2HRFA

Solution structure of cu(i) p174l hsco1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
SFTGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCLEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCO1 protein homolog, mitochondrial
publication title Human Sco1 functional studies and pathological implications of the P174L mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 55
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hrfA00
2IMFA 4MK3A 2VLVA 4F2IA 2C80A 3GSTA 4GSSA 1EOHA 1UA5A 4MP4A 6GSSA 2WB9A 2EIOA 2VCVA 1TI3A 3L78A 1K3YA 3C71A 2ES7A 2YCDA 2WGRA 2FGXA 2H19A 13GSA 3NIVA 3W6GA 1OAZA 3RPNA 4MCUA 2VM2A 3UL3A 3IPZA 3ZL5A 4N11A 1LU4A 2LJKA 2HZEB 4IELA 3TJGA 3QD9A 3D5JA 1SJZA 1V9WA 2MBTA 1SL0B 2ON5A 1J08A 2GQKA 3F3QA 4EDYA 5JCGA 1EEJA 19GSA 1AW9A 2K6VA 1V40A 1ZOFA 4BWSA 3TJKA 4HEA2 4CHSA 4POBA 1LBKA 2DJ0A 1O85A 3FR3A 5EVOA 4IP1A 1SKSB 4BVYA 4XS4A 3Q74A 4WBRD 2H0IA 5AIXA 3IE3A 1SL2B 4PX1A 3GRXA 2O8VB 2A4VA 1GSDA 1V57A 4PNGA 1X5CA 3IC4A 4N0ZA 5CAXA 4IW9A 3RHCA 3ZZXA 1JHBA 4NMUA 5J9CA 2MBSA 3TRXA 5CNWA 2B5YA 3HXSA 4NWYA 4MABA 4MF6A 4KH7A 1K0NA 4RQRA 2LS5A 3GA4A 2IMEA 1A0FA 3GMFA 2BJXA 3CMIA 2ALBA 3UVTA 1Q98A 1XZOA 3FEUA 3FRCA 1WJKA 1FG4A 5AISA 3UMAA 2YV7A 1M7TA 9GSSA 2RUEA 1ERTA 4KDXA 4J57E 4KX4A 2LNSA 4FH8A 1AAZA 1G7EA 3CTGA 1B4QA 1FVKA 2LEGA 1K3OA 1ZCPA 4OMVA 4TR4A 1K0OA 3QAWA 2HRFA 3M9JA 2QSIA 3ERWA 2C3NA 4ECIA 1TU7A 2L4CA 2YOIA 11GSA 3TUEA 2IMIA 1TU8A 4QL7A 5D9WA 2VL3A 3GV1A 1OE7A 3MAKA 2OKAA 2VCWA 4LLRA 3ZMLA 2LRTA 3JCML 2B6MA 2C3QA 1SYRA 3G7IA 5IMDA 3GH6A 2F51A 1QGVA 4K7IA 3C1SA 2C0DA 2NDOA 1G0TA 2CX4A 2WZ9A 3FR9A 3TKQA 4O5RA 3ERFA 1GTUA 4HZ2A 5D9TA 4MZWA 20GSA 3KH9A 1A0RP 1BX9A 1SJ6A 1QXHA 3WGXA 1N2AA 1RK4A 5CO3A 1ZMAA 3QR6A 1NSWA 5ECKB 1XFLA 1UVZA 1TRUA 3GX0A 2MMAA 2X99A 2N5FA 4RUVA 4IKHA 3PR8A 3TJFA 1TKDB 1ST9A 1PN9A 4FO5A 3ZVJD 1GLQA 1XWKA 5CYYA 2K8VA 4TR0A 4GXZA 3ZLPA 3W8JA 4K7OA 2FY6A 4ZB8A 5JCWA 2OE1A 2YJ7A 3DXBA 1CQGA 5IMFA 1GUMA 5E4WA 5F05A 5KN0A 1F3BA 3WYWA 2MZCA 1OC8A 3CSIA 1W4VA 1V2AA 3FR6A 2B5XA 4POKA 2RM5A 4KUNA 1LJRA 1JZRA 3ZMKA 3UARA 3VWUA 3RPPA 4FIWA 3F9UA 1J0FA 4FYUA 2WJUA 4RI6A 2LKUA 1OC9A 1UN2A 5DAKA 1O8WA 5ECLB 2GLRA 3IHQA 1SYXA 2YV9A 3ZFLA 5LCZA 3IA1A 2OBKA 3QCPA 2H72A 1YKAA 5KN3A 1V58A 1ZGNA 3GUSA 3GX8A 1Z3EA 4L5LA 1PRXA 4I2UA 4IJ3A 5FT3A 4GCIA 4IHUA 1FOVA 4TOPA 4EL1A 5HFKA 2V6OA 4XS6A 5F0GA 2FHEA 3HVXA 3GTUB 2XC2A 3I6AA 5IO2A 1TI1A 2DJ2A 3FHKA 2HI7A 2OE3A 5IMVA 2B7KA 1FHEA 3H1NA 4ILFA 4NHWA 4L8EA 1BQ7A 5ECSA 1WE0A 2L6DA 3M0FA 4TKYA 2IMKA 1U3AA 4PUFC 1F6MC 3HJMA 1XW6A 4BA7A 4F9ZA 4K2DA 2M46A 4EDZA 3DWVA 2PGTA 1Z6MA 4ZILA 2NVLA 2L57A 4G19A 2IMDA 3GN3A 5EPFA 2B1LA 2CAIA 1BAYA 2JSZA 4HU7A 1YF1A 2WRTA 2LSTA 2VCXA 3KCMA 1KEBA 4HQSA 1GNEA 2YWNA 2DJ3A 3C73A 1EGOA 3QAVA 2RUFA 5JWRB 2QC7A 3F4TA 4IJIA 3F4SA 2OACA 3KIJA 2VD1A 1PKWA 2VL2C 1M9AA 2WCIA 2YZUA 3DVWA 2VUPA 3GL3A 4HS1A 2FA8A 1VRSD 2VIMA 5GAPD 4YQUA 2JU5A 4IQAA 2MMZA 2LJRA 1TRWA 3ME7A 3W8SA 2VL9A 3QMXA 3WD6A 4WETA 5CRHA 3KMOA 3GURA 4HDEA 1XWBA 2PWJA 2GVPA 1R4WA 2NTOA 3L9UA 4XTSA 4HOJA 2B5EA 3KD0A 2OADA 1JFUA 1XVWA 4KSMA 5ECNB 3LGCA 4TW5A 2OA7A 1PL2A 5DALB 1GLPA 1SK1A 2PVOC 2RM6A 3WGDA 4V2LA 4GTUA 3UBLA 5COHA 1EOGA 2H1DA 2VCQA 4E8EA 3LSZA 4XRAA 2H0HA 3GNJA 1MDIA 2WFCA 1EP7A 2VLUA 4JZQA 3DRNA 3TGZA 3QAGA 3PINA 3KGKA 1SENA 1TP9A 5G5EA 10GSA 2GDRA 3TCOA 4F0BA 2PVQA 3IAM2 1M2BA 2L6CA 4MF7A 5H5SA 2CT6A 1ZZYA 2HSYA 4OCFA 5HFIA 2BTOT 3GIXA 4K9ZA 1PQNA 2KUCA 4IBPA 3TJBA 3M9KA 2HXKA 1WMJA 1THOA 3EINA 5IO0A 2C1YA 3ZTLA 5D73A 3HJOA 1HNAA 2GT5A 3F4RA 2P0GA 2H01A 1VF2A 3P2AA 3RAZA 2BMXA 3D4MA 5H5QA 2IFQA 3HD5A 2I3YA 4XS4B 1ZYQB 3HJPA 1XWAA 3ZYWA 2GSSA 2IWTA 1M99A 5IMAA 5ECPB 2WS2A 5G5FA 2RLIA 3LORA 1JLWA 2V1MA 1GSYA 1ABAA 1K0AA 1U3IA 3BJ5A 1X5DA 3FKFA 4L0UA 4K6XA 4G10A 5A5KA 5DDLA 2ON7A 5F06A 1HNBA 3KTBA 3F63A 1XW5A 4OO4A 3LXTA 1QFNA 7GSSA 5DCHA 3IV4A 1Q4JA 4HI7A 4ZB6A 1KNGA 4GF0A 4WF5A 1XVQA 1T4YA 1T4ZA 2KLXA 1YJ6A 3UAPA 3ZITA 1XWCA 3C8EA 2PERA 4YAPA 1GSFA 1PL1A 1MDKA 1T00A 2V32A 1WOUA 3KEBA 2L59A 4ULXA 3LEFA 4X0XA 1XIYA 4L5OA 1PSQA 4GSTA 1Y25A 5D9XA 4L0WA 1MD3A 2DMMA 1A2JA 4G9HA 1SJIA 5G2ZA 2CA8A 4XHMA 4NV5A 1XW9A 1GSSA 4NHZA 3I43A 3IR4A 2L5OA 1FO5A 5GZZB 3U5RE 3LQ7A 4MJBA 4GQFA 4JEDA 4E8HA 3ZIVA 5LNKe 2XPEA 2C0EA 1X9WB 5ELGA 4KB3A 4TXOA 4I2TA 2CAQA 2MMOA 4KNDA 3APQA 3FK8A 2H75A 1EWXA 3A3TA 2JL4A 4V1Ag 1BG5A 5DQSA 4EC0A 1U6TA 2E0QA 1SKWB 2VO4A 2DJKA 2M80A 3VWWA 1AQWA 1GNWA 1IYHA 3I69A 1NHOA 3GHAA 2VD0A 3CYNA 1C72A 2IPAA 5IOXA 1XXUA 3F8UA 2CVBA 3LYKA 3L9VA 5G31A 4IS0A 3EMPA 4PNFA 1N8JA 2JSYA 3A2WA 5KN2A 2EIRA 3VI7A 4I8BA 1ACVA 2YWOA 1T3BA 3KTLA 3LJRA 3Q18A 3D22A 4K7NA 4RI7A 5B8AA 1GUHA 1Z7PA 2B3SA 2X64A 3O3TA 1T8EB 2CZ2A 2HNLA 3DKSA 3DVXA 3GH9A 2C0FA 2GQLA 4V2NA 3KM6A 2KHPA 1M2DA 1A23A 4OWYA 4ZL8A 2K18A 5C04A 4ML1A 1S3DA 2N5AA 4HUAA 3VPTA 1YZXA 1SL1B 1FB0A 1DE1A 2I9HA 2XBQA 2H70A 5AIVA 4IN0A 2DC5A 4KA0A 3LYPA 1TK5B 3IK9A 2AHEA 1TK8B 2YWIA 2DJJA 5J5NA 4BL7A 2VM1A 4GWRA 4LMWA 1JLVA 1XWGA 4HZ4A 1A24A 5AGYA 2H8LA 4MJAA 4HU9A 4X43A 4OFNA 3U6VA 1B4PA 2YP6A 2DBCA 3WT1A 2HFDA 3ERGA 3H4KA 2EC4A 4MDCA 3HCZA 2TIRA 1OC9B 1FVJA 4DEJA 5DAKB 1GTBA 1Z7RA 3VWXA 3N9JA 2V41A 1ZL9A 2HYXA 5FHIA 3APOA 1PMTA 1FAAA 1WWJA 1ZYEA 5G1LA 3BCKA 2MYGA 1SK0A 3GFKA 1GSEA 4OCEA 3MNGA 5F07A 4EF0A 3PH9A 4JRRA 4WR4A 4P3YB 3M8NA 4PURA 1KTEA 1GP1A 2GSQA 3BCIA 5EY6A 4DVCA 1ILOA 1TOFA 5KN1A 3IAS2 1WRYA 4KW6A 2IJYA 4F0CA 2HT9A 3TRQA 5GSSA 4WXTA 5JWOB 2HE3A 5IMZA 3TKRA 1EP8A 4CW9A 3ZFBA 3CRTA 3WGEA 2FWGA 3US3A 4X1UA 1EV4A 1BYEA 3AY8A 4PXOA 5CRGA 3GSSA 5ELAA 2YJHA 4ECJA 2CVKA 1WIKA 2JZSA 5D8IA 2DIZA 3CSJA 3L9SA 1FW1A 4NAXA 2FUG2 1GRXA 4TRXA 5DJMA 3TB2A 4EE0A 3ISOA 5JCUA 3ZREA 4K0NA 3HHVA 2VOCA 5GSTA 1H75A 2NBSA 2L5LA 5ID2A 4MJEA 1ERUA 3RDWA 2LTKA 1QUWA 3HZ8A 1MEKA 5D96A 4ZB9A 3WT2A 3UVHA 1YY7A 3G7YA 1FB6A 1MTCA 4MZCA 1K3LA 1DUGA 4LA1A 4F03A 1F37A 2X8HA 5G30A 4H86A 3TOUA 4MH3A 2V2GA 4O92A 4HJMA 5B8BA 4AGSA 1GSUA 2FNOA 1NM3A 2H1AA 4XRDA 4YH2A 1AIUA 2Z9SA 3GL5A 4PQIA 2F3MA 6GSVA 1R7HA 4FYCA 3EYTA 3EMXA 4JE1A 2IIYA 6GSYA 3CBUA 3QOUA 5HR0A 1X0RA 1QMVA 3J7Yb 3O6TA 4CDOA 4ZL9A 1PX6A 1SK2A 3N5OA 4ECBA 3QDNA 2LQOA 2VLTA 2GT6A 3F6DA 3P8WA 4TR3A 1PKZA 4MF5A 5ECMB 2HLSA 4D73A 1TJDA 2VCZA 2QGVA 1DE2A 3D21A 1SD9A 4GSNA 2I81A 3M3MA 5INYA 4GQCA 1XOAA 1O6JA 1F9MA 1K0DA 4PQ1A 5CREA 5ENUA 1A8LA 5G1KA 5IMCA 1EZKA 4K0GA 4IGJA 3RHBA 6GSWA 1H4OA 4LL4B 2B7JA 2E2MA 1XOBA 1PX7A 5E59A 1I5GA 1M9BA 1TXXA 2H30A 2OBIA 4MPFA 3GKMA 4RQXA 2YN1A 3GYKA 3D6IA 3KXOA 1E6BA 1EV9A 3EURA 1X9SB 3NZNA 2FA4A 2AAWA 1O7UA 5D9VA 3MWHA 2FWHA 2IFQB 3VI5A 5IIZA 4ZBDA 3TOTA 5HFGA 1JZDA 1ERVA 2O85A 1XCCA 4K1FA 1G7OA 2P31A 4MLYA 3KP9A 2C8UA 5DJLA 1AQXA 5JWQB 2F9SA 4Q5QA 3FZAA 2KOKA 3OR5A 3BOAA 1PD21 1R5PA 5IQYA 3VURA 2LV3A 1HD2A 5HR2A 3RBTA 1A2MA 4N0VA 3HY2A 2I4AA 2QKEA 4ZXGA 14GSA 4IP6A 5CRWA 2GZYA 2R6KA 5IM9A 1B9YC 4N30A 1R26A 3BD2A 4DSSA 4MA9A 2I1UA 1G6WA 5J9BA 2DLXA 1K0MA 4TR1A 3D0ZA 2FCHA 4EO3A 2LRCA 3H79A 2C4JA 5A4UA 5H5RA 2GTUA 4POLA 2KP2A 1YQ1A 2G2QA 2FWFA 2N5BA 2R37A 5B6MA 1TK0B 2YANA 3L4NA 4TXOB 2XBIA 1XBSA 2LJAA 4KGIA 4Q5RA 3VK9A 2G0FA 2AYTA 2FWEA 1X9MB 1O81A 4BVXA 2OJLA 3TJJA 3KMNA 1Y6EA 3C7MA 1GTIA 4N10A 3FZ4A 2J9HA 3F6FA 5FWGA 1U87A 1ON4A 2A2RA 2P5QA 5AN1A 1GUKA 2EIQA 4OD7A 2E2GA 4AJ6A 3TKSA 4YQMA 5ECRB 2CZ3A 3BBYA 2TRCP 2PN8A 3EE2A 1GTAA 2X8CA 2LNTA 2HZEA 3Q6OA 2GSTA 2JZTA 4MMMA 4JU5A 3E3EA 4O32A 3CRUA 1ERWA 1VF4A 4WF4A 5IPHA 4XS1A 4OFMA 3UOMA 1EGRA 3GKXA 2H76A 5CRDA 2AUVA 2VAFA 1BJXA 3SBCA 4AF2A 3F3RA 2R2JA 22GSA 3APSA 4KSOA 3O76A 1PGTA 4DSQA 4NV2A 4YQVA 1OVNA 5J3RA 3UEMA 5B7CA 1GSQA 2H71A 1OC3A 3PGTA 2J23A 4WBJA 2CX3A 3EU4A 4PGTA 3IOSA 1A2LA 2WULA 3CSHA 3LXZA 2O7KA 4Q5FA 1AUCA 4ZL7A 3J7Yk 3EWLA 1OYJA 1TDIA 5IPGA 2PUKC 3UJ1A 4KE3A 3A2XA 8GSSA 4AJ7A 3LWAA 3NOFA 3QFAC 5J41A 1YEPA 1IYIA 2C3TA 3IRAA 3IDVA 4K8MA 2GSRA 3MSZA 1UC7A 1MD4A 1SD8A 1QK8A 4QL9A 4EVMA 1THXA 4EUYA 1GULA 3HDCA 1GL8A 1M2AA 4JR6A 1W89A 5F8BA 2LQQA 2XPDA 18GSA 3R2QA 1OKDA 5KEJA 2P5RA 4O7HA 3TKSC 5ABRA 2KP1A 4YAVA 2CVDA 3FW2A 2GZPA 2GQMA 17GSA 2TRXA 2O89A 2WDUA 5D93A 3S9FA 2HSHA 4FYBA 4EXJA 4NPBA 4ML6A 4PQHA 4IVFA 1BEDA 1J9BA 2YZHA 2PPTA 1YF0A 4V1Ap 1S3AA 1AC1A 3TDGA 2OE0A 3FY7A 5HR3A 3FYGA 3FZ9A 5DVBA 2MMNA 4LL1B 2IL3A 1OE8A 4V2MA 1DBYA 1U88A 1AXDA 5CP1A 3VPQA 3EC3A 1TRVA 2JACA 2B1KA 3DGQA 1YDKA 4GRFA 5DQYA 2FLSA 5DCGA 1F2EA 5A4WA 2DMLA 2H6XA 2HZFA 1B8XA 2ZNMA 2X8GA 3MDKA 2AJQB 2H0GA 2D2ZA 1Z5YE 4J56E 2R3XA 4KAEA 4HQZA 1PA3A 3H8QA 2F8AA 4PUAA 12GSA 1KBNA 2R4VA 3TKSE 2R5GA 3V1WA 2NPBA 4DSRA 4I97A 2E7PA 2AB6A 1USBA 4MPGA 1GH2A 4LMVA 4I6XA 5ID2B 1R5AA 2VL2A 4POMA 2C0GA 1QQ2A 2GS3A 3IXRA 2FD3A 1ML6A 3KZQA 1HNCA 2ZUPA 3G9BA 1GWCA 4ZIJA 3IBHA 5HQPA 2DJ1A 5DBQA 5L71A 1Z6NA 1VF3A 3UIWA 1TW9A 1HYUA 2YWMA 4BWQA 2H1BA 1O8XA 2YPMA 1T7PB 1TTZA 2H73A 1SU9A 1VGLA 4J2FA 3Q19A 2GZZA 1VF1A 4NXIA 4WEYA 2LUSA 4XCSA 4ISDA 4MH2A 2XHFA 3KJYA 4QQ7A 1RQMA 3E0UA 4D73B 6GSTA 4BPYA 5GAND 1T1VA 5C00A 3I9V2 3M1GA 1K0CA 2V6KA 4ID0A 2ZCTA 3A2VA 4GLTA 1E2YA 1NHYA 5J4UA 3TKPA 1WP0A 1URMA 4OO5A 3K8NA 3DEXA 2H6ZA 3ME8A 2PBJA 3HYPA 2O87A 3ZIJA 1V98A 4Z7XA 4TN8A 3DD3A 3HZ4A 4MJCA 1K0BA 5HR1A 2PMTA 3P90A 3ZRDA 4I5QA 2H1GA 4KDUA 4WR5A 3GTUA 4KCEA 2REMA 3VLNA 4TXVA 2M72A 3D4TA 3HVVA 3TRPA 4OFTA 1SKRB 1EEMA 1HQOA 3FZ5A 1B48A 1JZWA 3GKKA 4ZBAA 2LRNA 4JBBA 4KDYA 1A8YA 3LG6A 1NW2A 3UBKA 3F0IA 3C1RA 4AJ8A 4ECCA 1JZOA 2DIYA 3ED3A 2L4QA 3KH7A 2H6YA 2F8FA 5IOWA 2K8SA 3P7XA 1F3AA 1YEXA 2CQ9A 2VCTA 4F82A 4G2EA 2GGTA 6GSUA 1I9DA 3GKNA 3CTFA 4ZBBA 1RW1A 3HKRA 1B9XC 1CQHA 2A2SA 2JADA 16GSA 1S3CA 1MDJA 5A4VA 3VFIA 3L0HA 2IN3A 5ECQB 5B6NA 2H66A 3KP8A 1DSBA 3DIEA 4EKZA 2HRNA 2RIIA 3E9JB 1G6YA 1TRSA 3CXGA 3DYRA 3LFLA 4TVEA 4XIHA 1M0UA 4IQ1A 3VWVA 3QPMA 1AQVA 3EVIA 3A5WA 4WKWA 3SWLA 5ECOB 4KCAA 5ECIB 4MZBA 2JZRA 3DMLA 4ACSA 3H93A 3IK7A 3ZVJA 4DSSB 3EU3A 2H74A 2PU9C 3QFBC 2CV4A 4TR1B 1Z9HA 3G7JA 4Q5NA 3HVSA 2DSAA 6GSXA 1X5EA 2YNXA 5ECHB 4HJ2A 2AV4A 3HA9A 1OKTA 1O73A 1XPVA 5LD0A 1WPIA 5DALA 1YKCA 5EL8A 2K9FA 4JR4A
chains in the Genus database with same CATH superfamily
2IMFA 4MK3A 2VLVA 1M3IA 2C80A 4F2IA 3GSTA 4GSSA 1EOHA 1UA5A 4MP4A 6GSSA 2WB9A 2EIOA 2VCVA 1TI3A 4BVXB 3L78A 1K3YA 3C71A 2ES7A 2YCDA 2WGRA 2FGXA 2H19A 13GSA 3NIVA 3W6GA 1OAZA 3RPNA 4MCUA 2VM2A 3UL3A 3IPZA 3ZL5A 4N11A 1LU4A 2LJKA 2HZEB 4IELA 3TJGA 3QD9A 3D5JA 1SJZA 1V9WA 2MBTA 1SL0B 2ON5A 1J08A 2GQKA 3F3QA 4EDYA 5JCGA 1EEJA 19GSA 1AW9A 2K6VA 1V40A 1ZOFA 4BWSA 3TJKA 4HEA2 4CHSA 4POBA 1LBKA 2DJ0A 1O85A 3FR3A 5EVOA 4IP1A 1SKSB 4BVYA 4XS4A 3Q74A 4WBRD 2H0IA 5AIXA 3IE3A 1SL2B 4PX1A 3GRXA 2O8VB 2A4VA 4A5PA 1GSDA 1V57A 4PNGA 1X5CA 3IC4A 4N0ZA 5CAXA 4IW9A 3RHCA 3ZZXA 1JHBA 4NMUA 5J9CA 2MBSA 3TRXA 5CNWA 2B5YA 3HXSA 4NWYA 4MABA 4MF6A 4KH7A 1K0NA 4RQRA 2LS5A 3GA4A 2IMEA 1A0FA 3GMFA 2BJXA 3CMIA 2ALBA 3UVTA 1Q98A 1XZOA 3FEUA 3FRCA 1WJKA 1FG4A 5AISA 3UMAA 2YV7A 1M7TA 9GSSA 2RUEA 1ERTA 4KDXA 4J57E 4KX4A 2LNSA 4FH8A 1AAZA 1G7EA 3CTGA 1B4QA 1FVKA 2LEGA 1K3OA 1ZCPA 4OMVA 4TR4A 1K0OA 3QAWA 2HRFA 3M9JA 2QSIA 3ERWA 2C3NA 4ECIA 1TU7A 2L4CA 3LW9A 2YOIA 4K5SA 11GSA 1S3RA 3TUEA 2DKIA 2IMIA 1TU8A 4QL7A 5D9WA 2VL3A 3GV1A 1OE7A 2R0GA 3MAKA 2OKAA 2VCWA 4LLRA 3PPUA 3ZMLA 4PTSA 2LRTA 3JCML 2B6MA 2C3QA 1SYRA 3G7IA 5IMDA 3GH6A 2F51A 1QGVA 4K7IA 3C1SA 2C0DA 2NDOA 1G0TA 2CX4A 2WZ9A 3FR9A 3TKQA 4O5RA 3ERFA 1GTUA 4HZ2A 5D9TA 4MZWA 20GSA 3KH9A 1A0RP 1BX9A 1SJ6A 1QXHA 2QA1A 3WGXA 4G0KA 1N2AA 1RK4A 5CO3A 1ZMAA 3QR6A 1NSWA 5ECKB 1XFLA 1UVZA 1TRUA 3GX0A 2MMAA 2X99A 2N5FA 4RUVA 4IKHA 3PR8A 3TJFA 1TKDB 1ST9A 1PN9A 4FO5A 3ZVJD 1GLQA 1XWKA 5CYYA 2K8VA 4TR0A 4GXZA 3ZLPA 3W8JA 4K7OA 4O5QA 2FY6A 2R0PA 4ZB8A 5JCWA 2OE1A 2YJ7A 3DXBA 3MYDA 1CQGA 5IMFA 1GUMA 5E4WA 5F05A 5KN0A 1F3BA 3WYWA 2MZCA 1OC8A 3CSIA 1W4VA 1V2AA 3FR6A 2B5XA 4POKA 2RM5A 4KUNA 1LJRA 1JZRA 3ZMKA 3UARA 4G0IA 3VWUA 3RPPA 3MIXA 4FIWA 3F9UA 1J0FA 4FYUA 2WJUA 4RI6A 2LKUA 1OC9A 1UN2A 5DAKA 1O8WA 2GLRA 5ECLB 3IHQA 1SYXA 2YV9A 3ZFLA 5LCZA 3IA1A 2OBKA 3QCPA 2H72A 1YKAA 5KN3A 1V58A 1ZGNA 3GUSA 3GX8A 1Z3EA 4L5LA 1PRXA 4I2UA 2HRAA 4IJ3A 5FT3A 4GCIA 4IHUA 1FOVA 4TOPA 4EL1A 5HFKA 2V6OA 4XS6A 5F0GA 2FHEA 3HVXA 3GTUB 2XC2A 3I6AA 5IO2A 1TI1A 2DJ2A 3FHKA 2HI7A 2OE3A 5IMVA 2B7KA 1FHEA 3H1NA 4ILFA 4NHWA 4L8EA 1BQ7A 5ECSA 1WE0A 2L6DA 2X4AA 3M0FA 4TKYA 2IMKA 1U3AA 4PUFC 1F6MC 3HJMA 1XW6A 4BA7A 4F9ZA 4K2DA 2M46A 4EDZA 3DWVA 2PGTA 1Z6MA 3A5IA 4ZILA 2NVLA 2L57A 4G19A 2IMDA 3GN3A 2B1LA 5EPFA 2CAIA 1BAYA 2JSZA 4Z2TA 4HU7A 1YF1A 2WRTA 2LSTA 2VCXA 3KCMA 1KEBA 4HQSA 1GNEA 2YWNA 2DJ3A 3C73A 1EGOA 3IC8A 3QAVA 4X4JA 2RUFA 5JWRB 2QC7A 3F4TA 4IJIA 3F4SA 2OACA 3KIJA 2VD1A 1PKWA 2VL2C 1M9AA 2WCIA 2YZUA 3DVWA 2VUPA 3GL3A 4HS1A 2FA8A 1VRSD 2VIMA 5GAPD 4YQUA 2JU5A 4IQAA 2MMZA 2LJRA 1TRWA 3ME7A 3W8SA 2VL9A 3QMXA 3WD6A 4WETA 5CRHA 3KMOA 3GURA 4HDEA 1XWBA 2PWJA 2GVPA 1R4WA 2NTOA 3L9UA 4XTSA 4HOJA 2B5EA 3KD0A 2OADA 1JFUA 1XVWA 4KSMA 5ECNB 3LGCA 4TW5A 2OA7A 1PL2A 5DALB 1GLPA 1SK1A 2PVOC 2RM6A 3WGDA 4V2LA 4GTUA 3UBLA 5COHA 1EOGA 2H1DA 2VCQA 4E8EA 3LSZA 4XRAA 2H0HA 3GNJA 1MDIA 2WFCA 1EP7A 2VLUA 4JZQA 3DRNA 3TGZA 3QAGA 3PINA 4Z2RA 3CQFA 3KGKA 1SENA 1TP9A 5G5EA 10GSA 2GDRA 3TCOA 4F0BA 2PVQA 3IAM2 1M2BA 2L6CA 4MF7A 5H5SA 2CT6A 1ZZYA 2HSYA 4OCFA 5HFIA 2BTOT 3GIXA 4K9ZA 1PQNA 2KUCA 4IBPA 3TJBA 3M9KA 2HXKA 1WMJA 1THOA 1PN0A 3EINA 5IO0A 2C1YA 3ZTLA 5D73A 3HJOA 1HNAA 2GT5A 3F4RA 2P0GA 2H01A 1VF2A 3P2AA 3RAZA 2BMXA 3D4MA 5H5QA 2IFQA 3HD5A 2I3YA 4XS4B 4G0LA 1ZYQB 3HJPA 1XWAA 3ZYWA 2GSSA 2IWTA 1M99A 5IMAA 5ECPB 2WS2A 5G5FA 2RLIA 3LORA 1JLWA 2V1MA 1GSYA 1ABAA 1K0AA 4L0UA 1U3IA 1X5DA 3BJ5A 3FKFA 4K6XA 4G10A 5A5KA 5DDLA 2ON7A 5F06A 1HNBA 3KTBA 3F63A 1XW5A 4OO4A 3LXTA 1QFNA 7GSSA 5DCHA 3IV4A 1Q4JA 4HI7A 4ZB6A 1KNGA 4GF0A 4WF5A 3R3EA 1XVQA 1T4YA 1T4ZA 2KLXA 1YJ6A 3UAPA 3ZITA 1XWCA 3C8EA 2PERA 4YAPA 1GSFA 1PL1A 1MDKA 1T00A 2V32A 4O5UA 1WOUA 3KEBA 2L59A 4ULXA 3LEFA 4X0XA 1XIYA 4L5OA 1PSQA 4GSTA 1Y25A 5D9XA 4L0WA 1MD3A 1PFOA 2DMMA 1A2JA 4G9HA 1SJIA 1M3JA 5G2ZA 2CA8A 4XHMA 4NV5A 1XW9A 4Z2UA 1GSSA 4NHZA 3I43A 3IR4A 2L5OA 1FO5A 5GZZB 3U5RE 3LQ7A 4MJBA 4GQFA 4JEDA 4E8HA 3ZIVA 5LNKe 2XPEA 2C0EA 1X9WB 5ELGA 4KB3A 4TXOA 4I2TA 2CAQA 2MMOA 4KNDA 3APQA 3FK8A 2H75A 1EWXA 3A3TA 2JL4A 4YKFA 4V1Ag 1BG5A 5DQSA 4EIQA 4EC0A 1U6TA 2E0QA 1SKWB 2VO4A 2DJKA 2M80A 3VWWA 1AQWA 1GNWA 1IYHA 3I69A 1NHOA 3GHAA 2VD0A 3CYNA 1C72A 2IPAA 5IOXA 1XXUA 4YKGA 3F8UA 2CVBA 3LYKA 3L9VA 5G31A 4IS0A 3EMPA 4PNFA 1N8JA 2JSYA 3A2WA 5KN2A 2EIRA 3VI7A 4I8BA 1ACVA 2YWOA 1T3BA 3KTLA 3LJRA 3Q18A 3D22A 4K7NA 4RI7A 5B8AA 1GUHA 1Z7PA 2B3SA 2X64A 3O3TA 1T8EB 2CZ2A 2HNLA 3DKSA 3DVXA 3GH9A 2C0FA 2GQLA 4V2NA 3KM6A 2KHPA 1M2DA 1A23A 4OWYA 4ZL8A 2K18A 5C04A 4ML1A 1S3DA 2N5AA 1ZYPA 4HUAA 3VPTA 1YZXA 1SL1B 1FB0A 1DE1A 2I9HA 2XBQA 2H70A 4KA0A 4IN0A 2DC5A 5AIVA 3LYPA 1TK5B 3IK9A 2AHEA 1TK8B 2YWIA 2DJJA 5J5NA 4BL7A 2VM1A 4GWRA 4LMWA 1JLVA 1XWGA 4HZ4A 1A24A 5AGYA 2H8LA 4MJAA 4HU9A 4X43A 4OFNA 3U6VA 1B4PA 2YP6A 2DBCA 3WT1A 2HFDA 3ERGA 3H4KA 2EC4A 4MDCA 3HCZA 2TIRA 1OC9B 1FVJA 4DEJA 5DAKB 4ICYA 1GTBA 1Z7RA 3VWXA 3N9JA 2V41A 1ZL9A 2HYXA 5FHIA 3APOA 1PMTA 1FAAA 1WWJA 1ZYEA 5G1LA 3BCKA 2MYGA 1SK0A 3GFKA 1GSEA 4OCEA 3MNGA 5F07A 4EF0A 3PH9A 4JRRA 4WR4A 4P3YB 3M8NA 4PURA 1KTEA 1GP1A 2GSQA 3BCIA 5EY6A 4DVCA 1ILOA 1TOFA 5KN1A 3IAS2 1WRYA 4KW6A 2IJYA 4F0CA 2HT9A 3TRQA 5GSSA 4WXTA 5JWOB 2HE3A 5IMZA 3TKRA 1EP8A 4CW9A 3ZFBA 3CRTA 3WGEA 2FWGA 3US3A 4X1UA 1EV4A 1BYEA 3AY8A 4PXOA 5CRGA 3GSSA 5ELAA 2YJHA 3EPTA 4ECJA 2CVKA 1WIKA 2JZSA 5D8IA 2DIZA 3CSJA 3L9SA 1FW1A 4NAXA 2FUG2 1GRXA 4TRXA 5DJMA 3TB2A 4EE0A 3ISOA 5JCUA 3ZREA 4K0NA 3HHVA 2VOCA 5GSTA 1H75A 2NBSA 2L5LA 5ID2A 4MJEA 1ERUA 3RDWA 2LTKA 1QUWA 3HZ8A 1MEKA 5D96A 4ZB9A 3WT2A 3UVHA 1YY7A 3G7YA 1FB6A 1MTCA 4MZCA 1K3LA 1DUGA 4LA1A 4F03A 1F37A 2X8HA 5G30A 4H86A 3TOUA 4MH3A 2V2GA 4O92A 4HJMA 5B8BA 4AGSA 1GSUA 2FNOA 1NM3A 2H1AA 4XRDA 4YH2A 1AIUA 2Z9SA 5BRTA 3GL5A 4PQIA 2F3MA 6GSVA 1R7HA 4FYCA 3EYTA 3EMXA 4JE1A 2IIYA 6GSYA 3CBUA 3QOUA 5HR0A 1X0RA 1QMVA 3J7Yb 3O6TA 4CDOA 4ZL9A 1PX6A 1SK2A 3N5OA 4ECBA 3QDNA 2LQOA 2VLTA 2GT6A 3F6DA 3P8WA 4TR3A 1PKZA 4MF5A 5ECMB 2HLSA 4D73A 1TJDA 2VCZA 1FOHA 2QGVA 1DE2A 3D21A 1SD9A 4CY6A 4GSNA 2I81A 2HSMA 5KOWA 3M3MA 5INYA 4GQCA 1XOAA 1O6JA 1F9MA 1K0DA 4PQ1A 5CREA 5ENUA 1A8LA 5G1KA 5IMCA 1EZKA 4K0GA 4IGJA 3RHBA 6GSWA 1H4OA 4LL4B 2B7JA 2E2MA 1XOBA 1PX7A 5E59A 1I5GA 1M9BA 1TXXA 2H30A 2OBIA 4MPFA 3GKMA 4RQXA 2YN1A 3GYKA 3D6IA 3KXOA 1E6BA 1EV9A 3EURA 1X9SB 3NZNA 2FA4A 2AAWA 1O7UA 5D9VA 3MWHA 2FWHA 2IFQB 3VI5A 5IIZA 4ZBDA 3TOTA 5HFGA 1JZDA 1ERVA 2O85A 1XCCA 4K1FA 1G7OA 2P31A 4MLYA 3KP9A 2C8UA 5DJLA 1AQXA 5JWQB 2F9SA 4Q5QA 3FZAA 2KOKA 3OR5A 3BOAA 1PD21 1R5PA 5IQYA 3VURA 2LV3A 1HD2A 5HR2A 3RBTA 1A2MA 4N0VA 3HY2A 2I4AA 2QKEA 4BVYB 4ZXGA 14GSA 4IP6A 5CRWA 2GZYA 2R6KA 5IM9A 1B9YC 4N30A 1R26A 3BD2A 4DSSA 4MA9A 2I1UA 1G6WA 5J9BA 2DLXA 1K0MA 4TR1A 3D0ZA 2FCHA 4EO3A 2LRCA 3H79A 2C4JA 5A4UA 5H5RA 2GTUA 4POLA 2KP2A 1YQ1A 2G2QA 2FWFA 2N5BA 2R37A 5B6MA 1TK0B 2YANA 3L4NA 4TXOB 2XBIA 1XBSA 2LJAA 4KGIA 4Q5RA 3VK9A 2G0FA 2AYTA 2FWEA 1X9MB 1O81A 4BVXA 2OJLA 3TJJA 3KMNA 2DKHA 1Y6EA 3C7MA 1GTIA 4N10A 3FZ4A 2J9HA 3F6FA 5FWGA 1U87A 1ON4A 2A2RA 2P5QA 5AN1A 1GUKA 2EIQA 4OD7A 2E2GA 4AJ6A 3TKSA 4YQMA 2CZ3A 5ECRB 3BBYA 2TRCP 2PN8A 3EE2A 1GTAA 2X8CA 2LNTA 2HZEA 3Q6OA 2GSTA 2JZTA 4MMMA 4JU5A 3E3EA 4O32A 3CRUA 1ERWA 1VF4A 4WF4A 5IPHA 4XS1A 4OFMA 3UOMA 1EGRA 3GKXA 2H76A 5CRDA 2AUVA 2VAFA 1BJXA 3SBCA 4AF2A 3F3RA 2R2JA 22GSA 3APSA 4KSOA 3O76A 1PGTA 4DSQA 4NV2A 4YQVA 1OVNA 5J3RA 3UEMA 5B7CA 1GSQA 2H71A 1OC3A 3PGTA 4KF9A 2J23A 4WBJA 2CX3A 4USSA 3EU4A 4PGTA 3IOSA 4BL7B 1A2LA 2WULA 3CSHA 3LXZA 2O7KA 4Q5FA 1AUCA 4ZL7A 3J7Yk 3EWLA 1OYJA 1TDIA 5IPGA 2PUKC 3UJ1A 4KE3A 3A2XA 8GSSA 4AJ7A 3LWAA 3NOFA 3QFAC 5J41A 1YEPA 1IYIA 2C3TA 3IRAA 3IDVA 4K8MA 2GSRA 3MSZA 1UC7A 1MD4A 1SD8A 1QK8A 4QL9A 4EVMA 1THXA 4EUYA 1GULA 4EIPA 3HDCA 1GL8A 1M2AA 4JR6A 1W89A 5F8BA 2LQQA 2XPDA 18GSA 3R2QA 1OKDA 5KEJA 2P5RA 4O7HA 3TKSC 5ABRA 2KP1A 4YAVA 2CVDA 3FW2A 2GZPA 2GQMA 17GSA 4HSCX 2TRXA 2O89A 2WDUA 5D93A 3S9FA 2HSHA 4FYBA 4EXJA 4NPBA 4ML6A 4PQHA 4IVFA 4CY8A 1BEDA 1J9BA 2YZHA 2PPTA 1YF0A 4V1Ap 1S3AA 1AC1A 3FMWA 3TDGA 2OE0A 3FY7A 5HR3A 3FYGA 3FZ9A 5DVBA 2MMNA 4LL1B 2IL3A 1OE8A 4V2MA 1DBYA 2QA2A 1U88A 1AXDA 5CP1A 3VPQA 3EC3A 1TRVA 2JACA 2B1KA 3DGQA 1YDKA 4GRFA 5DQYA 2FLSA 5DCGA 1F2EA 5A4WA 2DMLA 2H6XA 2HZFA 1B8XA 2ZNMA 2X8GA 3MDKA 2AJQB 2H0GA 2D2ZA 1Z5YE 4J56E 2R3XA 4KAEA 4HQZA 1PA3A 3H8QA 2F8AA 4PUAA 12GSA 1KBNA 2R4VA 3TKSE 2R5GA 3V1WA 2NPBA 4DSRA 4I97A 4FQUA 2E7PA 2X49A 2AB6A 1USBA 4MPGA 1GH2A 4LMVA 4I6XA 5BMUA 5ID2B 1R5AA 2VL2A 4POMA 2C0GA 1QQ2A 2GS3A 3IXRA 2FD3A 1ML6A 3KZQA 5KOXA 1HNCA 2ZUPA 3G9BA 1GWCA 4ZIJA 3IBHA 5HQPA 1XG8A 2DJ1A 5DBQA 5L71A 1Z6NA 1VF3A 3UIWA 1TW9A 1HYUA 2YWMA 4BWQA 2H1BA 1O8XA 2R0CA 2YPMA 1T7PB 1TTZA 2H73A 1SU9A 1VGLA 4J2FA 3Q19A 2GZZA 3IHGA 1VF1A 4NXIA 4WEYA 2LUSA 4XCSA 4ISDA 4MH2A 2XHFA 3KJYA 4QQ7A 1RQMA 3E0UA 4D73B 6GSTA 4BPYA 5GAND 1T1VA 5C00A 3I9V2 3M1GA 1K0CA 2V6KA 4ID0A 2ZCTA 3A2VA 4GLTA 1E2YA 1ZYNA 1NHYA 5J4UA 3TKPA 1WP0A 1URMA 4OO5A 3K8NA 3DEXA 2H6ZA 3ME8A 2PBJA 3HYPA 2O87A 3ZIJA 1V98A 4Z7XA 4TN8A 3DD3A 3HZ4A 4MNNA 4MJCA 1K0BA 5HR1A 2PMTA 3P90A 3ZRDA 4I5QA 2H1GA 4KDUA 4WR5A 3GTUA 4KCEA 2REMA 3VLNA 4TXVA 2M72A 3D4TA 3HVVA 3TRPA 4OFTA 1SKRB 1EEMA 1HQOA 3FZ5A 1B48A 1JZWA 3GKKA 4ZBAA 2LRNA 4JBBA 4KDYA 1A8YA 2A4HA 3LG6A 2A2PA 1NW2A 3UBKA 3F0IA 3C1RA 4AJ8A 4ECCA 1JZOA 2DIYA 3ED3A 2L4QA 3KH7A 2H6YA 2F8FA 5IOWA 2K8SA 3P7XA 1F3AA 1YEXA 2CQ9A 2VCTA 4F82A 4G2EA 2GGTA 6GSUA 1I9DA 3GKNA 3CTFA 4ZBBA 4BIKA 1RW1A 3HKRA 1B9XC 1CQHA 2A2SA 2JADA 16GSA 1S3CA 1MDJA 5A4VA 3VFIA 2HRKA 3L0HA 2IN3A 5ECQB 5B6NA 2H66A 3KP8A 1DSBA 4K2XA 3DIEA 4EKZA 2HRNA 2UZ8A 2RIIA 3E9JB 1G6YA 1TRSA 3CXGA 3DYRA 3LFLA 4TVEA 4XIHA 1M0UA 4IQ1A 3VWVA 3QPMA 1AQVA 3EVIA 3A5WA 4WKWA 3SWLA 5ECIB 4KCAA 5ECOB 4MZBA 2JZRA 3DMLA 4ACSA 3H93A 3IK7A 3ZVJA 4DSSB 3EU3A 4K5RA 2H74A 2PU9C 3QFBC 2CV4A 4TR1B 1Z9HA 3G7JA 4Q5NA 3HVSA 2DSAA 6GSXA 1X5EA 3HVNA 2YNXA 5ECHB 4HJ2A 2AV4A 3HA9A 1OKTA 1O73A 1XPVA 5LD0A 1WPIA 5DALA 1YKCA 5EL8A 2K9FA 4JR4A
chains in the Genus database with same CATH topology
2IMFA 4MK3A 2VLVA 4F2IA 2C80A 3GSTA 4GSSA 1EOHA 1UA5A 4MP4A 6GSSA 2WB9A 2EIOA 2VCVA 1TI3A 4BVXB 3L78A 1K3YA 3C71A 2ES7A 2YCDA 2WGRA 2FGXA 2H19A 13GSA 3NIVA 3W6GA 1OAZA 3RPNA 4MCUA 2VM2A 3UL3A 3IPZA 3ZL5A 4N11A 1LU4A 2LJKA 2HZEB 4IELA 3TJGA 3QD9A 3D5JA 1SJZA 1V9WA 2MBTA 1SL0B 2ON5A 1J08A 2GQKA 3F3QA 4EDYA 5JCGA 1EEJA 19GSA 1AW9A 2K6VA 1V40A 1ZOFA 4BWSA 3TJKA 4HEA2 4CHSA 4POBA 1LBKA 2DJ0A 1O85A 3FR3A 5EVOA 4IP1A 1SKSB 4BVYA 4XS4A 3Q74A 4WBRD 2H0IA 5AIXA 3IE3A 1SL2B 4PX1A 3GRXA 2O8VB 2A4VA 4A5PA 1GSDA 1V57A 4PNGA 1X5CA 3IC4A 4N0ZA 5CAXA 4IW9A 3RHCA 3ZZXA 1JHBA 4NMUA 5J9CA 2MBSA 3TRXA 5CNWA 2B5YA 3HXSA 4NWYA 4MABA 4MF6A 4KH7A 1K0NA 4RQRA 2LS5A 3GA4A 2IMEA 1A0FA 3GMFA 2BJXA 3CMIA 2ALBA 3UVTA 1Q98A 1XZOA 3FEUA 3FRCA 1WJKA 1FG4A 5AISA 3UMAA 2YV7A 1M7TA 9GSSA 2RUEA 1ERTA 4KDXA 4J57E 4KX4A 2LNSA 4FH8A 1AAZA 1G7EA 3CTGA 1B4QA 1FVKA 2LEGA 1K3OA 1ZCPA 4OMVA 4TR4A 1K0OA 3QAWA 2HRFA 3M9JA 2QSIA 3ERWA 2C3NA 4ECIA 1TU7A 2L4CA 3LW9A 2YOIA 4K5SA 11GSA 3TUEA 2DKIA 2IMIA 1TU8A 4QL7A 5D9WA 2VL3A 3GV1A 1OE7A 2R0GA 3MAKA 2OKAA 2VCWA 4LLRA 3PPUA 3ZMLA 4PTSA 2LRTA 3JCML 2B6MA 2C3QA 1SYRA 3G7IA 5IMDA 3GH6A 2F51A 1QGVA 4K7IA 3C1SA 2C0DA 2NDOA 1G0TA 2CX4A 2WZ9A 3FR9A 3TKQA 4O5RA 3ERFA 1GTUA 4HZ2A 5D9TA 4MZWA 20GSA 3KH9A 1A0RP 1BX9A 1SJ6A 1QXHA 2QA1A 3WGXA 4G0KA 1N2AA 1RK4A 5CO3A 1ZMAA 3QR6A 1NSWA 5ECKB 1XFLA 1UVZA 1TRUA 3GX0A 2MMAA 2X99A 2N5FA 4RUVA 4IKHA 3PR8A 3TJFA 1TKDB 1ST9A 1PN9A 4FO5A 3ZVJD 1GLQA 1XWKA 5CYYA 2K8VA 4TR0A 4GXZA 3ZLPA 3W8JA 4K7OA 4O5QA 2FY6A 2R0PA 4ZB8A 5JCWA 2OE1A 2YJ7A 3DXBA 3MYDA 1CQGA 5IMFA 1GUMA 5E4WA 5F05A 5KN0A 1F3BA 3WYWA 2MZCA 1OC8A 3CSIA 1W4VA 1V2AA 3FR6A 2B5XA 4POKA 2RM5A 4KUNA 1LJRA 1JZRA 3ZMKA 3UARA 4G0IA 3VWUA 3RPPA 3MIXA 4FIWA 3F9UA 1J0FA 4FYUA 2WJUA 4RI6A 2LKUA 1OC9A 1UN2A 5DAKA 1O8WA 2GLRA 5ECLB 3IHQA 1SYXA 2YV9A 3ZFLA 5LCZA 3IA1A 2OBKA 3QCPA 2H72A 1YKAA 5KN3A 1V58A 1ZGNA 3GUSA 3GX8A 1Z3EA 4L5LA 1PRXA 4I2UA 2HRAA 4IJ3A 5FT3A 4GCIA 4IHUA 1FOVA 4TOPA 4EL1A 5HFKA 2V6OA 4XS6A 5F0GA 2FHEA 3HVXA 3GTUB 2XC2A 3I6AA 5IO2A 1TI1A 2DJ2A 3FHKA 2HI7A 2OE3A 5IMVA 2B7KA 1FHEA 3H1NA 4ILFA 4NHWA 4L8EA 1BQ7A 5ECSA 1WE0A 2L6DA 2X4AA 3M0FA 4TKYA 2IMKA 1U3AA 4PUFC 1F6MC 3HJMA 1XW6A 4BA7A 4F9ZA 4K2DA 2M46A 4EDZA 3DWVA 2PGTA 1Z6MA 3A5IA 4ZILA 2NVLA 2L57A 4G19A 2IMDA 3GN3A 2B1LA 5EPFA 2CAIA 1BAYA 2JSZA 4Z2TA 4HU7A 1YF1A 2WRTA 2LSTA 2VCXA 3KCMA 1KEBA 4HQSA 1GNEA 2YWNA 2DJ3A 3C73A 1EGOA 3IC8A 3QAVA 4X4JA 2RUFA 5JWRB 2QC7A 3F4TA 4IJIA 3F4SA 2OACA 3KIJA 2VD1A 1PKWA 2VL2C 1M9AA 2WCIA 2YZUA 3DVWA 2VUPA 3GL3A 4HS1A 2FA8A 1VRSD 2VIMA 5GAPD 4YQUA 2JU5A 4IQAA 2MMZA 2LJRA 1TRWA 3ME7A 3W8SA 2VL9A 3QMXA 3WD6A 4WETA 5CRHA 3KMOA 3GURA 4HDEA 1XWBA 2PWJA 2GVPA 1R4WA 2NTOA 3L9UA 4XTSA 4HOJA 2B5EA 3KD0A 2OADA 1JFUA 1XVWA 4KSMA 5ECNB 3LGCA 4TW5A 2OA7A 1PL2A 5DALB 1GLPA 1SK1A 2PVOC 2RM6A 3WGDA 4V2LA 4GTUA 3UBLA 5COHA 1EOGA 2H1DA 2VCQA 4E8EA 3LSZA 4XRAA 2H0HA 3GNJA 1MDIA 2WFCA 1EP7A 2VLUA 4JZQA 3DRNA 3TGZA 3QAGA 3PINA 4Z2RA 3KGKA 1SENA 1TP9A 5G5EA 10GSA 2GDRA 3TCOA 4F0BA 2PVQA 3IAM2 1M2BA 2L6CA 4MF7A 5H5SA 2CT6A 1ZZYA 2HSYA 4OCFA 5HFIA 2BTOT 3GIXA 4K9ZA 1PQNA 2KUCA 4IBPA 3TJBA 3M9KA 2HXKA 1WMJA 1THOA 1PN0A 3EINA 5IO0A 2C1YA 3ZTLA 5D73A 3HJOA 1HNAA 2GT5A 3F4RA 2P0GA 2H01A 1VF2A 3P2AA 3RAZA 2BMXA 3D4MA 5H5QA 2IFQA 3HD5A 2I3YA 4XS4B 4G0LA 1ZYQB 3HJPA 1XWAA 3ZYWA 2GSSA 2IWTA 1M99A 5IMAA 5ECPB 2WS2A 5G5FA 2RLIA 3LORA 1JLWA 2V1MA 1GSYA 1ABAA 1K0AA 4L0UA 1U3IA 1X5DA 3BJ5A 3FKFA 4K6XA 4G10A 5A5KA 5DDLA 2ON7A 5F06A 1HNBA 3KTBA 3F63A 1XW5A 4OO4A 3LXTA 1QFNA 7GSSA 5DCHA 3IV4A 1Q4JA 4HI7A 4ZB6A 1KNGA 4GF0A 4WF5A 3R3EA 1XVQA 1T4YA 1T4ZA 2KLXA 1YJ6A 3UAPA 3ZITA 1XWCA 3C8EA 2PERA 4YAPA 1GSFA 1PL1A 1MDKA 1T00A 2V32A 4O5UA 1WOUA 3KEBA 2L59A 4ULXA 3LEFA 4X0XA 1XIYA 4L5OA 1PSQA 4GSTA 1Y25A 5D9XA 4L0WA 1MD3A 2DMMA 1A2JA 4G9HA 1SJIA 5G2ZA 2CA8A 4XHMA 4NV5A 1XW9A 4Z2UA 1GSSA 4NHZA 3I43A 3IR4A 2L5OA 1FO5A 5GZZB 3U5RE 3LQ7A 4MJBA 4GQFA 4JEDA 4E8HA 3ZIVA 5LNKe 2XPEA 2C0EA 1X9WB 5ELGA 4KB3A 4TXOA 4I2TA 2CAQA 2MMOA 4KNDA 3APQA 3FK8A 2H75A 1EWXA 3A3TA 2JL4A 4YKFA 4V1Ag 1BG5A 5DQSA 4EIQA 4EC0A 1U6TA 2E0QA 1SKWB 2VO4A 2DJKA 2M80A 3VWWA 1AQWA 1GNWA 1IYHA 3I69A 1NHOA 3GHAA 2VD0A 3CYNA 1C72A 2IPAA 5IOXA 1XXUA 4YKGA 3F8UA 2CVBA 3LYKA 3L9VA 5G31A 4IS0A 3EMPA 4PNFA 1N8JA 2JSYA 3A2WA 5KN2A 2EIRA 3VI7A 4I8BA 1ACVA 2YWOA 1T3BA 3KTLA 3LJRA 3Q18A 3D22A 4K7NA 4RI7A 5B8AA 1GUHA 1Z7PA 2B3SA 2X64A 3O3TA 1T8EB 2CZ2A 2HNLA 3DKSA 3DVXA 3GH9A 2C0FA 2GQLA 4V2NA 3KM6A 2KHPA 1M2DA 1A23A 4OWYA 4ZL8A 2K18A 5C04A 4ML1A 1S3DA 2N5AA 1ZYPA 4HUAA 3VPTA 1YZXA 1SL1B 1FB0A 1DE1A 2I9HA 2XBQA 2H70A 4KA0A 5AIVA 4IN0A 2DC5A 3LYPA 1TK5B 3IK9A 2AHEA 1TK8B 2YWIA 2DJJA 5J5NA 4BL7A 2VM1A 4GWRA 4LMWA 1JLVA 1XWGA 4HZ4A 1A24A 5AGYA 2H8LA 4MJAA 4HU9A 4X43A 4OFNA 3U6VA 1B4PA 2YP6A 2DBCA 3WT1A 2HFDA 3ERGA 3H4KA 2EC4A 4MDCA 3HCZA 2TIRA 1OC9B 1FVJA 4DEJA 5DAKB 4ICYA 1GTBA 1Z7RA 3VWXA 3N9JA 2V41A 1ZL9A 2HYXA 5FHIA 3APOA 1PMTA 1FAAA 1WWJA 1ZYEA 5G1LA 3BCKA 2MYGA 1SK0A 3GFKA 1GSEA 4OCEA 3MNGA 5F07A 4EF0A 3PH9A 4JRRA 4WR4A 4P3YB 3M8NA 4PURA 1KTEA 1GP1A 2GSQA 3BCIA 5EY6A 4DVCA 1ILOA 1TOFA 5KN1A 3IAS2 1WRYA 4KW6A 2IJYA 4F0CA 2HT9A 3TRQA 5GSSA 4WXTA 5JWOB 2HE3A 5IMZA 3TKRA 1EP8A 4CW9A 3ZFBA 3CRTA 3WGEA 2FWGA 3US3A 4X1UA 1EV4A 1BYEA 3AY8A 4PXOA 5CRGA 3GSSA 5ELAA 2YJHA 3EPTA 4ECJA 2CVKA 1WIKA 2JZSA 5D8IA 2DIZA 3CSJA 3L9SA 1FW1A 4NAXA 2FUG2 1GRXA 4TRXA 5DJMA 3TB2A 4EE0A 3ISOA 5JCUA 3ZREA 4K0NA 3HHVA 2VOCA 5GSTA 1H75A 2NBSA 2L5LA 5ID2A 4MJEA 1ERUA 3RDWA 2LTKA 1QUWA 3HZ8A 1MEKA 5D96A 4ZB9A 3WT2A 3UVHA 1YY7A 3G7YA 1FB6A 1MTCA 4MZCA 1K3LA 1DUGA 4LA1A 4F03A 1F37A 2X8HA 5G30A 4H86A 3TOUA 4MH3A 2V2GA 4O92A 4HJMA 5B8BA 4AGSA 1GSUA 2FNOA 1NM3A 2H1AA 4XRDA 4YH2A 1AIUA 2Z9SA 5BRTA 3GL5A 4PQIA 2F3MA 6GSVA 1R7HA 4FYCA 3EYTA 3EMXA 4JE1A 2IIYA 6GSYA 3CBUA 3QOUA 5HR0A 1X0RA 1QMVA 3J7Yb 3O6TA 4CDOA 4ZL9A 1PX6A 1SK2A 3N5OA 4ECBA 3QDNA 2LQOA 2VLTA 2GT6A 3F6DA 3P8WA 4TR3A 1PKZA 4MF5A 5ECMB 2HLSA 4D73A 1TJDA 2VCZA 1FOHA 2QGVA 1DE2A 3D21A 1SD9A 4CY6A 4GSNA 2I81A 2HSMA 5KOWA 3M3MA 5INYA 4GQCA 1XOAA 1O6JA 1F9MA 1K0DA 4PQ1A 5CREA 5ENUA 1A8LA 5G1KA 5IMCA 1EZKA 4K0GA 4IGJA 3RHBA 6GSWA 1H4OA 4LL4B 2B7JA 2E2MA 1XOBA 1PX7A 5E59A 1I5GA 1M9BA 1TXXA 2H30A 2OBIA 4MPFA 3GKMA 4RQXA 2YN1A 3GYKA 3D6IA 3KXOA 1E6BA 1EV9A 3EURA 1X9SB 3NZNA 2FA4A 2AAWA 1O7UA 5D9VA 3MWHA 2FWHA 2IFQB 3VI5A 5IIZA 4ZBDA 3TOTA 5HFGA 1JZDA 1ERVA 2O85A 1XCCA 4K1FA 1G7OA 2P31A 4MLYA 3KP9A 2C8UA 5DJLA 1AQXA 5JWQB 2F9SA 4Q5QA 3FZAA 2KOKA 3OR5A 3BOAA 1PD21 1R5PA 5IQYA 3VURA 2LV3A 1HD2A 5HR2A 3RBTA 1A2MA 4N0VA 3HY2A 2I4AA 2QKEA 4BVYB 4ZXGA 14GSA 4IP6A 5CRWA 2GZYA 2R6KA 5IM9A 1B9YC 4N30A 1R26A 3BD2A 4DSSA 4MA9A 2I1UA 1G6WA 5J9BA 2DLXA 1K0MA 4TR1A 3D0ZA 2FCHA 4EO3A 2LRCA 3H79A 2C4JA 5A4UA 5H5RA 2GTUA 4POLA 2KP2A 1YQ1A 2G2QA 2FWFA 2N5BA 2R37A 5B6MA 1TK0B 2YANA 3L4NA 4TXOB 2XBIA 1XBSA 2LJAA 4KGIA 4Q5RA 3VK9A 2G0FA 2AYTA 2FWEA 1X9MB 1O81A 4BVXA 2OJLA 3TJJA 3KMNA 2DKHA 1Y6EA 3C7MA 1GTIA 4N10A 3FZ4A 2J9HA 3F6FA 5FWGA 1U87A 1ON4A 2A2RA 2P5QA 5AN1A 1GUKA 2EIQA 4OD7A 2E2GA 4AJ6A 3TKSA 4YQMA 2CZ3A 5ECRB 3BBYA 2TRCP 2PN8A 3EE2A 1GTAA 2X8CA 2LNTA 2HZEA 3Q6OA 2GSTA 2JZTA 4MMMA 4JU5A 3E3EA 4O32A 3CRUA 1ERWA 1VF4A 4WF4A 5IPHA 4XS1A 4OFMA 3UOMA 1EGRA 3GKXA 2H76A 5CRDA 2AUVA 2VAFA 1BJXA 3SBCA 4AF2A 3F3RA 2R2JA 22GSA 3APSA 4KSOA 3O76A 1PGTA 4DSQA 4NV2A 4YQVA 1OVNA 5J3RA 3UEMA 5B7CA 1GSQA 2H71A 1OC3A 3PGTA 4KF9A 2J23A 4WBJA 2CX3A 4USSA 3EU4A 4PGTA 3IOSA 4BL7B 1A2LA 2WULA 3CSHA 3LXZA 2O7KA 4Q5FA 1AUCA 4ZL7A 3J7Yk 3EWLA 1OYJA 1TDIA 5IPGA 2PUKC 3UJ1A 4KE3A 3A2XA 8GSSA 4AJ7A 3LWAA 3NOFA 3QFAC 5J41A 1YEPA 1IYIA 2C3TA 3IRAA 3IDVA 4K8MA 2GSRA 3MSZA 1UC7A 1MD4A 1SD8A 1QK8A 4QL9A 4EVMA 1THXA 4EUYA 1GULA 4EIPA 3HDCA 1GL8A 1M2AA 4JR6A 1W89A 5F8BA 2LQQA 2XPDA 18GSA 3R2QA 1OKDA 5KEJA 2P5RA 4O7HA 3TKSC 5ABRA 2KP1A 4YAVA 2CVDA 3FW2A 2GZPA 2GQMA 17GSA 2TRXA 2O89A 2WDUA 5D93A 3S9FA 2HSHA 4FYBA 4EXJA 4NPBA 4ML6A 4PQHA 4IVFA 4CY8A 1BEDA 1J9BA 2YZHA 2PPTA 1YF0A 4V1Ap 1S3AA 1AC1A 3FMWA 3TDGA 2OE0A 3FY7A 5HR3A 3FYGA 3FZ9A 5DVBA 2MMNA 4LL1B 2IL3A 1OE8A 4V2MA 1DBYA 2QA2A 1U88A 1AXDA 5CP1A 3VPQA 3EC3A 1TRVA 2JACA 2B1KA 3DGQA 1YDKA 4GRFA 5DQYA 2FLSA 5DCGA 1F2EA 5A4WA 2DMLA 2H6XA 2HZFA 1B8XA 2ZNMA 2X8GA 3MDKA 2AJQB 2H0GA 2D2ZA 1Z5YE 4J56E 2R3XA 4KAEA 4HQZA 1PA3A 3H8QA 2F8AA 4PUAA 12GSA 1KBNA 2R4VA 3TKSE 2R5GA 3V1WA 2NPBA 4DSRA 4I97A 4FQUA 2E7PA 2X49A 2AB6A 1USBA 4MPGA 1GH2A 4LMVA 4I6XA 5BMUA 5ID2B 1R5AA 2VL2A 4POMA 2C0GA 1QQ2A 2GS3A 3IXRA 2FD3A 1ML6A 3KZQA 5KOXA 1HNCA 2ZUPA 3G9BA 1GWCA 4ZIJA 3IBHA 5HQPA 2DJ1A 5DBQA 5L71A 1Z6NA 1VF3A 3UIWA 1TW9A 1HYUA 2YWMA 4BWQA 2H1BA 1O8XA 2R0CA 2YPMA 1T7PB 1TTZA 2H73A 1SU9A 1VGLA 4J2FA 3Q19A 2GZZA 3IHGA 1VF1A 4NXIA 4WEYA 2LUSA 4XCSA 4ISDA 4MH2A 2XHFA 3KJYA 4QQ7A 1RQMA 3E0UA 4D73B 6GSTA 4BPYA 5GAND 1T1VA 5C00A 3I9V2 3M1GA 1K0CA 2V6KA 4ID0A 2ZCTA 3A2VA 4GLTA 1E2YA 1ZYNA 1NHYA 5J4UA 3TKPA 1WP0A 1URMA 4OO5A 3K8NA 3DEXA 2H6ZA 3ME8A 2PBJA 3HYPA 2O87A 3ZIJA 1V98A 4Z7XA 4TN8A 3DD3A 3HZ4A 4MNNA 4MJCA 1K0BA 5HR1A 2PMTA 3P90A 3ZRDA 4I5QA 2H1GA 4KDUA 4WR5A 3GTUA 4KCEA 2REMA 3VLNA 4TXVA 2M72A 3D4TA 3HVVA 3TRPA 4OFTA 1SKRB 1EEMA 1HQOA 3FZ5A 1B48A 1JZWA 3GKKA 4ZBAA 2LRNA 4JBBA 4KDYA 1A8YA 2A4HA 3LG6A 2A2PA 1NW2A 3UBKA 3F0IA 3C1RA 4AJ8A 4ECCA 1JZOA 2DIYA 3ED3A 2L4QA 3KH7A 2H6YA 2F8FA 5IOWA 2K8SA 3P7XA 1F3AA 1YEXA 2CQ9A 2VCTA 4F82A 4G2EA 2GGTA 6GSUA 1I9DA 3GKNA 3CTFA 4ZBBA 1RW1A 3HKRA 1B9XC 1CQHA 2A2SA 2JADA 16GSA 1S3CA 1MDJA 5A4VA 3VFIA 2HRKA 3L0HA 2IN3A 5ECQB 5B6NA 2H66A 3KP8A 1DSBA 4K2XA 3DIEA 4EKZA 2HRNA 2UZ8A 2RIIA 3E9JB 1G6YA 1TRSA 3CXGA 3DYRA 3LFLA 4TVEA 4XIHA 1M0UA 4IQ1A 3VWVA 3QPMA 1AQVA 3EVIA 3A5WA 4WKWA 3SWLA 5ECIB 4KCAA 5ECOB 4MZBA 2JZRA 3DMLA 4ACSA 3H93A 3IK7A 3ZVJA 4DSSB 3EU3A 4K5RA 2H74A 2PU9C 3QFBC 2CV4A 4TR1B 1Z9HA 3G7JA 4Q5NA 3HVSA 2DSAA 6GSXA 1X5EA 2YNXA 5ECHB 4HJ2A 2AV4A 3HA9A 1OKTA 1O73A 1XPVA 5LD0A 1WPIA 5DALA 1YKCA 5EL8A 2K9FA 4JR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IMF A;  4MK3 A;  2VLV A;  4F2I A;  2C80 A;  3GST A;  4GSS A;  1EOH A;  1UA5 A;  4MP4 A;  6GSS A;  2WB9 A;  2EIO A;  2VCV A;  1TI3 A;  3L78 A;  1K3Y A;  3C71 A;  2ES7 A;  2YCD A;  2WGR A;  2FGX A;  2H19 A;  13GS A;  3NIV A;  3W6G A;  1OAZ A;  3RPN A;  4MCU A;  2VM2 A;  3UL3 A;  3IPZ A;  3ZL5 A;  4N11 A;  1LU4 A;  2LJK A;  2HZE B;  4IEL A;  3TJG A;  3QD9 A;  3D5J A;  1SJZ A;  1V9W A;  2MBT A;  1SL0 B;  2ON5 A;  1J08 A;  2GQK A;  3F3Q A;  4EDY A;  5JCG A;  1EEJ A;  19GS A;  1AW9 A;  2K6V A;  1V40 A;  1ZOF A;  4BWS A;  3TJK A;  4HEA 2;  4CHS A;  4POB A;  1LBK A;  2DJ0 A;  1O85 A;  3FR3 A;  5EVO A;  4IP1 A;  1SKS B;  4BVY A;  4XS4 A;  3Q74 A;  4WBR D;  2H0I A;  5AIX A;  3IE3 A;  1SL2 B;  4PX1 A;  3GRX A;  2O8V B;  2A4V A;  1GSD A;  1V57 A;  4PNG A;  1X5C A;  3IC4 A;  4N0Z A;  5CAX A;  4IW9 A;  3RHC A;  3ZZX A;  1JHB A;  4NMU A;  5J9C A;  2MBS A;  3TRX A;  5CNW A;  2B5Y A;  3HXS A;  4NWY A;  4MAB A;  4MF6 A;  4KH7 A;  1K0N A;  4RQR A;  2LS5 A;  3GA4 A;  2IME A;  1A0F A;  3GMF A;  2BJX A;  3CMI A;  2ALB A;  3UVT A;  1Q98 A;  1XZO A;  3FEU A;  3FRC A;  1WJK A;  1FG4 A;  5AIS A;  3UMA A;  2YV7 A;  1M7T A;  9GSS A;  2RUE A;  1ERT A;  4KDX A;  4J57 E;  4KX4 A;  2LNS A;  4FH8 A;  1AAZ A;  1G7E A;  3CTG A;  1B4Q A;  1FVK A;  2LEG A;  1K3O A;  1ZCP A;  4OMV A;  4TR4 A;  1K0O A;  3QAW A;  2HRF A;  3M9J A;  2QSI A;  3ERW A;  2C3N A;  4ECI A;  1TU7 A;  2L4C A;  2YOI A;  11GS A;  3TUE A;  2IMI A;  1TU8 A;  4QL7 A;  5D9W A;  2VL3 A;  3GV1 A;  1OE7 A;  3MAK A;  2OKA A;  2VCW A;  4LLR A;  3ZML A;  2LRT A;  3JCM L;  2B6M A;  2C3Q A;  1SYR A;  3G7I A;  5IMD A;  3GH6 A;  2F51 A;  1QGV A;  4K7I A;  3C1S A;  2C0D A;  2NDO A;  1G0T A;  2CX4 A;  2WZ9 A;  3FR9 A;  3TKQ A;  4O5R A;  3ERF A;  1GTU A;  4HZ2 A;  5D9T A;  4MZW A;  20GS A;  3KH9 A;  1A0R P;  1BX9 A;  1SJ6 A;  1QXH A;  3WGX A;  1N2A A;  1RK4 A;  5CO3 A;  1ZMA A;  3QR6 A;  1NSW A;  5ECK B;  1XFL A;  1UVZ A;  1TRU A;  3GX0 A;  2MMA A;  2X99 A;  2N5F A;  4RUV A;  4IKH A;  3PR8 A;  3TJF A;  1TKD B;  1ST9 A;  1PN9 A;  4FO5 A;  3ZVJ D;  1GLQ A;  1XWK A;  5CYY A;  2K8V A;  4TR0 A;  4GXZ A;  3ZLP A;  3W8J A;  4K7O A;  2FY6 A;  4ZB8 A;  5JCW A;  2OE1 A;  2YJ7 A;  3DXB A;  1CQG A;  5IMF A;  1GUM A;  5E4W A;  5F05 A;  5KN0 A;  1F3B A;  3WYW A;  2MZC A;  1OC8 A;  3CSI A;  1W4V A;  1V2A A;  3FR6 A;  2B5X A;  4POK A;  2RM5 A;  4KUN A;  1LJR A;  1JZR A;  3ZMK A;  3UAR A;  3VWU A;  3RPP A;  4FIW A;  3F9U A;  1J0F A;  4FYU A;  2WJU A;  4RI6 A;  2LKU A;  1OC9 A;  1UN2 A;  5DAK A;  1O8W A;  5ECL B;  2GLR A;  3IHQ A;  1SYX A;  2YV9 A;  3ZFL A;  5LCZ A;  3IA1 A;  2OBK A;  3QCP A;  2H72 A;  1YKA A;  5KN3 A;  1V58 A;  1ZGN A;  3GUS A;  3GX8 A;  1Z3E A;  4L5L A;  1PRX A;  4I2U A;  4IJ3 A;  5FT3 A;  4GCI A;  4IHU A;  1FOV A;  4TOP A;  4EL1 A;  5HFK A;  2V6O A;  4XS6 A;  5F0G A;  2FHE A;  3HVX A;  3GTU B;  2XC2 A;  3I6A A;  5IO2 A;  1TI1 A;  2DJ2 A;  3FHK A;  2HI7 A;  2OE3 A;  5IMV A;  2B7K A;  1FHE A;  3H1N A;  4ILF A;  4NHW A;  4L8E A;  1BQ7 A;  5ECS A;  1WE0 A;  2L6D A;  3M0F A;  4TKY A;  2IMK A;  1U3A A;  4PUF C;  1F6M C;  3HJM A;  1XW6 A;  4BA7 A;  4F9Z A;  4K2D A;  2M46 A;  4EDZ A;  3DWV A;  2PGT A;  1Z6M A;  4ZIL A;  2NVL A;  2L57 A;  4G19 A;  2IMD A;  3GN3 A;  5EPF A;  2B1L A;  2CAI A;  1BAY A;  2JSZ A;  4HU7 A;  1YF1 A;  2WRT A;  2LST A;  2VCX A;  3KCM A;  1KEB A;  4HQS A;  1GNE A;  2YWN A;  2DJ3 A;  3C73 A;  1EGO A;  3QAV A;  2RUF A;  5JWR B;  2QC7 A;  3F4T A;  4IJI A;  3F4S A;  2OAC A;  3KIJ A;  2VD1 A;  1PKW A;  2VL2 C;  1M9A A;  2WCI A;  2YZU A;  3DVW A;  2VUP A;  3GL3 A;  4HS1 A;  2FA8 A;  1VRS D;  2VIM A;  5GAP D;  4YQU A;  2JU5 A;  4IQA A;  2MMZ A;  2LJR A;  1TRW A;  3ME7 A;  3W8S A;  2VL9 A;  3QMX A;  3WD6 A;  4WET A;  5CRH A;  3KMO A;  3GUR A;  4HDE A;  1XWB A;  2PWJ A;  2GVP A;  1R4W A;  2NTO A;  3L9U A;  4XTS A;  4HOJ A;  2B5E A;  3KD0 A;  2OAD A;  1JFU A;  1XVW A;  4KSM A;  5ECN B;  3LGC A;  4TW5 A;  2OA7 A;  1PL2 A;  5DAL B;  1GLP A;  1SK1 A;  2PVO C;  2RM6 A;  3WGD A;  4V2L A;  4GTU A;  3UBL A;  5COH A;  1EOG A;  2H1D A;  2VCQ A;  4E8E A;  3LSZ A;  4XRA A;  2H0H A;  3GNJ A;  1MDI A;  2WFC A;  1EP7 A;  2VLU A;  4JZQ A;  3DRN A;  3TGZ A;  3QAG A;  3PIN A;  3KGK A;  1SEN A;  1TP9 A;  5G5E A;  10GS A;  2GDR A;  3TCO A;  4F0B A;  2PVQ A;  3IAM 2;  1M2B A;  2L6C A;  4MF7 A;  5H5S A;  2CT6 A;  1ZZY A;  2HSY A;  4OCF A;  5HFI A;  2BTO T;  3GIX A;  4K9Z A;  1PQN A;  2KUC A;  4IBP A;  3TJB A;  3M9K A;  2HXK A;  1WMJ A;  1THO A;  3EIN A;  5IO0 A;  2C1Y A;  3ZTL A;  5D73 A;  3HJO A;  1HNA A;  2GT5 A;  3F4R A;  2P0G A;  2H01 A;  1VF2 A;  3P2A A;  3RAZ A;  2BMX A;  3D4M A;  5H5Q A;  2IFQ A;  3HD5 A;  2I3Y A;  4XS4 B;  1ZYQ B;  3HJP A;  1XWA A;  3ZYW A;  2GSS A;  2IWT A;  1M99 A;  5IMA A;  5ECP B;  2WS2 A;  5G5F A;  2RLI A;  3LOR A;  1JLW A;  2V1M A;  1GSY A;  1ABA A;  1K0A A;  1U3I A;  3BJ5 A;  1X5D A;  3FKF A;  4L0U A;  4K6X A;  4G10 A;  5A5K A;  5DDL A;  2ON7 A;  5F06 A;  1HNB A;  3KTB A;  3F63 A;  1XW5 A;  4OO4 A;  3LXT A;  1QFN A;  7GSS A;  5DCH A;  3IV4 A;  1Q4J A;  4HI7 A;  4ZB6 A;  1KNG A;  4GF0 A;  4WF5 A;  1XVQ A;  1T4Y A;  1T4Z A;  2KLX A;  1YJ6 A;  3UAP A;  3ZIT A;  1XWC A;  3C8E A;  2PER A;  4YAP A;  1GSF A;  1PL1 A;  1MDK A;  1T00 A;  2V32 A;  1WOU A;  3KEB A;  2L59 A;  4ULX A;  3LEF A;  4X0X A;  1XIY A;  4L5O A;  1PSQ A;  4GST A;  1Y25 A;  5D9X A;  4L0W A;  1MD3 A;  2DMM A;  1A2J A;  4G9H A;  1SJI A;  5G2Z A;  2CA8 A;  4XHM A;  4NV5 A;  1XW9 A;  1GSS A;  4NHZ A;  3I43 A;  3IR4 A;  2L5O A;  1FO5 A;  5GZZ B;  3U5R E;  3LQ7 A;  4MJB A;  4GQF A;  4JED A;  4E8H A;  3ZIV A;  5LNK e;  2XPE A;  2C0E A;  1X9W B;  5ELG A;  4KB3 A;  4TXO A;  4I2T A;  2CAQ A;  2MMO A;  4KND A;  3APQ A;  3FK8 A;  2H75 A;  1EWX A;  3A3T A;  2JL4 A;  4V1A g;  1BG5 A;  5DQS A;  4EC0 A;  1U6T A;  2E0Q A;  1SKW B;  2VO4 A;  2DJK A;  2M80 A;  3VWW A;  1AQW A;  1GNW A;  1IYH A;  3I69 A;  1NHO A;  3GHA A;  2VD0 A;  3CYN A;  1C72 A;  2IPA A;  5IOX A;  1XXU A;  3F8U A;  2CVB A;  3LYK A;  3L9V A;  5G31 A;  4IS0 A;  3EMP A;  4PNF A;  1N8J A;  2JSY A;  3A2W A;  5KN2 A;  2EIR A;  3VI7 A;  4I8B A;  1ACV A;  2YWO A;  1T3B A;  3KTL A;  3LJR A;  3Q18 A;  3D22 A;  4K7N A;  4RI7 A;  5B8A A;  1GUH A;  1Z7P A;  2B3S A;  2X64 A;  3O3T A;  1T8E B;  2CZ2 A;  2HNL A;  3DKS A;  3DVX A;  3GH9 A;  2C0F A;  2GQL A;  4V2N A;  3KM6 A;  2KHP A;  1M2D A;  1A23 A;  4OWY A;  4ZL8 A;  2K18 A;  5C04 A;  4ML1 A;  1S3D A;  2N5A A;  4HUA A;  3VPT A;  1YZX A;  1SL1 B;  1FB0 A;  1DE1 A;  2I9H A;  2XBQ A;  2H70 A;  5AIV A;  4IN0 A;  2DC5 A;  4KA0 A;  3LYP A;  1TK5 B;  3IK9 A;  2AHE A;  1TK8 B;  2YWI A;  2DJJ A;  5J5N A;  4BL7 A;  2VM1 A;  4GWR A;  4LMW A;  1JLV A;  1XWG A;  4HZ4 A;  1A24 A;  5AGY A;  2H8L A;  4MJA A;  4HU9 A;  4X43 A;  4OFN A;  3U6V A;  1B4P A;  2YP6 A;  2DBC A;  3WT1 A;  2HFD A;  3ERG A;  3H4K A;  2EC4 A;  4MDC A;  3HCZ A;  2TIR A;  1OC9 B;  1FVJ A;  4DEJ A;  5DAK B;  1GTB A;  1Z7R A;  3VWX A;  3N9J A;  2V41 A;  1ZL9 A;  2HYX A;  5FHI A;  3APO A;  1PMT A;  1FAA A;  1WWJ A;  1ZYE A;  5G1L A;  3BCK A;  2MYG A;  1SK0 A;  3GFK A;  1GSE A;  4OCE A;  3MNG A;  5F07 A;  4EF0 A;  3PH9 A;  4JRR A;  4WR4 A;  4P3Y B;  3M8N A;  4PUR A;  1KTE A;  1GP1 A;  2GSQ A;  3BCI A;  5EY6 A;  4DVC A;  1ILO A;  1TOF A;  5KN1 A;  3IAS 2;  1WRY A;  4KW6 A;  2IJY A;  4F0C A;  2HT9 A;  3TRQ A;  5GSS A;  4WXT A;  5JWO B;  2HE3 A;  5IMZ A;  3TKR A;  1EP8 A;  4CW9 A;  3ZFB A;  3CRT A;  3WGE A;  2FWG A;  3US3 A;  4X1U A;  1EV4 A;  1BYE A;  3AY8 A;  4PXO A;  5CRG A;  3GSS A;  5ELA A;  2YJH A;  4ECJ A;  2CVK A;  1WIK A;  2JZS A;  5D8I A;  2DIZ A;  3CSJ A;  3L9S A;  1FW1 A;  4NAX A;  2FUG 2;  1GRX A;  4TRX A;  5DJM A;  3TB2 A;  4EE0 A;  3ISO A;  5JCU A;  3ZRE A;  4K0N A;  3HHV A;  2VOC A;  5GST A;  1H75 A;  2NBS A;  2L5L A;  5ID2 A;  4MJE A;  1ERU A;  3RDW A;  2LTK A;  1QUW A;  3HZ8 A;  1MEK A;  5D96 A;  4ZB9 A;  3WT2 A;  3UVH A;  1YY7 A;  3G7Y A;  1FB6 A;  1MTC A;  4MZC A;  1K3L A;  1DUG A;  4LA1 A;  4F03 A;  1F37 A;  2X8H A;  5G30 A;  4H86 A;  3TOU A;  4MH3 A;  2V2G A;  4O92 A;  4HJM A;  5B8B A;  4AGS A;  1GSU A;  2FNO A;  1NM3 A;  2H1A A;  4XRD A;  4YH2 A;  1AIU A;  2Z9S A;  3GL5 A;  4PQI A;  2F3M A;  6GSV A;  1R7H A;  4FYC A;  3EYT A;  3EMX A;  4JE1 A;  2IIY A;  6GSY A;  3CBU A;  3QOU A;  5HR0 A;  1X0R A;  1QMV A;  3J7Y b;  3O6T A;  4CDO A;  4ZL9 A;  1PX6 A;  1SK2 A;  3N5O A;  4ECB A;  3QDN A;  2LQO A;  2VLT A;  2GT6 A;  3F6D A;  3P8W A;  4TR3 A;  1PKZ A;  4MF5 A;  5ECM B;  2HLS A;  4D73 A;  1TJD A;  2VCZ A;  2QGV A;  1DE2 A;  3D21 A;  1SD9 A;  4GSN A;  2I81 A;  3M3M A;  5INY A;  4GQC A;  1XOA A;  1O6J A;  1F9M A;  1K0D A;  4PQ1 A;  5CRE A;  5ENU A;  1A8L A;  5G1K A;  5IMC A;  1EZK A;  4K0G A;  4IGJ A;  3RHB A;  6GSW A;  1H4O A;  4LL4 B;  2B7J A;  2E2M A;  1XOB A;  1PX7 A;  5E59 A;  1I5G A;  1M9B A;  1TXX A;  2H30 A;  2OBI A;  4MPF A;  3GKM A;  4RQX A;  2YN1 A;  3GYK A;  3D6I A;  3KXO A;  1E6B A;  1EV9 A;  3EUR A;  1X9S B;  3NZN A;  2FA4 A;  2AAW A;  1O7U A;  5D9V A;  3MWH A;  2FWH A;  2IFQ B;  3VI5 A;  5IIZ A;  4ZBD A;  3TOT A;  5HFG A;  1JZD A;  1ERV A;  2O85 A;  1XCC A;  4K1F A;  1G7O A;  2P31 A;  4MLY A;  3KP9 A;  2C8U A;  5DJL A;  1AQX A;  5JWQ B;  2F9S A;  4Q5Q A;  3FZA A;  2KOK A;  3OR5 A;  3BOA A;  1PD2 1;  1R5P A;  5IQY A;  3VUR A;  2LV3 A;  1HD2 A;  5HR2 A;  3RBT A;  1A2M A;  4N0V A;  3HY2 A;  2I4A A;  2QKE A;  4ZXG A;  14GS A;  4IP6 A;  5CRW A;  2GZY A;  2R6K A;  5IM9 A;  1B9Y C;  4N30 A;  1R26 A;  3BD2 A;  4DSS A;  4MA9 A;  2I1U A;  1G6W A;  5J9B A;  2DLX A;  1K0M A;  4TR1 A;  3D0Z A;  2FCH A;  4EO3 A;  2LRC A;  3H79 A;  2C4J A;  5A4U A;  5H5R A;  2GTU A;  4POL A;  2KP2 A;  1YQ1 A;  2G2Q A;  2FWF A;  2N5B A;  2R37 A;  5B6M A;  1TK0 B;  2YAN A;  3L4N A;  4TXO B;  2XBI A;  1XBS A;  2LJA A;  4KGI A;  4Q5R A;  3VK9 A;  2G0F A;  2AYT A;  2FWE A;  1X9M B;  1O81 A;  4BVX A;  2OJL A;  3TJJ A;  3KMN A;  1Y6E A;  3C7M A;  1GTI A;  4N10 A;  3FZ4 A;  2J9H A;  3F6F A;  5FWG A;  1U87 A;  1ON4 A;  2A2R A;  2P5Q A;  5AN1 A;  1GUK A;  2EIQ A;  4OD7 A;  2E2G A;  4AJ6 A;  3TKS A;  4YQM A;  5ECR B;  2CZ3 A;  3BBY A;  2TRC P;  2PN8 A;  3EE2 A;  1GTA A;  2X8C A;  2LNT A;  2HZE A;  3Q6O A;  2GST A;  2JZT A;  4MMM A;  4JU5 A;  3E3E A;  4O32 A;  3CRU A;  1ERW A;  1VF4 A;  4WF4 A;  5IPH A;  4XS1 A;  4OFM A;  3UOM A;  1EGR A;  3GKX A;  2H76 A;  5CRD A;  2AUV A;  2VAF A;  1BJX A;  3SBC A;  4AF2 A;  3F3R A;  2R2J A;  22GS A;  3APS A;  4KSO A;  3O76 A;  1PGT A;  4DSQ A;  4NV2 A;  4YQV A;  1OVN A;  5J3R A;  3UEM A;  5B7C A;  1GSQ A;  2H71 A;  1OC3 A;  3PGT A;  2J23 A;  4WBJ A;  2CX3 A;  3EU4 A;  4PGT A;  3IOS A;  1A2L A;  2WUL A;  3CSH A;  3LXZ A;  2O7K A;  4Q5F A;  1AUC A;  4ZL7 A;  3J7Y k;  3EWL A;  1OYJ A;  1TDI A;  5IPG A;  2PUK C;  3UJ1 A;  4KE3 A;  3A2X A;  8GSS A;  4AJ7 A;  3LWA A;  3NOF A;  3QFA C;  5J41 A;  1YEP A;  1IYI A;  2C3T A;  3IRA A;  3IDV A;  4K8M A;  2GSR A;  3MSZ A;  1UC7 A;  1MD4 A;  1SD8 A;  1QK8 A;  4QL9 A;  4EVM A;  1THX A;  4EUY A;  1GUL A;  3HDC A;  1GL8 A;  1M2A A;  4JR6 A;  1W89 A;  5F8B A;  2LQQ A;  2XPD A;  18GS A;  3R2Q A;  1OKD A;  5KEJ A;  2P5R A;  4O7H A;  3TKS C;  5ABR A;  2KP1 A;  4YAV A;  2CVD A;  3FW2 A;  2GZP A;  2GQM A;  17GS A;  2TRX A;  2O89 A;  2WDU A;  5D93 A;  3S9F A;  2HSH A;  4FYB A;  4EXJ A;  4NPB A;  4ML6 A;  4PQH A;  4IVF A;  1BED A;  1J9B A;  2YZH A;  2PPT A;  1YF0 A;  4V1A p;  1S3A A;  1AC1 A;  3TDG A;  2OE0 A;  3FY7 A;  5HR3 A;  3FYG A;  3FZ9 A;  5DVB A;  2MMN A;  4LL1 B;  2IL3 A;  1OE8 A;  4V2M A;  1DBY A;  1U88 A;  1AXD A;  5CP1 A;  3VPQ A;  3EC3 A;  1TRV A;  2JAC A;  2B1K A;  3DGQ A;  1YDK A;  4GRF A;  5DQY A;  2FLS A;  5DCG A;  1F2E A;  5A4W A;  2DML A;  2H6X A;  2HZF A;  1B8X A;  2ZNM A;  2X8G A;  3MDK A;  2AJQ B;  2H0G A;  2D2Z A;  1Z5Y E;  4J56 E;  2R3X A;  4KAE A;  4HQZ A;  1PA3 A;  3H8Q A;  2F8A A;  4PUA A;  12GS A;  1KBN A;  2R4V A;  3TKS E;  2R5G A;  3V1W A;  2NPB A;  4DSR A;  4I97 A;  2E7P A;  2AB6 A;  1USB A;  4MPG A;  1GH2 A;  4LMV A;  4I6X A;  5ID2 B;  1R5A A;  2VL2 A;  4POM A;  2C0G A;  1QQ2 A;  2GS3 A;  3IXR A;  2FD3 A;  1ML6 A;  3KZQ A;  1HNC A;  2ZUP A;  3G9B A;  1GWC A;  4ZIJ A;  3IBH A;  5HQP A;  2DJ1 A;  5DBQ A;  5L71 A;  1Z6N A;  1VF3 A;  3UIW A;  1TW9 A;  1HYU A;  2YWM A;  4BWQ A;  2H1B A;  1O8X A;  2YPM A;  1T7P B;  1TTZ A;  2H73 A;  1SU9 A;  1VGL A;  4J2F A;  3Q19 A;  2GZZ A;  1VF1 A;  4NXI A;  4WEY A;  2LUS A;  4XCS A;  4ISD A;  4MH2 A;  2XHF A;  3KJY A;  4QQ7 A;  1RQM A;  3E0U A;  4D73 B;  6GST A;  4BPY A;  5GAN D;  1T1V A;  5C00 A;  3I9V 2;  3M1G A;  1K0C A;  2V6K A;  4ID0 A;  2ZCT A;  3A2V A;  4GLT A;  1E2Y A;  1NHY A;  5J4U A;  3TKP A;  1WP0 A;  1URM A;  4OO5 A;  3K8N A;  3DEX A;  2H6Z A;  3ME8 A;  2PBJ A;  3HYP A;  2O87 A;  3ZIJ A;  1V98 A;  4Z7X A;  4TN8 A;  3DD3 A;  3HZ4 A;  4MJC A;  1K0B A;  5HR1 A;  2PMT A;  3P90 A;  3ZRD A;  4I5Q A;  2H1G A;  4KDU A;  4WR5 A;  3GTU A;  4KCE A;  2REM A;  3VLN A;  4TXV A;  2M72 A;  3D4T A;  3HVV A;  3TRP A;  4OFT A;  1SKR B;  1EEM A;  1HQO A;  3FZ5 A;  1B48 A;  1JZW A;  3GKK A;  4ZBA A;  2LRN A;  4JBB A;  4KDY A;  1A8Y A;  3LG6 A;  1NW2 A;  3UBK A;  3F0I A;  3C1R A;  4AJ8 A;  4ECC A;  1JZO A;  2DIY A;  3ED3 A;  2L4Q A;  3KH7 A;  2H6Y A;  2F8F A;  5IOW A;  2K8S A;  3P7X A;  1F3A A;  1YEX A;  2CQ9 A;  2VCT A;  4F82 A;  4G2E A;  2GGT A;  6GSU A;  1I9D A;  3GKN A;  3CTF A;  4ZBB A;  1RW1 A;  3HKR A;  1B9X C;  1CQH A;  2A2S A;  2JAD A;  16GS A;  1S3C A;  1MDJ A;  5A4V A;  3VFI A;  3L0H A;  2IN3 A;  5ECQ B;  5B6N A;  2H66 A;  3KP8 A;  1DSB A;  3DIE A;  4EKZ A;  2HRN A;  2RII A;  3E9J B;  1G6Y A;  1TRS A;  3CXG A;  3DYR A;  3LFL A;  4TVE A;  4XIH A;  1M0U A;  4IQ1 A;  3VWV A;  3QPM A;  1AQV A;  3EVI A;  3A5W A;  4WKW A;  3SWL A;  5ECO B;  4KCA A;  5ECI B;  4MZB A;  2JZR A;  3DML A;  4ACS A;  3H93 A;  3IK7 A;  3ZVJ A;  4DSS B;  3EU3 A;  2H74 A;  2PU9 C;  3QFB C;  2CV4 A;  4TR1 B;  1Z9H A;  3G7J A;  4Q5N A;  3HVS A;  2DSA A;  6GSX A;  1X5E A;  2YNX A;  5ECH B;  4HJ2 A;  2AV4 A;  3HA9 A;  1OKT A;  1O73 A;  1XPV A;  5LD0 A;  1WPI A;  5DAL A;  1YKC A;  5EL8 A;  2K9F A;  4JR4 A; 
#chains in the Genus database with same CATH topology
 2IMF A;  4MK3 A;  2VLV A;  1M3I A;  2C80 A;  4F2I A;  3GST A;  4GSS A;  1EOH A;  1UA5 A;  4MP4 A;  6GSS A;  2WB9 A;  2EIO A;  2VCV A;  1TI3 A;  4BVX B;  3L78 A;  1K3Y A;  3C71 A;  2ES7 A;  2YCD A;  2WGR A;  2FGX A;  2H19 A;  13GS A;  3NIV A;  3W6G A;  1OAZ A;  3RPN A;  4MCU A;  2VM2 A;  3UL3 A;  3IPZ A;  3ZL5 A;  4N11 A;  1LU4 A;  2LJK A;  2HZE B;  4IEL A;  3TJG A;  3QD9 A;  3D5J A;  1SJZ A;  1V9W A;  2MBT A;  1SL0 B;  2ON5 A;  1J08 A;  2GQK A;  3F3Q A;  4EDY A;  5JCG A;  1EEJ A;  19GS A;  1AW9 A;  2K6V A;  1V40 A;  1ZOF A;  4BWS A;  3TJK A;  4HEA 2;  4CHS A;  4POB A;  1LBK A;  2DJ0 A;  1O85 A;  3FR3 A;  5EVO A;  4IP1 A;  1SKS B;  4BVY A;  4XS4 A;  3Q74 A;  4WBR D;  2H0I A;  5AIX A;  3IE3 A;  1SL2 B;  4PX1 A;  3GRX A;  2O8V B;  2A4V A;  4A5P A;  1GSD A;  1V57 A;  4PNG A;  1X5C A;  3IC4 A;  4N0Z A;  5CAX A;  4IW9 A;  3RHC A;  3ZZX A;  1JHB A;  4NMU A;  5J9C A;  2MBS A;  3TRX A;  5CNW A;  2B5Y A;  3HXS A;  4NWY A;  4MAB A;  4MF6 A;  4KH7 A;  1K0N A;  4RQR A;  2LS5 A;  3GA4 A;  2IME A;  1A0F A;  3GMF A;  2BJX A;  3CMI A;  2ALB A;  3UVT A;  1Q98 A;  1XZO A;  3FEU A;  3FRC A;  1WJK A;  1FG4 A;  5AIS A;  3UMA A;  2YV7 A;  1M7T A;  9GSS A;  2RUE A;  1ERT A;  4KDX A;  4J57 E;  4KX4 A;  2LNS A;  4FH8 A;  1AAZ A;  1G7E A;  3CTG A;  1B4Q A;  1FVK A;  2LEG A;  1K3O A;  1ZCP A;  4OMV A;  4TR4 A;  1K0O A;  3QAW A;  2HRF A;  3M9J A;  2QSI A;  3ERW A;  2C3N A;  4ECI A;  1TU7 A;  2L4C A;  3LW9 A;  2YOI A;  4K5S A;  11GS A;  1S3R A;  3TUE A;  2DKI A;  2IMI A;  1TU8 A;  4QL7 A;  5D9W A;  2VL3 A;  3GV1 A;  1OE7 A;  2R0G A;  3MAK A;  2OKA A;  2VCW A;  4LLR A;  3PPU A;  3ZML A;  4PTS A;  2LRT A;  3JCM L;  2B6M A;  2C3Q A;  1SYR A;  3G7I A;  5IMD A;  3GH6 A;  2F51 A;  1QGV A;  4K7I A;  3C1S A;  2C0D A;  2NDO A;  1G0T A;  2CX4 A;  2WZ9 A;  3FR9 A;  3TKQ A;  4O5R A;  3ERF A;  1GTU A;  4HZ2 A;  5D9T A;  4MZW A;  20GS A;  3KH9 A;  1A0R P;  1BX9 A;  1SJ6 A;  1QXH A;  2QA1 A;  3WGX A;  4G0K A;  1N2A A;  1RK4 A;  5CO3 A;  1ZMA A;  3QR6 A;  1NSW A;  5ECK B;  1XFL A;  1UVZ A;  1TRU A;  3GX0 A;  2MMA A;  2X99 A;  2N5F A;  4RUV A;  4IKH A;  3PR8 A;  3TJF A;  1TKD B;  1ST9 A;  1PN9 A;  4FO5 A;  3ZVJ D;  1GLQ A;  1XWK A;  5CYY A;  2K8V A;  4TR0 A;  4GXZ A;  3ZLP A;  3W8J A;  4K7O A;  4O5Q A;  2FY6 A;  2R0P A;  4ZB8 A;  5JCW A;  2OE1 A;  2YJ7 A;  3DXB A;  3MYD A;  1CQG A;  5IMF A;  1GUM A;  5E4W A;  5F05 A;  5KN0 A;  1F3B A;  3WYW A;  2MZC A;  1OC8 A;  3CSI A;  1W4V A;  1V2A A;  3FR6 A;  2B5X A;  4POK A;  2RM5 A;  4KUN A;  1LJR A;  1JZR A;  3ZMK A;  3UAR A;  4G0I A;  3VWU A;  3RPP A;  3MIX A;  4FIW A;  3F9U A;  1J0F A;  4FYU A;  2WJU A;  4RI6 A;  2LKU A;  1OC9 A;  1UN2 A;  5DAK A;  1O8W A;  2GLR A;  5ECL B;  3IHQ A;  1SYX A;  2YV9 A;  3ZFL A;  5LCZ A;  3IA1 A;  2OBK A;  3QCP A;  2H72 A;  1YKA A;  5KN3 A;  1V58 A;  1ZGN A;  3GUS A;  3GX8 A;  1Z3E A;  4L5L A;  1PRX A;  4I2U A;  2HRA A;  4IJ3 A;  5FT3 A;  4GCI A;  4IHU A;  1FOV A;  4TOP A;  4EL1 A;  5HFK A;  2V6O A;  4XS6 A;  5F0G A;  2FHE A;  3HVX A;  3GTU B;  2XC2 A;  3I6A A;  5IO2 A;  1TI1 A;  2DJ2 A;  3FHK A;  2HI7 A;  2OE3 A;  5IMV A;  2B7K A;  1FHE A;  3H1N A;  4ILF A;  4NHW A;  4L8E A;  1BQ7 A;  5ECS A;  1WE0 A;  2L6D A;  2X4A A;  3M0F A;  4TKY A;  2IMK A;  1U3A A;  4PUF C;  1F6M C;  3HJM A;  1XW6 A;  4BA7 A;  4F9Z A;  4K2D A;  2M46 A;  4EDZ A;  3DWV A;  2PGT A;  1Z6M A;  3A5I A;  4ZIL A;  2NVL A;  2L57 A;  4G19 A;  2IMD A;  3GN3 A;  2B1L A;  5EPF A;  2CAI A;  1BAY A;  2JSZ A;  4Z2T A;  4HU7 A;  1YF1 A;  2WRT A;  2LST A;  2VCX A;  3KCM A;  1KEB A;  4HQS A;  1GNE A;  2YWN A;  2DJ3 A;  3C73 A;  1EGO A;  3IC8 A;  3QAV A;  4X4J A;  2RUF A;  5JWR B;  2QC7 A;  3F4T A;  4IJI A;  3F4S A;  2OAC A;  3KIJ A;  2VD1 A;  1PKW A;  2VL2 C;  1M9A A;  2WCI A;  2YZU A;  3DVW A;  2VUP A;  3GL3 A;  4HS1 A;  2FA8 A;  1VRS D;  2VIM A;  5GAP D;  4YQU A;  2JU5 A;  4IQA A;  2MMZ A;  2LJR A;  1TRW A;  3ME7 A;  3W8S A;  2VL9 A;  3QMX A;  3WD6 A;  4WET A;  5CRH A;  3KMO A;  3GUR A;  4HDE A;  1XWB A;  2PWJ A;  2GVP A;  1R4W A;  2NTO A;  3L9U A;  4XTS A;  4HOJ A;  2B5E A;  3KD0 A;  2OAD A;  1JFU A;  1XVW A;  4KSM A;  5ECN B;  3LGC A;  4TW5 A;  2OA7 A;  1PL2 A;  5DAL B;  1GLP A;  1SK1 A;  2PVO C;  2RM6 A;  3WGD A;  4V2L A;  4GTU A;  3UBL A;  5COH A;  1EOG A;  2H1D A;  2VCQ A;  4E8E A;  3LSZ A;  4XRA A;  2H0H A;  3GNJ A;  1MDI A;  2WFC A;  1EP7 A;  2VLU A;  4JZQ A;  3DRN A;  3TGZ A;  3QAG A;  3PIN A;  4Z2R A;  3CQF A;  3KGK A;  1SEN A;  1TP9 A;  5G5E A;  10GS A;  2GDR A;  3TCO A;  4F0B A;  2PVQ A;  3IAM 2;  1M2B A;  2L6C A;  4MF7 A;  5H5S A;  2CT6 A;  1ZZY A;  2HSY A;  4OCF A;  5HFI A;  2BTO T;  3GIX A;  4K9Z A;  1PQN A;  2KUC A;  4IBP A;  3TJB A;  3M9K A;  2HXK A;  1WMJ A;  1THO A;  1PN0 A;  3EIN A;  5IO0 A;  2C1Y A;  3ZTL A;  5D73 A;  3HJO A;  1HNA A;  2GT5 A;  3F4R A;  2P0G A;  2H01 A;  1VF2 A;  3P2A A;  3RAZ A;  2BMX A;  3D4M A;  5H5Q A;  2IFQ A;  3HD5 A;  2I3Y A;  4XS4 B;  4G0L A;  1ZYQ B;  3HJP A;  1XWA A;  3ZYW A;  2GSS A;  2IWT A;  1M99 A;  5IMA A;  5ECP B;  2WS2 A;  5G5F A;  2RLI A;  3LOR A;  1JLW A;  2V1M A;  1GSY A;  1ABA A;  1K0A A;  4L0U A;  1U3I A;  1X5D A;  3BJ5 A;  3FKF A;  4K6X A;  4G10 A;  5A5K A;  5DDL A;  2ON7 A;  5F06 A;  1HNB A;  3KTB A;  3F63 A;  1XW5 A;  4OO4 A;  3LXT A;  1QFN A;  7GSS A;  5DCH A;  3IV4 A;  1Q4J A;  4HI7 A;  4ZB6 A;  1KNG A;  4GF0 A;  4WF5 A;  3R3E A;  1XVQ A;  1T4Y A;  1T4Z A;  2KLX A;  1YJ6 A;  3UAP A;  3ZIT A;  1XWC A;  3C8E A;  2PER A;  4YAP A;  1GSF A;  1PL1 A;  1MDK A;  1T00 A;  2V32 A;  4O5U A;  1WOU A;  3KEB A;  2L59 A;  4ULX A;  3LEF A;  4X0X A;  1XIY A;  4L5O A;  1PSQ A;  4GST A;  1Y25 A;  5D9X A;  4L0W A;  1MD3 A;  1PFO A;  2DMM A;  1A2J A;  4G9H A;  1SJI A;  1M3J A;  5G2Z A;  2CA8 A;  4XHM A;  4NV5 A;  1XW9 A;  4Z2U A;  1GSS A;  4NHZ A;  3I43 A;  3IR4 A;  2L5O A;  1FO5 A;  5GZZ B;  3U5R E;  3LQ7 A;  4MJB A;  4GQF A;  4JED A;  4E8H A;  3ZIV A;  5LNK e;  2XPE A;  2C0E A;  1X9W B;  5ELG A;  4KB3 A;  4TXO A;  4I2T A;  2CAQ A;  2MMO A;  4KND A;  3APQ A;  3FK8 A;  2H75 A;  1EWX A;  3A3T A;  2JL4 A;  4YKF A;  4V1A g;  1BG5 A;  5DQS A;  4EIQ A;  4EC0 A;  1U6T A;  2E0Q A;  1SKW B;  2VO4 A;  2DJK A;  2M80 A;  3VWW A;  1AQW A;  1GNW A;  1IYH A;  3I69 A;  1NHO A;  3GHA A;  2VD0 A;  3CYN A;  1C72 A;  2IPA A;  5IOX A;  1XXU A;  4YKG A;  3F8U A;  2CVB A;  3LYK A;  3L9V A;  5G31 A;  4IS0 A;  3EMP A;  4PNF A;  1N8J A;  2JSY A;  3A2W A;  5KN2 A;  2EIR A;  3VI7 A;  4I8B A;  1ACV A;  2YWO A;  1T3B A;  3KTL A;  3LJR A;  3Q18 A;  3D22 A;  4K7N A;  4RI7 A;  5B8A A;  1GUH A;  1Z7P A;  2B3S A;  2X64 A;  3O3T A;  1T8E B;  2CZ2 A;  2HNL A;  3DKS A;  3DVX A;  3GH9 A;  2C0F A;  2GQL A;  4V2N A;  3KM6 A;  2KHP A;  1M2D A;  1A23 A;  4OWY A;  4ZL8 A;  2K18 A;  5C04 A;  4ML1 A;  1S3D A;  2N5A A;  1ZYP A;  4HUA A;  3VPT A;  1YZX A;  1SL1 B;  1FB0 A;  1DE1 A;  2I9H A;  2XBQ A;  2H70 A;  4KA0 A;  4IN0 A;  2DC5 A;  5AIV A;  3LYP A;  1TK5 B;  3IK9 A;  2AHE A;  1TK8 B;  2YWI A;  2DJJ A;  5J5N A;  4BL7 A;  2VM1 A;  4GWR A;  4LMW A;  1JLV A;  1XWG A;  4HZ4 A;  1A24 A;  5AGY A;  2H8L A;  4MJA A;  4HU9 A;  4X43 A;  4OFN A;  3U6V A;  1B4P A;  2YP6 A;  2DBC A;  3WT1 A;  2HFD A;  3ERG A;  3H4K A;  2EC4 A;  4MDC A;  3HCZ A;  2TIR A;  1OC9 B;  1FVJ A;  4DEJ A;  5DAK B;  4ICY A;  1GTB A;  1Z7R A;  3VWX A;  3N9J A;  2V41 A;  1ZL9 A;  2HYX A;  5FHI A;  3APO A;  1PMT A;  1FAA A;  1WWJ A;  1ZYE A;  5G1L A;  3BCK A;  2MYG A;  1SK0 A;  3GFK A;  1GSE A;  4OCE A;  3MNG A;  5F07 A;  4EF0 A;  3PH9 A;  4JRR A;  4WR4 A;  4P3Y B;  3M8N A;  4PUR A;  1KTE A;  1GP1 A;  2GSQ A;  3BCI A;  5EY6 A;  4DVC A;  1ILO A;  1TOF A;  5KN1 A;  3IAS 2;  1WRY A;  4KW6 A;  2IJY A;  4F0C A;  2HT9 A;  3TRQ A;  5GSS A;  4WXT A;  5JWO B;  2HE3 A;  5IMZ A;  3TKR A;  1EP8 A;  4CW9 A;  3ZFB A;  3CRT A;  3WGE A;  2FWG A;  3US3 A;  4X1U A;  1EV4 A;  1BYE A;  3AY8 A;  4PXO A;  5CRG A;  3GSS A;  5ELA A;  2YJH A;  3EPT A;  4ECJ A;  2CVK A;  1WIK A;  2JZS A;  5D8I A;  2DIZ A;  3CSJ A;  3L9S A;  1FW1 A;  4NAX A;  2FUG 2;  1GRX A;  4TRX A;  5DJM A;  3TB2 A;  4EE0 A;  3ISO A;  5JCU A;  3ZRE A;  4K0N A;  3HHV A;  2VOC A;  5GST A;  1H75 A;  2NBS A;  2L5L A;  5ID2 A;  4MJE A;  1ERU A;  3RDW A;  2LTK A;  1QUW A;  3HZ8 A;  1MEK A;  5D96 A;  4ZB9 A;  3WT2 A;  3UVH A;  1YY7 A;  3G7Y A;  1FB6 A;  1MTC A;  4MZC A;  1K3L A;  1DUG A;  4LA1 A;  4F03 A;  1F37 A;  2X8H A;  5G30 A;  4H86 A;  3TOU A;  4MH3 A;  2V2G A;  4O92 A;  4HJM A;  5B8B A;  4AGS A;  1GSU A;  2FNO A;  1NM3 A;  2H1A A;  4XRD A;  4YH2 A;  1AIU A;  2Z9S A;  5BRT A;  3GL5 A;  4PQI A;  2F3M A;  6GSV A;  1R7H A;  4FYC A;  3EYT A;  3EMX A;  4JE1 A;  2IIY A;  6GSY A;  3CBU A;  3QOU A;  5HR0 A;  1X0R A;  1QMV A;  3J7Y b;  3O6T A;  4CDO A;  4ZL9 A;  1PX6 A;  1SK2 A;  3N5O A;  4ECB A;  3QDN A;  2LQO A;  2VLT A;  2GT6 A;  3F6D A;  3P8W A;  4TR3 A;  1PKZ A;  4MF5 A;  5ECM B;  2HLS A;  4D73 A;  1TJD A;  2VCZ A;  1FOH A;  2QGV A;  1DE2 A;  3D21 A;  1SD9 A;  4CY6 A;  4GSN A;  2I81 A;  2HSM A;  5KOW A;  3M3M A;  5INY A;  4GQC A;  1XOA A;  1O6J A;  1F9M A;  1K0D A;  4PQ1 A;  5CRE A;  5ENU A;  1A8L A;  5G1K A;  5IMC A;  1EZK A;  4K0G A;  4IGJ A;  3RHB A;  6GSW A;  1H4O A;  4LL4 B;  2B7J A;  2E2M A;  1XOB A;  1PX7 A;  5E59 A;  1I5G A;  1M9B A;  1TXX A;  2H30 A;  2OBI A;  4MPF A;  3GKM A;  4RQX A;  2YN1 A;  3GYK A;  3D6I A;  3KXO A;  1E6B A;  1EV9 A;  3EUR A;  1X9S B;  3NZN A;  2FA4 A;  2AAW A;  1O7U A;  5D9V A;  3MWH A;  2FWH A;  2IFQ B;  3VI5 A;  5IIZ A;  4ZBD A;  3TOT A;  5HFG A;  1JZD A;  1ERV A;  2O85 A;  1XCC A;  4K1F A;  1G7O A;  2P31 A;  4MLY A;  3KP9 A;  2C8U A;  5DJL A;  1AQX A;  5JWQ B;  2F9S A;  4Q5Q A;  3FZA A;  2KOK A;  3OR5 A;  3BOA A;  1PD2 1;  1R5P A;  5IQY A;  3VUR A;  2LV3 A;  1HD2 A;  5HR2 A;  3RBT A;  1A2M A;  4N0V A;  3HY2 A;  2I4A A;  2QKE A;  4BVY B;  4ZXG A;  14GS A;  4IP6 A;  5CRW A;  2GZY A;  2R6K A;  5IM9 A;  1B9Y C;  4N30 A;  1R26 A;  3BD2 A;  4DSS A;  4MA9 A;  2I1U A;  1G6W A;  5J9B A;  2DLX A;  1K0M A;  4TR1 A;  3D0Z A;  2FCH A;  4EO3 A;  2LRC A;  3H79 A;  2C4J A;  5A4U A;  5H5R A;  2GTU A;  4POL A;  2KP2 A;  1YQ1 A;  2G2Q A;  2FWF A;  2N5B A;  2R37 A;  5B6M A;  1TK0 B;  2YAN A;  3L4N A;  4TXO B;  2XBI A;  1XBS A;  2LJA A;  4KGI A;  4Q5R A;  3VK9 A;  2G0F A;  2AYT A;  2FWE A;  1X9M B;  1O81 A;  4BVX A;  2OJL A;  3TJJ A;  3KMN A;  2DKH A;  1Y6E A;  3C7M A;  1GTI A;  4N10 A;  3FZ4 A;  2J9H A;  3F6F A;  5FWG A;  1U87 A;  1ON4 A;  2A2R A;  2P5Q A;  5AN1 A;  1GUK A;  2EIQ A;  4OD7 A;  2E2G A;  4AJ6 A;  3TKS A;  4YQM A;  2CZ3 A;  5ECR B;  3BBY A;  2TRC P;  2PN8 A;  3EE2 A;  1GTA A;  2X8C A;  2LNT A;  2HZE A;  3Q6O A;  2GST A;  2JZT A;  4MMM A;  4JU5 A;  3E3E A;  4O32 A;  3CRU A;  1ERW A;  1VF4 A;  4WF4 A;  5IPH A;  4XS1 A;  4OFM A;  3UOM A;  1EGR A;  3GKX A;  2H76 A;  5CRD A;  2AUV A;  2VAF A;  1BJX A;  3SBC A;  4AF2 A;  3F3R A;  2R2J A;  22GS A;  3APS A;  4KSO A;  3O76 A;  1PGT A;  4DSQ A;  4NV2 A;  4YQV A;  1OVN A;  5J3R A;  3UEM A;  5B7C A;  1GSQ A;  2H71 A;  1OC3 A;  3PGT A;  4KF9 A;  2J23 A;  4WBJ A;  2CX3 A;  4USS A;  3EU4 A;  4PGT A;  3IOS A;  4BL7 B;  1A2L A;  2WUL A;  3CSH A;  3LXZ A;  2O7K A;  4Q5F A;  1AUC A;  4ZL7 A;  3J7Y k;  3EWL A;  1OYJ A;  1TDI A;  5IPG A;  2PUK C;  3UJ1 A;  4KE3 A;  3A2X A;  8GSS A;  4AJ7 A;  3LWA A;  3NOF A;  3QFA C;  5J41 A;  1YEP A;  1IYI A;  2C3T A;  3IRA A;  3IDV A;  4K8M A;  2GSR A;  3MSZ A;  1UC7 A;  1MD4 A;  1SD8 A;  1QK8 A;  4QL9 A;  4EVM A;  1THX A;  4EUY A;  1GUL A;  4EIP A;  3HDC A;  1GL8 A;  1M2A A;  4JR6 A;  1W89 A;  5F8B A;  2LQQ A;  2XPD A;  18GS A;  3R2Q A;  1OKD A;  5KEJ A;  2P5R A;  4O7H A;  3TKS C;  5ABR A;  2KP1 A;  4YAV A;  2CVD A;  3FW2 A;  2GZP A;  2GQM A;  17GS A;  4HSC X;  2TRX A;  2O89 A;  2WDU A;  5D93 A;  3S9F A;  2HSH A;  4FYB A;  4EXJ A;  4NPB A;  4ML6 A;  4PQH A;  4IVF A;  4CY8 A;  1BED A;  1J9B A;  2YZH A;  2PPT A;  1YF0 A;  4V1A p;  1S3A A;  1AC1 A;  3FMW A;  3TDG A;  2OE0 A;  3FY7 A;  5HR3 A;  3FYG A;  3FZ9 A;  5DVB A;  2MMN A;  4LL1 B;  2IL3 A;  1OE8 A;  4V2M A;  1DBY A;  2QA2 A;  1U88 A;  1AXD A;  5CP1 A;  3VPQ A;  3EC3 A;  1TRV A;  2JAC A;  2B1K A;  3DGQ A;  1YDK A;  4GRF A;  5DQY A;  2FLS A;  5DCG A;  1F2E A;  5A4W A;  2DML A;  2H6X A;  2HZF A;  1B8X A;  2ZNM A;  2X8G A;  3MDK A;  2AJQ B;  2H0G A;  2D2Z A;  1Z5Y E;  4J56 E;  2R3X A;  4KAE A;  4HQZ A;  1PA3 A;  3H8Q A;  2F8A A;  4PUA A;  12GS A;  1KBN A;  2R4V A;  3TKS E;  2R5G A;  3V1W A;  2NPB A;  4DSR A;  4I97 A;  4FQU A;  2E7P A;  2X49 A;  2AB6 A;  1USB A;  4MPG A;  1GH2 A;  4LMV A;  4I6X A;  5BMU A;  5ID2 B;  1R5A A;  2VL2 A;  4POM A;  2C0G A;  1QQ2 A;  2GS3 A;  3IXR A;  2FD3 A;  1ML6 A;  3KZQ A;  5KOX A;  1HNC A;  2ZUP A;  3G9B A;  1GWC A;  4ZIJ A;  3IBH A;  5HQP A;  1XG8 A;  2DJ1 A;  5DBQ A;  5L71 A;  1Z6N A;  1VF3 A;  3UIW A;  1TW9 A;  1HYU A;  2YWM A;  4BWQ A;  2H1B A;  1O8X A;  2R0C A;  2YPM A;  1T7P B;  1TTZ A;  2H73 A;  1SU9 A;  1VGL A;  4J2F A;  3Q19 A;  2GZZ A;  3IHG A;  1VF1 A;  4NXI A;  4WEY A;  2LUS A;  4XCS A;  4ISD A;  4MH2 A;  2XHF A;  3KJY A;  4QQ7 A;  1RQM A;  3E0U A;  4D73 B;  6GST A;  4BPY A;  5GAN D;  1T1V A;  5C00 A;  3I9V 2;  3M1G A;  1K0C A;  2V6K A;  4ID0 A;  2ZCT A;  3A2V A;  4GLT A;  1E2Y A;  1ZYN A;  1NHY A;  5J4U A;  3TKP A;  1WP0 A;  1URM A;  4OO5 A;  3K8N A;  3DEX A;  2H6Z A;  3ME8 A;  2PBJ A;  3HYP A;  2O87 A;  3ZIJ A;  1V98 A;  4Z7X A;  4TN8 A;  3DD3 A;  3HZ4 A;  4MNN A;  4MJC A;  1K0B A;  5HR1 A;  2PMT A;  3P90 A;  3ZRD A;  4I5Q A;  2H1G A;  4KDU A;  4WR5 A;  3GTU A;  4KCE A;  2REM A;  3VLN A;  4TXV A;  2M72 A;  3D4T A;  3HVV A;  3TRP A;  4OFT A;  1SKR B;  1EEM A;  1HQO A;  3FZ5 A;  1B48 A;  1JZW A;  3GKK A;  4ZBA A;  2LRN A;  4JBB A;  4KDY A;  1A8Y A;  2A4H A;  3LG6 A;  2A2P A;  1NW2 A;  3UBK A;  3F0I A;  3C1R A;  4AJ8 A;  4ECC A;  1JZO A;  2DIY A;  3ED3 A;  2L4Q A;  3KH7 A;  2H6Y A;  2F8F A;  5IOW A;  2K8S A;  3P7X A;  1F3A A;  1YEX A;  2CQ9 A;  2VCT A;  4F82 A;  4G2E A;  2GGT A;  6GSU A;  1I9D A;  3GKN A;  3CTF A;  4ZBB A;  4BIK A;  1RW1 A;  3HKR A;  1B9X C;  1CQH A;  2A2S A;  2JAD A;  16GS A;  1S3C A;  1MDJ A;  5A4V A;  3VFI A;  2HRK A;  3L0H A;  2IN3 A;  5ECQ B;  5B6N A;  2H66 A;  3KP8 A;  1DSB A;  4K2X A;  3DIE A;  4EKZ A;  2HRN A;  2UZ8 A;  2RII A;  3E9J B;  1G6Y A;  1TRS A;  3CXG A;  3DYR A;  3LFL A;  4TVE A;  4XIH A;  1M0U A;  4IQ1 A;  3VWV A;  3QPM A;  1AQV A;  3EVI A;  3A5W A;  4WKW A;  3SWL A;  5ECI B;  4KCA A;  5ECO B;  4MZB A;  2JZR A;  3DML A;  4ACS A;  3H93 A;  3IK7 A;  3ZVJ A;  4DSS B;  3EU3 A;  4K5R A;  2H74 A;  2PU9 C;  3QFB C;  2CV4 A;  4TR1 B;  1Z9H A;  3G7J A;  4Q5N A;  3HVS A;  2DSA A;  6GSX A;  1X5E A;  3HVN A;  2YNX A;  5ECH B;  4HJ2 A;  2AV4 A;  3HA9 A;  1OKT A;  1O73 A;  1XPV A;  5LD0 A;  1WPI A;  5DAL A;  1YKC A;  5EL8 A;  2K9F A;  4JR4 A; 
#chains in the Genus database with same CATH homology
 2IMF A;  4MK3 A;  2VLV A;  4F2I A;  2C80 A;  3GST A;  4GSS A;  1EOH A;  1UA5 A;  4MP4 A;  6GSS A;  2WB9 A;  2EIO A;  2VCV A;  1TI3 A;  4BVX B;  3L78 A;  1K3Y A;  3C71 A;  2ES7 A;  2YCD A;  2WGR A;  2FGX A;  2H19 A;  13GS A;  3NIV A;  3W6G A;  1OAZ A;  3RPN A;  4MCU A;  2VM2 A;  3UL3 A;  3IPZ A;  3ZL5 A;  4N11 A;  1LU4 A;  2LJK A;  2HZE B;  4IEL A;  3TJG A;  3QD9 A;  3D5J A;  1SJZ A;  1V9W A;  2MBT A;  1SL0 B;  2ON5 A;  1J08 A;  2GQK A;  3F3Q A;  4EDY A;  5JCG A;  1EEJ A;  19GS A;  1AW9 A;  2K6V A;  1V40 A;  1ZOF A;  4BWS A;  3TJK A;  4HEA 2;  4CHS A;  4POB A;  1LBK A;  2DJ0 A;  1O85 A;  3FR3 A;  5EVO A;  4IP1 A;  1SKS B;  4BVY A;  4XS4 A;  3Q74 A;  4WBR D;  2H0I A;  5AIX A;  3IE3 A;  1SL2 B;  4PX1 A;  3GRX A;  2O8V B;  2A4V A;  4A5P A;  1GSD A;  1V57 A;  4PNG A;  1X5C A;  3IC4 A;  4N0Z A;  5CAX A;  4IW9 A;  3RHC A;  3ZZX A;  1JHB A;  4NMU A;  5J9C A;  2MBS A;  3TRX A;  5CNW A;  2B5Y A;  3HXS A;  4NWY A;  4MAB A;  4MF6 A;  4KH7 A;  1K0N A;  4RQR A;  2LS5 A;  3GA4 A;  2IME A;  1A0F A;  3GMF A;  2BJX A;  3CMI A;  2ALB A;  3UVT A;  1Q98 A;  1XZO A;  3FEU A;  3FRC A;  1WJK A;  1FG4 A;  5AIS A;  3UMA A;  2YV7 A;  1M7T A;  9GSS A;  2RUE A;  1ERT A;  4KDX A;  4J57 E;  4KX4 A;  2LNS A;  4FH8 A;  1AAZ A;  1G7E A;  3CTG A;  1B4Q A;  1FVK A;  2LEG A;  1K3O A;  1ZCP A;  4OMV A;  4TR4 A;  1K0O A;  3QAW A;  2HRF A;  3M9J A;  2QSI A;  3ERW A;  2C3N A;  4ECI A;  1TU7 A;  2L4C A;  3LW9 A;  2YOI A;  4K5S A;  11GS A;  3TUE A;  2DKI A;  2IMI A;  1TU8 A;  4QL7 A;  5D9W A;  2VL3 A;  3GV1 A;  1OE7 A;  2R0G A;  3MAK A;  2OKA A;  2VCW A;  4LLR A;  3PPU A;  3ZML A;  4PTS A;  2LRT A;  3JCM L;  2B6M A;  2C3Q A;  1SYR A;  3G7I A;  5IMD A;  3GH6 A;  2F51 A;  1QGV A;  4K7I A;  3C1S A;  2C0D A;  2NDO A;  1G0T A;  2CX4 A;  2WZ9 A;  3FR9 A;  3TKQ A;  4O5R A;  3ERF A;  1GTU A;  4HZ2 A;  5D9T A;  4MZW A;  20GS A;  3KH9 A;  1A0R P;  1BX9 A;  1SJ6 A;  1QXH A;  2QA1 A;  3WGX A;  4G0K A;  1N2A A;  1RK4 A;  5CO3 A;  1ZMA A;  3QR6 A;  1NSW A;  5ECK B;  1XFL A;  1UVZ A;  1TRU A;  3GX0 A;  2MMA A;  2X99 A;  2N5F A;  4RUV A;  4IKH A;  3PR8 A;  3TJF A;  1TKD B;  1ST9 A;  1PN9 A;  4FO5 A;  3ZVJ D;  1GLQ A;  1XWK A;  5CYY A;  2K8V A;  4TR0 A;  4GXZ A;  3ZLP A;  3W8J A;  4K7O A;  4O5Q A;  2FY6 A;  2R0P A;  4ZB8 A;  5JCW A;  2OE1 A;  2YJ7 A;  3DXB A;  3MYD A;  1CQG A;  5IMF A;  1GUM A;  5E4W A;  5F05 A;  5KN0 A;  1F3B A;  3WYW A;  2MZC A;  1OC8 A;  3CSI A;  1W4V A;  1V2A A;  3FR6 A;  2B5X A;  4POK A;  2RM5 A;  4KUN A;  1LJR A;  1JZR A;  3ZMK A;  3UAR A;  4G0I A;  3VWU A;  3RPP A;  3MIX A;  4FIW A;  3F9U A;  1J0F A;  4FYU A;  2WJU A;  4RI6 A;  2LKU A;  1OC9 A;  1UN2 A;  5DAK A;  1O8W A;  2GLR A;  5ECL B;  3IHQ A;  1SYX A;  2YV9 A;  3ZFL A;  5LCZ A;  3IA1 A;  2OBK A;  3QCP A;  2H72 A;  1YKA A;  5KN3 A;  1V58 A;  1ZGN A;  3GUS A;  3GX8 A;  1Z3E A;  4L5L A;  1PRX A;  4I2U A;  2HRA A;  4IJ3 A;  5FT3 A;  4GCI A;  4IHU A;  1FOV A;  4TOP A;  4EL1 A;  5HFK A;  2V6O A;  4XS6 A;  5F0G A;  2FHE A;  3HVX A;  3GTU B;  2XC2 A;  3I6A A;  5IO2 A;  1TI1 A;  2DJ2 A;  3FHK A;  2HI7 A;  2OE3 A;  5IMV A;  2B7K A;  1FHE A;  3H1N A;  4ILF A;  4NHW A;  4L8E A;  1BQ7 A;  5ECS A;  1WE0 A;  2L6D A;  2X4A A;  3M0F A;  4TKY A;  2IMK A;  1U3A A;  4PUF C;  1F6M C;  3HJM A;  1XW6 A;  4BA7 A;  4F9Z A;  4K2D A;  2M46 A;  4EDZ A;  3DWV A;  2PGT A;  1Z6M A;  3A5I A;  4ZIL A;  2NVL A;  2L57 A;  4G19 A;  2IMD A;  3GN3 A;  2B1L A;  5EPF A;  2CAI A;  1BAY A;  2JSZ A;  4Z2T A;  4HU7 A;  1YF1 A;  2WRT A;  2LST A;  2VCX A;  3KCM A;  1KEB A;  4HQS A;  1GNE A;  2YWN A;  2DJ3 A;  3C73 A;  1EGO A;  3IC8 A;  3QAV A;  4X4J A;  2RUF A;  5JWR B;  2QC7 A;  3F4T A;  4IJI A;  3F4S A;  2OAC A;  3KIJ A;  2VD1 A;  1PKW A;  2VL2 C;  1M9A A;  2WCI A;  2YZU A;  3DVW A;  2VUP A;  3GL3 A;  4HS1 A;  2FA8 A;  1VRS D;  2VIM A;  5GAP D;  4YQU A;  2JU5 A;  4IQA A;  2MMZ A;  2LJR A;  1TRW A;  3ME7 A;  3W8S A;  2VL9 A;  3QMX A;  3WD6 A;  4WET A;  5CRH A;  3KMO A;  3GUR A;  4HDE A;  1XWB A;  2PWJ A;  2GVP A;  1R4W A;  2NTO A;  3L9U A;  4XTS A;  4HOJ A;  2B5E A;  3KD0 A;  2OAD A;  1JFU A;  1XVW A;  4KSM A;  5ECN B;  3LGC A;  4TW5 A;  2OA7 A;  1PL2 A;  5DAL B;  1GLP A;  1SK1 A;  2PVO C;  2RM6 A;  3WGD A;  4V2L A;  4GTU A;  3UBL A;  5COH A;  1EOG A;  2H1D A;  2VCQ A;  4E8E A;  3LSZ A;  4XRA A;  2H0H A;  3GNJ A;  1MDI A;  2WFC A;  1EP7 A;  2VLU A;  4JZQ A;  3DRN A;  3TGZ A;  3QAG A;  3PIN A;  4Z2R A;  3KGK A;  1SEN A;  1TP9 A;  5G5E A;  10GS A;  2GDR A;  3TCO A;  4F0B A;  2PVQ A;  3IAM 2;  1M2B A;  2L6C A;  4MF7 A;  5H5S A;  2CT6 A;  1ZZY A;  2HSY A;  4OCF A;  5HFI A;  2BTO T;  3GIX A;  4K9Z A;  1PQN A;  2KUC A;  4IBP A;  3TJB A;  3M9K A;  2HXK A;  1WMJ A;  1THO A;  1PN0 A;  3EIN A;  5IO0 A;  2C1Y A;  3ZTL A;  5D73 A;  3HJO A;  1HNA A;  2GT5 A;  3F4R A;  2P0G A;  2H01 A;  1VF2 A;  3P2A A;  3RAZ A;  2BMX A;  3D4M A;  5H5Q A;  2IFQ A;  3HD5 A;  2I3Y A;  4XS4 B;  4G0L A;  1ZYQ B;  3HJP A;  1XWA A;  3ZYW A;  2GSS A;  2IWT A;  1M99 A;  5IMA A;  5ECP B;  2WS2 A;  5G5F A;  2RLI A;  3LOR A;  1JLW A;  2V1M A;  1GSY A;  1ABA A;  1K0A A;  4L0U A;  1U3I A;  1X5D A;  3BJ5 A;  3FKF A;  4K6X A;  4G10 A;  5A5K A;  5DDL A;  2ON7 A;  5F06 A;  1HNB A;  3KTB A;  3F63 A;  1XW5 A;  4OO4 A;  3LXT A;  1QFN A;  7GSS A;  5DCH A;  3IV4 A;  1Q4J A;  4HI7 A;  4ZB6 A;  1KNG A;  4GF0 A;  4WF5 A;  3R3E A;  1XVQ A;  1T4Y A;  1T4Z A;  2KLX A;  1YJ6 A;  3UAP A;  3ZIT A;  1XWC A;  3C8E A;  2PER A;  4YAP A;  1GSF A;  1PL1 A;  1MDK A;  1T00 A;  2V32 A;  4O5U A;  1WOU A;  3KEB A;  2L59 A;  4ULX A;  3LEF A;  4X0X A;  1XIY A;  4L5O A;  1PSQ A;  4GST A;  1Y25 A;  5D9X A;  4L0W A;  1MD3 A;  2DMM A;  1A2J A;  4G9H A;  1SJI A;  5G2Z A;  2CA8 A;  4XHM A;  4NV5 A;  1XW9 A;  4Z2U A;  1GSS A;  4NHZ A;  3I43 A;  3IR4 A;  2L5O A;  1FO5 A;  5GZZ B;  3U5R E;  3LQ7 A;  4MJB A;  4GQF A;  4JED A;  4E8H A;  3ZIV A;  5LNK e;  2XPE A;  2C0E A;  1X9W B;  5ELG A;  4KB3 A;  4TXO A;  4I2T A;  2CAQ A;  2MMO A;  4KND A;  3APQ A;  3FK8 A;  2H75 A;  1EWX A;  3A3T A;  2JL4 A;  4YKF A;  4V1A g;  1BG5 A;  5DQS A;  4EIQ A;  4EC0 A;  1U6T A;  2E0Q A;  1SKW B;  2VO4 A;  2DJK A;  2M80 A;  3VWW A;  1AQW A;  1GNW A;  1IYH A;  3I69 A;  1NHO A;  3GHA A;  2VD0 A;  3CYN A;  1C72 A;  2IPA A;  5IOX A;  1XXU A;  4YKG A;  3F8U A;  2CVB A;  3LYK A;  3L9V A;  5G31 A;  4IS0 A;  3EMP A;  4PNF A;  1N8J A;  2JSY A;  3A2W A;  5KN2 A;  2EIR A;  3VI7 A;  4I8B A;  1ACV A;  2YWO A;  1T3B A;  3KTL A;  3LJR A;  3Q18 A;  3D22 A;  4K7N A;  4RI7 A;  5B8A A;  1GUH A;  1Z7P A;  2B3S A;  2X64 A;  3O3T A;  1T8E B;  2CZ2 A;  2HNL A;  3DKS A;  3DVX A;  3GH9 A;  2C0F A;  2GQL A;  4V2N A;  3KM6 A;  2KHP A;  1M2D A;  1A23 A;  4OWY A;  4ZL8 A;  2K18 A;  5C04 A;  4ML1 A;  1S3D A;  2N5A A;  1ZYP A;  4HUA A;  3VPT A;  1YZX A;  1SL1 B;  1FB0 A;  1DE1 A;  2I9H A;  2XBQ A;  2H70 A;  4KA0 A;  5AIV A;  4IN0 A;  2DC5 A;  3LYP A;  1TK5 B;  3IK9 A;  2AHE A;  1TK8 B;  2YWI A;  2DJJ A;  5J5N A;  4BL7 A;  2VM1 A;  4GWR A;  4LMW A;  1JLV A;  1XWG A;  4HZ4 A;  1A24 A;  5AGY A;  2H8L A;  4MJA A;  4HU9 A;  4X43 A;  4OFN A;  3U6V A;  1B4P A;  2YP6 A;  2DBC A;  3WT1 A;  2HFD A;  3ERG A;  3H4K A;  2EC4 A;  4MDC A;  3HCZ A;  2TIR A;  1OC9 B;  1FVJ A;  4DEJ A;  5DAK B;  4ICY A;  1GTB A;  1Z7R A;  3VWX A;  3N9J A;  2V41 A;  1ZL9 A;  2HYX A;  5FHI A;  3APO A;  1PMT A;  1FAA A;  1WWJ A;  1ZYE A;  5G1L A;  3BCK A;  2MYG A;  1SK0 A;  3GFK A;  1GSE A;  4OCE A;  3MNG A;  5F07 A;  4EF0 A;  3PH9 A;  4JRR A;  4WR4 A;  4P3Y B;  3M8N A;  4PUR A;  1KTE A;  1GP1 A;  2GSQ A;  3BCI A;  5EY6 A;  4DVC A;  1ILO A;  1TOF A;  5KN1 A;  3IAS 2;  1WRY A;  4KW6 A;  2IJY A;  4F0C A;  2HT9 A;  3TRQ A;  5GSS A;  4WXT A;  5JWO B;  2HE3 A;  5IMZ A;  3TKR A;  1EP8 A;  4CW9 A;  3ZFB A;  3CRT A;  3WGE A;  2FWG A;  3US3 A;  4X1U A;  1EV4 A;  1BYE A;  3AY8 A;  4PXO A;  5CRG A;  3GSS A;  5ELA A;  2YJH A;  3EPT A;  4ECJ A;  2CVK A;  1WIK A;  2JZS A;  5D8I A;  2DIZ A;  3CSJ A;  3L9S A;  1FW1 A;  4NAX A;  2FUG 2;  1GRX A;  4TRX A;  5DJM A;  3TB2 A;  4EE0 A;  3ISO A;  5JCU A;  3ZRE A;  4K0N A;  3HHV A;  2VOC A;  5GST A;  1H75 A;  2NBS A;  2L5L A;  5ID2 A;  4MJE A;  1ERU A;  3RDW A;  2LTK A;  1QUW A;  3HZ8 A;  1MEK A;  5D96 A;  4ZB9 A;  3WT2 A;  3UVH A;  1YY7 A;  3G7Y A;  1FB6 A;  1MTC A;  4MZC A;  1K3L A;  1DUG A;  4LA1 A;  4F03 A;  1F37 A;  2X8H A;  5G30 A;  4H86 A;  3TOU A;  4MH3 A;  2V2G A;  4O92 A;  4HJM A;  5B8B A;  4AGS A;  1GSU A;  2FNO A;  1NM3 A;  2H1A A;  4XRD A;  4YH2 A;  1AIU A;  2Z9S A;  5BRT A;  3GL5 A;  4PQI A;  2F3M A;  6GSV A;  1R7H A;  4FYC A;  3EYT A;  3EMX A;  4JE1 A;  2IIY A;  6GSY A;  3CBU A;  3QOU A;  5HR0 A;  1X0R A;  1QMV A;  3J7Y b;  3O6T A;  4CDO A;  4ZL9 A;  1PX6 A;  1SK2 A;  3N5O A;  4ECB A;  3QDN A;  2LQO A;  2VLT A;  2GT6 A;  3F6D A;  3P8W A;  4TR3 A;  1PKZ A;  4MF5 A;  5ECM B;  2HLS A;  4D73 A;  1TJD A;  2VCZ A;  1FOH A;  2QGV A;  1DE2 A;  3D21 A;  1SD9 A;  4CY6 A;  4GSN A;  2I81 A;  2HSM A;  5KOW A;  3M3M A;  5INY A;  4GQC A;  1XOA A;  1O6J A;  1F9M A;  1K0D A;  4PQ1 A;  5CRE A;  5ENU A;  1A8L A;  5G1K A;  5IMC A;  1EZK A;  4K0G A;  4IGJ A;  3RHB A;  6GSW A;  1H4O A;  4LL4 B;  2B7J A;  2E2M A;  1XOB A;  1PX7 A;  5E59 A;  1I5G A;  1M9B A;  1TXX A;  2H30 A;  2OBI A;  4MPF A;  3GKM A;  4RQX A;  2YN1 A;  3GYK A;  3D6I A;  3KXO A;  1E6B A;  1EV9 A;  3EUR A;  1X9S B;  3NZN A;  2FA4 A;  2AAW A;  1O7U A;  5D9V A;  3MWH A;  2FWH A;  2IFQ B;  3VI5 A;  5IIZ A;  4ZBD A;  3TOT A;  5HFG A;  1JZD A;  1ERV A;  2O85 A;  1XCC A;  4K1F A;  1G7O A;  2P31 A;  4MLY A;  3KP9 A;  2C8U A;  5DJL A;  1AQX A;  5JWQ B;  2F9S A;  4Q5Q A;  3FZA A;  2KOK A;  3OR5 A;  3BOA A;  1PD2 1;  1R5P A;  5IQY A;  3VUR A;  2LV3 A;  1HD2 A;  5HR2 A;  3RBT A;  1A2M A;  4N0V A;  3HY2 A;  2I4A A;  2QKE A;  4BVY B;  4ZXG A;  14GS A;  4IP6 A;  5CRW A;  2GZY A;  2R6K A;  5IM9 A;  1B9Y C;  4N30 A;  1R26 A;  3BD2 A;  4DSS A;  4MA9 A;  2I1U A;  1G6W A;  5J9B A;  2DLX A;  1K0M A;  4TR1 A;  3D0Z A;  2FCH A;  4EO3 A;  2LRC A;  3H79 A;  2C4J A;  5A4U A;  5H5R A;  2GTU A;  4POL A;  2KP2 A;  1YQ1 A;  2G2Q A;  2FWF A;  2N5B A;  2R37 A;  5B6M A;  1TK0 B;  2YAN A;  3L4N A;  4TXO B;  2XBI A;  1XBS A;  2LJA A;  4KGI A;  4Q5R A;  3VK9 A;  2G0F A;  2AYT A;  2FWE A;  1X9M B;  1O81 A;  4BVX A;  2OJL A;  3TJJ A;  3KMN A;  2DKH A;  1Y6E A;  3C7M A;  1GTI A;  4N10 A;  3FZ4 A;  2J9H A;  3F6F A;  5FWG A;  1U87 A;  1ON4 A;  2A2R A;  2P5Q A;  5AN1 A;  1GUK A;  2EIQ A;  4OD7 A;  2E2G A;  4AJ6 A;  3TKS A;  4YQM A;  2CZ3 A;  5ECR B;  3BBY A;  2TRC P;  2PN8 A;  3EE2 A;  1GTA A;  2X8C A;  2LNT A;  2HZE A;  3Q6O A;  2GST A;  2JZT A;  4MMM A;  4JU5 A;  3E3E A;  4O32 A;  3CRU A;  1ERW A;  1VF4 A;  4WF4 A;  5IPH A;  4XS1 A;  4OFM A;  3UOM A;  1EGR A;  3GKX A;  2H76 A;  5CRD A;  2AUV A;  2VAF A;  1BJX A;  3SBC A;  4AF2 A;  3F3R A;  2R2J A;  22GS A;  3APS A;  4KSO A;  3O76 A;  1PGT A;  4DSQ A;  4NV2 A;  4YQV A;  1OVN A;  5J3R A;  3UEM A;  5B7C A;  1GSQ A;  2H71 A;  1OC3 A;  3PGT A;  4KF9 A;  2J23 A;  4WBJ A;  2CX3 A;  4USS A;  3EU4 A;  4PGT A;  3IOS A;  4BL7 B;  1A2L A;  2WUL A;  3CSH A;  3LXZ A;  2O7K A;  4Q5F A;  1AUC A;  4ZL7 A;  3J7Y k;  3EWL A;  1OYJ A;  1TDI A;  5IPG A;  2PUK C;  3UJ1 A;  4KE3 A;  3A2X A;  8GSS A;  4AJ7 A;  3LWA A;  3NOF A;  3QFA C;  5J41 A;  1YEP A;  1IYI A;  2C3T A;  3IRA A;  3IDV A;  4K8M A;  2GSR A;  3MSZ A;  1UC7 A;  1MD4 A;  1SD8 A;  1QK8 A;  4QL9 A;  4EVM A;  1THX A;  4EUY A;  1GUL A;  4EIP A;  3HDC A;  1GL8 A;  1M2A A;  4JR6 A;  1W89 A;  5F8B A;  2LQQ A;  2XPD A;  18GS A;  3R2Q A;  1OKD A;  5KEJ A;  2P5R A;  4O7H A;  3TKS C;  5ABR A;  2KP1 A;  4YAV A;  2CVD A;  3FW2 A;  2GZP A;  2GQM A;  17GS A;  2TRX A;  2O89 A;  2WDU A;  5D93 A;  3S9F A;  2HSH A;  4FYB A;  4EXJ A;  4NPB A;  4ML6 A;  4PQH A;  4IVF A;  4CY8 A;  1BED A;  1J9B A;  2YZH A;  2PPT A;  1YF0 A;  4V1A p;  1S3A A;  1AC1 A;  3FMW A;  3TDG A;  2OE0 A;  3FY7 A;  5HR3 A;  3FYG A;  3FZ9 A;  5DVB A;  2MMN A;  4LL1 B;  2IL3 A;  1OE8 A;  4V2M A;  1DBY A;  2QA2 A;  1U88 A;  1AXD A;  5CP1 A;  3VPQ A;  3EC3 A;  1TRV A;  2JAC A;  2B1K A;  3DGQ A;  1YDK A;  4GRF A;  5DQY A;  2FLS A;  5DCG A;  1F2E A;  5A4W A;  2DML A;  2H6X A;  2HZF A;  1B8X A;  2ZNM A;  2X8G A;  3MDK A;  2AJQ B;  2H0G A;  2D2Z A;  1Z5Y E;  4J56 E;  2R3X A;  4KAE A;  4HQZ A;  1PA3 A;  3H8Q A;  2F8A A;  4PUA A;  12GS A;  1KBN A;  2R4V A;  3TKS E;  2R5G A;  3V1W A;  2NPB A;  4DSR A;  4I97 A;  4FQU A;  2E7P A;  2X49 A;  2AB6 A;  1USB A;  4MPG A;  1GH2 A;  4LMV A;  4I6X A;  5BMU A;  5ID2 B;  1R5A A;  2VL2 A;  4POM A;  2C0G A;  1QQ2 A;  2GS3 A;  3IXR A;  2FD3 A;  1ML6 A;  3KZQ A;  5KOX A;  1HNC A;  2ZUP A;  3G9B A;  1GWC A;  4ZIJ A;  3IBH A;  5HQP A;  2DJ1 A;  5DBQ A;  5L71 A;  1Z6N A;  1VF3 A;  3UIW A;  1TW9 A;  1HYU A;  2YWM A;  4BWQ A;  2H1B A;  1O8X A;  2R0C A;  2YPM A;  1T7P B;  1TTZ A;  2H73 A;  1SU9 A;  1VGL A;  4J2F A;  3Q19 A;  2GZZ A;  3IHG A;  1VF1 A;  4NXI A;  4WEY A;  2LUS A;  4XCS A;  4ISD A;  4MH2 A;  2XHF A;  3KJY A;  4QQ7 A;  1RQM A;  3E0U A;  4D73 B;  6GST A;  4BPY A;  5GAN D;  1T1V A;  5C00 A;  3I9V 2;  3M1G A;  1K0C A;  2V6K A;  4ID0 A;  2ZCT A;  3A2V A;  4GLT A;  1E2Y A;  1ZYN A;  1NHY A;  5J4U A;  3TKP A;  1WP0 A;  1URM A;  4OO5 A;  3K8N A;  3DEX A;  2H6Z A;  3ME8 A;  2PBJ A;  3HYP A;  2O87 A;  3ZIJ A;  1V98 A;  4Z7X A;  4TN8 A;  3DD3 A;  3HZ4 A;  4MNN A;  4MJC A;  1K0B A;  5HR1 A;  2PMT A;  3P90 A;  3ZRD A;  4I5Q A;  2H1G A;  4KDU A;  4WR5 A;  3GTU A;  4KCE A;  2REM A;  3VLN A;  4TXV A;  2M72 A;  3D4T A;  3HVV A;  3TRP A;  4OFT A;  1SKR B;  1EEM A;  1HQO A;  3FZ5 A;  1B48 A;  1JZW A;  3GKK A;  4ZBA A;  2LRN A;  4JBB A;  4KDY A;  1A8Y A;  2A4H A;  3LG6 A;  2A2P A;  1NW2 A;  3UBK A;  3F0I A;  3C1R A;  4AJ8 A;  4ECC A;  1JZO A;  2DIY A;  3ED3 A;  2L4Q A;  3KH7 A;  2H6Y A;  2F8F A;  5IOW A;  2K8S A;  3P7X A;  1F3A A;  1YEX A;  2CQ9 A;  2VCT A;  4F82 A;  4G2E A;  2GGT A;  6GSU A;  1I9D A;  3GKN A;  3CTF A;  4ZBB A;  1RW1 A;  3HKR A;  1B9X C;  1CQH A;  2A2S A;  2JAD A;  16GS A;  1S3C A;  1MDJ A;  5A4V A;  3VFI A;  2HRK A;  3L0H A;  2IN3 A;  5ECQ B;  5B6N A;  2H66 A;  3KP8 A;  1DSB A;  4K2X A;  3DIE A;  4EKZ A;  2HRN A;  2UZ8 A;  2RII A;  3E9J B;  1G6Y A;  1TRS A;  3CXG A;  3DYR A;  3LFL A;  4TVE A;  4XIH A;  1M0U A;  4IQ1 A;  3VWV A;  3QPM A;  1AQV A;  3EVI A;  3A5W A;  4WKW A;  3SWL A;  5ECI B;  4KCA A;  5ECO B;  4MZB A;  2JZR A;  3DML A;  4ACS A;  3H93 A;  3IK7 A;  3ZVJ A;  4DSS B;  3EU3 A;  4K5R A;  2H74 A;  2PU9 C;  3QFB C;  2CV4 A;  4TR1 B;  1Z9H A;  3G7J A;  4Q5N A;  3HVS A;  2DSA A;  6GSX A;  1X5E A;  2YNX A;  5ECH B;  4HJ2 A;  2AV4 A;  3HA9 A;  1OKT A;  1O73 A;  1XPV A;  5LD0 A;  1WPI A;  5DAL A;  1YKC A;  5EL8 A;  2K9F A;  4JR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...