2FA4A

Crystal structure of oxidized form from saccharomyces cerevisiae
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
b'MVTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin II
publication title Crystal structure of the yeast cytoplasmic thioredoxin Trx2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Electron transport
total genus 29
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fa4A00
1X9SB 2F9SA 3H79A 2ES7A 3L0HA 3QAGA 3F3QA 3GN3A 5A5KA 4JU5A 4I2UA 1O8WA 4AJ8A 1EGOA 2DJ0A 5IIZA 3N5OA 4EC0A 4LL4B 2CV4A 4F82A 1K0NA 1ST9A 3F9UA 3GYKA 3TCOA 1V40A 1K0AA 3A2VA 4DSRA 4JZQA 4RUVA 5JCGA 3EMPA 1FO5A 3G7JA 2L5OA 1TK8B 3QMXA 4PQIA 2F51A 2R5GA 1Z6MA 3HD5A 2CZ3A 3DVWA 3BBYA 5F05A 2DLXA 3GL5A 2KP2A 2HFDA 5IMDA 3FZ9A 4IP6A 2PVOC 4KAEA 1TRSA 5G2ZA 2AAWA 4PGTA 1DE1A 3ZRDA 1KEBA 2VCZA 3LEFA 3KGKA 3IV4A 4EL1A 2YWNA 2PVQA 1WMJA 4MJBA 3FZAA 2FHEA 1JLWA 5J41A 3E3EA 4DSSB 4QL9A 5G5FA 2ON7A 4HJMA 1XVWA 1SU9A 1VF3A 2NVLA 4MF5A 3Q19A 1SKWB 1MDIA 5J3RA 1M0UA 3E0UA 3GHAA 1Z7RA 4OCEA 3ERFA 4POKA 1Y6EA 2GZPA 3L9SA 4Q5NA 3RBTA 4V2NA 1HNCA 4G2EA 2FUG2 2FA4A 5H5RA 2R4VA 2GZYA 1EV4A 1I9DA 2Z9SA 5H5SA 2YV7A 4MPFA 4KSMA 2VM1A 2O8VB 2WFCA 1YF1A 5CP1A 3IAM2 4D73A 3RHCA 2H66A 1M2DA 1T4YA 5D9XA 5AIVA 2NTOA 1SL2B 1ILOA 4J57E 1ZL9A 1HYUA 5DAKA 4QQ7A 3RPPA 2TRCP 4XS1A 1PX7A 1SJ6A 2XHFA 3GX8A 4ZL8A 1G6WA 2LQQA 2L4QA 3GH6A 4EDZA 1RQMA 1Z9HA 2FWHA 2V6KA 5KN2A 5IPGA 5G1KA 1XWBA 4MF7A 1TU8A 5DJLA 4ILFA 1ML6A 3K8NA 1TI3A 2RIIA 1OC9B 2OADA 2IMIA 2LUSA 3DD3A 5B6MA 3F6DA 4PX1A 1MD4A 3DXBA 2IFQB 1BQ7A 1KBNA 1PMTA 2VCVA 4O32A 2GGTA 3HVSA 4TR1A 4ISDA 4MA9A 5GSTA 1QUWA 3NOFA 2YWOA 13GSA 2KLXA 3SWLA 2REMA 1JZOA 1XBSA 1ZZYA 2H75A 4RI6A 2ZCTA 1FHEA 5ECRB 3HKRA 3L78A 2WZ9A 3O6TA 4E8EA 5AGYA 3O76A 4DVCA 3IRAA 1TDIA 2GLRA 1JZRA 5DCGA 5H5QA 3WT2A 3EYTA 2HXKA 2BJXA 5D96A 3GTUB 4WXTA 3VWUA 3IC4A 2MMNA 5JWQB 2C0EA 4WKWA 1T4ZA 3DIEA 2GS3A 4IP1A 1UVZA 3IE3A 1FW1A 3GSSA 3MWHA 3M9KA 1TK5B 1FB0A 4IGJA 3DRNA 2KP1A 3IK9A 1BX9A 3QR6A 1A0RP 3Q18A 1PRXA 4TR0A 1HD2A 4FH8A 2MMAA 2B7JA 2AV4A 1B48A 3O3TA 2DC5A 3ZTLA 1JFUA 5GAPD 4YQUA 2K9FA 3TKSA 5CRHA 18GSA 2O87A 4BL7A 3DKSA 3D4TA 2VCXA 3QD9A 1QXHA 4TVEA 2VL2A 4MJCA 3UBLA 2HRNA 4OMVA 1V58A 1LU4A 2C8UA 1AC1A 4V1Ag 4IN0A 1GUKA 3VLNA 4RI7A 5A4VA 1OC3A 2CX3A 3ZLPA 2WS2A 2RM6A 2L5LA 1NM3A 3FHKA 4IJ3A 5DQYA 2HRFA 1TOFA 4GTUA 1WWJA 11GSA 2VOCA 4TW5A 3ED3A 5F8BA 3QFBC 4X1UA 4F0CA 2I1UA 3P2AA 3ME8A 1O7UA 1O6JA 16GSA 4XRAA 1J08A 1F9MA 1A2MA 3ZIVA 3CSJA 3EMXA 5ECHB 3L9UA 3BOAA 3CSIA 2FD3A 5D9WA 1UA5A 1SYRA 5GSSA 2DJKA 5DDLA 1XZOA 1N2AA 3P90A 4ZB9A 1MD3A 5ELGA 1R4WA 3GSTA 4KCAA 5E59A 2IMDA 2X64A 2H70A 2IJYA 3H93A 1J9BA 5G30A 5A4WA 2HE3A 5HR1A 2GT6A 2IMEA 1OYJA 3UIWA 3LQ7A 2GSSA 2X8CA 2H73A 4ZB6A 1HQOA 2H1BA 1O85A 1B9XC 1NSWA 4L8EA 4WEYA 2DMLA 2I81A 2YPMA 5CNWA 1G0TA 2P5QA 5IMAA 1ZMAA 3CTFA 4D73B 4K0NA 1TW9A 1U3AA 4EE0A 3D21A 3VWXA 2OE3A 2VO4A 4K2DA 1A2LA 3MDKA 1GNWA 1X5EA 2VLVA 5LNKe 1ABAA 4HZ4A 4F9ZA 2LJAA 2EC4A 3ZMKA 1JZDA 2I4AA 4NV2A 4JR6A 3IAS2 4TOPA 4KA0A 1G6YA 5IM9A 4Q5RA 1LJRA 4XS4A 9GSSA 2G0FA 20GSA 4NHZA 1MTCA 1AQVA 1K3YA 2R3XA 4ZL7A 2GQKA 4MCUA 4EUYA 4GCIA 4OFTA 3EWLA 1NHYA 4TKYA 1AAZA 1T7PB 3C71A 5JCWA 5B6NA 4HI7A 1TRWA 5IO0A 2DMMA 3UJ1A 1AIUA 3LGCA 5F07A 3KP8A 4N0ZA 2LQOA 3GV1A 3M9JA 2YNXA 2CZ2A 2NDOA 1MDJA 3APQA 3F4TA 4MMMA 4DSQA 5HFKA 2M46A 4RQXA 1XCCA 4ECBA 3CYNA 2EIRA 2OJLA 2IWTA 1XFLA 1V98A 1GSUA 2WCIA 5DVBA 2WULA 3P7XA 3KCMA 5IMZA 1A0FA 3FRCA 1RK4A 4KDUA 3BCIA 2H6XA 2F3MA 3MAKA 2C3NA 6GSYA 3G7IA 3OR5A 2LEGA 4OO5A 1Q4JA 3TKPA 3VFIA 4JEDA 4ID0A 8GSSA 2GSRA 2ZNMA 1TU7A 3TJBA 2V2GA 5CRWA 1GSYA 3VWVA 1PL1A 3I6AA 3APSA 4L5OA 2FY6A 2LRNA 1TKDB 1CQGA 5EY6A 2AUVA 2V1MA 4KB3A 1XW9A 5J9CA 3MSZA 2TIRA 5IMCA 1K0BA 4BPYA 1LBKA 2EIOA 3W6GA 1GSFA 3WGDA 2MMZA 2HYXA 2GQMA 4EKZA 5ECKB 4KCEA 6GSXA 4OCFA 1GUHA 6GSVA 2RUEA 4JE1A 3UMAA 1A24A 1HNAA 1GSQA 3UBKA 4WETA 1GRXA 4KE3A 1YEXA 2B1LA 3TJGA 4MZWA 4N0VA 2H19A 4KW6A 3EE2A 2DJ1A 1SK0A 1J0FA 5DCHA 2P0GA 5B7CA 2JSZA 4TN8A 2PUKC 5G1LA 2B5YA 2FWFA 3Q6OA 3C1RA 2WDUA 2L59A 4PQ1A 3V1WA 2K18A 5J9BA 4IELA 1O73A 2H76A 3LORA 3UARA 2YV9A 4ZILA 1WPIA 2QKEA 3KZQA 2VD1A 2MBTA 1OE8A 3KIJA 3UVHA 5CRGA 4MZBA 1XXUA 3M0FA 3DYRA 2YZHA 2M80A 4LMVA 1B9YC 4HDEA 3H1NA 1SL0B 2R37A 1EOHA 4KUNA 1GTIA 3HJOA 2O7KA 2H6ZA 4IVFA 3F6FA 2LJRA 1R26A 4X0XA 3GURA 5CO3A 3WGXA 2OBIA 4GF0A 2PPTA 2MMOA 4XS6A 2DJ2A 4XIHA 4OFMA 4YQVA 3TKRA 3CRUA 2DBCA 3HXSA 3ME7A 4MDCA 1M7TA 4XRDA 4Z7XA 4CDOA 2LRCA 2L6CA 5D73A 2BMXA 4ECIA 2HSYA 3Q74A 4XS4B 5KN0A 2C3TA 2VCTA 4IHUA 4PXOA 3NIVA 3GKKA 1BEDA 4K8MA 3VWWA 4TXVA 1XIYA 3LJRA 3DMLA 1EV9A 4NV5A 1THOA 5GAND 5E4WA 3GL3A 4WF4A 3ZYWA 2D2ZA 4K7NA 4HS1A 1S3AA 1XWAA 3J7Yk 2VCQA 1GNEA 3F4SA 1TRVA 4ZXGA 3KH7A 4IS0A 3ZVJA 1FVKA 3HVXA 3HJPA 1FVJA 4KH7A 1AQWA 2N5BA 4L5LA 3FR9A 1IYHA 2C0DA 1OKTA 5ECMB 2LKUA 3FY7A 2VL3A 3TRQA 1SJIA 3D0ZA 1PQNA 4F2IA 1VF1A 4GLTA 4QL7A 4ZBDA 5IOWA 1WRYA 1B4PA 4IBPA 3FKFA 1ERVA 1IYIA 3TJFA 1M2AA 3CRTA 6GSUA 3KMOA 3EVIA 1K3OA 4YQMA 1R5AA 3FR6A 5D93A 4BWQA 2VD0A 2A4VA 4N10A 1DE2A 3S9FA 4I8BA 1KNGA 1XW6A 4HU7A 1ON4A 2VL9A 3LSZA 2FNOA 4NXIA 3UL3A 6GSSA 3TJJA 3HVVA 3EU4A 1PL2A 1QQ2A 5ECPB 14GSA 4TR4A 4FYBA 3RAZA 2OE0A 2MYGA 5HR3A 2GVPA 5KN3A 2CX4A 2H8LA 3F0IA 5DALA 1S3DA 4IW9A 2C80A 2CAQA 4LL1B 1PKZA 4J2FA 4KX4A 1DBYA 1PKWA 1T1VA 2IL3A 5DBQA 5DQSA 4WBRD 2AJQB 4CW9A 2VLTA 1TXXA 2FCHA 1F3AA 2HI7A 2M72A 1M2BA 5IQYA 4DEJA 1BJXA 5AIXA 2PGTA 1XWGA 3IPZA 3FYGA 2AYTA 4H86A 3LXZA 3BD2A 3VI5A 1GL8A 4PQHA 4X43A 1ZOFA 3CSHA 3A5WA 3TKSE 5ABRA 2O85A 3DVXA 3L4NA 1DSBA 2WB9A 4AGSA 2J23A 2YZUA 2H1GA 2K6VA 1AXDA 1PA3A 4G9HA 2VM2A 1THXA 1FOVA 1ZYEA 3ZREA 2F8FA 3H4KA 2PBJA 1PX6A 4NPBA 4ECJA 3EURA 3A2XA 1PD21 4ZBAA 2YN1A 2H0IA 3LG6A 2LS5A 3EINA 4K7OA 4GSNA 3SBCA 19GSA 1GWCA 3GMFA 1MDKA 2C1YA 4MP4A 3HY2A 2PU9C 3HDCA 2B5EA 1GUMA 5HR0A 3TOUA 5HR2A 4V1Ap 1VF2A 1V2AA 1T00A 5JWOB 1Y25A 3VPTA 1FB6A 3UOMA 3HA9A 2YANA 4OO4A 4GQCA 4LMWA 1MEKA 3I69A 1F2EA 4ZBBA 1SENA 1G7OA 3KTBA 3LFLA 3PH9A 4Q5QA 3C1SA 5CRDA 3RHBA 5J4UA 1WJKA 1PGTA 3CBUA 2MZCA 2RLIA 1WIKA 1JHBA 1FAAA 2VIMA 4XTSA 3MNGA 2V41A 3IA1A 5ID2B 4E8HA 2B7KA 1ERUA 1PN9A 2FLSA 2WJUA 1PSQA 2GT5A 2LNSA 5HQPA 1BAYA 1Z3EA 5B8AA 2H0HA 3VI7A 1WOUA 2QGVA 4XCSA 2X99A 2GDRA 3D4MA 4NWYA 2EIQA 3GRXA 2ALBA 5D9VA 1GTUA 2L6DA 3G9BA 1ACVA 1GH2A 4KDYA 3D5JA 1VGLA 2YCDA 1W4VA 2DIZA 1QK8A 3WD6A 2FGXA 3A2WA 5LD0A 1V9WA 2VCWA 4ECCA 1XOAA 2JZRA 3TUEA 3UVTA 3PR8A 4K9ZA 4K7IA 4BVYA 2WGRA 2IN3A 5JCUA 4ML6A 3WYWA 2ZUPA 2DIYA 3IOSA 1QFNA 2GTUA 3KM6A 2GQLA 3HHVA 4EF0A 2FA8A 4TR3A 3M8NA 2KUCA 3J7Yb 3LWAA 5L71A 3CXGA 2CVDA 1X0RA 3KP9A 2LNTA 1Q98A 2JSYA 4WR5A 1JLVA 3IXRA 4HJ2A 5IMVA 1GTAA 3DGQA 5ECQB 4OD7A 1GSSA 4GRFA 1F37A 4N30A 3TKSC 2H72A 1VRSD 5INYA 3ISOA 4I6XA 2RUFA 2AHEA 4PNFA 1XOBA 2PERA 2VL2C 1O8XA 4ULXA 1WP0A 3KD0A 1OVNA 2NPBA 1CQHA 3GKMA 4P3YB 1R5PA 4F03A 1A2JA 1XVQA 3D22A 4GWRA 3M3MA 3FR3A 2IMFA 5AN1A 5ECIB 5DALB 5COHA 3ZVJD 4POLA 1VF4A 2JACA 1EWXA 1R7HA 2CVKA 4EXJA 3GKNA 2E0QA 1GTBA 4NMUA 1BG5A 2PN8A 3JCML 2H71A 5FHIA 1XWCA 3BJ5A 1U6TA 1X5DA 5CREA 1GLQA 3L9VA 4HZ2A 2CQ9A 4G10A 1USBA 2VAFA 4KGIA 1F6MC 3QPMA 3C73A 3GH9A 2DSAA 3TB2A 3HYPA 4JR4A 2XPDA 4POMA 4ZB8A 2J9HA 1N8JA 1NHOA 2O89A 2GSTA 4TXOA 2PWJA 1U87A 1URMA 3CTGA 1EEJA 4I5QA 3IR4A 1UC7A 5ECLB 12GSA 2LV3A 1X9WB 4FYCA 2X8HA 1Z7PA 3W8JA 3D6IA 3HZ4A 4POBA 3E9JB 4XHMA 2B5XA 3I43A 2HNLA 2H74A 2K8VA 3QDNA 4IQ1A 3US3A 1Z5YE 5IO2A 2C4JA 4JRRA 2OKAA 2RM5A 4HOJA 1G7EA 3R2QA 3VPQA 4YAPA 4MF6A 2YOIA 4GQFA 5IOXA 2N5AA 3ZMLA 5G31A 4ACSA 4FIWA 4J56E 1ZGNA 3HZ8A 5EPFA 1YQ1A 1A23A 3NZNA 5ECOB 2NBSA 2XC2A 4WBJA 3QCPA 4HEA2 5ID2A 4JBBA 4L0WA 2XBQA 4K6XA 2YWIA 2VUPA 4KSOA 5ECSA 4MJEA 3H8QA 3VURA 1YEPA 1YKCA 4NHWA 5IPHA 3IBHA 1ERTA 2H30A 2OACA 4GSSA 1X5CA 3GX0A 2CAIA 1YJ6A 4KNDA 5ENUA 1T3BA 3U6VA 1SD8A 1HNBA 2HZEA 4MABA 3IDVA 3LXTA 1W89A 1F3BA 4YH2A 5KEJA 4K0GA 1AUCA 2B6MA 4YAVA 4IJIA 5GZZB 1QGVA 1A8LA 3GKXA 2HZFA 1SL1B 1B8XA 4PUFC 3VK9A 4OFNA 4PURA 1X9MB 2E2MA 4MJAA 2B3SA 2H6YA 3GIXA 2YJHA 1SK2A 1TI1A 3FW2A 3QAWA 4GSTA 2DJJA 1EP8A 3KTLA 1JZWA 4ZL9A 2CVBA 5F06A 6GSWA 2DJ3A 1ZYQB 1RW1A 3FZ5A 5JWRB 1B4QA 3F4RA 2IIYA 3IHQA 3P8WA 3IK7A 3ZFLA 2V32A 2JADA 1SYXA 2KHPA 2HLSA 4I97A 2JZSA 4L0UA 2OE1A 1ERWA 1A8YA 3FK8A 2R2JA 2LRTA 1AW9A 3BCKA 2H01A 1XW5A 3F8UA 4I2TA 5C00A 3LYKA 1S3CA 2YWMA 1YKAA 1TTZA 5FWGA 4EVMA 3W8SA 1C72A 4BWSA 2H1AA 2P5RA 1AQXA 2JU5A 4AJ7A 4AJ6A 4Q5FA 1OKDA 1GULA 3RPNA 3DEXA 5CAXA 5J5NA 3F3RA 3KH9A 2WRTA 2C3QA 3DWVA 4PUAA 3F63A 3UEMA 2YJ7A 5C04A 3KJYA 2GSQA 4V2LA 3AY8A 2XPEA 3G7YA 1EZKA 6GSTA 4HU9A 3TOTA 3TGZA 2QC7A 4LA1A 5KN1A 1K0MA 5HFGA 1UN2A 4MZCA 5ELAA 1BYEA 3APOA 1U3IA 5F0GA 2PMTA 1Z6NA 1KTEA 1M99A 1YF0A 4IQAA 5AISA 3CMIA 3M1GA 2F8AA 2I3YA 1O81A 3ZITA 1M9BA 2A2SA 2C0GA 2LTKA 1GLPA 1NW2A 2V6OA 5DJMA 1FG4A 4FO5A 4KDXA 2VLUA 5A4UA 1OE7A 2FWGA 22GSA 1EEMA 2L57A 4G19A 1XWKA 1WE0A 3GA4A 4EDYA 3GFKA 5HFIA 3I9V2 3TDGA 1YY7A 5EL8A 2L4CA 3N9JA 2MBSA 4DSSA 1EP7A 4RQRA 5D9TA 2K8SA 1YZXA 2XBIA 3PINA 1GSEA 3KEBA 1TP9A 2P31A 1E2YA 4N11A 3A3TA 4HUAA 4TXOB 5FT3A 1M9AA 3TJKA 5IMFA 4WF5A 4EO3A 1K3LA 4ML1A 3GNJA 17GSA 2QSIA 1OAZA 1YDKA 5LCZA 1T8EB 4MH3A 2OBKA 3ZZXA 1SKRB 7GSSA 2LSTA 2CT6A 4CHSA 2E7PA 4TRXA 3ERGA 4K1FA 3QAVA 2AB6A 1EOGA 1GSDA 3KXOA 2H0GA 2E2GA 2ON5A 1I5GA 4MPGA 3C7MA 5EVOA 3TKQA 1TJDA 4BVXA 4WR4A 3FEUA 1K0DA 4O5RA 3TRPA 4HQSA 4LLRA 1XPVA 3ZFBA 1SJZA 3WGEA 3HJMA 1U88A 4O7HA 3HCZA 2X8GA 3PGTA 5DAKB 4BA7A 2HSHA 2OA7A 2IPAA 1DUGA 1V57A 2YP6A 4IKHA 1H75A 1SK1A 3WT1A 4AF2A 2C0FA 2JL4A 3ERWA 2CA8A 4NAXA 1QMVA 1OC9A 2JZTA 2IMKA 1TK0B 2G2QA 3U5RE 5D8IA 3ZIJA 3TRXA 2LJKA 3KMNA 2IFQA 5ECNB 4OWYA 3RDWA 4PNGA 3FZ4A 2N5FA 3UAPA 1OC8A 2FWEA 2HZEB 3ZL5A 4TR1B 1TRUA 4FYUA 3C8EA 4GXZA 2B1KA 1SKSB 4V2MA 2KOKA 1ZCPA 1K0OA 2TRXA 3LYPA 5CYYA 2HT9A 1H4OA 4ZIJA 2I9HA 2R6KA 1EGRA 10GSA 4MH2A 3GTUA 2BTOT 1SD9A 3QOUA 4O92A 1GP1A 4F0BA 5B8BA 3EU3A 4MLYA 2A2RA 3QFAC 3GUSA 4MK3A 5G5EA 1E6BA 3EC3A 4HQZA 2H1DA 2GZZA 1K0CA
chains in the Genus database with same CATH superfamily
1X9SB 2F9SA 3H79A 2ES7A 3L0HA 3QAGA 3F3QA 3GN3A 5A5KA 1XG8A 5BMUA 4JU5A 4I2UA 1O8WA 4AJ8A 1EGOA 2DJ0A 5IIZA 3N5OA 4EC0A 4LL4B 2CV4A 4F82A 1K0NA 1ST9A 3F9UA 3GYKA 3TCOA 1V40A 1K0AA 3A2VA 2HSMA 4DSRA 4JZQA 4RUVA 5JCGA 3EMPA 1FO5A 3G7JA 2L5OA 1TK8B 3QMXA 4PQIA 2F51A 2R5GA 1Z6MA 3HD5A 2CZ3A 3DVWA 3BBYA 5F05A 2DLXA 3GL5A 2KP2A 2HFDA 5IMDA 3FZ9A 4IP6A 2PVOC 4KAEA 1TRSA 5G2ZA 2AAWA 4PGTA 1DE1A 3ZRDA 1KEBA 2VCZA 3LEFA 3KGKA 3IV4A 4EL1A 2YWNA 2PVQA 1WMJA 4MJBA 3FZAA 2FHEA 1JLWA 5J41A 3E3EA 4DSSB 4QL9A 3HVNA 5G5FA 2ON7A 4HJMA 1XVWA 1SU9A 1VF3A 2NVLA 4MF5A 3Q19A 1SKWB 1MDIA 5J3RA 1M0UA 3E0UA 3GHAA 1Z7RA 4OCEA 3ERFA 4POKA 1Y6EA 2GZPA 3L9SA 4Q5NA 3RBTA 4V2NA 1HNCA 4G2EA 2FUG2 3FMWA 2FA4A 5H5RA 2R4VA 2GZYA 1EV4A 1I9DA 2Z9SA 5H5SA 2YV7A 4MPFA 4KSMA 2VM1A 2O8VB 2WFCA 1YF1A 5CP1A 3IAM2 4D73A 3RHCA 2H66A 1M2DA 1T4YA 5D9XA 5AIVA 2NTOA 1SL2B 1ILOA 4J57E 1ZL9A 1HYUA 5DAKA 4QQ7A 3RPPA 2TRCP 4XS1A 1PX7A 1SJ6A 2XHFA 3GX8A 4ZL8A 1G6WA 2QA2A 2LQQA 2L4QA 3GH6A 4EDZA 1RQMA 1Z9HA 2FWHA 2V6KA 5KN2A 5IPGA 5G1KA 1XWBA 4MF7A 1TU8A 5DJLA 4ILFA 1ML6A 3K8NA 1TI3A 2RIIA 1OC9B 2OADA 2IMIA 2LUSA 3DD3A 5B6MA 3F6DA 4PX1A 1MD4A 3DXBA 2IFQB 1BQ7A 1KBNA 1PMTA 2VCVA 4O32A 1ZYNA 2GGTA 3HVSA 4TR1A 4ISDA 4MA9A 5GSTA 1QUWA 3NOFA 2YWOA 13GSA 2KLXA 3SWLA 2REMA 1JZOA 1XBSA 1ZZYA 2H75A 4RI6A 2ZCTA 1FHEA 5ECRB 3HKRA 3L78A 2WZ9A 3O6TA 4E8EA 5AGYA 3IHGA 4EIQA 3O76A 4DVCA 3IRAA 1TDIA 2GLRA 1JZRA 5DCGA 5H5QA 3WT2A 3EYTA 2HXKA 2BJXA 5D96A 3GTUB 4WXTA 3VWUA 3IC4A 2MMNA 5JWQB 2C0EA 4WKWA 1T4ZA 3DIEA 2GS3A 4IP1A 1UVZA 3IE3A 1FW1A 3GSSA 3MWHA 3M9KA 1TK5B 1FB0A 4IGJA 3DRNA 2KP1A 3IK9A 1BX9A 3QR6A 1A0RP 3Q18A 1PRXA 4TR0A 1HD2A 4FH8A 2MMAA 2B7JA 2AV4A 4Z2UA 1B48A 3O3TA 1M3JA 2DC5A 3ZTLA 1JFUA 5GAPD 4YQUA 2K9FA 3TKSA 5CRHA 18GSA 2O87A 4BL7A 3DKSA 3D4TA 2VCXA 3QD9A 1QXHA 4TVEA 2VL2A 4MJCA 3UBLA 2HRNA 4OMVA 1V58A 1LU4A 2C8UA 1AC1A 4O5QA 4V1Ag 4IN0A 1GUKA 3IC8A 3VLNA 4RI7A 5A4VA 1OC3A 2CX3A 3ZLPA 2WS2A 2RM6A 2L5LA 1NM3A 3FHKA 4IJ3A 5DQYA 1ZYPA 2HRFA 1TOFA 4GTUA 1WWJA 11GSA 2VOCA 4TW5A 4FQUA 3ED3A 5F8BA 3QFBC 4X1UA 5KOWA 4F0CA 2A2PA 2I1UA 3P2AA 2X49A 3ME8A 1O7UA 1O6JA 16GSA 4XRAA 1J08A 1F9MA 1A2MA 3ZIVA 3CSJA 3EMXA 5ECHB 3L9UA 3BOAA 3CSIA 2FD3A 5D9WA 1UA5A 1SYRA 5GSSA 2DJKA 5DDLA 1XZOA 1N2AA 3P90A 4ZB9A 1MD3A 5ELGA 1R4WA 3GSTA 4KCAA 5E59A 2R0CA 2IMDA 2X64A 2H70A 2IJYA 2HRAA 3H93A 1J9BA 5G30A 5A4WA 2HE3A 5HR1A 2GT6A 2IMEA 1OYJA 3UIWA 3LQ7A 2GSSA 2DKIA 2X8CA 2H73A 4ZB6A 1HQOA 2H1BA 1O85A 1B9XC 1NSWA 4L8EA 4WEYA 2DMLA 2I81A 2YPMA 5CNWA 1G0TA 2P5QA 5IMAA 1ZMAA 3CTFA 4D73B 4K0NA 1TW9A 4KF9A 1U3AA 4EE0A 3D21A 3VWXA 2OE3A 2VO4A 4K2DA 1A2LA 3MDKA 1GNWA 1X5EA 2VLVA 5LNKe 1ABAA 4HZ4A 4F9ZA 2LJAA 2EC4A 3ZMKA 1JZDA 2I4AA 4NV2A 4JR6A 3IAS2 4TOPA 4KA0A 1G6YA 5IM9A 4Q5RA 1LJRA 4XS4A 9GSSA 2G0FA 20GSA 4NHZA 4YKGA 1MTCA 1AQVA 1K3YA 2R3XA 4ZL7A 3PPUA 2GQKA 4MCUA 4EUYA 4GCIA 4OFTA 3EWLA 1NHYA 4TKYA 1AAZA 1T7PB 3C71A 5JCWA 5B6NA 4HI7A 1TRWA 5IO0A 2DMMA 3UJ1A 1AIUA 3LGCA 5F07A 3KP8A 4N0ZA 2LQOA 3GV1A 3M9JA 2YNXA 2CZ2A 2NDOA 1MDJA 3APQA 3F4TA 4MMMA 4DSQA 5HFKA 2M46A 4RQXA 1XCCA 4ECBA 3CYNA 2EIRA 2OJLA 2IWTA 1XFLA 1V98A 4Z2TA 1GSUA 2WCIA 5DVBA 2WULA 3P7XA 3KCMA 5IMZA 1A0FA 3FRCA 1RK4A 4KDUA 3BCIA 2H6XA 2F3MA 3MAKA 2C3NA 6GSYA 3G7IA 3OR5A 2LEGA 4OO5A 1Q4JA 3TKPA 3VFIA 4JEDA 4ID0A 8GSSA 2GSRA 2ZNMA 1TU7A 3TJBA 2V2GA 5CRWA 1GSYA 2X4AA 3VWVA 1PL1A 4BL7B 3I6AA 3APSA 4L5OA 2FY6A 2LRNA 1TKDB 1CQGA 5EY6A 2AUVA 2V1MA 4KB3A 1XW9A 5J9CA 3MSZA 2TIRA 5IMCA 1K0BA 4BPYA 1LBKA 2EIOA 3W6GA 1GSFA 2QA1A 3WGDA 2MMZA 2HYXA 2GQMA 4EKZA 5ECKB 4KCEA 6GSXA 4OCFA 1GUHA 6GSVA 2RUEA 4JE1A 3UMAA 1A24A 4BIKA 1HNAA 1GSQA 3UBKA 4WETA 1GRXA 4KE3A 1YEXA 2B1LA 3TJGA 4MZWA 4PTSA 4N0VA 2H19A 4KW6A 3EE2A 2DJ1A 1SK0A 1J0FA 5DCHA 2P0GA 5B7CA 2JSZA 4TN8A 2PUKC 5G1LA 2B5YA 2FWFA 3Q6OA 3C1RA 2WDUA 2L59A 4PQ1A 3V1WA 2K18A 5J9BA 4IELA 1O73A 2H76A 3LORA 3UARA 2YV9A 4ZILA 1WPIA 2QKEA 3KZQA 2VD1A 2MBTA 1OE8A 3KIJA 3UVHA 5CRGA 4MZBA 1XXUA 3M0FA 3DYRA 2YZHA 2M80A 4LMVA 1B9YC 4HDEA 3H1NA 1SL0B 2R37A 1EOHA 4KUNA 1GTIA 3HJOA 2O7KA 2H6ZA 4IVFA 3F6FA 4X4JA 2LJRA 1R26A 4X0XA 3GURA 5CO3A 3WGXA 2OBIA 4K5RA 1S3RA 4GF0A 2PPTA 2MMOA 4XS6A 2DJ2A 4XIHA 4OFMA 4YQVA 3TKRA 3CRUA 2DBCA 3HXSA 3ME7A 4MDCA 1M7TA 4XRDA 4Z7XA 4CDOA 2LRCA 2L6CA 5D73A 2BMXA 4ECIA 2HSYA 3Q74A 4XS4B 5KN0A 2C3TA 2VCTA 4IHUA 4PXOA 4G0IA 3NIVA 3GKKA 1BEDA 4K8MA 3VWWA 4TXVA 1XIYA 3LJRA 3DMLA 1EV9A 4NV5A 1THOA 5GAND 5E4WA 3GL3A 4WF4A 3ZYWA 2D2ZA 4K7NA 4HS1A 1S3AA 1XWAA 3J7Yk 2VCQA 1GNEA 3F4SA 1TRVA 4ZXGA 3KH7A 4IS0A 3ZVJA 1FVKA 3HVXA 3HJPA 1FVJA 4KH7A 1AQWA 2N5BA 4L5LA 3FR9A 1IYHA 2C0DA 1OKTA 5ECMB 2LKUA 3FY7A 2VL3A 4USSA 3TRQA 1SJIA 3D0ZA 1PQNA 4F2IA 1VF1A 2R0PA 4GLTA 4QL7A 4ZBDA 5IOWA 1WRYA 4EIPA 1B4PA 4IBPA 3FKFA 1ERVA 1IYIA 3TJFA 1M2AA 3CRTA 6GSUA 3KMOA 3EVIA 1K3OA 4YQMA 1R5AA 3FR6A 5D93A 4BWQA 2VD0A 2A4VA 4N10A 1DE2A 3S9FA 4I8BA 1KNGA 1XW6A 4HU7A 1ON4A 2VL9A 3LSZA 2FNOA 4NXIA 3UL3A 6GSSA 3TJJA 3HVVA 3EU4A 1PL2A 1QQ2A 5ECPB 14GSA 4TR4A 4FYBA 3RAZA 2OE0A 2MYGA 5HR3A 2GVPA 5KN3A 2CX4A 2H8LA 3F0IA 5DALA 1S3DA 4IW9A 2C80A 2CAQA 4LL1B 1PKZA 4J2FA 4KX4A 1DBYA 1PKWA 1T1VA 2IL3A 5DBQA 5DQSA 4WBRD 2AJQB 4CW9A 2VLTA 1TXXA 2FCHA 1F3AA 2HI7A 2M72A 1M2BA 5IQYA 4DEJA 1BJXA 5AIXA 2PGTA 1XWGA 3IPZA 3FYGA 2AYTA 4H86A 3LXZA 3BD2A 3VI5A 1GL8A 4PQHA 4X43A 1ZOFA 3CSHA 4MNNA 3A5WA 3TKSE 5ABRA 2O85A 3DVXA 3L4NA 1DSBA 2WB9A 4AGSA 2J23A 2YZUA 2H1GA 2K6VA 1AXDA 1PA3A 4G9HA 2VM2A 1THXA 1FOVA 1ZYEA 3ZREA 2F8FA 2R0GA 3H4KA 2PBJA 1PX6A 4NPBA 4ECJA 4HSCX 3EURA 3A2XA 1PD21 4ZBAA 2YN1A 2H0IA 3LG6A 2LS5A 3EINA 4K7OA 4GSNA 3SBCA 19GSA 1GWCA 1PFOA 3GMFA 1MDKA 2C1YA 4MP4A 3HY2A 2PU9C 3HDCA 2B5EA 1GUMA 5HR0A 3TOUA 4ICYA 5HR2A 4V1Ap 1VF2A 1V2AA 1T00A 5JWOB 1Y25A 3VPTA 1FB6A 3UOMA 3HA9A 2YANA 4OO4A 4GQCA 4LMWA 1MEKA 3I69A 1F2EA 4ZBBA 1SENA 1G7OA 3KTBA 3LFLA 3PH9A 4Q5QA 3C1SA 5CRDA 3RHBA 5J4UA 1WJKA 1PGTA 3CBUA 2MZCA 2RLIA 1WIKA 1JHBA 1FAAA 2VIMA 4XTSA 3MNGA 2V41A 3IA1A 5ID2B 4E8HA 2B7KA 1ERUA 1PN9A 2FLSA 2WJUA 1PSQA 2GT5A 2LNSA 4K5SA 5HQPA 1BAYA 1Z3EA 5B8AA 2H0HA 3VI7A 1WOUA 2QGVA 4XCSA 2X99A 2GDRA 3D4MA 4NWYA 2EIQA 3GRXA 2ALBA 4K2XA 5D9VA 4G0KA 1GTUA 2L6DA 3G9BA 1ACVA 1GH2A 4KDYA 3D5JA 1VGLA 4A5PA 2YCDA 1W4VA 2DIZA 1QK8A 3WD6A 2FGXA 3A2WA 5LD0A 4G0LA 1V9WA 2VCWA 4ECCA 1XOAA 2JZRA 3TUEA 3UVTA 3PR8A 4K9ZA 4K7IA 4YKFA 4BVYA 2WGRA 2IN3A 5JCUA 4ML6A 3WYWA 2ZUPA 2DIYA 3IOSA 1QFNA 2GTUA 3KM6A 2GQLA 3HHVA 4EF0A 2FA8A 4TR3A 3M8NA 2KUCA 3J7Yb 3LWAA 5L71A 3CXGA 2CVDA 1X0RA 2A4HA 3KP9A 2LNTA 1Q98A 2JSYA 4WR5A 1JLVA 3IXRA 4HJ2A 5IMVA 1GTAA 3R3EA 3DGQA 5ECQB 4OD7A 1GSSA 4GRFA 1F37A 4N30A 3TKSC 2H72A 1VRSD 5INYA 3ISOA 4I6XA 2RUFA 2AHEA 4PNFA 1XOBA 2PERA 2VL2C 1O8XA 4ULXA 1WP0A 3KD0A 1OVNA 4Z2RA 2NPBA 1CQHA 3GKMA 4P3YB 1R5PA 4F03A 1A2JA 1XVQA 3D22A 4GWRA 3M3MA 3FR3A 2IMFA 5AN1A 5ECIB 5DALB 5COHA 3ZVJD 4POLA 1VF4A 2JACA 1EWXA 1R7HA 2CVKA 4EXJA 3GKNA 2E0QA 1GTBA 4NMUA 1BG5A 3MYDA 2PN8A 3JCML 2H71A 5FHIA 1XWCA 3BJ5A 1U6TA 1X5DA 5CREA 1GLQA 3L9VA 4HZ2A 2CQ9A 4G10A 1USBA 2VAFA 4KGIA 1F6MC 3QPMA 4CY6A 3C73A 3GH9A 2DSAA 3TB2A 3HYPA 4JR4A 2XPDA 4POMA 4ZB8A 2J9HA 1N8JA 1NHOA 2O89A 2GSTA 4TXOA 2PWJA 1U87A 1URMA 3CTGA 1EEJA 4I5QA 3IR4A 1UC7A 5ECLB 12GSA 2LV3A 1X9WB 4FYCA 2X8HA 1Z7PA 3W8JA 3D6IA 3HZ4A 4POBA 3E9JB 4O5UA 3LW9A 4XHMA 2B5XA 3I43A 2HNLA 2H74A 2K8VA 3QDNA 4IQ1A 3US3A 1Z5YE 5IO2A 2C4JA 4JRRA 2OKAA 2RM5A 4HOJA 1G7EA 3R2QA 3VPQA 4BVXB 4YAPA 4MF6A 2YOIA 4GQFA 5IOXA 2N5AA 3ZMLA 5G31A 4ACSA 4FIWA 4J56E 1ZGNA 3A5IA 3HZ8A 5EPFA 1YQ1A 1A23A 3NZNA 5ECOB 2NBSA 2XC2A 4WBJA 3QCPA 4HEA2 5ID2A 4JBBA 2DKHA 4L0WA 2XBQA 4K6XA 2YWIA 2VUPA 4KSOA 5ECSA 4MJEA 3H8QA 3VURA 1YEPA 1YKCA 4NHWA 5IPHA 3IBHA 1ERTA 2H30A 2OACA 4GSSA 1X5CA 3GX0A 2CAIA 1YJ6A 4KNDA 5ENUA 1T3BA 3U6VA 1SD8A 1HNBA 2HZEA 4MABA 3IDVA 3LXTA 1W89A 1F3BA 4YH2A 5KEJA 4K0GA 1AUCA 2B6MA 4YAVA 4IJIA 5GZZB 1QGVA 1A8LA 3GKXA 2HZFA 1SL1B 1B8XA 4PUFC 3VK9A 4OFNA 4PURA 1X9MB 2E2MA 4MJAA 2B3SA 2H6YA 3GIXA 2YJHA 1SK2A 1TI1A 3FW2A 3QAWA 4GSTA 2DJJA 1EP8A 3KTLA 1JZWA 4BVYB 4ZL9A 2CVBA 5F06A 6GSWA 2DJ3A 1ZYQB 1RW1A 3FZ5A 3CQFA 5JWRB 1B4QA 3F4RA 2IIYA 3IHQA 3P8WA 3IK7A 3ZFLA 2V32A 2JADA 1SYXA 2KHPA 2HLSA 4I97A 2JZSA 4L0UA 2OE1A 1ERWA 1A8YA 3FK8A 2R2JA 2LRTA 1AW9A 3BCKA 2H01A 1XW5A 2HRKA 3F8UA 4I2TA 5C00A 3LYKA 1S3CA 2YWMA 1YKAA 1TTZA 5FWGA 4EVMA 3W8SA 1C72A 4BWSA 2H1AA 2P5RA 1AQXA 2JU5A 4AJ7A 4AJ6A 4Q5FA 1OKDA 1GULA 3RPNA 3DEXA 5CAXA 5J5NA 3F3RA 3KH9A 2WRTA 2C3QA 3DWVA 4PUAA 3F63A 3UEMA 2YJ7A 5C04A 3KJYA 2GSQA 4V2LA 3AY8A 2XPEA 3G7YA 1EZKA 6GSTA 1M3IA 4HU9A 3TOTA 3TGZA 2QC7A 4LA1A 5KN1A 1K0MA 3MIXA 5HFGA 1UN2A 4MZCA 5ELAA 1BYEA 3APOA 1U3IA 5F0GA 2PMTA 1Z6NA 1KTEA 5BRTA 1M99A 1YF0A 4IQAA 5AISA 3CMIA 3M1GA 2F8AA 2I3YA 1O81A 3ZITA 1M9BA 2A2SA 2C0GA 2LTKA 1GLPA 1NW2A 2V6OA 4CY8A 5DJMA 1FG4A 4FO5A 4KDXA 2VLUA 5A4UA 1OE7A 2FWGA 22GSA 1EEMA 2L57A 4G19A 1XWKA 1WE0A 3GA4A 4EDYA 3GFKA 5HFIA 3I9V2 3TDGA 1YY7A 5EL8A 2L4CA 3N9JA 2MBSA 4DSSA 1EP7A 4RQRA 5D9TA 2K8SA 1YZXA 2XBIA 3PINA 1GSEA 3KEBA 1TP9A 2P31A 1E2YA 4N11A 3A3TA 4HUAA 4TXOB 5FT3A 1M9AA 3TJKA 5IMFA 4WF5A 4EO3A 1K3LA 4ML1A 3GNJA 17GSA 2QSIA 1OAZA 1YDKA 5LCZA 1T8EB 4MH3A 2OBKA 3ZZXA 1SKRB 7GSSA 2LSTA 2CT6A 4CHSA 2E7PA 4TRXA 3ERGA 4K1FA 3QAVA 2AB6A 1EOGA 1GSDA 3KXOA 2H0GA 2E2GA 2ON5A 1I5GA 4MPGA 1PN0A 3C7MA 5EVOA 3TKQA 1TJDA 4BVXA 4WR4A 3FEUA 1K0DA 4O5RA 3TRPA 4HQSA 4LLRA 1XPVA 3ZFBA 1SJZA 3WGEA 3HJMA 1U88A 4O7HA 3HCZA 2X8GA 3PGTA 5DAKB 4BA7A 2HSHA 2OA7A 2IPAA 1DUGA 1V57A 2YP6A 4IKHA 1H75A 1SK1A 3WT1A 4AF2A 2C0FA 2JL4A 3ERWA 2CA8A 4NAXA 1QMVA 1OC9A 2JZTA 2IMKA 1TK0B 2G2QA 3U5RE 5D8IA 3ZIJA 5KOXA 3TRXA 2LJKA 3KMNA 2IFQA 5ECNB 4OWYA 3RDWA 4PNGA 3FZ4A 2N5FA 3UAPA 1OC8A 2FWEA 1FOHA 2HZEB 3ZL5A 4TR1B 1TRUA 4FYUA 3C8EA 2UZ8A 4GXZA 2B1KA 1SKSB 4V2MA 2KOKA 1ZCPA 1K0OA 2TRXA 3LYPA 5CYYA 2HT9A 1H4OA 4ZIJA 2I9HA 2R6KA 1EGRA 10GSA 4MH2A 3GTUA 2BTOT 1SD9A 3QOUA 4O92A 1GP1A 4F0BA 5B8BA 3EU3A 4MLYA 2A2RA 3QFAC 3GUSA 3EPTA 4MK3A 5G5EA 1E6BA 3EC3A 4HQZA 2H1DA 2GZZA 1K0CA
chains in the Genus database with same CATH topology
1X9SB 2F9SA 3H79A 2ES7A 3L0HA 3QAGA 3F3QA 3GN3A 5A5KA 5BMUA 4JU5A 4I2UA 1O8WA 4AJ8A 1EGOA 2DJ0A 5IIZA 3N5OA 4EC0A 4LL4B 2CV4A 4F82A 1K0NA 1ST9A 3F9UA 3GYKA 3TCOA 1V40A 1K0AA 3A2VA 2HSMA 4DSRA 4JZQA 4RUVA 5JCGA 3EMPA 1FO5A 3G7JA 2L5OA 1TK8B 3QMXA 4PQIA 2F51A 2R5GA 1Z6MA 3HD5A 2CZ3A 3DVWA 3BBYA 5F05A 2DLXA 3GL5A 2KP2A 2HFDA 5IMDA 3FZ9A 4IP6A 2PVOC 4KAEA 1TRSA 5G2ZA 2AAWA 4PGTA 1DE1A 3ZRDA 1KEBA 2VCZA 3LEFA 3KGKA 3IV4A 4EL1A 2YWNA 2PVQA 1WMJA 4MJBA 3FZAA 2FHEA 1JLWA 5J41A 3E3EA 4DSSB 4QL9A 5G5FA 2ON7A 4HJMA 1XVWA 1SU9A 1VF3A 2NVLA 4MF5A 3Q19A 1SKWB 1MDIA 5J3RA 1M0UA 3E0UA 3GHAA 1Z7RA 4OCEA 3ERFA 4POKA 1Y6EA 2GZPA 3L9SA 4Q5NA 3RBTA 4V2NA 1HNCA 4G2EA 2FUG2 3FMWA 2FA4A 5H5RA 2R4VA 2GZYA 1EV4A 1I9DA 2Z9SA 5H5SA 2YV7A 4MPFA 4KSMA 2VM1A 2O8VB 2WFCA 1YF1A 5CP1A 3IAM2 4D73A 3RHCA 2H66A 1M2DA 1T4YA 5D9XA 5AIVA 2NTOA 1SL2B 1ILOA 4J57E 1ZL9A 1HYUA 5DAKA 4QQ7A 3RPPA 2TRCP 4XS1A 1PX7A 1SJ6A 2XHFA 3GX8A 4ZL8A 1G6WA 2QA2A 2LQQA 2L4QA 3GH6A 4EDZA 1RQMA 1Z9HA 2FWHA 2V6KA 5KN2A 5IPGA 5G1KA 1XWBA 4MF7A 1TU8A 5DJLA 4ILFA 1ML6A 3K8NA 1TI3A 2RIIA 1OC9B 2OADA 2IMIA 2LUSA 3DD3A 5B6MA 3F6DA 4PX1A 1MD4A 3DXBA 2IFQB 1BQ7A 1KBNA 1PMTA 2VCVA 4O32A 1ZYNA 2GGTA 3HVSA 4TR1A 4ISDA 4MA9A 5GSTA 1QUWA 3NOFA 2YWOA 13GSA 2KLXA 3SWLA 2REMA 1JZOA 1XBSA 1ZZYA 2H75A 4RI6A 2ZCTA 1FHEA 5ECRB 3HKRA 3L78A 2WZ9A 3O6TA 4E8EA 5AGYA 3IHGA 4EIQA 3O76A 4DVCA 3IRAA 1TDIA 2GLRA 1JZRA 5DCGA 5H5QA 3WT2A 3EYTA 2HXKA 2BJXA 5D96A 3GTUB 4WXTA 3VWUA 3IC4A 2MMNA 5JWQB 2C0EA 4WKWA 1T4ZA 3DIEA 2GS3A 4IP1A 1UVZA 3IE3A 1FW1A 3GSSA 3MWHA 3M9KA 1TK5B 1FB0A 4IGJA 3DRNA 2KP1A 3IK9A 1BX9A 3QR6A 1A0RP 3Q18A 1PRXA 4TR0A 1HD2A 4FH8A 2MMAA 2B7JA 2AV4A 4Z2UA 1B48A 3O3TA 2DC5A 3ZTLA 1JFUA 5GAPD 4YQUA 2K9FA 3TKSA 5CRHA 18GSA 2O87A 4BL7A 3DKSA 3D4TA 2VCXA 3QD9A 1QXHA 4TVEA 2VL2A 4MJCA 3UBLA 2HRNA 4OMVA 1V58A 1LU4A 2C8UA 1AC1A 4O5QA 4V1Ag 4IN0A 1GUKA 3IC8A 3VLNA 4RI7A 5A4VA 1OC3A 2CX3A 3ZLPA 2WS2A 2RM6A 2L5LA 1NM3A 3FHKA 4IJ3A 5DQYA 1ZYPA 2HRFA 1TOFA 4GTUA 1WWJA 11GSA 2VOCA 4TW5A 4FQUA 3ED3A 5F8BA 3QFBC 4X1UA 5KOWA 4F0CA 2A2PA 2I1UA 3P2AA 2X49A 3ME8A 1O7UA 1O6JA 16GSA 4XRAA 1J08A 1F9MA 1A2MA 3ZIVA 3CSJA 3EMXA 5ECHB 3L9UA 3BOAA 3CSIA 2FD3A 5D9WA 1UA5A 1SYRA 5GSSA 2DJKA 5DDLA 1XZOA 1N2AA 3P90A 4ZB9A 1MD3A 5ELGA 1R4WA 3GSTA 4KCAA 5E59A 2R0CA 2IMDA 2X64A 2H70A 2IJYA 2HRAA 3H93A 1J9BA 5G30A 5A4WA 2HE3A 5HR1A 2GT6A 2IMEA 1OYJA 3UIWA 3LQ7A 2GSSA 2DKIA 2X8CA 2H73A 4ZB6A 1HQOA 2H1BA 1O85A 1B9XC 1NSWA 4L8EA 4WEYA 2DMLA 2I81A 2YPMA 5CNWA 1G0TA 2P5QA 5IMAA 1ZMAA 3CTFA 4D73B 4K0NA 1TW9A 4KF9A 1U3AA 4EE0A 3D21A 3VWXA 2OE3A 2VO4A 4K2DA 1A2LA 3MDKA 1GNWA 1X5EA 2VLVA 5LNKe 1ABAA 4HZ4A 4F9ZA 2LJAA 2EC4A 3ZMKA 1JZDA 2I4AA 4NV2A 4JR6A 3IAS2 4TOPA 4KA0A 1G6YA 5IM9A 4Q5RA 1LJRA 4XS4A 9GSSA 2G0FA 20GSA 4NHZA 4YKGA 1MTCA 1AQVA 1K3YA 2R3XA 4ZL7A 3PPUA 2GQKA 4MCUA 4EUYA 4GCIA 4OFTA 3EWLA 1NHYA 4TKYA 1AAZA 1T7PB 3C71A 5JCWA 5B6NA 4HI7A 1TRWA 5IO0A 2DMMA 3UJ1A 1AIUA 3LGCA 5F07A 3KP8A 4N0ZA 2LQOA 3GV1A 3M9JA 2YNXA 2CZ2A 2NDOA 1MDJA 3APQA 3F4TA 4MMMA 4DSQA 5HFKA 2M46A 4RQXA 1XCCA 4ECBA 3CYNA 2EIRA 2OJLA 2IWTA 1XFLA 1V98A 4Z2TA 1GSUA 2WCIA 5DVBA 2WULA 3P7XA 3KCMA 5IMZA 1A0FA 3FRCA 1RK4A 4KDUA 3BCIA 2H6XA 2F3MA 3MAKA 2C3NA 6GSYA 3G7IA 3OR5A 2LEGA 4OO5A 1Q4JA 3TKPA 3VFIA 4JEDA 4ID0A 8GSSA 2GSRA 2ZNMA 1TU7A 3TJBA 2V2GA 5CRWA 1GSYA 2X4AA 3VWVA 1PL1A 4BL7B 3I6AA 3APSA 4L5OA 2FY6A 2LRNA 1TKDB 1CQGA 5EY6A 2AUVA 2V1MA 4KB3A 1XW9A 5J9CA 3MSZA 2TIRA 5IMCA 1K0BA 4BPYA 1LBKA 2EIOA 3W6GA 1GSFA 2QA1A 3WGDA 2MMZA 2HYXA 2GQMA 4EKZA 5ECKB 4KCEA 6GSXA 4OCFA 1GUHA 6GSVA 2RUEA 4JE1A 3UMAA 1A24A 1HNAA 1GSQA 3UBKA 4WETA 1GRXA 4KE3A 1YEXA 2B1LA 3TJGA 4MZWA 4PTSA 4N0VA 2H19A 4KW6A 3EE2A 2DJ1A 1SK0A 1J0FA 5DCHA 2P0GA 5B7CA 2JSZA 4TN8A 2PUKC 5G1LA 2B5YA 2FWFA 3Q6OA 3C1RA 2WDUA 2L59A 4PQ1A 3V1WA 2K18A 5J9BA 4IELA 1O73A 2H76A 3LORA 3UARA 2YV9A 4ZILA 1WPIA 2QKEA 3KZQA 2VD1A 2MBTA 1OE8A 3KIJA 3UVHA 5CRGA 4MZBA 1XXUA 3M0FA 3DYRA 2YZHA 2M80A 4LMVA 1B9YC 4HDEA 3H1NA 1SL0B 2R37A 1EOHA 4KUNA 1GTIA 3HJOA 2O7KA 2H6ZA 4IVFA 3F6FA 4X4JA 2LJRA 1R26A 4X0XA 3GURA 5CO3A 3WGXA 2OBIA 4K5RA 4GF0A 2PPTA 2MMOA 4XS6A 2DJ2A 4XIHA 4OFMA 4YQVA 3TKRA 3CRUA 2DBCA 3HXSA 3ME7A 4MDCA 1M7TA 4XRDA 4Z7XA 4CDOA 2LRCA 2L6CA 5D73A 2BMXA 4ECIA 2HSYA 3Q74A 4XS4B 5KN0A 2C3TA 2VCTA 4IHUA 4PXOA 4G0IA 3NIVA 3GKKA 1BEDA 4K8MA 3VWWA 4TXVA 1XIYA 3LJRA 3DMLA 1EV9A 4NV5A 1THOA 5GAND 5E4WA 3GL3A 4WF4A 3ZYWA 2D2ZA 4K7NA 4HS1A 1S3AA 1XWAA 3J7Yk 2VCQA 1GNEA 3F4SA 1TRVA 4ZXGA 3KH7A 4IS0A 3ZVJA 1FVKA 3HVXA 3HJPA 1FVJA 4KH7A 1AQWA 2N5BA 4L5LA 3FR9A 1IYHA 2C0DA 1OKTA 5ECMB 2LKUA 3FY7A 2VL3A 4USSA 3TRQA 1SJIA 3D0ZA 1PQNA 4F2IA 1VF1A 2R0PA 4GLTA 4QL7A 4ZBDA 5IOWA 1WRYA 4EIPA 1B4PA 4IBPA 3FKFA 1ERVA 1IYIA 3TJFA 1M2AA 3CRTA 6GSUA 3KMOA 3EVIA 1K3OA 4YQMA 1R5AA 3FR6A 5D93A 4BWQA 2VD0A 2A4VA 4N10A 1DE2A 3S9FA 4I8BA 1KNGA 1XW6A 4HU7A 1ON4A 2VL9A 3LSZA 2FNOA 4NXIA 3UL3A 6GSSA 3TJJA 3HVVA 3EU4A 1PL2A 1QQ2A 5ECPB 14GSA 4TR4A 4FYBA 3RAZA 2OE0A 2MYGA 5HR3A 2GVPA 5KN3A 2CX4A 2H8LA 3F0IA 5DALA 1S3DA 4IW9A 2C80A 2CAQA 4LL1B 1PKZA 4J2FA 4KX4A 1DBYA 1PKWA 1T1VA 2IL3A 5DBQA 5DQSA 4WBRD 2AJQB 4CW9A 2VLTA 1TXXA 2FCHA 1F3AA 2HI7A 2M72A 1M2BA 5IQYA 4DEJA 1BJXA 5AIXA 2PGTA 1XWGA 3IPZA 3FYGA 2AYTA 4H86A 3LXZA 3BD2A 3VI5A 1GL8A 4PQHA 4X43A 1ZOFA 3CSHA 4MNNA 3A5WA 3TKSE 5ABRA 2O85A 3DVXA 3L4NA 1DSBA 2WB9A 4AGSA 2J23A 2YZUA 2H1GA 2K6VA 1AXDA 1PA3A 4G9HA 2VM2A 1THXA 1FOVA 1ZYEA 3ZREA 2F8FA 2R0GA 3H4KA 2PBJA 1PX6A 4NPBA 4ECJA 3EURA 3A2XA 1PD21 4ZBAA 2YN1A 2H0IA 3LG6A 2LS5A 3EINA 4K7OA 4GSNA 3SBCA 19GSA 1GWCA 3GMFA 1MDKA 2C1YA 4MP4A 3HY2A 2PU9C 3HDCA 2B5EA 1GUMA 5HR0A 3TOUA 4ICYA 5HR2A 4V1Ap 1VF2A 1V2AA 1T00A 5JWOB 1Y25A 3VPTA 1FB6A 3UOMA 3HA9A 2YANA 4OO4A 4GQCA 4LMWA 1MEKA 3I69A 1F2EA 4ZBBA 1SENA 1G7OA 3KTBA 3LFLA 3PH9A 4Q5QA 3C1SA 5CRDA 3RHBA 5J4UA 1WJKA 1PGTA 3CBUA 2MZCA 2RLIA 1WIKA 1JHBA 1FAAA 2VIMA 4XTSA 3MNGA 2V41A 3IA1A 5ID2B 4E8HA 2B7KA 1ERUA 1PN9A 2FLSA 2WJUA 1PSQA 2GT5A 2LNSA 4K5SA 5HQPA 1BAYA 1Z3EA 5B8AA 2H0HA 3VI7A 1WOUA 2QGVA 4XCSA 2X99A 2GDRA 3D4MA 4NWYA 2EIQA 3GRXA 2ALBA 4K2XA 5D9VA 4G0KA 1GTUA 2L6DA 3G9BA 1ACVA 1GH2A 4KDYA 3D5JA 1VGLA 4A5PA 2YCDA 1W4VA 2DIZA 1QK8A 3WD6A 2FGXA 3A2WA 5LD0A 4G0LA 1V9WA 2VCWA 4ECCA 1XOAA 2JZRA 3TUEA 3UVTA 3PR8A 4K9ZA 4K7IA 4YKFA 4BVYA 2WGRA 2IN3A 5JCUA 4ML6A 3WYWA 2ZUPA 2DIYA 3IOSA 1QFNA 2GTUA 3KM6A 2GQLA 3HHVA 4EF0A 2FA8A 4TR3A 3M8NA 2KUCA 3J7Yb 3LWAA 5L71A 3CXGA 2CVDA 1X0RA 2A4HA 3KP9A 2LNTA 1Q98A 2JSYA 4WR5A 1JLVA 3IXRA 4HJ2A 5IMVA 1GTAA 3R3EA 3DGQA 5ECQB 4OD7A 1GSSA 4GRFA 1F37A 4N30A 3TKSC 2H72A 1VRSD 5INYA 3ISOA 4I6XA 2RUFA 2AHEA 4PNFA 1XOBA 2PERA 2VL2C 1O8XA 4ULXA 1WP0A 3KD0A 1OVNA 4Z2RA 2NPBA 1CQHA 3GKMA 4P3YB 1R5PA 4F03A 1A2JA 1XVQA 3D22A 4GWRA 3M3MA 3FR3A 2IMFA 5AN1A 5ECIB 5DALB 5COHA 3ZVJD 4POLA 1VF4A 2JACA 1EWXA 1R7HA 2CVKA 4EXJA 3GKNA 2E0QA 1GTBA 4NMUA 1BG5A 3MYDA 2PN8A 3JCML 2H71A 5FHIA 1XWCA 3BJ5A 1U6TA 1X5DA 5CREA 1GLQA 3L9VA 4HZ2A 2CQ9A 4G10A 1USBA 2VAFA 4KGIA 1F6MC 3QPMA 4CY6A 3C73A 3GH9A 2DSAA 3TB2A 3HYPA 4JR4A 2XPDA 4POMA 4ZB8A 2J9HA 1N8JA 1NHOA 2O89A 2GSTA 4TXOA 2PWJA 1U87A 1URMA 3CTGA 1EEJA 4I5QA 3IR4A 1UC7A 5ECLB 12GSA 2LV3A 1X9WB 4FYCA 2X8HA 1Z7PA 3W8JA 3D6IA 3HZ4A 4POBA 3E9JB 4O5UA 3LW9A 4XHMA 2B5XA 3I43A 2HNLA 2H74A 2K8VA 3QDNA 4IQ1A 3US3A 1Z5YE 5IO2A 2C4JA 4JRRA 2OKAA 2RM5A 4HOJA 1G7EA 3R2QA 3VPQA 4BVXB 4YAPA 4MF6A 2YOIA 4GQFA 5IOXA 2N5AA 3ZMLA 5G31A 4ACSA 4FIWA 4J56E 1ZGNA 3A5IA 3HZ8A 5EPFA 1YQ1A 1A23A 3NZNA 5ECOB 2NBSA 2XC2A 4WBJA 3QCPA 4HEA2 5ID2A 4JBBA 2DKHA 4L0WA 2XBQA 4K6XA 2YWIA 2VUPA 4KSOA 5ECSA 4MJEA 3H8QA 3VURA 1YEPA 1YKCA 4NHWA 5IPHA 3IBHA 1ERTA 2H30A 2OACA 4GSSA 1X5CA 3GX0A 2CAIA 1YJ6A 4KNDA 5ENUA 1T3BA 3U6VA 1SD8A 1HNBA 2HZEA 4MABA 3IDVA 3LXTA 1W89A 1F3BA 4YH2A 5KEJA 4K0GA 1AUCA 2B6MA 4YAVA 4IJIA 5GZZB 1QGVA 1A8LA 3GKXA 2HZFA 1SL1B 1B8XA 4PUFC 3VK9A 4OFNA 4PURA 1X9MB 2E2MA 4MJAA 2B3SA 2H6YA 3GIXA 2YJHA 1SK2A 1TI1A 3FW2A 3QAWA 4GSTA 2DJJA 1EP8A 3KTLA 1JZWA 4BVYB 4ZL9A 2CVBA 5F06A 6GSWA 2DJ3A 1ZYQB 1RW1A 3FZ5A 5JWRB 1B4QA 3F4RA 2IIYA 3IHQA 3P8WA 3IK7A 3ZFLA 2V32A 2JADA 1SYXA 2KHPA 2HLSA 4I97A 2JZSA 4L0UA 2OE1A 1ERWA 1A8YA 3FK8A 2R2JA 2LRTA 1AW9A 3BCKA 2H01A 1XW5A 2HRKA 3F8UA 4I2TA 5C00A 3LYKA 1S3CA 2YWMA 1YKAA 1TTZA 5FWGA 4EVMA 3W8SA 1C72A 4BWSA 2H1AA 2P5RA 1AQXA 2JU5A 4AJ7A 4AJ6A 4Q5FA 1OKDA 1GULA 3RPNA 3DEXA 5CAXA 5J5NA 3F3RA 3KH9A 2WRTA 2C3QA 3DWVA 4PUAA 3F63A 3UEMA 2YJ7A 5C04A 3KJYA 2GSQA 4V2LA 3AY8A 2XPEA 3G7YA 1EZKA 6GSTA 4HU9A 3TOTA 3TGZA 2QC7A 4LA1A 5KN1A 1K0MA 3MIXA 5HFGA 1UN2A 4MZCA 5ELAA 1BYEA 3APOA 1U3IA 5F0GA 2PMTA 1Z6NA 1KTEA 5BRTA 1M99A 1YF0A 4IQAA 5AISA 3CMIA 3M1GA 2F8AA 2I3YA 1O81A 3ZITA 1M9BA 2A2SA 2C0GA 2LTKA 1GLPA 1NW2A 2V6OA 4CY8A 5DJMA 1FG4A 4FO5A 4KDXA 2VLUA 5A4UA 1OE7A 2FWGA 22GSA 1EEMA 2L57A 4G19A 1XWKA 1WE0A 3GA4A 4EDYA 3GFKA 5HFIA 3I9V2 3TDGA 1YY7A 5EL8A 2L4CA 3N9JA 2MBSA 4DSSA 1EP7A 4RQRA 5D9TA 2K8SA 1YZXA 2XBIA 3PINA 1GSEA 3KEBA 1TP9A 2P31A 1E2YA 4N11A 3A3TA 4HUAA 4TXOB 5FT3A 1M9AA 3TJKA 5IMFA 4WF5A 4EO3A 1K3LA 4ML1A 3GNJA 17GSA 2QSIA 1OAZA 1YDKA 5LCZA 1T8EB 4MH3A 2OBKA 3ZZXA 1SKRB 7GSSA 2LSTA 2CT6A 4CHSA 2E7PA 4TRXA 3ERGA 4K1FA 3QAVA 2AB6A 1EOGA 1GSDA 3KXOA 2H0GA 2E2GA 2ON5A 1I5GA 4MPGA 1PN0A 3C7MA 5EVOA 3TKQA 1TJDA 4BVXA 4WR4A 3FEUA 1K0DA 4O5RA 3TRPA 4HQSA 4LLRA 1XPVA 3ZFBA 1SJZA 3WGEA 3HJMA 1U88A 4O7HA 3HCZA 2X8GA 3PGTA 5DAKB 4BA7A 2HSHA 2OA7A 2IPAA 1DUGA 1V57A 2YP6A 4IKHA 1H75A 1SK1A 3WT1A 4AF2A 2C0FA 2JL4A 3ERWA 2CA8A 4NAXA 1QMVA 1OC9A 2JZTA 2IMKA 1TK0B 2G2QA 3U5RE 5D8IA 3ZIJA 5KOXA 3TRXA 2LJKA 3KMNA 2IFQA 5ECNB 4OWYA 3RDWA 4PNGA 3FZ4A 2N5FA 3UAPA 1OC8A 2FWEA 1FOHA 2HZEB 3ZL5A 4TR1B 1TRUA 4FYUA 3C8EA 2UZ8A 4GXZA 2B1KA 1SKSB 4V2MA 2KOKA 1ZCPA 1K0OA 2TRXA 3LYPA 5CYYA 2HT9A 1H4OA 4ZIJA 2I9HA 2R6KA 1EGRA 10GSA 4MH2A 3GTUA 2BTOT 1SD9A 3QOUA 4O92A 1GP1A 4F0BA 5B8BA 3EU3A 4MLYA 2A2RA 3QFAC 3GUSA 3EPTA 4MK3A 5G5EA 1E6BA 3EC3A 4HQZA 2H1DA 2GZZA 1K0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X9S B;  2F9S A;  3H79 A;  2ES7 A;  3L0H A;  3QAG A;  3F3Q A;  3GN3 A;  5A5K A;  4JU5 A;  4I2U A;  1O8W A;  4AJ8 A;  1EGO A;  2DJ0 A;  5IIZ A;  3N5O A;  4EC0 A;  4LL4 B;  2CV4 A;  4F82 A;  1K0N A;  1ST9 A;  3F9U A;  3GYK A;  3TCO A;  1V40 A;  1K0A A;  3A2V A;  4DSR A;  4JZQ A;  4RUV A;  5JCG A;  3EMP A;  1FO5 A;  3G7J A;  2L5O A;  1TK8 B;  3QMX A;  4PQI A;  2F51 A;  2R5G A;  1Z6M A;  3HD5 A;  2CZ3 A;  3DVW A;  3BBY A;  5F05 A;  2DLX A;  3GL5 A;  2KP2 A;  2HFD A;  5IMD A;  3FZ9 A;  4IP6 A;  2PVO C;  4KAE A;  1TRS A;  5G2Z A;  2AAW A;  4PGT A;  1DE1 A;  3ZRD A;  1KEB A;  2VCZ A;  3LEF A;  3KGK A;  3IV4 A;  4EL1 A;  2YWN A;  2PVQ A;  1WMJ A;  4MJB A;  3FZA A;  2FHE A;  1JLW A;  5J41 A;  3E3E A;  4DSS B;  4QL9 A;  5G5F A;  2ON7 A;  4HJM A;  1XVW A;  1SU9 A;  1VF3 A;  2NVL A;  4MF5 A;  3Q19 A;  1SKW B;  1MDI A;  5J3R A;  1M0U A;  3E0U A;  3GHA A;  1Z7R A;  4OCE A;  3ERF A;  4POK A;  1Y6E A;  2GZP A;  3L9S A;  4Q5N A;  3RBT A;  4V2N A;  1HNC A;  4G2E A;  2FUG 2;  2FA4 A;  5H5R A;  2R4V A;  2GZY A;  1EV4 A;  1I9D A;  2Z9S A;  5H5S A;  2YV7 A;  4MPF A;  4KSM A;  2VM1 A;  2O8V B;  2WFC A;  1YF1 A;  5CP1 A;  3IAM 2;  4D73 A;  3RHC A;  2H66 A;  1M2D A;  1T4Y A;  5D9X A;  5AIV A;  2NTO A;  1SL2 B;  1ILO A;  4J57 E;  1ZL9 A;  1HYU A;  5DAK A;  4QQ7 A;  3RPP A;  2TRC P;  4XS1 A;  1PX7 A;  1SJ6 A;  2XHF A;  3GX8 A;  4ZL8 A;  1G6W A;  2LQQ A;  2L4Q A;  3GH6 A;  4EDZ A;  1RQM A;  1Z9H A;  2FWH A;  2V6K A;  5KN2 A;  5IPG A;  5G1K A;  1XWB A;  4MF7 A;  1TU8 A;  5DJL A;  4ILF A;  1ML6 A;  3K8N A;  1TI3 A;  2RII A;  1OC9 B;  2OAD A;  2IMI A;  2LUS A;  3DD3 A;  5B6M A;  3F6D A;  4PX1 A;  1MD4 A;  3DXB A;  2IFQ B;  1BQ7 A;  1KBN A;  1PMT A;  2VCV A;  4O32 A;  2GGT A;  3HVS A;  4TR1 A;  4ISD A;  4MA9 A;  5GST A;  1QUW A;  3NOF A;  2YWO A;  13GS A;  2KLX A;  3SWL A;  2REM A;  1JZO A;  1XBS A;  1ZZY A;  2H75 A;  4RI6 A;  2ZCT A;  1FHE A;  5ECR B;  3HKR A;  3L78 A;  2WZ9 A;  3O6T A;  4E8E A;  5AGY A;  3O76 A;  4DVC A;  3IRA A;  1TDI A;  2GLR A;  1JZR A;  5DCG A;  5H5Q A;  3WT2 A;  3EYT A;  2HXK A;  2BJX A;  5D96 A;  3GTU B;  4WXT A;  3VWU A;  3IC4 A;  2MMN A;  5JWQ B;  2C0E A;  4WKW A;  1T4Z A;  3DIE A;  2GS3 A;  4IP1 A;  1UVZ A;  3IE3 A;  1FW1 A;  3GSS A;  3MWH A;  3M9K A;  1TK5 B;  1FB0 A;  4IGJ A;  3DRN A;  2KP1 A;  3IK9 A;  1BX9 A;  3QR6 A;  1A0R P;  3Q18 A;  1PRX A;  4TR0 A;  1HD2 A;  4FH8 A;  2MMA A;  2B7J A;  2AV4 A;  1B48 A;  3O3T A;  2DC5 A;  3ZTL A;  1JFU A;  5GAP D;  4YQU A;  2K9F A;  3TKS A;  5CRH A;  18GS A;  2O87 A;  4BL7 A;  3DKS A;  3D4T A;  2VCX A;  3QD9 A;  1QXH A;  4TVE A;  2VL2 A;  4MJC A;  3UBL A;  2HRN A;  4OMV A;  1V58 A;  1LU4 A;  2C8U A;  1AC1 A;  4V1A g;  4IN0 A;  1GUK A;  3VLN A;  4RI7 A;  5A4V A;  1OC3 A;  2CX3 A;  3ZLP A;  2WS2 A;  2RM6 A;  2L5L A;  1NM3 A;  3FHK A;  4IJ3 A;  5DQY A;  2HRF A;  1TOF A;  4GTU A;  1WWJ A;  11GS A;  2VOC A;  4TW5 A;  3ED3 A;  5F8B A;  3QFB C;  4X1U A;  4F0C A;  2I1U A;  3P2A A;  3ME8 A;  1O7U A;  1O6J A;  16GS A;  4XRA A;  1J08 A;  1F9M A;  1A2M A;  3ZIV A;  3CSJ A;  3EMX A;  5ECH B;  3L9U A;  3BOA A;  3CSI A;  2FD3 A;  5D9W A;  1UA5 A;  1SYR A;  5GSS A;  2DJK A;  5DDL A;  1XZO A;  1N2A A;  3P90 A;  4ZB9 A;  1MD3 A;  5ELG A;  1R4W A;  3GST A;  4KCA A;  5E59 A;  2IMD A;  2X64 A;  2H70 A;  2IJY A;  3H93 A;  1J9B A;  5G30 A;  5A4W A;  2HE3 A;  5HR1 A;  2GT6 A;  2IME A;  1OYJ A;  3UIW A;  3LQ7 A;  2GSS A;  2X8C A;  2H73 A;  4ZB6 A;  1HQO A;  2H1B A;  1O85 A;  1B9X C;  1NSW A;  4L8E A;  4WEY A;  2DML A;  2I81 A;  2YPM A;  5CNW A;  1G0T A;  2P5Q A;  5IMA A;  1ZMA A;  3CTF A;  4D73 B;  4K0N A;  1TW9 A;  1U3A A;  4EE0 A;  3D21 A;  3VWX A;  2OE3 A;  2VO4 A;  4K2D A;  1A2L A;  3MDK A;  1GNW A;  1X5E A;  2VLV A;  5LNK e;  1ABA A;  4HZ4 A;  4F9Z A;  2LJA A;  2EC4 A;  3ZMK A;  1JZD A;  2I4A A;  4NV2 A;  4JR6 A;  3IAS 2;  4TOP A;  4KA0 A;  1G6Y A;  5IM9 A;  4Q5R A;  1LJR A;  4XS4 A;  9GSS A;  2G0F A;  20GS A;  4NHZ A;  1MTC A;  1AQV A;  1K3Y A;  2R3X A;  4ZL7 A;  2GQK A;  4MCU A;  4EUY A;  4GCI A;  4OFT A;  3EWL A;  1NHY A;  4TKY A;  1AAZ A;  1T7P B;  3C71 A;  5JCW A;  5B6N A;  4HI7 A;  1TRW A;  5IO0 A;  2DMM A;  3UJ1 A;  1AIU A;  3LGC A;  5F07 A;  3KP8 A;  4N0Z A;  2LQO A;  3GV1 A;  3M9J A;  2YNX A;  2CZ2 A;  2NDO A;  1MDJ A;  3APQ A;  3F4T A;  4MMM A;  4DSQ A;  5HFK A;  2M46 A;  4RQX A;  1XCC A;  4ECB A;  3CYN A;  2EIR A;  2OJL A;  2IWT A;  1XFL A;  1V98 A;  1GSU A;  2WCI A;  5DVB A;  2WUL A;  3P7X A;  3KCM A;  5IMZ A;  1A0F A;  3FRC A;  1RK4 A;  4KDU A;  3BCI A;  2H6X A;  2F3M A;  3MAK A;  2C3N A;  6GSY A;  3G7I A;  3OR5 A;  2LEG A;  4OO5 A;  1Q4J A;  3TKP A;  3VFI A;  4JED A;  4ID0 A;  8GSS A;  2GSR A;  2ZNM A;  1TU7 A;  3TJB A;  2V2G A;  5CRW A;  1GSY A;  3VWV A;  1PL1 A;  3I6A A;  3APS A;  4L5O A;  2FY6 A;  2LRN A;  1TKD B;  1CQG A;  5EY6 A;  2AUV A;  2V1M A;  4KB3 A;  1XW9 A;  5J9C A;  3MSZ A;  2TIR A;  5IMC A;  1K0B A;  4BPY A;  1LBK A;  2EIO A;  3W6G A;  1GSF A;  3WGD A;  2MMZ A;  2HYX A;  2GQM A;  4EKZ A;  5ECK B;  4KCE A;  6GSX A;  4OCF A;  1GUH A;  6GSV A;  2RUE A;  4JE1 A;  3UMA A;  1A24 A;  1HNA A;  1GSQ A;  3UBK A;  4WET A;  1GRX A;  4KE3 A;  1YEX A;  2B1L A;  3TJG A;  4MZW A;  4N0V A;  2H19 A;  4KW6 A;  3EE2 A;  2DJ1 A;  1SK0 A;  1J0F A;  5DCH A;  2P0G A;  5B7C A;  2JSZ A;  4TN8 A;  2PUK C;  5G1L A;  2B5Y A;  2FWF A;  3Q6O A;  3C1R A;  2WDU A;  2L59 A;  4PQ1 A;  3V1W A;  2K18 A;  5J9B A;  4IEL A;  1O73 A;  2H76 A;  3LOR A;  3UAR A;  2YV9 A;  4ZIL A;  1WPI A;  2QKE A;  3KZQ A;  2VD1 A;  2MBT A;  1OE8 A;  3KIJ A;  3UVH A;  5CRG A;  4MZB A;  1XXU A;  3M0F A;  3DYR A;  2YZH A;  2M80 A;  4LMV A;  1B9Y C;  4HDE A;  3H1N A;  1SL0 B;  2R37 A;  1EOH A;  4KUN A;  1GTI A;  3HJO A;  2O7K A;  2H6Z A;  4IVF A;  3F6F A;  2LJR A;  1R26 A;  4X0X A;  3GUR A;  5CO3 A;  3WGX A;  2OBI A;  4GF0 A;  2PPT A;  2MMO A;  4XS6 A;  2DJ2 A;  4XIH A;  4OFM A;  4YQV A;  3TKR A;  3CRU A;  2DBC A;  3HXS A;  3ME7 A;  4MDC A;  1M7T A;  4XRD A;  4Z7X A;  4CDO A;  2LRC A;  2L6C A;  5D73 A;  2BMX A;  4ECI A;  2HSY A;  3Q74 A;  4XS4 B;  5KN0 A;  2C3T A;  2VCT A;  4IHU A;  4PXO A;  3NIV A;  3GKK A;  1BED A;  4K8M A;  3VWW A;  4TXV A;  1XIY A;  3LJR A;  3DML A;  1EV9 A;  4NV5 A;  1THO A;  5GAN D;  5E4W A;  3GL3 A;  4WF4 A;  3ZYW A;  2D2Z A;  4K7N A;  4HS1 A;  1S3A A;  1XWA A;  3J7Y k;  2VCQ A;  1GNE A;  3F4S A;  1TRV A;  4ZXG A;  3KH7 A;  4IS0 A;  3ZVJ A;  1FVK A;  3HVX A;  3HJP A;  1FVJ A;  4KH7 A;  1AQW A;  2N5B A;  4L5L A;  3FR9 A;  1IYH A;  2C0D A;  1OKT A;  5ECM B;  2LKU A;  3FY7 A;  2VL3 A;  3TRQ A;  1SJI A;  3D0Z A;  1PQN A;  4F2I A;  1VF1 A;  4GLT A;  4QL7 A;  4ZBD A;  5IOW A;  1WRY A;  1B4P A;  4IBP A;  3FKF A;  1ERV A;  1IYI A;  3TJF A;  1M2A A;  3CRT A;  6GSU A;  3KMO A;  3EVI A;  1K3O A;  4YQM A;  1R5A A;  3FR6 A;  5D93 A;  4BWQ A;  2VD0 A;  2A4V A;  4N10 A;  1DE2 A;  3S9F A;  4I8B A;  1KNG A;  1XW6 A;  4HU7 A;  1ON4 A;  2VL9 A;  3LSZ A;  2FNO A;  4NXI A;  3UL3 A;  6GSS A;  3TJJ A;  3HVV A;  3EU4 A;  1PL2 A;  1QQ2 A;  5ECP B;  14GS A;  4TR4 A;  4FYB A;  3RAZ A;  2OE0 A;  2MYG A;  5HR3 A;  2GVP A;  5KN3 A;  2CX4 A;  2H8L A;  3F0I A;  5DAL A;  1S3D A;  4IW9 A;  2C80 A;  2CAQ A;  4LL1 B;  1PKZ A;  4J2F A;  4KX4 A;  1DBY A;  1PKW A;  1T1V A;  2IL3 A;  5DBQ A;  5DQS A;  4WBR D;  2AJQ B;  4CW9 A;  2VLT A;  1TXX A;  2FCH A;  1F3A A;  2HI7 A;  2M72 A;  1M2B A;  5IQY A;  4DEJ A;  1BJX A;  5AIX A;  2PGT A;  1XWG A;  3IPZ A;  3FYG A;  2AYT A;  4H86 A;  3LXZ A;  3BD2 A;  3VI5 A;  1GL8 A;  4PQH A;  4X43 A;  1ZOF A;  3CSH A;  3A5W A;  3TKS E;  5ABR A;  2O85 A;  3DVX A;  3L4N A;  1DSB A;  2WB9 A;  4AGS A;  2J23 A;  2YZU A;  2H1G A;  2K6V A;  1AXD A;  1PA3 A;  4G9H A;  2VM2 A;  1THX A;  1FOV A;  1ZYE A;  3ZRE A;  2F8F A;  3H4K A;  2PBJ A;  1PX6 A;  4NPB A;  4ECJ A;  3EUR A;  3A2X A;  1PD2 1;  4ZBA A;  2YN1 A;  2H0I A;  3LG6 A;  2LS5 A;  3EIN A;  4K7O A;  4GSN A;  3SBC A;  19GS A;  1GWC A;  3GMF A;  1MDK A;  2C1Y A;  4MP4 A;  3HY2 A;  2PU9 C;  3HDC A;  2B5E A;  1GUM A;  5HR0 A;  3TOU A;  5HR2 A;  4V1A p;  1VF2 A;  1V2A A;  1T00 A;  5JWO B;  1Y25 A;  3VPT A;  1FB6 A;  3UOM A;  3HA9 A;  2YAN A;  4OO4 A;  4GQC A;  4LMW A;  1MEK A;  3I69 A;  1F2E A;  4ZBB A;  1SEN A;  1G7O A;  3KTB A;  3LFL A;  3PH9 A;  4Q5Q A;  3C1S A;  5CRD A;  3RHB A;  5J4U A;  1WJK A;  1PGT A;  3CBU A;  2MZC A;  2RLI A;  1WIK A;  1JHB A;  1FAA A;  2VIM A;  4XTS A;  3MNG A;  2V41 A;  3IA1 A;  5ID2 B;  4E8H A;  2B7K A;  1ERU A;  1PN9 A;  2FLS A;  2WJU A;  1PSQ A;  2GT5 A;  2LNS A;  5HQP A;  1BAY A;  1Z3E A;  5B8A A;  2H0H A;  3VI7 A;  1WOU A;  2QGV A;  4XCS A;  2X99 A;  2GDR A;  3D4M A;  4NWY A;  2EIQ A;  3GRX A;  2ALB A;  5D9V A;  1GTU A;  2L6D A;  3G9B A;  1ACV A;  1GH2 A;  4KDY A;  3D5J A;  1VGL A;  2YCD A;  1W4V A;  2DIZ A;  1QK8 A;  3WD6 A;  2FGX A;  3A2W A;  5LD0 A;  1V9W A;  2VCW A;  4ECC A;  1XOA A;  2JZR A;  3TUE A;  3UVT A;  3PR8 A;  4K9Z A;  4K7I A;  4BVY A;  2WGR A;  2IN3 A;  5JCU A;  4ML6 A;  3WYW A;  2ZUP A;  2DIY A;  3IOS A;  1QFN A;  2GTU A;  3KM6 A;  2GQL A;  3HHV A;  4EF0 A;  2FA8 A;  4TR3 A;  3M8N A;  2KUC A;  3J7Y b;  3LWA A;  5L71 A;  3CXG A;  2CVD A;  1X0R A;  3KP9 A;  2LNT A;  1Q98 A;  2JSY A;  4WR5 A;  1JLV A;  3IXR A;  4HJ2 A;  5IMV A;  1GTA A;  3DGQ A;  5ECQ B;  4OD7 A;  1GSS A;  4GRF A;  1F37 A;  4N30 A;  3TKS C;  2H72 A;  1VRS D;  5INY A;  3ISO A;  4I6X A;  2RUF A;  2AHE A;  4PNF A;  1XOB A;  2PER A;  2VL2 C;  1O8X A;  4ULX A;  1WP0 A;  3KD0 A;  1OVN A;  2NPB A;  1CQH A;  3GKM A;  4P3Y B;  1R5P A;  4F03 A;  1A2J A;  1XVQ A;  3D22 A;  4GWR A;  3M3M A;  3FR3 A;  2IMF A;  5AN1 A;  5ECI B;  5DAL B;  5COH A;  3ZVJ D;  4POL A;  1VF4 A;  2JAC A;  1EWX A;  1R7H A;  2CVK A;  4EXJ A;  3GKN A;  2E0Q A;  1GTB A;  4NMU A;  1BG5 A;  2PN8 A;  3JCM L;  2H71 A;  5FHI A;  1XWC A;  3BJ5 A;  1U6T A;  1X5D A;  5CRE A;  1GLQ A;  3L9V A;  4HZ2 A;  2CQ9 A;  4G10 A;  1USB A;  2VAF A;  4KGI A;  1F6M C;  3QPM A;  3C73 A;  3GH9 A;  2DSA A;  3TB2 A;  3HYP A;  4JR4 A;  2XPD A;  4POM A;  4ZB8 A;  2J9H A;  1N8J A;  1NHO A;  2O89 A;  2GST A;  4TXO A;  2PWJ A;  1U87 A;  1URM A;  3CTG A;  1EEJ A;  4I5Q A;  3IR4 A;  1UC7 A;  5ECL B;  12GS A;  2LV3 A;  1X9W B;  4FYC A;  2X8H A;  1Z7P A;  3W8J A;  3D6I A;  3HZ4 A;  4POB A;  3E9J B;  4XHM A;  2B5X A;  3I43 A;  2HNL A;  2H74 A;  2K8V A;  3QDN A;  4IQ1 A;  3US3 A;  1Z5Y E;  5IO2 A;  2C4J A;  4JRR A;  2OKA A;  2RM5 A;  4HOJ A;  1G7E A;  3R2Q A;  3VPQ A;  4YAP A;  4MF6 A;  2YOI A;  4GQF A;  5IOX A;  2N5A A;  3ZML A;  5G31 A;  4ACS A;  4FIW A;  4J56 E;  1ZGN A;  3HZ8 A;  5EPF A;  1YQ1 A;  1A23 A;  3NZN A;  5ECO B;  2NBS A;  2XC2 A;  4WBJ A;  3QCP A;  4HEA 2;  5ID2 A;  4JBB A;  4L0W A;  2XBQ A;  4K6X A;  2YWI A;  2VUP A;  4KSO A;  5ECS A;  4MJE A;  3H8Q A;  3VUR A;  1YEP A;  1YKC A;  4NHW A;  5IPH A;  3IBH A;  1ERT A;  2H30 A;  2OAC A;  4GSS A;  1X5C A;  3GX0 A;  2CAI A;  1YJ6 A;  4KND A;  5ENU A;  1T3B A;  3U6V A;  1SD8 A;  1HNB A;  2HZE A;  4MAB A;  3IDV A;  3LXT A;  1W89 A;  1F3B A;  4YH2 A;  5KEJ A;  4K0G A;  1AUC A;  2B6M A;  4YAV A;  4IJI A;  5GZZ B;  1QGV A;  1A8L A;  3GKX A;  2HZF A;  1SL1 B;  1B8X A;  4PUF C;  3VK9 A;  4OFN A;  4PUR A;  1X9M B;  2E2M A;  4MJA A;  2B3S A;  2H6Y A;  3GIX A;  2YJH A;  1SK2 A;  1TI1 A;  3FW2 A;  3QAW A;  4GST A;  2DJJ A;  1EP8 A;  3KTL A;  1JZW A;  4ZL9 A;  2CVB A;  5F06 A;  6GSW A;  2DJ3 A;  1ZYQ B;  1RW1 A;  3FZ5 A;  5JWR B;  1B4Q A;  3F4R A;  2IIY A;  3IHQ A;  3P8W A;  3IK7 A;  3ZFL A;  2V32 A;  2JAD A;  1SYX A;  2KHP A;  2HLS A;  4I97 A;  2JZS A;  4L0U A;  2OE1 A;  1ERW A;  1A8Y A;  3FK8 A;  2R2J A;  2LRT A;  1AW9 A;  3BCK A;  2H01 A;  1XW5 A;  3F8U A;  4I2T A;  5C00 A;  3LYK A;  1S3C A;  2YWM A;  1YKA A;  1TTZ A;  5FWG A;  4EVM A;  3W8S A;  1C72 A;  4BWS A;  2H1A A;  2P5R A;  1AQX A;  2JU5 A;  4AJ7 A;  4AJ6 A;  4Q5F A;  1OKD A;  1GUL A;  3RPN A;  3DEX A;  5CAX A;  5J5N A;  3F3R A;  3KH9 A;  2WRT A;  2C3Q A;  3DWV A;  4PUA A;  3F63 A;  3UEM A;  2YJ7 A;  5C04 A;  3KJY A;  2GSQ A;  4V2L A;  3AY8 A;  2XPE A;  3G7Y A;  1EZK A;  6GST A;  4HU9 A;  3TOT A;  3TGZ A;  2QC7 A;  4LA1 A;  5KN1 A;  1K0M A;  5HFG A;  1UN2 A;  4MZC A;  5ELA A;  1BYE A;  3APO A;  1U3I A;  5F0G A;  2PMT A;  1Z6N A;  1KTE A;  1M99 A;  1YF0 A;  4IQA A;  5AIS A;  3CMI A;  3M1G A;  2F8A A;  2I3Y A;  1O81 A;  3ZIT A;  1M9B A;  2A2S A;  2C0G A;  2LTK A;  1GLP A;  1NW2 A;  2V6O A;  5DJM A;  1FG4 A;  4FO5 A;  4KDX A;  2VLU A;  5A4U A;  1OE7 A;  2FWG A;  22GS A;  1EEM A;  2L57 A;  4G19 A;  1XWK A;  1WE0 A;  3GA4 A;  4EDY A;  3GFK A;  5HFI A;  3I9V 2;  3TDG A;  1YY7 A;  5EL8 A;  2L4C A;  3N9J A;  2MBS A;  4DSS A;  1EP7 A;  4RQR A;  5D9T A;  2K8S A;  1YZX A;  2XBI A;  3PIN A;  1GSE A;  3KEB A;  1TP9 A;  2P31 A;  1E2Y A;  4N11 A;  3A3T A;  4HUA A;  4TXO B;  5FT3 A;  1M9A A;  3TJK A;  5IMF A;  4WF5 A;  4EO3 A;  1K3L A;  4ML1 A;  3GNJ A;  17GS A;  2QSI A;  1OAZ A;  1YDK A;  5LCZ A;  1T8E B;  4MH3 A;  2OBK A;  3ZZX A;  1SKR B;  7GSS A;  2LST A;  2CT6 A;  4CHS A;  2E7P A;  4TRX A;  3ERG A;  4K1F A;  3QAV A;  2AB6 A;  1EOG A;  1GSD A;  3KXO A;  2H0G A;  2E2G A;  2ON5 A;  1I5G A;  4MPG A;  3C7M A;  5EVO A;  3TKQ A;  1TJD A;  4BVX A;  4WR4 A;  3FEU A;  1K0D A;  4O5R A;  3TRP A;  4HQS A;  4LLR A;  1XPV A;  3ZFB A;  1SJZ A;  3WGE A;  3HJM A;  1U88 A;  4O7H A;  3HCZ A;  2X8G A;  3PGT A;  5DAK B;  4BA7 A;  2HSH A;  2OA7 A;  2IPA A;  1DUG A;  1V57 A;  2YP6 A;  4IKH A;  1H75 A;  1SK1 A;  3WT1 A;  4AF2 A;  2C0F A;  2JL4 A;  3ERW A;  2CA8 A;  4NAX A;  1QMV A;  1OC9 A;  2JZT A;  2IMK A;  1TK0 B;  2G2Q A;  3U5R E;  5D8I A;  3ZIJ A;  3TRX A;  2LJK A;  3KMN A;  2IFQ A;  5ECN B;  4OWY A;  3RDW A;  4PNG A;  3FZ4 A;  2N5F A;  3UAP A;  1OC8 A;  2FWE A;  2HZE B;  3ZL5 A;  4TR1 B;  1TRU A;  4FYU A;  3C8E A;  4GXZ A;  2B1K A;  1SKS B;  4V2M A;  2KOK A;  1ZCP A;  1K0O A;  2TRX A;  3LYP A;  5CYY A;  2HT9 A;  1H4O A;  4ZIJ A;  2I9H A;  2R6K A;  1EGR A;  10GS A;  4MH2 A;  3GTU A;  2BTO T;  1SD9 A;  3QOU A;  4O92 A;  1GP1 A;  4F0B A;  5B8B A;  3EU3 A;  4MLY A;  2A2R A;  3QFA C;  3GUS A;  4MK3 A;  5G5E A;  1E6B A;  3EC3 A;  4HQZ A;  2H1D A;  2GZZ A;  1K0C A; 
#chains in the Genus database with same CATH topology
 1X9S B;  2F9S A;  3H79 A;  2ES7 A;  3L0H A;  3QAG A;  3F3Q A;  3GN3 A;  5A5K A;  1XG8 A;  5BMU A;  4JU5 A;  4I2U A;  1O8W A;  4AJ8 A;  1EGO A;  2DJ0 A;  5IIZ A;  3N5O A;  4EC0 A;  4LL4 B;  2CV4 A;  4F82 A;  1K0N A;  1ST9 A;  3F9U A;  3GYK A;  3TCO A;  1V40 A;  1K0A A;  3A2V A;  2HSM A;  4DSR A;  4JZQ A;  4RUV A;  5JCG A;  3EMP A;  1FO5 A;  3G7J A;  2L5O A;  1TK8 B;  3QMX A;  4PQI A;  2F51 A;  2R5G A;  1Z6M A;  3HD5 A;  2CZ3 A;  3DVW A;  3BBY A;  5F05 A;  2DLX A;  3GL5 A;  2KP2 A;  2HFD A;  5IMD A;  3FZ9 A;  4IP6 A;  2PVO C;  4KAE A;  1TRS A;  5G2Z A;  2AAW A;  4PGT A;  1DE1 A;  3ZRD A;  1KEB A;  2VCZ A;  3LEF A;  3KGK A;  3IV4 A;  4EL1 A;  2YWN A;  2PVQ A;  1WMJ A;  4MJB A;  3FZA A;  2FHE A;  1JLW A;  5J41 A;  3E3E A;  4DSS B;  4QL9 A;  3HVN A;  5G5F A;  2ON7 A;  4HJM A;  1XVW A;  1SU9 A;  1VF3 A;  2NVL A;  4MF5 A;  3Q19 A;  1SKW B;  1MDI A;  5J3R A;  1M0U A;  3E0U A;  3GHA A;  1Z7R A;  4OCE A;  3ERF A;  4POK A;  1Y6E A;  2GZP A;  3L9S A;  4Q5N A;  3RBT A;  4V2N A;  1HNC A;  4G2E A;  2FUG 2;  3FMW A;  2FA4 A;  5H5R A;  2R4V A;  2GZY A;  1EV4 A;  1I9D A;  2Z9S A;  5H5S A;  2YV7 A;  4MPF A;  4KSM A;  2VM1 A;  2O8V B;  2WFC A;  1YF1 A;  5CP1 A;  3IAM 2;  4D73 A;  3RHC A;  2H66 A;  1M2D A;  1T4Y A;  5D9X A;  5AIV A;  2NTO A;  1SL2 B;  1ILO A;  4J57 E;  1ZL9 A;  1HYU A;  5DAK A;  4QQ7 A;  3RPP A;  2TRC P;  4XS1 A;  1PX7 A;  1SJ6 A;  2XHF A;  3GX8 A;  4ZL8 A;  1G6W A;  2QA2 A;  2LQQ A;  2L4Q A;  3GH6 A;  4EDZ A;  1RQM A;  1Z9H A;  2FWH A;  2V6K A;  5KN2 A;  5IPG A;  5G1K A;  1XWB A;  4MF7 A;  1TU8 A;  5DJL A;  4ILF A;  1ML6 A;  3K8N A;  1TI3 A;  2RII A;  1OC9 B;  2OAD A;  2IMI A;  2LUS A;  3DD3 A;  5B6M A;  3F6D A;  4PX1 A;  1MD4 A;  3DXB A;  2IFQ B;  1BQ7 A;  1KBN A;  1PMT A;  2VCV A;  4O32 A;  1ZYN A;  2GGT A;  3HVS A;  4TR1 A;  4ISD A;  4MA9 A;  5GST A;  1QUW A;  3NOF A;  2YWO A;  13GS A;  2KLX A;  3SWL A;  2REM A;  1JZO A;  1XBS A;  1ZZY A;  2H75 A;  4RI6 A;  2ZCT A;  1FHE A;  5ECR B;  3HKR A;  3L78 A;  2WZ9 A;  3O6T A;  4E8E A;  5AGY A;  3IHG A;  4EIQ A;  3O76 A;  4DVC A;  3IRA A;  1TDI A;  2GLR A;  1JZR A;  5DCG A;  5H5Q A;  3WT2 A;  3EYT A;  2HXK A;  2BJX A;  5D96 A;  3GTU B;  4WXT A;  3VWU A;  3IC4 A;  2MMN A;  5JWQ B;  2C0E A;  4WKW A;  1T4Z A;  3DIE A;  2GS3 A;  4IP1 A;  1UVZ A;  3IE3 A;  1FW1 A;  3GSS A;  3MWH A;  3M9K A;  1TK5 B;  1FB0 A;  4IGJ A;  3DRN A;  2KP1 A;  3IK9 A;  1BX9 A;  3QR6 A;  1A0R P;  3Q18 A;  1PRX A;  4TR0 A;  1HD2 A;  4FH8 A;  2MMA A;  2B7J A;  2AV4 A;  4Z2U A;  1B48 A;  3O3T A;  1M3J A;  2DC5 A;  3ZTL A;  1JFU A;  5GAP D;  4YQU A;  2K9F A;  3TKS A;  5CRH A;  18GS A;  2O87 A;  4BL7 A;  3DKS A;  3D4T A;  2VCX A;  3QD9 A;  1QXH A;  4TVE A;  2VL2 A;  4MJC A;  3UBL A;  2HRN A;  4OMV A;  1V58 A;  1LU4 A;  2C8U A;  1AC1 A;  4O5Q A;  4V1A g;  4IN0 A;  1GUK A;  3IC8 A;  3VLN A;  4RI7 A;  5A4V A;  1OC3 A;  2CX3 A;  3ZLP A;  2WS2 A;  2RM6 A;  2L5L A;  1NM3 A;  3FHK A;  4IJ3 A;  5DQY A;  1ZYP A;  2HRF A;  1TOF A;  4GTU A;  1WWJ A;  11GS A;  2VOC A;  4TW5 A;  4FQU A;  3ED3 A;  5F8B A;  3QFB C;  4X1U A;  5KOW A;  4F0C A;  2A2P A;  2I1U A;  3P2A A;  2X49 A;  3ME8 A;  1O7U A;  1O6J A;  16GS A;  4XRA A;  1J08 A;  1F9M A;  1A2M A;  3ZIV A;  3CSJ A;  3EMX A;  5ECH B;  3L9U A;  3BOA A;  3CSI A;  2FD3 A;  5D9W A;  1UA5 A;  1SYR A;  5GSS A;  2DJK A;  5DDL A;  1XZO A;  1N2A A;  3P90 A;  4ZB9 A;  1MD3 A;  5ELG A;  1R4W A;  3GST A;  4KCA A;  5E59 A;  2R0C A;  2IMD A;  2X64 A;  2H70 A;  2IJY A;  2HRA A;  3H93 A;  1J9B A;  5G30 A;  5A4W A;  2HE3 A;  5HR1 A;  2GT6 A;  2IME A;  1OYJ A;  3UIW A;  3LQ7 A;  2GSS A;  2DKI A;  2X8C A;  2H73 A;  4ZB6 A;  1HQO A;  2H1B A;  1O85 A;  1B9X C;  1NSW A;  4L8E A;  4WEY A;  2DML A;  2I81 A;  2YPM A;  5CNW A;  1G0T A;  2P5Q A;  5IMA A;  1ZMA A;  3CTF A;  4D73 B;  4K0N A;  1TW9 A;  4KF9 A;  1U3A A;  4EE0 A;  3D21 A;  3VWX A;  2OE3 A;  2VO4 A;  4K2D A;  1A2L A;  3MDK A;  1GNW A;  1X5E A;  2VLV A;  5LNK e;  1ABA A;  4HZ4 A;  4F9Z A;  2LJA A;  2EC4 A;  3ZMK A;  1JZD A;  2I4A A;  4NV2 A;  4JR6 A;  3IAS 2;  4TOP A;  4KA0 A;  1G6Y A;  5IM9 A;  4Q5R A;  1LJR A;  4XS4 A;  9GSS A;  2G0F A;  20GS A;  4NHZ A;  4YKG A;  1MTC A;  1AQV A;  1K3Y A;  2R3X A;  4ZL7 A;  3PPU A;  2GQK A;  4MCU A;  4EUY A;  4GCI A;  4OFT A;  3EWL A;  1NHY A;  4TKY A;  1AAZ A;  1T7P B;  3C71 A;  5JCW A;  5B6N A;  4HI7 A;  1TRW A;  5IO0 A;  2DMM A;  3UJ1 A;  1AIU A;  3LGC A;  5F07 A;  3KP8 A;  4N0Z A;  2LQO A;  3GV1 A;  3M9J A;  2YNX A;  2CZ2 A;  2NDO A;  1MDJ A;  3APQ A;  3F4T A;  4MMM A;  4DSQ A;  5HFK A;  2M46 A;  4RQX A;  1XCC A;  4ECB A;  3CYN A;  2EIR A;  2OJL A;  2IWT A;  1XFL A;  1V98 A;  4Z2T A;  1GSU A;  2WCI A;  5DVB A;  2WUL A;  3P7X A;  3KCM A;  5IMZ A;  1A0F A;  3FRC A;  1RK4 A;  4KDU A;  3BCI A;  2H6X A;  2F3M A;  3MAK A;  2C3N A;  6GSY A;  3G7I A;  3OR5 A;  2LEG A;  4OO5 A;  1Q4J A;  3TKP A;  3VFI A;  4JED A;  4ID0 A;  8GSS A;  2GSR A;  2ZNM A;  1TU7 A;  3TJB A;  2V2G A;  5CRW A;  1GSY A;  2X4A A;  3VWV A;  1PL1 A;  4BL7 B;  3I6A A;  3APS A;  4L5O A;  2FY6 A;  2LRN A;  1TKD B;  1CQG A;  5EY6 A;  2AUV A;  2V1M A;  4KB3 A;  1XW9 A;  5J9C A;  3MSZ A;  2TIR A;  5IMC A;  1K0B A;  4BPY A;  1LBK A;  2EIO A;  3W6G A;  1GSF A;  2QA1 A;  3WGD A;  2MMZ A;  2HYX A;  2GQM A;  4EKZ A;  5ECK B;  4KCE A;  6GSX A;  4OCF A;  1GUH A;  6GSV A;  2RUE A;  4JE1 A;  3UMA A;  1A24 A;  4BIK A;  1HNA A;  1GSQ A;  3UBK A;  4WET A;  1GRX A;  4KE3 A;  1YEX A;  2B1L A;  3TJG A;  4MZW A;  4PTS A;  4N0V A;  2H19 A;  4KW6 A;  3EE2 A;  2DJ1 A;  1SK0 A;  1J0F A;  5DCH A;  2P0G A;  5B7C A;  2JSZ A;  4TN8 A;  2PUK C;  5G1L A;  2B5Y A;  2FWF A;  3Q6O A;  3C1R A;  2WDU A;  2L59 A;  4PQ1 A;  3V1W A;  2K18 A;  5J9B A;  4IEL A;  1O73 A;  2H76 A;  3LOR A;  3UAR A;  2YV9 A;  4ZIL A;  1WPI A;  2QKE A;  3KZQ A;  2VD1 A;  2MBT A;  1OE8 A;  3KIJ A;  3UVH A;  5CRG A;  4MZB A;  1XXU A;  3M0F A;  3DYR A;  2YZH A;  2M80 A;  4LMV A;  1B9Y C;  4HDE A;  3H1N A;  1SL0 B;  2R37 A;  1EOH A;  4KUN A;  1GTI A;  3HJO A;  2O7K A;  2H6Z A;  4IVF A;  3F6F A;  4X4J A;  2LJR A;  1R26 A;  4X0X A;  3GUR A;  5CO3 A;  3WGX A;  2OBI A;  4K5R A;  1S3R A;  4GF0 A;  2PPT A;  2MMO A;  4XS6 A;  2DJ2 A;  4XIH A;  4OFM A;  4YQV A;  3TKR A;  3CRU A;  2DBC A;  3HXS A;  3ME7 A;  4MDC A;  1M7T A;  4XRD A;  4Z7X A;  4CDO A;  2LRC A;  2L6C A;  5D73 A;  2BMX A;  4ECI A;  2HSY A;  3Q74 A;  4XS4 B;  5KN0 A;  2C3T A;  2VCT A;  4IHU A;  4PXO A;  4G0I A;  3NIV A;  3GKK A;  1BED A;  4K8M A;  3VWW A;  4TXV A;  1XIY A;  3LJR A;  3DML A;  1EV9 A;  4NV5 A;  1THO A;  5GAN D;  5E4W A;  3GL3 A;  4WF4 A;  3ZYW A;  2D2Z A;  4K7N A;  4HS1 A;  1S3A A;  1XWA A;  3J7Y k;  2VCQ A;  1GNE A;  3F4S A;  1TRV A;  4ZXG A;  3KH7 A;  4IS0 A;  3ZVJ A;  1FVK A;  3HVX A;  3HJP A;  1FVJ A;  4KH7 A;  1AQW A;  2N5B A;  4L5L A;  3FR9 A;  1IYH A;  2C0D A;  1OKT A;  5ECM B;  2LKU A;  3FY7 A;  2VL3 A;  4USS A;  3TRQ A;  1SJI A;  3D0Z A;  1PQN A;  4F2I A;  1VF1 A;  2R0P A;  4GLT A;  4QL7 A;  4ZBD A;  5IOW A;  1WRY A;  4EIP A;  1B4P A;  4IBP A;  3FKF A;  1ERV A;  1IYI A;  3TJF A;  1M2A A;  3CRT A;  6GSU A;  3KMO A;  3EVI A;  1K3O A;  4YQM A;  1R5A A;  3FR6 A;  5D93 A;  4BWQ A;  2VD0 A;  2A4V A;  4N10 A;  1DE2 A;  3S9F A;  4I8B A;  1KNG A;  1XW6 A;  4HU7 A;  1ON4 A;  2VL9 A;  3LSZ A;  2FNO A;  4NXI A;  3UL3 A;  6GSS A;  3TJJ A;  3HVV A;  3EU4 A;  1PL2 A;  1QQ2 A;  5ECP B;  14GS A;  4TR4 A;  4FYB A;  3RAZ A;  2OE0 A;  2MYG A;  5HR3 A;  2GVP A;  5KN3 A;  2CX4 A;  2H8L A;  3F0I A;  5DAL A;  1S3D A;  4IW9 A;  2C80 A;  2CAQ A;  4LL1 B;  1PKZ A;  4J2F A;  4KX4 A;  1DBY A;  1PKW A;  1T1V A;  2IL3 A;  5DBQ A;  5DQS A;  4WBR D;  2AJQ B;  4CW9 A;  2VLT A;  1TXX A;  2FCH A;  1F3A A;  2HI7 A;  2M72 A;  1M2B A;  5IQY A;  4DEJ A;  1BJX A;  5AIX A;  2PGT A;  1XWG A;  3IPZ A;  3FYG A;  2AYT A;  4H86 A;  3LXZ A;  3BD2 A;  3VI5 A;  1GL8 A;  4PQH A;  4X43 A;  1ZOF A;  3CSH A;  4MNN A;  3A5W A;  3TKS E;  5ABR A;  2O85 A;  3DVX A;  3L4N A;  1DSB A;  2WB9 A;  4AGS A;  2J23 A;  2YZU A;  2H1G A;  2K6V A;  1AXD A;  1PA3 A;  4G9H A;  2VM2 A;  1THX A;  1FOV A;  1ZYE A;  3ZRE A;  2F8F A;  2R0G A;  3H4K A;  2PBJ A;  1PX6 A;  4NPB A;  4ECJ A;  4HSC X;  3EUR A;  3A2X A;  1PD2 1;  4ZBA A;  2YN1 A;  2H0I A;  3LG6 A;  2LS5 A;  3EIN A;  4K7O A;  4GSN A;  3SBC A;  19GS A;  1GWC A;  1PFO A;  3GMF A;  1MDK A;  2C1Y A;  4MP4 A;  3HY2 A;  2PU9 C;  3HDC A;  2B5E A;  1GUM A;  5HR0 A;  3TOU A;  4ICY A;  5HR2 A;  4V1A p;  1VF2 A;  1V2A A;  1T00 A;  5JWO B;  1Y25 A;  3VPT A;  1FB6 A;  3UOM A;  3HA9 A;  2YAN A;  4OO4 A;  4GQC A;  4LMW A;  1MEK A;  3I69 A;  1F2E A;  4ZBB A;  1SEN A;  1G7O A;  3KTB A;  3LFL A;  3PH9 A;  4Q5Q A;  3C1S A;  5CRD A;  3RHB A;  5J4U A;  1WJK A;  1PGT A;  3CBU A;  2MZC A;  2RLI A;  1WIK A;  1JHB A;  1FAA A;  2VIM A;  4XTS A;  3MNG A;  2V41 A;  3IA1 A;  5ID2 B;  4E8H A;  2B7K A;  1ERU A;  1PN9 A;  2FLS A;  2WJU A;  1PSQ A;  2GT5 A;  2LNS A;  4K5S A;  5HQP A;  1BAY A;  1Z3E A;  5B8A A;  2H0H A;  3VI7 A;  1WOU A;  2QGV A;  4XCS A;  2X99 A;  2GDR A;  3D4M A;  4NWY A;  2EIQ A;  3GRX A;  2ALB A;  4K2X A;  5D9V A;  4G0K A;  1GTU A;  2L6D A;  3G9B A;  1ACV A;  1GH2 A;  4KDY A;  3D5J A;  1VGL A;  4A5P A;  2YCD A;  1W4V A;  2DIZ A;  1QK8 A;  3WD6 A;  2FGX A;  3A2W A;  5LD0 A;  4G0L A;  1V9W A;  2VCW A;  4ECC A;  1XOA A;  2JZR A;  3TUE A;  3UVT A;  3PR8 A;  4K9Z A;  4K7I A;  4YKF A;  4BVY A;  2WGR A;  2IN3 A;  5JCU A;  4ML6 A;  3WYW A;  2ZUP A;  2DIY A;  3IOS A;  1QFN A;  2GTU A;  3KM6 A;  2GQL A;  3HHV A;  4EF0 A;  2FA8 A;  4TR3 A;  3M8N A;  2KUC A;  3J7Y b;  3LWA A;  5L71 A;  3CXG A;  2CVD A;  1X0R A;  2A4H A;  3KP9 A;  2LNT A;  1Q98 A;  2JSY A;  4WR5 A;  1JLV A;  3IXR A;  4HJ2 A;  5IMV A;  1GTA A;  3R3E A;  3DGQ A;  5ECQ B;  4OD7 A;  1GSS A;  4GRF A;  1F37 A;  4N30 A;  3TKS C;  2H72 A;  1VRS D;  5INY A;  3ISO A;  4I6X A;  2RUF A;  2AHE A;  4PNF A;  1XOB A;  2PER A;  2VL2 C;  1O8X A;  4ULX A;  1WP0 A;  3KD0 A;  1OVN A;  4Z2R A;  2NPB A;  1CQH A;  3GKM A;  4P3Y B;  1R5P A;  4F03 A;  1A2J A;  1XVQ A;  3D22 A;  4GWR A;  3M3M A;  3FR3 A;  2IMF A;  5AN1 A;  5ECI B;  5DAL B;  5COH A;  3ZVJ D;  4POL A;  1VF4 A;  2JAC A;  1EWX A;  1R7H A;  2CVK A;  4EXJ A;  3GKN A;  2E0Q A;  1GTB A;  4NMU A;  1BG5 A;  3MYD A;  2PN8 A;  3JCM L;  2H71 A;  5FHI A;  1XWC A;  3BJ5 A;  1U6T A;  1X5D A;  5CRE A;  1GLQ A;  3L9V A;  4HZ2 A;  2CQ9 A;  4G10 A;  1USB A;  2VAF A;  4KGI A;  1F6M C;  3QPM A;  4CY6 A;  3C73 A;  3GH9 A;  2DSA A;  3TB2 A;  3HYP A;  4JR4 A;  2XPD A;  4POM A;  4ZB8 A;  2J9H A;  1N8J A;  1NHO A;  2O89 A;  2GST A;  4TXO A;  2PWJ A;  1U87 A;  1URM A;  3CTG A;  1EEJ A;  4I5Q A;  3IR4 A;  1UC7 A;  5ECL B;  12GS A;  2LV3 A;  1X9W B;  4FYC A;  2X8H A;  1Z7P A;  3W8J A;  3D6I A;  3HZ4 A;  4POB A;  3E9J B;  4O5U A;  3LW9 A;  4XHM A;  2B5X A;  3I43 A;  2HNL A;  2H74 A;  2K8V A;  3QDN A;  4IQ1 A;  3US3 A;  1Z5Y E;  5IO2 A;  2C4J A;  4JRR A;  2OKA A;  2RM5 A;  4HOJ A;  1G7E A;  3R2Q A;  3VPQ A;  4BVX B;  4YAP A;  4MF6 A;  2YOI A;  4GQF A;  5IOX A;  2N5A A;  3ZML A;  5G31 A;  4ACS A;  4FIW A;  4J56 E;  1ZGN A;  3A5I A;  3HZ8 A;  5EPF A;  1YQ1 A;  1A23 A;  3NZN A;  5ECO B;  2NBS A;  2XC2 A;  4WBJ A;  3QCP A;  4HEA 2;  5ID2 A;  4JBB A;  2DKH A;  4L0W A;  2XBQ A;  4K6X A;  2YWI A;  2VUP A;  4KSO A;  5ECS A;  4MJE A;  3H8Q A;  3VUR A;  1YEP A;  1YKC A;  4NHW A;  5IPH A;  3IBH A;  1ERT A;  2H30 A;  2OAC A;  4GSS A;  1X5C A;  3GX0 A;  2CAI A;  1YJ6 A;  4KND A;  5ENU A;  1T3B A;  3U6V A;  1SD8 A;  1HNB A;  2HZE A;  4MAB A;  3IDV A;  3LXT A;  1W89 A;  1F3B A;  4YH2 A;  5KEJ A;  4K0G A;  1AUC A;  2B6M A;  4YAV A;  4IJI A;  5GZZ B;  1QGV A;  1A8L A;  3GKX A;  2HZF A;  1SL1 B;  1B8X A;  4PUF C;  3VK9 A;  4OFN A;  4PUR A;  1X9M B;  2E2M A;  4MJA A;  2B3S A;  2H6Y A;  3GIX A;  2YJH A;  1SK2 A;  1TI1 A;  3FW2 A;  3QAW A;  4GST A;  2DJJ A;  1EP8 A;  3KTL A;  1JZW A;  4BVY B;  4ZL9 A;  2CVB A;  5F06 A;  6GSW A;  2DJ3 A;  1ZYQ B;  1RW1 A;  3FZ5 A;  3CQF A;  5JWR B;  1B4Q A;  3F4R A;  2IIY A;  3IHQ A;  3P8W A;  3IK7 A;  3ZFL A;  2V32 A;  2JAD A;  1SYX A;  2KHP A;  2HLS A;  4I97 A;  2JZS A;  4L0U A;  2OE1 A;  1ERW A;  1A8Y A;  3FK8 A;  2R2J A;  2LRT A;  1AW9 A;  3BCK A;  2H01 A;  1XW5 A;  2HRK A;  3F8U A;  4I2T A;  5C00 A;  3LYK A;  1S3C A;  2YWM A;  1YKA A;  1TTZ A;  5FWG A;  4EVM A;  3W8S A;  1C72 A;  4BWS A;  2H1A A;  2P5R A;  1AQX A;  2JU5 A;  4AJ7 A;  4AJ6 A;  4Q5F A;  1OKD A;  1GUL A;  3RPN A;  3DEX A;  5CAX A;  5J5N A;  3F3R A;  3KH9 A;  2WRT A;  2C3Q A;  3DWV A;  4PUA A;  3F63 A;  3UEM A;  2YJ7 A;  5C04 A;  3KJY A;  2GSQ A;  4V2L A;  3AY8 A;  2XPE A;  3G7Y A;  1EZK A;  6GST A;  1M3I A;  4HU9 A;  3TOT A;  3TGZ A;  2QC7 A;  4LA1 A;  5KN1 A;  1K0M A;  3MIX A;  5HFG A;  1UN2 A;  4MZC A;  5ELA A;  1BYE A;  3APO A;  1U3I A;  5F0G A;  2PMT A;  1Z6N A;  1KTE A;  5BRT A;  1M99 A;  1YF0 A;  4IQA A;  5AIS A;  3CMI A;  3M1G A;  2F8A A;  2I3Y A;  1O81 A;  3ZIT A;  1M9B A;  2A2S A;  2C0G A;  2LTK A;  1GLP A;  1NW2 A;  2V6O A;  4CY8 A;  5DJM A;  1FG4 A;  4FO5 A;  4KDX A;  2VLU A;  5A4U A;  1OE7 A;  2FWG A;  22GS A;  1EEM A;  2L57 A;  4G19 A;  1XWK A;  1WE0 A;  3GA4 A;  4EDY A;  3GFK A;  5HFI A;  3I9V 2;  3TDG A;  1YY7 A;  5EL8 A;  2L4C A;  3N9J A;  2MBS A;  4DSS A;  1EP7 A;  4RQR A;  5D9T A;  2K8S A;  1YZX A;  2XBI A;  3PIN A;  1GSE A;  3KEB A;  1TP9 A;  2P31 A;  1E2Y A;  4N11 A;  3A3T A;  4HUA A;  4TXO B;  5FT3 A;  1M9A A;  3TJK A;  5IMF A;  4WF5 A;  4EO3 A;  1K3L A;  4ML1 A;  3GNJ A;  17GS A;  2QSI A;  1OAZ A;  1YDK A;  5LCZ A;  1T8E B;  4MH3 A;  2OBK A;  3ZZX A;  1SKR B;  7GSS A;  2LST A;  2CT6 A;  4CHS A;  2E7P A;  4TRX A;  3ERG A;  4K1F A;  3QAV A;  2AB6 A;  1EOG A;  1GSD A;  3KXO A;  2H0G A;  2E2G A;  2ON5 A;  1I5G A;  4MPG A;  1PN0 A;  3C7M A;  5EVO A;  3TKQ A;  1TJD A;  4BVX A;  4WR4 A;  3FEU A;  1K0D A;  4O5R A;  3TRP A;  4HQS A;  4LLR A;  1XPV A;  3ZFB A;  1SJZ A;  3WGE A;  3HJM A;  1U88 A;  4O7H A;  3HCZ A;  2X8G A;  3PGT A;  5DAK B;  4BA7 A;  2HSH A;  2OA7 A;  2IPA A;  1DUG A;  1V57 A;  2YP6 A;  4IKH A;  1H75 A;  1SK1 A;  3WT1 A;  4AF2 A;  2C0F A;  2JL4 A;  3ERW A;  2CA8 A;  4NAX A;  1QMV A;  1OC9 A;  2JZT A;  2IMK A;  1TK0 B;  2G2Q A;  3U5R E;  5D8I A;  3ZIJ A;  5KOX A;  3TRX A;  2LJK A;  3KMN A;  2IFQ A;  5ECN B;  4OWY A;  3RDW A;  4PNG A;  3FZ4 A;  2N5F A;  3UAP A;  1OC8 A;  2FWE A;  1FOH A;  2HZE B;  3ZL5 A;  4TR1 B;  1TRU A;  4FYU A;  3C8E A;  2UZ8 A;  4GXZ A;  2B1K A;  1SKS B;  4V2M A;  2KOK A;  1ZCP A;  1K0O A;  2TRX A;  3LYP A;  5CYY A;  2HT9 A;  1H4O A;  4ZIJ A;  2I9H A;  2R6K A;  1EGR A;  10GS A;  4MH2 A;  3GTU A;  2BTO T;  1SD9 A;  3QOU A;  4O92 A;  1GP1 A;  4F0B A;  5B8B A;  3EU3 A;  4MLY A;  2A2R A;  3QFA C;  3GUS A;  3EPT A;  4MK3 A;  5G5E A;  1E6B A;  3EC3 A;  4HQZ A;  2H1D A;  2GZZ A;  1K0C A; 
#chains in the Genus database with same CATH homology
 1X9S B;  2F9S A;  3H79 A;  2ES7 A;  3L0H A;  3QAG A;  3F3Q A;  3GN3 A;  5A5K A;  5BMU A;  4JU5 A;  4I2U A;  1O8W A;  4AJ8 A;  1EGO A;  2DJ0 A;  5IIZ A;  3N5O A;  4EC0 A;  4LL4 B;  2CV4 A;  4F82 A;  1K0N A;  1ST9 A;  3F9U A;  3GYK A;  3TCO A;  1V40 A;  1K0A A;  3A2V A;  2HSM A;  4DSR A;  4JZQ A;  4RUV A;  5JCG A;  3EMP A;  1FO5 A;  3G7J A;  2L5O A;  1TK8 B;  3QMX A;  4PQI A;  2F51 A;  2R5G A;  1Z6M A;  3HD5 A;  2CZ3 A;  3DVW A;  3BBY A;  5F05 A;  2DLX A;  3GL5 A;  2KP2 A;  2HFD A;  5IMD A;  3FZ9 A;  4IP6 A;  2PVO C;  4KAE A;  1TRS A;  5G2Z A;  2AAW A;  4PGT A;  1DE1 A;  3ZRD A;  1KEB A;  2VCZ A;  3LEF A;  3KGK A;  3IV4 A;  4EL1 A;  2YWN A;  2PVQ A;  1WMJ A;  4MJB A;  3FZA A;  2FHE A;  1JLW A;  5J41 A;  3E3E A;  4DSS B;  4QL9 A;  5G5F A;  2ON7 A;  4HJM A;  1XVW A;  1SU9 A;  1VF3 A;  2NVL A;  4MF5 A;  3Q19 A;  1SKW B;  1MDI A;  5J3R A;  1M0U A;  3E0U A;  3GHA A;  1Z7R A;  4OCE A;  3ERF A;  4POK A;  1Y6E A;  2GZP A;  3L9S A;  4Q5N A;  3RBT A;  4V2N A;  1HNC A;  4G2E A;  2FUG 2;  3FMW A;  2FA4 A;  5H5R A;  2R4V A;  2GZY A;  1EV4 A;  1I9D A;  2Z9S A;  5H5S A;  2YV7 A;  4MPF A;  4KSM A;  2VM1 A;  2O8V B;  2WFC A;  1YF1 A;  5CP1 A;  3IAM 2;  4D73 A;  3RHC A;  2H66 A;  1M2D A;  1T4Y A;  5D9X A;  5AIV A;  2NTO A;  1SL2 B;  1ILO A;  4J57 E;  1ZL9 A;  1HYU A;  5DAK A;  4QQ7 A;  3RPP A;  2TRC P;  4XS1 A;  1PX7 A;  1SJ6 A;  2XHF A;  3GX8 A;  4ZL8 A;  1G6W A;  2QA2 A;  2LQQ A;  2L4Q A;  3GH6 A;  4EDZ A;  1RQM A;  1Z9H A;  2FWH A;  2V6K A;  5KN2 A;  5IPG A;  5G1K A;  1XWB A;  4MF7 A;  1TU8 A;  5DJL A;  4ILF A;  1ML6 A;  3K8N A;  1TI3 A;  2RII A;  1OC9 B;  2OAD A;  2IMI A;  2LUS A;  3DD3 A;  5B6M A;  3F6D A;  4PX1 A;  1MD4 A;  3DXB A;  2IFQ B;  1BQ7 A;  1KBN A;  1PMT A;  2VCV A;  4O32 A;  1ZYN A;  2GGT A;  3HVS A;  4TR1 A;  4ISD A;  4MA9 A;  5GST A;  1QUW A;  3NOF A;  2YWO A;  13GS A;  2KLX A;  3SWL A;  2REM A;  1JZO A;  1XBS A;  1ZZY A;  2H75 A;  4RI6 A;  2ZCT A;  1FHE A;  5ECR B;  3HKR A;  3L78 A;  2WZ9 A;  3O6T A;  4E8E A;  5AGY A;  3IHG A;  4EIQ A;  3O76 A;  4DVC A;  3IRA A;  1TDI A;  2GLR A;  1JZR A;  5DCG A;  5H5Q A;  3WT2 A;  3EYT A;  2HXK A;  2BJX A;  5D96 A;  3GTU B;  4WXT A;  3VWU A;  3IC4 A;  2MMN A;  5JWQ B;  2C0E A;  4WKW A;  1T4Z A;  3DIE A;  2GS3 A;  4IP1 A;  1UVZ A;  3IE3 A;  1FW1 A;  3GSS A;  3MWH A;  3M9K A;  1TK5 B;  1FB0 A;  4IGJ A;  3DRN A;  2KP1 A;  3IK9 A;  1BX9 A;  3QR6 A;  1A0R P;  3Q18 A;  1PRX A;  4TR0 A;  1HD2 A;  4FH8 A;  2MMA A;  2B7J A;  2AV4 A;  4Z2U A;  1B48 A;  3O3T A;  2DC5 A;  3ZTL A;  1JFU A;  5GAP D;  4YQU A;  2K9F A;  3TKS A;  5CRH A;  18GS A;  2O87 A;  4BL7 A;  3DKS A;  3D4T A;  2VCX A;  3QD9 A;  1QXH A;  4TVE A;  2VL2 A;  4MJC A;  3UBL A;  2HRN A;  4OMV A;  1V58 A;  1LU4 A;  2C8U A;  1AC1 A;  4O5Q A;  4V1A g;  4IN0 A;  1GUK A;  3IC8 A;  3VLN A;  4RI7 A;  5A4V A;  1OC3 A;  2CX3 A;  3ZLP A;  2WS2 A;  2RM6 A;  2L5L A;  1NM3 A;  3FHK A;  4IJ3 A;  5DQY A;  1ZYP A;  2HRF A;  1TOF A;  4GTU A;  1WWJ A;  11GS A;  2VOC A;  4TW5 A;  4FQU A;  3ED3 A;  5F8B A;  3QFB C;  4X1U A;  5KOW A;  4F0C A;  2A2P A;  2I1U A;  3P2A A;  2X49 A;  3ME8 A;  1O7U A;  1O6J A;  16GS A;  4XRA A;  1J08 A;  1F9M A;  1A2M A;  3ZIV A;  3CSJ A;  3EMX A;  5ECH B;  3L9U A;  3BOA A;  3CSI A;  2FD3 A;  5D9W A;  1UA5 A;  1SYR A;  5GSS A;  2DJK A;  5DDL A;  1XZO A;  1N2A A;  3P90 A;  4ZB9 A;  1MD3 A;  5ELG A;  1R4W A;  3GST A;  4KCA A;  5E59 A;  2R0C A;  2IMD A;  2X64 A;  2H70 A;  2IJY A;  2HRA A;  3H93 A;  1J9B A;  5G30 A;  5A4W A;  2HE3 A;  5HR1 A;  2GT6 A;  2IME A;  1OYJ A;  3UIW A;  3LQ7 A;  2GSS A;  2DKI A;  2X8C A;  2H73 A;  4ZB6 A;  1HQO A;  2H1B A;  1O85 A;  1B9X C;  1NSW A;  4L8E A;  4WEY A;  2DML A;  2I81 A;  2YPM A;  5CNW A;  1G0T A;  2P5Q A;  5IMA A;  1ZMA A;  3CTF A;  4D73 B;  4K0N A;  1TW9 A;  4KF9 A;  1U3A A;  4EE0 A;  3D21 A;  3VWX A;  2OE3 A;  2VO4 A;  4K2D A;  1A2L A;  3MDK A;  1GNW A;  1X5E A;  2VLV A;  5LNK e;  1ABA A;  4HZ4 A;  4F9Z A;  2LJA A;  2EC4 A;  3ZMK A;  1JZD A;  2I4A A;  4NV2 A;  4JR6 A;  3IAS 2;  4TOP A;  4KA0 A;  1G6Y A;  5IM9 A;  4Q5R A;  1LJR A;  4XS4 A;  9GSS A;  2G0F A;  20GS A;  4NHZ A;  4YKG A;  1MTC A;  1AQV A;  1K3Y A;  2R3X A;  4ZL7 A;  3PPU A;  2GQK A;  4MCU A;  4EUY A;  4GCI A;  4OFT A;  3EWL A;  1NHY A;  4TKY A;  1AAZ A;  1T7P B;  3C71 A;  5JCW A;  5B6N A;  4HI7 A;  1TRW A;  5IO0 A;  2DMM A;  3UJ1 A;  1AIU A;  3LGC A;  5F07 A;  3KP8 A;  4N0Z A;  2LQO A;  3GV1 A;  3M9J A;  2YNX A;  2CZ2 A;  2NDO A;  1MDJ A;  3APQ A;  3F4T A;  4MMM A;  4DSQ A;  5HFK A;  2M46 A;  4RQX A;  1XCC A;  4ECB A;  3CYN A;  2EIR A;  2OJL A;  2IWT A;  1XFL A;  1V98 A;  4Z2T A;  1GSU A;  2WCI A;  5DVB A;  2WUL A;  3P7X A;  3KCM A;  5IMZ A;  1A0F A;  3FRC A;  1RK4 A;  4KDU A;  3BCI A;  2H6X A;  2F3M A;  3MAK A;  2C3N A;  6GSY A;  3G7I A;  3OR5 A;  2LEG A;  4OO5 A;  1Q4J A;  3TKP A;  3VFI A;  4JED A;  4ID0 A;  8GSS A;  2GSR A;  2ZNM A;  1TU7 A;  3TJB A;  2V2G A;  5CRW A;  1GSY A;  2X4A A;  3VWV A;  1PL1 A;  4BL7 B;  3I6A A;  3APS A;  4L5O A;  2FY6 A;  2LRN A;  1TKD B;  1CQG A;  5EY6 A;  2AUV A;  2V1M A;  4KB3 A;  1XW9 A;  5J9C A;  3MSZ A;  2TIR A;  5IMC A;  1K0B A;  4BPY A;  1LBK A;  2EIO A;  3W6G A;  1GSF A;  2QA1 A;  3WGD A;  2MMZ A;  2HYX A;  2GQM A;  4EKZ A;  5ECK B;  4KCE A;  6GSX A;  4OCF A;  1GUH A;  6GSV A;  2RUE A;  4JE1 A;  3UMA A;  1A24 A;  1HNA A;  1GSQ A;  3UBK A;  4WET A;  1GRX A;  4KE3 A;  1YEX A;  2B1L A;  3TJG A;  4MZW A;  4PTS A;  4N0V A;  2H19 A;  4KW6 A;  3EE2 A;  2DJ1 A;  1SK0 A;  1J0F A;  5DCH A;  2P0G A;  5B7C A;  2JSZ A;  4TN8 A;  2PUK C;  5G1L A;  2B5Y A;  2FWF A;  3Q6O A;  3C1R A;  2WDU A;  2L59 A;  4PQ1 A;  3V1W A;  2K18 A;  5J9B A;  4IEL A;  1O73 A;  2H76 A;  3LOR A;  3UAR A;  2YV9 A;  4ZIL A;  1WPI A;  2QKE A;  3KZQ A;  2VD1 A;  2MBT A;  1OE8 A;  3KIJ A;  3UVH A;  5CRG A;  4MZB A;  1XXU A;  3M0F A;  3DYR A;  2YZH A;  2M80 A;  4LMV A;  1B9Y C;  4HDE A;  3H1N A;  1SL0 B;  2R37 A;  1EOH A;  4KUN A;  1GTI A;  3HJO A;  2O7K A;  2H6Z A;  4IVF A;  3F6F A;  4X4J A;  2LJR A;  1R26 A;  4X0X A;  3GUR A;  5CO3 A;  3WGX A;  2OBI A;  4K5R A;  4GF0 A;  2PPT A;  2MMO A;  4XS6 A;  2DJ2 A;  4XIH A;  4OFM A;  4YQV A;  3TKR A;  3CRU A;  2DBC A;  3HXS A;  3ME7 A;  4MDC A;  1M7T A;  4XRD A;  4Z7X A;  4CDO A;  2LRC A;  2L6C A;  5D73 A;  2BMX A;  4ECI A;  2HSY A;  3Q74 A;  4XS4 B;  5KN0 A;  2C3T A;  2VCT A;  4IHU A;  4PXO A;  4G0I A;  3NIV A;  3GKK A;  1BED A;  4K8M A;  3VWW A;  4TXV A;  1XIY A;  3LJR A;  3DML A;  1EV9 A;  4NV5 A;  1THO A;  5GAN D;  5E4W A;  3GL3 A;  4WF4 A;  3ZYW A;  2D2Z A;  4K7N A;  4HS1 A;  1S3A A;  1XWA A;  3J7Y k;  2VCQ A;  1GNE A;  3F4S A;  1TRV A;  4ZXG A;  3KH7 A;  4IS0 A;  3ZVJ A;  1FVK A;  3HVX A;  3HJP A;  1FVJ A;  4KH7 A;  1AQW A;  2N5B A;  4L5L A;  3FR9 A;  1IYH A;  2C0D A;  1OKT A;  5ECM B;  2LKU A;  3FY7 A;  2VL3 A;  4USS A;  3TRQ A;  1SJI A;  3D0Z A;  1PQN A;  4F2I A;  1VF1 A;  2R0P A;  4GLT A;  4QL7 A;  4ZBD A;  5IOW A;  1WRY A;  4EIP A;  1B4P A;  4IBP A;  3FKF A;  1ERV A;  1IYI A;  3TJF A;  1M2A A;  3CRT A;  6GSU A;  3KMO A;  3EVI A;  1K3O A;  4YQM A;  1R5A A;  3FR6 A;  5D93 A;  4BWQ A;  2VD0 A;  2A4V A;  4N10 A;  1DE2 A;  3S9F A;  4I8B A;  1KNG A;  1XW6 A;  4HU7 A;  1ON4 A;  2VL9 A;  3LSZ A;  2FNO A;  4NXI A;  3UL3 A;  6GSS A;  3TJJ A;  3HVV A;  3EU4 A;  1PL2 A;  1QQ2 A;  5ECP B;  14GS A;  4TR4 A;  4FYB A;  3RAZ A;  2OE0 A;  2MYG A;  5HR3 A;  2GVP A;  5KN3 A;  2CX4 A;  2H8L A;  3F0I A;  5DAL A;  1S3D A;  4IW9 A;  2C80 A;  2CAQ A;  4LL1 B;  1PKZ A;  4J2F A;  4KX4 A;  1DBY A;  1PKW A;  1T1V A;  2IL3 A;  5DBQ A;  5DQS A;  4WBR D;  2AJQ B;  4CW9 A;  2VLT A;  1TXX A;  2FCH A;  1F3A A;  2HI7 A;  2M72 A;  1M2B A;  5IQY A;  4DEJ A;  1BJX A;  5AIX A;  2PGT A;  1XWG A;  3IPZ A;  3FYG A;  2AYT A;  4H86 A;  3LXZ A;  3BD2 A;  3VI5 A;  1GL8 A;  4PQH A;  4X43 A;  1ZOF A;  3CSH A;  4MNN A;  3A5W A;  3TKS E;  5ABR A;  2O85 A;  3DVX A;  3L4N A;  1DSB A;  2WB9 A;  4AGS A;  2J23 A;  2YZU A;  2H1G A;  2K6V A;  1AXD A;  1PA3 A;  4G9H A;  2VM2 A;  1THX A;  1FOV A;  1ZYE A;  3ZRE A;  2F8F A;  2R0G A;  3H4K A;  2PBJ A;  1PX6 A;  4NPB A;  4ECJ A;  3EUR A;  3A2X A;  1PD2 1;  4ZBA A;  2YN1 A;  2H0I A;  3LG6 A;  2LS5 A;  3EIN A;  4K7O A;  4GSN A;  3SBC A;  19GS A;  1GWC A;  3GMF A;  1MDK A;  2C1Y A;  4MP4 A;  3HY2 A;  2PU9 C;  3HDC A;  2B5E A;  1GUM A;  5HR0 A;  3TOU A;  4ICY A;  5HR2 A;  4V1A p;  1VF2 A;  1V2A A;  1T00 A;  5JWO B;  1Y25 A;  3VPT A;  1FB6 A;  3UOM A;  3HA9 A;  2YAN A;  4OO4 A;  4GQC A;  4LMW A;  1MEK A;  3I69 A;  1F2E A;  4ZBB A;  1SEN A;  1G7O A;  3KTB A;  3LFL A;  3PH9 A;  4Q5Q A;  3C1S A;  5CRD A;  3RHB A;  5J4U A;  1WJK A;  1PGT A;  3CBU A;  2MZC A;  2RLI A;  1WIK A;  1JHB A;  1FAA A;  2VIM A;  4XTS A;  3MNG A;  2V41 A;  3IA1 A;  5ID2 B;  4E8H A;  2B7K A;  1ERU A;  1PN9 A;  2FLS A;  2WJU A;  1PSQ A;  2GT5 A;  2LNS A;  4K5S A;  5HQP A;  1BAY A;  1Z3E A;  5B8A A;  2H0H A;  3VI7 A;  1WOU A;  2QGV A;  4XCS A;  2X99 A;  2GDR A;  3D4M A;  4NWY A;  2EIQ A;  3GRX A;  2ALB A;  4K2X A;  5D9V A;  4G0K A;  1GTU A;  2L6D A;  3G9B A;  1ACV A;  1GH2 A;  4KDY A;  3D5J A;  1VGL A;  4A5P A;  2YCD A;  1W4V A;  2DIZ A;  1QK8 A;  3WD6 A;  2FGX A;  3A2W A;  5LD0 A;  4G0L A;  1V9W A;  2VCW A;  4ECC A;  1XOA A;  2JZR A;  3TUE A;  3UVT A;  3PR8 A;  4K9Z A;  4K7I A;  4YKF A;  4BVY A;  2WGR A;  2IN3 A;  5JCU A;  4ML6 A;  3WYW A;  2ZUP A;  2DIY A;  3IOS A;  1QFN A;  2GTU A;  3KM6 A;  2GQL A;  3HHV A;  4EF0 A;  2FA8 A;  4TR3 A;  3M8N A;  2KUC A;  3J7Y b;  3LWA A;  5L71 A;  3CXG A;  2CVD A;  1X0R A;  2A4H A;  3KP9 A;  2LNT A;  1Q98 A;  2JSY A;  4WR5 A;  1JLV A;  3IXR A;  4HJ2 A;  5IMV A;  1GTA A;  3R3E A;  3DGQ A;  5ECQ B;  4OD7 A;  1GSS A;  4GRF A;  1F37 A;  4N30 A;  3TKS C;  2H72 A;  1VRS D;  5INY A;  3ISO A;  4I6X A;  2RUF A;  2AHE A;  4PNF A;  1XOB A;  2PER A;  2VL2 C;  1O8X A;  4ULX A;  1WP0 A;  3KD0 A;  1OVN A;  4Z2R A;  2NPB A;  1CQH A;  3GKM A;  4P3Y B;  1R5P A;  4F03 A;  1A2J A;  1XVQ A;  3D22 A;  4GWR A;  3M3M A;  3FR3 A;  2IMF A;  5AN1 A;  5ECI B;  5DAL B;  5COH A;  3ZVJ D;  4POL A;  1VF4 A;  2JAC A;  1EWX A;  1R7H A;  2CVK A;  4EXJ A;  3GKN A;  2E0Q A;  1GTB A;  4NMU A;  1BG5 A;  3MYD A;  2PN8 A;  3JCM L;  2H71 A;  5FHI A;  1XWC A;  3BJ5 A;  1U6T A;  1X5D A;  5CRE A;  1GLQ A;  3L9V A;  4HZ2 A;  2CQ9 A;  4G10 A;  1USB A;  2VAF A;  4KGI A;  1F6M C;  3QPM A;  4CY6 A;  3C73 A;  3GH9 A;  2DSA A;  3TB2 A;  3HYP A;  4JR4 A;  2XPD A;  4POM A;  4ZB8 A;  2J9H A;  1N8J A;  1NHO A;  2O89 A;  2GST A;  4TXO A;  2PWJ A;  1U87 A;  1URM A;  3CTG A;  1EEJ A;  4I5Q A;  3IR4 A;  1UC7 A;  5ECL B;  12GS A;  2LV3 A;  1X9W B;  4FYC A;  2X8H A;  1Z7P A;  3W8J A;  3D6I A;  3HZ4 A;  4POB A;  3E9J B;  4O5U A;  3LW9 A;  4XHM A;  2B5X A;  3I43 A;  2HNL A;  2H74 A;  2K8V A;  3QDN A;  4IQ1 A;  3US3 A;  1Z5Y E;  5IO2 A;  2C4J A;  4JRR A;  2OKA A;  2RM5 A;  4HOJ A;  1G7E A;  3R2Q A;  3VPQ A;  4BVX B;  4YAP A;  4MF6 A;  2YOI A;  4GQF A;  5IOX A;  2N5A A;  3ZML A;  5G31 A;  4ACS A;  4FIW A;  4J56 E;  1ZGN A;  3A5I A;  3HZ8 A;  5EPF A;  1YQ1 A;  1A23 A;  3NZN A;  5ECO B;  2NBS A;  2XC2 A;  4WBJ A;  3QCP A;  4HEA 2;  5ID2 A;  4JBB A;  2DKH A;  4L0W A;  2XBQ A;  4K6X A;  2YWI A;  2VUP A;  4KSO A;  5ECS A;  4MJE A;  3H8Q A;  3VUR A;  1YEP A;  1YKC A;  4NHW A;  5IPH A;  3IBH A;  1ERT A;  2H30 A;  2OAC A;  4GSS A;  1X5C A;  3GX0 A;  2CAI A;  1YJ6 A;  4KND A;  5ENU A;  1T3B A;  3U6V A;  1SD8 A;  1HNB A;  2HZE A;  4MAB A;  3IDV A;  3LXT A;  1W89 A;  1F3B A;  4YH2 A;  5KEJ A;  4K0G A;  1AUC A;  2B6M A;  4YAV A;  4IJI A;  5GZZ B;  1QGV A;  1A8L A;  3GKX A;  2HZF A;  1SL1 B;  1B8X A;  4PUF C;  3VK9 A;  4OFN A;  4PUR A;  1X9M B;  2E2M A;  4MJA A;  2B3S A;  2H6Y A;  3GIX A;  2YJH A;  1SK2 A;  1TI1 A;  3FW2 A;  3QAW A;  4GST A;  2DJJ A;  1EP8 A;  3KTL A;  1JZW A;  4BVY B;  4ZL9 A;  2CVB A;  5F06 A;  6GSW A;  2DJ3 A;  1ZYQ B;  1RW1 A;  3FZ5 A;  5JWR B;  1B4Q A;  3F4R A;  2IIY A;  3IHQ A;  3P8W A;  3IK7 A;  3ZFL A;  2V32 A;  2JAD A;  1SYX A;  2KHP A;  2HLS A;  4I97 A;  2JZS A;  4L0U A;  2OE1 A;  1ERW A;  1A8Y A;  3FK8 A;  2R2J A;  2LRT A;  1AW9 A;  3BCK A;  2H01 A;  1XW5 A;  2HRK A;  3F8U A;  4I2T A;  5C00 A;  3LYK A;  1S3C A;  2YWM A;  1YKA A;  1TTZ A;  5FWG A;  4EVM A;  3W8S A;  1C72 A;  4BWS A;  2H1A A;  2P5R A;  1AQX A;  2JU5 A;  4AJ7 A;  4AJ6 A;  4Q5F A;  1OKD A;  1GUL A;  3RPN A;  3DEX A;  5CAX A;  5J5N A;  3F3R A;  3KH9 A;  2WRT A;  2C3Q A;  3DWV A;  4PUA A;  3F63 A;  3UEM A;  2YJ7 A;  5C04 A;  3KJY A;  2GSQ A;  4V2L A;  3AY8 A;  2XPE A;  3G7Y A;  1EZK A;  6GST A;  4HU9 A;  3TOT A;  3TGZ A;  2QC7 A;  4LA1 A;  5KN1 A;  1K0M A;  3MIX A;  5HFG A;  1UN2 A;  4MZC A;  5ELA A;  1BYE A;  3APO A;  1U3I A;  5F0G A;  2PMT A;  1Z6N A;  1KTE A;  5BRT A;  1M99 A;  1YF0 A;  4IQA A;  5AIS A;  3CMI A;  3M1G A;  2F8A A;  2I3Y A;  1O81 A;  3ZIT A;  1M9B A;  2A2S A;  2C0G A;  2LTK A;  1GLP A;  1NW2 A;  2V6O A;  4CY8 A;  5DJM A;  1FG4 A;  4FO5 A;  4KDX A;  2VLU A;  5A4U A;  1OE7 A;  2FWG A;  22GS A;  1EEM A;  2L57 A;  4G19 A;  1XWK A;  1WE0 A;  3GA4 A;  4EDY A;  3GFK A;  5HFI A;  3I9V 2;  3TDG A;  1YY7 A;  5EL8 A;  2L4C A;  3N9J A;  2MBS A;  4DSS A;  1EP7 A;  4RQR A;  5D9T A;  2K8S A;  1YZX A;  2XBI A;  3PIN A;  1GSE A;  3KEB A;  1TP9 A;  2P31 A;  1E2Y A;  4N11 A;  3A3T A;  4HUA A;  4TXO B;  5FT3 A;  1M9A A;  3TJK A;  5IMF A;  4WF5 A;  4EO3 A;  1K3L A;  4ML1 A;  3GNJ A;  17GS A;  2QSI A;  1OAZ A;  1YDK A;  5LCZ A;  1T8E B;  4MH3 A;  2OBK A;  3ZZX A;  1SKR B;  7GSS A;  2LST A;  2CT6 A;  4CHS A;  2E7P A;  4TRX A;  3ERG A;  4K1F A;  3QAV A;  2AB6 A;  1EOG A;  1GSD A;  3KXO A;  2H0G A;  2E2G A;  2ON5 A;  1I5G A;  4MPG A;  1PN0 A;  3C7M A;  5EVO A;  3TKQ A;  1TJD A;  4BVX A;  4WR4 A;  3FEU A;  1K0D A;  4O5R A;  3TRP A;  4HQS A;  4LLR A;  1XPV A;  3ZFB A;  1SJZ A;  3WGE A;  3HJM A;  1U88 A;  4O7H A;  3HCZ A;  2X8G A;  3PGT A;  5DAK B;  4BA7 A;  2HSH A;  2OA7 A;  2IPA A;  1DUG A;  1V57 A;  2YP6 A;  4IKH A;  1H75 A;  1SK1 A;  3WT1 A;  4AF2 A;  2C0F A;  2JL4 A;  3ERW A;  2CA8 A;  4NAX A;  1QMV A;  1OC9 A;  2JZT A;  2IMK A;  1TK0 B;  2G2Q A;  3U5R E;  5D8I A;  3ZIJ A;  5KOX A;  3TRX A;  2LJK A;  3KMN A;  2IFQ A;  5ECN B;  4OWY A;  3RDW A;  4PNG A;  3FZ4 A;  2N5F A;  3UAP A;  1OC8 A;  2FWE A;  1FOH A;  2HZE B;  3ZL5 A;  4TR1 B;  1TRU A;  4FYU A;  3C8E A;  2UZ8 A;  4GXZ A;  2B1K A;  1SKS B;  4V2M A;  2KOK A;  1ZCP A;  1K0O A;  2TRX A;  3LYP A;  5CYY A;  2HT9 A;  1H4O A;  4ZIJ A;  2I9H A;  2R6K A;  1EGR A;  10GS A;  4MH2 A;  3GTU A;  2BTO T;  1SD9 A;  3QOU A;  4O92 A;  1GP1 A;  4F0B A;  5B8B A;  3EU3 A;  4MLY A;  2A2R A;  3QFA C;  3GUS A;  3EPT A;  4MK3 A;  5G5E A;  1E6B A;  3EC3 A;  4HQZ A;  2H1D A;  2GZZ A;  1K0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...