2HRFA

Solution structure of cu(i) p174l hsco1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
SFTGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCLEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords SCO1 protein homolog, mitochondrial
publication title Human Sco1 functional studies and pathological implications of the P174L mutant.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hrfA00
1TRUA 3P90A 1PGTA 5CYYA 5A4WA 1V2AA 1GSYA 14GSA 1KEBA 2GTUA 1TI3A 5LD0A 1ABAA 1SYXA 4MF5A 3F63A 4HJMA 3KJYA 4CW9A 3R2QA 1VF1A 4I5QA 1ZMAA 1F3BA 5B8BA 3W6GA 2CA8A 5FT3A 4PNGA 5ECPB 3OR5A 4XHMA 3GKXA 3HCZA 7GSSA 2WDUA 4X43A 3PINA 3HD5A 1OC3A 5IMVA 3ERWA 1PL1A 3TRPA 1A23A 4FYCA 3TOUA 4XTSA 5CRHA 5DBQA 2L57A 2DJJA 3HJOA 5EL8A 2OE3A 3QFBC 3KH7A 3W8SA 5D9VA 5ELAA 3HVXA 1A8LA 4OFMA 3WGEA 3GYKA 3J7Yb 2B5EA 4POLA 3LEFA 1QUWA 3QAGA 4AJ8A 4BA7A 5HR1A 5B6NA 1T3BA 2FCHA 3LGCA 5ENUA 4MJCA 1O7UA 2H6ZA 1A0FA 1OYJA 5G30A 1FAAA 4FO5A 1J0FA 1Z9HA 2YNXA 2GQMA 4POMA 1T8EB 3Q6OA 3ZIVA 2AHEA 1Q4JA 5ECMB 1F9MA 1S3CA 1T4YA 2JACA 3TKPA 3GL3A 2VCQA 5HR3A 4ZB8A 4BWSA 3FZAA 5B8AA 4KH7A 1SU9A 1YKCA 2K18A 4D73A 2WULA 1GSFA 1YZXA 1VGLA 2PUKC 1JZOA 2YV7A 4I2TA 5IMCA 1SENA 1N8JA 3P7XA 2OKAA 4XS6A 2P31A 1MDKA 2CZ2A 3IE3A 4Q5NA 1M0UA 5DVBA 4EDYA 2KOKA 3HY2A 5DJMA 3EMPA 3O3TA 4MH3A 2VCXA 3IRAA 4NAXA 2LNSA 1OKTA 20GSA 4GF0A 4LL4B 1A24A 3RPNA 1ERUA 4YQMA 1HYUA 2PBJA 2A2SA 4QQ7A 3EWLA 4PUFC 4OFNA 1DE1A 2VD0A 2YV9A 10GSA 1PMTA 3QR6A 1IYHA 3KP9A 2YN1A 3IBHA 4IW9A 1I5GA 2HZFA 3RPPA 3UVHA 1LU4A 3A3TA 2IWTA 4L0WA 1FW1A 3KM6A 1R26A 1ZOFA 3IAM2 3LJRA 1ON4A 5CNWA 2M72A 3ZVJD 2C0EA 2YWOA 3ZMLA 2P5RA 4ZBDA 3CXGA 4TR3A 4BWQA 3IV4A 2H73A 1ACVA 1PX7A 1EP7A 4G9HA 1MDJA 1WMJA 1DSBA 3TCOA 2AAWA 1XOAA 1YF1A 3GN3A 1OC9B 1OE7A 2JZSA 3UBLA 4GWRA 4MMMA 5F8BA 4IQAA 3N5OA 3DXBA 5A4UA 2FD3A 3F6FA 1K0BA 2N5AA 3NIVA 3FR3A 1EOHA 4LA1A 4K2DA 1WRYA 2E0QA 4MK3A 5LNKe 4L8EA 2CAIA 2MMAA 1SK1A 1OKDA 4GSSA 3O76A 3QD9A 4NV2A 4CHSA 1R5AA 2GQKA 2DJKA 1WIKA 4ECBA 1M2AA 1JZDA 1I9DA 1TK0B 2KP2A 1OE8A 5F06A 4I6XA 3TOTA 2H70A 2XPEA 2VL3A 4DSSB 3G9BA 3DRNA 2ZNMA 1M2BA 3GTUA 1K0OA 1TRVA 2WFCA 4Z7XA 2P5QA 3FZ5A 1B48A 1USBA 2LQQA 1K0CA 2R3XA 2F3MA 4L5LA 1SD8A 1QMVA 2GSTA 3UOMA 1GRXA 3CSIA 3H1NA 1T7PB 3TKSE 4HQSA 3EVIA 4N0VA 1PRXA 2DMMA 2JSZA 1M9AA 3V1WA 3IR4A 3HHVA 4KE3A 2QC7A 4RUVA 4TXVA 2C3TA 3VI7A 2IMFA 3UARA 3UEMA 5KN2A 1J9BA 1VF4A 3CRTA 4H86A 2H01A 2FWFA 4WF4A 2ZUPA 1XW6A 3GX8A 5KEJA 1V58A 2L5OA 3BBYA 4PQIA 3U5RE 1AC1A 2DJ1A 4WBRD 2JSYA 1GSSA 2PWJA 2LKUA 1A2JA 1ZCPA 4JRRA 1V40A 1TJDA 2Z9SA 3A2XA 2GSRA 1F6MC 3QDNA 2DSAA 1GLPA 2WRTA 2G2QA 1XIYA 5INYA 1GUHA 1F37A 2IL3A 5IMZA 2MBSA 1EV9A 2OA7A 3BCKA 3APQA 4IJ3A 1E2YA 2EIQA 3E9JB 2C0DA 2MBTA 1TW9A 1SD9A 2YZUA 4RQXA 3WD6A 4NPBA 4PNFA 3F6DA 1OC9A 5CP1A 4GLTA 5F0GA 3C8EA 1GUMA 3L0HA 4KDUA 2OACA 2DC5A 4ISDA 4KW6A 4FH8A 1X5EA 4KSOA 3GH6A 5DQSA 1EEMA 4HU9A 1K0AA 3D21A 5D73A 1XZOA 5A4VA 1ST9A 3ZRDA 4DSQA 4HI7A 4HUAA 4HOJA 4O5RA 2HT9A 2BTOT 2HYXA 1NHYA 3MAKA 3H93A 5JCWA 2IFQA 1DE2A 1H75A 1JZRA 1Z3EA 5IM9A 2N5BA 4MZCA 2ON7A 3VLNA 1Z6NA 5DCGA 2GSQA 3MNGA 4ACSA 2VO4A 5IIZA 5KN0A 2VLTA 4TRXA 1SL1B 2RLIA 2K8VA 1TU7A 4XIHA 5JCUA 1BEDA 4NWYA 5FWGA 1U88A 2DBCA 1DUGA 2XC2A 1WJKA 2IMDA 4MABA 3QCPA 2IMEA 3GRXA 2H0HA 5HR0A 2AYTA 2VL9A 2FA8A 1O6JA 2LJAA 3KIJA 3M9JA 1UN2A 1GNWA 3I43A 3FY7A 1FVJA 2C4JA 2O8VB 3WYWA 2H30A 1X0RA 2OE0A 4JEDA 4TXOA 3ZIJA 3ERGA 2X64A 4P3YB 1YY7A 3DWVA 5C00A 5CRGA 3Q18A 4YQVA 5J41A 4TOPA 1CQHA 1ML6A 3C7MA 3SWLA 4WR5A 2HXKA 1YF0A 1EOGA 2PMTA 1RK4A 3IPZA 5HFIA 1GTUA 3TJBA 4NHWA 2B5XA 1S3DA 3A2WA 2V6KA 3VURA 3GNJA 2YANA 3D22A 2D2ZA 3LXTA 5EVOA 1F2EA 3TUEA 1KNGA 1PKWA 5ELGA 3L9SA 4O92A 5HFKA 6GSYA 1K3LA 3G7JA 3DVWA 4ML1A 3FW2A 4MH2A 6GSVA 4I8BA 4K7NA 4ULXA 4TR1B 4IQ1A 1XPVA 4V1Ap 3C73A 1MEKA 3M9KA 4Q5RA 3EU3A 2FLSA 2JADA 1H4OA 1RQMA 3HJMA 3FEUA 4L0UA 1GTBA 4WKWA 4EO3A 3KH9A 3HJPA 2VOCA 3CMIA 17GSA 1ZYEA 8GSSA 2MYGA 2H6YA 1B4PA 1LJRA 3ZLPA 2OADA 2PN8A 3KTBA 2BMXA 2AUVA 2B3SA 1K3YA 2VCVA 5GZZB 2LV3A 1U3IA 4LLRA 4TR4A 5ECNB 2R5GA 4JR4A 2E2MA 3N9JA 2DJ2A 1QXHA 4XRDA 3GTUB 5JWQB 1UC7A 1FB0A 3F4SA 3QOUA 4V1Ag 2GGTA 3EE2A 1ZL9A 3VPTA 1GTIA 5IPHA 2F8AA 3RAZA 4OMVA 2GVPA 3CTFA 4NV5A 2YOIA 4EC0A 4EDZA 5HFGA 3A5WA 3TB2A 1TU8A 3TJJA 1V9WA 3GSTA 2AV4A 2V1MA 1QQ2A 4J57E 2GS3A 2V32A 4IP1A 4MZBA 3GH9A 5ECHB 22GSA 1K0MA 3HXSA 4F0BA 3IC4A 1NW2A 1TTZA 3VWVA 2V2GA 2V41A 2E7PA 2GQLA 4AGSA 1GSEA 1A2MA 5ECRB 2MZCA 4JZQA 5LCZA 4HEA2 3ZTLA 1YEXA 1XFLA 2B1LA 2JU5A 3CSHA 4LL1B 5GAPD 4O32A 1PKZA 3RBTA 6GSTA 4TW5A 2CVKA 2P0GA 5DJLA 1XWGA 1M7TA 5DDLA 5B7CA 2G0FA 3GUSA 2QKEA 1K0DA 3GV1A 1BJXA 3FZ9A 4MDCA 2OJLA 2QSIA 1T1VA 4MA9A 1K3OA 2YJ7A 1YJ6A 5IOWA 4XS1A 2C3NA 5GSTA 2I81A 3F3RA 4PGTA 4ZXGA 4YQUA 2PVOC 5J9BA 3TJFA 1PSQA 1PD21 3BJ5A 4GTUA 2HSHA 1V57A 2FGXA 3EYTA 2CVDA 1M9BA 1PQNA 5ABRA 4N11A 1F3AA 2YCDA 3TKSA 2R2JA 2J9HA 1T4ZA 3M0FA 3FYGA 4N10A 2H66A 2C3QA 3KCMA 2YZHA 2HRFA 2I9HA 3ZL5A 1G0TA 3VWXA 4K0NA 3TDGA 5J5NA 4HDEA 4FYUA 3HYPA 4MF6A 4TR1A 4ZILA 2PU9C 3ZFBA 1SKSB 5CRWA 2H1AA 2H75A 1XWAA 2IFQB 3PR8A 4EUYA 3VFIA 1UA5A 2C0FA 2B7JA 3WT2A 3US3A 2NBSA 3F4TA 1EP8A 2GT6A 1O81A 2RIIA 2ES7A 2F51A 3HA9A 1T00A 4G2EA 1B9YC 5DALB 2C1YA 1Z7RA 4OD7A 1C72A 1XXUA 4KDXA 1KBNA 3KTLA 3HVVA 1ILOA 4IN0A 3SBCA 1GLQA 3KMOA 2KHPA 4WEYA 1GWCA 3RDWA 2LUSA 1VF3A 1EV4A 4OO5A 2O89A 5GAND 5F05A 4HJ2A 4WBJA 3IA1A 3BCIA 4F03A 1HNBA 3ED3A 2LNTA 4V2MA 5L71A 3DVXA 2XHFA 2HSYA 1DBYA 1XW5A 2VLUA 5IMFA 5B6MA 3I9V2 1MDIA 1SYRA 5D9XA 3KZQA 3JCML 4DVCA 4K8MA 4TXOB 4L5OA 4JU5A 4IBPA 3CBUA 1BG5A 3GKMA 1GSQA 2VL2A 1U87A 1NM3A 1PN9A 3D5JA 4KA0A 3QAVA 3TKQA 1K0NA 2WZ9A 1BQ7A 5C04A 5JWOB 3DYRA 4DSRA 6GSWA 4IHUA 1EWXA 4XRAA 1SJIA 4PX1A 4V2NA 1AQVA 3MDKA 4E8EA 4KAEA 4V2LA 2HFDA 1XWKA 2PGTA 3E3EA 1X9SB 2A4VA 3QPMA 1GP1A 4GSTA 1MD4A 1JZWA 1O85A 3ZMKA 4NMUA 4EKZA 1SJ6A 3D4MA 2OBKA 3VI5A 3UJ1A 2VCZA 2FY6A 1A8YA 2VUPA 4POKA 2YPMA 1M99A 2A2RA 2VCTA 4AJ7A 1G7EA 3LORA 3FRCA 5AIXA 4PURA 1MTCA 2N5FA 4RI7A 3HDCA 5IMAA 4GCIA 1X5DA 4TVEA 4ZBAA 1XVQA 12GSA 3KD0A 4ZBBA 1ZZYA 5ECSA 18GSA 4RI6A 2HE3A 1TP9A 1B4QA 4MPFA 1HNAA 2RUEA 3CRUA 5IPGA 1OC8A 3PH9A 1AXDA 2R4VA 2C8UA 4WXTA 4JR6A 1XW9A 5G1LA 1XWCA 1THOA 4JE1A 1V98A 1JHBA 4LMVA 3ZREA 1EGRA 4HZ2A 2C80A 4PXOA 4JBBA 4J2FA 1OVNA 2WGRA 4ECCA 4OWYA 4GQCA 1AQXA 3F0IA 4MLYA 5GSSA 3TKRA 4ILFA 1NHOA 2LRNA 1HNCA 5EY6A 2MMZA 3F9UA 4ZL8A 4TR0A 2DJ3A 2CT6A 2XBIA 3L78A 2K6VA 5DALA 2NVLA 4ZL7A 6GSSA 1Z6MA 4GXZA 1GSUA 1UVZA 4KCAA 2FHEA 4IVFA 2GZPA 2GT5A 3IK7A 4ZL9A 5DAKA 1GSDA 16GSA 3I6AA 4ZB6A 2FNOA 4KNDA 3FR6A 2CAQA 2PVQA 3TKSC 4XS4B 3GA4A 2QGVA 1M2DA 3EURA 2VM2A 3GURA 4PQ1A 1EGOA 3H79A 4OO4A 5G5FA 2MMNA 3UL3A 2X99A 4KDYA 5H5QA 3RHBA 4DEJA 2HZEB 4PQHA 3NOFA 4G10A 1AQWA 4E8HA 4EF0A 2VLVA 2FWEA 1MD3A 2DJ0A 3FZ4A 1WE0A 1ERVA 4HU7A 3M1GA 2RM5A 2L5LA 2RM6A 3C1RA 3HZ8A 5HR2A 1GNEA 2LTKA 2TRXA 2TIRA 2CX3A 3CSJA 3LWAA 3C71A 1SK0A 1CQGA 2CV4A 1A2LA 2L59A 2B7KA 3G7IA 4YAPA 5ECOB 4ID0A 2KLXA 2HNLA 3GFKA 3DD3A 4K0GA 2H1GA 5FHIA 2H74A 2XBQA 3HKRA 4F9ZA 4CDOA 5ID2A 3LG6A 5J4UA 2H6XA 3GHAA 2M46A 4KCEA 4MCUA 3CYNA 1Y25A 2OBIA 2REMA 3FHKA 2VL2C 2X8CA 3L9VA 1B9XC 2JZTA 1AIUA 3IHQA 2GLRA 4IP6A 2IN3A 1BX9A 5J9CA 3EU4A 3LSZA 1TXXA 3L4NA 4K7OA 3GIXA 3DKSA 5DQYA 1XOBA 1GL8A 3Q74A 3TJKA 3TRQA 4K6XA 2AB6A 4I97A 2O85A 5ECQB 2PPTA 2WJUA 2FA4A 1G7OA 2JL4A 2B5YA 1PL2A 2L4QA 4HS1A 5F07A 3HVSA 1GH2A 1JLVA 1HD2A 4K7IA 2F9SA 2YP6A 3M8NA 2K8SA 3VWWA 1SK2A 2FWHA 3C1SA 5CRDA 3DIEA 4ZB9A 2F8FA 3WT1A 1R4WA 2M80A 1TK8B 3F4RA 2LSTA 1VRSD 3TGZA 4F2IA 2CX4A 3GKNA 5D93A 2H0IA 3W8JA 5IO0A 4KSMA 5AN1A 4IGJA 4X1UA 5HQPA 1PA3A 4XS4A 3ZITA 4FIWA 3QMXA 2K9FA 2DMLA 4AF2A 4OFTA 1U3AA 2PERA 2IIYA 4NXIA 5IOXA 3NZNA 2LQOA 6GSXA 5CO3A 1Z7PA 2HZEA 1Q98A 1O73A 3ZYWA 5CAXA 1SKRB 5DCHA 3APSA 2FUG2 3WGDA 3RHCA 1Y6EA 5J3RA 3GX0A 2CVBA 2VD1A 2LEGA 4YAVA 2L6CA 2I4AA 5KN3A 2R37A 3KMNA 1G6WA 1FHEA 2KUCA 4IELA 3S9FA 1TK5B 3A2VA 1THXA 2YWIA 4POBA 4RQRA 6GSUA 1E6BA 1FB6A 1YEPA 2H72A 2VM1A 2ON5A 3KXOA 3UMAA 2I1UA 1GTAA 3EC3A 5KN1A 3GKKA 1YKAA 2EC4A 2LRTA 3TRXA 2J23A 4EXJA 3G7YA 2WCIA 3ISOA 2H8LA 2H71A 2V6OA 1Z5YE 5COHA 3IOSA 1AUCA 3QFAC 2EIOA 1ERWA 3J7Yk 1JLWA 4KUNA 1X5CA 3VWUA 3D0ZA 2CZ3A 3UVTA 2XPDA 4HZ4A 2VIMA 5EPFA 1ZYQB 11GSA 1SL0B 1W89A 1J08A 1X9WB 1WPIA 2EIRA 1AW9A 4AJ6A 3DEXA 3IAS2 2YWNA 3FK8A 1R7HA 3PGTA 1QGVA 5ECIB 4F0CA 4OCFA 3KEBA 2X8HA 2KP1A 1JFUA 5IQYA 3BOAA 4ECJA 3ME7A 1G6YA 1R5PA 13GSA 2X8GA 3UBKA 4YH2A 4KB3A 4IJIA 1EEJA 3AY8A 5DAKB 4G19A 4WETA 3ERFA 4KGIA 4N0ZA 3LXZA 5CREA 1SL2B 3D6IA 1AAZA 2BJXA 3I69A 4TKYA 4K9ZA 4ML6A 3GSSA 9GSSA 2LS5A 1PX6A 3D4TA 1B8XA 2H76A 3FKFA 4I2UA 4QL7A 3CTGA 2NDOA 1SKWB 2B1KA 1QFNA 1TOFA 4Q5QA 4J56E 3K8NA 4NHZA 3KGKA 1OAZA 1A0RP 3LQ7A 1WOUA 2YWMA 2DLXA 5A5KA 4EVMA 4O7HA 1GULA 2GDRA 4BPYA 1FO5A 5G5EA 4KX4A 4GQFA 2NPBA 5G1KA 4LMWA 4FYBA 4F82A 1YDKA 2ALBA 2CQ9A 4GRFA 3ZZXA 5D8IA 2IMKA 3DMLA 4K1FA 2NTOA 4OCEA 5D9TA 2RUFA 1XBSA 3U6VA 2LRCA 2O7KA 5ID2B 5AGYA 5E4WA 5IMDA 3LFLA 3KP8A 1O8WA 1O8XA 2OE1A 3GMFA 2E2GA 2LJRA 4TN8A 2WB9A 3L9UA 4X0XA 3E0UA 3ZFLA 2HI7A 2I3YA 4IKHA 2C0GA 3UAPA 4MPGA 4WF5A 1VF2A 1TDIA 2FWGA 4MJBA 2H19A 5JWRB 5D96A 3H8QA 2YJHA 3BD2A 1KTEA 3F3QA 1YQ1A 2MMOA 2L4CA 2GSSA 1BAYA 1NSWA 2GZZA 1FG4A 4XCSA 2TRCP 4MP4A 2DIYA 5H5RA 2H1BA 2IPAA 2H1DA 2ZCTA 4EE0A 3DGQA 3LYKA 4Q5FA 5H5SA 3TJGA 5AIVA 2B6MA 2L6DA 3GL5A 1ZGNA 4N30A 3FR9A 1EZKA 1BYEA 1U6TA 4PUAA 4MZWA 4QL9A 1X9MB 3ME8A 3H4KA 3ZVJA 4BVXA 3EINA 5E59A 1XCCA 1FOVA 4HQZA 2IJYA 4EL1A 4MJEA 3UIWA 2H0GA 5G2ZA 3QAWA 4D73B 3EMXA 1N2AA 1IYIA 3HZ4A 1TRSA 4MJAA 3APOA 4DSSA 3O6TA 5G31A 2VCWA 3IXRA 4ECIA 3WGXA 3MWHA 1LBKA 1SJZA 1QK8A 2O87A 1W4VA 2R6KA 3MSZA 4WR4A 1WP0A 3IK9A 2VAFA 5ECLB 2LJKA 2IMIA 4BVYA 2AJQB 4BL7A 2HLSA 1XVWA 5AISA 5IO2A 1HQOA 1FVKA 3P8WA 4IS0A 2JZRA 2WS2A 1GUKA 1TRWA 4MF7A 3IDVA 3VK9A 1URMA 1WWJA 1TKDB 5D9WA 2GZYA 3F8UA 2HRNA 3LYPA 1XWBA 3M3MA 4ZIJA 1RW1A 3VPQA 5ECKB 1TI1A 3P2AA 3Q19A 1S3AA 2DIZA 1ERTA 5JCGA 19GSA 4GSNA
chains in the Genus database with same CATH superfamily
1TRUA 3P90A 1PGTA 5CYYA 5A4WA 1V2AA 1GSYA 14GSA 1KEBA 2GTUA 1TI3A 5LD0A 1ABAA 1SYXA 4MF5A 3F63A 4HJMA 3KJYA 4CW9A 3R2QA 1VF1A 4I5QA 1ZMAA 1F3BA 4EIPA 5B8BA 3W6GA 2CA8A 5FT3A 4PNGA 5ECPB 3OR5A 4XHMA 3GKXA 3HCZA 7GSSA 2WDUA 4X43A 3PINA 3HD5A 1OC3A 4Z2RA 5IMVA 3ERWA 1PL1A 3TRPA 1A23A 4FYCA 4BIKA 3TOUA 4XTSA 5CRHA 5DBQA 2L57A 2DJJA 3HJOA 5EL8A 2OE3A 3QFBC 3KH7A 3W8SA 5D9VA 5ELAA 3HVXA 1A8LA 4OFMA 4O5UA 3WGEA 3GYKA 3J7Yb 2B5EA 4POLA 3LEFA 1QUWA 3QAGA 4AJ8A 4BA7A 5HR1A 5B6NA 1T3BA 2FCHA 3LGCA 5ENUA 4G0LA 4K5RA 4MJCA 1O7UA 2H6ZA 1A0FA 1OYJA 5G30A 1FAAA 4FO5A 1J0FA 1Z9HA 2YNXA 2GQMA 4POMA 1T8EB 3Q6OA 3ZIVA 2AHEA 1Q4JA 5ECMB 1F9MA 1S3CA 1T4YA 3MYDA 2JACA 3TKPA 3GL3A 2VCQA 5HR3A 4ZB8A 4BWSA 3FZAA 5B8AA 4KH7A 1SU9A 1YKCA 2K18A 4D73A 2WULA 1GSFA 1YZXA 1VGLA 2PUKC 1JZOA 2YV7A 4I2TA 5IMCA 1SENA 1N8JA 3P7XA 2OKAA 4XS6A 2P31A 1MDKA 2CZ2A 3IE3A 4Q5NA 1M0UA 5DVBA 4EDYA 2KOKA 3HY2A 5DJMA 4CY8A 3EMPA 3O3TA 4MH3A 2VCXA 3IRAA 4NAXA 2LNSA 1OKTA 20GSA 4GF0A 4LL4B 1A24A 3RPNA 1ERUA 4YQMA 1HYUA 2PBJA 2A2SA 4QQ7A 3EWLA 4PUFC 2QA2A 3FMWA 4OFNA 1DE1A 2VD0A 2YV9A 2HSMA 10GSA 1PMTA 3QR6A 1IYHA 3KP9A 2YN1A 3IBHA 4IW9A 1I5GA 2HZFA 2A2PA 3RPPA 3UVHA 1LU4A 3A3TA 2IWTA 4L0WA 1FW1A 3KM6A 1R26A 1ZOFA 3IAM2 3LJRA 1ON4A 5CNWA 2M72A 3ZVJD 2C0EA 2YWOA 3ZMLA 2P5RA 4ZBDA 3CXGA 4TR3A 4BWQA 3IV4A 2H73A 1ACVA 1PX7A 1EP7A 4G9HA 1MDJA 1WMJA 1DSBA 3TCOA 2AAWA 1XOAA 1YF1A 3GN3A 1OC9B 1OE7A 2JZSA 3UBLA 4GWRA 4MMMA 5F8BA 4IQAA 5KOWA 3N5OA 3DXBA 5A4UA 2FD3A 3F6FA 4K2XA 1K0BA 2N5AA 3NIVA 3FR3A 1EOHA 4LA1A 4K2DA 1WRYA 2E0QA 4MK3A 5LNKe 4L8EA 2CAIA 2MMAA 1SK1A 1OKDA 4GSSA 3O76A 3QD9A 4NV2A 4CHSA 1R5AA 2GQKA 2DJKA 1WIKA 4ECBA 1M2AA 1JZDA 1I9DA 1TK0B 2KP2A 1OE8A 5F06A 4I6XA 3TOTA 2H70A 2XPEA 2VL3A 4DSSB 3G9BA 3DRNA 2ZNMA 1M2BA 3GTUA 1K0OA 1TRVA 2WFCA 4Z7XA 2P5QA 3FZ5A 1B48A 1USBA 4BVYB 2LQQA 1K0CA 2R3XA 2F3MA 4L5LA 1SD8A 1QMVA 2GSTA 3UOMA 1GRXA 3CSIA 3H1NA 1T7PB 3TKSE 4HQSA 3EVIA 4N0VA 1PRXA 2DMMA 2JSZA 1M9AA 3V1WA 3IR4A 3HHVA 4KE3A 2R0CA 2QC7A 4RUVA 4TXVA 3EPTA 2C3TA 3VI7A 2IMFA 3UARA 3UEMA 5KN2A 1J9BA 1VF4A 3CRTA 4H86A 2H01A 2FWFA 4WF4A 2ZUPA 1XW6A 3GX8A 5KEJA 1V58A 2L5OA 3BBYA 4PQIA 3U5RE 1AC1A 2DJ1A 4WBRD 2JSYA 1GSSA 2PWJA 2LKUA 1A2JA 1ZCPA 4JRRA 1V40A 1TJDA 2Z9SA 3A2XA 2GSRA 1F6MC 3QDNA 2DSAA 1GLPA 2WRTA 2G2QA 1XIYA 5INYA 1GUHA 1F37A 2IL3A 5IMZA 2MBSA 1EV9A 2OA7A 3BCKA 3APQA 4IJ3A 1E2YA 2EIQA 3E9JB 2C0DA 2MBTA 1TW9A 1SD9A 2YZUA 4RQXA 3WD6A 4NPBA 4PNFA 3F6DA 1OC9A 5CP1A 4GLTA 5F0GA 3C8EA 1GUMA 3L0HA 4KDUA 2OACA 2DC5A 4ISDA 4KW6A 4FH8A 1X5EA 4YKFA 4KSOA 3GH6A 5DQSA 1EEMA 4HU9A 1K0AA 3D21A 5D73A 1XZOA 5A4VA 1ST9A 3ZRDA 4DSQA 4HI7A 4HUAA 4HOJA 4O5RA 2HT9A 2BTOT 2HYXA 1NHYA 3MAKA 3H93A 5JCWA 2IFQA 1DE2A 1H75A 1JZRA 1Z3EA 5IM9A 2N5BA 4MZCA 2ON7A 3VLNA 1Z6NA 5DCGA 2GSQA 3MNGA 4ACSA 2VO4A 5IIZA 5KN0A 2VLTA 4TRXA 1SL1B 2RLIA 2K8VA 1TU7A 4XIHA 5JCUA 1BEDA 4NWYA 5FWGA 1U88A 2DBCA 1DUGA 4MNNA 2XC2A 1WJKA 2IMDA 4MABA 3QCPA 2IMEA 3GRXA 2H0HA 5HR0A 2AYTA 2VL9A 2FA8A 1O6JA 2LJAA 3KIJA 3M9JA 1UN2A 1GNWA 3I43A 3FY7A 1FVJA 2C4JA 2O8VB 3WYWA 2H30A 1X0RA 2OE0A 4JEDA 4TXOA 3ZIJA 3ERGA 2X64A 4P3YB 1YY7A 3DWVA 5C00A 5CRGA 3Q18A 4YQVA 5J41A 4TOPA 1CQHA 1ML6A 3C7MA 3SWLA 4WR5A 2HXKA 1YF0A 1EOGA 2PMTA 1RK4A 3IPZA 5HFIA 1GTUA 3TJBA 4NHWA 2B5XA 1S3DA 3A2WA 2V6KA 1FOHA 3VURA 3GNJA 2YANA 3D22A 2D2ZA 3LXTA 5EVOA 1F2EA 3TUEA 1KNGA 1PKWA 5ELGA 3L9SA 4O92A 5HFKA 6GSYA 1K3LA 3G7JA 3DVWA 4ML1A 3FW2A 4MH2A 6GSVA 4I8BA 4K7NA 4ULXA 4TR1B 4IQ1A 1XPVA 4V1Ap 3C73A 1MEKA 3M9KA 4Q5RA 3EU3A 2FLSA 2JADA 1H4OA 1RQMA 3HJMA 3FEUA 4L0UA 1GTBA 4WKWA 4EO3A 3KH9A 3HJPA 2VOCA 3CMIA 17GSA 1ZYEA 8GSSA 2MYGA 1ZYPA 2H6YA 1B4PA 1LJRA 3ZLPA 2OADA 2PN8A 3KTBA 4A5PA 1M3IA 2BMXA 2AUVA 3PPUA 2B3SA 1K3YA 2VCVA 5GZZB 2LV3A 1U3IA 4LLRA 4TR4A 5ECNB 2R5GA 4JR4A 2E2MA 4K5SA 3N9JA 2DJ2A 1QXHA 4XRDA 3GTUB 5JWQB 1UC7A 1FB0A 3F4SA 3QOUA 4V1Ag 1ZYNA 2GGTA 3EE2A 1ZL9A 3VPTA 1GTIA 5IPHA 2F8AA 3RAZA 4OMVA 2GVPA 3CTFA 4NV5A 2YOIA 4EC0A 4EDZA 5HFGA 3A5WA 3TB2A 1TU8A 3TJJA 1V9WA 3GSTA 2AV4A 2V1MA 1QQ2A 4J57E 2GS3A 2V32A 4IP1A 4MZBA 3GH9A 5ECHB 22GSA 1K0MA 3HXSA 4F0BA 3IC4A 1NW2A 1TTZA 3VWVA 2V2GA 2V41A 2E7PA 2GQLA 4AGSA 1GSEA 1A2MA 5ECRB 2MZCA 4JZQA 2QA1A 5LCZA 4HEA2 3ZTLA 1YEXA 1XFLA 2B1LA 2JU5A 3CSHA 4LL1B 5GAPD 4O32A 2R0PA 1PKZA 3RBTA 6GSTA 4TW5A 2X4AA 2CVKA 2P0GA 5DJLA 1XWGA 1M7TA 5DDLA 5B7CA 2G0FA 3GUSA 3MIXA 2QKEA 1K0DA 5BMUA 3GV1A 1BJXA 3FZ9A 4MDCA 2OJLA 2QSIA 1T1VA 4MA9A 1K3OA 2YJ7A 1YJ6A 5IOWA 4XS1A 1S3RA 2C3NA 5GSTA 2I81A 3F3RA 4PGTA 4ZXGA 4YQUA 2PVOC 5J9BA 3TJFA 1PSQA 1PD21 3BJ5A 4GTUA 2HSHA 1V57A 2FGXA 4KF9A 3EYTA 2CVDA 1M9BA 1PQNA 5ABRA 4N11A 1F3AA 2YCDA 3TKSA 2R2JA 2J9HA 1T4ZA 3M0FA 3FYGA 4N10A 2H66A 2C3QA 3KCMA 2YZHA 2HRFA 2I9HA 3ZL5A 1G0TA 3VWXA 4K0NA 3TDGA 5J5NA 4HDEA 4FYUA 3HYPA 4MF6A 4TR1A 4ZILA 2PU9C 3ZFBA 1SKSB 5CRWA 2H1AA 2H75A 1XWAA 2IFQB 3PR8A 4EUYA 3VFIA 1UA5A 2C0FA 2B7JA 3WT2A 3US3A 2NBSA 3F4TA 1EP8A 2GT6A 1O81A 2RIIA 2ES7A 2F51A 3HA9A 1T00A 4G2EA 1B9YC 5DALB 2C1YA 1Z7RA 4OD7A 1C72A 1XXUA 4KDXA 1KBNA 3KTLA 3HVVA 1ILOA 4IN0A 3SBCA 1GLQA 3KMOA 2KHPA 4WEYA 1GWCA 3RDWA 2LUSA 1VF3A 1EV4A 4OO5A 2O89A 5GAND 5F05A 4HJ2A 4WBJA 3IA1A 3BCIA 4F03A 1HNBA 3ED3A 2LNTA 4V2MA 5L71A 3DVXA 2XHFA 2HSYA 1DBYA 1XW5A 2VLUA 5IMFA 5B6MA 3I9V2 1MDIA 1SYRA 5D9XA 3KZQA 3JCML 4DVCA 4K8MA 4TXOB 4L5OA 4JU5A 4IBPA 3CBUA 1BG5A 3GKMA 1GSQA 2VL2A 1U87A 1NM3A 1PN9A 3D5JA 4KA0A 3QAVA 3TKQA 1K0NA 2WZ9A 1BQ7A 5C04A 5JWOB 3DYRA 4DSRA 6GSWA 4IHUA 1EWXA 4XRAA 1SJIA 4PX1A 4V2NA 1AQVA 3MDKA 4E8EA 4KAEA 4V2LA 2HFDA 1XWKA 2PGTA 3E3EA 1X9SB 2A4VA 3QPMA 1GP1A 4GSTA 1MD4A 1JZWA 1O85A 3ZMKA 4NMUA 4EKZA 1SJ6A 3D4MA 2OBKA 3VI5A 3UJ1A 2VCZA 2FY6A 1A8YA 2VUPA 4POKA 2YPMA 1XG8A 1M99A 2A2RA 2VCTA 4AJ7A 1G7EA 3LORA 3FRCA 5AIXA 4PURA 1MTCA 2N5FA 4RI7A 3HDCA 5IMAA 4GCIA 1X5DA 4TVEA 4ZBAA 1XVQA 12GSA 3KD0A 4ZBBA 1ZZYA 5ECSA 18GSA 4RI6A 2HE3A 1TP9A 1B4QA 4MPFA 1HNAA 2RUEA 3CRUA 5IPGA 1OC8A 3PH9A 1AXDA 2R4VA 2C8UA 4WXTA 4JR6A 1XW9A 3IHGA 1XWCA 1THOA 4JE1A 5G1LA 1PN0A 1V98A 1JHBA 4LMVA 3ZREA 1EGRA 4HZ2A 2C80A 4PXOA 4USSA 4JBBA 4J2FA 1OVNA 2WGRA 4ECCA 4OWYA 4GQCA 1AQXA 3F0IA 4MLYA 5GSSA 3TKRA 4ILFA 1NHOA 2LRNA 1HNCA 5EY6A 4X4JA 2MMZA 3F9UA 4ZL8A 4TR0A 2DJ3A 2CT6A 2XBIA 3L78A 2K6VA 5DALA 4ICYA 2NVLA 4Z2UA 4O5QA 3HVNA 4ZL7A 6GSSA 1Z6MA 4GXZA 1GSUA 1UVZA 4KCAA 2FHEA 4IVFA 2GZPA 2GT5A 3IK7A 4ZL9A 5DAKA 1GSDA 16GSA 3I6AA 4ZB6A 2FNOA 4KNDA 3FR6A 2CAQA 2PVQA 3TKSC 4XS4B 3GA4A 2QGVA 1M2DA 3EURA 2VM2A 3GURA 4PQ1A 1EGOA 3H79A 4OO4A 5G5FA 2MMNA 3UL3A 2X99A 4KDYA 5H5QA 3RHBA 4DEJA 2HZEB 4PQHA 3NOFA 4G10A 1AQWA 4E8HA 4EF0A 2VLVA 1PFOA 3CQFA 2FWEA 1MD3A 2DJ0A 3FZ4A 1WE0A 1ERVA 4HU7A 3M1GA 2RM5A 2L5LA 2RM6A 3C1RA 3HZ8A 5HR2A 1GNEA 2LTKA 2TRXA 2TIRA 2CX3A 3CSJA 3LWAA 3C71A 1SK0A 1CQGA 2CV4A 1A2LA 2L59A 2B7KA 3G7IA 4YAPA 5ECOB 4ID0A 2KLXA 2HNLA 3GFKA 3DD3A 5BRTA 4K0GA 2H1GA 5FHIA 2H74A 2XBQA 3HKRA 4F9ZA 4CDOA 5ID2A 3LG6A 5J4UA 2H6XA 5KOXA 3GHAA 2M46A 4KCEA 4MCUA 3CYNA 1Y25A 2OBIA 2REMA 4G0KA 3FHKA 2VL2C 2X8CA 3L9VA 1B9XC 2JZTA 1AIUA 3IHQA 2GLRA 4IP6A 2IN3A 1BX9A 5J9CA 3EU4A 4CY6A 3LSZA 1TXXA 3L4NA 4K7OA 2X49A 3GIXA 3DKSA 5DQYA 1XOBA 1GL8A 3Q74A 3A5IA 3TJKA 3TRQA 4K6XA 2AB6A 4I97A 2O85A 2PPTA 5ECQB 2WJUA 2FA4A 1G7OA 2JL4A 2B5YA 1PL2A 2L4QA 4HS1A 5F07A 3HVSA 1GH2A 1JLVA 1HD2A 4K7IA 2F9SA 2YP6A 3M8NA 2K8SA 3VWWA 1SK2A 2FWHA 3C1SA 5CRDA 3DIEA 4ZB9A 2F8FA 3WT1A 1R4WA 2M80A 1TK8B 3F4RA 2LSTA 1VRSD 3TGZA 4F2IA 2CX4A 3R3EA 3GKNA 5D93A 2H0IA 3W8JA 5IO0A 4KSMA 5AN1A 4IGJA 4X1UA 5HQPA 1PA3A 4XS4A 3ZITA 4FIWA 3QMXA 2K9FA 2DMLA 4AF2A 4OFTA 1U3AA 2PERA 3IC8A 2IIYA 4NXIA 5IOXA 3NZNA 2LQOA 6GSXA 5CO3A 1Z7PA 2HZEA 1Q98A 1O73A 3ZYWA 5CAXA 1SKRB 2DKIA 5DCHA 3APSA 2FUG2 3WGDA 3RHCA 1Y6EA 5J3RA 3GX0A 2CVBA 2VD1A 2LEGA 4YAVA 2L6CA 2I4AA 5KN3A 2R37A 3KMNA 1G6WA 1FHEA 2KUCA 4IELA 3S9FA 1TK5B 3A2VA 1THXA 2YWIA 4POBA 4RQRA 6GSUA 1E6BA 1FB6A 1YEPA 2H72A 2VM1A 2ON5A 3KXOA 3UMAA 2I1UA 1GTAA 3EC3A 5KN1A 3GKKA 1YKAA 2EC4A 2LRTA 3TRXA 2UZ8A 4YKGA 2J23A 4EXJA 3G7YA 2WCIA 3ISOA 2H8LA 4G0IA 2H71A 2DKHA 2V6OA 1Z5YE 5COHA 3IOSA 1AUCA 3QFAC 2EIOA 1ERWA 3J7Yk 1JLWA 4KUNA 1X5CA 3VWUA 3D0ZA 2CZ3A 3UVTA 2XPDA 4HZ4A 2VIMA 5EPFA 1ZYQB 11GSA 1SL0B 1W89A 1J08A 1X9WB 1WPIA 2EIRA 1AW9A 4AJ6A 3DEXA 3IAS2 2YWNA 3FK8A 1R7HA 3PGTA 1QGVA 5ECIB 4F0CA 4OCFA 3KEBA 2X8HA 2KP1A 1JFUA 5IQYA 3BOAA 4ECJA 4BVXB 3ME7A 1G6YA 4Z2TA 1R5PA 13GSA 2X8GA 3UBKA 4YH2A 4KB3A 4IJIA 1EEJA 3AY8A 5DAKB 4G19A 4WETA 3ERFA 4KGIA 4N0ZA 3LXZA 5CREA 1SL2B 3D6IA 1AAZA 2BJXA 3I69A 4TKYA 4K9ZA 4ML6A 3GSSA 9GSSA 2LS5A 1PX6A 3D4TA 1B8XA 2H76A 3FKFA 4I2UA 4QL7A 4BL7B 3CTGA 4EIQA 2NDOA 1SKWB 2B1KA 1QFNA 1TOFA 4Q5QA 4J56E 3K8NA 4NHZA 3KGKA 1OAZA 1A0RP 3LQ7A 1WOUA 2YWMA 2DLXA 5A5KA 4EVMA 4O7HA 1GULA 2GDRA 4BPYA 1FO5A 5G5EA 4KX4A 4GQFA 2NPBA 5G1KA 4LMWA 4FYBA 4F82A 1YDKA 2ALBA 2CQ9A 4GRFA 3ZZXA 5D8IA 2IMKA 3DMLA 4K1FA 2NTOA 4OCEA 5D9TA 2RUFA 1XBSA 3U6VA 2LRCA 2O7KA 5ID2B 2HRAA 5AGYA 5E4WA 5IMDA 3LFLA 3KP8A 1M3JA 1O8WA 1O8XA 2OE1A 2HRKA 3GMFA 2E2GA 2LJRA 4TN8A 2WB9A 3L9UA 4X0XA 3E0UA 3ZFLA 2HI7A 2I3YA 4IKHA 2C0GA 3UAPA 4MPGA 4WF5A 1VF2A 1TDIA 2FWGA 4MJBA 2H19A 5JWRB 5D96A 3H8QA 2YJHA 3BD2A 1KTEA 3F3QA 1YQ1A 2MMOA 2L4CA 2GSSA 1BAYA 1NSWA 2GZZA 1FG4A 4XCSA 2TRCP 4MP4A 2DIYA 5H5RA 2H1BA 2IPAA 2H1DA 2ZCTA 4EE0A 3DGQA 3LYKA 4Q5FA 5H5SA 3TJGA 5AIVA 2B6MA 2L6DA 3GL5A 1ZGNA 4N30A 3FR9A 1EZKA 1BYEA 1U6TA 2R0GA 4PUAA 4MZWA 4QL9A 1X9MB 3LW9A 3ME8A 3H4KA 3ZVJA 4BVXA 3EINA 5E59A 1XCCA 1FOVA 4HQZA 2IJYA 4EL1A 4MJEA 3UIWA 2H0GA 5G2ZA 3QAWA 4D73B 3EMXA 4PTSA 1N2AA 1IYIA 3HZ4A 1TRSA 4MJAA 3APOA 4DSSA 3O6TA 5G31A 2VCWA 3IXRA 4ECIA 2A4HA 3WGXA 3MWHA 1LBKA 1SJZA 1QK8A 2O87A 1W4VA 2R6KA 3MSZA 4WR4A 1WP0A 3IK9A 2VAFA 5ECLB 2LJKA 2IMIA 4BVYA 4HSCX 4BL7A 2HLSA 2AJQB 1XVWA 4FQUA 5AISA 5IO2A 1HQOA 1FVKA 3P8WA 4IS0A 2JZRA 2WS2A 1GUKA 1TRWA 4MF7A 3IDVA 3VK9A 1URMA 1WWJA 1TKDB 5D9WA 2GZYA 3F8UA 2HRNA 3LYPA 1XWBA 3M3MA 4ZIJA 1RW1A 3VPQA 5ECKB 1TI1A 3P2AA 3Q19A 1S3AA 2DIZA 1ERTA 5JCGA 19GSA 4GSNA
chains in the Genus database with same CATH topology
1TRUA 3P90A 1PGTA 5CYYA 5A4WA 1V2AA 1GSYA 14GSA 1KEBA 2GTUA 1TI3A 5LD0A 1ABAA 1SYXA 4MF5A 3F63A 4HJMA 3KJYA 4CW9A 3R2QA 1VF1A 4I5QA 1ZMAA 1F3BA 4EIPA 5B8BA 3W6GA 2CA8A 5FT3A 4PNGA 5ECPB 3OR5A 4XHMA 3GKXA 3HCZA 7GSSA 2WDUA 4X43A 3PINA 3HD5A 1OC3A 4Z2RA 5IMVA 3ERWA 1PL1A 3TRPA 1A23A 4FYCA 3TOUA 4XTSA 5CRHA 5DBQA 2L57A 2DJJA 3HJOA 5EL8A 2OE3A 3QFBC 3KH7A 3W8SA 5D9VA 5ELAA 3HVXA 1A8LA 4OFMA 4O5UA 3WGEA 3GYKA 3J7Yb 2B5EA 4POLA 3LEFA 1QUWA 3QAGA 4AJ8A 4BA7A 5HR1A 5B6NA 1T3BA 2FCHA 3LGCA 5ENUA 4G0LA 4K5RA 4MJCA 1O7UA 2H6ZA 1A0FA 1OYJA 5G30A 1FAAA 4FO5A 1J0FA 1Z9HA 2YNXA 2GQMA 4POMA 1T8EB 3Q6OA 3ZIVA 2AHEA 1Q4JA 5ECMB 1F9MA 1S3CA 1T4YA 3MYDA 2JACA 3TKPA 3GL3A 2VCQA 5HR3A 4ZB8A 4BWSA 3FZAA 5B8AA 4KH7A 1SU9A 1YKCA 2K18A 4D73A 2WULA 1GSFA 1YZXA 1VGLA 2PUKC 1JZOA 2YV7A 4I2TA 5IMCA 1SENA 1N8JA 3P7XA 2OKAA 4XS6A 2P31A 1MDKA 2CZ2A 3IE3A 4Q5NA 1M0UA 5DVBA 4EDYA 2KOKA 3HY2A 5DJMA 4CY8A 3EMPA 3O3TA 4MH3A 2VCXA 3IRAA 4NAXA 2LNSA 1OKTA 20GSA 4GF0A 4LL4B 1A24A 3RPNA 1ERUA 4YQMA 1HYUA 2PBJA 2A2SA 4QQ7A 3EWLA 4PUFC 2QA2A 3FMWA 4OFNA 1DE1A 2VD0A 2YV9A 2HSMA 10GSA 1PMTA 3QR6A 1IYHA 3KP9A 2YN1A 3IBHA 4IW9A 1I5GA 2HZFA 2A2PA 3RPPA 3UVHA 1LU4A 3A3TA 2IWTA 4L0WA 1FW1A 3KM6A 1R26A 1ZOFA 3IAM2 3LJRA 1ON4A 5CNWA 2M72A 3ZVJD 2C0EA 2YWOA 3ZMLA 2P5RA 4ZBDA 3CXGA 4TR3A 4BWQA 3IV4A 2H73A 1ACVA 1PX7A 1EP7A 4G9HA 1MDJA 1WMJA 1DSBA 3TCOA 2AAWA 1XOAA 1YF1A 3GN3A 1OC9B 1OE7A 2JZSA 3UBLA 4GWRA 4MMMA 5F8BA 4IQAA 5KOWA 3N5OA 3DXBA 5A4UA 2FD3A 3F6FA 4K2XA 1K0BA 2N5AA 3NIVA 3FR3A 1EOHA 4LA1A 4K2DA 1WRYA 2E0QA 4MK3A 5LNKe 4L8EA 2CAIA 2MMAA 1SK1A 1OKDA 4GSSA 3O76A 3QD9A 4NV2A 4CHSA 1R5AA 2GQKA 2DJKA 1WIKA 4ECBA 1M2AA 1JZDA 1I9DA 1TK0B 2KP2A 1OE8A 5F06A 4I6XA 3TOTA 2H70A 2XPEA 2VL3A 4DSSB 3G9BA 3DRNA 2ZNMA 1M2BA 3GTUA 1K0OA 1TRVA 2WFCA 4Z7XA 2P5QA 3FZ5A 1B48A 1USBA 4BVYB 2LQQA 1K0CA 2R3XA 2F3MA 4L5LA 1SD8A 1QMVA 2GSTA 3UOMA 1GRXA 3CSIA 3H1NA 1T7PB 3TKSE 4HQSA 3EVIA 4N0VA 1PRXA 2DMMA 2JSZA 1M9AA 3V1WA 3IR4A 3HHVA 4KE3A 2R0CA 2QC7A 4RUVA 4TXVA 3EPTA 2C3TA 3VI7A 2IMFA 3UARA 3UEMA 5KN2A 1J9BA 1VF4A 3CRTA 4H86A 2H01A 2FWFA 4WF4A 2ZUPA 1XW6A 3GX8A 5KEJA 1V58A 2L5OA 3BBYA 4PQIA 3U5RE 1AC1A 2DJ1A 4WBRD 2JSYA 1GSSA 2PWJA 2LKUA 1A2JA 1ZCPA 4JRRA 1V40A 1TJDA 2Z9SA 3A2XA 2GSRA 1F6MC 3QDNA 2DSAA 1GLPA 2WRTA 2G2QA 1XIYA 5INYA 1GUHA 1F37A 2IL3A 5IMZA 2MBSA 1EV9A 2OA7A 3BCKA 3APQA 4IJ3A 1E2YA 2EIQA 3E9JB 2C0DA 2MBTA 1TW9A 1SD9A 2YZUA 4RQXA 3WD6A 4NPBA 4PNFA 3F6DA 1OC9A 5CP1A 4GLTA 5F0GA 3C8EA 1GUMA 3L0HA 4KDUA 2OACA 2DC5A 4ISDA 4KW6A 4FH8A 1X5EA 4YKFA 4KSOA 3GH6A 5DQSA 1EEMA 4HU9A 1K0AA 3D21A 5D73A 1XZOA 5A4VA 1ST9A 3ZRDA 4DSQA 4HI7A 4HUAA 4HOJA 4O5RA 2HT9A 2BTOT 2HYXA 1NHYA 3MAKA 3H93A 5JCWA 2IFQA 1DE2A 1H75A 1JZRA 1Z3EA 5IM9A 2N5BA 4MZCA 2ON7A 3VLNA 1Z6NA 5DCGA 2GSQA 3MNGA 4ACSA 2VO4A 5IIZA 5KN0A 2VLTA 4TRXA 1SL1B 2RLIA 2K8VA 1TU7A 4XIHA 5JCUA 1BEDA 4NWYA 5FWGA 1U88A 2DBCA 1DUGA 4MNNA 2XC2A 1WJKA 2IMDA 4MABA 3QCPA 2IMEA 3GRXA 2H0HA 5HR0A 2AYTA 2VL9A 2FA8A 1O6JA 2LJAA 3KIJA 3M9JA 1UN2A 1GNWA 3I43A 3FY7A 1FVJA 2C4JA 2O8VB 3WYWA 2H30A 1X0RA 2OE0A 4JEDA 4TXOA 3ZIJA 3ERGA 2X64A 4P3YB 1YY7A 3DWVA 5C00A 5CRGA 3Q18A 4YQVA 5J41A 4TOPA 1CQHA 1ML6A 3C7MA 3SWLA 4WR5A 2HXKA 1YF0A 1EOGA 2PMTA 1RK4A 3IPZA 5HFIA 1GTUA 3TJBA 4NHWA 2B5XA 1S3DA 3A2WA 2V6KA 1FOHA 3VURA 3GNJA 2YANA 3D22A 2D2ZA 3LXTA 5EVOA 1F2EA 3TUEA 1KNGA 1PKWA 5ELGA 3L9SA 4O92A 5HFKA 6GSYA 1K3LA 3G7JA 3DVWA 4ML1A 3FW2A 4MH2A 6GSVA 4I8BA 4K7NA 4ULXA 4TR1B 4IQ1A 1XPVA 4V1Ap 3C73A 1MEKA 3M9KA 4Q5RA 3EU3A 2FLSA 2JADA 1H4OA 1RQMA 3HJMA 3FEUA 4L0UA 1GTBA 4WKWA 4EO3A 3KH9A 3HJPA 2VOCA 3CMIA 17GSA 1ZYEA 8GSSA 2MYGA 1ZYPA 2H6YA 1B4PA 1LJRA 3ZLPA 2OADA 2PN8A 3KTBA 4A5PA 2BMXA 2AUVA 3PPUA 2B3SA 1K3YA 2VCVA 5GZZB 2LV3A 1U3IA 4LLRA 4TR4A 5ECNB 2R5GA 4JR4A 2E2MA 4K5SA 3N9JA 2DJ2A 1QXHA 4XRDA 3GTUB 5JWQB 1UC7A 1FB0A 3F4SA 3QOUA 4V1Ag 1ZYNA 2GGTA 3EE2A 1ZL9A 3VPTA 1GTIA 5IPHA 2F8AA 3RAZA 4OMVA 2GVPA 3CTFA 4NV5A 2YOIA 4EC0A 4EDZA 5HFGA 3A5WA 3TB2A 1TU8A 3TJJA 1V9WA 3GSTA 2AV4A 2V1MA 1QQ2A 4J57E 2GS3A 2V32A 4IP1A 4MZBA 3GH9A 5ECHB 22GSA 1K0MA 3HXSA 4F0BA 3IC4A 1NW2A 1TTZA 3VWVA 2V2GA 2V41A 2E7PA 2GQLA 4AGSA 1GSEA 1A2MA 5ECRB 2MZCA 4JZQA 2QA1A 5LCZA 4HEA2 3ZTLA 1YEXA 1XFLA 2B1LA 2JU5A 3CSHA 4LL1B 5GAPD 4O32A 2R0PA 1PKZA 3RBTA 6GSTA 4TW5A 2X4AA 2CVKA 2P0GA 5DJLA 1XWGA 1M7TA 5DDLA 5B7CA 2G0FA 3GUSA 3MIXA 2QKEA 1K0DA 5BMUA 3GV1A 1BJXA 3FZ9A 4MDCA 2OJLA 2QSIA 1T1VA 4MA9A 1K3OA 2YJ7A 1YJ6A 5IOWA 4XS1A 2C3NA 5GSTA 2I81A 3F3RA 4PGTA 4ZXGA 4YQUA 2PVOC 5J9BA 3TJFA 1PSQA 1PD21 3BJ5A 4GTUA 2HSHA 1V57A 2FGXA 4KF9A 3EYTA 2CVDA 1M9BA 1PQNA 5ABRA 4N11A 1F3AA 2YCDA 3TKSA 2R2JA 2J9HA 1T4ZA 3M0FA 3FYGA 4N10A 2H66A 2C3QA 3KCMA 2YZHA 2HRFA 2I9HA 3ZL5A 1G0TA 3VWXA 4K0NA 3TDGA 5J5NA 4HDEA 4FYUA 3HYPA 4MF6A 4TR1A 4ZILA 2PU9C 3ZFBA 1SKSB 5CRWA 2H1AA 2H75A 1XWAA 2IFQB 3PR8A 4EUYA 3VFIA 1UA5A 2C0FA 2B7JA 3WT2A 3US3A 2NBSA 3F4TA 1EP8A 2GT6A 1O81A 2RIIA 2ES7A 2F51A 3HA9A 1T00A 4G2EA 1B9YC 5DALB 2C1YA 1Z7RA 4OD7A 1C72A 1XXUA 4KDXA 1KBNA 3KTLA 3HVVA 1ILOA 4IN0A 3SBCA 1GLQA 3KMOA 2KHPA 4WEYA 1GWCA 3RDWA 2LUSA 1VF3A 1EV4A 4OO5A 2O89A 5GAND 5F05A 4HJ2A 4WBJA 3IA1A 3BCIA 4F03A 1HNBA 3ED3A 2LNTA 4V2MA 5L71A 3DVXA 2XHFA 2HSYA 1DBYA 1XW5A 2VLUA 5IMFA 5B6MA 3I9V2 1MDIA 1SYRA 5D9XA 3KZQA 3JCML 4DVCA 4K8MA 4TXOB 4L5OA 4JU5A 4IBPA 3CBUA 1BG5A 3GKMA 1GSQA 2VL2A 1U87A 1NM3A 1PN9A 3D5JA 4KA0A 3QAVA 3TKQA 1K0NA 2WZ9A 1BQ7A 5C04A 5JWOB 3DYRA 4DSRA 6GSWA 4IHUA 1EWXA 4XRAA 1SJIA 4PX1A 4V2NA 1AQVA 3MDKA 4E8EA 4KAEA 4V2LA 2HFDA 1XWKA 2PGTA 3E3EA 1X9SB 2A4VA 3QPMA 1GP1A 4GSTA 1MD4A 1JZWA 1O85A 3ZMKA 4NMUA 4EKZA 1SJ6A 3D4MA 2OBKA 3VI5A 3UJ1A 2VCZA 2FY6A 1A8YA 2VUPA 4POKA 2YPMA 1M99A 2A2RA 2VCTA 4AJ7A 1G7EA 3LORA 3FRCA 5AIXA 4PURA 1MTCA 2N5FA 4RI7A 3HDCA 5IMAA 4GCIA 1X5DA 4TVEA 4ZBAA 1XVQA 12GSA 3KD0A 4ZBBA 1ZZYA 5ECSA 18GSA 4RI6A 2HE3A 1TP9A 1B4QA 4MPFA 1HNAA 2RUEA 3CRUA 5IPGA 1OC8A 3PH9A 1AXDA 2R4VA 2C8UA 4WXTA 4JR6A 1XW9A 3IHGA 1XWCA 1THOA 4JE1A 5G1LA 1PN0A 1V98A 1JHBA 4LMVA 3ZREA 1EGRA 4HZ2A 2C80A 4PXOA 4USSA 4JBBA 4J2FA 1OVNA 2WGRA 4ECCA 4OWYA 4GQCA 1AQXA 3F0IA 4MLYA 5GSSA 3TKRA 4ILFA 1NHOA 2LRNA 1HNCA 5EY6A 4X4JA 2MMZA 3F9UA 4ZL8A 4TR0A 2DJ3A 2CT6A 2XBIA 3L78A 2K6VA 5DALA 4ICYA 2NVLA 4Z2UA 4O5QA 4ZL7A 6GSSA 1Z6MA 4GXZA 1GSUA 1UVZA 4KCAA 2FHEA 4IVFA 2GZPA 2GT5A 3IK7A 4ZL9A 5DAKA 1GSDA 16GSA 3I6AA 4ZB6A 2FNOA 4KNDA 3FR6A 2CAQA 2PVQA 3TKSC 4XS4B 3GA4A 2QGVA 1M2DA 3EURA 2VM2A 3GURA 4PQ1A 1EGOA 3H79A 4OO4A 5G5FA 2MMNA 3UL3A 2X99A 4KDYA 5H5QA 3RHBA 4DEJA 2HZEB 4PQHA 3NOFA 4G10A 1AQWA 4E8HA 4EF0A 2VLVA 2FWEA 1MD3A 2DJ0A 3FZ4A 1WE0A 1ERVA 4HU7A 3M1GA 2RM5A 2L5LA 2RM6A 3C1RA 3HZ8A 5HR2A 1GNEA 2LTKA 2TRXA 2TIRA 2CX3A 3CSJA 3LWAA 3C71A 1SK0A 1CQGA 2CV4A 1A2LA 2L59A 2B7KA 3G7IA 4YAPA 5ECOB 4ID0A 2KLXA 2HNLA 3GFKA 3DD3A 5BRTA 4K0GA 2H1GA 5FHIA 2H74A 2XBQA 3HKRA 4F9ZA 4CDOA 5ID2A 3LG6A 5J4UA 2H6XA 5KOXA 3GHAA 2M46A 4KCEA 4MCUA 3CYNA 1Y25A 2OBIA 2REMA 4G0KA 3FHKA 2VL2C 2X8CA 3L9VA 1B9XC 2JZTA 1AIUA 3IHQA 2GLRA 4IP6A 2IN3A 1BX9A 5J9CA 3EU4A 4CY6A 3LSZA 1TXXA 3L4NA 4K7OA 2X49A 3GIXA 3DKSA 5DQYA 1XOBA 1GL8A 3Q74A 3A5IA 3TJKA 3TRQA 4K6XA 2AB6A 4I97A 2O85A 2PPTA 5ECQB 2WJUA 2FA4A 1G7OA 2JL4A 2B5YA 1PL2A 2L4QA 4HS1A 5F07A 3HVSA 1GH2A 1JLVA 1HD2A 4K7IA 2F9SA 2YP6A 3M8NA 2K8SA 3VWWA 1SK2A 2FWHA 3C1SA 5CRDA 3DIEA 4ZB9A 2F8FA 3WT1A 1R4WA 2M80A 1TK8B 3F4RA 2LSTA 1VRSD 3TGZA 4F2IA 2CX4A 3R3EA 3GKNA 5D93A 2H0IA 3W8JA 5IO0A 4KSMA 5AN1A 4IGJA 4X1UA 5HQPA 1PA3A 4XS4A 3ZITA 4FIWA 3QMXA 2K9FA 2DMLA 4AF2A 4OFTA 1U3AA 2PERA 3IC8A 2IIYA 4NXIA 5IOXA 3NZNA 2LQOA 6GSXA 5CO3A 1Z7PA 2HZEA 1Q98A 1O73A 3ZYWA 5CAXA 1SKRB 2DKIA 5DCHA 3APSA 2FUG2 3WGDA 3RHCA 1Y6EA 5J3RA 3GX0A 2CVBA 2VD1A 2LEGA 4YAVA 2L6CA 2I4AA 5KN3A 2R37A 3KMNA 1G6WA 1FHEA 2KUCA 4IELA 3S9FA 1TK5B 3A2VA 1THXA 2YWIA 4POBA 4RQRA 6GSUA 1E6BA 1FB6A 1YEPA 2H72A 2VM1A 2ON5A 3KXOA 3UMAA 2I1UA 1GTAA 3EC3A 5KN1A 3GKKA 1YKAA 2EC4A 2LRTA 3TRXA 2UZ8A 4YKGA 2J23A 4EXJA 3G7YA 2WCIA 3ISOA 2H8LA 4G0IA 2H71A 2DKHA 2V6OA 1Z5YE 5COHA 3IOSA 1AUCA 3QFAC 2EIOA 1ERWA 3J7Yk 1JLWA 4KUNA 1X5CA 3VWUA 3D0ZA 2CZ3A 3UVTA 2XPDA 4HZ4A 2VIMA 5EPFA 1ZYQB 11GSA 1SL0B 1W89A 1J08A 1X9WB 1WPIA 2EIRA 1AW9A 4AJ6A 3DEXA 3IAS2 2YWNA 3FK8A 1R7HA 3PGTA 1QGVA 5ECIB 4F0CA 4OCFA 3KEBA 2X8HA 2KP1A 1JFUA 5IQYA 3BOAA 4ECJA 4BVXB 3ME7A 1G6YA 4Z2TA 1R5PA 13GSA 2X8GA 3UBKA 4YH2A 4KB3A 4IJIA 1EEJA 3AY8A 5DAKB 4G19A 4WETA 3ERFA 4KGIA 4N0ZA 3LXZA 5CREA 1SL2B 3D6IA 1AAZA 2BJXA 3I69A 4TKYA 4K9ZA 4ML6A 3GSSA 9GSSA 2LS5A 1PX6A 3D4TA 1B8XA 2H76A 3FKFA 4I2UA 4QL7A 4BL7B 3CTGA 4EIQA 2NDOA 1SKWB 2B1KA 1QFNA 1TOFA 4Q5QA 4J56E 3K8NA 4NHZA 3KGKA 1OAZA 1A0RP 3LQ7A 1WOUA 2YWMA 2DLXA 5A5KA 4EVMA 4O7HA 1GULA 2GDRA 4BPYA 1FO5A 5G5EA 4KX4A 4GQFA 2NPBA 5G1KA 4LMWA 4FYBA 4F82A 1YDKA 2ALBA 2CQ9A 4GRFA 3ZZXA 5D8IA 2IMKA 3DMLA 4K1FA 2NTOA 4OCEA 5D9TA 2RUFA 1XBSA 3U6VA 2LRCA 2O7KA 5ID2B 2HRAA 5AGYA 5E4WA 5IMDA 3LFLA 3KP8A 1O8WA 1O8XA 2OE1A 2HRKA 3GMFA 2E2GA 2LJRA 4TN8A 2WB9A 3L9UA 4X0XA 3E0UA 3ZFLA 2HI7A 2I3YA 4IKHA 2C0GA 3UAPA 4MPGA 4WF5A 1VF2A 1TDIA 2FWGA 4MJBA 2H19A 5JWRB 5D96A 3H8QA 2YJHA 3BD2A 1KTEA 3F3QA 1YQ1A 2MMOA 2L4CA 2GSSA 1BAYA 1NSWA 2GZZA 1FG4A 4XCSA 2TRCP 4MP4A 2DIYA 5H5RA 2H1BA 2IPAA 2H1DA 2ZCTA 4EE0A 3DGQA 3LYKA 4Q5FA 5H5SA 3TJGA 5AIVA 2B6MA 2L6DA 3GL5A 1ZGNA 4N30A 3FR9A 1EZKA 1BYEA 1U6TA 2R0GA 4PUAA 4MZWA 4QL9A 1X9MB 3LW9A 3ME8A 3H4KA 3ZVJA 4BVXA 3EINA 5E59A 1XCCA 1FOVA 4HQZA 2IJYA 4EL1A 4MJEA 3UIWA 2H0GA 5G2ZA 3QAWA 4D73B 3EMXA 4PTSA 1N2AA 1IYIA 3HZ4A 1TRSA 4MJAA 3APOA 4DSSA 3O6TA 5G31A 2VCWA 3IXRA 4ECIA 2A4HA 3WGXA 3MWHA 1LBKA 1SJZA 1QK8A 2O87A 1W4VA 2R6KA 3MSZA 4WR4A 1WP0A 3IK9A 2VAFA 5ECLB 2LJKA 2IMIA 4BVYA 2AJQB 4BL7A 2HLSA 1XVWA 4FQUA 5AISA 5IO2A 1HQOA 1FVKA 3P8WA 4IS0A 2JZRA 2WS2A 1GUKA 1TRWA 4MF7A 3IDVA 3VK9A 1URMA 1WWJA 1TKDB 5D9WA 2GZYA 3F8UA 2HRNA 3LYPA 1XWBA 3M3MA 4ZIJA 1RW1A 3VPQA 5ECKB 1TI1A 3P2AA 3Q19A 1S3AA 2DIZA 1ERTA 5JCGA 19GSA 4GSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TRU A;  3P90 A;  1PGT A;  5CYY A;  5A4W A;  1V2A A;  1GSY A;  14GS A;  1KEB A;  2GTU A;  1TI3 A;  5LD0 A;  1ABA A;  1SYX A;  4MF5 A;  3F63 A;  4HJM A;  3KJY A;  4CW9 A;  3R2Q A;  1VF1 A;  4I5Q A;  1ZMA A;  1F3B A;  5B8B A;  3W6G A;  2CA8 A;  5FT3 A;  4PNG A;  5ECP B;  3OR5 A;  4XHM A;  3GKX A;  3HCZ A;  7GSS A;  2WDU A;  4X43 A;  3PIN A;  3HD5 A;  1OC3 A;  5IMV A;  3ERW A;  1PL1 A;  3TRP A;  1A23 A;  4FYC A;  3TOU A;  4XTS A;  5CRH A;  5DBQ A;  2L57 A;  2DJJ A;  3HJO A;  5EL8 A;  2OE3 A;  3QFB C;  3KH7 A;  3W8S A;  5D9V A;  5ELA A;  3HVX A;  1A8L A;  4OFM A;  3WGE A;  3GYK A;  3J7Y b;  2B5E A;  4POL A;  3LEF A;  1QUW A;  3QAG A;  4AJ8 A;  4BA7 A;  5HR1 A;  5B6N A;  1T3B A;  2FCH A;  3LGC A;  5ENU A;  4MJC A;  1O7U A;  2H6Z A;  1A0F A;  1OYJ A;  5G30 A;  1FAA A;  4FO5 A;  1J0F A;  1Z9H A;  2YNX A;  2GQM A;  4POM A;  1T8E B;  3Q6O A;  3ZIV A;  2AHE A;  1Q4J A;  5ECM B;  1F9M A;  1S3C A;  1T4Y A;  2JAC A;  3TKP A;  3GL3 A;  2VCQ A;  5HR3 A;  4ZB8 A;  4BWS A;  3FZA A;  5B8A A;  4KH7 A;  1SU9 A;  1YKC A;  2K18 A;  4D73 A;  2WUL A;  1GSF A;  1YZX A;  1VGL A;  2PUK C;  1JZO A;  2YV7 A;  4I2T A;  5IMC A;  1SEN A;  1N8J A;  3P7X A;  2OKA A;  4XS6 A;  2P31 A;  1MDK A;  2CZ2 A;  3IE3 A;  4Q5N A;  1M0U A;  5DVB A;  4EDY A;  2KOK A;  3HY2 A;  5DJM A;  3EMP A;  3O3T A;  4MH3 A;  2VCX A;  3IRA A;  4NAX A;  2LNS A;  1OKT A;  20GS A;  4GF0 A;  4LL4 B;  1A24 A;  3RPN A;  1ERU A;  4YQM A;  1HYU A;  2PBJ A;  2A2S A;  4QQ7 A;  3EWL A;  4PUF C;  4OFN A;  1DE1 A;  2VD0 A;  2YV9 A;  10GS A;  1PMT A;  3QR6 A;  1IYH A;  3KP9 A;  2YN1 A;  3IBH A;  4IW9 A;  1I5G A;  2HZF A;  3RPP A;  3UVH A;  1LU4 A;  3A3T A;  2IWT A;  4L0W A;  1FW1 A;  3KM6 A;  1R26 A;  1ZOF A;  3IAM 2;  3LJR A;  1ON4 A;  5CNW A;  2M72 A;  3ZVJ D;  2C0E A;  2YWO A;  3ZML A;  2P5R A;  4ZBD A;  3CXG A;  4TR3 A;  4BWQ A;  3IV4 A;  2H73 A;  1ACV A;  1PX7 A;  1EP7 A;  4G9H A;  1MDJ A;  1WMJ A;  1DSB A;  3TCO A;  2AAW A;  1XOA A;  1YF1 A;  3GN3 A;  1OC9 B;  1OE7 A;  2JZS A;  3UBL A;  4GWR A;  4MMM A;  5F8B A;  4IQA A;  3N5O A;  3DXB A;  5A4U A;  2FD3 A;  3F6F A;  1K0B A;  2N5A A;  3NIV A;  3FR3 A;  1EOH A;  4LA1 A;  4K2D A;  1WRY A;  2E0Q A;  4MK3 A;  5LNK e;  4L8E A;  2CAI A;  2MMA A;  1SK1 A;  1OKD A;  4GSS A;  3O76 A;  3QD9 A;  4NV2 A;  4CHS A;  1R5A A;  2GQK A;  2DJK A;  1WIK A;  4ECB A;  1M2A A;  1JZD A;  1I9D A;  1TK0 B;  2KP2 A;  1OE8 A;  5F06 A;  4I6X A;  3TOT A;  2H70 A;  2XPE A;  2VL3 A;  4DSS B;  3G9B A;  3DRN A;  2ZNM A;  1M2B A;  3GTU A;  1K0O A;  1TRV A;  2WFC A;  4Z7X A;  2P5Q A;  3FZ5 A;  1B48 A;  1USB A;  2LQQ A;  1K0C A;  2R3X A;  2F3M A;  4L5L A;  1SD8 A;  1QMV A;  2GST A;  3UOM A;  1GRX A;  3CSI A;  3H1N A;  1T7P B;  3TKS E;  4HQS A;  3EVI A;  4N0V A;  1PRX A;  2DMM A;  2JSZ A;  1M9A A;  3V1W A;  3IR4 A;  3HHV A;  4KE3 A;  2QC7 A;  4RUV A;  4TXV A;  2C3T A;  3VI7 A;  2IMF A;  3UAR A;  3UEM A;  5KN2 A;  1J9B A;  1VF4 A;  3CRT A;  4H86 A;  2H01 A;  2FWF A;  4WF4 A;  2ZUP A;  1XW6 A;  3GX8 A;  5KEJ A;  1V58 A;  2L5O A;  3BBY A;  4PQI A;  3U5R E;  1AC1 A;  2DJ1 A;  4WBR D;  2JSY A;  1GSS A;  2PWJ A;  2LKU A;  1A2J A;  1ZCP A;  4JRR A;  1V40 A;  1TJD A;  2Z9S A;  3A2X A;  2GSR A;  1F6M C;  3QDN A;  2DSA A;  1GLP A;  2WRT A;  2G2Q A;  1XIY A;  5INY A;  1GUH A;  1F37 A;  2IL3 A;  5IMZ A;  2MBS A;  1EV9 A;  2OA7 A;  3BCK A;  3APQ A;  4IJ3 A;  1E2Y A;  2EIQ A;  3E9J B;  2C0D A;  2MBT A;  1TW9 A;  1SD9 A;  2YZU A;  4RQX A;  3WD6 A;  4NPB A;  4PNF A;  3F6D A;  1OC9 A;  5CP1 A;  4GLT A;  5F0G A;  3C8E A;  1GUM A;  3L0H A;  4KDU A;  2OAC A;  2DC5 A;  4ISD A;  4KW6 A;  4FH8 A;  1X5E A;  4KSO A;  3GH6 A;  5DQS A;  1EEM A;  4HU9 A;  1K0A A;  3D21 A;  5D73 A;  1XZO A;  5A4V A;  1ST9 A;  3ZRD A;  4DSQ A;  4HI7 A;  4HUA A;  4HOJ A;  4O5R A;  2HT9 A;  2BTO T;  2HYX A;  1NHY A;  3MAK A;  3H93 A;  5JCW A;  2IFQ A;  1DE2 A;  1H75 A;  1JZR A;  1Z3E A;  5IM9 A;  2N5B A;  4MZC A;  2ON7 A;  3VLN A;  1Z6N A;  5DCG A;  2GSQ A;  3MNG A;  4ACS A;  2VO4 A;  5IIZ A;  5KN0 A;  2VLT A;  4TRX A;  1SL1 B;  2RLI A;  2K8V A;  1TU7 A;  4XIH A;  5JCU A;  1BED A;  4NWY A;  5FWG A;  1U88 A;  2DBC A;  1DUG A;  2XC2 A;  1WJK A;  2IMD A;  4MAB A;  3QCP A;  2IME A;  3GRX A;  2H0H A;  5HR0 A;  2AYT A;  2VL9 A;  2FA8 A;  1O6J A;  2LJA A;  3KIJ A;  3M9J A;  1UN2 A;  1GNW A;  3I43 A;  3FY7 A;  1FVJ A;  2C4J A;  2O8V B;  3WYW A;  2H30 A;  1X0R A;  2OE0 A;  4JED A;  4TXO A;  3ZIJ A;  3ERG A;  2X64 A;  4P3Y B;  1YY7 A;  3DWV A;  5C00 A;  5CRG A;  3Q18 A;  4YQV A;  5J41 A;  4TOP A;  1CQH A;  1ML6 A;  3C7M A;  3SWL A;  4WR5 A;  2HXK A;  1YF0 A;  1EOG A;  2PMT A;  1RK4 A;  3IPZ A;  5HFI A;  1GTU A;  3TJB A;  4NHW A;  2B5X A;  1S3D A;  3A2W A;  2V6K A;  3VUR A;  3GNJ A;  2YAN A;  3D22 A;  2D2Z A;  3LXT A;  5EVO A;  1F2E A;  3TUE A;  1KNG A;  1PKW A;  5ELG A;  3L9S A;  4O92 A;  5HFK A;  6GSY A;  1K3L A;  3G7J A;  3DVW A;  4ML1 A;  3FW2 A;  4MH2 A;  6GSV A;  4I8B A;  4K7N A;  4ULX A;  4TR1 B;  4IQ1 A;  1XPV A;  4V1A p;  3C73 A;  1MEK A;  3M9K A;  4Q5R A;  3EU3 A;  2FLS A;  2JAD A;  1H4O A;  1RQM A;  3HJM A;  3FEU A;  4L0U A;  1GTB A;  4WKW A;  4EO3 A;  3KH9 A;  3HJP A;  2VOC A;  3CMI A;  17GS A;  1ZYE A;  8GSS A;  2MYG A;  2H6Y A;  1B4P A;  1LJR A;  3ZLP A;  2OAD A;  2PN8 A;  3KTB A;  2BMX A;  2AUV A;  2B3S A;  1K3Y A;  2VCV A;  5GZZ B;  2LV3 A;  1U3I A;  4LLR A;  4TR4 A;  5ECN B;  2R5G A;  4JR4 A;  2E2M A;  3N9J A;  2DJ2 A;  1QXH A;  4XRD A;  3GTU B;  5JWQ B;  1UC7 A;  1FB0 A;  3F4S A;  3QOU A;  4V1A g;  2GGT A;  3EE2 A;  1ZL9 A;  3VPT A;  1GTI A;  5IPH A;  2F8A A;  3RAZ A;  4OMV A;  2GVP A;  3CTF A;  4NV5 A;  2YOI A;  4EC0 A;  4EDZ A;  5HFG A;  3A5W A;  3TB2 A;  1TU8 A;  3TJJ A;  1V9W A;  3GST A;  2AV4 A;  2V1M A;  1QQ2 A;  4J57 E;  2GS3 A;  2V32 A;  4IP1 A;  4MZB A;  3GH9 A;  5ECH B;  22GS A;  1K0M A;  3HXS A;  4F0B A;  3IC4 A;  1NW2 A;  1TTZ A;  3VWV A;  2V2G A;  2V41 A;  2E7P A;  2GQL A;  4AGS A;  1GSE A;  1A2M A;  5ECR B;  2MZC A;  4JZQ A;  5LCZ A;  4HEA 2;  3ZTL A;  1YEX A;  1XFL A;  2B1L A;  2JU5 A;  3CSH A;  4LL1 B;  5GAP D;  4O32 A;  1PKZ A;  3RBT A;  6GST A;  4TW5 A;  2CVK A;  2P0G A;  5DJL A;  1XWG A;  1M7T A;  5DDL A;  5B7C A;  2G0F A;  3GUS A;  2QKE A;  1K0D A;  3GV1 A;  1BJX A;  3FZ9 A;  4MDC A;  2OJL A;  2QSI A;  1T1V A;  4MA9 A;  1K3O A;  2YJ7 A;  1YJ6 A;  5IOW A;  4XS1 A;  2C3N A;  5GST A;  2I81 A;  3F3R A;  4PGT A;  4ZXG A;  4YQU A;  2PVO C;  5J9B A;  3TJF A;  1PSQ A;  1PD2 1;  3BJ5 A;  4GTU A;  2HSH A;  1V57 A;  2FGX A;  3EYT A;  2CVD A;  1M9B A;  1PQN A;  5ABR A;  4N11 A;  1F3A A;  2YCD A;  3TKS A;  2R2J A;  2J9H A;  1T4Z A;  3M0F A;  3FYG A;  4N10 A;  2H66 A;  2C3Q A;  3KCM A;  2YZH A;  2HRF A;  2I9H A;  3ZL5 A;  1G0T A;  3VWX A;  4K0N A;  3TDG A;  5J5N A;  4HDE A;  4FYU A;  3HYP A;  4MF6 A;  4TR1 A;  4ZIL A;  2PU9 C;  3ZFB A;  1SKS B;  5CRW A;  2H1A A;  2H75 A;  1XWA A;  2IFQ B;  3PR8 A;  4EUY A;  3VFI A;  1UA5 A;  2C0F A;  2B7J A;  3WT2 A;  3US3 A;  2NBS A;  3F4T A;  1EP8 A;  2GT6 A;  1O81 A;  2RII A;  2ES7 A;  2F51 A;  3HA9 A;  1T00 A;  4G2E A;  1B9Y C;  5DAL B;  2C1Y A;  1Z7R A;  4OD7 A;  1C72 A;  1XXU A;  4KDX A;  1KBN A;  3KTL A;  3HVV A;  1ILO A;  4IN0 A;  3SBC A;  1GLQ A;  3KMO A;  2KHP A;  4WEY A;  1GWC A;  3RDW A;  2LUS A;  1VF3 A;  1EV4 A;  4OO5 A;  2O89 A;  5GAN D;  5F05 A;  4HJ2 A;  4WBJ A;  3IA1 A;  3BCI A;  4F03 A;  1HNB A;  3ED3 A;  2LNT A;  4V2M A;  5L71 A;  3DVX A;  2XHF A;  2HSY A;  1DBY A;  1XW5 A;  2VLU A;  5IMF A;  5B6M A;  3I9V 2;  1MDI A;  1SYR A;  5D9X A;  3KZQ A;  3JCM L;  4DVC A;  4K8M A;  4TXO B;  4L5O A;  4JU5 A;  4IBP A;  3CBU A;  1BG5 A;  3GKM A;  1GSQ A;  2VL2 A;  1U87 A;  1NM3 A;  1PN9 A;  3D5J A;  4KA0 A;  3QAV A;  3TKQ A;  1K0N A;  2WZ9 A;  1BQ7 A;  5C04 A;  5JWO B;  3DYR A;  4DSR A;  6GSW A;  4IHU A;  1EWX A;  4XRA A;  1SJI A;  4PX1 A;  4V2N A;  1AQV A;  3MDK A;  4E8E A;  4KAE A;  4V2L A;  2HFD A;  1XWK A;  2PGT A;  3E3E A;  1X9S B;  2A4V A;  3QPM A;  1GP1 A;  4GST A;  1MD4 A;  1JZW A;  1O85 A;  3ZMK A;  4NMU A;  4EKZ A;  1SJ6 A;  3D4M A;  2OBK A;  3VI5 A;  3UJ1 A;  2VCZ A;  2FY6 A;  1A8Y A;  2VUP A;  4POK A;  2YPM A;  1M99 A;  2A2R A;  2VCT A;  4AJ7 A;  1G7E A;  3LOR A;  3FRC A;  5AIX A;  4PUR A;  1MTC A;  2N5F A;  4RI7 A;  3HDC A;  5IMA A;  4GCI A;  1X5D A;  4TVE A;  4ZBA A;  1XVQ A;  12GS A;  3KD0 A;  4ZBB A;  1ZZY A;  5ECS A;  18GS A;  4RI6 A;  2HE3 A;  1TP9 A;  1B4Q A;  4MPF A;  1HNA A;  2RUE A;  3CRU A;  5IPG A;  1OC8 A;  3PH9 A;  1AXD A;  2R4V A;  2C8U A;  4WXT A;  4JR6 A;  1XW9 A;  5G1L A;  1XWC A;  1THO A;  4JE1 A;  1V98 A;  1JHB A;  4LMV A;  3ZRE A;  1EGR A;  4HZ2 A;  2C80 A;  4PXO A;  4JBB A;  4J2F A;  1OVN A;  2WGR A;  4ECC A;  4OWY A;  4GQC A;  1AQX A;  3F0I A;  4MLY A;  5GSS A;  3TKR A;  4ILF A;  1NHO A;  2LRN A;  1HNC A;  5EY6 A;  2MMZ A;  3F9U A;  4ZL8 A;  4TR0 A;  2DJ3 A;  2CT6 A;  2XBI A;  3L78 A;  2K6V A;  5DAL A;  2NVL A;  4ZL7 A;  6GSS A;  1Z6M A;  4GXZ A;  1GSU A;  1UVZ A;  4KCA A;  2FHE A;  4IVF A;  2GZP A;  2GT5 A;  3IK7 A;  4ZL9 A;  5DAK A;  1GSD A;  16GS A;  3I6A A;  4ZB6 A;  2FNO A;  4KND A;  3FR6 A;  2CAQ A;  2PVQ A;  3TKS C;  4XS4 B;  3GA4 A;  2QGV A;  1M2D A;  3EUR A;  2VM2 A;  3GUR A;  4PQ1 A;  1EGO A;  3H79 A;  4OO4 A;  5G5F A;  2MMN A;  3UL3 A;  2X99 A;  4KDY A;  5H5Q A;  3RHB A;  4DEJ A;  2HZE B;  4PQH A;  3NOF A;  4G10 A;  1AQW A;  4E8H A;  4EF0 A;  2VLV A;  2FWE A;  1MD3 A;  2DJ0 A;  3FZ4 A;  1WE0 A;  1ERV A;  4HU7 A;  3M1G A;  2RM5 A;  2L5L A;  2RM6 A;  3C1R A;  3HZ8 A;  5HR2 A;  1GNE A;  2LTK A;  2TRX A;  2TIR A;  2CX3 A;  3CSJ A;  3LWA A;  3C71 A;  1SK0 A;  1CQG A;  2CV4 A;  1A2L A;  2L59 A;  2B7K A;  3G7I A;  4YAP A;  5ECO B;  4ID0 A;  2KLX A;  2HNL A;  3GFK A;  3DD3 A;  4K0G A;  2H1G A;  5FHI A;  2H74 A;  2XBQ A;  3HKR A;  4F9Z A;  4CDO A;  5ID2 A;  3LG6 A;  5J4U A;  2H6X A;  3GHA A;  2M46 A;  4KCE A;  4MCU A;  3CYN A;  1Y25 A;  2OBI A;  2REM A;  3FHK A;  2VL2 C;  2X8C A;  3L9V A;  1B9X C;  2JZT A;  1AIU A;  3IHQ A;  2GLR A;  4IP6 A;  2IN3 A;  1BX9 A;  5J9C A;  3EU4 A;  3LSZ A;  1TXX A;  3L4N A;  4K7O A;  3GIX A;  3DKS A;  5DQY A;  1XOB A;  1GL8 A;  3Q74 A;  3TJK A;  3TRQ A;  4K6X A;  2AB6 A;  4I97 A;  2O85 A;  5ECQ B;  2PPT A;  2WJU A;  2FA4 A;  1G7O A;  2JL4 A;  2B5Y A;  1PL2 A;  2L4Q A;  4HS1 A;  5F07 A;  3HVS A;  1GH2 A;  1JLV A;  1HD2 A;  4K7I A;  2F9S A;  2YP6 A;  3M8N A;  2K8S A;  3VWW A;  1SK2 A;  2FWH A;  3C1S A;  5CRD A;  3DIE A;  4ZB9 A;  2F8F A;  3WT1 A;  1R4W A;  2M80 A;  1TK8 B;  3F4R A;  2LST A;  1VRS D;  3TGZ A;  4F2I A;  2CX4 A;  3GKN A;  5D93 A;  2H0I A;  3W8J A;  5IO0 A;  4KSM A;  5AN1 A;  4IGJ A;  4X1U A;  5HQP A;  1PA3 A;  4XS4 A;  3ZIT A;  4FIW A;  3QMX A;  2K9F A;  2DML A;  4AF2 A;  4OFT A;  1U3A A;  2PER A;  2IIY A;  4NXI A;  5IOX A;  3NZN A;  2LQO A;  6GSX A;  5CO3 A;  1Z7P A;  2HZE A;  1Q98 A;  1O73 A;  3ZYW A;  5CAX A;  1SKR B;  5DCH A;  3APS A;  2FUG 2;  3WGD A;  3RHC A;  1Y6E A;  5J3R A;  3GX0 A;  2CVB A;  2VD1 A;  2LEG A;  4YAV A;  2L6C A;  2I4A A;  5KN3 A;  2R37 A;  3KMN A;  1G6W A;  1FHE A;  2KUC A;  4IEL A;  3S9F A;  1TK5 B;  3A2V A;  1THX A;  2YWI A;  4POB A;  4RQR A;  6GSU A;  1E6B A;  1FB6 A;  1YEP A;  2H72 A;  2VM1 A;  2ON5 A;  3KXO A;  3UMA A;  2I1U A;  1GTA A;  3EC3 A;  5KN1 A;  3GKK A;  1YKA A;  2EC4 A;  2LRT A;  3TRX A;  2J23 A;  4EXJ A;  3G7Y A;  2WCI A;  3ISO A;  2H8L A;  2H71 A;  2V6O A;  1Z5Y E;  5COH A;  3IOS A;  1AUC A;  3QFA C;  2EIO A;  1ERW A;  3J7Y k;  1JLW A;  4KUN A;  1X5C A;  3VWU A;  3D0Z A;  2CZ3 A;  3UVT A;  2XPD A;  4HZ4 A;  2VIM A;  5EPF A;  1ZYQ B;  11GS A;  1SL0 B;  1W89 A;  1J08 A;  1X9W B;  1WPI A;  2EIR A;  1AW9 A;  4AJ6 A;  3DEX A;  3IAS 2;  2YWN A;  3FK8 A;  1R7H A;  3PGT A;  1QGV A;  5ECI B;  4F0C A;  4OCF A;  3KEB A;  2X8H A;  2KP1 A;  1JFU A;  5IQY A;  3BOA A;  4ECJ A;  3ME7 A;  1G6Y A;  1R5P A;  13GS A;  2X8G A;  3UBK A;  4YH2 A;  4KB3 A;  4IJI A;  1EEJ A;  3AY8 A;  5DAK B;  4G19 A;  4WET A;  3ERF A;  4KGI A;  4N0Z A;  3LXZ A;  5CRE A;  1SL2 B;  3D6I A;  1AAZ A;  2BJX A;  3I69 A;  4TKY A;  4K9Z A;  4ML6 A;  3GSS A;  9GSS A;  2LS5 A;  1PX6 A;  3D4T A;  1B8X A;  2H76 A;  3FKF A;  4I2U A;  4QL7 A;  3CTG A;  2NDO A;  1SKW B;  2B1K A;  1QFN A;  1TOF A;  4Q5Q A;  4J56 E;  3K8N A;  4NHZ A;  3KGK A;  1OAZ A;  1A0R P;  3LQ7 A;  1WOU A;  2YWM A;  2DLX A;  5A5K A;  4EVM A;  4O7H A;  1GUL A;  2GDR A;  4BPY A;  1FO5 A;  5G5E A;  4KX4 A;  4GQF A;  2NPB A;  5G1K A;  4LMW A;  4FYB A;  4F82 A;  1YDK A;  2ALB A;  2CQ9 A;  4GRF A;  3ZZX A;  5D8I A;  2IMK A;  3DML A;  4K1F A;  2NTO A;  4OCE A;  5D9T A;  2RUF A;  1XBS A;  3U6V A;  2LRC A;  2O7K A;  5ID2 B;  5AGY A;  5E4W A;  5IMD A;  3LFL A;  3KP8 A;  1O8W A;  1O8X A;  2OE1 A;  3GMF A;  2E2G A;  2LJR A;  4TN8 A;  2WB9 A;  3L9U A;  4X0X A;  3E0U A;  3ZFL A;  2HI7 A;  2I3Y A;  4IKH A;  2C0G A;  3UAP A;  4MPG A;  4WF5 A;  1VF2 A;  1TDI A;  2FWG A;  4MJB A;  2H19 A;  5JWR B;  5D96 A;  3H8Q A;  2YJH A;  3BD2 A;  1KTE A;  3F3Q A;  1YQ1 A;  2MMO A;  2L4C A;  2GSS A;  1BAY A;  1NSW A;  2GZZ A;  1FG4 A;  4XCS A;  2TRC P;  4MP4 A;  2DIY A;  5H5R A;  2H1B A;  2IPA A;  2H1D A;  2ZCT A;  4EE0 A;  3DGQ A;  3LYK A;  4Q5F A;  5H5S A;  3TJG A;  5AIV A;  2B6M A;  2L6D A;  3GL5 A;  1ZGN A;  4N30 A;  3FR9 A;  1EZK A;  1BYE A;  1U6T A;  4PUA A;  4MZW A;  4QL9 A;  1X9M B;  3ME8 A;  3H4K A;  3ZVJ A;  4BVX A;  3EIN A;  5E59 A;  1XCC A;  1FOV A;  4HQZ A;  2IJY A;  4EL1 A;  4MJE A;  3UIW A;  2H0G A;  5G2Z A;  3QAW A;  4D73 B;  3EMX A;  1N2A A;  1IYI A;  3HZ4 A;  1TRS A;  4MJA A;  3APO A;  4DSS A;  3O6T A;  5G31 A;  2VCW A;  3IXR A;  4ECI A;  3WGX A;  3MWH A;  1LBK A;  1SJZ A;  1QK8 A;  2O87 A;  1W4V A;  2R6K A;  3MSZ A;  4WR4 A;  1WP0 A;  3IK9 A;  2VAF A;  5ECL B;  2LJK A;  2IMI A;  4BVY A;  2AJQ B;  4BL7 A;  2HLS A;  1XVW A;  5AIS A;  5IO2 A;  1HQO A;  1FVK A;  3P8W A;  4IS0 A;  2JZR A;  2WS2 A;  1GUK A;  1TRW A;  4MF7 A;  3IDV A;  3VK9 A;  1URM A;  1WWJ A;  1TKD B;  5D9W A;  2GZY A;  3F8U A;  2HRN A;  3LYP A;  1XWB A;  3M3M A;  4ZIJ A;  1RW1 A;  3VPQ A;  5ECK B;  1TI1 A;  3P2A A;  3Q19 A;  1S3A A;  2DIZ A;  1ERT A;  5JCG A;  19GS A;  4GSN A; 
#chains in the Genus database with same CATH topology
 1TRU A;  3P90 A;  1PGT A;  5CYY A;  5A4W A;  1V2A A;  1GSY A;  14GS A;  1KEB A;  2GTU A;  1TI3 A;  5LD0 A;  1ABA A;  1SYX A;  4MF5 A;  3F63 A;  4HJM A;  3KJY A;  4CW9 A;  3R2Q A;  1VF1 A;  4I5Q A;  1ZMA A;  1F3B A;  4EIP A;  5B8B A;  3W6G A;  2CA8 A;  5FT3 A;  4PNG A;  5ECP B;  3OR5 A;  4XHM A;  3GKX A;  3HCZ A;  7GSS A;  2WDU A;  4X43 A;  3PIN A;  3HD5 A;  1OC3 A;  4Z2R A;  5IMV A;  3ERW A;  1PL1 A;  3TRP A;  1A23 A;  4FYC A;  4BIK A;  3TOU A;  4XTS A;  5CRH A;  5DBQ A;  2L57 A;  2DJJ A;  3HJO A;  5EL8 A;  2OE3 A;  3QFB C;  3KH7 A;  3W8S A;  5D9V A;  5ELA A;  3HVX A;  1A8L A;  4OFM A;  4O5U A;  3WGE A;  3GYK A;  3J7Y b;  2B5E A;  4POL A;  3LEF A;  1QUW A;  3QAG A;  4AJ8 A;  4BA7 A;  5HR1 A;  5B6N A;  1T3B A;  2FCH A;  3LGC A;  5ENU A;  4G0L A;  4K5R A;  4MJC A;  1O7U A;  2H6Z A;  1A0F A;  1OYJ A;  5G30 A;  1FAA A;  4FO5 A;  1J0F A;  1Z9H A;  2YNX A;  2GQM A;  4POM A;  1T8E B;  3Q6O A;  3ZIV A;  2AHE A;  1Q4J A;  5ECM B;  1F9M A;  1S3C A;  1T4Y A;  3MYD A;  2JAC A;  3TKP A;  3GL3 A;  2VCQ A;  5HR3 A;  4ZB8 A;  4BWS A;  3FZA A;  5B8A A;  4KH7 A;  1SU9 A;  1YKC A;  2K18 A;  4D73 A;  2WUL A;  1GSF A;  1YZX A;  1VGL A;  2PUK C;  1JZO A;  2YV7 A;  4I2T A;  5IMC A;  1SEN A;  1N8J A;  3P7X A;  2OKA A;  4XS6 A;  2P31 A;  1MDK A;  2CZ2 A;  3IE3 A;  4Q5N A;  1M0U A;  5DVB A;  4EDY A;  2KOK A;  3HY2 A;  5DJM A;  4CY8 A;  3EMP A;  3O3T A;  4MH3 A;  2VCX A;  3IRA A;  4NAX A;  2LNS A;  1OKT A;  20GS A;  4GF0 A;  4LL4 B;  1A24 A;  3RPN A;  1ERU A;  4YQM A;  1HYU A;  2PBJ A;  2A2S A;  4QQ7 A;  3EWL A;  4PUF C;  2QA2 A;  3FMW A;  4OFN A;  1DE1 A;  2VD0 A;  2YV9 A;  2HSM A;  10GS A;  1PMT A;  3QR6 A;  1IYH A;  3KP9 A;  2YN1 A;  3IBH A;  4IW9 A;  1I5G A;  2HZF A;  2A2P A;  3RPP A;  3UVH A;  1LU4 A;  3A3T A;  2IWT A;  4L0W A;  1FW1 A;  3KM6 A;  1R26 A;  1ZOF A;  3IAM 2;  3LJR A;  1ON4 A;  5CNW A;  2M72 A;  3ZVJ D;  2C0E A;  2YWO A;  3ZML A;  2P5R A;  4ZBD A;  3CXG A;  4TR3 A;  4BWQ A;  3IV4 A;  2H73 A;  1ACV A;  1PX7 A;  1EP7 A;  4G9H A;  1MDJ A;  1WMJ A;  1DSB A;  3TCO A;  2AAW A;  1XOA A;  1YF1 A;  3GN3 A;  1OC9 B;  1OE7 A;  2JZS A;  3UBL A;  4GWR A;  4MMM A;  5F8B A;  4IQA A;  5KOW A;  3N5O A;  3DXB A;  5A4U A;  2FD3 A;  3F6F A;  4K2X A;  1K0B A;  2N5A A;  3NIV A;  3FR3 A;  1EOH A;  4LA1 A;  4K2D A;  1WRY A;  2E0Q A;  4MK3 A;  5LNK e;  4L8E A;  2CAI A;  2MMA A;  1SK1 A;  1OKD A;  4GSS A;  3O76 A;  3QD9 A;  4NV2 A;  4CHS A;  1R5A A;  2GQK A;  2DJK A;  1WIK A;  4ECB A;  1M2A A;  1JZD A;  1I9D A;  1TK0 B;  2KP2 A;  1OE8 A;  5F06 A;  4I6X A;  3TOT A;  2H70 A;  2XPE A;  2VL3 A;  4DSS B;  3G9B A;  3DRN A;  2ZNM A;  1M2B A;  3GTU A;  1K0O A;  1TRV A;  2WFC A;  4Z7X A;  2P5Q A;  3FZ5 A;  1B48 A;  1USB A;  4BVY B;  2LQQ A;  1K0C A;  2R3X A;  2F3M A;  4L5L A;  1SD8 A;  1QMV A;  2GST A;  3UOM A;  1GRX A;  3CSI A;  3H1N A;  1T7P B;  3TKS E;  4HQS A;  3EVI A;  4N0V A;  1PRX A;  2DMM A;  2JSZ A;  1M9A A;  3V1W A;  3IR4 A;  3HHV A;  4KE3 A;  2R0C A;  2QC7 A;  4RUV A;  4TXV A;  3EPT A;  2C3T A;  3VI7 A;  2IMF A;  3UAR A;  3UEM A;  5KN2 A;  1J9B A;  1VF4 A;  3CRT A;  4H86 A;  2H01 A;  2FWF A;  4WF4 A;  2ZUP A;  1XW6 A;  3GX8 A;  5KEJ A;  1V58 A;  2L5O A;  3BBY A;  4PQI A;  3U5R E;  1AC1 A;  2DJ1 A;  4WBR D;  2JSY A;  1GSS A;  2PWJ A;  2LKU A;  1A2J A;  1ZCP A;  4JRR A;  1V40 A;  1TJD A;  2Z9S A;  3A2X A;  2GSR A;  1F6M C;  3QDN A;  2DSA A;  1GLP A;  2WRT A;  2G2Q A;  1XIY A;  5INY A;  1GUH A;  1F37 A;  2IL3 A;  5IMZ A;  2MBS A;  1EV9 A;  2OA7 A;  3BCK A;  3APQ A;  4IJ3 A;  1E2Y A;  2EIQ A;  3E9J B;  2C0D A;  2MBT A;  1TW9 A;  1SD9 A;  2YZU A;  4RQX A;  3WD6 A;  4NPB A;  4PNF A;  3F6D A;  1OC9 A;  5CP1 A;  4GLT A;  5F0G A;  3C8E A;  1GUM A;  3L0H A;  4KDU A;  2OAC A;  2DC5 A;  4ISD A;  4KW6 A;  4FH8 A;  1X5E A;  4YKF A;  4KSO A;  3GH6 A;  5DQS A;  1EEM A;  4HU9 A;  1K0A A;  3D21 A;  5D73 A;  1XZO A;  5A4V A;  1ST9 A;  3ZRD A;  4DSQ A;  4HI7 A;  4HUA A;  4HOJ A;  4O5R A;  2HT9 A;  2BTO T;  2HYX A;  1NHY A;  3MAK A;  3H93 A;  5JCW A;  2IFQ A;  1DE2 A;  1H75 A;  1JZR A;  1Z3E A;  5IM9 A;  2N5B A;  4MZC A;  2ON7 A;  3VLN A;  1Z6N A;  5DCG A;  2GSQ A;  3MNG A;  4ACS A;  2VO4 A;  5IIZ A;  5KN0 A;  2VLT A;  4TRX A;  1SL1 B;  2RLI A;  2K8V A;  1TU7 A;  4XIH A;  5JCU A;  1BED A;  4NWY A;  5FWG A;  1U88 A;  2DBC A;  1DUG A;  4MNN A;  2XC2 A;  1WJK A;  2IMD A;  4MAB A;  3QCP A;  2IME A;  3GRX A;  2H0H A;  5HR0 A;  2AYT A;  2VL9 A;  2FA8 A;  1O6J A;  2LJA A;  3KIJ A;  3M9J A;  1UN2 A;  1GNW A;  3I43 A;  3FY7 A;  1FVJ A;  2C4J A;  2O8V B;  3WYW A;  2H30 A;  1X0R A;  2OE0 A;  4JED A;  4TXO A;  3ZIJ A;  3ERG A;  2X64 A;  4P3Y B;  1YY7 A;  3DWV A;  5C00 A;  5CRG A;  3Q18 A;  4YQV A;  5J41 A;  4TOP A;  1CQH A;  1ML6 A;  3C7M A;  3SWL A;  4WR5 A;  2HXK A;  1YF0 A;  1EOG A;  2PMT A;  1RK4 A;  3IPZ A;  5HFI A;  1GTU A;  3TJB A;  4NHW A;  2B5X A;  1S3D A;  3A2W A;  2V6K A;  1FOH A;  3VUR A;  3GNJ A;  2YAN A;  3D22 A;  2D2Z A;  3LXT A;  5EVO A;  1F2E A;  3TUE A;  1KNG A;  1PKW A;  5ELG A;  3L9S A;  4O92 A;  5HFK A;  6GSY A;  1K3L A;  3G7J A;  3DVW A;  4ML1 A;  3FW2 A;  4MH2 A;  6GSV A;  4I8B A;  4K7N A;  4ULX A;  4TR1 B;  4IQ1 A;  1XPV A;  4V1A p;  3C73 A;  1MEK A;  3M9K A;  4Q5R A;  3EU3 A;  2FLS A;  2JAD A;  1H4O A;  1RQM A;  3HJM A;  3FEU A;  4L0U A;  1GTB A;  4WKW A;  4EO3 A;  3KH9 A;  3HJP A;  2VOC A;  3CMI A;  17GS A;  1ZYE A;  8GSS A;  2MYG A;  1ZYP A;  2H6Y A;  1B4P A;  1LJR A;  3ZLP A;  2OAD A;  2PN8 A;  3KTB A;  4A5P A;  1M3I A;  2BMX A;  2AUV A;  3PPU A;  2B3S A;  1K3Y A;  2VCV A;  5GZZ B;  2LV3 A;  1U3I A;  4LLR A;  4TR4 A;  5ECN B;  2R5G A;  4JR4 A;  2E2M A;  4K5S A;  3N9J A;  2DJ2 A;  1QXH A;  4XRD A;  3GTU B;  5JWQ B;  1UC7 A;  1FB0 A;  3F4S A;  3QOU A;  4V1A g;  1ZYN A;  2GGT A;  3EE2 A;  1ZL9 A;  3VPT A;  1GTI A;  5IPH A;  2F8A A;  3RAZ A;  4OMV A;  2GVP A;  3CTF A;  4NV5 A;  2YOI A;  4EC0 A;  4EDZ A;  5HFG A;  3A5W A;  3TB2 A;  1TU8 A;  3TJJ A;  1V9W A;  3GST A;  2AV4 A;  2V1M A;  1QQ2 A;  4J57 E;  2GS3 A;  2V32 A;  4IP1 A;  4MZB A;  3GH9 A;  5ECH B;  22GS A;  1K0M A;  3HXS A;  4F0B A;  3IC4 A;  1NW2 A;  1TTZ A;  3VWV A;  2V2G A;  2V41 A;  2E7P A;  2GQL A;  4AGS A;  1GSE A;  1A2M A;  5ECR B;  2MZC A;  4JZQ A;  2QA1 A;  5LCZ A;  4HEA 2;  3ZTL A;  1YEX A;  1XFL A;  2B1L A;  2JU5 A;  3CSH A;  4LL1 B;  5GAP D;  4O32 A;  2R0P A;  1PKZ A;  3RBT A;  6GST A;  4TW5 A;  2X4A A;  2CVK A;  2P0G A;  5DJL A;  1XWG A;  1M7T A;  5DDL A;  5B7C A;  2G0F A;  3GUS A;  3MIX A;  2QKE A;  1K0D A;  5BMU A;  3GV1 A;  1BJX A;  3FZ9 A;  4MDC A;  2OJL A;  2QSI A;  1T1V A;  4MA9 A;  1K3O A;  2YJ7 A;  1YJ6 A;  5IOW A;  4XS1 A;  1S3R A;  2C3N A;  5GST A;  2I81 A;  3F3R A;  4PGT A;  4ZXG A;  4YQU A;  2PVO C;  5J9B A;  3TJF A;  1PSQ A;  1PD2 1;  3BJ5 A;  4GTU A;  2HSH A;  1V57 A;  2FGX A;  4KF9 A;  3EYT A;  2CVD A;  1M9B A;  1PQN A;  5ABR A;  4N11 A;  1F3A A;  2YCD A;  3TKS A;  2R2J A;  2J9H A;  1T4Z A;  3M0F A;  3FYG A;  4N10 A;  2H66 A;  2C3Q A;  3KCM A;  2YZH A;  2HRF A;  2I9H A;  3ZL5 A;  1G0T A;  3VWX A;  4K0N A;  3TDG A;  5J5N A;  4HDE A;  4FYU A;  3HYP A;  4MF6 A;  4TR1 A;  4ZIL A;  2PU9 C;  3ZFB A;  1SKS B;  5CRW A;  2H1A A;  2H75 A;  1XWA A;  2IFQ B;  3PR8 A;  4EUY A;  3VFI A;  1UA5 A;  2C0F A;  2B7J A;  3WT2 A;  3US3 A;  2NBS A;  3F4T A;  1EP8 A;  2GT6 A;  1O81 A;  2RII A;  2ES7 A;  2F51 A;  3HA9 A;  1T00 A;  4G2E A;  1B9Y C;  5DAL B;  2C1Y A;  1Z7R A;  4OD7 A;  1C72 A;  1XXU A;  4KDX A;  1KBN A;  3KTL A;  3HVV A;  1ILO A;  4IN0 A;  3SBC A;  1GLQ A;  3KMO A;  2KHP A;  4WEY A;  1GWC A;  3RDW A;  2LUS A;  1VF3 A;  1EV4 A;  4OO5 A;  2O89 A;  5GAN D;  5F05 A;  4HJ2 A;  4WBJ A;  3IA1 A;  3BCI A;  4F03 A;  1HNB A;  3ED3 A;  2LNT A;  4V2M A;  5L71 A;  3DVX A;  2XHF A;  2HSY A;  1DBY A;  1XW5 A;  2VLU A;  5IMF A;  5B6M A;  3I9V 2;  1MDI A;  1SYR A;  5D9X A;  3KZQ A;  3JCM L;  4DVC A;  4K8M A;  4TXO B;  4L5O A;  4JU5 A;  4IBP A;  3CBU A;  1BG5 A;  3GKM A;  1GSQ A;  2VL2 A;  1U87 A;  1NM3 A;  1PN9 A;  3D5J A;  4KA0 A;  3QAV A;  3TKQ A;  1K0N A;  2WZ9 A;  1BQ7 A;  5C04 A;  5JWO B;  3DYR A;  4DSR A;  6GSW A;  4IHU A;  1EWX A;  4XRA A;  1SJI A;  4PX1 A;  4V2N A;  1AQV A;  3MDK A;  4E8E A;  4KAE A;  4V2L A;  2HFD A;  1XWK A;  2PGT A;  3E3E A;  1X9S B;  2A4V A;  3QPM A;  1GP1 A;  4GST A;  1MD4 A;  1JZW A;  1O85 A;  3ZMK A;  4NMU A;  4EKZ A;  1SJ6 A;  3D4M A;  2OBK A;  3VI5 A;  3UJ1 A;  2VCZ A;  2FY6 A;  1A8Y A;  2VUP A;  4POK A;  2YPM A;  1XG8 A;  1M99 A;  2A2R A;  2VCT A;  4AJ7 A;  1G7E A;  3LOR A;  3FRC A;  5AIX A;  4PUR A;  1MTC A;  2N5F A;  4RI7 A;  3HDC A;  5IMA A;  4GCI A;  1X5D A;  4TVE A;  4ZBA A;  1XVQ A;  12GS A;  3KD0 A;  4ZBB A;  1ZZY A;  5ECS A;  18GS A;  4RI6 A;  2HE3 A;  1TP9 A;  1B4Q A;  4MPF A;  1HNA A;  2RUE A;  3CRU A;  5IPG A;  1OC8 A;  3PH9 A;  1AXD A;  2R4V A;  2C8U A;  4WXT A;  4JR6 A;  1XW9 A;  3IHG A;  1XWC A;  1THO A;  4JE1 A;  5G1L A;  1PN0 A;  1V98 A;  1JHB A;  4LMV A;  3ZRE A;  1EGR A;  4HZ2 A;  2C80 A;  4PXO A;  4USS A;  4JBB A;  4J2F A;  1OVN A;  2WGR A;  4ECC A;  4OWY A;  4GQC A;  1AQX A;  3F0I A;  4MLY A;  5GSS A;  3TKR A;  4ILF A;  1NHO A;  2LRN A;  1HNC A;  5EY6 A;  4X4J A;  2MMZ A;  3F9U A;  4ZL8 A;  4TR0 A;  2DJ3 A;  2CT6 A;  2XBI A;  3L78 A;  2K6V A;  5DAL A;  4ICY A;  2NVL A;  4Z2U A;  4O5Q A;  3HVN A;  4ZL7 A;  6GSS A;  1Z6M A;  4GXZ A;  1GSU A;  1UVZ A;  4KCA A;  2FHE A;  4IVF A;  2GZP A;  2GT5 A;  3IK7 A;  4ZL9 A;  5DAK A;  1GSD A;  16GS A;  3I6A A;  4ZB6 A;  2FNO A;  4KND A;  3FR6 A;  2CAQ A;  2PVQ A;  3TKS C;  4XS4 B;  3GA4 A;  2QGV A;  1M2D A;  3EUR A;  2VM2 A;  3GUR A;  4PQ1 A;  1EGO A;  3H79 A;  4OO4 A;  5G5F A;  2MMN A;  3UL3 A;  2X99 A;  4KDY A;  5H5Q A;  3RHB A;  4DEJ A;  2HZE B;  4PQH A;  3NOF A;  4G10 A;  1AQW A;  4E8H A;  4EF0 A;  2VLV A;  1PFO A;  3CQF A;  2FWE A;  1MD3 A;  2DJ0 A;  3FZ4 A;  1WE0 A;  1ERV A;  4HU7 A;  3M1G A;  2RM5 A;  2L5L A;  2RM6 A;  3C1R A;  3HZ8 A;  5HR2 A;  1GNE A;  2LTK A;  2TRX A;  2TIR A;  2CX3 A;  3CSJ A;  3LWA A;  3C71 A;  1SK0 A;  1CQG A;  2CV4 A;  1A2L A;  2L59 A;  2B7K A;  3G7I A;  4YAP A;  5ECO B;  4ID0 A;  2KLX A;  2HNL A;  3GFK A;  3DD3 A;  5BRT A;  4K0G A;  2H1G A;  5FHI A;  2H74 A;  2XBQ A;  3HKR A;  4F9Z A;  4CDO A;  5ID2 A;  3LG6 A;  5J4U A;  2H6X A;  5KOX A;  3GHA A;  2M46 A;  4KCE A;  4MCU A;  3CYN A;  1Y25 A;  2OBI A;  2REM A;  4G0K A;  3FHK A;  2VL2 C;  2X8C A;  3L9V A;  1B9X C;  2JZT A;  1AIU A;  3IHQ A;  2GLR A;  4IP6 A;  2IN3 A;  1BX9 A;  5J9C A;  3EU4 A;  4CY6 A;  3LSZ A;  1TXX A;  3L4N A;  4K7O A;  2X49 A;  3GIX A;  3DKS A;  5DQY A;  1XOB A;  1GL8 A;  3Q74 A;  3A5I A;  3TJK A;  3TRQ A;  4K6X A;  2AB6 A;  4I97 A;  2O85 A;  2PPT A;  5ECQ B;  2WJU A;  2FA4 A;  1G7O A;  2JL4 A;  2B5Y A;  1PL2 A;  2L4Q A;  4HS1 A;  5F07 A;  3HVS A;  1GH2 A;  1JLV A;  1HD2 A;  4K7I A;  2F9S A;  2YP6 A;  3M8N A;  2K8S A;  3VWW A;  1SK2 A;  2FWH A;  3C1S A;  5CRD A;  3DIE A;  4ZB9 A;  2F8F A;  3WT1 A;  1R4W A;  2M80 A;  1TK8 B;  3F4R A;  2LST A;  1VRS D;  3TGZ A;  4F2I A;  2CX4 A;  3R3E A;  3GKN A;  5D93 A;  2H0I A;  3W8J A;  5IO0 A;  4KSM A;  5AN1 A;  4IGJ A;  4X1U A;  5HQP A;  1PA3 A;  4XS4 A;  3ZIT A;  4FIW A;  3QMX A;  2K9F A;  2DML A;  4AF2 A;  4OFT A;  1U3A A;  2PER A;  3IC8 A;  2IIY A;  4NXI A;  5IOX A;  3NZN A;  2LQO A;  6GSX A;  5CO3 A;  1Z7P A;  2HZE A;  1Q98 A;  1O73 A;  3ZYW A;  5CAX A;  1SKR B;  2DKI A;  5DCH A;  3APS A;  2FUG 2;  3WGD A;  3RHC A;  1Y6E A;  5J3R A;  3GX0 A;  2CVB A;  2VD1 A;  2LEG A;  4YAV A;  2L6C A;  2I4A A;  5KN3 A;  2R37 A;  3KMN A;  1G6W A;  1FHE A;  2KUC A;  4IEL A;  3S9F A;  1TK5 B;  3A2V A;  1THX A;  2YWI A;  4POB A;  4RQR A;  6GSU A;  1E6B A;  1FB6 A;  1YEP A;  2H72 A;  2VM1 A;  2ON5 A;  3KXO A;  3UMA A;  2I1U A;  1GTA A;  3EC3 A;  5KN1 A;  3GKK A;  1YKA A;  2EC4 A;  2LRT A;  3TRX A;  2UZ8 A;  4YKG A;  2J23 A;  4EXJ A;  3G7Y A;  2WCI A;  3ISO A;  2H8L A;  4G0I A;  2H71 A;  2DKH A;  2V6O A;  1Z5Y E;  5COH A;  3IOS A;  1AUC A;  3QFA C;  2EIO A;  1ERW A;  3J7Y k;  1JLW A;  4KUN A;  1X5C A;  3VWU A;  3D0Z A;  2CZ3 A;  3UVT A;  2XPD A;  4HZ4 A;  2VIM A;  5EPF A;  1ZYQ B;  11GS A;  1SL0 B;  1W89 A;  1J08 A;  1X9W B;  1WPI A;  2EIR A;  1AW9 A;  4AJ6 A;  3DEX A;  3IAS 2;  2YWN A;  3FK8 A;  1R7H A;  3PGT A;  1QGV A;  5ECI B;  4F0C A;  4OCF A;  3KEB A;  2X8H A;  2KP1 A;  1JFU A;  5IQY A;  3BOA A;  4ECJ A;  4BVX B;  3ME7 A;  1G6Y A;  4Z2T A;  1R5P A;  13GS A;  2X8G A;  3UBK A;  4YH2 A;  4KB3 A;  4IJI A;  1EEJ A;  3AY8 A;  5DAK B;  4G19 A;  4WET A;  3ERF A;  4KGI A;  4N0Z A;  3LXZ A;  5CRE A;  1SL2 B;  3D6I A;  1AAZ A;  2BJX A;  3I69 A;  4TKY A;  4K9Z A;  4ML6 A;  3GSS A;  9GSS A;  2LS5 A;  1PX6 A;  3D4T A;  1B8X A;  2H76 A;  3FKF A;  4I2U A;  4QL7 A;  4BL7 B;  3CTG A;  4EIQ A;  2NDO A;  1SKW B;  2B1K A;  1QFN A;  1TOF A;  4Q5Q A;  4J56 E;  3K8N A;  4NHZ A;  3KGK A;  1OAZ A;  1A0R P;  3LQ7 A;  1WOU A;  2YWM A;  2DLX A;  5A5K A;  4EVM A;  4O7H A;  1GUL A;  2GDR A;  4BPY A;  1FO5 A;  5G5E A;  4KX4 A;  4GQF A;  2NPB A;  5G1K A;  4LMW A;  4FYB A;  4F82 A;  1YDK A;  2ALB A;  2CQ9 A;  4GRF A;  3ZZX A;  5D8I A;  2IMK A;  3DML A;  4K1F A;  2NTO A;  4OCE A;  5D9T A;  2RUF A;  1XBS A;  3U6V A;  2LRC A;  2O7K A;  5ID2 B;  2HRA A;  5AGY A;  5E4W A;  5IMD A;  3LFL A;  3KP8 A;  1M3J A;  1O8W A;  1O8X A;  2OE1 A;  2HRK A;  3GMF A;  2E2G A;  2LJR A;  4TN8 A;  2WB9 A;  3L9U A;  4X0X A;  3E0U A;  3ZFL A;  2HI7 A;  2I3Y A;  4IKH A;  2C0G A;  3UAP A;  4MPG A;  4WF5 A;  1VF2 A;  1TDI A;  2FWG A;  4MJB A;  2H19 A;  5JWR B;  5D96 A;  3H8Q A;  2YJH A;  3BD2 A;  1KTE A;  3F3Q A;  1YQ1 A;  2MMO A;  2L4C A;  2GSS A;  1BAY A;  1NSW A;  2GZZ A;  1FG4 A;  4XCS A;  2TRC P;  4MP4 A;  2DIY A;  5H5R A;  2H1B A;  2IPA A;  2H1D A;  2ZCT A;  4EE0 A;  3DGQ A;  3LYK A;  4Q5F A;  5H5S A;  3TJG A;  5AIV A;  2B6M A;  2L6D A;  3GL5 A;  1ZGN A;  4N30 A;  3FR9 A;  1EZK A;  1BYE A;  1U6T A;  2R0G A;  4PUA A;  4MZW A;  4QL9 A;  1X9M B;  3LW9 A;  3ME8 A;  3H4K A;  3ZVJ A;  4BVX A;  3EIN A;  5E59 A;  1XCC A;  1FOV A;  4HQZ A;  2IJY A;  4EL1 A;  4MJE A;  3UIW A;  2H0G A;  5G2Z A;  3QAW A;  4D73 B;  3EMX A;  4PTS A;  1N2A A;  1IYI A;  3HZ4 A;  1TRS A;  4MJA A;  3APO A;  4DSS A;  3O6T A;  5G31 A;  2VCW A;  3IXR A;  4ECI A;  2A4H A;  3WGX A;  3MWH A;  1LBK A;  1SJZ A;  1QK8 A;  2O87 A;  1W4V A;  2R6K A;  3MSZ A;  4WR4 A;  1WP0 A;  3IK9 A;  2VAF A;  5ECL B;  2LJK A;  2IMI A;  4BVY A;  4HSC X;  4BL7 A;  2HLS A;  2AJQ B;  1XVW A;  4FQU A;  5AIS A;  5IO2 A;  1HQO A;  1FVK A;  3P8W A;  4IS0 A;  2JZR A;  2WS2 A;  1GUK A;  1TRW A;  4MF7 A;  3IDV A;  3VK9 A;  1URM A;  1WWJ A;  1TKD B;  5D9W A;  2GZY A;  3F8U A;  2HRN A;  3LYP A;  1XWB A;  3M3M A;  4ZIJ A;  1RW1 A;  3VPQ A;  5ECK B;  1TI1 A;  3P2A A;  3Q19 A;  1S3A A;  2DIZ A;  1ERT A;  5JCG A;  19GS A;  4GSN A; 
#chains in the Genus database with same CATH homology
 1TRU A;  3P90 A;  1PGT A;  5CYY A;  5A4W A;  1V2A A;  1GSY A;  14GS A;  1KEB A;  2GTU A;  1TI3 A;  5LD0 A;  1ABA A;  1SYX A;  4MF5 A;  3F63 A;  4HJM A;  3KJY A;  4CW9 A;  3R2Q A;  1VF1 A;  4I5Q A;  1ZMA A;  1F3B A;  4EIP A;  5B8B A;  3W6G A;  2CA8 A;  5FT3 A;  4PNG A;  5ECP B;  3OR5 A;  4XHM A;  3GKX A;  3HCZ A;  7GSS A;  2WDU A;  4X43 A;  3PIN A;  3HD5 A;  1OC3 A;  4Z2R A;  5IMV A;  3ERW A;  1PL1 A;  3TRP A;  1A23 A;  4FYC A;  3TOU A;  4XTS A;  5CRH A;  5DBQ A;  2L57 A;  2DJJ A;  3HJO A;  5EL8 A;  2OE3 A;  3QFB C;  3KH7 A;  3W8S A;  5D9V A;  5ELA A;  3HVX A;  1A8L A;  4OFM A;  4O5U A;  3WGE A;  3GYK A;  3J7Y b;  2B5E A;  4POL A;  3LEF A;  1QUW A;  3QAG A;  4AJ8 A;  4BA7 A;  5HR1 A;  5B6N A;  1T3B A;  2FCH A;  3LGC A;  5ENU A;  4G0L A;  4K5R A;  4MJC A;  1O7U A;  2H6Z A;  1A0F A;  1OYJ A;  5G30 A;  1FAA A;  4FO5 A;  1J0F A;  1Z9H A;  2YNX A;  2GQM A;  4POM A;  1T8E B;  3Q6O A;  3ZIV A;  2AHE A;  1Q4J A;  5ECM B;  1F9M A;  1S3C A;  1T4Y A;  3MYD A;  2JAC A;  3TKP A;  3GL3 A;  2VCQ A;  5HR3 A;  4ZB8 A;  4BWS A;  3FZA A;  5B8A A;  4KH7 A;  1SU9 A;  1YKC A;  2K18 A;  4D73 A;  2WUL A;  1GSF A;  1YZX A;  1VGL A;  2PUK C;  1JZO A;  2YV7 A;  4I2T A;  5IMC A;  1SEN A;  1N8J A;  3P7X A;  2OKA A;  4XS6 A;  2P31 A;  1MDK A;  2CZ2 A;  3IE3 A;  4Q5N A;  1M0U A;  5DVB A;  4EDY A;  2KOK A;  3HY2 A;  5DJM A;  4CY8 A;  3EMP A;  3O3T A;  4MH3 A;  2VCX A;  3IRA A;  4NAX A;  2LNS A;  1OKT A;  20GS A;  4GF0 A;  4LL4 B;  1A24 A;  3RPN A;  1ERU A;  4YQM A;  1HYU A;  2PBJ A;  2A2S A;  4QQ7 A;  3EWL A;  4PUF C;  2QA2 A;  3FMW A;  4OFN A;  1DE1 A;  2VD0 A;  2YV9 A;  2HSM A;  10GS A;  1PMT A;  3QR6 A;  1IYH A;  3KP9 A;  2YN1 A;  3IBH A;  4IW9 A;  1I5G A;  2HZF A;  2A2P A;  3RPP A;  3UVH A;  1LU4 A;  3A3T A;  2IWT A;  4L0W A;  1FW1 A;  3KM6 A;  1R26 A;  1ZOF A;  3IAM 2;  3LJR A;  1ON4 A;  5CNW A;  2M72 A;  3ZVJ D;  2C0E A;  2YWO A;  3ZML A;  2P5R A;  4ZBD A;  3CXG A;  4TR3 A;  4BWQ A;  3IV4 A;  2H73 A;  1ACV A;  1PX7 A;  1EP7 A;  4G9H A;  1MDJ A;  1WMJ A;  1DSB A;  3TCO A;  2AAW A;  1XOA A;  1YF1 A;  3GN3 A;  1OC9 B;  1OE7 A;  2JZS A;  3UBL A;  4GWR A;  4MMM A;  5F8B A;  4IQA A;  5KOW A;  3N5O A;  3DXB A;  5A4U A;  2FD3 A;  3F6F A;  4K2X A;  1K0B A;  2N5A A;  3NIV A;  3FR3 A;  1EOH A;  4LA1 A;  4K2D A;  1WRY A;  2E0Q A;  4MK3 A;  5LNK e;  4L8E A;  2CAI A;  2MMA A;  1SK1 A;  1OKD A;  4GSS A;  3O76 A;  3QD9 A;  4NV2 A;  4CHS A;  1R5A A;  2GQK A;  2DJK A;  1WIK A;  4ECB A;  1M2A A;  1JZD A;  1I9D A;  1TK0 B;  2KP2 A;  1OE8 A;  5F06 A;  4I6X A;  3TOT A;  2H70 A;  2XPE A;  2VL3 A;  4DSS B;  3G9B A;  3DRN A;  2ZNM A;  1M2B A;  3GTU A;  1K0O A;  1TRV A;  2WFC A;  4Z7X A;  2P5Q A;  3FZ5 A;  1B48 A;  1USB A;  4BVY B;  2LQQ A;  1K0C A;  2R3X A;  2F3M A;  4L5L A;  1SD8 A;  1QMV A;  2GST A;  3UOM A;  1GRX A;  3CSI A;  3H1N A;  1T7P B;  3TKS E;  4HQS A;  3EVI A;  4N0V A;  1PRX A;  2DMM A;  2JSZ A;  1M9A A;  3V1W A;  3IR4 A;  3HHV A;  4KE3 A;  2R0C A;  2QC7 A;  4RUV A;  4TXV A;  3EPT A;  2C3T A;  3VI7 A;  2IMF A;  3UAR A;  3UEM A;  5KN2 A;  1J9B A;  1VF4 A;  3CRT A;  4H86 A;  2H01 A;  2FWF A;  4WF4 A;  2ZUP A;  1XW6 A;  3GX8 A;  5KEJ A;  1V58 A;  2L5O A;  3BBY A;  4PQI A;  3U5R E;  1AC1 A;  2DJ1 A;  4WBR D;  2JSY A;  1GSS A;  2PWJ A;  2LKU A;  1A2J A;  1ZCP A;  4JRR A;  1V40 A;  1TJD A;  2Z9S A;  3A2X A;  2GSR A;  1F6M C;  3QDN A;  2DSA A;  1GLP A;  2WRT A;  2G2Q A;  1XIY A;  5INY A;  1GUH A;  1F37 A;  2IL3 A;  5IMZ A;  2MBS A;  1EV9 A;  2OA7 A;  3BCK A;  3APQ A;  4IJ3 A;  1E2Y A;  2EIQ A;  3E9J B;  2C0D A;  2MBT A;  1TW9 A;  1SD9 A;  2YZU A;  4RQX A;  3WD6 A;  4NPB A;  4PNF A;  3F6D A;  1OC9 A;  5CP1 A;  4GLT A;  5F0G A;  3C8E A;  1GUM A;  3L0H A;  4KDU A;  2OAC A;  2DC5 A;  4ISD A;  4KW6 A;  4FH8 A;  1X5E A;  4YKF A;  4KSO A;  3GH6 A;  5DQS A;  1EEM A;  4HU9 A;  1K0A A;  3D21 A;  5D73 A;  1XZO A;  5A4V A;  1ST9 A;  3ZRD A;  4DSQ A;  4HI7 A;  4HUA A;  4HOJ A;  4O5R A;  2HT9 A;  2BTO T;  2HYX A;  1NHY A;  3MAK A;  3H93 A;  5JCW A;  2IFQ A;  1DE2 A;  1H75 A;  1JZR A;  1Z3E A;  5IM9 A;  2N5B A;  4MZC A;  2ON7 A;  3VLN A;  1Z6N A;  5DCG A;  2GSQ A;  3MNG A;  4ACS A;  2VO4 A;  5IIZ A;  5KN0 A;  2VLT A;  4TRX A;  1SL1 B;  2RLI A;  2K8V A;  1TU7 A;  4XIH A;  5JCU A;  1BED A;  4NWY A;  5FWG A;  1U88 A;  2DBC A;  1DUG A;  4MNN A;  2XC2 A;  1WJK A;  2IMD A;  4MAB A;  3QCP A;  2IME A;  3GRX A;  2H0H A;  5HR0 A;  2AYT A;  2VL9 A;  2FA8 A;  1O6J A;  2LJA A;  3KIJ A;  3M9J A;  1UN2 A;  1GNW A;  3I43 A;  3FY7 A;  1FVJ A;  2C4J A;  2O8V B;  3WYW A;  2H30 A;  1X0R A;  2OE0 A;  4JED A;  4TXO A;  3ZIJ A;  3ERG A;  2X64 A;  4P3Y B;  1YY7 A;  3DWV A;  5C00 A;  5CRG A;  3Q18 A;  4YQV A;  5J41 A;  4TOP A;  1CQH A;  1ML6 A;  3C7M A;  3SWL A;  4WR5 A;  2HXK A;  1YF0 A;  1EOG A;  2PMT A;  1RK4 A;  3IPZ A;  5HFI A;  1GTU A;  3TJB A;  4NHW A;  2B5X A;  1S3D A;  3A2W A;  2V6K A;  1FOH A;  3VUR A;  3GNJ A;  2YAN A;  3D22 A;  2D2Z A;  3LXT A;  5EVO A;  1F2E A;  3TUE A;  1KNG A;  1PKW A;  5ELG A;  3L9S A;  4O92 A;  5HFK A;  6GSY A;  1K3L A;  3G7J A;  3DVW A;  4ML1 A;  3FW2 A;  4MH2 A;  6GSV A;  4I8B A;  4K7N A;  4ULX A;  4TR1 B;  4IQ1 A;  1XPV A;  4V1A p;  3C73 A;  1MEK A;  3M9K A;  4Q5R A;  3EU3 A;  2FLS A;  2JAD A;  1H4O A;  1RQM A;  3HJM A;  3FEU A;  4L0U A;  1GTB A;  4WKW A;  4EO3 A;  3KH9 A;  3HJP A;  2VOC A;  3CMI A;  17GS A;  1ZYE A;  8GSS A;  2MYG A;  1ZYP A;  2H6Y A;  1B4P A;  1LJR A;  3ZLP A;  2OAD A;  2PN8 A;  3KTB A;  4A5P A;  2BMX A;  2AUV A;  3PPU A;  2B3S A;  1K3Y A;  2VCV A;  5GZZ B;  2LV3 A;  1U3I A;  4LLR A;  4TR4 A;  5ECN B;  2R5G A;  4JR4 A;  2E2M A;  4K5S A;  3N9J A;  2DJ2 A;  1QXH A;  4XRD A;  3GTU B;  5JWQ B;  1UC7 A;  1FB0 A;  3F4S A;  3QOU A;  4V1A g;  1ZYN A;  2GGT A;  3EE2 A;  1ZL9 A;  3VPT A;  1GTI A;  5IPH A;  2F8A A;  3RAZ A;  4OMV A;  2GVP A;  3CTF A;  4NV5 A;  2YOI A;  4EC0 A;  4EDZ A;  5HFG A;  3A5W A;  3TB2 A;  1TU8 A;  3TJJ A;  1V9W A;  3GST A;  2AV4 A;  2V1M A;  1QQ2 A;  4J57 E;  2GS3 A;  2V32 A;  4IP1 A;  4MZB A;  3GH9 A;  5ECH B;  22GS A;  1K0M A;  3HXS A;  4F0B A;  3IC4 A;  1NW2 A;  1TTZ A;  3VWV A;  2V2G A;  2V41 A;  2E7P A;  2GQL A;  4AGS A;  1GSE A;  1A2M A;  5ECR B;  2MZC A;  4JZQ A;  2QA1 A;  5LCZ A;  4HEA 2;  3ZTL A;  1YEX A;  1XFL A;  2B1L A;  2JU5 A;  3CSH A;  4LL1 B;  5GAP D;  4O32 A;  2R0P A;  1PKZ A;  3RBT A;  6GST A;  4TW5 A;  2X4A A;  2CVK A;  2P0G A;  5DJL A;  1XWG A;  1M7T A;  5DDL A;  5B7C A;  2G0F A;  3GUS A;  3MIX A;  2QKE A;  1K0D A;  5BMU A;  3GV1 A;  1BJX A;  3FZ9 A;  4MDC A;  2OJL A;  2QSI A;  1T1V A;  4MA9 A;  1K3O A;  2YJ7 A;  1YJ6 A;  5IOW A;  4XS1 A;  2C3N A;  5GST A;  2I81 A;  3F3R A;  4PGT A;  4ZXG A;  4YQU A;  2PVO C;  5J9B A;  3TJF A;  1PSQ A;  1PD2 1;  3BJ5 A;  4GTU A;  2HSH A;  1V57 A;  2FGX A;  4KF9 A;  3EYT A;  2CVD A;  1M9B A;  1PQN A;  5ABR A;  4N11 A;  1F3A A;  2YCD A;  3TKS A;  2R2J A;  2J9H A;  1T4Z A;  3M0F A;  3FYG A;  4N10 A;  2H66 A;  2C3Q A;  3KCM A;  2YZH A;  2HRF A;  2I9H A;  3ZL5 A;  1G0T A;  3VWX A;  4K0N A;  3TDG A;  5J5N A;  4HDE A;  4FYU A;  3HYP A;  4MF6 A;  4TR1 A;  4ZIL A;  2PU9 C;  3ZFB A;  1SKS B;  5CRW A;  2H1A A;  2H75 A;  1XWA A;  2IFQ B;  3PR8 A;  4EUY A;  3VFI A;  1UA5 A;  2C0F A;  2B7J A;  3WT2 A;  3US3 A;  2NBS A;  3F4T A;  1EP8 A;  2GT6 A;  1O81 A;  2RII A;  2ES7 A;  2F51 A;  3HA9 A;  1T00 A;  4G2E A;  1B9Y C;  5DAL B;  2C1Y A;  1Z7R A;  4OD7 A;  1C72 A;  1XXU A;  4KDX A;  1KBN A;  3KTL A;  3HVV A;  1ILO A;  4IN0 A;  3SBC A;  1GLQ A;  3KMO A;  2KHP A;  4WEY A;  1GWC A;  3RDW A;  2LUS A;  1VF3 A;  1EV4 A;  4OO5 A;  2O89 A;  5GAN D;  5F05 A;  4HJ2 A;  4WBJ A;  3IA1 A;  3BCI A;  4F03 A;  1HNB A;  3ED3 A;  2LNT A;  4V2M A;  5L71 A;  3DVX A;  2XHF A;  2HSY A;  1DBY A;  1XW5 A;  2VLU A;  5IMF A;  5B6M A;  3I9V 2;  1MDI A;  1SYR A;  5D9X A;  3KZQ A;  3JCM L;  4DVC A;  4K8M A;  4TXO B;  4L5O A;  4JU5 A;  4IBP A;  3CBU A;  1BG5 A;  3GKM A;  1GSQ A;  2VL2 A;  1U87 A;  1NM3 A;  1PN9 A;  3D5J A;  4KA0 A;  3QAV A;  3TKQ A;  1K0N A;  2WZ9 A;  1BQ7 A;  5C04 A;  5JWO B;  3DYR A;  4DSR A;  6GSW A;  4IHU A;  1EWX A;  4XRA A;  1SJI A;  4PX1 A;  4V2N A;  1AQV A;  3MDK A;  4E8E A;  4KAE A;  4V2L A;  2HFD A;  1XWK A;  2PGT A;  3E3E A;  1X9S B;  2A4V A;  3QPM A;  1GP1 A;  4GST A;  1MD4 A;  1JZW A;  1O85 A;  3ZMK A;  4NMU A;  4EKZ A;  1SJ6 A;  3D4M A;  2OBK A;  3VI5 A;  3UJ1 A;  2VCZ A;  2FY6 A;  1A8Y A;  2VUP A;  4POK A;  2YPM A;  1M99 A;  2A2R A;  2VCT A;  4AJ7 A;  1G7E A;  3LOR A;  3FRC A;  5AIX A;  4PUR A;  1MTC A;  2N5F A;  4RI7 A;  3HDC A;  5IMA A;  4GCI A;  1X5D A;  4TVE A;  4ZBA A;  1XVQ A;  12GS A;  3KD0 A;  4ZBB A;  1ZZY A;  5ECS A;  18GS A;  4RI6 A;  2HE3 A;  1TP9 A;  1B4Q A;  4MPF A;  1HNA A;  2RUE A;  3CRU A;  5IPG A;  1OC8 A;  3PH9 A;  1AXD A;  2R4V A;  2C8U A;  4WXT A;  4JR6 A;  1XW9 A;  3IHG A;  1XWC A;  1THO A;  4JE1 A;  5G1L A;  1PN0 A;  1V98 A;  1JHB A;  4LMV A;  3ZRE A;  1EGR A;  4HZ2 A;  2C80 A;  4PXO A;  4USS A;  4JBB A;  4J2F A;  1OVN A;  2WGR A;  4ECC A;  4OWY A;  4GQC A;  1AQX A;  3F0I A;  4MLY A;  5GSS A;  3TKR A;  4ILF A;  1NHO A;  2LRN A;  1HNC A;  5EY6 A;  4X4J A;  2MMZ A;  3F9U A;  4ZL8 A;  4TR0 A;  2DJ3 A;  2CT6 A;  2XBI A;  3L78 A;  2K6V A;  5DAL A;  4ICY A;  2NVL A;  4Z2U A;  4O5Q A;  4ZL7 A;  6GSS A;  1Z6M A;  4GXZ A;  1GSU A;  1UVZ A;  4KCA A;  2FHE A;  4IVF A;  2GZP A;  2GT5 A;  3IK7 A;  4ZL9 A;  5DAK A;  1GSD A;  16GS A;  3I6A A;  4ZB6 A;  2FNO A;  4KND A;  3FR6 A;  2CAQ A;  2PVQ A;  3TKS C;  4XS4 B;  3GA4 A;  2QGV A;  1M2D A;  3EUR A;  2VM2 A;  3GUR A;  4PQ1 A;  1EGO A;  3H79 A;  4OO4 A;  5G5F A;  2MMN A;  3UL3 A;  2X99 A;  4KDY A;  5H5Q A;  3RHB A;  4DEJ A;  2HZE B;  4PQH A;  3NOF A;  4G10 A;  1AQW A;  4E8H A;  4EF0 A;  2VLV A;  2FWE A;  1MD3 A;  2DJ0 A;  3FZ4 A;  1WE0 A;  1ERV A;  4HU7 A;  3M1G A;  2RM5 A;  2L5L A;  2RM6 A;  3C1R A;  3HZ8 A;  5HR2 A;  1GNE A;  2LTK A;  2TRX A;  2TIR A;  2CX3 A;  3CSJ A;  3LWA A;  3C71 A;  1SK0 A;  1CQG A;  2CV4 A;  1A2L A;  2L59 A;  2B7K A;  3G7I A;  4YAP A;  5ECO B;  4ID0 A;  2KLX A;  2HNL A;  3GFK A;  3DD3 A;  5BRT A;  4K0G A;  2H1G A;  5FHI A;  2H74 A;  2XBQ A;  3HKR A;  4F9Z A;  4CDO A;  5ID2 A;  3LG6 A;  5J4U A;  2H6X A;  5KOX A;  3GHA A;  2M46 A;  4KCE A;  4MCU A;  3CYN A;  1Y25 A;  2OBI A;  2REM A;  4G0K A;  3FHK A;  2VL2 C;  2X8C A;  3L9V A;  1B9X C;  2JZT A;  1AIU A;  3IHQ A;  2GLR A;  4IP6 A;  2IN3 A;  1BX9 A;  5J9C A;  3EU4 A;  4CY6 A;  3LSZ A;  1TXX A;  3L4N A;  4K7O A;  2X49 A;  3GIX A;  3DKS A;  5DQY A;  1XOB A;  1GL8 A;  3Q74 A;  3A5I A;  3TJK A;  3TRQ A;  4K6X A;  2AB6 A;  4I97 A;  2O85 A;  2PPT A;  5ECQ B;  2WJU A;  2FA4 A;  1G7O A;  2JL4 A;  2B5Y A;  1PL2 A;  2L4Q A;  4HS1 A;  5F07 A;  3HVS A;  1GH2 A;  1JLV A;  1HD2 A;  4K7I A;  2F9S A;  2YP6 A;  3M8N A;  2K8S A;  3VWW A;  1SK2 A;  2FWH A;  3C1S A;  5CRD A;  3DIE A;  4ZB9 A;  2F8F A;  3WT1 A;  1R4W A;  2M80 A;  1TK8 B;  3F4R A;  2LST A;  1VRS D;  3TGZ A;  4F2I A;  2CX4 A;  3R3E A;  3GKN A;  5D93 A;  2H0I A;  3W8J A;  5IO0 A;  4KSM A;  5AN1 A;  4IGJ A;  4X1U A;  5HQP A;  1PA3 A;  4XS4 A;  3ZIT A;  4FIW A;  3QMX A;  2K9F A;  2DML A;  4AF2 A;  4OFT A;  1U3A A;  2PER A;  3IC8 A;  2IIY A;  4NXI A;  5IOX A;  3NZN A;  2LQO A;  6GSX A;  5CO3 A;  1Z7P A;  2HZE A;  1Q98 A;  1O73 A;  3ZYW A;  5CAX A;  1SKR B;  2DKI A;  5DCH A;  3APS A;  2FUG 2;  3WGD A;  3RHC A;  1Y6E A;  5J3R A;  3GX0 A;  2CVB A;  2VD1 A;  2LEG A;  4YAV A;  2L6C A;  2I4A A;  5KN3 A;  2R37 A;  3KMN A;  1G6W A;  1FHE A;  2KUC A;  4IEL A;  3S9F A;  1TK5 B;  3A2V A;  1THX A;  2YWI A;  4POB A;  4RQR A;  6GSU A;  1E6B A;  1FB6 A;  1YEP A;  2H72 A;  2VM1 A;  2ON5 A;  3KXO A;  3UMA A;  2I1U A;  1GTA A;  3EC3 A;  5KN1 A;  3GKK A;  1YKA A;  2EC4 A;  2LRT A;  3TRX A;  2UZ8 A;  4YKG A;  2J23 A;  4EXJ A;  3G7Y A;  2WCI A;  3ISO A;  2H8L A;  4G0I A;  2H71 A;  2DKH A;  2V6O A;  1Z5Y E;  5COH A;  3IOS A;  1AUC A;  3QFA C;  2EIO A;  1ERW A;  3J7Y k;  1JLW A;  4KUN A;  1X5C A;  3VWU A;  3D0Z A;  2CZ3 A;  3UVT A;  2XPD A;  4HZ4 A;  2VIM A;  5EPF A;  1ZYQ B;  11GS A;  1SL0 B;  1W89 A;  1J08 A;  1X9W B;  1WPI A;  2EIR A;  1AW9 A;  4AJ6 A;  3DEX A;  3IAS 2;  2YWN A;  3FK8 A;  1R7H A;  3PGT A;  1QGV A;  5ECI B;  4F0C A;  4OCF A;  3KEB A;  2X8H A;  2KP1 A;  1JFU A;  5IQY A;  3BOA A;  4ECJ A;  4BVX B;  3ME7 A;  1G6Y A;  4Z2T A;  1R5P A;  13GS A;  2X8G A;  3UBK A;  4YH2 A;  4KB3 A;  4IJI A;  1EEJ A;  3AY8 A;  5DAK B;  4G19 A;  4WET A;  3ERF A;  4KGI A;  4N0Z A;  3LXZ A;  5CRE A;  1SL2 B;  3D6I A;  1AAZ A;  2BJX A;  3I69 A;  4TKY A;  4K9Z A;  4ML6 A;  3GSS A;  9GSS A;  2LS5 A;  1PX6 A;  3D4T A;  1B8X A;  2H76 A;  3FKF A;  4I2U A;  4QL7 A;  4BL7 B;  3CTG A;  4EIQ A;  2NDO A;  1SKW B;  2B1K A;  1QFN A;  1TOF A;  4Q5Q A;  4J56 E;  3K8N A;  4NHZ A;  3KGK A;  1OAZ A;  1A0R P;  3LQ7 A;  1WOU A;  2YWM A;  2DLX A;  5A5K A;  4EVM A;  4O7H A;  1GUL A;  2GDR A;  4BPY A;  1FO5 A;  5G5E A;  4KX4 A;  4GQF A;  2NPB A;  5G1K A;  4LMW A;  4FYB A;  4F82 A;  1YDK A;  2ALB A;  2CQ9 A;  4GRF A;  3ZZX A;  5D8I A;  2IMK A;  3DML A;  4K1F A;  2NTO A;  4OCE A;  5D9T A;  2RUF A;  1XBS A;  3U6V A;  2LRC A;  2O7K A;  5ID2 B;  2HRA A;  5AGY A;  5E4W A;  5IMD A;  3LFL A;  3KP8 A;  1O8W A;  1O8X A;  2OE1 A;  2HRK A;  3GMF A;  2E2G A;  2LJR A;  4TN8 A;  2WB9 A;  3L9U A;  4X0X A;  3E0U A;  3ZFL A;  2HI7 A;  2I3Y A;  4IKH A;  2C0G A;  3UAP A;  4MPG A;  4WF5 A;  1VF2 A;  1TDI A;  2FWG A;  4MJB A;  2H19 A;  5JWR B;  5D96 A;  3H8Q A;  2YJH A;  3BD2 A;  1KTE A;  3F3Q A;  1YQ1 A;  2MMO A;  2L4C A;  2GSS A;  1BAY A;  1NSW A;  2GZZ A;  1FG4 A;  4XCS A;  2TRC P;  4MP4 A;  2DIY A;  5H5R A;  2H1B A;  2IPA A;  2H1D A;  2ZCT A;  4EE0 A;  3DGQ A;  3LYK A;  4Q5F A;  5H5S A;  3TJG A;  5AIV A;  2B6M A;  2L6D A;  3GL5 A;  1ZGN A;  4N30 A;  3FR9 A;  1EZK A;  1BYE A;  1U6T A;  2R0G A;  4PUA A;  4MZW A;  4QL9 A;  1X9M B;  3LW9 A;  3ME8 A;  3H4K A;  3ZVJ A;  4BVX A;  3EIN A;  5E59 A;  1XCC A;  1FOV A;  4HQZ A;  2IJY A;  4EL1 A;  4MJE A;  3UIW A;  2H0G A;  5G2Z A;  3QAW A;  4D73 B;  3EMX A;  4PTS A;  1N2A A;  1IYI A;  3HZ4 A;  1TRS A;  4MJA A;  3APO A;  4DSS A;  3O6T A;  5G31 A;  2VCW A;  3IXR A;  4ECI A;  2A4H A;  3WGX A;  3MWH A;  1LBK A;  1SJZ A;  1QK8 A;  2O87 A;  1W4V A;  2R6K A;  3MSZ A;  4WR4 A;  1WP0 A;  3IK9 A;  2VAF A;  5ECL B;  2LJK A;  2IMI A;  4BVY A;  2AJQ B;  4BL7 A;  2HLS A;  1XVW A;  4FQU A;  5AIS A;  5IO2 A;  1HQO A;  1FVK A;  3P8W A;  4IS0 A;  2JZR A;  2WS2 A;  1GUK A;  1TRW A;  4MF7 A;  3IDV A;  3VK9 A;  1URM A;  1WWJ A;  1TKD B;  5D9W A;  2GZY A;  3F8U A;  2HRN A;  3LYP A;  1XWB A;  3M3M A;  4ZIJ A;  1RW1 A;  3VPQ A;  5ECK B;  1TI1 A;  3P2A A;  3Q19 A;  1S3A A;  2DIZ A;  1ERT A;  5JCG A;  19GS A;  4GSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...