2FA4A

Crystal structure of oxidized form from saccharomyces cerevisiae
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
MVTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin II
publication title Crystal structure of the yeast cytoplasmic thioredoxin Trx2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 29
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fa4A00
1ERWA 3ZVJA 4IKHA 2KLXA 3CBUA 3GKXA 2WB9A 1GNEA 5E59A 4WR5A 1WWJA 2PUKC 4V2NA 3IV4A 2C8UA 5J4UA 3M9KA 3L0HA 3IE3A 2H6XA 4EC0A 3ERWA 4GCIA 2MMOA 2WDUA 2GSRA 1MDKA 3UBLA 4JU5A 1ST9A 2WGRA 2LRNA 3EINA 3GUSA 3GTUA 2L4QA 2RM5A 3HZ4A 4D73A 3LEFA 5IM9A 2OACA 3VK9A 5H5SA 2LUSA 4NAXA 3GL3A 2XBIA 1GSDA 1M9BA 2IJYA 4KGIA 4NWYA 1Q4JA 2L6CA 2ZUPA 5FT3A 1ZOFA 1HYUA 4N30A 1Z6NA 1K0CA 3UL3A 3RHBA 1K3YA 3BCKA 3HYPA 1SU9A 3TJKA 3LGCA 2A2SA 5D9WA 3KIJA 3G7IA 4IW9A 4OD7A 5DBQA 1EP8A 3ME8A 1AUCA 2GT5A 2DIZA 1UVZA 2VL2C 2M46A 3F4SA 2AUVA 2H71A 4O32A 1O85A 2FCHA 2O8VB 1PMTA 4ZBDA 2QSIA 5DCGA 1OE7A 2GSQA 2I9HA 1SKWB 1V58A 4TKYA 3TRXA 1VF4A 4HJ2A 1PKZA 3RDWA 3P7XA 3HCZA 1XZOA 1O8WA 1B4QA 3TOTA 2VL9A 3NZNA 6GSUA 3ZTLA 2VIMA 2R6KA 2V6KA 3KH7A 1ABAA 3Q18A 4YQMA 3MDKA 1K0BA 2H1AA 1A0RP 1SD8A 3BBYA 2VD0A 3TB2A 3UMAA 1SK1A 4V2MA 1XFLA 5DALB 2C3QA 2AYTA 5G31A 2IL3A 5G1KA 1TK0B 1J0FA 3FHKA 5JWQB 5H5RA 4KH7A 2GSTA 1RQMA 2B1KA 4WR4A 2MMNA 1S3CA 1J9BA 1X5EA 5EVOA 4J2FA 4MZBA 2HSHA 3NOFA 4PXOA 5FHIA 1Z7PA 2TRCP 4MF6A 4MMMA 3M3MA 4WEYA 4KA0A 2PPTA 1BAYA 1SENA 1T1VA 5GZZB 1GUHA 4DSRA 3LYPA 4Q5FA 1LJRA 2YZHA 4HU7A 1TW9A 4FIWA 3TRQA 4POMA 2H73A 1EV4A 3F4TA 1GWCA 4QQ7A 2KUCA 3ZVJD 2EIQA 4HEA2 1BQ7A 5CNWA 3D5JA 5ELAA 4TOPA 1TRWA 2YV9A 1VF2A 3UJ1A 3GIXA 2I3YA 2L4CA 3KTLA 2H1BA 2PN8A 2CA8A 3EU4A 1M0UA 2KP1A 1YY7A 8GSSA 4OWYA 3CYNA 4WXTA 5F0GA 2RUFA 3C8EA 3ZIJA 3CTFA 2XC2A 3F6FA 1ML6A 2R4VA 3KP8A 3O76A 4I2UA 1QFNA 2C4JA 1HNAA 5E4WA 2X8HA 5DAKB 5CRWA 5ELGA 2WS2A 2WFCA 3G9BA 4XS6A 1WP0A 1G0TA 1N2AA 4BVYA 4GSNA 2XPDA 2O89A 3K8NA 1YF0A 5JWRB 3UARA 1XW5A 1K0DA 3APOA 4AF2A 1TTZA 4IQ1A 4I97A 3MAKA 4TXOA 5F05A 3ZZXA 1FW1A 2FWHA 4X1UA 4XS4A 1GNWA 1G7OA 3GTUB 3IOSA 3IAS2 4D73B 2H70A 3ZFLA 3DMLA 2KHPA 1BX9A 2HI7A 1GP1A 2BJXA 2JL4A 2VAFA 3KMNA 3WGEA 4N0ZA 3IA1A 4POBA 4BA7A 3EVIA 1F6MC 5LD0A 3DVXA 2PMTA 1FO5A 1SKSB 1QUWA 2LSTA 3J7Yk 2C0EA 4K7NA 3WGDA 2GVPA 3HY2A 3GNJA 4RI7A 4IP1A 1QMVA 2FGXA 3L78A 2YANA 4J57E 4EE0A 1DE2A 3QAWA 4BVXA 2VM1A 4TN8A 1TU7A 2HRFA 2GDRA 3DRNA 3A2WA 3TCOA 4JR4A 3ZRDA 4TVEA 2MBSA 2FWFA 4K1FA 1A2JA 1AQVA 2GGTA 2OA7A 5AIVA 1OE8A 1CQHA 1VGLA 2HZFA 2FA4A 5DJMA 4MLYA 5ECLB 1R4WA 5JCGA 3J7Yb 3ZREA 2H30A 2H1GA 2QGVA 1ON4A 3M1GA 1JZRA 4O7HA 5JWOB 3D6IA 2P0GA 1PRXA 2KOKA 5D9VA 5EL8A 4HU9A 2H66A 4ZIJA 2M80A 3P90A 4EDZA 3RBTA 4KDYA 4F82A 1OKDA 1JLWA 5IIZA 2DJ1A 4XIHA 3I6AA 2F3MA 2N5AA 1WPIA 4EKZA 2JZRA 5GAND 4DSSB 3L9VA 1OVNA 4POLA 2OE1A 3FK8A 5LNKe 3IXRA 2DMMA 2FHEA 3HVXA 5CRGA 4MJBA 2VM2A 1ZMAA 1JLVA 3TGZA 2LJAA 3KGKA 3PGTA 2IMKA 2LS5A 2GT6A 1O81A 2IN3A 5DQYA 1HQOA 2AV4A 2DMLA 2JZSA 1QQ2A 2B5XA 1V2AA 5ECPB 4HJMA 5IO0A 4Q5QA 3DIEA 3EWLA 3VWVA 3WGXA 2JZTA 4MF5A 3TKSC 4PNGA 1GSSA 1SD9A 3GV1A 1FB0A 4E8EA 2ES7A 2HLSA 2AHEA 3EE2A 4MABA 3VFIA 2OADA 2GS3A 4YQUA 1R7HA 1GSFA 2YWMA 3Q74A 1TK5B 3HKRA 2X64A 1OKTA 5GAPD 4IJIA 3ZMKA 4QL7A 4K7IA 4NV5A 2MMAA 3F4RA 3QOUA 2YP6A 3SWLA 3GSTA 5ECOB 1YKCA 4GRFA 3EURA 2V6OA 2DJKA 1TKDB 1GH2A 2NDOA 3N5OA 3W8SA 2LQQA 4BWSA 4ZL9A 1EGOA 4NPBA 2A4VA 2HZEA 2RLIA 1Y6EA 3ZYWA 4WBJA 2IIYA 4TXOB 1X9MB 1IYHA 4ACSA 4BPYA 4DVCA 4ZB8A 3TJFA 4XS4B 4MDCA 2JSZA 4F0CA 2PGTA 4RQRA 1A0FA 4CHSA 4V1Ap 4XS1A 2PU9C 3GHAA 3PR8A 3E9JB 5IQYA 1LU4A 2P31A 2OKAA 4MA9A 2L6DA 5B8AA 1XVQA 4ID0A 3LG6A 3P8WA 5L71A 4MPFA 1SKRB 3FR3A 4K8MA 4PURA 1BG5A 3GL5A 4MJAA 4KAEA 1K0AA 3PH9A 1A23A 1V57A 2FUG2 3DD3A 1GL8A 2BMXA 2H01A 3H1NA 4TR4A 1TDIA 2YNXA 4IP6A 4MP4A 1Z5YE 3D4MA 2B5YA 3RPNA 1TJDA 3BOAA 1R5PA 4F0BA 4ULXA 3N9JA 3VPTA 2YOIA 1AQWA 1A24A 5ID2A 3EYTA 3CTGA 5D9TA 1W4VA 1H4OA 1TOFA 2I4AA 3PINA 1JZOA 1U88A 2GZPA 3KZQA 4RI6A 3VI7A 4RUVA 1Z9HA 5KN2A 2DJJA 3FY7A 2YZUA 3IDVA 1FOVA 4MK3A 1H75A 3A2VA 2O7KA 1AXDA 3Q6OA 4E8HA 3EMPA 2YN1A 2K9FA 1EV9A 2FWGA 1GTBA 1T4ZA 2LV3A 4HI7A 4OCEA 3FEUA 2V32A 3ISOA 1YDKA 2EIOA 3HVSA 4RQXA 1B4PA 2C0DA 3F9UA 3GSSA 2HFDA 3GURA 3TOUA 2H75A 1KNGA 1U87A 2N5BA 4MH2A 2LRCA 3ZITA 1EGRA 2L57A 2CVKA 1X9SB 5HR2A 1SJ6A 1MDIA 4ML1A 3A2XA 1ERTA 4ECIA 5ECNB 3QFBC 3ZLPA 3CSJA 4FYUA 2GQKA 1SL1B 4GXZA 1MD3A 2F8FA 3FR6A 2JADA 1T7PB 1VF1A 2NVLA 4HZ4A 1UN2A 2E7PA 1ZYQB 4NHZA 1B48A 3KCMA 1GUMA 2XHFA 2JSYA 1F37A 1M2AA 1OC9A 3WT1A 3A3TA 2I1UA 4TR0A 1UA5A 1G6WA 1XVWA 2AJQB 4ZL7A 4IELA 4JBBA 1GSEA 1V40A 3HXSA 5B8BA 5HR1A 3M0FA 3KP9A 4EUYA 3KH9A 1RW1A 5G30A 3F3QA 2PBJA 4KSMA 2CQ9A 2REMA 1S3DA 2DIYA 2ZCTA 3HJOA 2D2ZA 1GSYA 3ERGA 3H4KA 5D8IA 4POKA 3KM6A 2H1DA 2X99A 3UAPA 1SJZA 3W6GA 4G19A 5B7CA 4JE1A 4ECBA 1M9AA 3E3EA 1URMA 1GTAA 1GSQA 1SYRA 3QAGA 1WIKA 2HZEB 2YCDA 3VWUA 3O6TA 1R5AA 3LJRA 4IJ3A 2VD1A 4XRDA 1EZKA 1I5GA 1XOAA 1PSQA 3H93A 4O5RA 1M99A 2O87A 2K18A 2MMZA 5DVBA 1GSUA 4EF0A 4ZBAA 5IMVA 3EC3A 5ECKB 2OBKA 4HZ2A 2LNSA 5IOXA 3F8UA 1A8YA 3UEMA 3I43A 4WKWA 1A2LA 2MBTA 1XOBA 3F3RA 1PA3A 4L0UA 5DQSA 2DJ0A 6GSSA 5LCZA 2GSSA 4ZXGA 4L0WA 1OC3A 2DJ2A 4ZILA 1FG4A 1U3IA 19GSA 4ML6A 3VPQA 1TRSA 4MJEA 1DBYA 5A4WA 3FZAA 2BTOT 1PKWA 2VOCA 4BL7A 2EC4A 1J08A 2GZYA 5DJLA 5D96A 3FZ9A 5ID2B 1ZYEA 5IMDA 2VCQA 5EPFA 3ERFA 4F03A 3G7JA 4GQCA 1WOUA 3KEBA 4KDXA 3C7MA 4IS0A 4HUAA 1ERUA 2VCZA 1GTUA 2GZZA 14GSA 4NMUA 1GLQA 5IMAA 5J9CA 2B5EA 1WMJA 2WZ9A 3HJMA 1EOGA 1XWCA 3KTBA 3DVWA 2LRTA 5FWGA 4NXIA 1QGVA 1CQGA 3O3TA 5CRHA 1ACVA 4JRRA 3TJBA 1K0NA 2JACA 1VF3A 3AY8A 5B6NA 2FLSA 2HXKA 4K6XA 1BYEA 3TRPA 1K0OA 4J56E 3TDGA 1FVKA 4YAPA 5F06A 3C71A 2V1MA 3IAM2 4XRAA 2OE0A 1O73A 4LL1B 3TKSE 3IK9A 3MSZA 3C1SA 2R5GA 2H0GA 3M8NA 1EEJA 5COHA 5D93A 1TU8A 1C72A 1TP9A 1ILOA 2YWOA 2VCWA 1XW9A 2DJ3A 3LXTA 4MJCA 1JZWA 3UIWA 4IHUA 4I5QA 1O7UA 4ILFA 4KDUA 3RHCA 4AJ6A 3D4TA 2X8CA 4N11A 1OAZA 1F3AA 2LKUA 2OBIA 4KX4A 2C0FA 1O6JA 2GQLA 5A4VA 4WBRD 2X8GA 4ISDA 2P5QA 4JEDA 3H79A 5J9BA 3FRCA 1YQ1A 3TJJA 1O8XA 1AQXA 1YJ6A 3IPZA 5B6MA 4AJ7A 1OC9B 2C3NA 3MNGA 1YF1A 3JCML 4OFTA 1BJXA 4L5OA 3FYGA 1EP7A 2B7KA 1XPVA 5HFGA 5IO2A 4PQIA 3WT2A 2H6YA 4IN0A 1GLPA 4IVFA 3GFKA 5CREA 5DDLA 11GSA 4K9ZA 1DSBA 3QD9A 2VCVA 5ENUA 5D73A 2IPAA 3HA9A 2QKEA 10GSA 2YJHA 3ZMLA 3CRTA 3GRXA 4KNDA 4CDOA 1NSWA 2L5OA 4FO5A 3UBKA 2O85A 4TRXA 3DYRA 2NTOA 1T4YA 2C3TA 4EDYA 3TKQA 4YQVA 17GSA 3LFLA 3Q19A 2R3XA 5AGYA 3D0ZA 2RM6A 3A5WA 3MWHA 2CAIA 1EEMA 3ZL5A 1TRVA 1PGTA 5ECMB 2J23A 6GSWA 1T00A 1Y25A 2KP2A 2LTKA 3VWWA 1THXA 4KE3A 2G0FA 2VLUA 4AJ8A 16GSA 4ECJA 3L9UA 5D9XA 3LXZA 2FWEA 2MZCA 4LLRA 2MYGA 2RUEA 3EU3A 2A2RA 2DSAA 3U5RE 2DC5A 1YEPA 4QL9A 2H72A 3HJPA 3LORA 1X0RA 1A8LA 3QCPA 4EO3A 3SBCA 4ZB9A 3KD0A 1Z7RA 1G7EA 5G5FA 2F9SA 2VCXA 2IFQA 4GQFA 4KB3A 3RAZA 1HNCA 5AISA 1Q98A 3TKRA 5IPHA 7GSSA 2K8VA 3HVVA 5ECSA 2IMFA 4DEJA 3GKNA 2EIRA 2IMDA 4X0XA 4G2EA 2TIRA 1F9MA 5IOWA 5GSTA 2YWNA 2GLRA 4KSOA 1UC7A 2E2GA 4TW5A 6GSVA 2PERA 2L59A 1LBKA 2FD3A 5H5QA 1V9WA 4LMWA 4Z7XA 2CX4A 1B9YC 1VRSD 5HQPA 5A5KA 2B3SA 4K7OA 3CXGA 5GSSA 2B6MA 3IHQA 2NBSA 2VO4A 1ZZYA 3ME7A 4N10A 2FA8A 3KJYA 4GSSA 1XWGA 1WE0A 2Z9SA 4HQZA 2JU5A 2ON7A 1TRUA 2J9HA 5C00A 5CAXA 3GKKA 3P2AA 4LA1A 2H74A 1M2DA 18GSA 1KEBA 4TXVA 3VWXA 3QR6A 1F3BA 3FW2A 1GTIA 5HFKA 4WF4A 2XBQA 3HDCA 3ZFBA 2H76A 3TKPA 3EMXA 5J41A 1JFUA 3GKMA 1ZL9A 5KN1A 1AIUA 3VI5A 1USBA 3F63A 4KW6A 1SL0B 1XCCA 3BCIA 2C80A 3CSHA 3GX8A 5CO3A 1B9XC 1X5DA 1QXHA 5JCUA 4HS1A 4FYCA 2WCIA 4FYBA 3DKSA 5F8BA 1FVJA 3F6DA 4DSSA 2YJ7A 3CRUA 3L4NA 2F51A 4ZL8A 1GUKA 5ABRA 1QK8A 3FKFA 4PQHA 1JHBA 1K3LA 3D22A 2K8SA 3LQ7A 2HNLA 3I9V2 3M9JA 1SYXA 4GF0A 1KBNA 1FHEA 1Z6MA 1NW2A 1DE1A 1T8EB 2CX3A 1EOHA 2WRTA 4L8EA 1M7TA 2IWTA 2R2JA 4MZCA 4XHMA 4TR1A 4DSQA 4KUNA 4EVMA 1R26A 3FR9A 4YAVA 1GRXA 5J3RA 3LWAA 5IMCA 3GH9A 2YPMA 2H6ZA 2AB6A 4IQAA 5DCHA 2YV7A 3US3A 1WJKA 1YZXA 2TRXA 3FZ5A 6GSTA 2PVQA 2E0QA 4EL1A 2WJUA 4LMVA 4H86A 4IBPA 5KN0A 4GLTA 1B8XA 3H8QA 1ZCPA 1V98A 5ECHB 3GX0A 1XXUA 2VL3A 3ED3A 3KMOA 3ZIVA 3QFAC 1M2BA 3HD5A 4V1Ag 4PUFC 4HOJA 1BEDA 2CZ2A 5KN3A 3KXOA 2IMEA 2H0IA 3WD6A 3BJ5A 5INYA 2K6VA 4I6XA 3BD2A 4OO4A 2CAQA 4YH2A 5JCWA 1JZDA 2HYXA 3U6VA 3TKSA 2AAWA 3FZ4A 2B1LA 2N5FA 4HQSA 4PGTA 3CSIA 2VLVA 2IFQB 2ALBA 1RK4A 5C04A 1X9WB 3RPPA 4O92A 1SL2B 1S3AA 1AAZA 1XW6A 3IBHA 5AN1A 2LQOA 3IK7A 1SK0A 2GQMA 4AGSA 3HHVA 3R2QA 1YEXA 2HRNA 1N8JA 2HT9A 2H0HA 1PD21 3DXBA 2ON5A 22GSA 1AW9A 3F0IA 3APSA 5G1LA 4CW9A 20GSA 4PQ1A 5F07A 2DBCA 3CMIA 1MD4A 3GA4A 2ZNMA 3S9FA 4IGJA 12GSA 3WYWA 5G2ZA 3LSZA 5IPGA 3OR5A 1XWKA 2LJRA 4OO5A 1XBSA 5IMZA 2PWJA 2E2MA 2LJKA 4Q5NA 3QPMA 3IR4A 1SK2A 5CRDA 2M72A 4NV2A 5KEJA 4JR6A 1A2MA 2VUPA 2B7JA 1MDJA 2WULA 4GWRA 4K0GA 2H19A 5HFIA 1YKAA 3QAVA 4BWQA 1G6YA 2V2GA 4MPGA 4OFMA 3GH6A 4MH3A 2CV4A 3W8JA 1FB6A 4MF7A 2R37A 1TI1A 3HZ8A 1K0MA 2CZ3A 1T3BA 2C0GA 4WF5A 4ZB6A 4ZBBA 2XPEA 2I81A 1FAAA 1NHYA 3TUEA 4EXJA 2FNOA 2C1YA 3NIVA 5AIXA 3G7YA 2CVBA 5EY6A 3APQA 3C1RA 4X43A 1E6BA 3VLNA 3E0UA 2QC7A 1W89A 2IMIA 1XIYA 1X5CA 1KTEA 2H8LA 9GSSA 5CP1A 4PX1A 2L5LA 4MCUA 2OE3A 4I2TA 3QDNA 2PVOC 1F2EA 2HE3A 6GSXA 4K0NA 4JZQA 5A4UA 3L9SA 3VURA 2V41A 4XCSA 2CVDA 2P5RA 3IRAA 2VL2A 3DWVA 4MZWA 1PX6A 2HSYA 6GSYA 4P3YB 3D21A 5IMFA 5HR3A 2FY6A 1IYIA 5ECQB 1XWAA 5DALA 4NHWA 4OFNA 4PNFA 3V1WA 5ECRB 1GULA 2VLTA 4KCEA 3DEXA 4KCAA 4WETA 3LYKA 1ZGNA 3C73A 1THOA 3QMXA 4TR1B 1PN9A 1PL1A 1SJIA 1ERVA 2F8AA 4HDEA 1U6TA 2LNTA 5G5EA 1U3AA 4K2DA 4N0VA 1WRYA 4TR3A 4OCFA 1MEKA 1AC1A 3IC4A 5J5NA 1K3OA 4FH8A 4V2LA 3DGQA 3GN3A 2OJLA 3GMFA 5ECIB 3TJGA 2YWIA 3UVHA 1HNBA 1TXXA 5HR0A 1OC8A 2NPBA 1E2YA 1PX7A 2VCTA 4G9HA 3GYKA 4PUAA 2LEGA 4ECCA 4OMVA 1TK8B 1PQNA 4GSTA 4I8BA 13GSA 2DLXA 4F9ZA 4L5LA 5CYYA 1NHOA 4XTSA 1MTCA 3UOMA 1OYJA 4GTUA 1NM3A 1XWBA 5DAKA 1Z3EA 1EWXA 4F2IA 1HD2A 4Q5RA 1I9DA 1PL2A 2CT6A 1DUGA 3I69A 2G2QA 2RIIA 2GTUA 4G10A 1TI3A 3UVTA 4LL4B
chains in the Genus database with same CATH superfamily
1ERWA 3ZVJA 4IKHA 2KLXA 3CBUA 3GKXA 2WB9A 3IC8A 1GNEA 5E59A 4WR5A 1WWJA 2PUKC 4V2NA 3IV4A 2C8UA 5J4UA 3M9KA 3L0HA 3IE3A 4BIKA 2H6XA 5BMUA 4EC0A 3ERWA 4GCIA 2MMOA 2WDUA 2GSRA 1MDKA 3UBLA 4JU5A 1ST9A 2WGRA 2LRNA 3EINA 3GUSA 3GTUA 2L4QA 4K2XA 2RM5A 3HZ4A 4D73A 3LEFA 5IM9A 2OACA 3VK9A 5H5SA 2LUSA 4NAXA 3GL3A 2XBIA 1GSDA 1M9BA 2IJYA 4KGIA 4NWYA 1Q4JA 2L6CA 2ZUPA 5FT3A 1ZOFA 1HYUA 4N30A 1Z6NA 1PN0A 1K0CA 3UL3A 3RHBA 1K3YA 4HSCX 3IHGA 3BCKA 3HYPA 3CQFA 1SU9A 3TJKA 3LGCA 2A2SA 5D9WA 4MNNA 3KIJA 3G7IA 2DKHA 4IW9A 4OD7A 5DBQA 1EP8A 3ME8A 1AUCA 2GT5A 2DIZA 1UVZA 2VL2C 2M46A 3F4SA 2AUVA 2H71A 4O32A 1O85A 2FCHA 2O8VB 1PMTA 4ZBDA 2QSIA 5DCGA 1OE7A 2GSQA 2I9HA 1SKWB 1V58A 4TKYA 3TRXA 2A2PA 1VF4A 4HJ2A 1PKZA 3RDWA 3P7XA 3HCZA 1XZOA 1O8WA 1B4QA 3TOTA 4O5QA 2VL9A 3NZNA 6GSUA 3ZTLA 2VIMA 2R6KA 2V6KA 3KH7A 1ABAA 3Q18A 4YQMA 3MDKA 1K0BA 2H1AA 1A0RP 1SD8A 3BBYA 2VD0A 3TB2A 3UMAA 1SK1A 4V2MA 1XFLA 5DALB 2C3QA 2AYTA 5G31A 2IL3A 5G1KA 1TK0B 1J0FA 3FHKA 5JWQB 5H5RA 4KH7A 2GSTA 1RQMA 2B1KA 4WR4A 4CY6A 2MMNA 1S3CA 1J9BA 1X5EA 4G0LA 5EVOA 4J2FA 4MZBA 2HSHA 3NOFA 4PXOA 5FHIA 5BRTA 1Z7PA 2TRCP 4MF6A 4MMMA 3M3MA 4WEYA 4KA0A 2PPTA 1BAYA 1SENA 1T1VA 5GZZB 1GUHA 4DSRA 3LYPA 4Q5FA 1LJRA 2YZHA 4HU7A 1TW9A 4FIWA 3TRQA 4POMA 2H73A 1EV4A 3F4TA 1GWCA 4QQ7A 2KUCA 3ZVJD 2EIQA 4HEA2 1BQ7A 5CNWA 3D5JA 5ELAA 4TOPA 1TRWA 2YV9A 1VF2A 3UJ1A 3GIXA 2I3YA 2L4CA 3KTLA 2H1BA 2PN8A 2CA8A 3EU4A 1M0UA 2KP1A 1YY7A 2R0CA 8GSSA 4OWYA 3CYNA 4WXTA 5F0GA 2RUFA 3C8EA 3ZIJA 4YKGA 3CTFA 2XC2A 3F6FA 1ML6A 2R4VA 3KP8A 3O76A 4I2UA 1QFNA 2C4JA 1HNAA 5E4WA 2X8HA 5DAKB 5CRWA 5ELGA 2WS2A 2WFCA 3G9BA 4XS6A 1WP0A 1G0TA 1N2AA 4BVYA 4GSNA 2XPDA 2O89A 3K8NA 1YF0A 5JWRB 3UARA 1XW5A 1K0DA 4Z2RA 3APOA 4AF2A 1TTZA 4IQ1A 4I97A 3MAKA 4TXOA 5F05A 3ZZXA 1FW1A 2FWHA 4X1UA 4XS4A 1GNWA 1G7OA 3GTUB 3IOSA 3IAS2 4D73B 2H70A 3ZFLA 3DMLA 2KHPA 1BX9A 2HI7A 1GP1A 2BJXA 2JL4A 2VAFA 3KMNA 3WGEA 4N0ZA 3IA1A 4POBA 4BA7A 3EVIA 1F6MC 5LD0A 3DVXA 2PMTA 1FO5A 1SKSB 1QUWA 2LSTA 3J7Yk 2HSMA 2C0EA 4K7NA 3WGDA 2GVPA 3HY2A 3GNJA 4RI7A 4IP1A 1QMVA 2FGXA 3L78A 2YANA 1S3RA 4J57E 4EE0A 1DE2A 3QAWA 4BVXA 2VM1A 4TN8A 1TU7A 2HRFA 2GDRA 3DRNA 3A2WA 3TCOA 4JR4A 3ZRDA 4TVEA 2MBSA 2FWFA 4K1FA 1A2JA 1AQVA 2GGTA 2OA7A 5AIVA 1OE8A 1CQHA 1VGLA 2HZFA 2FA4A 5DJMA 4MLYA 5ECLB 1R4WA 5JCGA 3J7Yb 3ZREA 2H30A 2H1GA 2QGVA 1ON4A 3M1GA 1JZRA 4O7HA 5JWOB 3D6IA 2P0GA 1PRXA 2KOKA 5D9VA 5EL8A 4HU9A 2H66A 4ZIJA 2M80A 3P90A 4EDZA 3RBTA 4KDYA 4F82A 1OKDA 1JLWA 5IIZA 2DJ1A 4XIHA 3I6AA 2F3MA 2N5AA 1PFOA 1WPIA 4EKZA 2JZRA 5GAND 4DSSB 3L9VA 1OVNA 4POLA 2OE1A 3FK8A 5LNKe 3IXRA 2DMMA 2FHEA 3HVXA 5CRGA 4MJBA 2VM2A 1ZMAA 1JLVA 3TGZA 2LJAA 3KGKA 3PGTA 2IMKA 2LS5A 2GT6A 1O81A 2IN3A 5DQYA 1HQOA 2AV4A 2DMLA 2JZSA 1QQ2A 2B5XA 3A5IA 1V2AA 5ECPB 4HJMA 5IO0A 4Q5QA 3DIEA 3EWLA 3VWVA 3WGXA 2JZTA 4MF5A 3TKSC 4PNGA 1GSSA 1SD9A 3GV1A 1FB0A 4E8EA 2ES7A 2HLSA 2AHEA 3EE2A 4MABA 3VFIA 2OADA 2GS3A 4YQUA 1R7HA 1GSFA 2YWMA 3Q74A 1TK5B 3HKRA 2X64A 1OKTA 5GAPD 4IJIA 3ZMKA 4QL7A 4K7IA 4NV5A 2MMAA 3F4RA 3QOUA 2YP6A 3SWLA 3GSTA 5ECOB 1YKCA 4GRFA 3EURA 2V6OA 4BVYB 2DJKA 1TKDB 1GH2A 2NDOA 3N5OA 4G0IA 3W8SA 2LQQA 4BWSA 4ZL9A 1EGOA 2QA1A 4NPBA 2A4VA 2HZEA 2RLIA 1Y6EA 3ZYWA 4WBJA 2IIYA 4TXOB 1X9MB 1IYHA 4ACSA 4BPYA 4DVCA 4ZB8A 3TJFA 4XS4B 4MDCA 2JSZA 4F0CA 2PGTA 4RQRA 1A0FA 4CHSA 4V1Ap 4XS1A 2PU9C 3GHAA 3PR8A 3E9JB 5IQYA 1LU4A 2P31A 2OKAA 4MA9A 2L6DA 5B8AA 1XVQA 4ID0A 3LG6A 3P8WA 5L71A 4MPFA 1SKRB 3FR3A 4K8MA 4PURA 1BG5A 3GL5A 4MJAA 4KAEA 1K0AA 3PH9A 1A23A 1V57A 2FUG2 3DD3A 1GL8A 2BMXA 2H01A 3H1NA 4TR4A 1TDIA 2YNXA 4IP6A 4MP4A 1Z5YE 3D4MA 4BVXB 2B5YA 3RPNA 1TJDA 3BOAA 1R5PA 4F0BA 4ULXA 3N9JA 3VPTA 2YOIA 1AQWA 1A24A 5ID2A 3EYTA 3CTGA 5D9TA 1W4VA 1H4OA 1TOFA 2I4AA 3PINA 1JZOA 1U88A 2GZPA 3KZQA 4RI6A 3VI7A 4RUVA 1Z9HA 5KN2A 2DJJA 3FY7A 2YZUA 3IDVA 1FOVA 4MK3A 1H75A 3A2VA 2O7KA 1AXDA 3Q6OA 4E8HA 3EMPA 2YN1A 2K9FA 1EV9A 2FWGA 1GTBA 1T4ZA 2LV3A 4HI7A 4OCEA 2A4HA 3FEUA 2V32A 3ISOA 1YDKA 2EIOA 3HVSA 4RQXA 1B4PA 2C0DA 3F9UA 3GSSA 2HFDA 3GURA 3TOUA 2H75A 1KNGA 1U87A 2N5BA 4MH2A 2LRCA 3ZITA 1EGRA 2L57A 2CVKA 1X9SB 5HR2A 1SJ6A 1MDIA 4ML1A 3A2XA 1ERTA 4ECIA 5ECNB 3QFBC 3ZLPA 3CSJA 1ZYPA 4FYUA 2GQKA 1SL1B 4GXZA 3R3EA 1MD3A 2F8FA 3FR6A 2JADA 1T7PB 1VF1A 2NVLA 4HZ4A 1UN2A 2E7PA 1ZYQB 4NHZA 1B48A 3KCMA 1GUMA 4Z2TA 2XHFA 2JSYA 1F37A 1M2AA 1OC9A 3WT1A 3A3TA 2I1UA 4TR0A 1UA5A 1G6WA 1XVWA 2AJQB 2R0GA 4ZL7A 1M3JA 4IELA 4JBBA 1GSEA 1V40A 3HXSA 5B8BA 5HR1A 3M0FA 3KP9A 4EUYA 3KH9A 1RW1A 5G30A 3F3QA 2PBJA 4KSMA 2CQ9A 2REMA 1S3DA 2DIYA 2ZCTA 3HJOA 2D2ZA 1GSYA 3ERGA 3H4KA 5D8IA 4POKA 3KM6A 2H1DA 2X99A 3UAPA 1SJZA 3W6GA 4G19A 5B7CA 4JE1A 4ECBA 1M9AA 3E3EA 1URMA 1GTAA 1GSQA 1SYRA 3QAGA 1WIKA 2HZEB 2YCDA 4A5PA 3VWUA 3O6TA 1R5AA 3LJRA 4IJ3A 2VD1A 4XRDA 1EZKA 1I5GA 1XOAA 1PSQA 3H93A 4O5RA 1M99A 2O87A 2K18A 2MMZA 5DVBA 1GSUA 4EF0A 4ZBAA 5IMVA 3EC3A 5ECKB 2OBKA 4HZ2A 2LNSA 5IOXA 3F8UA 1A8YA 3UEMA 3I43A 4WKWA 1A2LA 2MBTA 1XOBA 3F3RA 1PA3A 4L0UA 5DQSA 3FMWA 2DJ0A 6GSSA 5LCZA 2GSSA 4ZXGA 4L0WA 1OC3A 4CY8A 2DJ2A 4ZILA 1FG4A 1U3IA 19GSA 4ML6A 3VPQA 1TRSA 4MJEA 1DBYA 5A4WA 3FZAA 2BTOT 1PKWA 2VOCA 4BL7A 2EC4A 1J08A 2GZYA 5DJLA 5D96A 3FZ9A 5ID2B 1ZYEA 5IMDA 2VCQA 5EPFA 3ERFA 4F03A 3G7JA 4GQCA 1WOUA 3KEBA 4KDXA 3C7MA 2X4AA 4IS0A 4HUAA 1ERUA 2VCZA 1GTUA 2GZZA 4Z2UA 14GSA 4NMUA 1GLQA 5IMAA 5J9CA 2B5EA 1WMJA 2WZ9A 3HJMA 1EOGA 1XWCA 3KTBA 3DVWA 2LRTA 5FWGA 4NXIA 1QGVA 1CQGA 3O3TA 5CRHA 1ACVA 4JRRA 3TJBA 1K0NA 2JACA 1VF3A 3AY8A 5B6NA 2FLSA 2HXKA 4K6XA 1BYEA 3TRPA 1K0OA 4J56E 3TDGA 1FVKA 4YAPA 5F06A 3C71A 2V1MA 3IAM2 4XRAA 2OE0A 1O73A 4LL1B 3TKSE 3IK9A 3MSZA 3C1SA 2R5GA 2H0GA 3M8NA 1EEJA 5COHA 5D93A 1TU8A 1C72A 1TP9A 1ILOA 2YWOA 2VCWA 1XW9A 2DJ3A 3LXTA 4MJCA 1JZWA 3UIWA 4IHUA 4I5QA 1O7UA 4ILFA 4KDUA 3RHCA 4AJ6A 3D4TA 2X8CA 4N11A 1OAZA 1F3AA 2LKUA 2OBIA 4KX4A 2C0FA 1O6JA 2R0PA 1XG8A 2GQLA 5A4VA 4WBRD 2X8GA 4ISDA 2P5QA 4JEDA 3H79A 5J9BA 3FRCA 4EIPA 1YQ1A 3TJJA 1O8XA 1AQXA 1YJ6A 3IPZA 5B6MA 4O5UA 4AJ7A 1OC9B 2C3NA 3MNGA 1YF1A 3JCML 4OFTA 1BJXA 4L5OA 3FYGA 1EP7A 2B7KA 1XPVA 5HFGA 5IO2A 4PQIA 3WT2A 2H6YA 4IN0A 1GLPA 4IVFA 3GFKA 5CREA 5DDLA 11GSA 4K9ZA 1DSBA 3QD9A 2VCVA 5ENUA 5D73A 2IPAA 3HA9A 2QKEA 10GSA 4K5RA 2YJHA 3ZMLA 3CRTA 3GRXA 4KNDA 4CDOA 1NSWA 2L5OA 4FO5A 3UBKA 2O85A 4TRXA 3DYRA 2NTOA 1T4YA 2C3TA 4EDYA 3TKQA 4YQVA 17GSA 3LFLA 3Q19A 2R3XA 5AGYA 3D0ZA 2RM6A 3A5WA 3MWHA 2CAIA 1EEMA 3ZL5A 4K5SA 1TRVA 1PGTA 5ECMB 2J23A 6GSWA 1T00A 1Y25A 2KP2A 2LTKA 3VWWA 1THXA 4KE3A 2G0FA 2VLUA 4AJ8A 16GSA 4ECJA 3L9UA 5D9XA 3LXZA 2FWEA 2MZCA 4LLRA 2MYGA 2RUEA 3EU3A 2A2RA 2DSAA 2HRAA 3U5RE 2UZ8A 2DC5A 1YEPA 4QL9A 2H72A 3HJPA 3LORA 1X0RA 1A8LA 2HRKA 3QCPA 4EO3A 3SBCA 4BL7B 4ZB9A 3KD0A 1Z7RA 1G7EA 5G5FA 2F9SA 2VCXA 2IFQA 4GQFA 4KB3A 4YKFA 3RAZA 1HNCA 5AISA 1Q98A 3TKRA 5IPHA 7GSSA 2K8VA 3HVVA 5ECSA 2IMFA 4DEJA 3GKNA 2EIRA 2IMDA 4X0XA 4G2EA 2TIRA 1F9MA 5IOWA 5GSTA 2YWNA 5KOWA 2GLRA 4KSOA 4FQUA 1UC7A 2E2GA 4TW5A 6GSVA 2PERA 2L59A 1LBKA 3HVNA 2FD3A 5H5QA 1V9WA 4LMWA 4Z7XA 2CX4A 1B9YC 1VRSD 5HQPA 5A5KA 2B3SA 4K7OA 3CXGA 5GSSA 2B6MA 3IHQA 2NBSA 2VO4A 1ZZYA 3ME7A 4N10A 2FA8A 3KJYA 4GSSA 1XWGA 1WE0A 2Z9SA 4HQZA 2JU5A 2ON7A 1TRUA 2J9HA 5C00A 5CAXA 3EPTA 3GKKA 3P2AA 4LA1A 2H74A 1M2DA 18GSA 1KEBA 4TXVA 3VWXA 3QR6A 1F3BA 3FW2A 1GTIA 5HFKA 4WF4A 2XBQA 3HDCA 3ZFBA 2H76A 3TKPA 3EMXA 5J41A 1JFUA 3GKMA 1ZL9A 5KN1A 1AIUA 4PTSA 1ZYNA 3VI5A 1USBA 3F63A 4KW6A 1SL0B 1XCCA 3BCIA 2C80A 3CSHA 3GX8A 5CO3A 1B9XC 1X5DA 1QXHA 5JCUA 4HS1A 4FYCA 2WCIA 4FYBA 3DKSA 5F8BA 1FVJA 3F6DA 4DSSA 2YJ7A 3CRUA 3L4NA 2F51A 4ZL8A 1GUKA 5ABRA 1QK8A 3FKFA 4PQHA 1JHBA 1K3LA 3D22A 2K8SA 5KOXA 3LQ7A 2HNLA 3I9V2 3M9JA 1SYXA 4GF0A 1KBNA 1FHEA 1Z6MA 1NW2A 1DE1A 1T8EB 2CX3A 1EOHA 2WRTA 4L8EA 1M7TA 2IWTA 2R2JA 4MZCA 4XHMA 4TR1A 4DSQA 4KUNA 4EVMA 1R26A 3FR9A 4YAVA 1GRXA 3PPUA 5J3RA 3LWAA 5IMCA 3GH9A 2YPMA 2H6ZA 2AB6A 4IQAA 5DCHA 2YV7A 3US3A 1WJKA 1YZXA 2TRXA 3FZ5A 6GSTA 2PVQA 2E0QA 4EL1A 2WJUA 4LMVA 4H86A 4IBPA 5KN0A 4X4JA 4GLTA 1B8XA 3H8QA 1ZCPA 1V98A 5ECHB 3GX0A 1XXUA 2QA2A 2VL3A 3ED3A 3KMOA 3ZIVA 1FOHA 3QFAC 1M2BA 3HD5A 4V1Ag 4PUFC 4HOJA 1BEDA 2CZ2A 5KN3A 3KXOA 2IMEA 2H0IA 3WD6A 3BJ5A 5INYA 2K6VA 4I6XA 3BD2A 4OO4A 2CAQA 3MYDA 4YH2A 5JCWA 1JZDA 2HYXA 3U6VA 3TKSA 2AAWA 3FZ4A 2B1LA 2N5FA 4HQSA 4PGTA 3CSIA 2VLVA 2IFQB 2ALBA 1RK4A 5C04A 1X9WB 3RPPA 4O92A 1SL2B 3MIXA 1S3AA 1AAZA 1XW6A 3IBHA 5AN1A 2LQOA 3IK7A 1SK0A 2GQMA 4AGSA 3HHVA 3R2QA 1YEXA 2HRNA 1N8JA 2HT9A 2H0HA 1PD21 3DXBA 2ON5A 22GSA 1AW9A 3F0IA 3APSA 5G1LA 4CW9A 20GSA 4PQ1A 2DBCA 5F07A 3CMIA 1MD4A 3GA4A 2ZNMA 3S9FA 4IGJA 12GSA 3WYWA 5G2ZA 3LSZA 5IPGA 3OR5A 1XWKA 2LJRA 4OO5A 1XBSA 5IMZA 2PWJA 2E2MA 2LJKA 4Q5NA 3QPMA 3IR4A 1SK2A 5CRDA 2M72A 4NV2A 5KEJA 4JR6A 1A2MA 2VUPA 2B7JA 1MDJA 2WULA 4GWRA 4K0GA 2H19A 5HFIA 1YKAA 3QAVA 4BWQA 1G6YA 2V2GA 4MPGA 4OFMA 3GH6A 4MH3A 2CV4A 3W8JA 1FB6A 4MF7A 2R37A 2X49A 1TI1A 3HZ8A 1K0MA 2CZ3A 1T3BA 2C0GA 4WF5A 4ZB6A 4ZBBA 2XPEA 2I81A 1FAAA 1NHYA 3TUEA 4USSA 4EXJA 2FNOA 2C1YA 3NIVA 5AIXA 3G7YA 2CVBA 5EY6A 3APQA 3C1RA 4X43A 1E6BA 3VLNA 3E0UA 2QC7A 1W89A 2IMIA 1XIYA 1X5CA 1KTEA 2H8LA 9GSSA 5CP1A 4PX1A 2L5LA 4MCUA 2OE3A 4I2TA 3QDNA 2PVOC 1F2EA 2HE3A 4EIQA 6GSXA 4K0NA 4JZQA 5A4UA 3L9SA 3VURA 2V41A 4XCSA 2CVDA 2P5RA 3IRAA 2VL2A 3DWVA 4MZWA 1PX6A 2HSYA 6GSYA 4P3YB 3D21A 5IMFA 5HR3A 3LW9A 2FY6A 1IYIA 5ECQB 1XWAA 5DALA 4NHWA 4OFNA 4PNFA 3V1WA 5ECRB 1GULA 2VLTA 4KCEA 3DEXA 4KCAA 4WETA 3LYKA 1ZGNA 3C73A 1THOA 4G0KA 3QMXA 4TR1B 1PN9A 1PL1A 1SJIA 1ERVA 1M3IA 2F8AA 4HDEA 1U6TA 2LNTA 5G5EA 1U3AA 4K2DA 4N0VA 1WRYA 4TR3A 4OCFA 1MEKA 1AC1A 3IC4A 5J5NA 1K3OA 4FH8A 4V2LA 3DGQA 3GN3A 2OJLA 3GMFA 5ECIB 3TJGA 2YWIA 3UVHA 1HNBA 1TXXA 5HR0A 1OC8A 2NPBA 1E2YA 2DKIA 1PX7A 2VCTA 4G9HA 3GYKA 4PUAA 2LEGA 4ECCA 4OMVA 1TK8B 1PQNA 4KF9A 4GSTA 4I8BA 13GSA 2DLXA 4F9ZA 4L5LA 5CYYA 1NHOA 4ICYA 4XTSA 1MTCA 3UOMA 1OYJA 4GTUA 1NM3A 1XWBA 5DAKA 1Z3EA 1EWXA 4F2IA 1HD2A 4Q5RA 1I9DA 1PL2A 2CT6A 1DUGA 3I69A 2G2QA 2RIIA 2GTUA 4G10A 1TI3A 3UVTA 4LL4B
chains in the Genus database with same CATH topology
1ERWA 3ZVJA 4IKHA 2KLXA 3CBUA 3GKXA 2WB9A 3IC8A 1GNEA 5E59A 4WR5A 1WWJA 2PUKC 4V2NA 3IV4A 2C8UA 5J4UA 3M9KA 3L0HA 3IE3A 2H6XA 5BMUA 4EC0A 3ERWA 4GCIA 2MMOA 2WDUA 2GSRA 1MDKA 3UBLA 4JU5A 1ST9A 2WGRA 2LRNA 3EINA 3GUSA 3GTUA 2L4QA 4K2XA 2RM5A 3HZ4A 4D73A 3LEFA 5IM9A 2OACA 3VK9A 5H5SA 2LUSA 4NAXA 3GL3A 2XBIA 1GSDA 1M9BA 2IJYA 4KGIA 4NWYA 1Q4JA 2L6CA 2ZUPA 5FT3A 1ZOFA 1HYUA 4N30A 1Z6NA 1PN0A 1K0CA 3UL3A 3RHBA 1K3YA 3IHGA 3BCKA 3HYPA 1SU9A 3TJKA 3LGCA 2A2SA 5D9WA 4MNNA 3KIJA 3G7IA 2DKHA 4IW9A 4OD7A 5DBQA 1EP8A 3ME8A 1AUCA 2GT5A 2DIZA 1UVZA 2VL2C 2M46A 3F4SA 2AUVA 2H71A 4O32A 1O85A 2FCHA 2O8VB 1PMTA 4ZBDA 2QSIA 5DCGA 1OE7A 2GSQA 2I9HA 1SKWB 1V58A 4TKYA 3TRXA 2A2PA 1VF4A 4HJ2A 1PKZA 3RDWA 3P7XA 3HCZA 1XZOA 1O8WA 1B4QA 3TOTA 4O5QA 2VL9A 3NZNA 6GSUA 3ZTLA 2VIMA 2R6KA 2V6KA 3KH7A 1ABAA 3Q18A 4YQMA 3MDKA 1K0BA 2H1AA 1A0RP 1SD8A 3BBYA 2VD0A 3TB2A 3UMAA 1SK1A 4V2MA 1XFLA 5DALB 2C3QA 2AYTA 5G31A 2IL3A 5G1KA 1TK0B 1J0FA 3FHKA 5JWQB 5H5RA 4KH7A 2GSTA 1RQMA 2B1KA 4WR4A 4CY6A 2MMNA 1S3CA 1J9BA 1X5EA 4G0LA 5EVOA 4J2FA 4MZBA 2HSHA 3NOFA 4PXOA 5FHIA 5BRTA 1Z7PA 2TRCP 4MF6A 4MMMA 3M3MA 4WEYA 4KA0A 2PPTA 1BAYA 1SENA 1T1VA 5GZZB 1GUHA 4DSRA 3LYPA 4Q5FA 1LJRA 2YZHA 4HU7A 1TW9A 4FIWA 3TRQA 4POMA 2H73A 1EV4A 3F4TA 1GWCA 4QQ7A 2KUCA 3ZVJD 2EIQA 4HEA2 1BQ7A 5CNWA 3D5JA 5ELAA 4TOPA 1TRWA 2YV9A 1VF2A 3UJ1A 3GIXA 2I3YA 2L4CA 3KTLA 2H1BA 2PN8A 2CA8A 3EU4A 1M0UA 2KP1A 1YY7A 2R0CA 8GSSA 4OWYA 3CYNA 4WXTA 5F0GA 2RUFA 3C8EA 3ZIJA 4YKGA 3CTFA 2XC2A 3F6FA 1ML6A 2R4VA 3KP8A 3O76A 4I2UA 1QFNA 2C4JA 1HNAA 5E4WA 2X8HA 5DAKB 5CRWA 5ELGA 2WS2A 2WFCA 3G9BA 4XS6A 1WP0A 1G0TA 1N2AA 4BVYA 4GSNA 2XPDA 2O89A 3K8NA 1YF0A 5JWRB 3UARA 1XW5A 1K0DA 4Z2RA 3APOA 4AF2A 1TTZA 4IQ1A 4I97A 3MAKA 4TXOA 5F05A 3ZZXA 1FW1A 2FWHA 4X1UA 4XS4A 1GNWA 1G7OA 3GTUB 3IOSA 3IAS2 4D73B 2H70A 3ZFLA 3DMLA 2KHPA 1BX9A 2HI7A 1GP1A 2BJXA 2JL4A 2VAFA 3KMNA 3WGEA 4N0ZA 3IA1A 4POBA 4BA7A 3EVIA 1F6MC 5LD0A 3DVXA 2PMTA 1FO5A 1SKSB 1QUWA 2LSTA 3J7Yk 2HSMA 2C0EA 4K7NA 3WGDA 2GVPA 3HY2A 3GNJA 4RI7A 4IP1A 1QMVA 2FGXA 3L78A 2YANA 4J57E 4EE0A 1DE2A 3QAWA 4BVXA 2VM1A 4TN8A 1TU7A 2HRFA 2GDRA 3DRNA 3A2WA 3TCOA 4JR4A 3ZRDA 4TVEA 2MBSA 2FWFA 4K1FA 1A2JA 1AQVA 2GGTA 2OA7A 5AIVA 1OE8A 1CQHA 1VGLA 2HZFA 2FA4A 5DJMA 4MLYA 5ECLB 1R4WA 5JCGA 3J7Yb 3ZREA 2H30A 2H1GA 2QGVA 1ON4A 3M1GA 1JZRA 4O7HA 5JWOB 3D6IA 2P0GA 1PRXA 2KOKA 5D9VA 5EL8A 4HU9A 2H66A 4ZIJA 2M80A 3P90A 4EDZA 3RBTA 4KDYA 4F82A 1OKDA 1JLWA 5IIZA 2DJ1A 4XIHA 3I6AA 2F3MA 2N5AA 1WPIA 4EKZA 2JZRA 5GAND 4DSSB 3L9VA 1OVNA 4POLA 2OE1A 3FK8A 5LNKe 3IXRA 2DMMA 2FHEA 3HVXA 5CRGA 4MJBA 2VM2A 1ZMAA 1JLVA 3TGZA 2LJAA 3KGKA 3PGTA 2IMKA 2LS5A 2GT6A 1O81A 2IN3A 5DQYA 1HQOA 2AV4A 2DMLA 2JZSA 1QQ2A 2B5XA 3A5IA 1V2AA 5ECPB 4HJMA 5IO0A 4Q5QA 3DIEA 3EWLA 3VWVA 3WGXA 2JZTA 4MF5A 3TKSC 4PNGA 1GSSA 1SD9A 3GV1A 1FB0A 4E8EA 2ES7A 2HLSA 2AHEA 3EE2A 4MABA 3VFIA 2OADA 2GS3A 4YQUA 1R7HA 1GSFA 2YWMA 3Q74A 1TK5B 3HKRA 2X64A 1OKTA 5GAPD 4IJIA 3ZMKA 4QL7A 4K7IA 4NV5A 2MMAA 3F4RA 3QOUA 2YP6A 3SWLA 3GSTA 5ECOB 1YKCA 4GRFA 3EURA 2V6OA 4BVYB 2DJKA 1TKDB 1GH2A 2NDOA 3N5OA 4G0IA 3W8SA 2LQQA 4BWSA 4ZL9A 1EGOA 2QA1A 4NPBA 2A4VA 2HZEA 2RLIA 1Y6EA 3ZYWA 4WBJA 2IIYA 4TXOB 1X9MB 1IYHA 4ACSA 4BPYA 4DVCA 4ZB8A 3TJFA 4XS4B 4MDCA 2JSZA 4F0CA 2PGTA 4RQRA 1A0FA 4CHSA 4V1Ap 4XS1A 2PU9C 3GHAA 3PR8A 3E9JB 5IQYA 1LU4A 2P31A 2OKAA 4MA9A 2L6DA 5B8AA 1XVQA 4ID0A 3LG6A 3P8WA 5L71A 4MPFA 1SKRB 3FR3A 4K8MA 4PURA 1BG5A 3GL5A 4MJAA 4KAEA 1K0AA 3PH9A 1A23A 1V57A 2FUG2 3DD3A 1GL8A 2BMXA 2H01A 3H1NA 4TR4A 1TDIA 2YNXA 4IP6A 4MP4A 1Z5YE 3D4MA 4BVXB 2B5YA 3RPNA 1TJDA 3BOAA 1R5PA 4F0BA 4ULXA 3N9JA 3VPTA 2YOIA 1AQWA 1A24A 5ID2A 3EYTA 3CTGA 5D9TA 1W4VA 1H4OA 1TOFA 2I4AA 3PINA 1JZOA 1U88A 2GZPA 3KZQA 4RI6A 3VI7A 4RUVA 1Z9HA 5KN2A 2DJJA 3FY7A 2YZUA 3IDVA 1FOVA 4MK3A 1H75A 3A2VA 2O7KA 1AXDA 3Q6OA 4E8HA 3EMPA 2YN1A 2K9FA 1EV9A 2FWGA 1GTBA 1T4ZA 2LV3A 4HI7A 4OCEA 2A4HA 3FEUA 2V32A 3ISOA 1YDKA 2EIOA 3HVSA 4RQXA 1B4PA 2C0DA 3F9UA 3GSSA 2HFDA 3GURA 3TOUA 2H75A 1KNGA 1U87A 2N5BA 4MH2A 2LRCA 3ZITA 1EGRA 2L57A 2CVKA 1X9SB 5HR2A 1SJ6A 1MDIA 4ML1A 3A2XA 1ERTA 4ECIA 5ECNB 3QFBC 3ZLPA 3CSJA 1ZYPA 4FYUA 2GQKA 1SL1B 4GXZA 3R3EA 1MD3A 2F8FA 3FR6A 2JADA 1T7PB 1VF1A 2NVLA 4HZ4A 1UN2A 2E7PA 1ZYQB 4NHZA 1B48A 3KCMA 1GUMA 4Z2TA 2XHFA 2JSYA 1F37A 1M2AA 1OC9A 3WT1A 3A3TA 2I1UA 4TR0A 1UA5A 1G6WA 1XVWA 2AJQB 2R0GA 4ZL7A 4IELA 4JBBA 1GSEA 1V40A 3HXSA 5B8BA 5HR1A 3M0FA 3KP9A 4EUYA 3KH9A 1RW1A 5G30A 3F3QA 2PBJA 4KSMA 2CQ9A 2REMA 1S3DA 2DIYA 2ZCTA 3HJOA 2D2ZA 1GSYA 3ERGA 3H4KA 5D8IA 4POKA 3KM6A 2H1DA 2X99A 3UAPA 1SJZA 3W6GA 4G19A 5B7CA 4JE1A 4ECBA 1M9AA 3E3EA 1URMA 1GTAA 1GSQA 1SYRA 3QAGA 1WIKA 2HZEB 2YCDA 4A5PA 3VWUA 3O6TA 1R5AA 3LJRA 4IJ3A 2VD1A 4XRDA 1EZKA 1I5GA 1XOAA 1PSQA 3H93A 4O5RA 1M99A 2O87A 2K18A 2MMZA 5DVBA 1GSUA 4EF0A 4ZBAA 5IMVA 3EC3A 5ECKB 2OBKA 4HZ2A 2LNSA 5IOXA 3F8UA 1A8YA 3UEMA 3I43A 4WKWA 1A2LA 2MBTA 1XOBA 3F3RA 1PA3A 4L0UA 5DQSA 3FMWA 2DJ0A 6GSSA 5LCZA 2GSSA 4ZXGA 4L0WA 1OC3A 4CY8A 2DJ2A 4ZILA 1FG4A 1U3IA 19GSA 4ML6A 3VPQA 1TRSA 4MJEA 1DBYA 5A4WA 3FZAA 2BTOT 1PKWA 2VOCA 4BL7A 2EC4A 1J08A 2GZYA 5DJLA 5D96A 3FZ9A 5ID2B 1ZYEA 5IMDA 2VCQA 5EPFA 3ERFA 4F03A 3G7JA 4GQCA 1WOUA 3KEBA 4KDXA 3C7MA 2X4AA 4IS0A 4HUAA 1ERUA 2VCZA 1GTUA 2GZZA 4Z2UA 14GSA 4NMUA 1GLQA 5IMAA 5J9CA 2B5EA 1WMJA 2WZ9A 3HJMA 1EOGA 1XWCA 3KTBA 3DVWA 2LRTA 5FWGA 4NXIA 1QGVA 1CQGA 3O3TA 5CRHA 1ACVA 4JRRA 3TJBA 1K0NA 2JACA 1VF3A 3AY8A 5B6NA 2FLSA 2HXKA 4K6XA 1BYEA 3TRPA 1K0OA 4J56E 3TDGA 1FVKA 4YAPA 5F06A 3C71A 2V1MA 3IAM2 4XRAA 2OE0A 1O73A 4LL1B 3TKSE 3IK9A 3MSZA 3C1SA 2R5GA 2H0GA 3M8NA 1EEJA 5COHA 5D93A 1TU8A 1C72A 1TP9A 1ILOA 2YWOA 2VCWA 1XW9A 2DJ3A 3LXTA 4MJCA 1JZWA 3UIWA 4IHUA 4I5QA 1O7UA 4ILFA 4KDUA 3RHCA 4AJ6A 3D4TA 2X8CA 4N11A 1OAZA 1F3AA 2LKUA 2OBIA 4KX4A 2C0FA 1O6JA 2R0PA 2GQLA 5A4VA 4WBRD 2X8GA 4ISDA 2P5QA 4JEDA 3H79A 5J9BA 3FRCA 4EIPA 1YQ1A 3TJJA 1O8XA 1AQXA 1YJ6A 3IPZA 5B6MA 4O5UA 4AJ7A 1OC9B 2C3NA 3MNGA 1YF1A 3JCML 4OFTA 1BJXA 4L5OA 3FYGA 1EP7A 2B7KA 1XPVA 5HFGA 5IO2A 4PQIA 3WT2A 2H6YA 4IN0A 1GLPA 4IVFA 3GFKA 5CREA 5DDLA 11GSA 4K9ZA 1DSBA 3QD9A 2VCVA 5ENUA 5D73A 2IPAA 3HA9A 2QKEA 10GSA 4K5RA 2YJHA 3ZMLA 3CRTA 3GRXA 4KNDA 4CDOA 1NSWA 2L5OA 4FO5A 3UBKA 2O85A 4TRXA 3DYRA 2NTOA 1T4YA 2C3TA 4EDYA 3TKQA 4YQVA 17GSA 3LFLA 3Q19A 2R3XA 5AGYA 3D0ZA 2RM6A 3A5WA 3MWHA 2CAIA 1EEMA 3ZL5A 4K5SA 1TRVA 1PGTA 5ECMB 2J23A 6GSWA 1T00A 1Y25A 2KP2A 2LTKA 3VWWA 1THXA 4KE3A 2G0FA 2VLUA 4AJ8A 16GSA 4ECJA 3L9UA 5D9XA 3LXZA 2FWEA 2MZCA 4LLRA 2MYGA 2RUEA 3EU3A 2A2RA 2DSAA 2HRAA 3U5RE 2UZ8A 2DC5A 1YEPA 4QL9A 2H72A 3HJPA 3LORA 1X0RA 1A8LA 2HRKA 3QCPA 4EO3A 3SBCA 4BL7B 4ZB9A 3KD0A 1Z7RA 1G7EA 5G5FA 2F9SA 2VCXA 2IFQA 4GQFA 4KB3A 4YKFA 3RAZA 1HNCA 5AISA 1Q98A 3TKRA 5IPHA 7GSSA 2K8VA 3HVVA 5ECSA 2IMFA 4DEJA 3GKNA 2EIRA 2IMDA 4X0XA 4G2EA 2TIRA 1F9MA 5IOWA 5GSTA 2YWNA 5KOWA 2GLRA 4KSOA 4FQUA 1UC7A 2E2GA 4TW5A 6GSVA 2PERA 2L59A 1LBKA 2FD3A 5H5QA 1V9WA 4LMWA 4Z7XA 2CX4A 1B9YC 1VRSD 5HQPA 5A5KA 2B3SA 4K7OA 3CXGA 5GSSA 2B6MA 3IHQA 2NBSA 2VO4A 1ZZYA 3ME7A 4N10A 2FA8A 3KJYA 4GSSA 1XWGA 1WE0A 2Z9SA 4HQZA 2JU5A 2ON7A 1TRUA 2J9HA 5C00A 5CAXA 3EPTA 3GKKA 3P2AA 4LA1A 2H74A 1M2DA 18GSA 1KEBA 4TXVA 3VWXA 3QR6A 1F3BA 3FW2A 1GTIA 5HFKA 4WF4A 2XBQA 3HDCA 3ZFBA 2H76A 3TKPA 3EMXA 5J41A 1JFUA 3GKMA 1ZL9A 5KN1A 1AIUA 4PTSA 1ZYNA 3VI5A 1USBA 3F63A 4KW6A 1SL0B 1XCCA 3BCIA 2C80A 3CSHA 3GX8A 5CO3A 1B9XC 1X5DA 1QXHA 5JCUA 4HS1A 4FYCA 2WCIA 4FYBA 3DKSA 5F8BA 1FVJA 3F6DA 4DSSA 2YJ7A 3CRUA 3L4NA 2F51A 4ZL8A 1GUKA 5ABRA 1QK8A 3FKFA 4PQHA 1JHBA 1K3LA 3D22A 2K8SA 5KOXA 3LQ7A 2HNLA 3I9V2 3M9JA 1SYXA 4GF0A 1KBNA 1FHEA 1Z6MA 1NW2A 1DE1A 1T8EB 2CX3A 1EOHA 2WRTA 4L8EA 1M7TA 2IWTA 2R2JA 4MZCA 4XHMA 4TR1A 4DSQA 4KUNA 4EVMA 1R26A 3FR9A 4YAVA 1GRXA 3PPUA 5J3RA 3LWAA 5IMCA 3GH9A 2YPMA 2H6ZA 2AB6A 4IQAA 5DCHA 2YV7A 3US3A 1WJKA 1YZXA 2TRXA 3FZ5A 6GSTA 2PVQA 2E0QA 4EL1A 2WJUA 4LMVA 4H86A 4IBPA 5KN0A 4X4JA 4GLTA 1B8XA 3H8QA 1ZCPA 1V98A 5ECHB 3GX0A 1XXUA 2QA2A 2VL3A 3ED3A 3KMOA 3ZIVA 1FOHA 3QFAC 1M2BA 3HD5A 4V1Ag 4PUFC 4HOJA 1BEDA 2CZ2A 5KN3A 3KXOA 2IMEA 2H0IA 3WD6A 3BJ5A 5INYA 2K6VA 4I6XA 3BD2A 4OO4A 2CAQA 3MYDA 4YH2A 5JCWA 1JZDA 2HYXA 3U6VA 3TKSA 2AAWA 3FZ4A 2B1LA 2N5FA 4HQSA 4PGTA 3CSIA 2VLVA 2IFQB 2ALBA 1RK4A 5C04A 1X9WB 3RPPA 4O92A 1SL2B 3MIXA 1S3AA 1AAZA 1XW6A 3IBHA 5AN1A 2LQOA 3IK7A 1SK0A 2GQMA 4AGSA 3HHVA 3R2QA 1YEXA 2HRNA 1N8JA 2HT9A 2H0HA 1PD21 3DXBA 2ON5A 22GSA 1AW9A 3F0IA 3APSA 5G1LA 4CW9A 20GSA 4PQ1A 2DBCA 5F07A 3CMIA 1MD4A 3GA4A 2ZNMA 3S9FA 4IGJA 12GSA 3WYWA 5G2ZA 3LSZA 5IPGA 3OR5A 1XWKA 2LJRA 4OO5A 1XBSA 5IMZA 2PWJA 2E2MA 2LJKA 4Q5NA 3QPMA 3IR4A 1SK2A 5CRDA 2M72A 4NV2A 5KEJA 4JR6A 1A2MA 2VUPA 2B7JA 1MDJA 2WULA 4GWRA 4K0GA 2H19A 5HFIA 1YKAA 3QAVA 4BWQA 1G6YA 2V2GA 4MPGA 4OFMA 3GH6A 4MH3A 2CV4A 3W8JA 1FB6A 4MF7A 2R37A 2X49A 1TI1A 3HZ8A 1K0MA 2CZ3A 1T3BA 2C0GA 4WF5A 4ZB6A 4ZBBA 2XPEA 2I81A 1FAAA 1NHYA 3TUEA 4USSA 4EXJA 2FNOA 2C1YA 3NIVA 5AIXA 3G7YA 2CVBA 5EY6A 3APQA 3C1RA 4X43A 1E6BA 3VLNA 3E0UA 2QC7A 1W89A 2IMIA 1XIYA 1X5CA 1KTEA 2H8LA 9GSSA 5CP1A 4PX1A 2L5LA 4MCUA 2OE3A 4I2TA 3QDNA 2PVOC 1F2EA 2HE3A 4EIQA 6GSXA 4K0NA 4JZQA 5A4UA 3L9SA 3VURA 2V41A 4XCSA 2CVDA 2P5RA 3IRAA 2VL2A 3DWVA 4MZWA 1PX6A 2HSYA 6GSYA 4P3YB 3D21A 5IMFA 5HR3A 3LW9A 2FY6A 1IYIA 5ECQB 1XWAA 5DALA 4NHWA 4OFNA 4PNFA 3V1WA 5ECRB 1GULA 2VLTA 4KCEA 3DEXA 4KCAA 4WETA 3LYKA 1ZGNA 3C73A 1THOA 4G0KA 3QMXA 4TR1B 1PN9A 1PL1A 1SJIA 1ERVA 2F8AA 4HDEA 1U6TA 2LNTA 5G5EA 1U3AA 4K2DA 4N0VA 1WRYA 4TR3A 4OCFA 1MEKA 1AC1A 3IC4A 5J5NA 1K3OA 4FH8A 4V2LA 3DGQA 3GN3A 2OJLA 3GMFA 5ECIB 3TJGA 2YWIA 3UVHA 1HNBA 1TXXA 5HR0A 1OC8A 2NPBA 1E2YA 2DKIA 1PX7A 2VCTA 4G9HA 3GYKA 4PUAA 2LEGA 4ECCA 4OMVA 1TK8B 1PQNA 4KF9A 4GSTA 4I8BA 13GSA 2DLXA 4F9ZA 4L5LA 5CYYA 1NHOA 4ICYA 4XTSA 1MTCA 3UOMA 1OYJA 4GTUA 1NM3A 1XWBA 5DAKA 1Z3EA 1EWXA 4F2IA 1HD2A 4Q5RA 1I9DA 1PL2A 2CT6A 1DUGA 3I69A 2G2QA 2RIIA 2GTUA 4G10A 1TI3A 3UVTA 4LL4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERW A;  3ZVJ A;  4IKH A;  2KLX A;  3CBU A;  3GKX A;  2WB9 A;  1GNE A;  5E59 A;  4WR5 A;  1WWJ A;  2PUK C;  4V2N A;  3IV4 A;  2C8U A;  5J4U A;  3M9K A;  3L0H A;  3IE3 A;  2H6X A;  4EC0 A;  3ERW A;  4GCI A;  2MMO A;  2WDU A;  2GSR A;  1MDK A;  3UBL A;  4JU5 A;  1ST9 A;  2WGR A;  2LRN A;  3EIN A;  3GUS A;  3GTU A;  2L4Q A;  2RM5 A;  3HZ4 A;  4D73 A;  3LEF A;  5IM9 A;  2OAC A;  3VK9 A;  5H5S A;  2LUS A;  4NAX A;  3GL3 A;  2XBI A;  1GSD A;  1M9B A;  2IJY A;  4KGI A;  4NWY A;  1Q4J A;  2L6C A;  2ZUP A;  5FT3 A;  1ZOF A;  1HYU A;  4N30 A;  1Z6N A;  1K0C A;  3UL3 A;  3RHB A;  1K3Y A;  3BCK A;  3HYP A;  1SU9 A;  3TJK A;  3LGC A;  2A2S A;  5D9W A;  3KIJ A;  3G7I A;  4IW9 A;  4OD7 A;  5DBQ A;  1EP8 A;  3ME8 A;  1AUC A;  2GT5 A;  2DIZ A;  1UVZ A;  2VL2 C;  2M46 A;  3F4S A;  2AUV A;  2H71 A;  4O32 A;  1O85 A;  2FCH A;  2O8V B;  1PMT A;  4ZBD A;  2QSI A;  5DCG A;  1OE7 A;  2GSQ A;  2I9H A;  1SKW B;  1V58 A;  4TKY A;  3TRX A;  1VF4 A;  4HJ2 A;  1PKZ A;  3RDW A;  3P7X A;  3HCZ A;  1XZO A;  1O8W A;  1B4Q A;  3TOT A;  2VL9 A;  3NZN A;  6GSU A;  3ZTL A;  2VIM A;  2R6K A;  2V6K A;  3KH7 A;  1ABA A;  3Q18 A;  4YQM A;  3MDK A;  1K0B A;  2H1A A;  1A0R P;  1SD8 A;  3BBY A;  2VD0 A;  3TB2 A;  3UMA A;  1SK1 A;  4V2M A;  1XFL A;  5DAL B;  2C3Q A;  2AYT A;  5G31 A;  2IL3 A;  5G1K A;  1TK0 B;  1J0F A;  3FHK A;  5JWQ B;  5H5R A;  4KH7 A;  2GST A;  1RQM A;  2B1K A;  4WR4 A;  2MMN A;  1S3C A;  1J9B A;  1X5E A;  5EVO A;  4J2F A;  4MZB A;  2HSH A;  3NOF A;  4PXO A;  5FHI A;  1Z7P A;  2TRC P;  4MF6 A;  4MMM A;  3M3M A;  4WEY A;  4KA0 A;  2PPT A;  1BAY A;  1SEN A;  1T1V A;  5GZZ B;  1GUH A;  4DSR A;  3LYP A;  4Q5F A;  1LJR A;  2YZH A;  4HU7 A;  1TW9 A;  4FIW A;  3TRQ A;  4POM A;  2H73 A;  1EV4 A;  3F4T A;  1GWC A;  4QQ7 A;  2KUC A;  3ZVJ D;  2EIQ A;  4HEA 2;  1BQ7 A;  5CNW A;  3D5J A;  5ELA A;  4TOP A;  1TRW A;  2YV9 A;  1VF2 A;  3UJ1 A;  3GIX A;  2I3Y A;  2L4C A;  3KTL A;  2H1B A;  2PN8 A;  2CA8 A;  3EU4 A;  1M0U A;  2KP1 A;  1YY7 A;  8GSS A;  4OWY A;  3CYN A;  4WXT A;  5F0G A;  2RUF A;  3C8E A;  3ZIJ A;  3CTF A;  2XC2 A;  3F6F A;  1ML6 A;  2R4V A;  3KP8 A;  3O76 A;  4I2U A;  1QFN A;  2C4J A;  1HNA A;  5E4W A;  2X8H A;  5DAK B;  5CRW A;  5ELG A;  2WS2 A;  2WFC A;  3G9B A;  4XS6 A;  1WP0 A;  1G0T A;  1N2A A;  4BVY A;  4GSN A;  2XPD A;  2O89 A;  3K8N A;  1YF0 A;  5JWR B;  3UAR A;  1XW5 A;  1K0D A;  3APO A;  4AF2 A;  1TTZ A;  4IQ1 A;  4I97 A;  3MAK A;  4TXO A;  5F05 A;  3ZZX A;  1FW1 A;  2FWH A;  4X1U A;  4XS4 A;  1GNW A;  1G7O A;  3GTU B;  3IOS A;  3IAS 2;  4D73 B;  2H70 A;  3ZFL A;  3DML A;  2KHP A;  1BX9 A;  2HI7 A;  1GP1 A;  2BJX A;  2JL4 A;  2VAF A;  3KMN A;  3WGE A;  4N0Z A;  3IA1 A;  4POB A;  4BA7 A;  3EVI A;  1F6M C;  5LD0 A;  3DVX A;  2PMT A;  1FO5 A;  1SKS B;  1QUW A;  2LST A;  3J7Y k;  2C0E A;  4K7N A;  3WGD A;  2GVP A;  3HY2 A;  3GNJ A;  4RI7 A;  4IP1 A;  1QMV A;  2FGX A;  3L78 A;  2YAN A;  4J57 E;  4EE0 A;  1DE2 A;  3QAW A;  4BVX A;  2VM1 A;  4TN8 A;  1TU7 A;  2HRF A;  2GDR A;  3DRN A;  3A2W A;  3TCO A;  4JR4 A;  3ZRD A;  4TVE A;  2MBS A;  2FWF A;  4K1F A;  1A2J A;  1AQV A;  2GGT A;  2OA7 A;  5AIV A;  1OE8 A;  1CQH A;  1VGL A;  2HZF A;  2FA4 A;  5DJM A;  4MLY A;  5ECL B;  1R4W A;  5JCG A;  3J7Y b;  3ZRE A;  2H30 A;  2H1G A;  2QGV A;  1ON4 A;  3M1G A;  1JZR A;  4O7H A;  5JWO B;  3D6I A;  2P0G A;  1PRX A;  2KOK A;  5D9V A;  5EL8 A;  4HU9 A;  2H66 A;  4ZIJ A;  2M80 A;  3P90 A;  4EDZ A;  3RBT A;  4KDY A;  4F82 A;  1OKD A;  1JLW A;  5IIZ A;  2DJ1 A;  4XIH A;  3I6A A;  2F3M A;  2N5A A;  1WPI A;  4EKZ A;  2JZR A;  5GAN D;  4DSS B;  3L9V A;  1OVN A;  4POL A;  2OE1 A;  3FK8 A;  5LNK e;  3IXR A;  2DMM A;  2FHE A;  3HVX A;  5CRG A;  4MJB A;  2VM2 A;  1ZMA A;  1JLV A;  3TGZ A;  2LJA A;  3KGK A;  3PGT A;  2IMK A;  2LS5 A;  2GT6 A;  1O81 A;  2IN3 A;  5DQY A;  1HQO A;  2AV4 A;  2DML A;  2JZS A;  1QQ2 A;  2B5X A;  1V2A A;  5ECP B;  4HJM A;  5IO0 A;  4Q5Q A;  3DIE A;  3EWL A;  3VWV A;  3WGX A;  2JZT A;  4MF5 A;  3TKS C;  4PNG A;  1GSS A;  1SD9 A;  3GV1 A;  1FB0 A;  4E8E A;  2ES7 A;  2HLS A;  2AHE A;  3EE2 A;  4MAB A;  3VFI A;  2OAD A;  2GS3 A;  4YQU A;  1R7H A;  1GSF A;  2YWM A;  3Q74 A;  1TK5 B;  3HKR A;  2X64 A;  1OKT A;  5GAP D;  4IJI A;  3ZMK A;  4QL7 A;  4K7I A;  4NV5 A;  2MMA A;  3F4R A;  3QOU A;  2YP6 A;  3SWL A;  3GST A;  5ECO B;  1YKC A;  4GRF A;  3EUR A;  2V6O A;  2DJK A;  1TKD B;  1GH2 A;  2NDO A;  3N5O A;  3W8S A;  2LQQ A;  4BWS A;  4ZL9 A;  1EGO A;  4NPB A;  2A4V A;  2HZE A;  2RLI A;  1Y6E A;  3ZYW A;  4WBJ A;  2IIY A;  4TXO B;  1X9M B;  1IYH A;  4ACS A;  4BPY A;  4DVC A;  4ZB8 A;  3TJF A;  4XS4 B;  4MDC A;  2JSZ A;  4F0C A;  2PGT A;  4RQR A;  1A0F A;  4CHS A;  4V1A p;  4XS1 A;  2PU9 C;  3GHA A;  3PR8 A;  3E9J B;  5IQY A;  1LU4 A;  2P31 A;  2OKA A;  4MA9 A;  2L6D A;  5B8A A;  1XVQ A;  4ID0 A;  3LG6 A;  3P8W A;  5L71 A;  4MPF A;  1SKR B;  3FR3 A;  4K8M A;  4PUR A;  1BG5 A;  3GL5 A;  4MJA A;  4KAE A;  1K0A A;  3PH9 A;  1A23 A;  1V57 A;  2FUG 2;  3DD3 A;  1GL8 A;  2BMX A;  2H01 A;  3H1N A;  4TR4 A;  1TDI A;  2YNX A;  4IP6 A;  4MP4 A;  1Z5Y E;  3D4M A;  2B5Y A;  3RPN A;  1TJD A;  3BOA A;  1R5P A;  4F0B A;  4ULX A;  3N9J A;  3VPT A;  2YOI A;  1AQW A;  1A24 A;  5ID2 A;  3EYT A;  3CTG A;  5D9T A;  1W4V A;  1H4O A;  1TOF A;  2I4A A;  3PIN A;  1JZO A;  1U88 A;  2GZP A;  3KZQ A;  4RI6 A;  3VI7 A;  4RUV A;  1Z9H A;  5KN2 A;  2DJJ A;  3FY7 A;  2YZU A;  3IDV A;  1FOV A;  4MK3 A;  1H75 A;  3A2V A;  2O7K A;  1AXD A;  3Q6O A;  4E8H A;  3EMP A;  2YN1 A;  2K9F A;  1EV9 A;  2FWG A;  1GTB A;  1T4Z A;  2LV3 A;  4HI7 A;  4OCE A;  3FEU A;  2V32 A;  3ISO A;  1YDK A;  2EIO A;  3HVS A;  4RQX A;  1B4P A;  2C0D A;  3F9U A;  3GSS A;  2HFD A;  3GUR A;  3TOU A;  2H75 A;  1KNG A;  1U87 A;  2N5B A;  4MH2 A;  2LRC A;  3ZIT A;  1EGR A;  2L57 A;  2CVK A;  1X9S B;  5HR2 A;  1SJ6 A;  1MDI A;  4ML1 A;  3A2X A;  1ERT A;  4ECI A;  5ECN B;  3QFB C;  3ZLP A;  3CSJ A;  4FYU A;  2GQK A;  1SL1 B;  4GXZ A;  1MD3 A;  2F8F A;  3FR6 A;  2JAD A;  1T7P B;  1VF1 A;  2NVL A;  4HZ4 A;  1UN2 A;  2E7P A;  1ZYQ B;  4NHZ A;  1B48 A;  3KCM A;  1GUM A;  2XHF A;  2JSY A;  1F37 A;  1M2A A;  1OC9 A;  3WT1 A;  3A3T A;  2I1U A;  4TR0 A;  1UA5 A;  1G6W A;  1XVW A;  2AJQ B;  4ZL7 A;  4IEL A;  4JBB A;  1GSE A;  1V40 A;  3HXS A;  5B8B A;  5HR1 A;  3M0F A;  3KP9 A;  4EUY A;  3KH9 A;  1RW1 A;  5G30 A;  3F3Q A;  2PBJ A;  4KSM A;  2CQ9 A;  2REM A;  1S3D A;  2DIY A;  2ZCT A;  3HJO A;  2D2Z A;  1GSY A;  3ERG A;  3H4K A;  5D8I A;  4POK A;  3KM6 A;  2H1D A;  2X99 A;  3UAP A;  1SJZ A;  3W6G A;  4G19 A;  5B7C A;  4JE1 A;  4ECB A;  1M9A A;  3E3E A;  1URM A;  1GTA A;  1GSQ A;  1SYR A;  3QAG A;  1WIK A;  2HZE B;  2YCD A;  3VWU A;  3O6T A;  1R5A A;  3LJR A;  4IJ3 A;  2VD1 A;  4XRD A;  1EZK A;  1I5G A;  1XOA A;  1PSQ A;  3H93 A;  4O5R A;  1M99 A;  2O87 A;  2K18 A;  2MMZ A;  5DVB A;  1GSU A;  4EF0 A;  4ZBA A;  5IMV A;  3EC3 A;  5ECK B;  2OBK A;  4HZ2 A;  2LNS A;  5IOX A;  3F8U A;  1A8Y A;  3UEM A;  3I43 A;  4WKW A;  1A2L A;  2MBT A;  1XOB A;  3F3R A;  1PA3 A;  4L0U A;  5DQS A;  2DJ0 A;  6GSS A;  5LCZ A;  2GSS A;  4ZXG A;  4L0W A;  1OC3 A;  2DJ2 A;  4ZIL A;  1FG4 A;  1U3I A;  19GS A;  4ML6 A;  3VPQ A;  1TRS A;  4MJE A;  1DBY A;  5A4W A;  3FZA A;  2BTO T;  1PKW A;  2VOC A;  4BL7 A;  2EC4 A;  1J08 A;  2GZY A;  5DJL A;  5D96 A;  3FZ9 A;  5ID2 B;  1ZYE A;  5IMD A;  2VCQ A;  5EPF A;  3ERF A;  4F03 A;  3G7J A;  4GQC A;  1WOU A;  3KEB A;  4KDX A;  3C7M A;  4IS0 A;  4HUA A;  1ERU A;  2VCZ A;  1GTU A;  2GZZ A;  14GS A;  4NMU A;  1GLQ A;  5IMA A;  5J9C A;  2B5E A;  1WMJ A;  2WZ9 A;  3HJM A;  1EOG A;  1XWC A;  3KTB A;  3DVW A;  2LRT A;  5FWG A;  4NXI A;  1QGV A;  1CQG A;  3O3T A;  5CRH A;  1ACV A;  4JRR A;  3TJB A;  1K0N A;  2JAC A;  1VF3 A;  3AY8 A;  5B6N A;  2FLS A;  2HXK A;  4K6X A;  1BYE A;  3TRP A;  1K0O A;  4J56 E;  3TDG A;  1FVK A;  4YAP A;  5F06 A;  3C71 A;  2V1M A;  3IAM 2;  4XRA A;  2OE0 A;  1O73 A;  4LL1 B;  3TKS E;  3IK9 A;  3MSZ A;  3C1S A;  2R5G A;  2H0G A;  3M8N A;  1EEJ A;  5COH A;  5D93 A;  1TU8 A;  1C72 A;  1TP9 A;  1ILO A;  2YWO A;  2VCW A;  1XW9 A;  2DJ3 A;  3LXT A;  4MJC A;  1JZW A;  3UIW A;  4IHU A;  4I5Q A;  1O7U A;  4ILF A;  4KDU A;  3RHC A;  4AJ6 A;  3D4T A;  2X8C A;  4N11 A;  1OAZ A;  1F3A A;  2LKU A;  2OBI A;  4KX4 A;  2C0F A;  1O6J A;  2GQL A;  5A4V A;  4WBR D;  2X8G A;  4ISD A;  2P5Q A;  4JED A;  3H79 A;  5J9B A;  3FRC A;  1YQ1 A;  3TJJ A;  1O8X A;  1AQX A;  1YJ6 A;  3IPZ A;  5B6M A;  4AJ7 A;  1OC9 B;  2C3N A;  3MNG A;  1YF1 A;  3JCM L;  4OFT A;  1BJX A;  4L5O A;  3FYG A;  1EP7 A;  2B7K A;  1XPV A;  5HFG A;  5IO2 A;  4PQI A;  3WT2 A;  2H6Y A;  4IN0 A;  1GLP A;  4IVF A;  3GFK A;  5CRE A;  5DDL A;  11GS A;  4K9Z A;  1DSB A;  3QD9 A;  2VCV A;  5ENU A;  5D73 A;  2IPA A;  3HA9 A;  2QKE A;  10GS A;  2YJH A;  3ZML A;  3CRT A;  3GRX A;  4KND A;  4CDO A;  1NSW A;  2L5O A;  4FO5 A;  3UBK A;  2O85 A;  4TRX A;  3DYR A;  2NTO A;  1T4Y A;  2C3T A;  4EDY A;  3TKQ A;  4YQV A;  17GS A;  3LFL A;  3Q19 A;  2R3X A;  5AGY A;  3D0Z A;  2RM6 A;  3A5W A;  3MWH A;  2CAI A;  1EEM A;  3ZL5 A;  1TRV A;  1PGT A;  5ECM B;  2J23 A;  6GSW A;  1T00 A;  1Y25 A;  2KP2 A;  2LTK A;  3VWW A;  1THX A;  4KE3 A;  2G0F A;  2VLU A;  4AJ8 A;  16GS A;  4ECJ A;  3L9U A;  5D9X A;  3LXZ A;  2FWE A;  2MZC A;  4LLR A;  2MYG A;  2RUE A;  3EU3 A;  2A2R A;  2DSA A;  3U5R E;  2DC5 A;  1YEP A;  4QL9 A;  2H72 A;  3HJP A;  3LOR A;  1X0R A;  1A8L A;  3QCP A;  4EO3 A;  3SBC A;  4ZB9 A;  3KD0 A;  1Z7R A;  1G7E A;  5G5F A;  2F9S A;  2VCX A;  2IFQ A;  4GQF A;  4KB3 A;  3RAZ A;  1HNC A;  5AIS A;  1Q98 A;  3TKR A;  5IPH A;  7GSS A;  2K8V A;  3HVV A;  5ECS A;  2IMF A;  4DEJ A;  3GKN A;  2EIR A;  2IMD A;  4X0X A;  4G2E A;  2TIR A;  1F9M A;  5IOW A;  5GST A;  2YWN A;  2GLR A;  4KSO A;  1UC7 A;  2E2G A;  4TW5 A;  6GSV A;  2PER A;  2L59 A;  1LBK A;  2FD3 A;  5H5Q A;  1V9W A;  4LMW A;  4Z7X A;  2CX4 A;  1B9Y C;  1VRS D;  5HQP A;  5A5K A;  2B3S A;  4K7O A;  3CXG A;  5GSS A;  2B6M A;  3IHQ A;  2NBS A;  2VO4 A;  1ZZY A;  3ME7 A;  4N10 A;  2FA8 A;  3KJY A;  4GSS A;  1XWG A;  1WE0 A;  2Z9S A;  4HQZ A;  2JU5 A;  2ON7 A;  1TRU A;  2J9H A;  5C00 A;  5CAX A;  3GKK A;  3P2A A;  4LA1 A;  2H74 A;  1M2D A;  18GS A;  1KEB A;  4TXV A;  3VWX A;  3QR6 A;  1F3B A;  3FW2 A;  1GTI A;  5HFK A;  4WF4 A;  2XBQ A;  3HDC A;  3ZFB A;  2H76 A;  3TKP A;  3EMX A;  5J41 A;  1JFU A;  3GKM A;  1ZL9 A;  5KN1 A;  1AIU A;  3VI5 A;  1USB A;  3F63 A;  4KW6 A;  1SL0 B;  1XCC A;  3BCI A;  2C80 A;  3CSH A;  3GX8 A;  5CO3 A;  1B9X C;  1X5D A;  1QXH A;  5JCU A;  4HS1 A;  4FYC A;  2WCI A;  4FYB A;  3DKS A;  5F8B A;  1FVJ A;  3F6D A;  4DSS A;  2YJ7 A;  3CRU A;  3L4N A;  2F51 A;  4ZL8 A;  1GUK A;  5ABR A;  1QK8 A;  3FKF A;  4PQH A;  1JHB A;  1K3L A;  3D22 A;  2K8S A;  3LQ7 A;  2HNL A;  3I9V 2;  3M9J A;  1SYX A;  4GF0 A;  1KBN A;  1FHE A;  1Z6M A;  1NW2 A;  1DE1 A;  1T8E B;  2CX3 A;  1EOH A;  2WRT A;  4L8E A;  1M7T A;  2IWT A;  2R2J A;  4MZC A;  4XHM A;  4TR1 A;  4DSQ A;  4KUN A;  4EVM A;  1R26 A;  3FR9 A;  4YAV A;  1GRX A;  5J3R A;  3LWA A;  5IMC A;  3GH9 A;  2YPM A;  2H6Z A;  2AB6 A;  4IQA A;  5DCH A;  2YV7 A;  3US3 A;  1WJK A;  1YZX A;  2TRX A;  3FZ5 A;  6GST A;  2PVQ A;  2E0Q A;  4EL1 A;  2WJU A;  4LMV A;  4H86 A;  4IBP A;  5KN0 A;  4GLT A;  1B8X A;  3H8Q A;  1ZCP A;  1V98 A;  5ECH B;  3GX0 A;  1XXU A;  2VL3 A;  3ED3 A;  3KMO A;  3ZIV A;  3QFA C;  1M2B A;  3HD5 A;  4V1A g;  4PUF C;  4HOJ A;  1BED A;  2CZ2 A;  5KN3 A;  3KXO A;  2IME A;  2H0I A;  3WD6 A;  3BJ5 A;  5INY A;  2K6V A;  4I6X A;  3BD2 A;  4OO4 A;  2CAQ A;  4YH2 A;  5JCW A;  1JZD A;  2HYX A;  3U6V A;  3TKS A;  2AAW A;  3FZ4 A;  2B1L A;  2N5F A;  4HQS A;  4PGT A;  3CSI A;  2VLV A;  2IFQ B;  2ALB A;  1RK4 A;  5C04 A;  1X9W B;  3RPP A;  4O92 A;  1SL2 B;  1S3A A;  1AAZ A;  1XW6 A;  3IBH A;  5AN1 A;  2LQO A;  3IK7 A;  1SK0 A;  2GQM A;  4AGS A;  3HHV A;  3R2Q A;  1YEX A;  2HRN A;  1N8J A;  2HT9 A;  2H0H A;  1PD2 1;  3DXB A;  2ON5 A;  22GS A;  1AW9 A;  3F0I A;  3APS A;  5G1L A;  4CW9 A;  20GS A;  4PQ1 A;  5F07 A;  2DBC A;  3CMI A;  1MD4 A;  3GA4 A;  2ZNM A;  3S9F A;  4IGJ A;  12GS A;  3WYW A;  5G2Z A;  3LSZ A;  5IPG A;  3OR5 A;  1XWK A;  2LJR A;  4OO5 A;  1XBS A;  5IMZ A;  2PWJ A;  2E2M A;  2LJK A;  4Q5N A;  3QPM A;  3IR4 A;  1SK2 A;  5CRD A;  2M72 A;  4NV2 A;  5KEJ A;  4JR6 A;  1A2M A;  2VUP A;  2B7J A;  1MDJ A;  2WUL A;  4GWR A;  4K0G A;  2H19 A;  5HFI A;  1YKA A;  3QAV A;  4BWQ A;  1G6Y A;  2V2G A;  4MPG A;  4OFM A;  3GH6 A;  4MH3 A;  2CV4 A;  3W8J A;  1FB6 A;  4MF7 A;  2R37 A;  1TI1 A;  3HZ8 A;  1K0M A;  2CZ3 A;  1T3B A;  2C0G A;  4WF5 A;  4ZB6 A;  4ZBB A;  2XPE A;  2I81 A;  1FAA A;  1NHY A;  3TUE A;  4EXJ A;  2FNO A;  2C1Y A;  3NIV A;  5AIX A;  3G7Y A;  2CVB A;  5EY6 A;  3APQ A;  3C1R A;  4X43 A;  1E6B A;  3VLN A;  3E0U A;  2QC7 A;  1W89 A;  2IMI A;  1XIY A;  1X5C A;  1KTE A;  2H8L A;  9GSS A;  5CP1 A;  4PX1 A;  2L5L A;  4MCU A;  2OE3 A;  4I2T A;  3QDN A;  2PVO C;  1F2E A;  2HE3 A;  6GSX A;  4K0N A;  4JZQ A;  5A4U A;  3L9S A;  3VUR A;  2V41 A;  4XCS A;  2CVD A;  2P5R A;  3IRA A;  2VL2 A;  3DWV A;  4MZW A;  1PX6 A;  2HSY A;  6GSY A;  4P3Y B;  3D21 A;  5IMF A;  5HR3 A;  2FY6 A;  1IYI A;  5ECQ B;  1XWA A;  5DAL A;  4NHW A;  4OFN A;  4PNF A;  3V1W A;  5ECR B;  1GUL A;  2VLT A;  4KCE A;  3DEX A;  4KCA A;  4WET A;  3LYK A;  1ZGN A;  3C73 A;  1THO A;  3QMX A;  4TR1 B;  1PN9 A;  1PL1 A;  1SJI A;  1ERV A;  2F8A A;  4HDE A;  1U6T A;  2LNT A;  5G5E A;  1U3A A;  4K2D A;  4N0V A;  1WRY A;  4TR3 A;  4OCF A;  1MEK A;  1AC1 A;  3IC4 A;  5J5N A;  1K3O A;  4FH8 A;  4V2L A;  3DGQ A;  3GN3 A;  2OJL A;  3GMF A;  5ECI B;  3TJG A;  2YWI A;  3UVH A;  1HNB A;  1TXX A;  5HR0 A;  1OC8 A;  2NPB A;  1E2Y A;  1PX7 A;  2VCT A;  4G9H A;  3GYK A;  4PUA A;  2LEG A;  4ECC A;  4OMV A;  1TK8 B;  1PQN A;  4GST A;  4I8B A;  13GS A;  2DLX A;  4F9Z A;  4L5L A;  5CYY A;  1NHO A;  4XTS A;  1MTC A;  3UOM A;  1OYJ A;  4GTU A;  1NM3 A;  1XWB A;  5DAK A;  1Z3E A;  1EWX A;  4F2I A;  1HD2 A;  4Q5R A;  1I9D A;  1PL2 A;  2CT6 A;  1DUG A;  3I69 A;  2G2Q A;  2RII A;  2GTU A;  4G10 A;  1TI3 A;  3UVT A;  4LL4 B; 
#chains in the Genus database with same CATH topology
 1ERW A;  3ZVJ A;  4IKH A;  2KLX A;  3CBU A;  3GKX A;  2WB9 A;  3IC8 A;  1GNE A;  5E59 A;  4WR5 A;  1WWJ A;  2PUK C;  4V2N A;  3IV4 A;  2C8U A;  5J4U A;  3M9K A;  3L0H A;  3IE3 A;  4BIK A;  2H6X A;  5BMU A;  4EC0 A;  3ERW A;  4GCI A;  2MMO A;  2WDU A;  2GSR A;  1MDK A;  3UBL A;  4JU5 A;  1ST9 A;  2WGR A;  2LRN A;  3EIN A;  3GUS A;  3GTU A;  2L4Q A;  4K2X A;  2RM5 A;  3HZ4 A;  4D73 A;  3LEF A;  5IM9 A;  2OAC A;  3VK9 A;  5H5S A;  2LUS A;  4NAX A;  3GL3 A;  2XBI A;  1GSD A;  1M9B A;  2IJY A;  4KGI A;  4NWY A;  1Q4J A;  2L6C A;  2ZUP A;  5FT3 A;  1ZOF A;  1HYU A;  4N30 A;  1Z6N A;  1PN0 A;  1K0C A;  3UL3 A;  3RHB A;  1K3Y A;  4HSC X;  3IHG A;  3BCK A;  3HYP A;  3CQF A;  1SU9 A;  3TJK A;  3LGC A;  2A2S A;  5D9W A;  4MNN A;  3KIJ A;  3G7I A;  2DKH A;  4IW9 A;  4OD7 A;  5DBQ A;  1EP8 A;  3ME8 A;  1AUC A;  2GT5 A;  2DIZ A;  1UVZ A;  2VL2 C;  2M46 A;  3F4S A;  2AUV A;  2H71 A;  4O32 A;  1O85 A;  2FCH A;  2O8V B;  1PMT A;  4ZBD A;  2QSI A;  5DCG A;  1OE7 A;  2GSQ A;  2I9H A;  1SKW B;  1V58 A;  4TKY A;  3TRX A;  2A2P A;  1VF4 A;  4HJ2 A;  1PKZ A;  3RDW A;  3P7X A;  3HCZ A;  1XZO A;  1O8W A;  1B4Q A;  3TOT A;  4O5Q A;  2VL9 A;  3NZN A;  6GSU A;  3ZTL A;  2VIM A;  2R6K A;  2V6K A;  3KH7 A;  1ABA A;  3Q18 A;  4YQM A;  3MDK A;  1K0B A;  2H1A A;  1A0R P;  1SD8 A;  3BBY A;  2VD0 A;  3TB2 A;  3UMA A;  1SK1 A;  4V2M A;  1XFL A;  5DAL B;  2C3Q A;  2AYT A;  5G31 A;  2IL3 A;  5G1K A;  1TK0 B;  1J0F A;  3FHK A;  5JWQ B;  5H5R A;  4KH7 A;  2GST A;  1RQM A;  2B1K A;  4WR4 A;  4CY6 A;  2MMN A;  1S3C A;  1J9B A;  1X5E A;  4G0L A;  5EVO A;  4J2F A;  4MZB A;  2HSH A;  3NOF A;  4PXO A;  5FHI A;  5BRT A;  1Z7P A;  2TRC P;  4MF6 A;  4MMM A;  3M3M A;  4WEY A;  4KA0 A;  2PPT A;  1BAY A;  1SEN A;  1T1V A;  5GZZ B;  1GUH A;  4DSR A;  3LYP A;  4Q5F A;  1LJR A;  2YZH A;  4HU7 A;  1TW9 A;  4FIW A;  3TRQ A;  4POM A;  2H73 A;  1EV4 A;  3F4T A;  1GWC A;  4QQ7 A;  2KUC A;  3ZVJ D;  2EIQ A;  4HEA 2;  1BQ7 A;  5CNW A;  3D5J A;  5ELA A;  4TOP A;  1TRW A;  2YV9 A;  1VF2 A;  3UJ1 A;  3GIX A;  2I3Y A;  2L4C A;  3KTL A;  2H1B A;  2PN8 A;  2CA8 A;  3EU4 A;  1M0U A;  2KP1 A;  1YY7 A;  2R0C A;  8GSS A;  4OWY A;  3CYN A;  4WXT A;  5F0G A;  2RUF A;  3C8E A;  3ZIJ A;  4YKG A;  3CTF A;  2XC2 A;  3F6F A;  1ML6 A;  2R4V A;  3KP8 A;  3O76 A;  4I2U A;  1QFN A;  2C4J A;  1HNA A;  5E4W A;  2X8H A;  5DAK B;  5CRW A;  5ELG A;  2WS2 A;  2WFC A;  3G9B A;  4XS6 A;  1WP0 A;  1G0T A;  1N2A A;  4BVY A;  4GSN A;  2XPD A;  2O89 A;  3K8N A;  1YF0 A;  5JWR B;  3UAR A;  1XW5 A;  1K0D A;  4Z2R A;  3APO A;  4AF2 A;  1TTZ A;  4IQ1 A;  4I97 A;  3MAK A;  4TXO A;  5F05 A;  3ZZX A;  1FW1 A;  2FWH A;  4X1U A;  4XS4 A;  1GNW A;  1G7O A;  3GTU B;  3IOS A;  3IAS 2;  4D73 B;  2H70 A;  3ZFL A;  3DML A;  2KHP A;  1BX9 A;  2HI7 A;  1GP1 A;  2BJX A;  2JL4 A;  2VAF A;  3KMN A;  3WGE A;  4N0Z A;  3IA1 A;  4POB A;  4BA7 A;  3EVI A;  1F6M C;  5LD0 A;  3DVX A;  2PMT A;  1FO5 A;  1SKS B;  1QUW A;  2LST A;  3J7Y k;  2HSM A;  2C0E A;  4K7N A;  3WGD A;  2GVP A;  3HY2 A;  3GNJ A;  4RI7 A;  4IP1 A;  1QMV A;  2FGX A;  3L78 A;  2YAN A;  1S3R A;  4J57 E;  4EE0 A;  1DE2 A;  3QAW A;  4BVX A;  2VM1 A;  4TN8 A;  1TU7 A;  2HRF A;  2GDR A;  3DRN A;  3A2W A;  3TCO A;  4JR4 A;  3ZRD A;  4TVE A;  2MBS A;  2FWF A;  4K1F A;  1A2J A;  1AQV A;  2GGT A;  2OA7 A;  5AIV A;  1OE8 A;  1CQH A;  1VGL A;  2HZF A;  2FA4 A;  5DJM A;  4MLY A;  5ECL B;  1R4W A;  5JCG A;  3J7Y b;  3ZRE A;  2H30 A;  2H1G A;  2QGV A;  1ON4 A;  3M1G A;  1JZR A;  4O7H A;  5JWO B;  3D6I A;  2P0G A;  1PRX A;  2KOK A;  5D9V A;  5EL8 A;  4HU9 A;  2H66 A;  4ZIJ A;  2M80 A;  3P90 A;  4EDZ A;  3RBT A;  4KDY A;  4F82 A;  1OKD A;  1JLW A;  5IIZ A;  2DJ1 A;  4XIH A;  3I6A A;  2F3M A;  2N5A A;  1PFO A;  1WPI A;  4EKZ A;  2JZR A;  5GAN D;  4DSS B;  3L9V A;  1OVN A;  4POL A;  2OE1 A;  3FK8 A;  5LNK e;  3IXR A;  2DMM A;  2FHE A;  3HVX A;  5CRG A;  4MJB A;  2VM2 A;  1ZMA A;  1JLV A;  3TGZ A;  2LJA A;  3KGK A;  3PGT A;  2IMK A;  2LS5 A;  2GT6 A;  1O81 A;  2IN3 A;  5DQY A;  1HQO A;  2AV4 A;  2DML A;  2JZS A;  1QQ2 A;  2B5X A;  3A5I A;  1V2A A;  5ECP B;  4HJM A;  5IO0 A;  4Q5Q A;  3DIE A;  3EWL A;  3VWV A;  3WGX A;  2JZT A;  4MF5 A;  3TKS C;  4PNG A;  1GSS A;  1SD9 A;  3GV1 A;  1FB0 A;  4E8E A;  2ES7 A;  2HLS A;  2AHE A;  3EE2 A;  4MAB A;  3VFI A;  2OAD A;  2GS3 A;  4YQU A;  1R7H A;  1GSF A;  2YWM A;  3Q74 A;  1TK5 B;  3HKR A;  2X64 A;  1OKT A;  5GAP D;  4IJI A;  3ZMK A;  4QL7 A;  4K7I A;  4NV5 A;  2MMA A;  3F4R A;  3QOU A;  2YP6 A;  3SWL A;  3GST A;  5ECO B;  1YKC A;  4GRF A;  3EUR A;  2V6O A;  4BVY B;  2DJK A;  1TKD B;  1GH2 A;  2NDO A;  3N5O A;  4G0I A;  3W8S A;  2LQQ A;  4BWS A;  4ZL9 A;  1EGO A;  2QA1 A;  4NPB A;  2A4V A;  2HZE A;  2RLI A;  1Y6E A;  3ZYW A;  4WBJ A;  2IIY A;  4TXO B;  1X9M B;  1IYH A;  4ACS A;  4BPY A;  4DVC A;  4ZB8 A;  3TJF A;  4XS4 B;  4MDC A;  2JSZ A;  4F0C A;  2PGT A;  4RQR A;  1A0F A;  4CHS A;  4V1A p;  4XS1 A;  2PU9 C;  3GHA A;  3PR8 A;  3E9J B;  5IQY A;  1LU4 A;  2P31 A;  2OKA A;  4MA9 A;  2L6D A;  5B8A A;  1XVQ A;  4ID0 A;  3LG6 A;  3P8W A;  5L71 A;  4MPF A;  1SKR B;  3FR3 A;  4K8M A;  4PUR A;  1BG5 A;  3GL5 A;  4MJA A;  4KAE A;  1K0A A;  3PH9 A;  1A23 A;  1V57 A;  2FUG 2;  3DD3 A;  1GL8 A;  2BMX A;  2H01 A;  3H1N A;  4TR4 A;  1TDI A;  2YNX A;  4IP6 A;  4MP4 A;  1Z5Y E;  3D4M A;  4BVX B;  2B5Y A;  3RPN A;  1TJD A;  3BOA A;  1R5P A;  4F0B A;  4ULX A;  3N9J A;  3VPT A;  2YOI A;  1AQW A;  1A24 A;  5ID2 A;  3EYT A;  3CTG A;  5D9T A;  1W4V A;  1H4O A;  1TOF A;  2I4A A;  3PIN A;  1JZO A;  1U88 A;  2GZP A;  3KZQ A;  4RI6 A;  3VI7 A;  4RUV A;  1Z9H A;  5KN2 A;  2DJJ A;  3FY7 A;  2YZU A;  3IDV A;  1FOV A;  4MK3 A;  1H75 A;  3A2V A;  2O7K A;  1AXD A;  3Q6O A;  4E8H A;  3EMP A;  2YN1 A;  2K9F A;  1EV9 A;  2FWG A;  1GTB A;  1T4Z A;  2LV3 A;  4HI7 A;  4OCE A;  2A4H A;  3FEU A;  2V32 A;  3ISO A;  1YDK A;  2EIO A;  3HVS A;  4RQX A;  1B4P A;  2C0D A;  3F9U A;  3GSS A;  2HFD A;  3GUR A;  3TOU A;  2H75 A;  1KNG A;  1U87 A;  2N5B A;  4MH2 A;  2LRC A;  3ZIT A;  1EGR A;  2L57 A;  2CVK A;  1X9S B;  5HR2 A;  1SJ6 A;  1MDI A;  4ML1 A;  3A2X A;  1ERT A;  4ECI A;  5ECN B;  3QFB C;  3ZLP A;  3CSJ A;  1ZYP A;  4FYU A;  2GQK A;  1SL1 B;  4GXZ A;  3R3E A;  1MD3 A;  2F8F A;  3FR6 A;  2JAD A;  1T7P B;  1VF1 A;  2NVL A;  4HZ4 A;  1UN2 A;  2E7P A;  1ZYQ B;  4NHZ A;  1B48 A;  3KCM A;  1GUM A;  4Z2T A;  2XHF A;  2JSY A;  1F37 A;  1M2A A;  1OC9 A;  3WT1 A;  3A3T A;  2I1U A;  4TR0 A;  1UA5 A;  1G6W A;  1XVW A;  2AJQ B;  2R0G A;  4ZL7 A;  1M3J A;  4IEL A;  4JBB A;  1GSE A;  1V40 A;  3HXS A;  5B8B A;  5HR1 A;  3M0F A;  3KP9 A;  4EUY A;  3KH9 A;  1RW1 A;  5G30 A;  3F3Q A;  2PBJ A;  4KSM A;  2CQ9 A;  2REM A;  1S3D A;  2DIY A;  2ZCT A;  3HJO A;  2D2Z A;  1GSY A;  3ERG A;  3H4K A;  5D8I A;  4POK A;  3KM6 A;  2H1D A;  2X99 A;  3UAP A;  1SJZ A;  3W6G A;  4G19 A;  5B7C A;  4JE1 A;  4ECB A;  1M9A A;  3E3E A;  1URM A;  1GTA A;  1GSQ A;  1SYR A;  3QAG A;  1WIK A;  2HZE B;  2YCD A;  4A5P A;  3VWU A;  3O6T A;  1R5A A;  3LJR A;  4IJ3 A;  2VD1 A;  4XRD A;  1EZK A;  1I5G A;  1XOA A;  1PSQ A;  3H93 A;  4O5R A;  1M99 A;  2O87 A;  2K18 A;  2MMZ A;  5DVB A;  1GSU A;  4EF0 A;  4ZBA A;  5IMV A;  3EC3 A;  5ECK B;  2OBK A;  4HZ2 A;  2LNS A;  5IOX A;  3F8U A;  1A8Y A;  3UEM A;  3I43 A;  4WKW A;  1A2L A;  2MBT A;  1XOB A;  3F3R A;  1PA3 A;  4L0U A;  5DQS A;  3FMW A;  2DJ0 A;  6GSS A;  5LCZ A;  2GSS A;  4ZXG A;  4L0W A;  1OC3 A;  4CY8 A;  2DJ2 A;  4ZIL A;  1FG4 A;  1U3I A;  19GS A;  4ML6 A;  3VPQ A;  1TRS A;  4MJE A;  1DBY A;  5A4W A;  3FZA A;  2BTO T;  1PKW A;  2VOC A;  4BL7 A;  2EC4 A;  1J08 A;  2GZY A;  5DJL A;  5D96 A;  3FZ9 A;  5ID2 B;  1ZYE A;  5IMD A;  2VCQ A;  5EPF A;  3ERF A;  4F03 A;  3G7J A;  4GQC A;  1WOU A;  3KEB A;  4KDX A;  3C7M A;  2X4A A;  4IS0 A;  4HUA A;  1ERU A;  2VCZ A;  1GTU A;  2GZZ A;  4Z2U A;  14GS A;  4NMU A;  1GLQ A;  5IMA A;  5J9C A;  2B5E A;  1WMJ A;  2WZ9 A;  3HJM A;  1EOG A;  1XWC A;  3KTB A;  3DVW A;  2LRT A;  5FWG A;  4NXI A;  1QGV A;  1CQG A;  3O3T A;  5CRH A;  1ACV A;  4JRR A;  3TJB A;  1K0N A;  2JAC A;  1VF3 A;  3AY8 A;  5B6N A;  2FLS A;  2HXK A;  4K6X A;  1BYE A;  3TRP A;  1K0O A;  4J56 E;  3TDG A;  1FVK A;  4YAP A;  5F06 A;  3C71 A;  2V1M A;  3IAM 2;  4XRA A;  2OE0 A;  1O73 A;  4LL1 B;  3TKS E;  3IK9 A;  3MSZ A;  3C1S A;  2R5G A;  2H0G A;  3M8N A;  1EEJ A;  5COH A;  5D93 A;  1TU8 A;  1C72 A;  1TP9 A;  1ILO A;  2YWO A;  2VCW A;  1XW9 A;  2DJ3 A;  3LXT A;  4MJC A;  1JZW A;  3UIW A;  4IHU A;  4I5Q A;  1O7U A;  4ILF A;  4KDU A;  3RHC A;  4AJ6 A;  3D4T A;  2X8C A;  4N11 A;  1OAZ A;  1F3A A;  2LKU A;  2OBI A;  4KX4 A;  2C0F A;  1O6J A;  2R0P A;  1XG8 A;  2GQL A;  5A4V A;  4WBR D;  2X8G A;  4ISD A;  2P5Q A;  4JED A;  3H79 A;  5J9B A;  3FRC A;  4EIP A;  1YQ1 A;  3TJJ A;  1O8X A;  1AQX A;  1YJ6 A;  3IPZ A;  5B6M A;  4O5U A;  4AJ7 A;  1OC9 B;  2C3N A;  3MNG A;  1YF1 A;  3JCM L;  4OFT A;  1BJX A;  4L5O A;  3FYG A;  1EP7 A;  2B7K A;  1XPV A;  5HFG A;  5IO2 A;  4PQI A;  3WT2 A;  2H6Y A;  4IN0 A;  1GLP A;  4IVF A;  3GFK A;  5CRE A;  5DDL A;  11GS A;  4K9Z A;  1DSB A;  3QD9 A;  2VCV A;  5ENU A;  5D73 A;  2IPA A;  3HA9 A;  2QKE A;  10GS A;  4K5R A;  2YJH A;  3ZML A;  3CRT A;  3GRX A;  4KND A;  4CDO A;  1NSW A;  2L5O A;  4FO5 A;  3UBK A;  2O85 A;  4TRX A;  3DYR A;  2NTO A;  1T4Y A;  2C3T A;  4EDY A;  3TKQ A;  4YQV A;  17GS A;  3LFL A;  3Q19 A;  2R3X A;  5AGY A;  3D0Z A;  2RM6 A;  3A5W A;  3MWH A;  2CAI A;  1EEM A;  3ZL5 A;  4K5S A;  1TRV A;  1PGT A;  5ECM B;  2J23 A;  6GSW A;  1T00 A;  1Y25 A;  2KP2 A;  2LTK A;  3VWW A;  1THX A;  4KE3 A;  2G0F A;  2VLU A;  4AJ8 A;  16GS A;  4ECJ A;  3L9U A;  5D9X A;  3LXZ A;  2FWE A;  2MZC A;  4LLR A;  2MYG A;  2RUE A;  3EU3 A;  2A2R A;  2DSA A;  2HRA A;  3U5R E;  2UZ8 A;  2DC5 A;  1YEP A;  4QL9 A;  2H72 A;  3HJP A;  3LOR A;  1X0R A;  1A8L A;  2HRK A;  3QCP A;  4EO3 A;  3SBC A;  4BL7 B;  4ZB9 A;  3KD0 A;  1Z7R A;  1G7E A;  5G5F A;  2F9S A;  2VCX A;  2IFQ A;  4GQF A;  4KB3 A;  4YKF A;  3RAZ A;  1HNC A;  5AIS A;  1Q98 A;  3TKR A;  5IPH A;  7GSS A;  2K8V A;  3HVV A;  5ECS A;  2IMF A;  4DEJ A;  3GKN A;  2EIR A;  2IMD A;  4X0X A;  4G2E A;  2TIR A;  1F9M A;  5IOW A;  5GST A;  2YWN A;  5KOW A;  2GLR A;  4KSO A;  4FQU A;  1UC7 A;  2E2G A;  4TW5 A;  6GSV A;  2PER A;  2L59 A;  1LBK A;  3HVN A;  2FD3 A;  5H5Q A;  1V9W A;  4LMW A;  4Z7X A;  2CX4 A;  1B9Y C;  1VRS D;  5HQP A;  5A5K A;  2B3S A;  4K7O A;  3CXG A;  5GSS A;  2B6M A;  3IHQ A;  2NBS A;  2VO4 A;  1ZZY A;  3ME7 A;  4N10 A;  2FA8 A;  3KJY A;  4GSS A;  1XWG A;  1WE0 A;  2Z9S A;  4HQZ A;  2JU5 A;  2ON7 A;  1TRU A;  2J9H A;  5C00 A;  5CAX A;  3EPT A;  3GKK A;  3P2A A;  4LA1 A;  2H74 A;  1M2D A;  18GS A;  1KEB A;  4TXV A;  3VWX A;  3QR6 A;  1F3B A;  3FW2 A;  1GTI A;  5HFK A;  4WF4 A;  2XBQ A;  3HDC A;  3ZFB A;  2H76 A;  3TKP A;  3EMX A;  5J41 A;  1JFU A;  3GKM A;  1ZL9 A;  5KN1 A;  1AIU A;  4PTS A;  1ZYN A;  3VI5 A;  1USB A;  3F63 A;  4KW6 A;  1SL0 B;  1XCC A;  3BCI A;  2C80 A;  3CSH A;  3GX8 A;  5CO3 A;  1B9X C;  1X5D A;  1QXH A;  5JCU A;  4HS1 A;  4FYC A;  2WCI A;  4FYB A;  3DKS A;  5F8B A;  1FVJ A;  3F6D A;  4DSS A;  2YJ7 A;  3CRU A;  3L4N A;  2F51 A;  4ZL8 A;  1GUK A;  5ABR A;  1QK8 A;  3FKF A;  4PQH A;  1JHB A;  1K3L A;  3D22 A;  2K8S A;  5KOX A;  3LQ7 A;  2HNL A;  3I9V 2;  3M9J A;  1SYX A;  4GF0 A;  1KBN A;  1FHE A;  1Z6M A;  1NW2 A;  1DE1 A;  1T8E B;  2CX3 A;  1EOH A;  2WRT A;  4L8E A;  1M7T A;  2IWT A;  2R2J A;  4MZC A;  4XHM A;  4TR1 A;  4DSQ A;  4KUN A;  4EVM A;  1R26 A;  3FR9 A;  4YAV A;  1GRX A;  3PPU A;  5J3R A;  3LWA A;  5IMC A;  3GH9 A;  2YPM A;  2H6Z A;  2AB6 A;  4IQA A;  5DCH A;  2YV7 A;  3US3 A;  1WJK A;  1YZX A;  2TRX A;  3FZ5 A;  6GST A;  2PVQ A;  2E0Q A;  4EL1 A;  2WJU A;  4LMV A;  4H86 A;  4IBP A;  5KN0 A;  4X4J A;  4GLT A;  1B8X A;  3H8Q A;  1ZCP A;  1V98 A;  5ECH B;  3GX0 A;  1XXU A;  2QA2 A;  2VL3 A;  3ED3 A;  3KMO A;  3ZIV A;  1FOH A;  3QFA C;  1M2B A;  3HD5 A;  4V1A g;  4PUF C;  4HOJ A;  1BED A;  2CZ2 A;  5KN3 A;  3KXO A;  2IME A;  2H0I A;  3WD6 A;  3BJ5 A;  5INY A;  2K6V A;  4I6X A;  3BD2 A;  4OO4 A;  2CAQ A;  3MYD A;  4YH2 A;  5JCW A;  1JZD A;  2HYX A;  3U6V A;  3TKS A;  2AAW A;  3FZ4 A;  2B1L A;  2N5F A;  4HQS A;  4PGT A;  3CSI A;  2VLV A;  2IFQ B;  2ALB A;  1RK4 A;  5C04 A;  1X9W B;  3RPP A;  4O92 A;  1SL2 B;  3MIX A;  1S3A A;  1AAZ A;  1XW6 A;  3IBH A;  5AN1 A;  2LQO A;  3IK7 A;  1SK0 A;  2GQM A;  4AGS A;  3HHV A;  3R2Q A;  1YEX A;  2HRN A;  1N8J A;  2HT9 A;  2H0H A;  1PD2 1;  3DXB A;  2ON5 A;  22GS A;  1AW9 A;  3F0I A;  3APS A;  5G1L A;  4CW9 A;  20GS A;  4PQ1 A;  2DBC A;  5F07 A;  3CMI A;  1MD4 A;  3GA4 A;  2ZNM A;  3S9F A;  4IGJ A;  12GS A;  3WYW A;  5G2Z A;  3LSZ A;  5IPG A;  3OR5 A;  1XWK A;  2LJR A;  4OO5 A;  1XBS A;  5IMZ A;  2PWJ A;  2E2M A;  2LJK A;  4Q5N A;  3QPM A;  3IR4 A;  1SK2 A;  5CRD A;  2M72 A;  4NV2 A;  5KEJ A;  4JR6 A;  1A2M A;  2VUP A;  2B7J A;  1MDJ A;  2WUL A;  4GWR A;  4K0G A;  2H19 A;  5HFI A;  1YKA A;  3QAV A;  4BWQ A;  1G6Y A;  2V2G A;  4MPG A;  4OFM A;  3GH6 A;  4MH3 A;  2CV4 A;  3W8J A;  1FB6 A;  4MF7 A;  2R37 A;  2X49 A;  1TI1 A;  3HZ8 A;  1K0M A;  2CZ3 A;  1T3B A;  2C0G A;  4WF5 A;  4ZB6 A;  4ZBB A;  2XPE A;  2I81 A;  1FAA A;  1NHY A;  3TUE A;  4USS A;  4EXJ A;  2FNO A;  2C1Y A;  3NIV A;  5AIX A;  3G7Y A;  2CVB A;  5EY6 A;  3APQ A;  3C1R A;  4X43 A;  1E6B A;  3VLN A;  3E0U A;  2QC7 A;  1W89 A;  2IMI A;  1XIY A;  1X5C A;  1KTE A;  2H8L A;  9GSS A;  5CP1 A;  4PX1 A;  2L5L A;  4MCU A;  2OE3 A;  4I2T A;  3QDN A;  2PVO C;  1F2E A;  2HE3 A;  4EIQ A;  6GSX A;  4K0N A;  4JZQ A;  5A4U A;  3L9S A;  3VUR A;  2V41 A;  4XCS A;  2CVD A;  2P5R A;  3IRA A;  2VL2 A;  3DWV A;  4MZW A;  1PX6 A;  2HSY A;  6GSY A;  4P3Y B;  3D21 A;  5IMF A;  5HR3 A;  3LW9 A;  2FY6 A;  1IYI A;  5ECQ B;  1XWA A;  5DAL A;  4NHW A;  4OFN A;  4PNF A;  3V1W A;  5ECR B;  1GUL A;  2VLT A;  4KCE A;  3DEX A;  4KCA A;  4WET A;  3LYK A;  1ZGN A;  3C73 A;  1THO A;  4G0K A;  3QMX A;  4TR1 B;  1PN9 A;  1PL1 A;  1SJI A;  1ERV A;  1M3I A;  2F8A A;  4HDE A;  1U6T A;  2LNT A;  5G5E A;  1U3A A;  4K2D A;  4N0V A;  1WRY A;  4TR3 A;  4OCF A;  1MEK A;  1AC1 A;  3IC4 A;  5J5N A;  1K3O A;  4FH8 A;  4V2L A;  3DGQ A;  3GN3 A;  2OJL A;  3GMF A;  5ECI B;  3TJG A;  2YWI A;  3UVH A;  1HNB A;  1TXX A;  5HR0 A;  1OC8 A;  2NPB A;  1E2Y A;  2DKI A;  1PX7 A;  2VCT A;  4G9H A;  3GYK A;  4PUA A;  2LEG A;  4ECC A;  4OMV A;  1TK8 B;  1PQN A;  4KF9 A;  4GST A;  4I8B A;  13GS A;  2DLX A;  4F9Z A;  4L5L A;  5CYY A;  1NHO A;  4ICY A;  4XTS A;  1MTC A;  3UOM A;  1OYJ A;  4GTU A;  1NM3 A;  1XWB A;  5DAK A;  1Z3E A;  1EWX A;  4F2I A;  1HD2 A;  4Q5R A;  1I9D A;  1PL2 A;  2CT6 A;  1DUG A;  3I69 A;  2G2Q A;  2RII A;  2GTU A;  4G10 A;  1TI3 A;  3UVT A;  4LL4 B; 
#chains in the Genus database with same CATH homology
 1ERW A;  3ZVJ A;  4IKH A;  2KLX A;  3CBU A;  3GKX A;  2WB9 A;  3IC8 A;  1GNE A;  5E59 A;  4WR5 A;  1WWJ A;  2PUK C;  4V2N A;  3IV4 A;  2C8U A;  5J4U A;  3M9K A;  3L0H A;  3IE3 A;  2H6X A;  5BMU A;  4EC0 A;  3ERW A;  4GCI A;  2MMO A;  2WDU A;  2GSR A;  1MDK A;  3UBL A;  4JU5 A;  1ST9 A;  2WGR A;  2LRN A;  3EIN A;  3GUS A;  3GTU A;  2L4Q A;  4K2X A;  2RM5 A;  3HZ4 A;  4D73 A;  3LEF A;  5IM9 A;  2OAC A;  3VK9 A;  5H5S A;  2LUS A;  4NAX A;  3GL3 A;  2XBI A;  1GSD A;  1M9B A;  2IJY A;  4KGI A;  4NWY A;  1Q4J A;  2L6C A;  2ZUP A;  5FT3 A;  1ZOF A;  1HYU A;  4N30 A;  1Z6N A;  1PN0 A;  1K0C A;  3UL3 A;  3RHB A;  1K3Y A;  3IHG A;  3BCK A;  3HYP A;  1SU9 A;  3TJK A;  3LGC A;  2A2S A;  5D9W A;  4MNN A;  3KIJ A;  3G7I A;  2DKH A;  4IW9 A;  4OD7 A;  5DBQ A;  1EP8 A;  3ME8 A;  1AUC A;  2GT5 A;  2DIZ A;  1UVZ A;  2VL2 C;  2M46 A;  3F4S A;  2AUV A;  2H71 A;  4O32 A;  1O85 A;  2FCH A;  2O8V B;  1PMT A;  4ZBD A;  2QSI A;  5DCG A;  1OE7 A;  2GSQ A;  2I9H A;  1SKW B;  1V58 A;  4TKY A;  3TRX A;  2A2P A;  1VF4 A;  4HJ2 A;  1PKZ A;  3RDW A;  3P7X A;  3HCZ A;  1XZO A;  1O8W A;  1B4Q A;  3TOT A;  4O5Q A;  2VL9 A;  3NZN A;  6GSU A;  3ZTL A;  2VIM A;  2R6K A;  2V6K A;  3KH7 A;  1ABA A;  3Q18 A;  4YQM A;  3MDK A;  1K0B A;  2H1A A;  1A0R P;  1SD8 A;  3BBY A;  2VD0 A;  3TB2 A;  3UMA A;  1SK1 A;  4V2M A;  1XFL A;  5DAL B;  2C3Q A;  2AYT A;  5G31 A;  2IL3 A;  5G1K A;  1TK0 B;  1J0F A;  3FHK A;  5JWQ B;  5H5R A;  4KH7 A;  2GST A;  1RQM A;  2B1K A;  4WR4 A;  4CY6 A;  2MMN A;  1S3C A;  1J9B A;  1X5E A;  4G0L A;  5EVO A;  4J2F A;  4MZB A;  2HSH A;  3NOF A;  4PXO A;  5FHI A;  5BRT A;  1Z7P A;  2TRC P;  4MF6 A;  4MMM A;  3M3M A;  4WEY A;  4KA0 A;  2PPT A;  1BAY A;  1SEN A;  1T1V A;  5GZZ B;  1GUH A;  4DSR A;  3LYP A;  4Q5F A;  1LJR A;  2YZH A;  4HU7 A;  1TW9 A;  4FIW A;  3TRQ A;  4POM A;  2H73 A;  1EV4 A;  3F4T A;  1GWC A;  4QQ7 A;  2KUC A;  3ZVJ D;  2EIQ A;  4HEA 2;  1BQ7 A;  5CNW A;  3D5J A;  5ELA A;  4TOP A;  1TRW A;  2YV9 A;  1VF2 A;  3UJ1 A;  3GIX A;  2I3Y A;  2L4C A;  3KTL A;  2H1B A;  2PN8 A;  2CA8 A;  3EU4 A;  1M0U A;  2KP1 A;  1YY7 A;  2R0C A;  8GSS A;  4OWY A;  3CYN A;  4WXT A;  5F0G A;  2RUF A;  3C8E A;  3ZIJ A;  4YKG A;  3CTF A;  2XC2 A;  3F6F A;  1ML6 A;  2R4V A;  3KP8 A;  3O76 A;  4I2U A;  1QFN A;  2C4J A;  1HNA A;  5E4W A;  2X8H A;  5DAK B;  5CRW A;  5ELG A;  2WS2 A;  2WFC A;  3G9B A;  4XS6 A;  1WP0 A;  1G0T A;  1N2A A;  4BVY A;  4GSN A;  2XPD A;  2O89 A;  3K8N A;  1YF0 A;  5JWR B;  3UAR A;  1XW5 A;  1K0D A;  4Z2R A;  3APO A;  4AF2 A;  1TTZ A;  4IQ1 A;  4I97 A;  3MAK A;  4TXO A;  5F05 A;  3ZZX A;  1FW1 A;  2FWH A;  4X1U A;  4XS4 A;  1GNW A;  1G7O A;  3GTU B;  3IOS A;  3IAS 2;  4D73 B;  2H70 A;  3ZFL A;  3DML A;  2KHP A;  1BX9 A;  2HI7 A;  1GP1 A;  2BJX A;  2JL4 A;  2VAF A;  3KMN A;  3WGE A;  4N0Z A;  3IA1 A;  4POB A;  4BA7 A;  3EVI A;  1F6M C;  5LD0 A;  3DVX A;  2PMT A;  1FO5 A;  1SKS B;  1QUW A;  2LST A;  3J7Y k;  2HSM A;  2C0E A;  4K7N A;  3WGD A;  2GVP A;  3HY2 A;  3GNJ A;  4RI7 A;  4IP1 A;  1QMV A;  2FGX A;  3L78 A;  2YAN A;  4J57 E;  4EE0 A;  1DE2 A;  3QAW A;  4BVX A;  2VM1 A;  4TN8 A;  1TU7 A;  2HRF A;  2GDR A;  3DRN A;  3A2W A;  3TCO A;  4JR4 A;  3ZRD A;  4TVE A;  2MBS A;  2FWF A;  4K1F A;  1A2J A;  1AQV A;  2GGT A;  2OA7 A;  5AIV A;  1OE8 A;  1CQH A;  1VGL A;  2HZF A;  2FA4 A;  5DJM A;  4MLY A;  5ECL B;  1R4W A;  5JCG A;  3J7Y b;  3ZRE A;  2H30 A;  2H1G A;  2QGV A;  1ON4 A;  3M1G A;  1JZR A;  4O7H A;  5JWO B;  3D6I A;  2P0G A;  1PRX A;  2KOK A;  5D9V A;  5EL8 A;  4HU9 A;  2H66 A;  4ZIJ A;  2M80 A;  3P90 A;  4EDZ A;  3RBT A;  4KDY A;  4F82 A;  1OKD A;  1JLW A;  5IIZ A;  2DJ1 A;  4XIH A;  3I6A A;  2F3M A;  2N5A A;  1WPI A;  4EKZ A;  2JZR A;  5GAN D;  4DSS B;  3L9V A;  1OVN A;  4POL A;  2OE1 A;  3FK8 A;  5LNK e;  3IXR A;  2DMM A;  2FHE A;  3HVX A;  5CRG A;  4MJB A;  2VM2 A;  1ZMA A;  1JLV A;  3TGZ A;  2LJA A;  3KGK A;  3PGT A;  2IMK A;  2LS5 A;  2GT6 A;  1O81 A;  2IN3 A;  5DQY A;  1HQO A;  2AV4 A;  2DML A;  2JZS A;  1QQ2 A;  2B5X A;  3A5I A;  1V2A A;  5ECP B;  4HJM A;  5IO0 A;  4Q5Q A;  3DIE A;  3EWL A;  3VWV A;  3WGX A;  2JZT A;  4MF5 A;  3TKS C;  4PNG A;  1GSS A;  1SD9 A;  3GV1 A;  1FB0 A;  4E8E A;  2ES7 A;  2HLS A;  2AHE A;  3EE2 A;  4MAB A;  3VFI A;  2OAD A;  2GS3 A;  4YQU A;  1R7H A;  1GSF A;  2YWM A;  3Q74 A;  1TK5 B;  3HKR A;  2X64 A;  1OKT A;  5GAP D;  4IJI A;  3ZMK A;  4QL7 A;  4K7I A;  4NV5 A;  2MMA A;  3F4R A;  3QOU A;  2YP6 A;  3SWL A;  3GST A;  5ECO B;  1YKC A;  4GRF A;  3EUR A;  2V6O A;  4BVY B;  2DJK A;  1TKD B;  1GH2 A;  2NDO A;  3N5O A;  4G0I A;  3W8S A;  2LQQ A;  4BWS A;  4ZL9 A;  1EGO A;  2QA1 A;  4NPB A;  2A4V A;  2HZE A;  2RLI A;  1Y6E A;  3ZYW A;  4WBJ A;  2IIY A;  4TXO B;  1X9M B;  1IYH A;  4ACS A;  4BPY A;  4DVC A;  4ZB8 A;  3TJF A;  4XS4 B;  4MDC A;  2JSZ A;  4F0C A;  2PGT A;  4RQR A;  1A0F A;  4CHS A;  4V1A p;  4XS1 A;  2PU9 C;  3GHA A;  3PR8 A;  3E9J B;  5IQY A;  1LU4 A;  2P31 A;  2OKA A;  4MA9 A;  2L6D A;  5B8A A;  1XVQ A;  4ID0 A;  3LG6 A;  3P8W A;  5L71 A;  4MPF A;  1SKR B;  3FR3 A;  4K8M A;  4PUR A;  1BG5 A;  3GL5 A;  4MJA A;  4KAE A;  1K0A A;  3PH9 A;  1A23 A;  1V57 A;  2FUG 2;  3DD3 A;  1GL8 A;  2BMX A;  2H01 A;  3H1N A;  4TR4 A;  1TDI A;  2YNX A;  4IP6 A;  4MP4 A;  1Z5Y E;  3D4M A;  4BVX B;  2B5Y A;  3RPN A;  1TJD A;  3BOA A;  1R5P A;  4F0B A;  4ULX A;  3N9J A;  3VPT A;  2YOI A;  1AQW A;  1A24 A;  5ID2 A;  3EYT A;  3CTG A;  5D9T A;  1W4V A;  1H4O A;  1TOF A;  2I4A A;  3PIN A;  1JZO A;  1U88 A;  2GZP A;  3KZQ A;  4RI6 A;  3VI7 A;  4RUV A;  1Z9H A;  5KN2 A;  2DJJ A;  3FY7 A;  2YZU A;  3IDV A;  1FOV A;  4MK3 A;  1H75 A;  3A2V A;  2O7K A;  1AXD A;  3Q6O A;  4E8H A;  3EMP A;  2YN1 A;  2K9F A;  1EV9 A;  2FWG A;  1GTB A;  1T4Z A;  2LV3 A;  4HI7 A;  4OCE A;  2A4H A;  3FEU A;  2V32 A;  3ISO A;  1YDK A;  2EIO A;  3HVS A;  4RQX A;  1B4P A;  2C0D A;  3F9U A;  3GSS A;  2HFD A;  3GUR A;  3TOU A;  2H75 A;  1KNG A;  1U87 A;  2N5B A;  4MH2 A;  2LRC A;  3ZIT A;  1EGR A;  2L57 A;  2CVK A;  1X9S B;  5HR2 A;  1SJ6 A;  1MDI A;  4ML1 A;  3A2X A;  1ERT A;  4ECI A;  5ECN B;  3QFB C;  3ZLP A;  3CSJ A;  1ZYP A;  4FYU A;  2GQK A;  1SL1 B;  4GXZ A;  3R3E A;  1MD3 A;  2F8F A;  3FR6 A;  2JAD A;  1T7P B;  1VF1 A;  2NVL A;  4HZ4 A;  1UN2 A;  2E7P A;  1ZYQ B;  4NHZ A;  1B48 A;  3KCM A;  1GUM A;  4Z2T A;  2XHF A;  2JSY A;  1F37 A;  1M2A A;  1OC9 A;  3WT1 A;  3A3T A;  2I1U A;  4TR0 A;  1UA5 A;  1G6W A;  1XVW A;  2AJQ B;  2R0G A;  4ZL7 A;  4IEL A;  4JBB A;  1GSE A;  1V40 A;  3HXS A;  5B8B A;  5HR1 A;  3M0F A;  3KP9 A;  4EUY A;  3KH9 A;  1RW1 A;  5G30 A;  3F3Q A;  2PBJ A;  4KSM A;  2CQ9 A;  2REM A;  1S3D A;  2DIY A;  2ZCT A;  3HJO A;  2D2Z A;  1GSY A;  3ERG A;  3H4K A;  5D8I A;  4POK A;  3KM6 A;  2H1D A;  2X99 A;  3UAP A;  1SJZ A;  3W6G A;  4G19 A;  5B7C A;  4JE1 A;  4ECB A;  1M9A A;  3E3E A;  1URM A;  1GTA A;  1GSQ A;  1SYR A;  3QAG A;  1WIK A;  2HZE B;  2YCD A;  4A5P A;  3VWU A;  3O6T A;  1R5A A;  3LJR A;  4IJ3 A;  2VD1 A;  4XRD A;  1EZK A;  1I5G A;  1XOA A;  1PSQ A;  3H93 A;  4O5R A;  1M99 A;  2O87 A;  2K18 A;  2MMZ A;  5DVB A;  1GSU A;  4EF0 A;  4ZBA A;  5IMV A;  3EC3 A;  5ECK B;  2OBK A;  4HZ2 A;  2LNS A;  5IOX A;  3F8U A;  1A8Y A;  3UEM A;  3I43 A;  4WKW A;  1A2L A;  2MBT A;  1XOB A;  3F3R A;  1PA3 A;  4L0U A;  5DQS A;  3FMW A;  2DJ0 A;  6GSS A;  5LCZ A;  2GSS A;  4ZXG A;  4L0W A;  1OC3 A;  4CY8 A;  2DJ2 A;  4ZIL A;  1FG4 A;  1U3I A;  19GS A;  4ML6 A;  3VPQ A;  1TRS A;  4MJE A;  1DBY A;  5A4W A;  3FZA A;  2BTO T;  1PKW A;  2VOC A;  4BL7 A;  2EC4 A;  1J08 A;  2GZY A;  5DJL A;  5D96 A;  3FZ9 A;  5ID2 B;  1ZYE A;  5IMD A;  2VCQ A;  5EPF A;  3ERF A;  4F03 A;  3G7J A;  4GQC A;  1WOU A;  3KEB A;  4KDX A;  3C7M A;  2X4A A;  4IS0 A;  4HUA A;  1ERU A;  2VCZ A;  1GTU A;  2GZZ A;  4Z2U A;  14GS A;  4NMU A;  1GLQ A;  5IMA A;  5J9C A;  2B5E A;  1WMJ A;  2WZ9 A;  3HJM A;  1EOG A;  1XWC A;  3KTB A;  3DVW A;  2LRT A;  5FWG A;  4NXI A;  1QGV A;  1CQG A;  3O3T A;  5CRH A;  1ACV A;  4JRR A;  3TJB A;  1K0N A;  2JAC A;  1VF3 A;  3AY8 A;  5B6N A;  2FLS A;  2HXK A;  4K6X A;  1BYE A;  3TRP A;  1K0O A;  4J56 E;  3TDG A;  1FVK A;  4YAP A;  5F06 A;  3C71 A;  2V1M A;  3IAM 2;  4XRA A;  2OE0 A;  1O73 A;  4LL1 B;  3TKS E;  3IK9 A;  3MSZ A;  3C1S A;  2R5G A;  2H0G A;  3M8N A;  1EEJ A;  5COH A;  5D93 A;  1TU8 A;  1C72 A;  1TP9 A;  1ILO A;  2YWO A;  2VCW A;  1XW9 A;  2DJ3 A;  3LXT A;  4MJC A;  1JZW A;  3UIW A;  4IHU A;  4I5Q A;  1O7U A;  4ILF A;  4KDU A;  3RHC A;  4AJ6 A;  3D4T A;  2X8C A;  4N11 A;  1OAZ A;  1F3A A;  2LKU A;  2OBI A;  4KX4 A;  2C0F A;  1O6J A;  2R0P A;  2GQL A;  5A4V A;  4WBR D;  2X8G A;  4ISD A;  2P5Q A;  4JED A;  3H79 A;  5J9B A;  3FRC A;  4EIP A;  1YQ1 A;  3TJJ A;  1O8X A;  1AQX A;  1YJ6 A;  3IPZ A;  5B6M A;  4O5U A;  4AJ7 A;  1OC9 B;  2C3N A;  3MNG A;  1YF1 A;  3JCM L;  4OFT A;  1BJX A;  4L5O A;  3FYG A;  1EP7 A;  2B7K A;  1XPV A;  5HFG A;  5IO2 A;  4PQI A;  3WT2 A;  2H6Y A;  4IN0 A;  1GLP A;  4IVF A;  3GFK A;  5CRE A;  5DDL A;  11GS A;  4K9Z A;  1DSB A;  3QD9 A;  2VCV A;  5ENU A;  5D73 A;  2IPA A;  3HA9 A;  2QKE A;  10GS A;  4K5R A;  2YJH A;  3ZML A;  3CRT A;  3GRX A;  4KND A;  4CDO A;  1NSW A;  2L5O A;  4FO5 A;  3UBK A;  2O85 A;  4TRX A;  3DYR A;  2NTO A;  1T4Y A;  2C3T A;  4EDY A;  3TKQ A;  4YQV A;  17GS A;  3LFL A;  3Q19 A;  2R3X A;  5AGY A;  3D0Z A;  2RM6 A;  3A5W A;  3MWH A;  2CAI A;  1EEM A;  3ZL5 A;  4K5S A;  1TRV A;  1PGT A;  5ECM B;  2J23 A;  6GSW A;  1T00 A;  1Y25 A;  2KP2 A;  2LTK A;  3VWW A;  1THX A;  4KE3 A;  2G0F A;  2VLU A;  4AJ8 A;  16GS A;  4ECJ A;  3L9U A;  5D9X A;  3LXZ A;  2FWE A;  2MZC A;  4LLR A;  2MYG A;  2RUE A;  3EU3 A;  2A2R A;  2DSA A;  2HRA A;  3U5R E;  2UZ8 A;  2DC5 A;  1YEP A;  4QL9 A;  2H72 A;  3HJP A;  3LOR A;  1X0R A;  1A8L A;  2HRK A;  3QCP A;  4EO3 A;  3SBC A;  4BL7 B;  4ZB9 A;  3KD0 A;  1Z7R A;  1G7E A;  5G5F A;  2F9S A;  2VCX A;  2IFQ A;  4GQF A;  4KB3 A;  4YKF A;  3RAZ A;  1HNC A;  5AIS A;  1Q98 A;  3TKR A;  5IPH A;  7GSS A;  2K8V A;  3HVV A;  5ECS A;  2IMF A;  4DEJ A;  3GKN A;  2EIR A;  2IMD A;  4X0X A;  4G2E A;  2TIR A;  1F9M A;  5IOW A;  5GST A;  2YWN A;  5KOW A;  2GLR A;  4KSO A;  4FQU A;  1UC7 A;  2E2G A;  4TW5 A;  6GSV A;  2PER A;  2L59 A;  1LBK A;  2FD3 A;  5H5Q A;  1V9W A;  4LMW A;  4Z7X A;  2CX4 A;  1B9Y C;  1VRS D;  5HQP A;  5A5K A;  2B3S A;  4K7O A;  3CXG A;  5GSS A;  2B6M A;  3IHQ A;  2NBS A;  2VO4 A;  1ZZY A;  3ME7 A;  4N10 A;  2FA8 A;  3KJY A;  4GSS A;  1XWG A;  1WE0 A;  2Z9S A;  4HQZ A;  2JU5 A;  2ON7 A;  1TRU A;  2J9H A;  5C00 A;  5CAX A;  3EPT A;  3GKK A;  3P2A A;  4LA1 A;  2H74 A;  1M2D A;  18GS A;  1KEB A;  4TXV A;  3VWX A;  3QR6 A;  1F3B A;  3FW2 A;  1GTI A;  5HFK A;  4WF4 A;  2XBQ A;  3HDC A;  3ZFB A;  2H76 A;  3TKP A;  3EMX A;  5J41 A;  1JFU A;  3GKM A;  1ZL9 A;  5KN1 A;  1AIU A;  4PTS A;  1ZYN A;  3VI5 A;  1USB A;  3F63 A;  4KW6 A;  1SL0 B;  1XCC A;  3BCI A;  2C80 A;  3CSH A;  3GX8 A;  5CO3 A;  1B9X C;  1X5D A;  1QXH A;  5JCU A;  4HS1 A;  4FYC A;  2WCI A;  4FYB A;  3DKS A;  5F8B A;  1FVJ A;  3F6D A;  4DSS A;  2YJ7 A;  3CRU A;  3L4N A;  2F51 A;  4ZL8 A;  1GUK A;  5ABR A;  1QK8 A;  3FKF A;  4PQH A;  1JHB A;  1K3L A;  3D22 A;  2K8S A;  5KOX A;  3LQ7 A;  2HNL A;  3I9V 2;  3M9J A;  1SYX A;  4GF0 A;  1KBN A;  1FHE A;  1Z6M A;  1NW2 A;  1DE1 A;  1T8E B;  2CX3 A;  1EOH A;  2WRT A;  4L8E A;  1M7T A;  2IWT A;  2R2J A;  4MZC A;  4XHM A;  4TR1 A;  4DSQ A;  4KUN A;  4EVM A;  1R26 A;  3FR9 A;  4YAV A;  1GRX A;  3PPU A;  5J3R A;  3LWA A;  5IMC A;  3GH9 A;  2YPM A;  2H6Z A;  2AB6 A;  4IQA A;  5DCH A;  2YV7 A;  3US3 A;  1WJK A;  1YZX A;  2TRX A;  3FZ5 A;  6GST A;  2PVQ A;  2E0Q A;  4EL1 A;  2WJU A;  4LMV A;  4H86 A;  4IBP A;  5KN0 A;  4X4J A;  4GLT A;  1B8X A;  3H8Q A;  1ZCP A;  1V98 A;  5ECH B;  3GX0 A;  1XXU A;  2QA2 A;  2VL3 A;  3ED3 A;  3KMO A;  3ZIV A;  1FOH A;  3QFA C;  1M2B A;  3HD5 A;  4V1A g;  4PUF C;  4HOJ A;  1BED A;  2CZ2 A;  5KN3 A;  3KXO A;  2IME A;  2H0I A;  3WD6 A;  3BJ5 A;  5INY A;  2K6V A;  4I6X A;  3BD2 A;  4OO4 A;  2CAQ A;  3MYD A;  4YH2 A;  5JCW A;  1JZD A;  2HYX A;  3U6V A;  3TKS A;  2AAW A;  3FZ4 A;  2B1L A;  2N5F A;  4HQS A;  4PGT A;  3CSI A;  2VLV A;  2IFQ B;  2ALB A;  1RK4 A;  5C04 A;  1X9W B;  3RPP A;  4O92 A;  1SL2 B;  3MIX A;  1S3A A;  1AAZ A;  1XW6 A;  3IBH A;  5AN1 A;  2LQO A;  3IK7 A;  1SK0 A;  2GQM A;  4AGS A;  3HHV A;  3R2Q A;  1YEX A;  2HRN A;  1N8J A;  2HT9 A;  2H0H A;  1PD2 1;  3DXB A;  2ON5 A;  22GS A;  1AW9 A;  3F0I A;  3APS A;  5G1L A;  4CW9 A;  20GS A;  4PQ1 A;  2DBC A;  5F07 A;  3CMI A;  1MD4 A;  3GA4 A;  2ZNM A;  3S9F A;  4IGJ A;  12GS A;  3WYW A;  5G2Z A;  3LSZ A;  5IPG A;  3OR5 A;  1XWK A;  2LJR A;  4OO5 A;  1XBS A;  5IMZ A;  2PWJ A;  2E2M A;  2LJK A;  4Q5N A;  3QPM A;  3IR4 A;  1SK2 A;  5CRD A;  2M72 A;  4NV2 A;  5KEJ A;  4JR6 A;  1A2M A;  2VUP A;  2B7J A;  1MDJ A;  2WUL A;  4GWR A;  4K0G A;  2H19 A;  5HFI A;  1YKA A;  3QAV A;  4BWQ A;  1G6Y A;  2V2G A;  4MPG A;  4OFM A;  3GH6 A;  4MH3 A;  2CV4 A;  3W8J A;  1FB6 A;  4MF7 A;  2R37 A;  2X49 A;  1TI1 A;  3HZ8 A;  1K0M A;  2CZ3 A;  1T3B A;  2C0G A;  4WF5 A;  4ZB6 A;  4ZBB A;  2XPE A;  2I81 A;  1FAA A;  1NHY A;  3TUE A;  4USS A;  4EXJ A;  2FNO A;  2C1Y A;  3NIV A;  5AIX A;  3G7Y A;  2CVB A;  5EY6 A;  3APQ A;  3C1R A;  4X43 A;  1E6B A;  3VLN A;  3E0U A;  2QC7 A;  1W89 A;  2IMI A;  1XIY A;  1X5C A;  1KTE A;  2H8L A;  9GSS A;  5CP1 A;  4PX1 A;  2L5L A;  4MCU A;  2OE3 A;  4I2T A;  3QDN A;  2PVO C;  1F2E A;  2HE3 A;  4EIQ A;  6GSX A;  4K0N A;  4JZQ A;  5A4U A;  3L9S A;  3VUR A;  2V41 A;  4XCS A;  2CVD A;  2P5R A;  3IRA A;  2VL2 A;  3DWV A;  4MZW A;  1PX6 A;  2HSY A;  6GSY A;  4P3Y B;  3D21 A;  5IMF A;  5HR3 A;  3LW9 A;  2FY6 A;  1IYI A;  5ECQ B;  1XWA A;  5DAL A;  4NHW A;  4OFN A;  4PNF A;  3V1W A;  5ECR B;  1GUL A;  2VLT A;  4KCE A;  3DEX A;  4KCA A;  4WET A;  3LYK A;  1ZGN A;  3C73 A;  1THO A;  4G0K A;  3QMX A;  4TR1 B;  1PN9 A;  1PL1 A;  1SJI A;  1ERV A;  2F8A A;  4HDE A;  1U6T A;  2LNT A;  5G5E A;  1U3A A;  4K2D A;  4N0V A;  1WRY A;  4TR3 A;  4OCF A;  1MEK A;  1AC1 A;  3IC4 A;  5J5N A;  1K3O A;  4FH8 A;  4V2L A;  3DGQ A;  3GN3 A;  2OJL A;  3GMF A;  5ECI B;  3TJG A;  2YWI A;  3UVH A;  1HNB A;  1TXX A;  5HR0 A;  1OC8 A;  2NPB A;  1E2Y A;  2DKI A;  1PX7 A;  2VCT A;  4G9H A;  3GYK A;  4PUA A;  2LEG A;  4ECC A;  4OMV A;  1TK8 B;  1PQN A;  4KF9 A;  4GST A;  4I8B A;  13GS A;  2DLX A;  4F9Z A;  4L5L A;  5CYY A;  1NHO A;  4ICY A;  4XTS A;  1MTC A;  3UOM A;  1OYJ A;  4GTU A;  1NM3 A;  1XWB A;  5DAK A;  1Z3E A;  1EWX A;  4F2I A;  1HD2 A;  4Q5R A;  1I9D A;  1PL2 A;  2CT6 A;  1DUG A;  3I69 A;  2G2Q A;  2RII A;  2GTU A;  4G10 A;  1TI3 A;  3UVT A;  4LL4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...