GQL A;  3GX8 A;  2H75 A;  5DAK A;  3VI7 A;  2V41 A;  4KSM A;  2HZF A;  4TXV A;  3EWL A;  2F9S A;  3KJY A;  3IXR A;  3Q74 A;  5CRG A;  4EDZ A;  1T00 A;  5EL8 A;  2MMA A;  4J57 E;  2VLU A;  3CTF A;  1QK8 A;  4YAP A;  2LQO A;  3GUR A;  4RQR A;  4DEJ A;  4ZBD A;  4YKF A;  1PRX A;  4ZIJ A;  3G9B A;  2B6M A;  3LW9 A;  5KN1 A;  3ZIJ A;  4NV2 A;  2FA4 A;  1TRU A;  4X4J A;  2CT6 A;  4MPF A;  1WWJ A;  4KDU A;  3L9V A;  4IQA A;  4YQM A;  1GUL A;  4BVY A;  5IMD A;  2I81 A;  6GSW A;  4DVC A;  6GST A;  1YY7 A;  3TKQ A;  3ZRD A;  3NZN A;  4KGI A;  1DSB A;  4PUF C;  5ELG A;  3UEM A;  5CAX A;  3VLN A;  1F2E A;  2EIO A;  2JSZ A;  1M2B A;  1GLP A;  2CX4 A;  1TKD B;  3GH9 A;  3N9J A;  3L9U A;  4JED A;  6GSV A;  3TKS C;  1GSY A;  4GSS A;  4NV5 A;  2CVB A;  1YEX A;  4I2U A;  4K1F A;  3H1N A;  2B1L A;  2P31 A;  2L5L A;  2LRN A;  1TI1 A;  4FQU A;  5ENU A;  4AF2 A;  1SJ6 A;  4DSR A;  3QFA C;  2FD3 A;  1YQ1 A;  3GRX A;  3J7Y b;  4EE0 A;  3ZZX A;  4XS1 A;  1K0O A;  4HQS A;  1BJX A;  1EGO A;  1PGT A;  1F9M A;  2HNL A;  3EYT A;  4ILF A;  1H75 A;  2E2M A;  2YWN A;  3DRN A;  2N5F A;  5G5F A;  2NBS A;  2XPD A;  4QQ7 A;  1CQH A;  2WRT A;  5HQP A;  1KTE A;  1HNB A;  1VF2 A;  3MSZ A;  3HVV A;  1YF0 A;  1ZZY A;  5D9T A;  1GP1 A;  5D96 A;  2LNT A;  2L4Q A;  2CVK A;  2WFC A;  3VWX A;  6GSY A;  1G6Y A;  3KP9 A;  1B4Q A;  4ZBB A;  2K9F A;  3ZFL A;  3HKR A;  5ECO B;  3MNG A;  2IPA A;  1PKW A;  1XIY A;  2AV4 A;  3CSJ A;  3HXS A;  3UBK A;  1NHY A;  4K5R A;  2HLS A;  2HRK A;  12GS A;  3UMA A;  3LEF A;  4O7H A;  4E8H A;  2AAW A;  2ES7 A;  2YPM A;  2RM6 A;  3FK8 A;  3FZ5 A;  2GQM A;  3CYN A;  2CAI A;  2QSI A;  1UN2 A;  4FH8 A;  1G0T A;  3KXO A;  4POM A;  4HU9 A;  3BJ5 A;  3RBT A;  4PGT A;  3RAZ A;  2JU5 A;  1XWA A;  2O7K A;  1PKZ A;  2LRT A;  2VCW A;  3JCM L;  2CZ3 A;  2X49 A;  2H01 A;  2GVP A;  1Z6M A;  3C8E A;  1QFN A;  4L8E A;  1N2A A;  4TR1 A;  2M72 A;  4XS4 A;  1AQV A;  3GX0 A;  1WJK A;  1HD2 A;  1SD8 A;  4OCF A;  5ECR B;  2JSY A;  20GS A;  3F9U A;  5J4U A;  5JWO B;  2AJQ B;  3UIW A;  4G0I A;  2DLX A;  4KH7 A;  3SWL A;  2PER A;  1XPV A;  2ZCT A;  1TK8 B;  2A2R A;  2P5Q A;  4EL1 A;  1U3A A;  2HSH A;  5J41 A;  5G5E A;  3GL3 A;  3FR6 A;  3HA9 A;  1SKS B;  4HS1 A;  2MBT A;  5ID2 A;  2OBK A;  1GTI A;  1XVQ A;  2V32 A;  1PX6 A;  1CQG A;  1K0D A;  1JZD A;  4IQ1 A;  5G1L A;  3TOU A;  3WGX A;  4EF0 A;  2OE1 A;  2VL2 A;  3F4T A;  4TRX A;  2MZC A;  1PSQ A;  3DIE A;  4K8M A;  3EPT A;  4ISD A;  2CAQ A;  3M8N A;  4JU5 A;  1V9W A;  2K18 A;  4LL4 B;  1YF1 A;  1MDJ A;  1F3A A;  1WMJ A;  4I5Q A;  3D4T A;  5ECN B;  5CRE A;  1XOA A;  3H8Q A;  5FHI A;  5DJL A;  5HR1 A;  5A4U A;  3HJM A;  5F07 A;  1F37 A;  2IL3 A;  4I8B A;  4ZL7 A;  2L4C A;  3TJF A;  2B1K A;  3QD9 A;  4CY6 A;  4MJB A;  4ICY A;  2VCV A;  4K2X A;  4WR4 A;  2BMX A;  2H6X A;  3A5W A;  1IYH A;  3GIX A;  3I9V 2;  5J5N A;  3ZLP A;  4ZL8 A;  2B7J A;  1WE0 A;  2LEG A;  3GA4 A;  2VCZ A;  2DML A;  1G7O A;  3GUS A;  1FB0 A;  4TKY A;  1FG4 A;  2AUV A;  4DSQ A;  4X43 A;  1TI3 A;  3EIN A;  3PH9 A;  4GQF A;  1M2A A;  2JZS A;  4K7N A;  1SD9 A;  4Z2T A;  2WS2 A;  2AYT A;  3M3M A;  4HEA 2;  2IMK A;  3C73 A;  10GS A;  2IME A;  2NVL A;  4G0K A;  1T3B A;  3PR8 A;  2JAD A;  4EIP A;  1O8W A;  5ID2 B;  5IM9 A;  3D5J A;  2QGV A;  3VUR A;  3WT1 A;  3I43 A;  2R37 A;  5CRH A;  5H5R A;  4ZB8 A;  2YP6 A;  3IR4 A;  1A8L A;  5JCU A;  4OFT A;  1MD3 A;  5ECS A;  3FKF A;  1GH2 A;  1URM A;  4X1U A;  3RDW A;  5AIX A;  2IJY A;  4POB A;  3F4S A;  2WUL A;  4IJI A;  4EUY A;  1R26 A;  3M1G A;  3F6D A;  1GSF A;  3IRA A;  2DKI A;  2JZR A;  1BYE A;  2I9H A;  4PNF A;  3M9J A;  3MAK A;  2RII A;  5ECL B;  1LBK A;  2WB9 A;  2G2Q A;  1X0R A;  4MH2 A;  2YJH A;  3HHV A;  4KW6 A;  4PUA A;  2O89 A;  4FO5 A;  4AJ6 A;  2GZP A;  2LV3 A;  1U87 A;  4Z7X A;  3LFL A;  2LUS A;  3IDV A;  5J9B A;  1AQX A;  3BCK A;  1LU4 A;  4Q5F A;  1ZL9 A;  3H93 A;  3KM6 A;  2ZUP A;  2BTO T;  1R5A A;  2LS5 A;  1B4P A;  3N5O A;  2PGT A;  4NXI A;  3ME7 A;  2GT5 A;  4PQH A;  5EY6 A;  5J9C A;  1ON4 A;  4ZBA A;  3D0Z A;  3O3T A;  3VPQ A;  1VF3 A;  4MH3 A;  4BWQ A;  4V2M A;  2WCI A;  5DVB A;  1ZMA A;  4N0Z A;  3K8N A;  2K8V A;  1THO A;  2HFD A;  4WET A;  6GSX A;  2IMI A;  1MEK A;  3US3 A;  2B5Y A;  4O32 A;  1K0M A;  2X8G A;  4KX4 A;  3ZRE A;  2FGX A;  1Q4J A;  4KND A;  4MF6 A;  1N8J A;  2R2J A;  2MBS A;  3L9S A;  3QAG A;  2V6O A;  4F82 A;  2R3X A;  1O8X A;  1YJ6 A;  1X5D A;  4G0L A;  3U5R E;  3H79 A;  3UVH A;  4EKZ A;  2YN1 A;  4YAV A;  2X99 A;  1M9A A;  4NMU A;  3BOA A;  2GSQ A;  1Y6E A;  3A2X A;  3APS A;  1NW2 A;  2J9H A;  2KOK A;  2NTO A;  2LJR A;  3RPN A;  17GS A;  2H1D A;  4MJA A;  4XRA A;  5CNW A;  2IWT A;  5INY A;  4IGJ A;  4KCA A;  2DJ3 A;  1Z6N A;  4RI6 A;  3A5I A;  2HI7 A;  1F3B A;  4EIQ A;  2H6Y A;  5ECQ B;  5G30 A;  5ECP B;  1EWX A;  4PX1 A;  1V2A A;  2LKU A;  1FOV A;  2FWH A;  3A2W A;  5D9V A;  4JR4 A;  1TU8 A;  4HDE A;  1G6W A;  5IQY A;  2TRX A;  2RLI A;  4OO4 A;  4IEL A;  5B8A A;  4V2N A;  1T4Z A;  2LJK A;  3LYK A;  3TJK A;  3IAS 2;  1DBY A;  2H0H A;  2L59 A;  3CMI A;  4KCE A;  1GLQ A;  1EP7 A;  3GKK A;  4BL7 B;  3ED3 A;  3RPP A;  4LL1 B;  3HVS A;  14GS A;  2YZU A;  1ML6 A;  5DQS A;  4IW9 A;  1LJR A;  3TUE A;  5IO0 A;  1J9B A;  1U3I A;  3TJB A;  4MP4 A;  1V40 A;  4JRR A;  4HI7 A;  2DKH A;  2HZE B;  2F8F A;  2H8L A;  2Z9S A;  4G2E A;  3KTB A;  4D73 B;  1JZW A;  1AAZ A;  5EPF A;  1S3D A;  2VUP A;  2G0F A;  5D73 A;  3ME8 A;  1FO5 A;  1XW9 A;  3IV4 A;  5F8B A;  2R4V A;  9GSS A;  5KEJ A;  1OKD A;  2CZ2 A;  5IMA A;  1GUM A;  3IAM 2;  4GF0 A;  3A3T A;  3E0U A;  3FHK A;  2LJA A;  1XWC A;  1SK2 A;  1AXD A;  1ACV A;  4N30 A;  1ERW A;  1E6B A;  3ERG A;  1ERV A;  2C8U A;  1JHB A;  2XBI A;  2EC4 A;  3L0H A;  4CDO A;  5D8I A;  5CRW A;  3AY8 A;  4IBP A;  2K8S A;  2FWE A;  3ZVJ A;  2RUF A;  2P0G A;  2ZNM A;  4X0X A;  4L0W A;  3C1S A;  2FCH A;  4MDC A;  1X5C A;  4HJ2 A;  3ZIV A;  5ABR A;  2PWJ A;  4PNG A;  5DQY A;  5AIV A;  3IHQ A;  4LLR A;  3ZVJ D;  3HVX A;  3W8S A;  2UZ8 A;  4O5Q A;  1FB6 A;  2H66 A;  3LXZ A;  1VF1 A;  2VM1 A;  3GV1 A;  5IMZ A;  2OAC A;  2YWM A;  1DUG A;  3KMO A;  1R7H A;  3FR3 A;  2GSS A;  5J3R A;  1I5G A;  2DBC A;  3G7Y A;  3TDG A;  2C0G A;  1EV4 A;  4KA0 A;  2FWF A;  1SKR B;  4KF9 A;  3TB2 A;  2LST A;  1ST9 A;  3ZFB A;  3LJR A;  5AN1 A;  4OWY A;  1TP9 A;  3E9J B;  1Z5Y E;  1O81 A;  3SBC A;  6GSU A;  3CRT A;  4JE1 A;  1R5P A;  2H73 A;  2PBJ A;  5JCG A;  2HXK A;  3P8W A;  1ILO A;  4XTS A;  3DML A;  2FNO A;  3FEU A;  3UAP A;  1PA3 A;  4K0N A;  4GST A;  2HE3 A;  1EV9 A;  2V2G A;  3EU4 A;  4K6X A;  1PN0 A;  2OAD A;  4KDX A;  2H30 A;  5DJM A;  5A4V A;  2OA7 A;  2O85 A;  4KUN A;  4A5P A;  1WRY A;  1THX A;  4LA1 A;  2H70 A;  3VI5 A;  2OKA A;  2FA8 A;  2YAN A;  2GQK A;  2WZ9 A;  4MZC A;  2E0Q A;  5D9X A;  2C80 A;  3GSS A;  1KNG A;  1OC3 A;  4OFM A;  3TJJ A;  4IP6 A;  5E59 A;  1Z3E A;  3GN3 A;  1XOB A;  1EZK A;  4WR5 A;  2YZH A;  3LG6 A;  4OO5 A;  2VD1 A;  3DEX A;  4ZL9 A;  4O5R A;  5H5S A;  1OE8 A;  4ZIL A;  2CQ9 A;  2KLX A;  1FW1 A;  3Q18 A;  2YWI A;  3W8J A;  5GAN D;  2PPT A;  2DIY A;  2GDR A;  1SJI A;  3IPZ A;  4TW5 A;  4PQI A;  2M80 A;  3BD2 A;  1PQN A;  4GXZ A;  4TR3 A;  3KD0 A;  1NHO A;  3U6V A;  4WF4 A;  2PUK C;  4ZB6 A;  3CRU A;  5IIZ A;  3WYW A;  2GT6 A;  4NWY A;  2IMD A;  4MF7 A;  4F03 A;  2WDU A;  5D93 A;  3HD5 A;  4POK A;  1ZCP A;  2KHP A;  3WGE A;  3FY7 A;  3TKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...