2FA4A

Crystal structure of oxidized form from saccharomyces cerevisiae
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
MVTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin II
publication title Crystal structure of the yeast cytoplasmic thioredoxin Trx2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Electron transport
total genus 29
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fa4A00
1T3BA 1B9XC 1T7PB 5G2ZA 3QMXA 4MDCA 3L0HA 2V32A 3RHBA 2E2MA 1I5GA 2H1GA 2GSTA 3DIEA 3HHVA 4WBJA 4ZB6A 2PN8A 3NOFA 1U88A 1DSBA 2VCZA 4WETA 1TU8A 2J9HA 1LJRA 2KLXA 4ZBDA 3VPQA 3ZMKA 4BA7A 2HZEB 2C3NA 1SD9A 4I6XA 4MJEA 4XS6A 3FYGA 2GS3A 2M46A 1ZOFA 3I9V2 3FY7A 4K7IA 2CV4A 3KZQA 1G0TA 4BWQA 2OADA 4O7HA 4OFNA 2H71A 1V58A 1XWAA 3I69A 3VWWA 3H93A 3BCIA 3GFKA 2FD3A 3RBTA 3ERFA 2CAQA 1WIKA 2KOKA 3VWUA 3TOTA 3PH9A 1LU4A 1U87A 2VLTA 3FR6A 4L5OA 3KTBA 2EIOA 1URMA 2GLRA 2P31A 3MAKA 5IIZA 1QXHA 1HQOA 3ZIVA 1ZYQB 2B1LA 1BJXA 4O32A 2A2RA 4IQAA 1AIUA 2DC5A 2F51A 4PUFC 5ID2A 2MZCA 2VD0A 1KEBA 4IW9A 2H01A 1O6JA 5J9BA 4MCUA 1MDJA 1EGRA 1O85A 3D0ZA 18GSA 1JZWA 5B8AA 1SKRB 4L8EA 1GSUA 1TRSA 3C1SA 4LL4B 5C04A 4EO3A 3TKSC 5DDLA 1V40A 1YKCA 1EV4A 3BJ5A 2F8FA 1ZCPA 2H0HA 5A4VA 4V2MA 1GULA 4BVXA 5HR1A 4ZBAA 4LA1A 2YN1A 3GN3A 3WGEA 4OO5A 2ES7A 2VCXA 2H1BA 1RQMA 1TRVA 4I5QA 1OC9A 4NHWA 1Z6NA 1FHEA 2A4VA 5IPGA 3TJKA 2ALBA 4FH8A 4F82A 3FKFA 1TTZA 4PURA 2I1UA 1G7EA 2O87A 3O76A 3LSZA 1IYIA 3Q19A 3JCML 1GWCA 5DAKA 6GSXA 2IFQA 1VF3A 2VLVA 4WF4A 1YJ6A 1A8LA 2VO4A 2AAWA 4TR3A 3UVTA 3EU4A 3P2AA 8GSSA 3EVIA 5DJMA 1PX6A 3HJOA 2F8AA 14GSA 2PPTA 6GSUA 1TP9A 3ZYWA 4AJ7A 4WR4A 2WGRA 1Z6MA 1TI1A 3M9JA 4PQHA 2CX4A 2DJ3A 2L6DA 4K1FA 2O89A 2H72A 4PQ1A 2VL2C 1Y6EA 1X9MB 4TR0A 5IO0A 1HD2A 1O81A 1XBSA 2AYTA 5ECIB 1B8XA 2DIYA 1N2AA 5F05A 3LXZA 1UN2A 2XPDA 4EL1A 1UVZA 4KA0A 3VK9A 1XZOA 3KTLA 3W8SA 1U3IA 4BL7A 3KIJA 10GSA 3FR9A 3FW2A 1PL1A 4RI7A 1VF4A 1SJ6A 3Q18A 2PBJA 2IL3A 1ON4A 3W6GA 1M9AA 1XFLA 3APQA 4MZBA 1OE7A 1X5CA 2FHEA 3IRAA 2O8VB 3KD0A 2HRFA 4PNFA 3ZVJD 6GSWA 3SWLA 5H5RA 1T8EB 1X9WB 1XWCA 1Z5YE 4XS1A 3C73A 5IQYA 5KEJA 4PXOA 2C4JA 3MWHA 1GLPA 5IMFA 4MMMA 3TB2A 1Z7RA 6GSYA 1RW1A 1M9BA 5ECPB 5AIVA 1VF2A 1S3DA 1A2LA 3UIWA 2GSRA 3ERWA 4MJAA 3ZL5A 4RQXA 5AGYA 3MSZA 4MZCA 4KH7A 1Z3EA 4KUNA 2X8GA 1OAZA 4ZL8A 3D21A 2WZ9A 1YY7A 5F07A 3I6AA 1EP7A 4PGTA 4ECBA 4KCEA 2YWOA 1JZRA 4K0GA 4ML1A 5B6NA 4KDUA 2FCHA 4X43A 1PA3A 5KN1A 4ECCA 3HD5A 3PR8A 3DEXA 1S3CA 1A0FA 12GSA 5G5EA 1H75A 1MDIA 4TR4A 3N9JA 4TKYA 2ON7A 2R5GA 5E4WA 4OFTA 5DBQA 3TJBA 3VPTA 4P3YB 3O3TA 2CZ3A 4Q5FA 1SK1A 3KXOA 3QAGA 4ISDA 3TCOA 2HXKA 1TK8B 2N5AA 4GLTA 4N10A 4I97A 2V2GA 3ISOA 2CVKA 2K8SA 5DALA 3R2QA 3GMFA 4JRRA 2VL9A 1GTIA 2O7KA 1GSSA 2DMMA 2BJXA 2AJQB 4TXOB 4ECIA 4PX1A 4XS4B 5ECSA 2NPBA 3ED3A 3TGZA 2H30A 5ECRB 1W4VA 1SL1B 3Q6OA 1ML6A 5ECHB 5ELAA 1C72A 4MF7A 2IPAA 5IOWA 1EV9A 4EKZA 2B5XA 3K8NA 4MP4A 4ZIJA 1EGOA 2OE3A 3IC4A 2LRNA 4ECJA 2PVOC 4XHMA 4FIWA 2I81A 17GSA 5CAXA 2X8CA 2C0FA 3IBHA 2IMDA 4ZL7A 5DCHA 3GH9A 5CREA 4Q5NA 3RDWA 2M72A 3IV4A 2L5LA 4OO4A 2CVDA 4V1Ap 4AGSA 3GHAA 1MEKA 1XOBA 1SYXA 3GUSA 5ECLB 3HDCA 2NVLA 3FHKA 5LD0A 3TKRA 4ZBBA 1Q4JA 4HQSA 3GV1A 2L4CA 1R5AA 2TIRA 3PINA 3KH9A 1EOHA 4ULXA 1F37A 1GTBA 3ME7A 2P5RA 1X5EA 3QR6A 5D9XA 3EYTA 4PQIA 3M1GA 4IJ3A 3KJYA 3TKQA 3ZFBA 1YEPA 1JZOA 3S9FA 2CA8A 3IHQA 3HZ4A 4G10A 3M8NA 3BD2A 1OVNA 4TN8A 1XCCA 2VCWA 2YP6A 3IK9A 4TR1A 1WPIA 2VM1A 2YCDA 2V6KA 3TJJA 3BBYA 2B5YA 3OR5A 5DQSA 1XPVA 1AQXA 3KEBA 4TVEA 4MF5A 5A4WA 2RUEA 5EY6A 5F8BA 3VURA 4IQ1A 4DSQA 4NMUA 4O5RA 4KNDA 2P0GA 1SU9A 3UARA 1QGVA 3HY2A 3UL3A 2YZUA 4DSSA 4NV5A 2YWMA 4V2NA 2MMZA 3P8WA 3IR4A 3ZFLA 2GT5A 1B4QA 4BPYA 1XW9A 3LJRA 3P90A 5ECQB 2DIZA 2C80A 2XBIA 1BAYA 1IYHA 4MJCA 1K0MA 1PRXA 1T4YA 5JWRB 5KN2A 3D22A 2DJKA 2C1YA 3GTUA 1XOAA 4WF5A 3RHCA 2FUG2 3G7JA 4POKA 2CVBA 2HE3A 5B6MA 1ERWA 3TJFA 3TOUA 2HSYA 1TOFA 5E59A 5COHA 2L4QA 1OC9B 4MPFA 2HYXA 2IMFA 4RI6A 1BG5A 2X8HA 2R4VA 3FZ5A 1USBA 13GSA 4BVYA 1M2BA 2LTKA 6GSVA 2REMA 2L59A 1K0CA 3ZLPA 4ML6A 2HNLA 3GYKA 5A4UA 1A24A 5G31A 5AN1A 2KP1A 1FOVA 5ECNB 4JEDA 2YANA 2MYGA 5ENUA 1TK5B 1JFUA 5DAKB 4MK3A 2IJYA 1M2AA 3LWAA 3Q74A 2FY6A 3GKMA 3QFBC 3UOMA 2NDOA 1KNGA 4XIHA 2PMTA 3GKXA 1SYRA 1AW9A 4E8HA 4F03A 1B48A 5LCZA 2GGTA 3KCMA 2LJAA 5F0GA 5ABRA 4X1UA 5FWGA 4NWYA 4F0CA 1SJZA 4FYUA 2IMIA 3EWLA 3FZ4A 2JZRA 2ZUPA 3ZZXA 1F3BA 4TRXA 3TJGA 1R26A 2VM2A 1K3YA 1OE8A 3FK8A 5D9VA 2YNXA 1VGLA 4HZ2A 3TRQA 2V1MA 5IMVA 3FR3A 4EVMA 1GSQA 4YQMA 2K18A 2KP2A 5G1KA 2OBIA 5J41A 2VAFA 2HZEA 4GXZA 3GRXA 2FGXA 4NAXA 5CO3A 3HVVA 4ZILA 1BYEA 1NM3A 3NZNA 1Q98A 4GF0A 1FVJA 1SK0A 1UA5A 1FB0A 2OJLA 2PERA 4GRFA 4L5LA 4TXVA 1GTUA 4GSSA 1QFNA 2LRCA 1I9DA 1PMTA 2B1KA 1SKSB 1X0RA 3U5RE 3A3TA 2GZPA 5D96A 1PGTA 1V2AA 2YOIA 4JR4A 3GURA 2RM5A 4HU7A 5FHIA 1OKTA 2B7JA 3US3A 1XWBA 3VI5A 2GQMA 1A2MA 1R4WA 3BOAA 1TXXA 2LSTA 2IMEA 4CW9A 4D73A 3HKRA 2TRCP 4JBBA 2C8UA 5D73A 2V6OA 2C0EA 2WULA 3F9UA 1TDIA 3L9SA 1K0OA 3APSA 2LV3A 3F4TA 1ACVA 4YQVA 1GSDA 1AUCA 3G7IA 16GSA 1SJIA 2OA7A 2HI7A 4HS1A 4O92A 3IA1A 3GNJA 1EZKA 4E8EA 5CRHA 2B7KA 2OACA 5ECOB 1HNCA 4POBA 4CDOA 1E6BA 2F3MA 2FA4A 5HR2A 2H1AA 3QOUA 5GZZB 4K0NA 3HYPA 2P5QA 19GSA 5KN0A 3IPZA 3F3QA 1YDKA 4L0UA 3V1WA 5H5QA 1CQGA 1OKDA 1Y25A 2NTOA 4POLA 3F6FA 2R3XA 4I2TA 3CTGA 3LG6A 3U6VA 2YV7A 5AIXA 2XBQA 6GSSA 1SD8A 3CBUA 4HI7A 1GNWA 2JSZA 2TRXA 4MH2A 2LQOA 4YAVA 1GSFA 3C71A 4EDYA 1BEDA 4KDYA 2JZTA 4POMA 3QCPA 2VLUA 4Q5QA 1K0AA 3HVXA 5HR3A 4GQFA 2M80A 2KHPA 3HJMA 2MBTA 1WWJA 5AISA 2EIRA 3G9BA 3KGKA 4HQZA 4KE3A 2DLXA 2AV4A 1A23A 3J7Yk 1NW2A 1XW5A 5JWOB 3KP8A 5D8IA 2B3SA 4HDEA 20GSA 3DVXA 1EP8A 3AY8A 1J08A 1K0BA 4ZL9A 1B4PA 4HJMA 4Z7XA 2LJKA 3GKKA 4J2FA 2JSYA 2V41A 2L6CA 1JLVA 2OKAA 2DSAA 1WE0A 1MTCA 1NSWA 4QL7A 3H1NA 5IMDA 1R7HA 3ZITA 3DVWA 3NIVA 4N11A 4L0WA 1YQ1A 2YWNA 2QKEA 4GTUA 1V57A 2LNTA 1GP1A 2MMOA 3ME8A 3ZMLA 3DXBA 3E0UA 2H6YA 2GSQA 4IJIA 3J7Yb 5G5FA 1SENA 2VCTA 3UEMA 5IMAA 1E2YA 3D6IA 4MLYA 3QDNA 5CNWA 3UBKA 4PNGA 4KAEA 2B6MA 3CMIA 4YH2A 1CQHA 4EXJA 1V9WA 4ID0A 3ZVJA 1HYUA 2MMNA 2DMLA 4F9ZA 2RUFA 3MNGA 2CX3A 3IK7A 1HNAA 3C8EA 1M0UA 2H1DA 4HU9A 1Z9HA 3QFAC 3FRCA 4NHZA 1PN9A 1XIYA 3WD6A 3PGTA 6GSTA 1MD3A 1QUWA 3W8JA 4K7OA 2XHFA 3VFIA 3KM6A 1YF0A 1JZDA 3LYKA 3TRXA 2HRNA 5ECKB 4AF2A 5DJLA 4DSSB 2H75A 3FZ9A 2K8VA 1XVWA 3LFLA 3RPPA 3UVHA 4KB3A 1K3OA 2LRTA 2ZNMA 4TW5A 2PWJA 3IE3A 4ZB8A 2K6VA 4LMVA 2R6KA 4K6XA 1U6TA 4OWYA 4XCSA 1F9MA 3EC3A 5HFIA 2OBKA 5DCGA 3KMNA 4GCIA 1DE1A 2E2GA 2LS5A 3UAPA 2K9FA 3I43A 4N30A 2RIIA 4GQCA 3GKNA 1SK2A 3DD3A 3M0FA 4I8BA 4TOPA 1EEMA 4DVCA 2YV9A 2D2ZA 3WYWA 1K0DA 2DJ2A 4KCAA 4N0VA 1SL0B 1QK8A 1A0RP 1AQWA 4TXOA 4XS4A 1PL2A 4EE0A 2JACA 5J9CA 2WS2A 3L9VA 3VI7A 1ERUA 1THXA 4WXTA 1YKAA 5IMCA 2F9SA 5EPFA 1DE2A 3HXSA 5ID2B 5F06A 5D9TA 1SKWB 1FG4A 1Z7PA 2RLIA 2GZZA 2O85A 4JU5A 2RM6A 5JWQB 1X5DA 2WB9A 1GL8A 1TI3A 2DJJA 4RUVA 3ZREA 2R37A 3F63A 2LKUA 3H79A 4AJ6A 1OC8A 1R5PA 3FEUA 2DBCA 5HR0A 3M9KA 11GSA 4HUAA 5GAPD 1ZGNA 2YPMA 2N5FA 1AAZA 1F6MC 2VCQA 4MZWA 3LXTA 1GRXA 1YEXA 4JE1A 3CSJA 4G2EA 1WJKA 5J5NA 3L78A 3MDKA 2B5EA 2WRTA 3D4MA 2GDRA 3IDVA 4FO5A 2PVQA 1PD21 4IGJA 2EIQA 4LMWA 2JU5A 4H86A 3HZ8A 4N0ZA 2IWTA 2QGVA 3F3RA 5D9WA 4NXIA 4OFMA 2YWIA 2IFQB 3L4NA 2MBSA 3DKSA 2LNSA 3CSIA 2GTUA 3EURA 5DQYA 5C00A 4G19A 4WKWA 2VL2A 4HEA2 3TRPA 1ZMAA 1W89A 3IOSA 2NBSA 1NHOA 1O8WA 5L71A 1AXDA 3EINA 4IP1A 2JADA 4HZ4A 5HQPA 4CHSA 3L9UA 4MF6A 3F6DA 4FYCA 2OE1A 5GSSA 3CRTA 4D73B 2ON5A 1G6WA 2IN3A 3HA9A 2FWFA 2HFDA 2PU9C 5INYA 5CRDA 4MPGA 2H66A 2CT6A 1F2EA 2JL4A 1GSYA 4WR5A 1ERTA 4YQUA 1ABAA 4G9HA 2C0DA 3CTFA 1THOA 2IMKA 3DWVA 1ZL9A 3RAZA 2H6ZA 5JCUA 4WBRD 4ILFA 1KBNA 1RK4A 2FWHA 2G2QA 3UBLA 3A2WA 1J0FA 3TDGA 1XW6A 5IMZA 2VCVA 2LEGA 3CSHA 3GX0A 5JCGA 4KGIA 2MMAA 4J56E 1MD4A 1AC1A 3F8UA 2PGTA 4IBPA 1VRSD 1WRYA 2DJ0A 3LEFA 2A2SA 2E7PA 3WGDA 2QSIA 4V2LA 1A2JA 3D5JA 1BQ7A 1GH2A 1TRWA 9GSSA 2I9HA 3QAVA 2GT6A 4DEJA 2R2JA 2HT9A 3GIXA 2FLSA 4OCFA 2IIYA 5B8BA 4WEYA 1M2DA 3VWVA 4PUAA 2AUVA 1O73A 5FT3A 4HJ2A 3EMPA 1XVQA 5G1LA 3IAM2 3BCKA 4IVFA 1TU7A 3SBCA 1OYJA 2WDUA 3HVSA 2BMXA 4BWSA 3LGCA 3APOA 3EU3A 3TUEA 2JZSA 1PKWA 3ZTLA 1EWXA 1DUGA 1QQ2A 3CRUA 1J9BA 3IXRA 1AQVA 3CYNA 1LBKA 4IHUA 1XWKA 5IOXA 5CRGA 4ZB9A 4K7NA 1S3AA 5A5KA 2L5OA 4XTSA 2LUSA 1XXUA 4OMVA 2HZFA 5GSTA 1FO5A 2HSHA 2H0IA 2YZHA 2G0FA 5IM9A 4K9ZA 1MDKA 3KP9A 3GL3A 3WGXA 3E9JB 1TRUA 1UC7A 5IO2A 2AB6A 4MA9A 1K0NA 1WOUA 2BTOT 5DALB 1HNBA 3VWXA 1K3LA 5GAND 2C3TA 4QQ7A 2CAIA 3GX8A 1TW9A 3G7YA 4EF0A 4K8MA 2H70A 4NPBA 4F0BA 3TKSE 5D93A 2X99A 1O8XA 1GNEA 4EUYA 1GTAA 1M99A 1JHBA 4GSTA 3DYRA 1WP0A 2LQQA 2WCIA 4V1Ag 22GSA 3E3EA 4X0XA 5LNKe 3A5WA 2Z9SA 1PSQA 3M3MA 1X9SB 1ZYEA 1A8YA 4JZQA 4IP6A 3A2VA 2YJHA 5ELGA 1FB6A 4K2DA 4ZXGA 4I2UA 4J57E 5B7CA 1DBYA 5G30A 1FVKA 3WT2A 1O7UA 4OD7A 4XRAA 2GZYA 1BX9A 1TKDB 2ZCTA 2DJ1A 1M7TA 2OE0A 1SL2B 3HCZA 3TKPA 1T00A 1GUMA 2YJ7A 1V98A 1GLQA 2C0GA 2LJRA 3QD9A 4Q5RA 1T4ZA 4GSNA 1U3AA 3GA4A 2GSSA 5DVBA 3A2XA 2GQLA 4LLRA 2XC2A 1VF1A 3H8QA 1PQNA 1G6YA 3N5OA 3EE2A 4KW6A 4YAPA 4OCEA 5CRWA 2N5BA 1GSEA 4LL1B 4ACSA 4FYBA 3ZIJA 3GSSA 1TJDA 1YF1A 2QC7A 1XWGA 4TR1B 4IN0A 4MH3A 5J4UA 3GSTA 2H74A 5H5SA 1KTEA 1WMJA 1F3AA 4KSMA 4MABA 2CZ2A 3D4TA 1GUKA 2WFCA 2E0QA 3DMLA 2GQKA 3FZAA 1ST9A 7GSSA 2H19A 3LQ7A 4QL9A 2VD1A 3QPMA 1N8JA 5CYYA 3LYPA 1OC3A 2WJUA 2VL3A 2FNOA 1QMVA 1ERVA 2EC4A 1FW1A 1TK0B 2FA8A 5ECMB 1GUHA 5EL8A 3C7MA 2AHEA 4KSOA 4DSRA 2X64A 5J3RA 5HFKA 2KUCA 2I3YA 4IKHA 4KX4A 2L57A 4MJBA 2VUPA 3KMOA 1ZZYA 1NHYA 1PX7A 3F4RA 3GTUB 5JCWA 3LORA 2I4AA 1G7OA 1ILOA 2J23A 4EC0A 3F4SA 1PKZA 2VOCA 2FWEA 4NV2A 2XPEA 2H6XA 2H0GA 3F0IA 4IELA 4IS0A 3DRNA 5KN3A 2GVPA 5EVOA 2FWGA 4EDZA 3O6TA 3CXGA 1FAAA 3QAWA 1EEJA 2H8LA 4JR6A 3VLNA 3GL5A 2CQ9A 1T1VA 2C3QA 4KDXA 2PUKC 1EOGA 3C1RA 3P7XA 3UMAA 3KH7A 3EMXA 3DGQA 3HJPA 3RPNA 3ZRDA 5IPHA 2HLSA 3IAS2 4GWRA 3GH6A 1YZXA 1B9YC 4F2IA 3WT1A 2VIMA 3H4KA 4XRDA 4AJ8A 3ERGA 5HFGA 3TKSA 2H76A 5CP1A 4RQRA 1H4OA 4HOJA 2H73A 1JLWA 3UJ1A
chains in the Genus database with same CATH superfamily
1T3BA 1B9XC 1T7PB 5G2ZA 3QMXA 4MDCA 3L0HA 2V32A 3RHBA 2E2MA 1I5GA 2H1GA 2GSTA 3DIEA 3HHVA 4WBJA 4ZB6A 2PN8A 3NOFA 1U88A 1DSBA 2VCZA 2HRKA 4WETA 1TU8A 2J9HA 1LJRA 2KLXA 4PTSA 4ZBDA 3VPQA 3ZMKA 4BA7A 2HZEB 2C3NA 1SD9A 4I6XA 4MJEA 4XS6A 3FYGA 2GS3A 2M46A 1ZOFA 3I9V2 3FY7A 4K7IA 2CV4A 4Z2TA 3KZQA 1G0TA 4BWQA 2OADA 4O7HA 4OFNA 2H71A 1V58A 1XWAA 3I69A 3VWWA 3H93A 3BCIA 3GFKA 2FD3A 3RBTA 3ERFA 2CAQA 1WIKA 2KOKA 3VWUA 3TOTA 3PH9A 1LU4A 1U87A 2VLTA 3FR6A 4L5OA 3KTBA 2EIOA 1URMA 2GLRA 2P31A 3MAKA 5IIZA 1QXHA 1HQOA 3ZIVA 1ZYQB 2B1LA 1BJXA 4O32A 2A2RA 4IQAA 1AIUA 2DC5A 2F51A 4PUFC 5ID2A 2MZCA 2VD0A 1KEBA 4IW9A 2H01A 1O6JA 5J9BA 4MCUA 1MDJA 1EGRA 1O85A 3D0ZA 18GSA 1JZWA 5B8AA 1SKRB 4L8EA 1GSUA 1TRSA 3C1SA 4LL4B 5C04A 4EO3A 3TKSC 5DDLA 1V40A 1YKCA 1EV4A 3BJ5A 2F8FA 1ZCPA 2H0HA 5A4VA 4V2MA 1GULA 4BVXA 5HR1A 4ZBAA 4LA1A 2YN1A 3GN3A 3WGEA 4OO5A 2ES7A 2VCXA 2H1BA 1RQMA 1TRVA 4I5QA 1OC9A 4NHWA 1S3RA 1Z6NA 1FHEA 2A4VA 5IPGA 3TJKA 2ALBA 4FH8A 4F82A 3FKFA 4G0KA 1TTZA 4PURA 2I1UA 1G7EA 2O87A 3O76A 3IC8A 3LSZA 4EIQA 1IYIA 3Q19A 3JCML 1GWCA 5DAKA 6GSXA 2IFQA 1VF3A 2VLVA 4WF4A 1YJ6A 1A8LA 2R0GA 2VO4A 2AAWA 4TR3A 3UVTA 3EU4A 3P2AA 8GSSA 3EVIA 5DJMA 1PX6A 3HJOA 2F8AA 14GSA 2PPTA 6GSUA 1TP9A 3ZYWA 4AJ7A 4WR4A 2WGRA 1Z6MA 1TI1A 3M9JA 4PQHA 2CX4A 2DJ3A 2L6DA 4K1FA 2O89A 2H72A 4PQ1A 2VL2C 1Y6EA 1X9MB 4G0IA 4TR0A 5IO0A 1HD2A 1O81A 1XBSA 2AYTA 5ECIB 1B8XA 2DIYA 1N2AA 5F05A 3LXZA 1UN2A 2XPDA 4EL1A 1UVZA 4KA0A 3VK9A 1XZOA 3KTLA 3W8SA 1U3IA 4BL7A 3KIJA 10GSA 3FR9A 3FW2A 1PL1A 4RI7A 1VF4A 1SJ6A 3Q18A 2PBJA 2IL3A 1ON4A 3W6GA 1M9AA 1XFLA 3APQA 4MZBA 1OE7A 1X5CA 2FHEA 3IRAA 2O8VB 4Z2RA 3KD0A 2HRFA 4PNFA 3ZVJD 6GSWA 3SWLA 5H5RA 1T8EB 4EIPA 1X9WB 1XWCA 1Z5YE 4XS1A 3C73A 5IQYA 5KEJA 4PXOA 2C4JA 3MWHA 1GLPA 5IMFA 4MMMA 3TB2A 1Z7RA 6GSYA 1RW1A 1M9BA 5ECPB 5AIVA 1VF2A 1S3DA 1A2LA 3UIWA 2GSRA 3ERWA 4MJAA 3ZL5A 4RQXA 5AGYA 3MSZA 4MZCA 4KH7A 1Z3EA 4KUNA 2X8GA 1OAZA 4ZL8A 3D21A 2WZ9A 1YY7A 5BRTA 3R3EA 5F07A 3I6AA 1EP7A 4PGTA 4ECBA 4KCEA 2YWOA 1JZRA 4K0GA 4ML1A 5B6NA 4KDUA 2FCHA 4X43A 1PA3A 5KN1A 4ECCA 3HD5A 3PR8A 3DEXA 1S3CA 1A0FA 12GSA 5G5EA 1H75A 1MDIA 4TR4A 3N9JA 4TKYA 2ON7A 2R5GA 5E4WA 4OFTA 3MYDA 5DBQA 3TJBA 3VPTA 4P3YB 3O3TA 2CZ3A 4Q5FA 1SK1A 3KXOA 3QAGA 4ISDA 3TCOA 2HXKA 1TK8B 2N5AA 4GLTA 4N10A 4I97A 1PFOA 2V2GA 3ISOA 2CVKA 2K8SA 5DALA 3R2QA 3GMFA 4JRRA 4X4JA 2VL9A 1GTIA 2O7KA 1GSSA 2DMMA 2BJXA 4O5QA 2AJQB 4TXOB 4ECIA 4PX1A 4XS4B 5ECSA 2NPBA 3ED3A 3TGZA 2H30A 4CY8A 5ECRB 1W4VA 1SL1B 3Q6OA 1ML6A 5ECHB 5ELAA 1C72A 4MF7A 1PN0A 2IPAA 5IOWA 1EV9A 2R0CA 4EKZA 2B5XA 3K8NA 4MP4A 4ZIJA 1EGOA 2OE3A 3IC4A 2LRNA 4ECJA 2PVOC 4XHMA 4FIWA 2I81A 17GSA 5CAXA 2X8CA 2C0FA 3IBHA 2IMDA 4ZL7A 5DCHA 4K2XA 3GH9A 1M3IA 5CREA 4Q5NA 3RDWA 2M72A 3IV4A 2L5LA 4OO4A 2CVDA 4V1Ap 4AGSA 5BMUA 3GHAA 1MEKA 1XOBA 1SYXA 3GUSA 1XG8A 5ECLB 3HDCA 2NVLA 3FHKA 5LD0A 3TKRA 4ZBBA 1Q4JA 4HQSA 3GV1A 2L4CA 1R5AA 1M3JA 2TIRA 3PINA 3KH9A 1EOHA 4ULXA 1F37A 1GTBA 3ME7A 2P5RA 1X5EA 3QR6A 5D9XA 3EYTA 4PQIA 3M1GA 4IJ3A 3KJYA 3TKQA 3ZFBA 1YEPA 1JZOA 3S9FA 2CA8A 3IHQA 3HZ4A 4G10A 3M8NA 3BD2A 1OVNA 4TN8A 1XCCA 2VCWA 2YP6A 3IK9A 4TR1A 1WPIA 2VM1A 2YCDA 2V6KA 3TJJA 3BBYA 2B5YA 3OR5A 5DQSA 1XPVA 1AQXA 3KEBA 4TVEA 4MF5A 5A4WA 2RUEA 5EY6A 5F8BA 3VURA 4IQ1A 4DSQA 4NMUA 4O5RA 4KNDA 2P0GA 3HVNA 1SU9A 3UARA 1QGVA 3HY2A 3UL3A 2YZUA 4DSSA 4NV5A 2YWMA 4V2NA 2MMZA 3P8WA 3IR4A 3ZFLA 2GT5A 1B4QA 3MIXA 4BPYA 1XW9A 3LJRA 3P90A 5ECQB 2DIZA 4BVXB 2C80A 2XBIA 1BAYA 1IYHA 4MJCA 1K0MA 1PRXA 1T4YA 5JWRB 5KN2A 3D22A 2DJKA 2C1YA 3GTUA 1XOAA 4WF5A 3RHCA 2FUG2 3G7JA 4POKA 2CVBA 2HE3A 5B6MA 1ERWA 3TJFA 3TOUA 2HSYA 1TOFA 5E59A 4HSCX 5COHA 2L4QA 1OC9B 4MPFA 2HYXA 2IMFA 4RI6A 1BG5A 4BIKA 2X8HA 2R4VA 3FZ5A 1USBA 13GSA 4BVYA 1M2BA 2LTKA 6GSVA 2REMA 2L59A 1K0CA 3ZLPA 4ML6A 2HNLA 3GYKA 5A4UA 1A24A 5G31A 5AN1A 2KP1A 1FOVA 5ECNB 4JEDA 2YANA 2MYGA 2UZ8A 5ENUA 1JFUA 5DAKB 1TK5B 4MK3A 2IJYA 1M2AA 3LWAA 3Q74A 2FY6A 3GKMA 3QFBC 3UOMA 4Z2UA 2NDOA 1KNGA 4XIHA 2PMTA 3GKXA 1SYRA 1AW9A 4E8HA 4F03A 1B48A 5LCZA 2GGTA 3KCMA 2LJAA 5F0GA 5ABRA 4X1UA 5FWGA 4NWYA 4F0CA 1SJZA 4FYUA 2IMIA 3EWLA 3FZ4A 2JZRA 2ZUPA 3ZZXA 1F3BA 4K5RA 4TRXA 3TJGA 1R26A 2VM2A 1K3YA 1OE8A 3FK8A 5D9VA 2YNXA 1VGLA 4HZ2A 3TRQA 2V1MA 5IMVA 3FR3A 4EVMA 1GSQA 4YQMA 2K18A 2KP2A 5G1KA 2OBIA 5J41A 2VAFA 2HZEA 4GXZA 3GRXA 2FGXA 4NAXA 5CO3A 3HVVA 4ZILA 3IHGA 1BYEA 1NM3A 3NZNA 1Q98A 4GF0A 1FVJA 1SK0A 2X49A 1UA5A 1FB0A 2OJLA 2PERA 4GRFA 4L5LA 4TXVA 1GTUA 4GSSA 1QFNA 2LRCA 1I9DA 1PMTA 2B1KA 1SKSB 1X0RA 3U5RE 3A3TA 2GZPA 5D96A 5KOWA 1PGTA 1V2AA 2YOIA 3LW9A 4JR4A 3GURA 2RM5A 4HU7A 5FHIA 1OKTA 2B7JA 3US3A 1XWBA 3VI5A 2GQMA 1A2MA 1R4WA 3BOAA 1TXXA 2LSTA 2IMEA 4CW9A 4D73A 3HKRA 2TRCP 3CQFA 4JBBA 2C8UA 5D73A 2V6OA 2C0EA 2WULA 3F9UA 1TDIA 3L9SA 1K0OA 3APSA 2LV3A 3F4TA 1ACVA 4YQVA 1GSDA 1AUCA 3G7IA 16GSA 1SJIA 2OA7A 2HI7A 4HS1A 4O92A 3IA1A 3GNJA 1EZKA 4E8EA 5CRHA 2B7KA 2OACA 5ECOB 1HNCA 4POBA 4CDOA 1E6BA 2F3MA 2FA4A 5HR2A 2H1AA 3QOUA 5GZZB 2DKHA 4K0NA 3HYPA 2P5QA 19GSA 5KN0A 3IPZA 4FQUA 3F3QA 1YDKA 4L0UA 3V1WA 5H5QA 1CQGA 4KF9A 1OKDA 1Y25A 2NTOA 4POLA 3F6FA 2R3XA 4I2TA 3CTGA 3LG6A 3U6VA 2YV7A 5AIXA 2XBQA 6GSSA 1SD8A 3CBUA 4HI7A 1GNWA 2JSZA 2TRXA 4MH2A 2LQOA 4YAVA 1GSFA 3C71A 4EDYA 1BEDA 2HSMA 4KDYA 2JZTA 4POMA 3QCPA 2A4HA 2VLUA 4Q5QA 1K0AA 4O5UA 3HVXA 5HR3A 4GQFA 2M80A 2KHPA 3HJMA 2MBTA 1WWJA 5AISA 2EIRA 3G9BA 3KGKA 4HQZA 4KE3A 2DLXA 2AV4A 1A23A 2HRAA 3J7Yk 1NW2A 1XW5A 5JWOB 3KP8A 5D8IA 2B3SA 4HDEA 20GSA 3DVXA 1EP8A 3AY8A 1J08A 1K0BA 4ZL9A 1B4PA 4HJMA 4Z7XA 2LJKA 3GKKA 4J2FA 2JSYA 2V41A 1ZYNA 2L6CA 1JLVA 2OKAA 2DSAA 1WE0A 1MTCA 1NSWA 4QL7A 3H1NA 5IMDA 1R7HA 3ZITA 3DVWA 3NIVA 4CY6A 4N11A 4L0WA 1YQ1A 2YWNA 2QKEA 4GTUA 1V57A 2LNTA 1GP1A 2MMOA 3ME8A 3ZMLA 3DXBA 3E0UA 2H6YA 2GSQA 4IJIA 3J7Yb 5G5FA 1SENA 2VCTA 3UEMA 5IMAA 1E2YA 3D6IA 4MLYA 3QDNA 5CNWA 3UBKA 4PNGA 4KAEA 2B6MA 3CMIA 4YH2A 1CQHA 4EXJA 1V9WA 4ID0A 3ZVJA 1HYUA 2MMNA 2DMLA 4F9ZA 2RUFA 3MNGA 2CX3A 3IK7A 1HNAA 3EPTA 3C8EA 1M0UA 2H1DA 4HU9A 1Z9HA 3QFAC 3FRCA 4NHZA 3FMWA 1PN9A 1XIYA 3WD6A 3PGTA 6GSTA 1MD3A 1QUWA 3W8JA 4K7OA 2XHFA 3VFIA 3KM6A 3PPUA 1YF0A 1JZDA 3LYKA 3TRXA 2HRNA 5ECKB 4AF2A 5DJLA 4DSSB 2H75A 3FZ9A 2K8VA 1XVWA 3LFLA 3RPPA 3UVHA 4KB3A 1K3OA 2LRTA 2ZNMA 4TW5A 2PWJA 3IE3A 4ZB8A 2K6VA 4LMVA 2R6KA 4K6XA 1U6TA 4OWYA 4XCSA 1F9MA 3EC3A 5HFIA 2OBKA 5DCGA 3KMNA 4GCIA 1DE1A 2E2GA 2LS5A 3UAPA 2K9FA 3I43A 4N30A 4ICYA 2RIIA 4GQCA 3GKNA 1SK2A 3DD3A 3M0FA 4I8BA 4TOPA 1EEMA 4DVCA 2YV9A 2D2ZA 3WYWA 1K0DA 2DJ2A 4KCAA 4N0VA 2R0PA 1SL0B 1QK8A 1A0RP 1AQWA 4TXOA 4XS4A 4MNNA 1PL2A 4EE0A 2JACA 5J9CA 2WS2A 3L9VA 3VI7A 1ERUA 1THXA 4WXTA 1YKAA 5IMCA 2F9SA 5EPFA 1DE2A 3HXSA 5ID2B 5F06A 5D9TA 1SKWB 1FG4A 1Z7PA 2RLIA 2GZZA 2O85A 4JU5A 2RM6A 5JWQB 1X5DA 2WB9A 1GL8A 1TI3A 2DJJA 4RUVA 3ZREA 4USSA 2R37A 3F63A 2LKUA 3H79A 4AJ6A 1OC8A 1R5PA 3FEUA 2DBCA 5HR0A 3M9KA 11GSA 4HUAA 5GAPD 1ZGNA 2YPMA 2N5FA 1AAZA 1F6MC 2VCQA 4MZWA 3LXTA 1GRXA 1YEXA 4JE1A 3CSJA 4G2EA 1WJKA 5J5NA 3L78A 3MDKA 2B5EA 2WRTA 3D4MA 2GDRA 3IDVA 4FO5A 2PVQA 3A5IA 1PD21 4IGJA 2EIQA 4LMWA 2JU5A 4H86A 3HZ8A 4N0ZA 2IWTA 2QGVA 3F3RA 5D9WA 4NXIA 4OFMA 2YWIA 2IFQB 3L4NA 2MBSA 3DKSA 2LNSA 3CSIA 2GTUA 3EURA 5DQYA 5C00A 4G19A 4WKWA 2VL2A 4HEA2 3TRPA 1ZMAA 1W89A 3IOSA 2NBSA 1NHOA 1O8WA 5L71A 1AXDA 3EINA 4IP1A 2JADA 4HZ4A 5HQPA 4CHSA 3L9UA 4MF6A 3F6DA 4FYCA 2OE1A 5GSSA 2DKIA 3CRTA 4D73B 2ON5A 1G6WA 2IN3A 3HA9A 2FWFA 2HFDA 2PU9C 4BL7B 5CRDA 4MPGA 5INYA 2H66A 2CT6A 1F2EA 2JL4A 1GSYA 4WR5A 1ERTA 4YQUA 1ABAA 4G9HA 2C0DA 3CTFA 1THOA 1ZYPA 2IMKA 3DWVA 1ZL9A 3RAZA 2H6ZA 5JCUA 4WBRD 4ILFA 1KBNA 1RK4A 2FWHA 2G2QA 3UBLA 3A2WA 1J0FA 3TDGA 1XW6A 5IMZA 2VCVA 2LEGA 3CSHA 3GX0A 5JCGA 4KGIA 2MMAA 4J56E 1MD4A 1AC1A 3F8UA 2PGTA 4IBPA 1VRSD 1WRYA 2DJ0A 3LEFA 2A2SA 2E7PA 3WGDA 2QSIA 4V2LA 1A2JA 3D5JA 1BQ7A 1GH2A 4YKFA 1TRWA 9GSSA 2I9HA 3QAVA 2GT6A 4DEJA 2R2JA 2HT9A 3GIXA 2FLSA 4OCFA 2IIYA 5B8BA 4WEYA 1M2DA 3VWVA 4PUAA 2AUVA 1O73A 5FT3A 4HJ2A 3EMPA 1XVQA 5G1LA 3IAM2 3BCKA 4YKGA 4IVFA 1TU7A 3SBCA 1OYJA 2WDUA 3HVSA 2BMXA 4BWSA 3LGCA 3APOA 3EU3A 3TUEA 2JZSA 1PKWA 3ZTLA 1EWXA 1DUGA 1QQ2A 3CRUA 1J9BA 3IXRA 1AQVA 3CYNA 1LBKA 4IHUA 1XWKA 5IOXA 5CRGA 4ZB9A 4K7NA 1S3AA 5A5KA 2L5OA 4XTSA 2LUSA 1XXUA 4OMVA 2HZFA 5GSTA 1FO5A 2QA2A 2HSHA 2H0IA 2YZHA 2G0FA 5IM9A 4K9ZA 1MDKA 3KP9A 3GL3A 3WGXA 3E9JB 1TRUA 1UC7A 5IO2A 2AB6A 4MA9A 1K0NA 1WOUA 2BTOT 5DALB 1HNBA 3VWXA 1K3LA 5GAND 2C3TA 4QQ7A 2CAIA 3GX8A 1TW9A 3G7YA 4EF0A 4K8MA 2H70A 4NPBA 4F0BA 3TKSE 5D93A 2X99A 1O8XA 1GNEA 4EUYA 1GTAA 1M99A 1JHBA 4GSTA 3DYRA 1WP0A 2LQQA 2WCIA 4V1Ag 22GSA 3E3EA 4X0XA 5LNKe 3A5WA 2Z9SA 1PSQA 3M3MA 1X9SB 1ZYEA 1A8YA 4JZQA 4IP6A 3A2VA 2YJHA 5ELGA 1FB6A 4K2DA 4ZXGA 4I2UA 4J57E 5B7CA 1DBYA 5G30A 1FVKA 3WT2A 1O7UA 4OD7A 4XRAA 2GZYA 1BX9A 1TKDB 2ZCTA 2DJ1A 1M7TA 2OE0A 4G0LA 1SL2B 3HCZA 2A2PA 3TKPA 1T00A 1GUMA 2YJ7A 1V98A 1GLQA 2C0GA 2X4AA 5KOXA 2LJRA 3QD9A 4Q5RA 1T4ZA 4GSNA 1U3AA 3GA4A 4A5PA 2GSSA 5DVBA 3A2XA 2GQLA 4LLRA 2XC2A 1VF1A 3H8QA 1PQNA 1G6YA 3N5OA 3EE2A 4KW6A 4YAPA 4OCEA 5CRWA 2N5BA 1GSEA 4LL1B 4ACSA 4FYBA 3ZIJA 3GSSA 1TJDA 1YF1A 2QC7A 1XWGA 4TR1B 4IN0A 4MH3A 5J4UA 3GSTA 2H74A 5H5SA 1KTEA 1WMJA 1F3AA 4KSMA 4MABA 2CZ2A 3D4TA 1GUKA 2WFCA 2E0QA 3DMLA 2GQKA 3FZAA 1ST9A 2QA1A 7GSSA 2H19A 3LQ7A 4QL9A 2VD1A 3QPMA 1N8JA 4K5SA 5CYYA 3LYPA 1OC3A 2WJUA 2VL3A 2FNOA 1QMVA 1ERVA 2EC4A 1FW1A 1TK0B 1FOHA 2FA8A 5ECMB 1GUHA 5EL8A 3C7MA 2AHEA 4KSOA 4DSRA 2X64A 5J3RA 5HFKA 2KUCA 2I3YA 4IKHA 4KX4A 2L57A 4MJBA 2VUPA 3KMOA 1ZZYA 1NHYA 1PX7A 3F4RA 3GTUB 5JCWA 3LORA 2I4AA 1G7OA 1ILOA 2J23A 4EC0A 3F4SA 1PKZA 2VOCA 2FWEA 4NV2A 2XPEA 2H6XA 2H0GA 3F0IA 4IELA 4IS0A 3DRNA 5KN3A 2GVPA 5EVOA 2FWGA 4EDZA 3O6TA 3CXGA 1FAAA 3QAWA 1EEJA 2H8LA 4BVYB 4JR6A 3VLNA 3GL5A 2CQ9A 1T1VA 2C3QA 4KDXA 2PUKC 1EOGA 3C1RA 3P7XA 3UMAA 3KH7A 3EMXA 3DGQA 3HJPA 3RPNA 3ZRDA 5IPHA 2HLSA 3IAS2 4GWRA 3GH6A 1YZXA 1B9YC 4F2IA 3WT1A 2VIMA 3H4KA 4XRDA 4AJ8A 3ERGA 5HFGA 3TKSA 2H76A 5CP1A 4RQRA 1H4OA 4HOJA 2H73A 1JLWA 3UJ1A
chains in the Genus database with same CATH topology
1T3BA 1B9XC 1T7PB 5G2ZA 3QMXA 4MDCA 3L0HA 2V32A 3RHBA 2E2MA 1I5GA 2H1GA 2GSTA 3DIEA 3HHVA 4WBJA 4ZB6A 2PN8A 3NOFA 1U88A 1DSBA 2VCZA 2HRKA 4WETA 1TU8A 2J9HA 1LJRA 2KLXA 4PTSA 4ZBDA 3VPQA 3ZMKA 4BA7A 2HZEB 2C3NA 1SD9A 4I6XA 4MJEA 4XS6A 3FYGA 2GS3A 2M46A 1ZOFA 3I9V2 3FY7A 4K7IA 2CV4A 4Z2TA 3KZQA 1G0TA 4BWQA 2OADA 4O7HA 4OFNA 2H71A 1V58A 1XWAA 3I69A 3VWWA 3H93A 3BCIA 3GFKA 2FD3A 3RBTA 3ERFA 2CAQA 1WIKA 2KOKA 3VWUA 3TOTA 3PH9A 1LU4A 1U87A 2VLTA 3FR6A 4L5OA 3KTBA 2EIOA 1URMA 2GLRA 2P31A 3MAKA 5IIZA 1QXHA 1HQOA 3ZIVA 1ZYQB 2B1LA 1BJXA 4O32A 2A2RA 4IQAA 1AIUA 2DC5A 2F51A 4PUFC 5ID2A 2MZCA 2VD0A 1KEBA 4IW9A 2H01A 1O6JA 5J9BA 4MCUA 1MDJA 1EGRA 1O85A 3D0ZA 18GSA 1JZWA 5B8AA 1SKRB 4L8EA 1GSUA 1TRSA 3C1SA 4LL4B 5C04A 4EO3A 3TKSC 5DDLA 1V40A 1YKCA 1EV4A 3BJ5A 2F8FA 1ZCPA 2H0HA 5A4VA 4V2MA 1GULA 4BVXA 5HR1A 4ZBAA 4LA1A 2YN1A 3GN3A 3WGEA 4OO5A 2ES7A 2VCXA 2H1BA 1RQMA 1TRVA 4I5QA 1OC9A 4NHWA 1Z6NA 1FHEA 2A4VA 5IPGA 3TJKA 2ALBA 4FH8A 4F82A 3FKFA 4G0KA 1TTZA 4PURA 2I1UA 1G7EA 2O87A 3O76A 3IC8A 3LSZA 4EIQA 1IYIA 3Q19A 3JCML 1GWCA 5DAKA 6GSXA 2IFQA 1VF3A 2VLVA 4WF4A 1YJ6A 1A8LA 2R0GA 2VO4A 2AAWA 4TR3A 3UVTA 3EU4A 3P2AA 8GSSA 3EVIA 5DJMA 1PX6A 3HJOA 2F8AA 14GSA 2PPTA 6GSUA 1TP9A 3ZYWA 4AJ7A 4WR4A 2WGRA 1Z6MA 1TI1A 3M9JA 4PQHA 2CX4A 2DJ3A 2L6DA 4K1FA 2O89A 2H72A 4PQ1A 2VL2C 1Y6EA 1X9MB 4G0IA 4TR0A 5IO0A 1HD2A 1O81A 1XBSA 2AYTA 5ECIB 1B8XA 2DIYA 1N2AA 5F05A 3LXZA 1UN2A 2XPDA 4EL1A 1UVZA 4KA0A 3VK9A 1XZOA 3KTLA 3W8SA 1U3IA 4BL7A 3KIJA 10GSA 3FR9A 3FW2A 1PL1A 4RI7A 1VF4A 1SJ6A 3Q18A 2PBJA 2IL3A 1ON4A 3W6GA 1M9AA 1XFLA 3APQA 4MZBA 1OE7A 1X5CA 2FHEA 3IRAA 2O8VB 4Z2RA 3KD0A 2HRFA 4PNFA 3ZVJD 6GSWA 3SWLA 5H5RA 1T8EB 4EIPA 1X9WB 1XWCA 1Z5YE 4XS1A 3C73A 5IQYA 5KEJA 4PXOA 2C4JA 3MWHA 1GLPA 5IMFA 4MMMA 3TB2A 1Z7RA 6GSYA 1RW1A 1M9BA 5ECPB 5AIVA 1VF2A 1S3DA 1A2LA 3UIWA 2GSRA 3ERWA 4MJAA 3ZL5A 4RQXA 5AGYA 3MSZA 4MZCA 4KH7A 1Z3EA 4KUNA 2X8GA 1OAZA 4ZL8A 3D21A 2WZ9A 1YY7A 5BRTA 3R3EA 5F07A 3I6AA 1EP7A 4PGTA 4ECBA 4KCEA 2YWOA 1JZRA 4K0GA 4ML1A 5B6NA 4KDUA 2FCHA 4X43A 1PA3A 5KN1A 4ECCA 3HD5A 3PR8A 3DEXA 1S3CA 1A0FA 12GSA 5G5EA 1H75A 1MDIA 4TR4A 3N9JA 4TKYA 2ON7A 2R5GA 5E4WA 4OFTA 3MYDA 5DBQA 3TJBA 3VPTA 4P3YB 3O3TA 2CZ3A 4Q5FA 1SK1A 3KXOA 3QAGA 4ISDA 3TCOA 2HXKA 1TK8B 2N5AA 4GLTA 4N10A 4I97A 2V2GA 3ISOA 2CVKA 2K8SA 5DALA 3R2QA 3GMFA 4JRRA 4X4JA 2VL9A 1GTIA 2O7KA 1GSSA 2DMMA 2BJXA 4O5QA 2AJQB 4TXOB 4ECIA 4PX1A 4XS4B 5ECSA 2NPBA 3ED3A 3TGZA 2H30A 4CY8A 5ECRB 1W4VA 1SL1B 3Q6OA 1ML6A 5ECHB 5ELAA 1C72A 4MF7A 1PN0A 2IPAA 5IOWA 1EV9A 2R0CA 4EKZA 2B5XA 3K8NA 4MP4A 4ZIJA 1EGOA 2OE3A 3IC4A 2LRNA 4ECJA 2PVOC 4XHMA 4FIWA 2I81A 17GSA 5CAXA 2X8CA 2C0FA 3IBHA 2IMDA 4ZL7A 5DCHA 4K2XA 3GH9A 5CREA 4Q5NA 3RDWA 2M72A 3IV4A 2L5LA 4OO4A 2CVDA 4V1Ap 4AGSA 5BMUA 3GHAA 1MEKA 1XOBA 1SYXA 3GUSA 5ECLB 3HDCA 2NVLA 3FHKA 5LD0A 3TKRA 4ZBBA 1Q4JA 4HQSA 3GV1A 2L4CA 1R5AA 2TIRA 3PINA 3KH9A 1EOHA 4ULXA 1F37A 1GTBA 3ME7A 2P5RA 1X5EA 3QR6A 5D9XA 3EYTA 4PQIA 3M1GA 4IJ3A 3KJYA 3TKQA 3ZFBA 1YEPA 1JZOA 3S9FA 2CA8A 3IHQA 3HZ4A 4G10A 3M8NA 3BD2A 1OVNA 4TN8A 1XCCA 2VCWA 2YP6A 3IK9A 4TR1A 1WPIA 2VM1A 2YCDA 2V6KA 3TJJA 3BBYA 2B5YA 3OR5A 5DQSA 1XPVA 1AQXA 3KEBA 4TVEA 4MF5A 5A4WA 2RUEA 5EY6A 5F8BA 3VURA 4IQ1A 4DSQA 4NMUA 4O5RA 4KNDA 2P0GA 1SU9A 3UARA 1QGVA 3HY2A 3UL3A 2YZUA 4DSSA 4NV5A 2YWMA 4V2NA 2MMZA 3P8WA 3IR4A 3ZFLA 2GT5A 1B4QA 3MIXA 4BPYA 1XW9A 3LJRA 3P90A 5ECQB 2DIZA 4BVXB 2C80A 2XBIA 1BAYA 1IYHA 4MJCA 1K0MA 1PRXA 1T4YA 5JWRB 5KN2A 3D22A 2DJKA 2C1YA 3GTUA 1XOAA 4WF5A 3RHCA 2FUG2 3G7JA 4POKA 2CVBA 2HE3A 5B6MA 1ERWA 3TJFA 3TOUA 2HSYA 1TOFA 5E59A 5COHA 2L4QA 1OC9B 4MPFA 2HYXA 2IMFA 4RI6A 1BG5A 2X8HA 2R4VA 3FZ5A 1USBA 13GSA 4BVYA 1M2BA 2LTKA 6GSVA 2REMA 2L59A 1K0CA 3ZLPA 4ML6A 2HNLA 3GYKA 5A4UA 1A24A 5G31A 5AN1A 2KP1A 1FOVA 5ECNB 4JEDA 2YANA 2MYGA 2UZ8A 5ENUA 1JFUA 5DAKB 1TK5B 4MK3A 2IJYA 1M2AA 3LWAA 3Q74A 2FY6A 3GKMA 3QFBC 3UOMA 4Z2UA 2NDOA 1KNGA 4XIHA 2PMTA 3GKXA 1SYRA 1AW9A 4E8HA 4F03A 1B48A 5LCZA 2GGTA 3KCMA 2LJAA 5F0GA 5ABRA 4X1UA 5FWGA 4NWYA 4F0CA 1SJZA 4FYUA 2IMIA 3EWLA 3FZ4A 2JZRA 2ZUPA 3ZZXA 1F3BA 4K5RA 4TRXA 3TJGA 1R26A 2VM2A 1K3YA 1OE8A 3FK8A 5D9VA 2YNXA 1VGLA 4HZ2A 3TRQA 2V1MA 5IMVA 3FR3A 4EVMA 1GSQA 4YQMA 2K18A 2KP2A 5G1KA 2OBIA 5J41A 2VAFA 2HZEA 4GXZA 3GRXA 2FGXA 4NAXA 5CO3A 3HVVA 4ZILA 3IHGA 1BYEA 1NM3A 3NZNA 1Q98A 4GF0A 1FVJA 1SK0A 2X49A 1UA5A 1FB0A 2OJLA 2PERA 4GRFA 4L5LA 4TXVA 1GTUA 4GSSA 1QFNA 2LRCA 1I9DA 1PMTA 2B1KA 1SKSB 1X0RA 3U5RE 3A3TA 2GZPA 5D96A 5KOWA 1PGTA 1V2AA 2YOIA 3LW9A 4JR4A 3GURA 2RM5A 4HU7A 5FHIA 1OKTA 2B7JA 3US3A 1XWBA 3VI5A 2GQMA 1A2MA 1R4WA 3BOAA 1TXXA 2LSTA 2IMEA 4CW9A 4D73A 3HKRA 2TRCP 4JBBA 2C8UA 5D73A 2V6OA 2C0EA 2WULA 3F9UA 1TDIA 3L9SA 1K0OA 3APSA 2LV3A 3F4TA 1ACVA 4YQVA 1GSDA 1AUCA 3G7IA 16GSA 1SJIA 2OA7A 2HI7A 4HS1A 4O92A 3IA1A 3GNJA 1EZKA 4E8EA 5CRHA 2B7KA 2OACA 5ECOB 1HNCA 4POBA 4CDOA 1E6BA 2F3MA 2FA4A 5HR2A 2H1AA 3QOUA 5GZZB 2DKHA 4K0NA 3HYPA 2P5QA 19GSA 5KN0A 3IPZA 4FQUA 3F3QA 1YDKA 4L0UA 3V1WA 5H5QA 1CQGA 4KF9A 1OKDA 1Y25A 2NTOA 4POLA 3F6FA 2R3XA 4I2TA 3CTGA 3LG6A 3U6VA 2YV7A 5AIXA 2XBQA 6GSSA 1SD8A 3CBUA 4HI7A 1GNWA 2JSZA 2TRXA 4MH2A 2LQOA 4YAVA 1GSFA 3C71A 4EDYA 1BEDA 2HSMA 4KDYA 2JZTA 4POMA 3QCPA 2A4HA 2VLUA 4Q5QA 1K0AA 4O5UA 3HVXA 5HR3A 4GQFA 2M80A 2KHPA 3HJMA 2MBTA 1WWJA 5AISA 2EIRA 3G9BA 3KGKA 4HQZA 4KE3A 2DLXA 2AV4A 1A23A 2HRAA 3J7Yk 1NW2A 1XW5A 5JWOB 3KP8A 5D8IA 2B3SA 4HDEA 20GSA 3DVXA 1EP8A 3AY8A 1J08A 1K0BA 4ZL9A 1B4PA 4HJMA 4Z7XA 2LJKA 3GKKA 4J2FA 2JSYA 2V41A 1ZYNA 2L6CA 1JLVA 2OKAA 2DSAA 1WE0A 1MTCA 1NSWA 4QL7A 3H1NA 5IMDA 1R7HA 3ZITA 3DVWA 3NIVA 4CY6A 4N11A 4L0WA 1YQ1A 2YWNA 2QKEA 4GTUA 1V57A 2LNTA 1GP1A 2MMOA 3ME8A 3ZMLA 3DXBA 3E0UA 2H6YA 2GSQA 4IJIA 3J7Yb 5G5FA 1SENA 2VCTA 3UEMA 5IMAA 1E2YA 3D6IA 4MLYA 3QDNA 5CNWA 3UBKA 4PNGA 4KAEA 2B6MA 3CMIA 4YH2A 1CQHA 4EXJA 1V9WA 4ID0A 3ZVJA 1HYUA 2MMNA 2DMLA 4F9ZA 2RUFA 3MNGA 2CX3A 3IK7A 1HNAA 3EPTA 3C8EA 1M0UA 2H1DA 4HU9A 1Z9HA 3QFAC 3FRCA 4NHZA 3FMWA 1PN9A 1XIYA 3WD6A 3PGTA 6GSTA 1MD3A 1QUWA 3W8JA 4K7OA 2XHFA 3VFIA 3KM6A 3PPUA 1YF0A 1JZDA 3LYKA 3TRXA 2HRNA 5ECKB 4AF2A 5DJLA 4DSSB 2H75A 3FZ9A 2K8VA 1XVWA 3LFLA 3RPPA 3UVHA 4KB3A 1K3OA 2LRTA 2ZNMA 4TW5A 2PWJA 3IE3A 4ZB8A 2K6VA 4LMVA 2R6KA 4K6XA 1U6TA 4OWYA 4XCSA 1F9MA 3EC3A 5HFIA 2OBKA 5DCGA 3KMNA 4GCIA 1DE1A 2E2GA 2LS5A 3UAPA 2K9FA 3I43A 4N30A 4ICYA 2RIIA 4GQCA 3GKNA 1SK2A 3DD3A 3M0FA 4I8BA 4TOPA 1EEMA 4DVCA 2YV9A 2D2ZA 3WYWA 1K0DA 2DJ2A 4KCAA 4N0VA 2R0PA 1SL0B 1QK8A 1A0RP 1AQWA 4TXOA 4XS4A 4MNNA 1PL2A 4EE0A 2JACA 5J9CA 2WS2A 3L9VA 3VI7A 1ERUA 1THXA 4WXTA 1YKAA 5IMCA 2F9SA 5EPFA 1DE2A 3HXSA 5ID2B 5F06A 5D9TA 1SKWB 1FG4A 1Z7PA 2RLIA 2GZZA 2O85A 4JU5A 2RM6A 5JWQB 1X5DA 2WB9A 1GL8A 1TI3A 2DJJA 4RUVA 3ZREA 4USSA 2R37A 3F63A 2LKUA 3H79A 4AJ6A 1OC8A 1R5PA 3FEUA 2DBCA 5HR0A 3M9KA 11GSA 4HUAA 5GAPD 1ZGNA 2YPMA 2N5FA 1AAZA 1F6MC 2VCQA 4MZWA 3LXTA 1GRXA 1YEXA 4JE1A 3CSJA 4G2EA 1WJKA 5J5NA 3L78A 3MDKA 2B5EA 2WRTA 3D4MA 2GDRA 3IDVA 4FO5A 2PVQA 3A5IA 1PD21 4IGJA 2EIQA 4LMWA 2JU5A 4H86A 3HZ8A 4N0ZA 2IWTA 2QGVA 3F3RA 5D9WA 4NXIA 4OFMA 2YWIA 2IFQB 3L4NA 2MBSA 3DKSA 2LNSA 3CSIA 2GTUA 3EURA 5DQYA 5C00A 4G19A 4WKWA 2VL2A 4HEA2 3TRPA 1ZMAA 1W89A 3IOSA 2NBSA 1NHOA 1O8WA 5L71A 1AXDA 3EINA 4IP1A 2JADA 4HZ4A 5HQPA 4CHSA 3L9UA 4MF6A 3F6DA 4FYCA 2OE1A 5GSSA 2DKIA 3CRTA 4D73B 2ON5A 1G6WA 2IN3A 3HA9A 2FWFA 2HFDA 2PU9C 4BL7B 5CRDA 4MPGA 5INYA 2H66A 2CT6A 1F2EA 2JL4A 1GSYA 4WR5A 1ERTA 4YQUA 1ABAA 4G9HA 2C0DA 3CTFA 1THOA 1ZYPA 2IMKA 3DWVA 1ZL9A 3RAZA 2H6ZA 5JCUA 4WBRD 4ILFA 1KBNA 1RK4A 2FWHA 2G2QA 3UBLA 3A2WA 1J0FA 3TDGA 1XW6A 5IMZA 2VCVA 2LEGA 3CSHA 3GX0A 5JCGA 4KGIA 2MMAA 4J56E 1MD4A 1AC1A 3F8UA 2PGTA 4IBPA 1VRSD 1WRYA 2DJ0A 3LEFA 2A2SA 2E7PA 3WGDA 2QSIA 4V2LA 1A2JA 3D5JA 1BQ7A 1GH2A 4YKFA 1TRWA 9GSSA 2I9HA 3QAVA 2GT6A 4DEJA 2R2JA 2HT9A 3GIXA 2FLSA 4OCFA 2IIYA 5B8BA 4WEYA 1M2DA 3VWVA 4PUAA 2AUVA 1O73A 5FT3A 4HJ2A 3EMPA 1XVQA 5G1LA 3IAM2 3BCKA 4YKGA 4IVFA 1TU7A 3SBCA 1OYJA 2WDUA 3HVSA 2BMXA 4BWSA 3LGCA 3APOA 3EU3A 3TUEA 2JZSA 1PKWA 3ZTLA 1EWXA 1DUGA 1QQ2A 3CRUA 1J9BA 3IXRA 1AQVA 3CYNA 1LBKA 4IHUA 1XWKA 5IOXA 5CRGA 4ZB9A 4K7NA 1S3AA 5A5KA 2L5OA 4XTSA 2LUSA 1XXUA 4OMVA 2HZFA 5GSTA 1FO5A 2QA2A 2HSHA 2H0IA 2YZHA 2G0FA 5IM9A 4K9ZA 1MDKA 3KP9A 3GL3A 3WGXA 3E9JB 1TRUA 1UC7A 5IO2A 2AB6A 4MA9A 1K0NA 1WOUA 2BTOT 5DALB 1HNBA 3VWXA 1K3LA 5GAND 2C3TA 4QQ7A 2CAIA 3GX8A 1TW9A 3G7YA 4EF0A 4K8MA 2H70A 4NPBA 4F0BA 3TKSE 5D93A 2X99A 1O8XA 1GNEA 4EUYA 1GTAA 1M99A 1JHBA 4GSTA 3DYRA 1WP0A 2LQQA 2WCIA 4V1Ag 22GSA 3E3EA 4X0XA 5LNKe 3A5WA 2Z9SA 1PSQA 3M3MA 1X9SB 1ZYEA 1A8YA 4JZQA 4IP6A 3A2VA 2YJHA 5ELGA 1FB6A 4K2DA 4ZXGA 4I2UA 4J57E 5B7CA 1DBYA 5G30A 1FVKA 3WT2A 1O7UA 4OD7A 4XRAA 2GZYA 1BX9A 1TKDB 2ZCTA 2DJ1A 1M7TA 2OE0A 4G0LA 1SL2B 3HCZA 2A2PA 3TKPA 1T00A 1GUMA 2YJ7A 1V98A 1GLQA 2C0GA 2X4AA 5KOXA 2LJRA 3QD9A 4Q5RA 1T4ZA 4GSNA 1U3AA 3GA4A 4A5PA 2GSSA 5DVBA 3A2XA 2GQLA 4LLRA 2XC2A 1VF1A 3H8QA 1PQNA 1G6YA 3N5OA 3EE2A 4KW6A 4YAPA 4OCEA 5CRWA 2N5BA 1GSEA 4LL1B 4ACSA 4FYBA 3ZIJA 3GSSA 1TJDA 1YF1A 2QC7A 1XWGA 4TR1B 4IN0A 4MH3A 5J4UA 3GSTA 2H74A 5H5SA 1KTEA 1WMJA 1F3AA 4KSMA 4MABA 2CZ2A 3D4TA 1GUKA 2WFCA 2E0QA 3DMLA 2GQKA 3FZAA 1ST9A 2QA1A 7GSSA 2H19A 3LQ7A 4QL9A 2VD1A 3QPMA 1N8JA 4K5SA 5CYYA 3LYPA 1OC3A 2WJUA 2VL3A 2FNOA 1QMVA 1ERVA 2EC4A 1FW1A 1TK0B 1FOHA 2FA8A 5ECMB 1GUHA 5EL8A 3C7MA 2AHEA 4KSOA 4DSRA 2X64A 5J3RA 5HFKA 2KUCA 2I3YA 4IKHA 4KX4A 2L57A 4MJBA 2VUPA 3KMOA 1ZZYA 1NHYA 1PX7A 3F4RA 3GTUB 5JCWA 3LORA 2I4AA 1G7OA 1ILOA 2J23A 4EC0A 3F4SA 1PKZA 2VOCA 2FWEA 4NV2A 2XPEA 2H6XA 2H0GA 3F0IA 4IELA 4IS0A 3DRNA 5KN3A 2GVPA 5EVOA 2FWGA 4EDZA 3O6TA 3CXGA 1FAAA 3QAWA 1EEJA 2H8LA 4BVYB 4JR6A 3VLNA 3GL5A 2CQ9A 1T1VA 2C3QA 4KDXA 2PUKC 1EOGA 3C1RA 3P7XA 3UMAA 3KH7A 3EMXA 3DGQA 3HJPA 3RPNA 3ZRDA 5IPHA 2HLSA 3IAS2 4GWRA 3GH6A 1YZXA 1B9YC 4F2IA 3WT1A 2VIMA 3H4KA 4XRDA 4AJ8A 3ERGA 5HFGA 3TKSA 2H76A 5CP1A 4RQRA 1H4OA 4HOJA 2H73A 1JLWA 3UJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T3B A;  1B9X C;  1T7P B;  5G2Z A;  3QMX A;  4MDC A;  3L0H A;  2V32 A;  3RHB A;  2E2M A;  1I5G A;  2H1G A;  2GST A;  3DIE A;  3HHV A;  4WBJ A;  4ZB6 A;  2PN8 A;  3NOF A;  1U88 A;  1DSB A;  2VCZ A;  4WET A;  1TU8 A;  2J9H A;  1LJR A;  2KLX A;  4ZBD A;  3VPQ A;  3ZMK A;  4BA7 A;  2HZE B;  2C3N A;  1SD9 A;  4I6X A;  4MJE A;  4XS6 A;  3FYG A;  2GS3 A;  2M46 A;  1ZOF A;  3I9V 2;  3FY7 A;  4K7I A;  2CV4 A;  3KZQ A;  1G0T A;  4BWQ A;  2OAD A;  4O7H A;  4OFN A;  2H71 A;  1V58 A;  1XWA A;  3I69 A;  3VWW A;  3H93 A;  3BCI A;  3GFK A;  2FD3 A;  3RBT A;  3ERF A;  2CAQ A;  1WIK A;  2KOK A;  3VWU A;  3TOT A;  3PH9 A;  1LU4 A;  1U87 A;  2VLT A;  3FR6 A;  4L5O A;  3KTB A;  2EIO A;  1URM A;  2GLR A;  2P31 A;  3MAK A;  5IIZ A;  1QXH A;  1HQO A;  3ZIV A;  1ZYQ B;  2B1L A;  1BJX A;  4O32 A;  2A2R A;  4IQA A;  1AIU A;  2DC5 A;  2F51 A;  4PUF C;  5ID2 A;  2MZC A;  2VD0 A;  1KEB A;  4IW9 A;  2H01 A;  1O6J A;  5J9B A;  4MCU A;  1MDJ A;  1EGR A;  1O85 A;  3D0Z A;  18GS A;  1JZW A;  5B8A A;  1SKR B;  4L8E A;  1GSU A;  1TRS A;  3C1S A;  4LL4 B;  5C04 A;  4EO3 A;  3TKS C;  5DDL A;  1V40 A;  1YKC A;  1EV4 A;  3BJ5 A;  2F8F A;  1ZCP A;  2H0H A;  5A4V A;  4V2M A;  1GUL A;  4BVX A;  5HR1 A;  4ZBA A;  4LA1 A;  2YN1 A;  3GN3 A;  3WGE A;  4OO5 A;  2ES7 A;  2VCX A;  2H1B A;  1RQM A;  1TRV A;  4I5Q A;  1OC9 A;  4NHW A;  1Z6N A;  1FHE A;  2A4V A;  5IPG A;  3TJK A;  2ALB A;  4FH8 A;  4F82 A;  3FKF A;  1TTZ A;  4PUR A;  2I1U A;  1G7E A;  2O87 A;  3O76 A;  3LSZ A;  1IYI A;  3Q19 A;  3JCM L;  1GWC A;  5DAK A;  6GSX A;  2IFQ A;  1VF3 A;  2VLV A;  4WF4 A;  1YJ6 A;  1A8L A;  2VO4 A;  2AAW A;  4TR3 A;  3UVT A;  3EU4 A;  3P2A A;  8GSS A;  3EVI A;  5DJM A;  1PX6 A;  3HJO A;  2F8A A;  14GS A;  2PPT A;  6GSU A;  1TP9 A;  3ZYW A;  4AJ7 A;  4WR4 A;  2WGR A;  1Z6M A;  1TI1 A;  3M9J A;  4PQH A;  2CX4 A;  2DJ3 A;  2L6D A;  4K1F A;  2O89 A;  2H72 A;  4PQ1 A;  2VL2 C;  1Y6E A;  1X9M B;  4TR0 A;  5IO0 A;  1HD2 A;  1O81 A;  1XBS A;  2AYT A;  5ECI B;  1B8X A;  2DIY A;  1N2A A;  5F05 A;  3LXZ A;  1UN2 A;  2XPD A;  4EL1 A;  1UVZ A;  4KA0 A;  3VK9 A;  1XZO A;  3KTL A;  3W8S A;  1U3I A;  4BL7 A;  3KIJ A;  10GS A;  3FR9 A;  3FW2 A;  1PL1 A;  4RI7 A;  1VF4 A;  1SJ6 A;  3Q18 A;  2PBJ A;  2IL3 A;  1ON4 A;  3W6G A;  1M9A A;  1XFL A;  3APQ A;  4MZB A;  1OE7 A;  1X5C A;  2FHE A;  3IRA A;  2O8V B;  3KD0 A;  2HRF A;  4PNF A;  3ZVJ D;  6GSW A;  3SWL A;  5H5R A;  1T8E B;  1X9W B;  1XWC A;  1Z5Y E;  4XS1 A;  3C73 A;  5IQY A;  5KEJ A;  4PXO A;  2C4J A;  3MWH A;  1GLP A;  5IMF A;  4MMM A;  3TB2 A;  1Z7R A;  6GSY A;  1RW1 A;  1M9B A;  5ECP B;  5AIV A;  1VF2 A;  1S3D A;  1A2L A;  3UIW A;  2GSR A;  3ERW A;  4MJA A;  3ZL5 A;  4RQX A;  5AGY A;  3MSZ A;  4MZC A;  4KH7 A;  1Z3E A;  4KUN A;  2X8G A;  1OAZ A;  4ZL8 A;  3D21 A;  2WZ9 A;  1YY7 A;  5F07 A;  3I6A A;  1EP7 A;  4PGT A;  4ECB A;  4KCE A;  2YWO A;  1JZR A;  4K0G A;  4ML1 A;  5B6N A;  4KDU A;  2FCH A;  4X43 A;  1PA3 A;  5KN1 A;  4ECC A;  3HD5 A;  3PR8 A;  3DEX A;  1S3C A;  1A0F A;  12GS A;  5G5E A;  1H75 A;  1MDI A;  4TR4 A;  3N9J A;  4TKY A;  2ON7 A;  2R5G A;  5E4W A;  4OFT A;  5DBQ A;  3TJB A;  3VPT A;  4P3Y B;  3O3T A;  2CZ3 A;  4Q5F A;  1SK1 A;  3KXO A;  3QAG A;  4ISD A;  3TCO A;  2HXK A;  1TK8 B;  2N5A A;  4GLT A;  4N10 A;  4I97 A;  2V2G A;  3ISO A;  2CVK A;  2K8S A;  5DAL A;  3R2Q A;  3GMF A;  4JRR A;  2VL9 A;  1GTI A;  2O7K A;  1GSS A;  2DMM A;  2BJX A;  2AJQ B;  4TXO B;  4ECI A;  4PX1 A;  4XS4 B;  5ECS A;  2NPB A;  3ED3 A;  3TGZ A;  2H30 A;  5ECR B;  1W4V A;  1SL1 B;  3Q6O A;  1ML6 A;  5ECH B;  5ELA A;  1C72 A;  4MF7 A;  2IPA A;  5IOW A;  1EV9 A;  4EKZ A;  2B5X A;  3K8N A;  4MP4 A;  4ZIJ A;  1EGO A;  2OE3 A;  3IC4 A;  2LRN A;  4ECJ A;  2PVO C;  4XHM A;  4FIW A;  2I81 A;  17GS A;  5CAX A;  2X8C A;  2C0F A;  3IBH A;  2IMD A;  4ZL7 A;  5DCH A;  3GH9 A;  5CRE A;  4Q5N A;  3RDW A;  2M72 A;  3IV4 A;  2L5L A;  4OO4 A;  2CVD A;  4V1A p;  4AGS A;  3GHA A;  1MEK A;  1XOB A;  1SYX A;  3GUS A;  5ECL B;  3HDC A;  2NVL A;  3FHK A;  5LD0 A;  3TKR A;  4ZBB A;  1Q4J A;  4HQS A;  3GV1 A;  2L4C A;  1R5A A;  2TIR A;  3PIN A;  3KH9 A;  1EOH A;  4ULX A;  1F37 A;  1GTB A;  3ME7 A;  2P5R A;  1X5E A;  3QR6 A;  5D9X A;  3EYT A;  4PQI A;  3M1G A;  4IJ3 A;  3KJY A;  3TKQ A;  3ZFB A;  1YEP A;  1JZO A;  3S9F A;  2CA8 A;  3IHQ A;  3HZ4 A;  4G10 A;  3M8N A;  3BD2 A;  1OVN A;  4TN8 A;  1XCC A;  2VCW A;  2YP6 A;  3IK9 A;  4TR1 A;  1WPI A;  2VM1 A;  2YCD A;  2V6K A;  3TJJ A;  3BBY A;  2B5Y A;  3OR5 A;  5DQS A;  1XPV A;  1AQX A;  3KEB A;  4TVE A;  4MF5 A;  5A4W A;  2RUE A;  5EY6 A;  5F8B A;  3VUR A;  4IQ1 A;  4DSQ A;  4NMU A;  4O5R A;  4KND A;  2P0G A;  1SU9 A;  3UAR A;  1QGV A;  3HY2 A;  3UL3 A;  2YZU A;  4DSS A;  4NV5 A;  2YWM A;  4V2N A;  2MMZ A;  3P8W A;  3IR4 A;  3ZFL A;  2GT5 A;  1B4Q A;  4BPY A;  1XW9 A;  3LJR A;  3P90 A;  5ECQ B;  2DIZ A;  2C80 A;  2XBI A;  1BAY A;  1IYH A;  4MJC A;  1K0M A;  1PRX A;  1T4Y A;  5JWR B;  5KN2 A;  3D22 A;  2DJK A;  2C1Y A;  3GTU A;  1XOA A;  4WF5 A;  3RHC A;  2FUG 2;  3G7J A;  4POK A;  2CVB A;  2HE3 A;  5B6M A;  1ERW A;  3TJF A;  3TOU A;  2HSY A;  1TOF A;  5E59 A;  5COH A;  2L4Q A;  1OC9 B;  4MPF A;  2HYX A;  2IMF A;  4RI6 A;  1BG5 A;  2X8H A;  2R4V A;  3FZ5 A;  1USB A;  13GS A;  4BVY A;  1M2B A;  2LTK A;  6GSV A;  2REM A;  2L59 A;  1K0C A;  3ZLP A;  4ML6 A;  2HNL A;  3GYK A;  5A4U A;  1A24 A;  5G31 A;  5AN1 A;  2KP1 A;  1FOV A;  5ECN B;  4JED A;  2YAN A;  2MYG A;  5ENU A;  1TK5 B;  1JFU A;  5DAK B;  4MK3 A;  2IJY A;  1M2A A;  3LWA A;  3Q74 A;  2FY6 A;  3GKM A;  3QFB C;  3UOM A;  2NDO A;  1KNG A;  4XIH A;  2PMT A;  3GKX A;  1SYR A;  1AW9 A;  4E8H A;  4F03 A;  1B48 A;  5LCZ A;  2GGT A;  3KCM A;  2LJA A;  5F0G A;  5ABR A;  4X1U A;  5FWG A;  4NWY A;  4F0C A;  1SJZ A;  4FYU A;  2IMI A;  3EWL A;  3FZ4 A;  2JZR A;  2ZUP A;  3ZZX A;  1F3B A;  4TRX A;  3TJG A;  1R26 A;  2VM2 A;  1K3Y A;  1OE8 A;  3FK8 A;  5D9V A;  2YNX A;  1VGL A;  4HZ2 A;  3TRQ A;  2V1M A;  5IMV A;  3FR3 A;  4EVM A;  1GSQ A;  4YQM A;  2K18 A;  2KP2 A;  5G1K A;  2OBI A;  5J41 A;  2VAF A;  2HZE A;  4GXZ A;  3GRX A;  2FGX A;  4NAX A;  5CO3 A;  3HVV A;  4ZIL A;  1BYE A;  1NM3 A;  3NZN A;  1Q98 A;  4GF0 A;  1FVJ A;  1SK0 A;  1UA5 A;  1FB0 A;  2OJL A;  2PER A;  4GRF A;  4L5L A;  4TXV A;  1GTU A;  4GSS A;  1QFN A;  2LRC A;  1I9D A;  1PMT A;  2B1K A;  1SKS B;  1X0R A;  3U5R E;  3A3T A;  2GZP A;  5D96 A;  1PGT A;  1V2A A;  2YOI A;  4JR4 A;  3GUR A;  2RM5 A;  4HU7 A;  5FHI A;  1OKT A;  2B7J A;  3US3 A;  1XWB A;  3VI5 A;  2GQM A;  1A2M A;  1R4W A;  3BOA A;  1TXX A;  2LST A;  2IME A;  4CW9 A;  4D73 A;  3HKR A;  2TRC P;  4JBB A;  2C8U A;  5D73 A;  2V6O A;  2C0E A;  2WUL A;  3F9U A;  1TDI A;  3L9S A;  1K0O A;  3APS A;  2LV3 A;  3F4T A;  1ACV A;  4YQV A;  1GSD A;  1AUC A;  3G7I A;  16GS A;  1SJI A;  2OA7 A;  2HI7 A;  4HS1 A;  4O92 A;  3IA1 A;  3GNJ A;  1EZK A;  4E8E A;  5CRH A;  2B7K A;  2OAC A;  5ECO B;  1HNC A;  4POB A;  4CDO A;  1E6B A;  2F3M A;  2FA4 A;  5HR2 A;  2H1A A;  3QOU A;  5GZZ B;  4K0N A;  3HYP A;  2P5Q A;  19GS A;  5KN0 A;  3IPZ A;  3F3Q A;  1YDK A;  4L0U A;  3V1W A;  5H5Q A;  1CQG A;  1OKD A;  1Y25 A;  2NTO A;  4POL A;  3F6F A;  2R3X A;  4I2T A;  3CTG A;  3LG6 A;  3U6V A;  2YV7 A;  5AIX A;  2XBQ A;  6GSS A;  1SD8 A;  3CBU A;  4HI7 A;  1GNW A;  2JSZ A;  2TRX A;  4MH2 A;  2LQO A;  4YAV A;  1GSF A;  3C71 A;  4EDY A;  1BED A;  4KDY A;  2JZT A;  4POM A;  3QCP A;  2VLU A;  4Q5Q A;  1K0A A;  3HVX A;  5HR3 A;  4GQF A;  2M80 A;  2KHP A;  3HJM A;  2MBT A;  1WWJ A;  5AIS A;  2EIR A;  3G9B A;  3KGK A;  4HQZ A;  4KE3 A;  2DLX A;  2AV4 A;  1A23 A;  3J7Y k;  1NW2 A;  1XW5 A;  5JWO B;  3KP8 A;  5D8I A;  2B3S A;  4HDE A;  20GS A;  3DVX A;  1EP8 A;  3AY8 A;  1J08 A;  1K0B A;  4ZL9 A;  1B4P A;  4HJM A;  4Z7X A;  2LJK A;  3GKK A;  4J2F A;  2JSY A;  2V41 A;  2L6C A;  1JLV A;  2OKA A;  2DSA A;  1WE0 A;  1MTC A;  1NSW A;  4QL7 A;  3H1N A;  5IMD A;  1R7H A;  3ZIT A;  3DVW A;  3NIV A;  4N11 A;  4L0W A;  1YQ1 A;  2YWN A;  2QKE A;  4GTU A;  1V57 A;  2LNT A;  1GP1 A;  2MMO A;  3ME8 A;  3ZML A;  3DXB A;  3E0U A;  2H6Y A;  2GSQ A;  4IJI A;  3J7Y b;  5G5F A;  1SEN A;  2VCT A;  3UEM A;  5IMA A;  1E2Y A;  3D6I A;  4MLY A;  3QDN A;  5CNW A;  3UBK A;  4PNG A;  4KAE A;  2B6M A;  3CMI A;  4YH2 A;  1CQH A;  4EXJ A;  1V9W A;  4ID0 A;  3ZVJ A;  1HYU A;  2MMN A;  2DML A;  4F9Z A;  2RUF A;  3MNG A;  2CX3 A;  3IK7 A;  1HNA A;  3C8E A;  1M0U A;  2H1D A;  4HU9 A;  1Z9H A;  3QFA C;  3FRC A;  4NHZ A;  1PN9 A;  1XIY A;  3WD6 A;  3PGT A;  6GST A;  1MD3 A;  1QUW A;  3W8J A;  4K7O A;  2XHF A;  3VFI A;  3KM6 A;  1YF0 A;  1JZD A;  3LYK A;  3TRX A;  2HRN A;  5ECK B;  4AF2 A;  5DJL A;  4DSS B;  2H75 A;  3FZ9 A;  2K8V A;  1XVW A;  3LFL A;  3RPP A;  3UVH A;  4KB3 A;  1K3O A;  2LRT A;  2ZNM A;  4TW5 A;  2PWJ A;  3IE3 A;  4ZB8 A;  2K6V A;  4LMV A;  2R6K A;  4K6X A;  1U6T A;  4OWY A;  4XCS A;  1F9M A;  3EC3 A;  5HFI A;  2OBK A;  5DCG A;  3KMN A;  4GCI A;  1DE1 A;  2E2G A;  2LS5 A;  3UAP A;  2K9F A;  3I43 A;  4N30 A;  2RII A;  4GQC A;  3GKN A;  1SK2 A;  3DD3 A;  3M0F A;  4I8B A;  4TOP A;  1EEM A;  4DVC A;  2YV9 A;  2D2Z A;  3WYW A;  1K0D A;  2DJ2 A;  4KCA A;  4N0V A;  1SL0 B;  1QK8 A;  1A0R P;  1AQW A;  4TXO A;  4XS4 A;  1PL2 A;  4EE0 A;  2JAC A;  5J9C A;  2WS2 A;  3L9V A;  3VI7 A;  1ERU A;  1THX A;  4WXT A;  1YKA A;  5IMC A;  2F9S A;  5EPF A;  1DE2 A;  3HXS A;  5ID2 B;  5F06 A;  5D9T A;  1SKW B;  1FG4 A;  1Z7P A;  2RLI A;  2GZZ A;  2O85 A;  4JU5 A;  2RM6 A;  5JWQ B;  1X5D A;  2WB9 A;  1GL8 A;  1TI3 A;  2DJJ A;  4RUV A;  3ZRE A;  2R37 A;  3F63 A;  2LKU A;  3H79 A;  4AJ6 A;  1OC8 A;  1R5P A;  3FEU A;  2DBC A;  5HR0 A;  3M9K A;  11GS A;  4HUA A;  5GAP D;  1ZGN A;  2YPM A;  2N5F A;  1AAZ A;  1F6M C;  2VCQ A;  4MZW A;  3LXT A;  1GRX A;  1YEX A;  4JE1 A;  3CSJ A;  4G2E A;  1WJK A;  5J5N A;  3L78 A;  3MDK A;  2B5E A;  2WRT A;  3D4M A;  2GDR A;  3IDV A;  4FO5 A;  2PVQ A;  1PD2 1;  4IGJ A;  2EIQ A;  4LMW A;  2JU5 A;  4H86 A;  3HZ8 A;  4N0Z A;  2IWT A;  2QGV A;  3F3R A;  5D9W A;  4NXI A;  4OFM A;  2YWI A;  2IFQ B;  3L4N A;  2MBS A;  3DKS A;  2LNS A;  3CSI A;  2GTU A;  3EUR A;  5DQY A;  5C00 A;  4G19 A;  4WKW A;  2VL2 A;  4HEA 2;  3TRP A;  1ZMA A;  1W89 A;  3IOS A;  2NBS A;  1NHO A;  1O8W A;  5L71 A;  1AXD A;  3EIN A;  4IP1 A;  2JAD A;  4HZ4 A;  5HQP A;  4CHS A;  3L9U A;  4MF6 A;  3F6D A;  4FYC A;  2OE1 A;  5GSS A;  3CRT A;  4D73 B;  2ON5 A;  1G6W A;  2IN3 A;  3HA9 A;  2FWF A;  2HFD A;  2PU9 C;  5INY A;  5CRD A;  4MPG A;  2H66 A;  2CT6 A;  1F2E A;  2JL4 A;  1GSY A;  4WR5 A;  1ERT A;  4YQU A;  1ABA A;  4G9H A;  2C0D A;  3CTF A;  1THO A;  2IMK A;  3DWV A;  1ZL9 A;  3RAZ A;  2H6Z A;  5JCU A;  4WBR D;  4ILF A;  1KBN A;  1RK4 A;  2FWH A;  2G2Q A;  3UBL A;  3A2W A;  1J0F A;  3TDG A;  1XW6 A;  5IMZ A;  2VCV A;  2LEG A;  3CSH A;  3GX0 A;  5JCG A;  4KGI A;  2MMA A;  4J56 E;  1MD4 A;  1AC1 A;  3F8U A;  2PGT A;  4IBP A;  1VRS D;  1WRY A;  2DJ0 A;  3LEF A;  2A2S A;  2E7P A;  3WGD A;  2QSI A;  4V2L A;  1A2J A;  3D5J A;  1BQ7 A;  1GH2 A;  1TRW A;  9GSS A;  2I9H A;  3QAV A;  2GT6 A;  4DEJ A;  2R2J A;  2HT9 A;  3GIX A;  2FLS A;  4OCF A;  2IIY A;  5B8B A;  4WEY A;  1M2D A;  3VWV A;  4PUA A;  2AUV A;  1O73 A;  5FT3 A;  4HJ2 A;  3EMP A;  1XVQ A;  5G1L A;  3IAM 2;  3BCK A;  4IVF A;  1TU7 A;  3SBC A;  1OYJ A;  2WDU A;  3HVS A;  2BMX A;  4BWS A;  3LGC A;  3APO A;  3EU3 A;  3TUE A;  2JZS A;  1PKW A;  3ZTL A;  1EWX A;  1DUG A;  1QQ2 A;  3CRU A;  1J9B A;  3IXR A;  1AQV A;  3CYN A;  1LBK A;  4IHU A;  1XWK A;  5IOX A;  5CRG A;  4ZB9 A;  4K7N A;  1S3A A;  5A5K A;  2L5O A;  4XTS A;  2LUS A;  1XXU A;  4OMV A;  2HZF A;  5GST A;  1FO5 A;  2HSH A;  2H0I A;  2YZH A;  2G0F A;  5IM9 A;  4K9Z A;  1MDK A;  3KP9 A;  3GL3 A;  3WGX A;  3E9J B;  1TRU A;  1UC7 A;  5IO2 A;  2AB6 A;  4MA9 A;  1K0N A;  1WOU A;  2BTO T;  5DAL B;  1HNB A;  3VWX A;  1K3L A;  5GAN D;  2C3T A;  4QQ7 A;  2CAI A;  3GX8 A;  1TW9 A;  3G7Y A;  4EF0 A;  4K8M A;  2H70 A;  4NPB A;  4F0B A;  3TKS E;  5D93 A;  2X99 A;  1O8X A;  1GNE A;  4EUY A;  1GTA A;  1M99 A;  1JHB A;  4GST A;  3DYR A;  1WP0 A;  2LQQ A;  2WCI A;  4V1A g;  22GS A;  3E3E A;  4X0X A;  5LNK e;  3A5W A;  2Z9S A;  1PSQ A;  3M3M A;  1X9S B;  1ZYE A;  1A8Y A;  4JZQ A;  4IP6 A;  3A2V A;  2YJH A;  5ELG A;  1FB6 A;  4K2D A;  4ZXG A;  4I2U A;  4J57 E;  5B7C A;  1DBY A;  5G30 A;  1FVK A;  3WT2 A;  1O7U A;  4OD7 A;  4XRA A;  2GZY A;  1BX9 A;  1TKD B;  2ZCT A;  2DJ1 A;  1M7T A;  2OE0 A;  1SL2 B;  3HCZ A;  3TKP A;  1T00 A;  1GUM A;  2YJ7 A;  1V98 A;  1GLQ A;  2C0G A;  2LJR A;  3QD9 A;  4Q5R A;  1T4Z A;  4GSN A;  1U3A A;  3GA4 A;  2GSS A;  5DVB A;  3A2X A;  2GQL A;  4LLR A;  2XC2 A;  1VF1 A;  3H8Q A;  1PQN A;  1G6Y A;  3N5O A;  3EE2 A;  4KW6 A;  4YAP A;  4OCE A;  5CRW A;  2N5B A;  1GSE A;  4LL1 B;  4ACS A;  4FYB A;  3ZIJ A;  3GSS A;  1TJD A;  1YF1 A;  2QC7 A;  1XWG A;  4TR1 B;  4IN0 A;  4MH3 A;  5J4U A;  3GST A;  2H74 A;  5H5S A;  1KTE A;  1WMJ A;  1F3A A;  4KSM A;  4MAB A;  2CZ2 A;  3D4T A;  1GUK A;  2WFC A;  2E0Q A;  3DML A;  2GQK A;  3FZA A;  1ST9 A;  7GSS A;  2H19 A;  3LQ7 A;  4QL9 A;  2VD1 A;  3QPM A;  1N8J A;  5CYY A;  3LYP A;  1OC3 A;  2WJU A;  2VL3 A;  2FNO A;  1QMV A;  1ERV A;  2EC4 A;  1FW1 A;  1TK0 B;  2FA8 A;  5ECM B;  1GUH A;  5EL8 A;  3C7M A;  2AHE A;  4KSO A;  4DSR A;  2X64 A;  5J3R A;  5HFK A;  2KUC A;  2I3Y A;  4IKH A;  4KX4 A;  2L57 A;  4MJB A;  2VUP A;  3KMO A;  1ZZY A;  1NHY A;  1PX7 A;  3F4R A;  3GTU B;  5JCW A;  3LOR A;  2I4A A;  1G7O A;  1ILO A;  2J23 A;  4EC0 A;  3F4S A;  1PKZ A;  2VOC A;  2FWE A;  4NV2 A;  2XPE A;  2H6X A;  2H0G A;  3F0I A;  4IEL A;  4IS0 A;  3DRN A;  5KN3 A;  2GVP A;  5EVO A;  2FWG A;  4EDZ A;  3O6T A;  3CXG A;  1FAA A;  3QAW A;  1EEJ A;  2H8L A;  4JR6 A;  3VLN A;  3GL5 A;  2CQ9 A;  1T1V A;  2C3Q A;  4KDX A;  2PUK C;  1EOG A;  3C1R A;  3P7X A;  3UMA A;  3KH7 A;  3EMX A;  3DGQ A;  3HJP A;  3RPN A;  3ZRD A;  5IPH A;  2HLS A;  3IAS 2;  4GWR A;  3GH6 A;  1YZX A;  1B9Y C;  4F2I A;  3WT1 A;  2VIM A;  3H4K A;  4XRD A;  4AJ8 A;  3ERG A;  5HFG A;  3TKS A;  2H76 A;  5CP1 A;  4RQR A;  1H4O A;  4HOJ A;  2H73 A;  1JLW A;  3UJ1 A; 
#chains in the Genus database with same CATH topology
 1T3B A;  1B9X C;  1T7P B;  5G2Z A;  3QMX A;  4MDC A;  3L0H A;  2V32 A;  3RHB A;  2E2M A;  1I5G A;  2H1G A;  2GST A;  3DIE A;  3HHV A;  4WBJ A;  4ZB6 A;  2PN8 A;  3NOF A;  1U88 A;  1DSB A;  2VCZ A;  2HRK A;  4WET A;  1TU8 A;  2J9H A;  1LJR A;  2KLX A;  4PTS A;  4ZBD A;  3VPQ A;  3ZMK A;  4BA7 A;  2HZE B;  2C3N A;  1SD9 A;  4I6X A;  4MJE A;  4XS6 A;  3FYG A;  2GS3 A;  2M46 A;  1ZOF A;  3I9V 2;  3FY7 A;  4K7I A;  2CV4 A;  4Z2T A;  3KZQ A;  1G0T A;  4BWQ A;  2OAD A;  4O7H A;  4OFN A;  2H71 A;  1V58 A;  1XWA A;  3I69 A;  3VWW A;  3H93 A;  3BCI A;  3GFK A;  2FD3 A;  3RBT A;  3ERF A;  2CAQ A;  1WIK A;  2KOK A;  3VWU A;  3TOT A;  3PH9 A;  1LU4 A;  1U87 A;  2VLT A;  3FR6 A;  4L5O A;  3KTB A;  2EIO A;  1URM A;  2GLR A;  2P31 A;  3MAK A;  5IIZ A;  1QXH A;  1HQO A;  3ZIV A;  1ZYQ B;  2B1L A;  1BJX A;  4O32 A;  2A2R A;  4IQA A;  1AIU A;  2DC5 A;  2F51 A;  4PUF C;  5ID2 A;  2MZC A;  2VD0 A;  1KEB A;  4IW9 A;  2H01 A;  1O6J A;  5J9B A;  4MCU A;  1MDJ A;  1EGR A;  1O85 A;  3D0Z A;  18GS A;  1JZW A;  5B8A A;  1SKR B;  4L8E A;  1GSU A;  1TRS A;  3C1S A;  4LL4 B;  5C04 A;  4EO3 A;  3TKS C;  5DDL A;  1V40 A;  1YKC A;  1EV4 A;  3BJ5 A;  2F8F A;  1ZCP A;  2H0H A;  5A4V A;  4V2M A;  1GUL A;  4BVX A;  5HR1 A;  4ZBA A;  4LA1 A;  2YN1 A;  3GN3 A;  3WGE A;  4OO5 A;  2ES7 A;  2VCX A;  2H1B A;  1RQM A;  1TRV A;  4I5Q A;  1OC9 A;  4NHW A;  1S3R A;  1Z6N A;  1FHE A;  2A4V A;  5IPG A;  3TJK A;  2ALB A;  4FH8 A;  4F82 A;  3FKF A;  4G0K A;  1TTZ A;  4PUR A;  2I1U A;  1G7E A;  2O87 A;  3O76 A;  3IC8 A;  3LSZ A;  4EIQ A;  1IYI A;  3Q19 A;  3JCM L;  1GWC A;  5DAK A;  6GSX A;  2IFQ A;  1VF3 A;  2VLV A;  4WF4 A;  1YJ6 A;  1A8L A;  2R0G A;  2VO4 A;  2AAW A;  4TR3 A;  3UVT A;  3EU4 A;  3P2A A;  8GSS A;  3EVI A;  5DJM A;  1PX6 A;  3HJO A;  2F8A A;  14GS A;  2PPT A;  6GSU A;  1TP9 A;  3ZYW A;  4AJ7 A;  4WR4 A;  2WGR A;  1Z6M A;  1TI1 A;  3M9J A;  4PQH A;  2CX4 A;  2DJ3 A;  2L6D A;  4K1F A;  2O89 A;  2H72 A;  4PQ1 A;  2VL2 C;  1Y6E A;  1X9M B;  4G0I A;  4TR0 A;  5IO0 A;  1HD2 A;  1O81 A;  1XBS A;  2AYT A;  5ECI B;  1B8X A;  2DIY A;  1N2A A;  5F05 A;  3LXZ A;  1UN2 A;  2XPD A;  4EL1 A;  1UVZ A;  4KA0 A;  3VK9 A;  1XZO A;  3KTL A;  3W8S A;  1U3I A;  4BL7 A;  3KIJ A;  10GS A;  3FR9 A;  3FW2 A;  1PL1 A;  4RI7 A;  1VF4 A;  1SJ6 A;  3Q18 A;  2PBJ A;  2IL3 A;  1ON4 A;  3W6G A;  1M9A A;  1XFL A;  3APQ A;  4MZB A;  1OE7 A;  1X5C A;  2FHE A;  3IRA A;  2O8V B;  4Z2R A;  3KD0 A;  2HRF A;  4PNF A;  3ZVJ D;  6GSW A;  3SWL A;  5H5R A;  1T8E B;  4EIP A;  1X9W B;  1XWC A;  1Z5Y E;  4XS1 A;  3C73 A;  5IQY A;  5KEJ A;  4PXO A;  2C4J A;  3MWH A;  1GLP A;  5IMF A;  4MMM A;  3TB2 A;  1Z7R A;  6GSY A;  1RW1 A;  1M9B A;  5ECP B;  5AIV A;  1VF2 A;  1S3D A;  1A2L A;  3UIW A;  2GSR A;  3ERW A;  4MJA A;  3ZL5 A;  4RQX A;  5AGY A;  3MSZ A;  4MZC A;  4KH7 A;  1Z3E A;  4KUN A;  2X8G A;  1OAZ A;  4ZL8 A;  3D21 A;  2WZ9 A;  1YY7 A;  5BRT A;  3R3E A;  5F07 A;  3I6A A;  1EP7 A;  4PGT A;  4ECB A;  4KCE A;  2YWO A;  1JZR A;  4K0G A;  4ML1 A;  5B6N A;  4KDU A;  2FCH A;  4X43 A;  1PA3 A;  5KN1 A;  4ECC A;  3HD5 A;  3PR8 A;  3DEX A;  1S3C A;  1A0F A;  12GS A;  5G5E A;  1H75 A;  1MDI A;  4TR4 A;  3N9J A;  4TKY A;  2ON7 A;  2R5G A;  5E4W A;  4OFT A;  3MYD A;  5DBQ A;  3TJB A;  3VPT A;  4P3Y B;  3O3T A;  2CZ3 A;  4Q5F A;  1SK1 A;  3KXO A;  3QAG A;  4ISD A;  3TCO A;  2HXK A;  1TK8 B;  2N5A A;  4GLT A;  4N10 A;  4I97 A;  1PFO A;  2V2G A;  3ISO A;  2CVK A;  2K8S A;  5DAL A;  3R2Q A;  3GMF A;  4JRR A;  4X4J A;  2VL9 A;  1GTI A;  2O7K A;  1GSS A;  2DMM A;  2BJX A;  4O5Q A;  2AJQ B;  4TXO B;  4ECI A;  4PX1 A;  4XS4 B;  5ECS A;  2NPB A;  3ED3 A;  3TGZ A;  2H30 A;  4CY8 A;  5ECR B;  1W4V A;  1SL1 B;  3Q6O A;  1ML6 A;  5ECH B;  5ELA A;  1C72 A;  4MF7 A;  1PN0 A;  2IPA A;  5IOW A;  1EV9 A;  2R0C A;  4EKZ A;  2B5X A;  3K8N A;  4MP4 A;  4ZIJ A;  1EGO A;  2OE3 A;  3IC4 A;  2LRN A;  4ECJ A;  2PVO C;  4XHM A;  4FIW A;  2I81 A;  17GS A;  5CAX A;  2X8C A;  2C0F A;  3IBH A;  2IMD A;  4ZL7 A;  5DCH A;  4K2X A;  3GH9 A;  1M3I A;  5CRE A;  4Q5N A;  3RDW A;  2M72 A;  3IV4 A;  2L5L A;  4OO4 A;  2CVD A;  4V1A p;  4AGS A;  5BMU A;  3GHA A;  1MEK A;  1XOB A;  1SYX A;  3GUS A;  1XG8 A;  5ECL B;  3HDC A;  2NVL A;  3FHK A;  5LD0 A;  3TKR A;  4ZBB A;  1Q4J A;  4HQS A;  3GV1 A;  2L4C A;  1R5A A;  1M3J A;  2TIR A;  3PIN A;  3KH9 A;  1EOH A;  4ULX A;  1F37 A;  1GTB A;  3ME7 A;  2P5R A;  1X5E A;  3QR6 A;  5D9X A;  3EYT A;  4PQI A;  3M1G A;  4IJ3 A;  3KJY A;  3TKQ A;  3ZFB A;  1YEP A;  1JZO A;  3S9F A;  2CA8 A;  3IHQ A;  3HZ4 A;  4G10 A;  3M8N A;  3BD2 A;  1OVN A;  4TN8 A;  1XCC A;  2VCW A;  2YP6 A;  3IK9 A;  4TR1 A;  1WPI A;  2VM1 A;  2YCD A;  2V6K A;  3TJJ A;  3BBY A;  2B5Y A;  3OR5 A;  5DQS A;  1XPV A;  1AQX A;  3KEB A;  4TVE A;  4MF5 A;  5A4W A;  2RUE A;  5EY6 A;  5F8B A;  3VUR A;  4IQ1 A;  4DSQ A;  4NMU A;  4O5R A;  4KND A;  2P0G A;  3HVN A;  1SU9 A;  3UAR A;  1QGV A;  3HY2 A;  3UL3 A;  2YZU A;  4DSS A;  4NV5 A;  2YWM A;  4V2N A;  2MMZ A;  3P8W A;  3IR4 A;  3ZFL A;  2GT5 A;  1B4Q A;  3MIX A;  4BPY A;  1XW9 A;  3LJR A;  3P90 A;  5ECQ B;  2DIZ A;  4BVX B;  2C80 A;  2XBI A;  1BAY A;  1IYH A;  4MJC A;  1K0M A;  1PRX A;  1T4Y A;  5JWR B;  5KN2 A;  3D22 A;  2DJK A;  2C1Y A;  3GTU A;  1XOA A;  4WF5 A;  3RHC A;  2FUG 2;  3G7J A;  4POK A;  2CVB A;  2HE3 A;  5B6M A;  1ERW A;  3TJF A;  3TOU A;  2HSY A;  1TOF A;  5E59 A;  4HSC X;  5COH A;  2L4Q A;  1OC9 B;  4MPF A;  2HYX A;  2IMF A;  4RI6 A;  1BG5 A;  4BIK A;  2X8H A;  2R4V A;  3FZ5 A;  1USB A;  13GS A;  4BVY A;  1M2B A;  2LTK A;  6GSV A;  2REM A;  2L59 A;  1K0C A;  3ZLP A;  4ML6 A;  2HNL A;  3GYK A;  5A4U A;  1A24 A;  5G31 A;  5AN1 A;  2KP1 A;  1FOV A;  5ECN B;  4JED A;  2YAN A;  2MYG A;  2UZ8 A;  5ENU A;  1JFU A;  5DAK B;  1TK5 B;  4MK3 A;  2IJY A;  1M2A A;  3LWA A;  3Q74 A;  2FY6 A;  3GKM A;  3QFB C;  3UOM A;  4Z2U A;  2NDO A;  1KNG A;  4XIH A;  2PMT A;  3GKX A;  1SYR A;  1AW9 A;  4E8H A;  4F03 A;  1B48 A;  5LCZ A;  2GGT A;  3KCM A;  2LJA A;  5F0G A;  5ABR A;  4X1U A;  5FWG A;  4NWY A;  4F0C A;  1SJZ A;  4FYU A;  2IMI A;  3EWL A;  3FZ4 A;  2JZR A;  2ZUP A;  3ZZX A;  1F3B A;  4K5R A;  4TRX A;  3TJG A;  1R26 A;  2VM2 A;  1K3Y A;  1OE8 A;  3FK8 A;  5D9V A;  2YNX A;  1VGL A;  4HZ2 A;  3TRQ A;  2V1M A;  5IMV A;  3FR3 A;  4EVM A;  1GSQ A;  4YQM A;  2K18 A;  2KP2 A;  5G1K A;  2OBI A;  5J41 A;  2VAF A;  2HZE A;  4GXZ A;  3GRX A;  2FGX A;  4NAX A;  5CO3 A;  3HVV A;  4ZIL A;  3IHG A;  1BYE A;  1NM3 A;  3NZN A;  1Q98 A;  4GF0 A;  1FVJ A;  1SK0 A;  2X49 A;  1UA5 A;  1FB0 A;  2OJL A;  2PER A;  4GRF A;  4L5L A;  4TXV A;  1GTU A;  4GSS A;  1QFN A;  2LRC A;  1I9D A;  1PMT A;  2B1K A;  1SKS B;  1X0R A;  3U5R E;  3A3T A;  2GZP A;  5D96 A;  5KOW A;  1PGT A;  1V2A A;  2YOI A;  3LW9 A;  4JR4 A;  3GUR A;  2RM5 A;  4HU7 A;  5FHI A;  1OKT A;  2B7J A;  3US3 A;  1XWB A;  3VI5 A;  2GQM A;  1A2M A;  1R4W A;  3BOA A;  1TXX A;  2LST A;  2IME A;  4CW9 A;  4D73 A;  3HKR A;  2TRC P;  3CQF A;  4JBB A;  2C8U A;  5D73 A;  2V6O A;  2C0E A;  2WUL A;  3F9U A;  1TDI A;  3L9S A;  1K0O A;  3APS A;  2LV3 A;  3F4T A;  1ACV A;  4YQV A;  1GSD A;  1AUC A;  3G7I A;  16GS A;  1SJI A;  2OA7 A;  2HI7 A;  4HS1 A;  4O92 A;  3IA1 A;  3GNJ A;  1EZK A;  4E8E A;  5CRH A;  2B7K A;  2OAC A;  5ECO B;  1HNC A;  4POB A;  4CDO A;  1E6B A;  2F3M A;  2FA4 A;  5HR2 A;  2H1A A;  3QOU A;  5GZZ B;  2DKH A;  4K0N A;  3HYP A;  2P5Q A;  19GS A;  5KN0 A;  3IPZ A;  4FQU A;  3F3Q A;  1YDK A;  4L0U A;  3V1W A;  5H5Q A;  1CQG A;  4KF9 A;  1OKD A;  1Y25 A;  2NTO A;  4POL A;  3F6F A;  2R3X A;  4I2T A;  3CTG A;  3LG6 A;  3U6V A;  2YV7 A;  5AIX A;  2XBQ A;  6GSS A;  1SD8 A;  3CBU A;  4HI7 A;  1GNW A;  2JSZ A;  2TRX A;  4MH2 A;  2LQO A;  4YAV A;  1GSF A;  3C71 A;  4EDY A;  1BED A;  2HSM A;  4KDY A;  2JZT A;  4POM A;  3QCP A;  2A4H A;  2VLU A;  4Q5Q A;  1K0A A;  4O5U A;  3HVX A;  5HR3 A;  4GQF A;  2M80 A;  2KHP A;  3HJM A;  2MBT A;  1WWJ A;  5AIS A;  2EIR A;  3G9B A;  3KGK A;  4HQZ A;  4KE3 A;  2DLX A;  2AV4 A;  1A23 A;  2HRA A;  3J7Y k;  1NW2 A;  1XW5 A;  5JWO B;  3KP8 A;  5D8I A;  2B3S A;  4HDE A;  20GS A;  3DVX A;  1EP8 A;  3AY8 A;  1J08 A;  1K0B A;  4ZL9 A;  1B4P A;  4HJM A;  4Z7X A;  2LJK A;  3GKK A;  4J2F A;  2JSY A;  2V41 A;  1ZYN A;  2L6C A;  1JLV A;  2OKA A;  2DSA A;  1WE0 A;  1MTC A;  1NSW A;  4QL7 A;  3H1N A;  5IMD A;  1R7H A;  3ZIT A;  3DVW A;  3NIV A;  4CY6 A;  4N11 A;  4L0W A;  1YQ1 A;  2YWN A;  2QKE A;  4GTU A;  1V57 A;  2LNT A;  1GP1 A;  2MMO A;  3ME8 A;  3ZML A;  3DXB A;  3E0U A;  2H6Y A;  2GSQ A;  4IJI A;  3J7Y b;  5G5F A;  1SEN A;  2VCT A;  3UEM A;  5IMA A;  1E2Y A;  3D6I A;  4MLY A;  3QDN A;  5CNW A;  3UBK A;  4PNG A;  4KAE A;  2B6M A;  3CMI A;  4YH2 A;  1CQH A;  4EXJ A;  1V9W A;  4ID0 A;  3ZVJ A;  1HYU A;  2MMN A;  2DML A;  4F9Z A;  2RUF A;  3MNG A;  2CX3 A;  3IK7 A;  1HNA A;  3EPT A;  3C8E A;  1M0U A;  2H1D A;  4HU9 A;  1Z9H A;  3QFA C;  3FRC A;  4NHZ A;  3FMW A;  1PN9 A;  1XIY A;  3WD6 A;  3PGT A;  6GST A;  1MD3 A;  1QUW A;  3W8J A;  4K7O A;  2XHF A;  3VFI A;  3KM6 A;  3PPU A;  1YF0 A;  1JZD A;  3LYK A;  3TRX A;  2HRN A;  5ECK B;  4AF2 A;  5DJL A;  4DSS B;  2H75 A;  3FZ9 A;  2K8V A;  1XVW A;  3LFL A;  3RPP A;  3UVH A;  4KB3 A;  1K3O A;  2LRT A;  2ZNM A;  4TW5 A;  2PWJ A;  3IE3 A;  4ZB8 A;  2K6V A;  4LMV A;  2R6K A;  4K6X A;  1U6T A;  4OWY A;  4XCS A;  1F9M A;  3EC3 A;  5HFI A;  2OBK A;  5DCG A;  3KMN A;  4GCI A;  1DE1 A;  2E2G A;  2LS5 A;  3UAP A;  2K9F A;  3I43 A;  4N30 A;  4ICY A;  2RII A;  4GQC A;  3GKN A;  1SK2 A;  3DD3 A;  3M0F A;  4I8B A;  4TOP A;  1EEM A;  4DVC A;  2YV9 A;  2D2Z A;  3WYW A;  1K0D A;  2DJ2 A;  4KCA A;  4N0V A;  2R0P A;  1SL0 B;  1QK8 A;  1A0R P;  1AQW A;  4TXO A;  4XS4 A;  4MNN A;  1PL2 A;  4EE0 A;  2JAC A;  5J9C A;  2WS2 A;  3L9V A;  3VI7 A;  1ERU A;  1THX A;  4WXT A;  1YKA A;  5IMC A;  2F9S A;  5EPF A;  1DE2 A;  3HXS A;  5ID2 B;  5F06 A;  5D9T A;  1SKW B;  1FG4 A;  1Z7P A;  2RLI A;  2GZZ A;  2O85 A;  4JU5 A;  2RM6 A;  5JWQ B;  1X5D A;  2WB9 A;  1GL8 A;  1TI3 A;  2DJJ A;  4RUV A;  3ZRE A;  4USS A;  2R37 A;  3F63 A;  2LKU A;  3H79 A;  4AJ6 A;  1OC8 A;  1R5P A;  3FEU A;  2DBC A;  5HR0 A;  3M9K A;  11GS A;  4HUA A;  5GAP D;  1ZGN A;  2YPM A;  2N5F A;  1AAZ A;  1F6M C;  2VCQ A;  4MZW A;  3LXT A;  1GRX A;  1YEX A;  4JE1 A;  3CSJ A;  4G2E A;  1WJK A;  5J5N A;  3L78 A;  3MDK A;  2B5E A;  2WRT A;  3D4M A;  2GDR A;  3IDV A;  4FO5 A;  2PVQ A;  3A5I A;  1PD2 1;  4IGJ A;  2EIQ A;  4LMW A;  2JU5 A;  4H86 A;  3HZ8 A;  4N0Z A;  2IWT A;  2QGV A;  3F3R A;  5D9W A;  4NXI A;  4OFM A;  2YWI A;  2IFQ B;  3L4N A;  2MBS A;  3DKS A;  2LNS A;  3CSI A;  2GTU A;  3EUR A;  5DQY A;  5C00 A;  4G19 A;  4WKW A;  2VL2 A;  4HEA 2;  3TRP A;  1ZMA A;  1W89 A;  3IOS A;  2NBS A;  1NHO A;  1O8W A;  5L71 A;  1AXD A;  3EIN A;  4IP1 A;  2JAD A;  4HZ4 A;  5HQP A;  4CHS A;  3L9U A;  4MF6 A;  3F6D A;  4FYC A;  2OE1 A;  5GSS A;  2DKI A;  3CRT A;  4D73 B;  2ON5 A;  1G6W A;  2IN3 A;  3HA9 A;  2FWF A;  2HFD A;  2PU9 C;  4BL7 B;  5CRD A;  4MPG A;  5INY A;  2H66 A;  2CT6 A;  1F2E A;  2JL4 A;  1GSY A;  4WR5 A;  1ERT A;  4YQU A;  1ABA A;  4G9H A;  2C0D A;  3CTF A;  1THO A;  1ZYP A;  2IMK A;  3DWV A;  1ZL9 A;  3RAZ A;  2H6Z A;  5JCU A;  4WBR D;  4ILF A;  1KBN A;  1RK4 A;  2FWH A;  2G2Q A;  3UBL A;  3A2W A;  1J0F A;  3TDG A;  1XW6 A;  5IMZ A;  2VCV A;  2LEG A;  3CSH A;  3GX0 A;  5JCG A;  4KGI A;  2MMA A;  4J56 E;  1MD4 A;  1AC1 A;  3F8U A;  2PGT A;  4IBP A;  1VRS D;  1WRY A;  2DJ0 A;  3LEF A;  2A2S A;  2E7P A;  3WGD A;  2QSI A;  4V2L A;  1A2J A;  3D5J A;  1BQ7 A;  1GH2 A;  4YKF A;  1TRW A;  9GSS A;  2I9H A;  3QAV A;  2GT6 A;  4DEJ A;  2R2J A;  2HT9 A;  3GIX A;  2FLS A;  4OCF A;  2IIY A;  5B8B A;  4WEY A;  1M2D A;  3VWV A;  4PUA A;  2AUV A;  1O73 A;  5FT3 A;  4HJ2 A;  3EMP A;  1XVQ A;  5G1L A;  3IAM 2;  3BCK A;  4YKG A;  4IVF A;  1TU7 A;  3SBC A;  1OYJ A;  2WDU A;  3HVS A;  2BMX A;  4BWS A;  3LGC A;  3APO A;  3EU3 A;  3TUE A;  2JZS A;  1PKW A;  3ZTL A;  1EWX A;  1DUG A;  1QQ2 A;  3CRU A;  1J9B A;  3IXR A;  1AQV A;  3CYN A;  1LBK A;  4IHU A;  1XWK A;  5IOX A;  5CRG A;  4ZB9 A;  4K7N A;  1S3A A;  5A5K A;  2L5O A;  4XTS A;  2LUS A;  1XXU A;  4OMV A;  2HZF A;  5GST A;  1FO5 A;  2QA2 A;  2HSH A;  2H0I A;  2YZH A;  2G0F A;  5IM9 A;  4K9Z A;  1MDK A;  3KP9 A;  3GL3 A;  3WGX A;  3E9J B;  1TRU A;  1UC7 A;  5IO2 A;  2AB6 A;  4MA9 A;  1K0N A;  1WOU A;  2BTO T;  5DAL B;  1HNB A;  3VWX A;  1K3L A;  5GAN D;  2C3T A;  4QQ7 A;  2CAI A;  3GX8 A;  1TW9 A;  3G7Y A;  4EF0 A;  4K8M A;  2H70 A;  4NPB A;  4F0B A;  3TKS E;  5D93 A;  2X99 A;  1O8X A;  1GNE A;  4EUY A;  1GTA A;  1M99 A;  1JHB A;  4GST A;  3DYR A;  1WP0 A;  2LQQ A;  2WCI A;  4V1A g;  22GS A;  3E3E A;  4X0X A;  5LNK e;  3A5W A;  2Z9S A;  1PSQ A;  3M3M A;  1X9S B;  1ZYE A;  1A8Y A;  4JZQ A;  4IP6 A;  3A2V A;  2YJH A;  5ELG A;  1FB6 A;  4K2D A;  4ZXG A;  4I2U A;  4J57 E;  5B7C A;  1DBY A;  5G30 A;  1FVK A;  3WT2 A;  1O7U A;  4OD7 A;  4XRA A;  2GZY A;  1BX9 A;  1TKD B;  2ZCT A;  2DJ1 A;  1M7T A;  2OE0 A;  4G0L A;  1SL2 B;  3HCZ A;  2A2P A;  3TKP A;  1T00 A;  1GUM A;  2YJ7 A;  1V98 A;  1GLQ A;  2C0G A;  2X4A A;  5KOX A;  2LJR A;  3QD9 A;  4Q5R A;  1T4Z A;  4GSN A;  1U3A A;  3GA4 A;  4A5P A;  2GSS A;  5DVB A;  3A2X A;  2GQL A;  4LLR A;  2XC2 A;  1VF1 A;  3H8Q A;  1PQN A;  1G6Y A;  3N5O A;  3EE2 A;  4KW6 A;  4YAP A;  4OCE A;  5CRW A;  2N5B A;  1GSE A;  4LL1 B;  4ACS A;  4FYB A;  3ZIJ A;  3GSS A;  1TJD A;  1YF1 A;  2QC7 A;  1XWG A;  4TR1 B;  4IN0 A;  4MH3 A;  5J4U A;  3GST A;  2H74 A;  5H5S A;  1KTE A;  1WMJ A;  1F3A A;  4KSM A;  4MAB A;  2CZ2 A;  3D4T A;  1GUK A;  2WFC A;  2E0Q A;  3DML A;  2GQK A;  3FZA A;  1ST9 A;  2QA1 A;  7GSS A;  2H19 A;  3LQ7 A;  4QL9 A;  2VD1 A;  3QPM A;  1N8J A;  4K5S A;  5CYY A;  3LYP A;  1OC3 A;  2WJU A;  2VL3 A;  2FNO A;  1QMV A;  1ERV A;  2EC4 A;  1FW1 A;  1TK0 B;  1FOH A;  2FA8 A;  5ECM B;  1GUH A;  5EL8 A;  3C7M A;  2AHE A;  4KSO A;  4DSR A;  2X64 A;  5J3R A;  5HFK A;  2KUC A;  2I3Y A;  4IKH A;  4KX4 A;  2L57 A;  4MJB A;  2VUP A;  3KMO A;  1ZZY A;  1NHY A;  1PX7 A;  3F4R A;  3GTU B;  5JCW A;  3LOR A;  2I4A A;  1G7O A;  1ILO A;  2J23 A;  4EC0 A;  3F4S A;  1PKZ A;  2VOC A;  2FWE A;  4NV2 A;  2XPE A;  2H6X A;  2H0G A;  3F0I A;  4IEL A;  4IS0 A;  3DRN A;  5KN3 A;  2GVP A;  5EVO A;  2FWG A;  4EDZ A;  3O6T A;  3CXG A;  1FAA A;  3QAW A;  1EEJ A;  2H8L A;  4BVY B;  4JR6 A;  3VLN A;  3GL5 A;  2CQ9 A;  1T1V A;  2C3Q A;  4KDX A;  2PUK C;  1EOG A;  3C1R A;  3P7X A;  3UMA A;  3KH7 A;  3EMX A;  3DGQ A;  3HJP A;  3RPN A;  3ZRD A;  5IPH A;  2HLS A;  3IAS 2;  4GWR A;  3GH6 A;  1YZX A;  1B9Y C;  4F2I A;  3WT1 A;  2VIM A;  3H4K A;  4XRD A;  4AJ8 A;  3ERG A;  5HFG A;  3TKS A;  2H76 A;  5CP1 A;  4RQR A;  1H4O A;  4HOJ A;  2H73 A;  1JLW A;  3UJ1 A; 
#chains in the Genus database with same CATH homology
 1T3B A;  1B9X C;  1T7P B;  5G2Z A;  3QMX A;  4MDC A;  3L0H A;  2V32 A;  3RHB A;  2E2M A;  1I5G A;  2H1G A;  2GST A;  3DIE A;  3HHV A;  4WBJ A;  4ZB6 A;  2PN8 A;  3NOF A;  1U88 A;  1DSB A;  2VCZ A;  2HRK A;  4WET A;  1TU8 A;  2J9H A;  1LJR A;  2KLX A;  4PTS A;  4ZBD A;  3VPQ A;  3ZMK A;  4BA7 A;  2HZE B;  2C3N A;  1SD9 A;  4I6X A;  4MJE A;  4XS6 A;  3FYG A;  2GS3 A;  2M46 A;  1ZOF A;  3I9V 2;  3FY7 A;  4K7I A;  2CV4 A;  4Z2T A;  3KZQ A;  1G0T A;  4BWQ A;  2OAD A;  4O7H A;  4OFN A;  2H71 A;  1V58 A;  1XWA A;  3I69 A;  3VWW A;  3H93 A;  3BCI A;  3GFK A;  2FD3 A;  3RBT A;  3ERF A;  2CAQ A;  1WIK A;  2KOK A;  3VWU A;  3TOT A;  3PH9 A;  1LU4 A;  1U87 A;  2VLT A;  3FR6 A;  4L5O A;  3KTB A;  2EIO A;  1URM A;  2GLR A;  2P31 A;  3MAK A;  5IIZ A;  1QXH A;  1HQO A;  3ZIV A;  1ZYQ B;  2B1L A;  1BJX A;  4O32 A;  2A2R A;  4IQA A;  1AIU A;  2DC5 A;  2F51 A;  4PUF C;  5ID2 A;  2MZC A;  2VD0 A;  1KEB A;  4IW9 A;  2H01 A;  1O6J A;  5J9B A;  4MCU A;  1MDJ A;  1EGR A;  1O85 A;  3D0Z A;  18GS A;  1JZW A;  5B8A A;  1SKR B;  4L8E A;  1GSU A;  1TRS A;  3C1S A;  4LL4 B;  5C04 A;  4EO3 A;  3TKS C;  5DDL A;  1V40 A;  1YKC A;  1EV4 A;  3BJ5 A;  2F8F A;  1ZCP A;  2H0H A;  5A4V A;  4V2M A;  1GUL A;  4BVX A;  5HR1 A;  4ZBA A;  4LA1 A;  2YN1 A;  3GN3 A;  3WGE A;  4OO5 A;  2ES7 A;  2VCX A;  2H1B A;  1RQM A;  1TRV A;  4I5Q A;  1OC9 A;  4NHW A;  1Z6N A;  1FHE A;  2A4V A;  5IPG A;  3TJK A;  2ALB A;  4FH8 A;  4F82 A;  3FKF A;  4G0K A;  1TTZ A;  4PUR A;  2I1U A;  1G7E A;  2O87 A;  3O76 A;  3IC8 A;  3LSZ A;  4EIQ A;  1IYI A;  3Q19 A;  3JCM L;  1GWC A;  5DAK A;  6GSX A;  2IFQ A;  1VF3 A;  2VLV A;  4WF4 A;  1YJ6 A;  1A8L A;  2R0G A;  2VO4 A;  2AAW A;  4TR3 A;  3UVT A;  3EU4 A;  3P2A A;  8GSS A;  3EVI A;  5DJM A;  1PX6 A;  3HJO A;  2F8A A;  14GS A;  2PPT A;  6GSU A;  1TP9 A;  3ZYW A;  4AJ7 A;  4WR4 A;  2WGR A;  1Z6M A;  1TI1 A;  3M9J A;  4PQH A;  2CX4 A;  2DJ3 A;  2L6D A;  4K1F A;  2O89 A;  2H72 A;  4PQ1 A;  2VL2 C;  1Y6E A;  1X9M B;  4G0I A;  4TR0 A;  5IO0 A;  1HD2 A;  1O81 A;  1XBS A;  2AYT A;  5ECI B;  1B8X A;  2DIY A;  1N2A A;  5F05 A;  3LXZ A;  1UN2 A;  2XPD A;  4EL1 A;  1UVZ A;  4KA0 A;  3VK9 A;  1XZO A;  3KTL A;  3W8S A;  1U3I A;  4BL7 A;  3KIJ A;  10GS A;  3FR9 A;  3FW2 A;  1PL1 A;  4RI7 A;  1VF4 A;  1SJ6 A;  3Q18 A;  2PBJ A;  2IL3 A;  1ON4 A;  3W6G A;  1M9A A;  1XFL A;  3APQ A;  4MZB A;  1OE7 A;  1X5C A;  2FHE A;  3IRA A;  2O8V B;  4Z2R A;  3KD0 A;  2HRF A;  4PNF A;  3ZVJ D;  6GSW A;  3SWL A;  5H5R A;  1T8E B;  4EIP A;  1X9W B;  1XWC A;  1Z5Y E;  4XS1 A;  3C73 A;  5IQY A;  5KEJ A;  4PXO A;  2C4J A;  3MWH A;  1GLP A;  5IMF A;  4MMM A;  3TB2 A;  1Z7R A;  6GSY A;  1RW1 A;  1M9B A;  5ECP B;  5AIV A;  1VF2 A;  1S3D A;  1A2L A;  3UIW A;  2GSR A;  3ERW A;  4MJA A;  3ZL5 A;  4RQX A;  5AGY A;  3MSZ A;  4MZC A;  4KH7 A;  1Z3E A;  4KUN A;  2X8G A;  1OAZ A;  4ZL8 A;  3D21 A;  2WZ9 A;  1YY7 A;  5BRT A;  3R3E A;  5F07 A;  3I6A A;  1EP7 A;  4PGT A;  4ECB A;  4KCE A;  2YWO A;  1JZR A;  4K0G A;  4ML1 A;  5B6N A;  4KDU A;  2FCH A;  4X43 A;  1PA3 A;  5KN1 A;  4ECC A;  3HD5 A;  3PR8 A;  3DEX A;  1S3C A;  1A0F A;  12GS A;  5G5E A;  1H75 A;  1MDI A;  4TR4 A;  3N9J A;  4TKY A;  2ON7 A;  2R5G A;  5E4W A;  4OFT A;  3MYD A;  5DBQ A;  3TJB A;  3VPT A;  4P3Y B;  3O3T A;  2CZ3 A;  4Q5F A;  1SK1 A;  3KXO A;  3QAG A;  4ISD A;  3TCO A;  2HXK A;  1TK8 B;  2N5A A;  4GLT A;  4N10 A;  4I97 A;  2V2G A;  3ISO A;  2CVK A;  2K8S A;  5DAL A;  3R2Q A;  3GMF A;  4JRR A;  4X4J A;  2VL9 A;  1GTI A;  2O7K A;  1GSS A;  2DMM A;  2BJX A;  4O5Q A;  2AJQ B;  4TXO B;  4ECI A;  4PX1 A;  4XS4 B;  5ECS A;  2NPB A;  3ED3 A;  3TGZ A;  2H30 A;  4CY8 A;  5ECR B;  1W4V A;  1SL1 B;  3Q6O A;  1ML6 A;  5ECH B;  5ELA A;  1C72 A;  4MF7 A;  1PN0 A;  2IPA A;  5IOW A;  1EV9 A;  2R0C A;  4EKZ A;  2B5X A;  3K8N A;  4MP4 A;  4ZIJ A;  1EGO A;  2OE3 A;  3IC4 A;  2LRN A;  4ECJ A;  2PVO C;  4XHM A;  4FIW A;  2I81 A;  17GS A;  5CAX A;  2X8C A;  2C0F A;  3IBH A;  2IMD A;  4ZL7 A;  5DCH A;  4K2X A;  3GH9 A;  5CRE A;  4Q5N A;  3RDW A;  2M72 A;  3IV4 A;  2L5L A;  4OO4 A;  2CVD A;  4V1A p;  4AGS A;  5BMU A;  3GHA A;  1MEK A;  1XOB A;  1SYX A;  3GUS A;  5ECL B;  3HDC A;  2NVL A;  3FHK A;  5LD0 A;  3TKR A;  4ZBB A;  1Q4J A;  4HQS A;  3GV1 A;  2L4C A;  1R5A A;  2TIR A;  3PIN A;  3KH9 A;  1EOH A;  4ULX A;  1F37 A;  1GTB A;  3ME7 A;  2P5R A;  1X5E A;  3QR6 A;  5D9X A;  3EYT A;  4PQI A;  3M1G A;  4IJ3 A;  3KJY A;  3TKQ A;  3ZFB A;  1YEP A;  1JZO A;  3S9F A;  2CA8 A;  3IHQ A;  3HZ4 A;  4G10 A;  3M8N A;  3BD2 A;  1OVN A;  4TN8 A;  1XCC A;  2VCW A;  2YP6 A;  3IK9 A;  4TR1 A;  1WPI A;  2VM1 A;  2YCD A;  2V6K A;  3TJJ A;  3BBY A;  2B5Y A;  3OR5 A;  5DQS A;  1XPV A;  1AQX A;  3KEB A;  4TVE A;  4MF5 A;  5A4W A;  2RUE A;  5EY6 A;  5F8B A;  3VUR A;  4IQ1 A;  4DSQ A;  4NMU A;  4O5R A;  4KND A;  2P0G A;  1SU9 A;  3UAR A;  1QGV A;  3HY2 A;  3UL3 A;  2YZU A;  4DSS A;  4NV5 A;  2YWM A;  4V2N A;  2MMZ A;  3P8W A;  3IR4 A;  3ZFL A;  2GT5 A;  1B4Q A;  3MIX A;  4BPY A;  1XW9 A;  3LJR A;  3P90 A;  5ECQ B;  2DIZ A;  4BVX B;  2C80 A;  2XBI A;  1BAY A;  1IYH A;  4MJC A;  1K0M A;  1PRX A;  1T4Y A;  5JWR B;  5KN2 A;  3D22 A;  2DJK A;  2C1Y A;  3GTU A;  1XOA A;  4WF5 A;  3RHC A;  2FUG 2;  3G7J A;  4POK A;  2CVB A;  2HE3 A;  5B6M A;  1ERW A;  3TJF A;  3TOU A;  2HSY A;  1TOF A;  5E59 A;  5COH A;  2L4Q A;  1OC9 B;  4MPF A;  2HYX A;  2IMF A;  4RI6 A;  1BG5 A;  2X8H A;  2R4V A;  3FZ5 A;  1USB A;  13GS A;  4BVY A;  1M2B A;  2LTK A;  6GSV A;  2REM A;  2L59 A;  1K0C A;  3ZLP A;  4ML6 A;  2HNL A;  3GYK A;  5A4U A;  1A24 A;  5G31 A;  5AN1 A;  2KP1 A;  1FOV A;  5ECN B;  4JED A;  2YAN A;  2MYG A;  2UZ8 A;  5ENU A;  1JFU A;  5DAK B;  1TK5 B;  4MK3 A;  2IJY A;  1M2A A;  3LWA A;  3Q74 A;  2FY6 A;  3GKM A;  3QFB C;  3UOM A;  4Z2U A;  2NDO A;  1KNG A;  4XIH A;  2PMT A;  3GKX A;  1SYR A;  1AW9 A;  4E8H A;  4F03 A;  1B48 A;  5LCZ A;  2GGT A;  3KCM A;  2LJA A;  5F0G A;  5ABR A;  4X1U A;  5FWG A;  4NWY A;  4F0C A;  1SJZ A;  4FYU A;  2IMI A;  3EWL A;  3FZ4 A;  2JZR A;  2ZUP A;  3ZZX A;  1F3B A;  4K5R A;  4TRX A;  3TJG A;  1R26 A;  2VM2 A;  1K3Y A;  1OE8 A;  3FK8 A;  5D9V A;  2YNX A;  1VGL A;  4HZ2 A;  3TRQ A;  2V1M A;  5IMV A;  3FR3 A;  4EVM A;  1GSQ A;  4YQM A;  2K18 A;  2KP2 A;  5G1K A;  2OBI A;  5J41 A;  2VAF A;  2HZE A;  4GXZ A;  3GRX A;  2FGX A;  4NAX A;  5CO3 A;  3HVV A;  4ZIL A;  3IHG A;  1BYE A;  1NM3 A;  3NZN A;  1Q98 A;  4GF0 A;  1FVJ A;  1SK0 A;  2X49 A;  1UA5 A;  1FB0 A;  2OJL A;  2PER A;  4GRF A;  4L5L A;  4TXV A;  1GTU A;  4GSS A;  1QFN A;  2LRC A;  1I9D A;  1PMT A;  2B1K A;  1SKS B;  1X0R A;  3U5R E;  3A3T A;  2GZP A;  5D96 A;  5KOW A;  1PGT A;  1V2A A;  2YOI A;  3LW9 A;  4JR4 A;  3GUR A;  2RM5 A;  4HU7 A;  5FHI A;  1OKT A;  2B7J A;  3US3 A;  1XWB A;  3VI5 A;  2GQM A;  1A2M A;  1R4W A;  3BOA A;  1TXX A;  2LST A;  2IME A;  4CW9 A;  4D73 A;  3HKR A;  2TRC P;  4JBB A;  2C8U A;  5D73 A;  2V6O A;  2C0E A;  2WUL A;  3F9U A;  1TDI A;  3L9S A;  1K0O A;  3APS A;  2LV3 A;  3F4T A;  1ACV A;  4YQV A;  1GSD A;  1AUC A;  3G7I A;  16GS A;  1SJI A;  2OA7 A;  2HI7 A;  4HS1 A;  4O92 A;  3IA1 A;  3GNJ A;  1EZK A;  4E8E A;  5CRH A;  2B7K A;  2OAC A;  5ECO B;  1HNC A;  4POB A;  4CDO A;  1E6B A;  2F3M A;  2FA4 A;  5HR2 A;  2H1A A;  3QOU A;  5GZZ B;  2DKH A;  4K0N A;  3HYP A;  2P5Q A;  19GS A;  5KN0 A;  3IPZ A;  4FQU A;  3F3Q A;  1YDK A;  4L0U A;  3V1W A;  5H5Q A;  1CQG A;  4KF9 A;  1OKD A;  1Y25 A;  2NTO A;  4POL A;  3F6F A;  2R3X A;  4I2T A;  3CTG A;  3LG6 A;  3U6V A;  2YV7 A;  5AIX A;  2XBQ A;  6GSS A;  1SD8 A;  3CBU A;  4HI7 A;  1GNW A;  2JSZ A;  2TRX A;  4MH2 A;  2LQO A;  4YAV A;  1GSF A;  3C71 A;  4EDY A;  1BED A;  2HSM A;  4KDY A;  2JZT A;  4POM A;  3QCP A;  2A4H A;  2VLU A;  4Q5Q A;  1K0A A;  4O5U A;  3HVX A;  5HR3 A;  4GQF A;  2M80 A;  2KHP A;  3HJM A;  2MBT A;  1WWJ A;  5AIS A;  2EIR A;  3G9B A;  3KGK A;  4HQZ A;  4KE3 A;  2DLX A;  2AV4 A;  1A23 A;  2HRA A;  3J7Y k;  1NW2 A;  1XW5 A;  5JWO B;  3KP8 A;  5D8I A;  2B3S A;  4HDE A;  20GS A;  3DVX A;  1EP8 A;  3AY8 A;  1J08 A;  1K0B A;  4ZL9 A;  1B4P A;  4HJM A;  4Z7X A;  2LJK A;  3GKK A;  4J2F A;  2JSY A;  2V41 A;  1ZYN A;  2L6C A;  1JLV A;  2OKA A;  2DSA A;  1WE0 A;  1MTC A;  1NSW A;  4QL7 A;  3H1N A;  5IMD A;  1R7H A;  3ZIT A;  3DVW A;  3NIV A;  4CY6 A;  4N11 A;  4L0W A;  1YQ1 A;  2YWN A;  2QKE A;  4GTU A;  1V57 A;  2LNT A;  1GP1 A;  2MMO A;  3ME8 A;  3ZML A;  3DXB A;  3E0U A;  2H6Y A;  2GSQ A;  4IJI A;  3J7Y b;  5G5F A;  1SEN A;  2VCT A;  3UEM A;  5IMA A;  1E2Y A;  3D6I A;  4MLY A;  3QDN A;  5CNW A;  3UBK A;  4PNG A;  4KAE A;  2B6M A;  3CMI A;  4YH2 A;  1CQH A;  4EXJ A;  1V9W A;  4ID0 A;  3ZVJ A;  1HYU A;  2MMN A;  2DML A;  4F9Z A;  2RUF A;  3MNG A;  2CX3 A;  3IK7 A;  1HNA A;  3EPT A;  3C8E A;  1M0U A;  2H1D A;  4HU9 A;  1Z9H A;  3QFA C;  3FRC A;  4NHZ A;  3FMW A;  1PN9 A;  1XIY A;  3WD6 A;  3PGT A;  6GST A;  1MD3 A;  1QUW A;  3W8J A;  4K7O A;  2XHF A;  3VFI A;  3KM6 A;  3PPU A;  1YF0 A;  1JZD A;  3LYK A;  3TRX A;  2HRN A;  5ECK B;  4AF2 A;  5DJL A;  4DSS B;  2H75 A;  3FZ9 A;  2K8V A;  1XVW A;  3LFL A;  3RPP A;  3UVH A;  4KB3 A;  1K3O A;  2LRT A;  2ZNM A;  4TW5 A;  2PWJ A;  3IE3 A;  4ZB8 A;  2K6V A;  4LMV A;  2R6K A;  4K6X A;  1U6T A;  4OWY A;  4XCS A;  1F9M A;  3EC3 A;  5HFI A;  2OBK A;  5DCG A;  3KMN A;  4GCI A;  1DE1 A;  2E2G A;  2LS5 A;  3UAP A;  2K9F A;  3I43 A;  4N30 A;  4ICY A;  2RII A;  4GQC A;  3GKN A;  1SK2 A;  3DD3 A;  3M0F A;  4I8B A;  4TOP A;  1EEM A;  4DVC A;  2YV9 A;  2D2Z A;  3WYW A;  1K0D A;  2DJ2 A;  4KCA A;  4N0V A;  2R0P A;  1SL0 B;  1QK8 A;  1A0R P;  1AQW A;  4TXO A;  4XS4 A;  4MNN A;  1PL2 A;  4EE0 A;  2JAC A;  5J9C A;  2WS2 A;  3L9V A;  3VI7 A;  1ERU A;  1THX A;  4WXT A;  1YKA A;  5IMC A;  2F9S A;  5EPF A;  1DE2 A;  3HXS A;  5ID2 B;  5F06 A;  5D9T A;  1SKW B;  1FG4 A;  1Z7P A;  2RLI A;  2GZZ A;  2O85 A;  4JU5 A;  2RM6 A;  5JWQ B;  1X5D A;  2WB9 A;  1GL8 A;  1TI3 A;  2DJJ A;  4RUV A;  3ZRE A;  4USS A;  2R37 A;  3F63 A;  2LKU A;  3H79 A;  4AJ6 A;  1OC8 A;  1R5P A;  3FEU A;  2DBC A;  5HR0 A;  3M9K A;  11GS A;  4HUA A;  5GAP D;  1ZGN A;  2YPM A;  2N5F A;  1AAZ A;  1F6M C;  2VCQ A;  4MZW A;  3LXT A;  1GRX A;  1YEX A;  4JE1 A;  3CSJ A;  4G2E A;  1WJK A;  5J5N A;  3L78 A;  3MDK A;  2B5E A;  2WRT A;  3D4M A;  2GDR A;  3IDV A;  4FO5 A;  2PVQ A;  3A5I A;  1PD2 1;  4IGJ A;  2EIQ A;  4LMW A;  2JU5 A;  4H86 A;  3HZ8 A;  4N0Z A;  2IWT A;  2QGV A;  3F3R A;  5D9W A;  4NXI A;  4OFM A;  2YWI A;  2IFQ B;  3L4N A;  2MBS A;  3DKS A;  2LNS A;  3CSI A;  2GTU A;  3EUR A;  5DQY A;  5C00 A;  4G19 A;  4WKW A;  2VL2 A;  4HEA 2;  3TRP A;  1ZMA A;  1W89 A;  3IOS A;  2NBS A;  1NHO A;  1O8W A;  5L71 A;  1AXD A;  3EIN A;  4IP1 A;  2JAD A;  4HZ4 A;  5HQP A;  4CHS A;  3L9U A;  4MF6 A;  3F6D A;  4FYC A;  2OE1 A;  5GSS A;  2DKI A;  3CRT A;  4D73 B;  2ON5 A;  1G6W A;  2IN3 A;  3HA9 A;  2FWF A;  2HFD A;  2PU9 C;  4BL7 B;  5CRD A;  4MPG A;  5INY A;  2H66 A;  2CT6 A;  1F2E A;  2JL4 A;  1GSY A;  4WR5 A;  1ERT A;  4YQU A;  1ABA A;  4G9H A;  2C0D A;  3CTF A;  1THO A;  1ZYP A;  2IMK A;  3DWV A;  1ZL9 A;  3RAZ A;  2H6Z A;  5JCU A;  4WBR D;  4ILF A;  1KBN A;  1RK4 A;  2FWH A;  2G2Q A;  3UBL A;  3A2W A;  1J0F A;  3TDG A;  1XW6 A;  5IMZ A;  2VCV A;  2LEG A;  3CSH A;  3GX0 A;  5JCG A;  4KGI A;  2MMA A;  4J56 E;  1MD4 A;  1AC1 A;  3F8U A;  2PGT A;  4IBP A;  1VRS D;  1WRY A;  2DJ0 A;  3LEF A;  2A2S A;  2E7P A;  3WGD A;  2QSI A;  4V2L A;  1A2J A;  3D5J A;  1BQ7 A;  1GH2 A;  4YKF A;  1TRW A;  9GSS A;  2I9H A;  3QAV A;  2GT6 A;  4DEJ A;  2R2J A;  2HT9 A;  3GIX A;  2FLS A;  4OCF A;  2IIY A;  5B8B A;  4WEY A;  1M2D A;  3VWV A;  4PUA A;  2AUV A;  1O73 A;  5FT3 A;  4HJ2 A;  3EMP A;  1XVQ A;  5G1L A;  3IAM 2;  3BCK A;  4YKG A;  4IVF A;  1TU7 A;  3SBC A;  1OYJ A;  2WDU A;  3HVS A;  2BMX A;  4BWS A;  3LGC A;  3APO A;  3EU3 A;  3TUE A;  2JZS A;  1PKW A;  3ZTL A;  1EWX A;  1DUG A;  1QQ2 A;  3CRU A;  1J9B A;  3IXR A;  1AQV A;  3CYN A;  1LBK A;  4IHU A;  1XWK A;  5IOX A;  5CRG A;  4ZB9 A;  4K7N A;  1S3A A;  5A5K A;  2L5O A;  4XTS A;  2LUS A;  1XXU A;  4OMV A;  2HZF A;  5GST A;  1FO5 A;  2QA2 A;  2HSH A;  2H0I A;  2YZH A;  2G0F A;  5IM9 A;  4K9Z A;  1MDK A;  3KP9 A;  3GL3 A;  3WGX A;  3E9J B;  1TRU A;  1UC7 A;  5IO2 A;  2AB6 A;  4MA9 A;  1K0N A;  1WOU A;  2BTO T;  5DAL B;  1HNB A;  3VWX A;  1K3L A;  5GAN D;  2C3T A;  4QQ7 A;  2CAI A;  3GX8 A;  1TW9 A;  3G7Y A;  4EF0 A;  4K8M A;  2H70 A;  4NPB A;  4F0B A;  3TKS E;  5D93 A;  2X99 A;  1O8X A;  1GNE A;  4EUY A;  1GTA A;  1M99 A;  1JHB A;  4GST A;  3DYR A;  1WP0 A;  2LQQ A;  2WCI A;  4V1A g;  22GS A;  3E3E A;  4X0X A;  5LNK e;  3A5W A;  2Z9S A;  1PSQ A;  3M3M A;  1X9S B;  1ZYE A;  1A8Y A;  4JZQ A;  4IP6 A;  3A2V A;  2YJH A;  5ELG A;  1FB6 A;  4K2D A;  4ZXG A;  4I2U A;  4J57 E;  5B7C A;  1DBY A;  5G30 A;  1FVK A;  3WT2 A;  1O7U A;  4OD7 A;  4XRA A;  2GZY A;  1BX9 A;  1TKD B;  2ZCT A;  2DJ1 A;  1M7T A;  2OE0 A;  4G0L A;  1SL2 B;  3HCZ A;  2A2P A;  3TKP A;  1T00 A;  1GUM A;  2YJ7 A;  1V98 A;  1GLQ A;  2C0G A;  2X4A A;  5KOX A;  2LJR A;  3QD9 A;  4Q5R A;  1T4Z A;  4GSN A;  1U3A A;  3GA4 A;  4A5P A;  2GSS A;  5DVB A;  3A2X A;  2GQL A;  4LLR A;  2XC2 A;  1VF1 A;  3H8Q A;  1PQN A;  1G6Y A;  3N5O A;  3EE2 A;  4KW6 A;  4YAP A;  4OCE A;  5CRW A;  2N5B A;  1GSE A;  4LL1 B;  4ACS A;  4FYB A;  3ZIJ A;  3GSS A;  1TJD A;  1YF1 A;  2QC7 A;  1XWG A;  4TR1 B;  4IN0 A;  4MH3 A;  5J4U A;  3GST A;  2H74 A;  5H5S A;  1KTE A;  1WMJ A;  1F3A A;  4KSM A;  4MAB A;  2CZ2 A;  3D4T A;  1GUK A;  2WFC A;  2E0Q A;  3DML A;  2GQK A;  3FZA A;  1ST9 A;  2QA1 A;  7GSS A;  2H19 A;  3LQ7 A;  4QL9 A;  2VD1 A;  3QPM A;  1N8J A;  4K5S A;  5CYY A;  3LYP A;  1OC3 A;  2WJU A;  2VL3 A;  2FNO A;  1QMV A;  1ERV A;  2EC4 A;  1FW1 A;  1TK0 B;  1FOH A;  2FA8 A;  5ECM B;  1GUH A;  5EL8 A;  3C7M A;  2AHE A;  4KSO A;  4DSR A;  2X64 A;  5J3R A;  5HFK A;  2KUC A;  2I3Y A;  4IKH A;  4KX4 A;  2L57 A;  4MJB A;  2VUP A;  3KMO A;  1ZZY A;  1NHY A;  1PX7 A;  3F4R A;  3GTU B;  5JCW A;  3LOR A;  2I4A A;  1G7O A;  1ILO A;  2J23 A;  4EC0 A;  3F4S A;  1PKZ A;  2VOC A;  2FWE A;  4NV2 A;  2XPE A;  2H6X A;  2H0G A;  3F0I A;  4IEL A;  4IS0 A;  3DRN A;  5KN3 A;  2GVP A;  5EVO A;  2FWG A;  4EDZ A;  3O6T A;  3CXG A;  1FAA A;  3QAW A;  1EEJ A;  2H8L A;  4BVY B;  4JR6 A;  3VLN A;  3GL5 A;  2CQ9 A;  1T1V A;  2C3Q A;  4KDX A;  2PUK C;  1EOG A;  3C1R A;  3P7X A;  3UMA A;  3KH7 A;  3EMX A;  3DGQ A;  3HJP A;  3RPN A;  3ZRD A;  5IPH A;  2HLS A;  3IAS 2;  4GWR A;  3GH6 A;  1YZX A;  1B9Y C;  4F2I A;  3WT1 A;  2VIM A;  3H4K A;  4XRD A;  4AJ8 A;  3ERG A;  5HFG A;  3TKS A;  2H76 A;  5CP1 A;  4RQR A;  1H4O A;  4HOJ A;  2H73 A;  1JLW A;  3UJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...