4KUNA

Crystal structure of legionella pneumophila lpp1115 / kaib
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
91
structure length
91
Chain Sequence
GMTRTKLKLFVIGNSAISKRAIINLQSICSDPKLADLCDIEVVDLCKNKGIAEQEKILATPILIKKEPLPERRIIGDLSDKQKVISALEMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Hypothetical protein Lpp1115
publication title The Legionella pneumophila kai operon is implicated in stress response and confers fitness in competitive environments.
pubmed doi rcsb
source organism Legionella pneumophila
total genus 27
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4kunA00
1GSUA 2TRCP 4ML6A 1PKWA 2B7JA 1M2DA 3E0UA 4DSRA 4ZBDA 1AQXA 4POLA 1J0FA 3EVIA 1NW2A 5E59A 4ECCA 3CYNA 1Z5YE 3F0IA 3ME7A 5HR1A 3L9SA 3DEXA 4HS1A 3J7Yb 4WR4A 5AN1A 5F0GA 3CSHA 3H1NA 2AJQB 7GSSA 2JZRA 1JZWA 1GSDA 1SK0A 4IP6A 4V1Ag 1X5CA 3I69A 2JADA 2ON7A 5A4WA 3QAVA 5DJMA 2FY6A 3IAM2 3KH9A 2JU5A 4WKWA 1AUCA 2KLXA 1U87A 4K9ZA 4TN8A 2IFQB 3IR4A 1DE2A 2RUEA 4MJAA 1SD9A 2VL2C 4KSOA 1R5AA 2OADA 4PUFC 2LEGA 2IJYA 2LTKA 1KBNA 4I2UA 2C0EA 2IFQA 3VI5A 1WMJA 2CX3A 1EGOA 1XWBA 4GTUA 4KGIA 4ACSA 5FT3A 3O3TA 1FO5A 3F8UA 1Z6MA 2O87A 5D96A 4FH8A 1K0BA 1Y6EA 5D9TA 3GX8A 5DJLA 1B4PA 4HEA2 2G0FA 2I3YA 1QFNA 1XOBA 1OKTA 1YEXA 4LMVA 4WEYA 3UJ1A 1G0TA 2WZ9A 3M3MA 2XC2A 2CVBA 2QGVA 3TRPA 3TRQA 1OC9B 3LJRA 1VF2A 1TK5B 1PSQA 4AJ6A 1PA3A 6GSUA 1MEKA 2ES7A 1U6TA 2L4CA 1BJXA 2IWTA 4GWRA 2EIRA 2Z9SA 2YZUA 4L0UA 2B6MA 2IN3A 4KDXA 4XRAA 5E4WA 2C3QA 3L4NA 5KN2A 3GIXA 4BWSA 1GRXA 4OFMA 4GSNA 2MYGA 3BCIA 2GQKA 3TRXA 1GL8A 2GSRA 3IC4A 4FIWA 5GSSA 2DBCA 2I1UA 22GSA 3LFLA 1SENA 4K1FA 1ZMAA 4BWQA 5D73A 1T8EB 2JZTA 2OE3A 5KN1A 5IO2A 4XCSA 3BOAA 4K7OA 3RDWA 1OC8A 4KB3A 3TKQA 3GKXA 3ZIJA 2CQ9A 3GKNA 4MZBA 4K0NA 1BYEA 5ABRA 1B48A 1T7PB 4TW5A 4GQFA 4TOPA 4IKHA 5IO0A 1E6BA 4KCEA 2B5YA 3SWLA 2KOKA 1OVNA 1XIYA 4ISDA 2VCZA 4AGSA 3GURA 3QOUA 1SL2B 4K0GA 2F9SA 5LD0A 4ZIJA 3C71A 1Z3EA 4CDOA 1Z7PA 1GNWA 1AIUA 4L5LA 3ZFLA 1GLPA 2VLTA 3P8WA 4POBA 1GSQA 3ZFBA 5J41A 1SKWB 3GMFA 3EURA 1JZOA 2RIIA 2WCIA 2V1MA 5D9XA 1NHOA 3DKSA 5CYYA 5DQSA 14GSA 3TJGA 3DVWA 2AYTA 1HD2A 1O73A 4KAEA 2RLIA 1K0OA 4ID0A 2PN8A 4NMUA 1USBA 2R3XA 3KD0A 4HU9A 2DIZA 2KP2A 4OFNA 1R4WA 4MF5A 3FK8A 1V57A 2I4AA 5HFIA 3BD2A 3US3A 4AJ7A 2F51A 2B1KA 4ILFA 3TJBA 2HXKA 2REMA 4PURA 2K9FA 4XTSA 1I5GA 1M7TA 1WPIA 3FRCA 2IMIA 3LGCA 2R2JA 2H6YA 5KEJA 4OO5A 3RBTA 4O7HA 3VPQA 2DJ3A 5HR2A 4KW6A 5JCGA 2N5FA 4MH3A 4HZ2A 1EGRA 4QQ7A 1EV9A 1S3AA 3UVTA 4ZL8A 3FYGA 5G1KA 4TR4A 3DD3A 2OKAA 2QC7A 3BBYA 2LQQA 1TI3A 4GCIA 3P2AA 2DJ0A 3J7Yk 3QFBC 2VIMA 5B6MA 4TR0A 4WF4A 5A4UA 1BQ7A 3L9VA 1TXXA 3O6TA 1XCCA 2HT9A 1FVKA 2DIYA 4HQSA 1V58A 3GX0A 4MP4A 1X9MB 4H86A 1WWJA 2MMNA 2IMEA 2WDUA 3GTUA 3IRAA 2WRTA 1SL0B 2L6DA 3ZVJA 3GKKA 1SD8A 3TCOA 2HNLA 4YH2A 4K8MA 3KTBA 2PERA 3M9KA 1WP0A 4G19A 3MDKA 2X8GA 2VL9A 4HUAA 4Q5RA 1A2JA 5CRHA 1AQVA 2HZFA 3ERFA 4ECBA 4EVMA 1G7EA 3RHBA 3RPPA 20GSA 5ECOB 1ZCPA 3IA1A 3O76A 3KMOA 4I97A 2V6OA 2H6XA 2P5QA 3MWHA 2JZSA 1F3AA 3CSIA 2IMKA 16GSA 1TU8A 1TP9A 2YWOA 2NBSA 3EYTA 2LQOA 5CAXA 3C1RA 1M99A 2R37A 3FW2A 1A23A 2CAIA 2XHFA 1OAZA 4V1Ap 4HDEA 1OC3A 2VCXA 1HNCA 4YAVA 2V32A 4K6XA 1N2AA 3ERGA 5ENUA 3GFKA 3ZTLA 2IL3A 2M72A 4POKA 3F4SA 2GTUA 3D0ZA 5IMAA 4TKYA 4TR1B 1ZYQB 1TI1A 2M80A 4OO4A 3FHKA 4ML1A 2C80A 4ECJA 3M8NA 3HJMA 4TR1A 5ECQB 1YY7A 2N5AA 3OR5A 2YNXA 1ERTA 3VURA 5IOWA 5H5QA 4YQMA 1LJRA 2ZUPA 2CT6A 1A8LA 3HKRA 2DC5A 4GRFA 2FA4A 3KGKA 2YJHA 3ED3A 1XWAA 4GF0A 3IOSA 4FYCA 3HD5A 3GKMA 1O85A 2LRCA 1F37A 4XHMA 1T4ZA 2C0DA 4JEDA 4HI7A 3MAKA 1WOUA 2C0FA 2JACA 3MSZA 4PXOA 3U6VA 4ZL7A 3GH6A 4RQXA 3NIVA 1GSYA 4OD7A 3VWXA 2LNSA 6GSVA 1M9AA 2GVPA 4N10A 2CVKA 1RK4A 5INYA 4J2FA 1PRXA 3N5OA 4TRXA 2GSTA 5G30A 4TVEA 4ZBAA 2H8LA 3KIJA 4BL7A 2MMOA 5IPHA 1B4QA 3H8QA 1I9DA 1V40A 2H1BA 1GLQA 4WR5A 5GZZB 1TDIA 2H66A 1UC7A 4WXTA 3TKSE 2H0GA 4KH7A 1U88A 1KTEA 2DMMA 4F0CA 2MBTA 3UVHA 3V1WA 5G1LA 3APQA 3GSSA 1WRYA 5J5NA 4JZQA 5GAPD 5AISA 3CMIA 2AB6A 2LJRA 3ZREA 6GSXA 1Z9HA 3K8NA 3LYPA 1THOA 1JHBA 3F9UA 5D9WA 2YJ7A 5AIVA 3ZITA 4MZCA 4F03A 2H30A 4MZWA 5ECRB 4K7IA 1JFUA 5EPFA 5HFGA 5IM9A 3PINA 2KHPA 4EXJA 5GAND 1OE7A 5ID2B 4I8BA 2XPEA 4PQIA 2YPMA 4IHUA 5ID2A 1NSWA 2H73A 4KA0A 5IMCA 3UAPA 1IYIA 5CNWA 4GQCA 4RQRA 1RQMA 3DGQA 2VLVA 2HLSA 1GUHA 1MD3A 3TOUA 1EEJA 4MJBA 3GHAA 8GSSA 4MPGA 2K18A 4P3YB 3LYKA 3ISOA 3GL5A 3N9JA 4PX1A 1CQHA 1DSBA 2KP1A 3GL3A 5B6NA 4ECIA 1GH2A 3QAGA 3WGDA 1EV4A 1HYUA 1SYXA 3I6AA 5H5RA 3C7MA 1OC9A 2YOIA 1X0RA 2L57A 1PQNA 2V6KA 2KUCA 2AHEA 2L4QA 2LV3A 1XW9A 5FWGA 2JSYA 1AXDA 4V2MA 2NVLA 4LL4B 1FG4A 3WT1A 1ON4A 2VCQA 5G5FA 3NZNA 1SK2A 3GYKA 4F82A 3MNGA 1A0RP 2XBQA 1Z6NA 2H72A 1CQGA 2K6VA 3FEUA 1MDJA 4LLRA 4EC0A 10GSA 4AF2A 1DBYA 3ZMKA 4N30A 5KN3A 1X9WB 2HSHA 4EDZA 2HZEB 1XZOA 2CX4A 1ZYEA 5DCGA 5DDLA 1XWCA 1LU4A 3G7YA 2HRNA 4HJMA 3IK7A 3LWAA 3CRTA 2OE0A 1TW9A 1K0MA 1PD21 1XOAA 3KM6A 5DCHA 1UN2A 1XVQA 2J9HA 3EU3A 5AIXA 3EU4A 3PR8A 3KXOA 1K3YA 4YQVA 3F4RA 2R6KA 4FYUA 1DE1A 4ZILA 5B7CA 4V2NA 1ERVA 4PQHA 1MTCA 2H1AA 2YCDA 3R2QA 3L0HA 1SJIA 1T1VA 1JZDA 1TK0B 5DBQA 5AGYA 3IE3A 3F6DA 5JCUA 4BPYA 1BAYA 2FWEA 3F6FA 4EO3A 3FKFA 1X5DA 1U3AA 1UA5A 1XBSA 3VK9A 3A5WA 1R5PA 2YWIA 2DJ2A 4NPBA 1M2BA 2FHEA 3TKPA 1N8JA 1NM3A 2IPAA 2HE3A 2H1GA 1EOHA 3HA9A 4GLTA 5A4VA 3H93A 2GSSA 3TKSC 3KEBA 3EC3A 3DXBA 2YV7A 5KN0A 1BX9A 2VCWA 2GDRA 2OE1A 2YV9A 5EVOA 1FVJA 4MMMA 1RW1A 1O8WA 4IS0A 1VRSD 5IOXA 3A2XA 3C8EA 1EWXA 1PX7A 1XPVA 2C3NA 1QXHA 5F05A 2HSYA 4IQAA 3GN3A 4KCAA 4MA9A 2YANA 2CZ2A 3P90A 5IMFA 2A2RA 4LMWA 4EF0A 4I6XA 2CA8A 1J9BA 1TU7A 1ILOA 1GWCA 4EE0A 4IELA 3LEFA 3G7JA 3WT2A 4FO5A 2G2QA 4MLYA 4PUAA 3KP8A 1MDKA 2FD3A 2J23A 3ZVJD 1V98A 3TJKA 4DSSB 2WS2A 2DMLA 2GSQA 4DEJA 3TKRA 3CSJA 3TUEA 3E3EA 1YDKA 4DSSA 3M0FA 1ERUA 1FW1A 2PVQA 4JRRA 1W89A 5ECKB 2GT5A 3KCMA 3DVXA 1T4YA 2RM5A 3D5JA 2C1YA 3PGTA 1ST9A 1PN9A 1ACVA 3Q18A 1T3BA 3M1GA 1TRWA 2P5RA 1AC1A 4KDUA 2VCVA 4HQZA 1TKDB 4XS6A 4I5QA 1K3OA 3QD9A 4E8EA 1URMA 3LXZA 2M46A 1EZKA 1Y25A 3CBUA 1ABAA 5J9CA 3H79A 6GSWA 3HVSA 3M9JA 3UBLA 2L59A 2RM6A 2BTOT 3HVVA 3GRXA 3U5RE 3VLNA 1M2AA 3HZ8A 5LCZA 3IBHA 1R26A 5IMDA 4QL7A 4IJ3A 1ML6A 4WBJA 5G2ZA 3KZQA 2OBKA 1IYHA 3VFIA 4X1UA 2H01A 4MCUA 1YZXA 4AJ8A 3VWUA 1V9WA 2F3MA 2VUPA 4D73B 1SU9A 2H75A 5G5EA 3G7IA 5COHA 3A2VA 2O7KA 2DJ1A 1R7HA 1ZL9A 3TOTA 3UOMA 2HFDA 1PL1A 3I43A 4ZB9A 2E0QA 3F3RA 3IDVA 3I9V2 3Q6OA 3RAZA 1HNBA 2X8CA 5DQYA 1G7OA 2DSAA 4MJEA 2B5XA 2L6CA 1AW9A 4KNDA 4BA7A 2ON5A 4HOJA 2BJXA 2H6ZA 2O8VB 1FAAA 4LA1A 3WGEA 1K0AA 5G31A 1OKDA 4L5OA 4MJCA 3QMXA 2EC4A 1GUKA 1YJ6A 3GSTA 5CO3A 2LJKA 2P31A 2VM1A 4BVXA 2OJLA 1YF0A 3BCKA 4NV5A 2EIOA 17GSA 11GSA 2FNOA 3F4TA 2VD0A 3FZ5A 3VI7A 1UVZA 2GZZA 1FB0A 1QUWA 2TRXA 1O6JA 2HRFA 1GTAA 5L71A 5EY6A 3KMNA 3TB2A 1JLWA 4ZXGA 2VL2A 2OBIA 4XRDA 1MDIA 4MPFA 1F3BA 2CV4A 3HJOA 1PMTA 1KNGA 3KTLA 2OA7A 3DWVA 5CRDA 2CZ3A 4N0VA 2H70A 1H75A 3FR3A 1EP8A 2B5EA 4KSMA 1X9SB 2B7KA 3UEMA 3QCPA 4KE3A 4K2DA 12GSA 1QMVA 19GSA 1EEMA 2TIRA 2GLRA 2H71A 2VLUA 5D93A 2O89A 3LSZA 4MK3A 2LKUA 1O8XA 3CTGA 1Q98A 2V41A 2LRTA 1GUMA 1EOGA 1PX6A 3Q19A 5C04A 4PNGA 1XWGA 2B3SA 2PMTA 4XS4B 5ECIB 1TRUA 2H0IA 1T00A 1WJKA 2DJJA 3QPMA 2K8SA 3FY7A 3CXGA 4TXOB 4XS4A 5HFKA 2VO4A 3D4TA 1O81A 2NDOA 3EE2A 2WJUA 1FB6A 3F63A 1HNAA 4TXOA 1PGTA 2A4VA 1XXUA 2YWNA 1TRSA 2WGRA 4X43A 4EKZA 2JL4A 5F06A 5F8BA 5IPGA 3G9BA 4ULXA 4Q5QA 2WULA 4IN0A 5IMZA 4E8HA 4EUYA 2XBIA 4JR4A 4GSTA 4KUNA 3NOFA 1ZGNA 3HCZA 4Q5FA 1U3IA 1VGLA 1VF1A 5IQYA 3IAS2 3W6GA 1VF4A 2NTOA 2LNTA 3D21A 4EDYA 1A2MA 2IIYA 2FLSA 5LNKe 5ECMB 1H4OA 5DVBA 1QGVA 3QAWA 1E2YA 4IVFA 1GTBA 2R5GA 3LQ7A 2VM2A 5IIZA 2C3TA 5CP1A 6GSTA 2HI7A 3HJPA 2H76A 1YKCA 4WBRD 4Q5NA 4GXZA 4OWYA 4NAXA 2GQMA 4F9ZA 1MD4A 4RUVA 4RI6A 1K3LA 3EMXA 2FUG2 3KP9A 2L5OA 5HR3A 1AAZA 3GA4A 3TDGA 5D9VA 2HZEA 1M9BA 3A2WA 2PBJA 5ELGA 3H4KA 5H5SA 4TR3A 5A5KA 3HY2A 3IXRA 4JE1A 3VPTA 3CRUA 2I9HA 2YN1A 2FA8A 1YKAA 5GSTA 4NHWA 3FZ4A 2YZHA 1THXA 5JCWA 4NV2A 1SJZA 1A0FA 2H1DA 3D6IA 4PGTA 1K0CA 3CTFA 3EINA 5D8IA 4BVYA 2DJKA 2VCTA 2OACA 6GSYA 2IMFA 2VOCA 3VWWA 2H0HA 2RUFA 2X64A 2LJAA 4CW9A 1GSSA 1JLVA 4EL1A 1ZOFA 5HR0A 2ZNMA 1F2EA 4HU7A 3QFAC 3D4MA 4PQ1A 2D2ZA 3TKSA 2H74A 4ZL9A 3WYWA 3ZL5A 4CHSA 4L8EA 4OMVA 1S3CA 1Z7RA 3GUSA 2LS5A 4DSQA 4NWYA 3HHVA 4MH2A 3TJFA 1SYRA 2A2SA 2VAFA 3QDNA 1BG5A 3P7XA 1K0DA 4IBPA 2VD1A 3ZMLA 3A3TA 2LUSA 5HQPA 4KDYA 1QQ2A 1M0UA 1SJ6A 1WE0A 2E2MA 3JCML 3E9JB 2H19A 3HYPA 1TK8B 4IQ1A 5F07A 3DRNA 2LSTA 1G6YA 1GSEA 4V2LA 1S3DA 1SK1A 3EWLA 2VL3A 2N5BA 3TGZA 2EIQA 4HZ4A 3KH7A 2F8AA 2CAQA 2HYXA 2MMAA 1A24A 4O92A 1SKSB 4QL9A 2NPBA 9GSSA 5EL8A 5ECNB 4DVCA 3DMLA 5ECLB 4WETA 5CREA 3FZ9A 3L9UA 3VWVA 2XPDA 4NXIA 1YF1A 4MF6A 2PVOC 3LG6A 2QKEA 5CRWA 3ZZXA 3IPZA 1OYJA 1B9YC 1GTUA 2GT6A 3GV1A 4OFTA 2MMZA 4IP1A 1GNEA 2FWHA 2C4JA 4PNFA 2AV4A 1TJDA 2ALBA 3TJJA 2PWJA 3D22A 4TXVA 3UBKA 4RI7A 4XS1A 1OE8A 1AQWA 5IMVA 5C00A 3BJ5A 2MBSA 3GTUB 3UMAA 1BEDA 1XWKA 4ZB6A 3APSA 2C8UA 4FYBA 4IJIA 4X0XA 5J3RA 1X5EA 1XW5A 1J08A 3PH9A 4WF5A 3UARA 2F8FA 4KX4A 4O32A 1DUGA 1JZRA 3L78A 1KEBA 1LBKA 2E2GA 2FWGA 4Z7XA 3IK9A 2YWMA 2JSZA 2GGTA 3ZRDA 5FHIA 13GSA 2GS3A 2X8HA 1C72A 4G10A 4LL1B 3KJYA 4NHZA 2IMDA 1GSFA 1FOVA 4K7NA 3Q74A 3S9FA 1TTZA 2PUKC 2I81A 2P0GA 5B8AA 3AY8A 2L5LA 2PPTA 1GULA 3LXTA 4HJ2A 2AUVA 4MF7A 3W8SA 1Q4JA 3W8JA 1TRVA 3FZAA 2LRNA 3RHCA 1A2LA 2O85A 3WD6A 4MDCA 3ME8A 1SL1B 5J9BA 4O5RA 5J4UA 3LORA 3DYRA 2WB9A 2FWFA 2PU9C 3C73A 2WFCA 1VF3A 2C0GA 2E7PA 4YAPA 1XW6A 3ZIVA 2CVDA 2BMXA 3ZYWA 4I2TA 3RPNA 2DLXA 3APOA 5JWRB 4IW9A 3F3QA 1GTIA 4L0WA 2R4VA 1XFLA 5ELAA 1NHYA 3UIWA 1ZZYA 3WGXA 2X99A 4D73A 3HDCA 3QR6A 3ERWA 3HXSA 3UL3A 5JWOB 4XIHA 4N11A 4F2IA 5ECHB 4OCEA 1A8YA 6GSSA 4GSSA 2MZCA 3FR6A 4G9HA 1TOFA 3EMPA 4ZBBA 1PL2A 3GNJA 1ERWA 1B9XC 2GQLA 5CRGA 1FHEA 2B1LA 5B8BA 2QSIA 1QK8A 5DAKB 3HZ4A 5ECSA 1K0NA 3GH9A 3IV4A 2ZCTA 3ZLPA 4JU5A 1PKZA 1G6WA 2V2GA 3IHQA 1HQOA 5DAKA 1EP7A 1YQ1A 4JR6A 4OCFA 4J56E 1V2AA 4JBBA 1WIKA 2GZPA 4YQUA 2FCHA 3HVXA 1GP1A 4G2EA 5ECPB 1YEPA 1XVWA 4F0BA 1W4VA 2PGTA 3DIEA 1F6MC 2YP6A 3FR9A 2K8VA 4POMA 1B8XA 4ZB8A 5DALB 4MABA 4J57E 1F9MA 2FGXA 4IGJA 2AAWA 4N0ZA 18GSA 5DALA 5JWQB 2GZYA 3C1SA 1SKRB 1O7UA 3SBCA
chains in the Genus database with same CATH superfamily
1GSUA 2TRCP 4ML6A 1PKWA 2B7JA 1M2DA 3E0UA 4DSRA 4ZBDA 1AQXA 4POLA 1J0FA 3EVIA 1NW2A 5E59A 4ECCA 3CYNA 1Z5YE 3F0IA 3ME7A 5HR1A 3IC8A 3L9SA 3DEXA 4HS1A 3J7Yb 4WR4A 5AN1A 4EIQA 5F0GA 4KF9A 3CSHA 3H1NA 2AJQB 7GSSA 2JZRA 1JZWA 1GSDA 1SK0A 4IP6A 4V1Ag 1X5CA 3I69A 2JADA 2ON7A 5A4WA 3QAVA 5DJMA 2FY6A 3IAM2 3KH9A 2JU5A 4WKWA 1AUCA 2KLXA 1U87A 4K9ZA 4TN8A 2IFQB 3IR4A 1DE2A 2RUEA 4MJAA 1SD9A 2VL2C 4KSOA 1R5AA 2OADA 4PUFC 2LEGA 2IJYA 2LTKA 1KBNA 4I2UA 2C0EA 2IFQA 3VI5A 1WMJA 2CX3A 1EGOA 1XWBA 4HSCX 4GTUA 4KGIA 4ACSA 5FT3A 3O3TA 1FO5A 3F8UA 1Z6MA 2O87A 5D96A 4FH8A 5KOXA 1K0BA 1Y6EA 1M3JA 5D9TA 3GX8A 5DJLA 1B4PA 4HEA2 2G0FA 2I3YA 1QFNA 1XOBA 1OKTA 1YEXA 4LMVA 4WEYA 3UJ1A 1G0TA 2WZ9A 3M3MA 2XC2A 2CVBA 2QGVA 3TRPA 3TRQA 1OC9B 3LJRA 1VF2A 1TK5B 1PSQA 4AJ6A 1PA3A 6GSUA 1MEKA 2ES7A 1U6TA 2L4CA 1BJXA 2IWTA 4GWRA 2EIRA 2Z9SA 2YZUA 4L0UA 2B6MA 2IN3A 4KDXA 4XRAA 5E4WA 2C3QA 3L4NA 5KN2A 3GIXA 4BWSA 1GRXA 4OFMA 4GSNA 2MYGA 3BCIA 2GQKA 3TRXA 1GL8A 2GSRA 3IC4A 4FIWA 5GSSA 2DBCA 2I1UA 22GSA 3LFLA 1SENA 4K1FA 1ZMAA 4BWQA 5D73A 1T8EB 2JZTA 2OE3A 5KN1A 5IO2A 4XCSA 3BOAA 4K7OA 3RDWA 1OC8A 4KB3A 3TKQA 3GKXA 3ZIJA 2CQ9A 3GKNA 4CY6A 2QA1A 4MZBA 4K0NA 1BYEA 5ABRA 1B48A 1T7PB 4TW5A 4GQFA 4TOPA 4IKHA 5IO0A 1E6BA 4KCEA 2B5YA 3SWLA 2KOKA 1OVNA 1XIYA 4ISDA 2VCZA 4AGSA 3GURA 3QOUA 1SL2B 4K0GA 2F9SA 5LD0A 1FOHA 4ZIJA 3C71A 1Z3EA 4CDOA 1Z7PA 1GNWA 1AIUA 4L5LA 3ZFLA 1GLPA 2VLTA 3P8WA 4POBA 1GSQA 3ZFBA 5J41A 1SKWB 3GMFA 3EURA 1JZOA 2HRAA 2RIIA 2WCIA 2V1MA 5D9XA 1NHOA 3DKSA 5CYYA 5DQSA 14GSA 3TJGA 3DVWA 2AYTA 1HD2A 1O73A 4KAEA 2RLIA 1K0OA 4ID0A 2PN8A 4NMUA 1USBA 2R3XA 3KD0A 4HU9A 2DIZA 2KP2A 4OFNA 1R4WA 4MF5A 3FK8A 1V57A 2I4AA 5HFIA 3BD2A 3US3A 4AJ7A 2F51A 2B1KA 4ILFA 3TJBA 2HXKA 2REMA 4PURA 2K9FA 4XTSA 1I5GA 1M7TA 1WPIA 3FRCA 2IMIA 3LGCA 2R2JA 2H6YA 5KEJA 4ICYA 4OO5A 3RBTA 4O7HA 3VPQA 2DJ3A 5HR2A 4KW6A 5JCGA 2N5FA 4MH3A 4HZ2A 1EGRA 4QQ7A 1EV9A 1S3AA 3UVTA 4ZL8A 4X4JA 3LW9A 3FYGA 5G1KA 4TR4A 3DD3A 3EPTA 2OKAA 2QC7A 3BBYA 2LQQA 1TI3A 4GCIA 3P2AA 2DJ0A 3J7Yk 3QFBC 2VIMA 5B6MA 4TR0A 4WF4A 5A4UA 1BQ7A 3L9VA 1TXXA 3O6TA 1XCCA 2HT9A 1FVKA 2DIYA 4HQSA 1V58A 3GX0A 4MP4A 1X9MB 4H86A 1WWJA 2MMNA 2IMEA 2WDUA 3GTUA 3IRAA 2WRTA 1SL0B 2L6DA 3ZVJA 3GKKA 1SD8A 3TCOA 2HNLA 4YH2A 4K8MA 3KTBA 2PERA 3M9KA 1WP0A 4G19A 3MDKA 2X8GA 2VL9A 4HUAA 4Q5RA 1A2JA 5CRHA 1AQVA 2HZFA 3ERFA 4ECBA 4EVMA 1G7EA 3RHBA 3RPPA 20GSA 5ECOB 1ZCPA 3IA1A 3O76A 3KMOA 4I97A 2V6OA 2H6XA 2P5QA 3MWHA 2JZSA 1F3AA 3CSIA 2IMKA 16GSA 1TU8A 1TP9A 2YWOA 2NBSA 3EYTA 2LQOA 5CAXA 3C1RA 1M99A 2R37A 3FW2A 1A23A 2CAIA 2XHFA 1OAZA 4V1Ap 4HDEA 4O5UA 1OC3A 2VCXA 1HNCA 4YAVA 2V32A 4K6XA 1N2AA 4Z2TA 3ERGA 5ENUA 3GFKA 3ZTLA 2IL3A 2M72A 4POKA 3F4SA 2GTUA 3D0ZA 5IMAA 4TKYA 4TR1B 1ZYQB 1TI1A 2M80A 4OO4A 3FHKA 4ML1A 2C80A 4ECJA 3M8NA 3HJMA 4TR1A 5ECQB 1YY7A 3A5IA 2N5AA 3OR5A 2YNXA 1ERTA 3VURA 5IOWA 5H5QA 4YQMA 1LJRA 2ZUPA 2CT6A 1A8LA 3HKRA 2DC5A 4GRFA 2FA4A 3KGKA 2YJHA 3ED3A 1XWAA 4GF0A 3IOSA 4FYCA 3HD5A 3GKMA 1O85A 2LRCA 1F37A 4XHMA 1T4ZA 2C0DA 4JEDA 4HI7A 3MAKA 1WOUA 2C0FA 2JACA 3MSZA 4BVXB 4PXOA 3U6VA 4ZL7A 3GH6A 4RQXA 3NIVA 1GSYA 4OD7A 3VWXA 2LNSA 6GSVA 1M9AA 2GVPA 4N10A 2CVKA 1RK4A 4BL7B 5INYA 4J2FA 1PRXA 3N5OA 4TRXA 2GSTA 5G30A 4TVEA 4ZBAA 1PN0A 2H8LA 3KIJA 4BL7A 2MMOA 5IPHA 1B4QA 2UZ8A 3H8QA 2R0PA 1I9DA 1V40A 2H1BA 1GLQA 4WR5A 5GZZB 1TDIA 2H66A 1UC7A 4WXTA 3TKSE 2H0GA 4KH7A 1U88A 3MIXA 1KTEA 2DMMA 4F0CA 2MBTA 3UVHA 3V1WA 5G1LA 3APQA 3GSSA 1WRYA 5J5NA 4JZQA 5GAPD 5AISA 3CMIA 2AB6A 2LJRA 3ZREA 6GSXA 1Z9HA 3K8NA 3LYPA 1THOA 1JHBA 3F9UA 5D9WA 2YJ7A 5AIVA 3ZITA 4MZCA 4F03A 2HSMA 2H30A 4MZWA 3PPUA 5ECRB 4K7IA 3MYDA 1JFUA 5EPFA 5HFGA 4PTSA 3PINA 5IM9A 2KHPA 4EXJA 5GAND 1OE7A 5ID2B 4I8BA 2XPEA 4PQIA 2YPMA 4IHUA 5ID2A 1NSWA 2H73A 4KA0A 5IMCA 3UAPA 1IYIA 5CNWA 4GQCA 4RQRA 4EIPA 1RQMA 3DGQA 2VLVA 2HLSA 1GUHA 1MD3A 3TOUA 1EEJA 4MJBA 3GHAA 8GSSA 4MPGA 2K18A 4P3YB 3LYKA 3ISOA 3GL5A 3N9JA 4PX1A 1CQHA 4K5RA 1DSBA 2KP1A 3GL3A 5B6NA 4ECIA 1GH2A 3QAGA 3WGDA 1EV4A 1HYUA 1SYXA 3I6AA 5H5RA 3C7MA 1OC9A 2YOIA 1X0RA 2L57A 1PQNA 2V6KA 1XG8A 2KUCA 2AHEA 2L4QA 1M3IA 2LV3A 1XW9A 5FWGA 2JSYA 1AXDA 4V2MA 2NVLA 4LL4B 1FG4A 3WT1A 4MNNA 1ON4A 2VCQA 5G5FA 3NZNA 1SK2A 3GYKA 2A2PA 4F82A 3MNGA 1A0RP 2XBQA 1Z6NA 2H72A 1CQGA 2K6VA 3FEUA 1PFOA 1MDJA 4LLRA 4EC0A 10GSA 4AF2A 1DBYA 3ZMKA 4N30A 5KN3A 1X9WB 2HSHA 4EDZA 2HZEB 1XZOA 2CX4A 1ZYEA 5DCGA 5DDLA 1XWCA 1LU4A 3G7YA 2HRNA 4HJMA 3IK7A 3LWAA 3CRTA 2OE0A 1TW9A 1K0MA 1PD21 1XOAA 3KM6A 4FQUA 5DCHA 1UN2A 1XVQA 2J9HA 3EU3A 5AIXA 4BVYB 3EU4A 3PR8A 3KXOA 2X4AA 1K3YA 4YQVA 3F4RA 2R6KA 4FYUA 1DE1A 4ZILA 5B7CA 4V2NA 1ERVA 4PQHA 1MTCA 2R0GA 2H1AA 2YCDA 3R2QA 3L0HA 1SJIA 1T1VA 1JZDA 1TK0B 5DBQA 5AGYA 3IE3A 3F6DA 5JCUA 4BPYA 1BAYA 2FWEA 3F6FA 4EO3A 3FKFA 1X5DA 1U3AA 1UA5A 1XBSA 3VK9A 3A5WA 1R5PA 2YWIA 2DJ2A 4NPBA 1M2BA 2FHEA 3TKPA 1N8JA 1NM3A 2IPAA 2HE3A 2H1GA 1EOHA 3HA9A 1S3RA 4GLTA 5A4VA 3H93A 2GSSA 3TKSC 3KEBA 3EC3A 3DXBA 2YV7A 5KN0A 1BX9A 2VCWA 2GDRA 2OE1A 2YV9A 5EVOA 1FVJA 4MMMA 1RW1A 1O8WA 4IS0A 1VRSD 5IOXA 3A2XA 3C8EA 1EWXA 2X49A 1PX7A 1XPVA 2C3NA 1QXHA 5F05A 2HSYA 4IQAA 3GN3A 4KCAA 4MA9A 2YANA 2CZ2A 3P90A 5IMFA 2A2RA 4LMWA 4EF0A 4I6XA 2CA8A 1J9BA 5BRTA 1TU7A 1ILOA 1GWCA 4EE0A 4IELA 3LEFA 3G7JA 3WT2A 4FO5A 2G2QA 4MLYA 4PUAA 3KP8A 1MDKA 2FD3A 2J23A 4Z2UA 3ZVJD 1V98A 3TJKA 4DSSB 2WS2A 2DMLA 2GSQA 4DEJA 3TKRA 5BMUA 3CSJA 3TUEA 3E3EA 2R0CA 1YDKA 4DSSA 3M0FA 4Z2RA 1ERUA 1FW1A 2PVQA 4JRRA 2HRKA 1W89A 5ECKB 2GT5A 3IHGA 3KCMA 3DVXA 1T4YA 2RM5A 3D5JA 2C1YA 3PGTA 1ST9A 1PN9A 1ACVA 3Q18A 1T3BA 3M1GA 1TRWA 2P5RA 1AC1A 4KDUA 2VCVA 4HQZA 1TKDB 4XS6A 4I5QA 1K3OA 3QD9A 4E8EA 1URMA 2DKHA 3LXZA 2M46A 1EZKA 1Y25A 3CBUA 1ABAA 5J9CA 3H79A 6GSWA 3HVNA 3HVSA 3M9JA 3UBLA 2L59A 2RM6A 2BTOT 3HVVA 3GRXA 3U5RE 3VLNA 1M2AA 3HZ8A 5LCZA 3IBHA 1R26A 5IMDA 4YKFA 4QL7A 4IJ3A 1ML6A 4WBJA 5G2ZA 3KZQA 2OBKA 1IYHA 3VFIA 4X1UA 2H01A 4MCUA 1YZXA 4AJ8A 3VWUA 1V9WA 2F3MA 4USSA 2VUPA 4D73B 1SU9A 2H75A 5G5EA 3G7IA 5COHA 3A2VA 2O7KA 2DJ1A 1R7HA 4YKGA 1ZL9A 3TOTA 3UOMA 2HFDA 1PL1A 3I43A 4ZB9A 2E0QA 3F3RA 3IDVA 3I9V2 3Q6OA 3RAZA 1HNBA 2X8CA 5DQYA 1G7OA 2DSAA 4MJEA 2B5XA 2L6CA 1AW9A 4KNDA 4BA7A 2ON5A 4HOJA 2BJXA 2H6ZA 2O8VB 1FAAA 4LA1A 3WGEA 1K0AA 5G31A 1OKDA 4L5OA 4MJCA 3QMXA 2EC4A 1GUKA 1YJ6A 1ZYNA 3GSTA 5CO3A 2LJKA 2P31A 2VM1A 4BVXA 2OJLA 1YF0A 3BCKA 4NV5A 2EIOA 17GSA 11GSA 2FNOA 3F4TA 2VD0A 3FZ5A 3VI7A 1UVZA 2GZZA 1FB0A 1QUWA 2TRXA 1O6JA 2HRFA 1GTAA 5L71A 5EY6A 3KMNA 3TB2A 1JLWA 4ZXGA 2VL2A 2OBIA 4XRDA 2DKIA 1MDIA 4MPFA 1F3BA 2CV4A 3HJOA 1PMTA 4BIKA 1KNGA 3KTLA 2A4HA 2OA7A 3DWVA 5CRDA 2CZ3A 4N0VA 2H70A 1H75A 3FR3A 1EP8A 2B5EA 4KSMA 1X9SB 2B7KA 3UEMA 3QCPA 4KE3A 4K2DA 12GSA 1QMVA 19GSA 1EEMA 2TIRA 2GLRA 2H71A 2VLUA 5D93A 2O89A 3LSZA 4MK3A 2LKUA 1O8XA 3CTGA 1Q98A 2V41A 2LRTA 1GUMA 1EOGA 1PX6A 3Q19A 5C04A 4PNGA 1XWGA 2B3SA 2PMTA 4XS4B 5ECIB 1TRUA 2H0IA 1T00A 4K5SA 1WJKA 2DJJA 3QPMA 2K8SA 3FY7A 3CXGA 4TXOB 4XS4A 5HFKA 2VO4A 3D4TA 1O81A 2NDOA 3EE2A 2WJUA 1FB6A 3F63A 1HNAA 4TXOA 1PGTA 2A4VA 1XXUA 2YWNA 1TRSA 2WGRA 4X43A 4EKZA 2JL4A 5F06A 5F8BA 5IPGA 3G9BA 4ULXA 4Q5QA 2WULA 4IN0A 5IMZA 4E8HA 4EUYA 2XBIA 4JR4A 3R3EA 4GSTA 4KUNA 3NOFA 1ZGNA 3HCZA 4Q5FA 1U3IA 1VGLA 1VF1A 5IQYA 3IAS2 3W6GA 1VF4A 4G0LA 2NTOA 2LNTA 3D21A 4EDYA 1A2MA 2IIYA 2FLSA 5LNKe 5ECMB 1H4OA 3CQFA 5DVBA 1ZYPA 1QGVA 3QAWA 1E2YA 4IVFA 1GTBA 2R5GA 3LQ7A 2VM2A 5IIZA 2C3TA 5CP1A 6GSTA 2HI7A 3HJPA 2H76A 1YKCA 4WBRD 4Q5NA 4GXZA 4OWYA 4NAXA 2GQMA 4F9ZA 1MD4A 4RUVA 4RI6A 1K3LA 3EMXA 2FUG2 3KP9A 2L5OA 5HR3A 1AAZA 3GA4A 3TDGA 5D9VA 2HZEA 1M9BA 3A2WA 2PBJA 5ELGA 3FMWA 3H4KA 5H5SA 4TR3A 5A5KA 3HY2A 3IXRA 4JE1A 3VPTA 3CRUA 2I9HA 2YN1A 2FA8A 1YKAA 5GSTA 4NHWA 3FZ4A 2YZHA 1THXA 5JCWA 4NV2A 1SJZA 1A0FA 2H1DA 3D6IA 4PGTA 1K0CA 3CTFA 3EINA 5D8IA 4BVYA 2DJKA 2VCTA 2OACA 6GSYA 2IMFA 2VOCA 4G0KA 3VWWA 2H0HA 2RUFA 2X64A 2LJAA 4CW9A 1GSSA 1JLVA 4EL1A 1ZOFA 4CY8A 5HR0A 2ZNMA 1F2EA 4HU7A 3QFAC 3D4MA 4PQ1A 2D2ZA 3TKSA 2H74A 4ZL9A 3WYWA 3ZL5A 4CHSA 4L8EA 4OMVA 1S3CA 1Z7RA 3GUSA 2LS5A 4DSQA 4NWYA 3HHVA 4MH2A 4A5PA 3TJFA 1SYRA 2A2SA 2VAFA 3QDNA 1BG5A 3P7XA 1K0DA 4IBPA 2VD1A 3ZMLA 3A3TA 2LUSA 5HQPA 4KDYA 1QQ2A 1M0UA 1SJ6A 1WE0A 2E2MA 3JCML 3E9JB 2H19A 3HYPA 1TK8B 4IQ1A 5F07A 3DRNA 2LSTA 1G6YA 1GSEA 4V2LA 1S3DA 1SK1A 3EWLA 2VL3A 2N5BA 3TGZA 2EIQA 4HZ4A 3KH7A 2F8AA 2CAQA 2HYXA 2MMAA 1A24A 4O92A 1SKSB 4QL9A 2NPBA 9GSSA 5EL8A 5ECNB 4DVCA 3DMLA 5ECLB 4WETA 5CREA 3FZ9A 3L9UA 3VWVA 2XPDA 4NXIA 1YF1A 4MF6A 2PVOC 3LG6A 2QKEA 5CRWA 3ZZXA 3IPZA 1OYJA 1B9YC 1GTUA 2GT6A 3GV1A 4OFTA 2MMZA 4IP1A 1GNEA 2FWHA 2C4JA 4PNFA 2AV4A 1TJDA 2ALBA 3TJJA 2PWJA 3D22A 4TXVA 3UBKA 4RI7A 4XS1A 1OE8A 1AQWA 5IMVA 4K2XA 5C00A 3BJ5A 2MBSA 3GTUB 3UMAA 1BEDA 1XWKA 4ZB6A 3APSA 2C8UA 4FYBA 4IJIA 4X0XA 5J3RA 1X5EA 1XW5A 1J08A 3PH9A 4WF5A 3UARA 5KOWA 2F8FA 4KX4A 4O32A 1DUGA 1JZRA 3L78A 1KEBA 1LBKA 2E2GA 2FWGA 4Z7XA 3IK9A 2YWMA 2JSZA 2GGTA 3ZRDA 5FHIA 13GSA 2GS3A 2X8HA 1C72A 4G10A 4LL1B 3KJYA 4NHZA 2IMDA 1GSFA 1FOVA 4K7NA 3Q74A 3S9FA 1TTZA 2PUKC 2I81A 2P0GA 5B8AA 3AY8A 2L5LA 2PPTA 1GULA 3LXTA 4HJ2A 2AUVA 4MF7A 3W8SA 1Q4JA 3W8JA 1TRVA 3FZAA 2LRNA 3RHCA 1A2LA 2O85A 3WD6A 4MDCA 3ME8A 1SL1B 5J9BA 4O5RA 5J4UA 3LORA 3DYRA 2WB9A 2FWFA 2PU9C 3C73A 2WFCA 1VF3A 2C0GA 2E7PA 4YAPA 1XW6A 3ZIVA 2CVDA 2BMXA 3ZYWA 4I2TA 3RPNA 2DLXA 3APOA 5JWRB 4IW9A 3F3QA 1GTIA 4L0WA 2R4VA 1XFLA 1NHYA 5ELAA 3UIWA 1ZZYA 3WGXA 2X99A 4D73A 3HDCA 3QR6A 3ERWA 3HXSA 3UL3A 5JWOB 4XIHA 4N11A 4F2IA 5ECHB 4OCEA 1A8YA 6GSSA 4GSSA 2MZCA 3FR6A 4G9HA 1TOFA 3EMPA 4ZBBA 1PL2A 3GNJA 1ERWA 1B9XC 2GQLA 5CRGA 1FHEA 2B1LA 5B8BA 2QSIA 1QK8A 5DAKB 3HZ4A 5ECSA 1K0NA 3GH9A 3IV4A 2ZCTA 3ZLPA 4JU5A 1PKZA 1G6WA 2V2GA 3IHQA 1HQOA 5DAKA 1EP7A 1YQ1A 4JR6A 4OCFA 4J56E 1V2AA 4JBBA 1WIKA 2GZPA 4YQUA 2FCHA 3HVXA 1GP1A 4G2EA 5ECPB 1YEPA 1XVWA 4F0BA 1W4VA 2PGTA 3DIEA 1F6MC 2YP6A 3FR9A 2K8VA 4POMA 1B8XA 4ZB8A 4O5QA 5DALB 4MABA 4J57E 1F9MA 2FGXA 4G0IA 2AAWA 4IGJA 4N0ZA 18GSA 5DALA 2QA2A 5JWQB 2GZYA 3C1SA 1SKRB 1O7UA 3SBCA
chains in the Genus database with same CATH topology
1GSUA 2TRCP 4ML6A 1PKWA 2B7JA 1M2DA 3E0UA 4DSRA 4ZBDA 1AQXA 4POLA 1J0FA 3EVIA 1NW2A 5E59A 4ECCA 3CYNA 1Z5YE 3F0IA 3ME7A 5HR1A 3IC8A 3L9SA 3DEXA 4HS1A 3J7Yb 4WR4A 5AN1A 4EIQA 5F0GA 4KF9A 3CSHA 3H1NA 2AJQB 7GSSA 2JZRA 1JZWA 1GSDA 1SK0A 4IP6A 4V1Ag 1X5CA 3I69A 2JADA 2ON7A 5A4WA 3QAVA 5DJMA 2FY6A 3IAM2 3KH9A 2JU5A 4WKWA 1AUCA 2KLXA 1U87A 4K9ZA 4TN8A 2IFQB 3IR4A 1DE2A 2RUEA 4MJAA 1SD9A 2VL2C 4KSOA 1R5AA 2OADA 4PUFC 2LEGA 2IJYA 2LTKA 1KBNA 4I2UA 2C0EA 2IFQA 3VI5A 1WMJA 2CX3A 1EGOA 1XWBA 4GTUA 4KGIA 4ACSA 5FT3A 3O3TA 1FO5A 3F8UA 1Z6MA 2O87A 5D96A 4FH8A 5KOXA 1K0BA 1Y6EA 5D9TA 3GX8A 5DJLA 1B4PA 4HEA2 2G0FA 2I3YA 1QFNA 1XOBA 1OKTA 1YEXA 4LMVA 4WEYA 3UJ1A 1G0TA 2WZ9A 3M3MA 2XC2A 2CVBA 2QGVA 3TRPA 3TRQA 1OC9B 3LJRA 1VF2A 1TK5B 1PSQA 4AJ6A 1PA3A 6GSUA 1MEKA 2ES7A 1U6TA 2L4CA 1BJXA 2IWTA 4GWRA 2EIRA 2Z9SA 2YZUA 4L0UA 2B6MA 2IN3A 4KDXA 4XRAA 5E4WA 2C3QA 3L4NA 5KN2A 3GIXA 4BWSA 1GRXA 4OFMA 4GSNA 2MYGA 3BCIA 2GQKA 3TRXA 1GL8A 2GSRA 3IC4A 4FIWA 5GSSA 2DBCA 2I1UA 22GSA 3LFLA 1SENA 4K1FA 1ZMAA 4BWQA 5D73A 1T8EB 2JZTA 2OE3A 5KN1A 5IO2A 4XCSA 3BOAA 4K7OA 3RDWA 1OC8A 4KB3A 3TKQA 3GKXA 3ZIJA 2CQ9A 3GKNA 4CY6A 2QA1A 4MZBA 4K0NA 1BYEA 5ABRA 1B48A 1T7PB 4TW5A 4GQFA 4TOPA 4IKHA 5IO0A 1E6BA 4KCEA 2B5YA 3SWLA 2KOKA 1OVNA 1XIYA 4ISDA 2VCZA 4AGSA 3GURA 3QOUA 1SL2B 4K0GA 2F9SA 5LD0A 1FOHA 4ZIJA 3C71A 1Z3EA 4CDOA 1Z7PA 1GNWA 1AIUA 4L5LA 3ZFLA 1GLPA 2VLTA 3P8WA 4POBA 1GSQA 3ZFBA 5J41A 1SKWB 3GMFA 3EURA 1JZOA 2HRAA 2RIIA 2WCIA 2V1MA 5D9XA 1NHOA 3DKSA 5CYYA 5DQSA 14GSA 3TJGA 3DVWA 2AYTA 1HD2A 1O73A 4KAEA 2RLIA 1K0OA 4ID0A 2PN8A 4NMUA 1USBA 2R3XA 3KD0A 4HU9A 2DIZA 2KP2A 4OFNA 1R4WA 4MF5A 3FK8A 1V57A 2I4AA 5HFIA 3BD2A 3US3A 4AJ7A 2F51A 2B1KA 4ILFA 3TJBA 2HXKA 2REMA 4PURA 2K9FA 4XTSA 1I5GA 1M7TA 1WPIA 3FRCA 2IMIA 3LGCA 2R2JA 2H6YA 5KEJA 4ICYA 4OO5A 3RBTA 4O7HA 3VPQA 2DJ3A 5HR2A 4KW6A 5JCGA 2N5FA 4MH3A 4HZ2A 1EGRA 4QQ7A 1EV9A 1S3AA 3UVTA 4ZL8A 4X4JA 3LW9A 3FYGA 5G1KA 4TR4A 3DD3A 3EPTA 2OKAA 2QC7A 3BBYA 2LQQA 1TI3A 4GCIA 3P2AA 2DJ0A 3J7Yk 3QFBC 2VIMA 5B6MA 4TR0A 4WF4A 5A4UA 1BQ7A 3L9VA 1TXXA 3O6TA 1XCCA 2HT9A 1FVKA 2DIYA 4HQSA 1V58A 3GX0A 4MP4A 1X9MB 4H86A 1WWJA 2MMNA 2IMEA 2WDUA 3GTUA 3IRAA 2WRTA 1SL0B 2L6DA 3ZVJA 3GKKA 1SD8A 3TCOA 2HNLA 4YH2A 4K8MA 3KTBA 2PERA 3M9KA 1WP0A 4G19A 3MDKA 2X8GA 2VL9A 4HUAA 4Q5RA 1A2JA 5CRHA 1AQVA 2HZFA 3ERFA 4ECBA 4EVMA 1G7EA 3RHBA 3RPPA 20GSA 5ECOB 1ZCPA 3IA1A 3O76A 3KMOA 4I97A 2V6OA 2H6XA 2P5QA 3MWHA 2JZSA 1F3AA 3CSIA 2IMKA 16GSA 1TU8A 1TP9A 2YWOA 2NBSA 3EYTA 2LQOA 5CAXA 3C1RA 1M99A 2R37A 3FW2A 1A23A 2CAIA 2XHFA 1OAZA 4V1Ap 4HDEA 4O5UA 1OC3A 2VCXA 1HNCA 4YAVA 2V32A 4K6XA 1N2AA 4Z2TA 3ERGA 5ENUA 3GFKA 3ZTLA 2IL3A 2M72A 4POKA 3F4SA 2GTUA 3D0ZA 5IMAA 4TKYA 4TR1B 1ZYQB 1TI1A 2M80A 4OO4A 3FHKA 4ML1A 2C80A 4ECJA 3M8NA 3HJMA 4TR1A 5ECQB 1YY7A 3A5IA 2N5AA 3OR5A 2YNXA 1ERTA 3VURA 5IOWA 5H5QA 4YQMA 1LJRA 2ZUPA 2CT6A 1A8LA 3HKRA 2DC5A 4GRFA 2FA4A 3KGKA 2YJHA 3ED3A 1XWAA 4GF0A 3IOSA 4FYCA 3HD5A 3GKMA 1O85A 2LRCA 1F37A 4XHMA 1T4ZA 2C0DA 4JEDA 4HI7A 3MAKA 1WOUA 2C0FA 2JACA 3MSZA 4BVXB 4PXOA 3U6VA 4ZL7A 3GH6A 4RQXA 3NIVA 1GSYA 4OD7A 3VWXA 2LNSA 6GSVA 1M9AA 2GVPA 4N10A 2CVKA 1RK4A 4BL7B 5INYA 4J2FA 1PRXA 3N5OA 4TRXA 2GSTA 5G30A 4TVEA 4ZBAA 1PN0A 2H8LA 3KIJA 4BL7A 2MMOA 5IPHA 1B4QA 2UZ8A 3H8QA 2R0PA 1I9DA 1V40A 2H1BA 1GLQA 4WR5A 5GZZB 1TDIA 2H66A 1UC7A 4WXTA 3TKSE 2H0GA 4KH7A 1U88A 3MIXA 1KTEA 2DMMA 4F0CA 2MBTA 3UVHA 3V1WA 5G1LA 3APQA 3GSSA 1WRYA 5J5NA 4JZQA 5GAPD 5AISA 3CMIA 2AB6A 2LJRA 3ZREA 6GSXA 1Z9HA 3K8NA 3LYPA 1THOA 1JHBA 3F9UA 5D9WA 2YJ7A 5AIVA 3ZITA 4MZCA 4F03A 2HSMA 2H30A 4MZWA 3PPUA 5ECRB 4K7IA 3MYDA 1JFUA 5EPFA 5HFGA 4PTSA 3PINA 5IM9A 2KHPA 4EXJA 5GAND 1OE7A 5ID2B 4I8BA 2XPEA 4PQIA 2YPMA 4IHUA 5ID2A 1NSWA 2H73A 4KA0A 5IMCA 3UAPA 1IYIA 5CNWA 4GQCA 4RQRA 4EIPA 1RQMA 3DGQA 2VLVA 2HLSA 1GUHA 1MD3A 3TOUA 1EEJA 4MJBA 3GHAA 8GSSA 4MPGA 2K18A 4P3YB 3LYKA 3ISOA 3GL5A 3N9JA 4PX1A 1CQHA 4K5RA 1DSBA 2KP1A 3GL3A 5B6NA 4ECIA 1GH2A 3QAGA 3WGDA 1EV4A 1HYUA 1SYXA 3I6AA 5H5RA 3C7MA 1OC9A 2YOIA 1X0RA 2L57A 1PQNA 2V6KA 2KUCA 2AHEA 2L4QA 2LV3A 1XW9A 5FWGA 2JSYA 1AXDA 4V2MA 2NVLA 4LL4B 1FG4A 3WT1A 4MNNA 1ON4A 2VCQA 5G5FA 3NZNA 1SK2A 3GYKA 2A2PA 4F82A 3MNGA 1A0RP 2XBQA 1Z6NA 2H72A 1CQGA 2K6VA 3FEUA 1MDJA 4LLRA 4EC0A 10GSA 4AF2A 1DBYA 3ZMKA 4N30A 5KN3A 1X9WB 2HSHA 4EDZA 2HZEB 1XZOA 2CX4A 1ZYEA 5DCGA 5DDLA 1XWCA 1LU4A 3G7YA 2HRNA 4HJMA 3IK7A 3LWAA 3CRTA 2OE0A 1TW9A 1K0MA 1PD21 1XOAA 3KM6A 4FQUA 5DCHA 1UN2A 1XVQA 2J9HA 3EU3A 5AIXA 4BVYB 3EU4A 3PR8A 3KXOA 2X4AA 1K3YA 4YQVA 3F4RA 2R6KA 4FYUA 1DE1A 4ZILA 5B7CA 4V2NA 1ERVA 4PQHA 1MTCA 2R0GA 2H1AA 2YCDA 3R2QA 3L0HA 1SJIA 1T1VA 1JZDA 1TK0B 5DBQA 5AGYA 3IE3A 3F6DA 5JCUA 4BPYA 1BAYA 2FWEA 3F6FA 4EO3A 3FKFA 1X5DA 1U3AA 1UA5A 1XBSA 3VK9A 3A5WA 1R5PA 2YWIA 2DJ2A 4NPBA 1M2BA 2FHEA 3TKPA 1N8JA 1NM3A 2IPAA 2HE3A 2H1GA 1EOHA 3HA9A 4GLTA 5A4VA 3H93A 2GSSA 3TKSC 3KEBA 3EC3A 3DXBA 2YV7A 5KN0A 1BX9A 2VCWA 2GDRA 2OE1A 2YV9A 5EVOA 1FVJA 4MMMA 1RW1A 1O8WA 4IS0A 1VRSD 5IOXA 3A2XA 3C8EA 1EWXA 2X49A 1PX7A 1XPVA 2C3NA 1QXHA 5F05A 2HSYA 4IQAA 3GN3A 4KCAA 4MA9A 2YANA 2CZ2A 3P90A 5IMFA 2A2RA 4LMWA 4EF0A 4I6XA 2CA8A 1J9BA 5BRTA 1TU7A 1ILOA 1GWCA 4EE0A 4IELA 3LEFA 3G7JA 3WT2A 4FO5A 2G2QA 4MLYA 4PUAA 3KP8A 1MDKA 2FD3A 2J23A 4Z2UA 3ZVJD 1V98A 3TJKA 4DSSB 2WS2A 2DMLA 2GSQA 4DEJA 3TKRA 5BMUA 3CSJA 3TUEA 3E3EA 2R0CA 1YDKA 4DSSA 3M0FA 4Z2RA 1ERUA 1FW1A 2PVQA 4JRRA 2HRKA 1W89A 5ECKB 2GT5A 3IHGA 3KCMA 3DVXA 1T4YA 2RM5A 3D5JA 2C1YA 3PGTA 1ST9A 1PN9A 1ACVA 3Q18A 1T3BA 3M1GA 1TRWA 2P5RA 1AC1A 4KDUA 2VCVA 4HQZA 1TKDB 4XS6A 4I5QA 1K3OA 3QD9A 4E8EA 1URMA 2DKHA 3LXZA 2M46A 1EZKA 1Y25A 3CBUA 1ABAA 5J9CA 3H79A 6GSWA 3HVSA 3M9JA 3UBLA 2L59A 2RM6A 2BTOT 3HVVA 3GRXA 3U5RE 3VLNA 1M2AA 3HZ8A 5LCZA 3IBHA 1R26A 5IMDA 4YKFA 4QL7A 4IJ3A 1ML6A 4WBJA 5G2ZA 3KZQA 2OBKA 1IYHA 3VFIA 4X1UA 2H01A 4MCUA 1YZXA 4AJ8A 3VWUA 1V9WA 2F3MA 4USSA 2VUPA 4D73B 1SU9A 2H75A 5G5EA 3G7IA 5COHA 3A2VA 2O7KA 2DJ1A 1R7HA 4YKGA 1ZL9A 3TOTA 3UOMA 2HFDA 1PL1A 3I43A 4ZB9A 2E0QA 3F3RA 3IDVA 3I9V2 3Q6OA 3RAZA 1HNBA 2X8CA 5DQYA 1G7OA 2DSAA 4MJEA 2B5XA 2L6CA 1AW9A 4KNDA 4BA7A 2ON5A 4HOJA 2BJXA 2H6ZA 2O8VB 1FAAA 4LA1A 3WGEA 1K0AA 5G31A 1OKDA 4L5OA 4MJCA 3QMXA 2EC4A 1GUKA 1YJ6A 1ZYNA 3GSTA 5CO3A 2LJKA 2P31A 2VM1A 4BVXA 2OJLA 1YF0A 3BCKA 4NV5A 2EIOA 17GSA 11GSA 2FNOA 3F4TA 2VD0A 3FZ5A 3VI7A 1UVZA 2GZZA 1FB0A 1QUWA 2TRXA 1O6JA 2HRFA 1GTAA 5L71A 5EY6A 3KMNA 3TB2A 1JLWA 4ZXGA 2VL2A 2OBIA 4XRDA 2DKIA 1MDIA 4MPFA 1F3BA 2CV4A 3HJOA 1PMTA 1KNGA 3KTLA 2A4HA 2OA7A 3DWVA 5CRDA 2CZ3A 4N0VA 2H70A 1H75A 3FR3A 1EP8A 2B5EA 4KSMA 1X9SB 2B7KA 3UEMA 3QCPA 4KE3A 4K2DA 12GSA 1QMVA 19GSA 1EEMA 2TIRA 2GLRA 2H71A 2VLUA 5D93A 2O89A 3LSZA 4MK3A 2LKUA 1O8XA 3CTGA 1Q98A 2V41A 2LRTA 1GUMA 1EOGA 1PX6A 3Q19A 5C04A 4PNGA 1XWGA 2B3SA 2PMTA 4XS4B 5ECIB 1TRUA 2H0IA 1T00A 4K5SA 1WJKA 2DJJA 3QPMA 2K8SA 3FY7A 3CXGA 4TXOB 4XS4A 5HFKA 2VO4A 3D4TA 1O81A 2NDOA 3EE2A 2WJUA 1FB6A 3F63A 1HNAA 4TXOA 1PGTA 2A4VA 1XXUA 2YWNA 1TRSA 2WGRA 4X43A 4EKZA 2JL4A 5F06A 5F8BA 5IPGA 3G9BA 4ULXA 4Q5QA 2WULA 4IN0A 5IMZA 4E8HA 4EUYA 2XBIA 4JR4A 3R3EA 4GSTA 4KUNA 3NOFA 1ZGNA 3HCZA 4Q5FA 1U3IA 1VGLA 1VF1A 5IQYA 3IAS2 3W6GA 1VF4A 4G0LA 2NTOA 2LNTA 3D21A 4EDYA 1A2MA 2IIYA 2FLSA 5LNKe 5ECMB 1H4OA 5DVBA 1ZYPA 1QGVA 3QAWA 1E2YA 4IVFA 1GTBA 2R5GA 3LQ7A 2VM2A 5IIZA 2C3TA 5CP1A 6GSTA 2HI7A 3HJPA 2H76A 1YKCA 4WBRD 4Q5NA 4GXZA 4OWYA 4NAXA 2GQMA 4F9ZA 1MD4A 4RUVA 4RI6A 1K3LA 3EMXA 2FUG2 3KP9A 2L5OA 5HR3A 1AAZA 3GA4A 3TDGA 5D9VA 2HZEA 1M9BA 3A2WA 2PBJA 5ELGA 3FMWA 3H4KA 5H5SA 4TR3A 5A5KA 3HY2A 3IXRA 4JE1A 3VPTA 3CRUA 2I9HA 2YN1A 2FA8A 1YKAA 5GSTA 4NHWA 3FZ4A 2YZHA 1THXA 5JCWA 4NV2A 1SJZA 1A0FA 2H1DA 3D6IA 4PGTA 1K0CA 3CTFA 3EINA 5D8IA 4BVYA 2DJKA 2VCTA 2OACA 6GSYA 2IMFA 2VOCA 4G0KA 3VWWA 2H0HA 2RUFA 2X64A 2LJAA 4CW9A 1GSSA 1JLVA 4EL1A 1ZOFA 4CY8A 5HR0A 2ZNMA 1F2EA 4HU7A 3QFAC 3D4MA 4PQ1A 2D2ZA 3TKSA 2H74A 4ZL9A 3WYWA 3ZL5A 4CHSA 4L8EA 4OMVA 1S3CA 1Z7RA 3GUSA 2LS5A 4DSQA 4NWYA 3HHVA 4MH2A 4A5PA 3TJFA 1SYRA 2A2SA 2VAFA 3QDNA 1BG5A 3P7XA 1K0DA 4IBPA 2VD1A 3ZMLA 3A3TA 2LUSA 5HQPA 4KDYA 1QQ2A 1M0UA 1SJ6A 1WE0A 2E2MA 3JCML 3E9JB 2H19A 3HYPA 1TK8B 4IQ1A 5F07A 3DRNA 2LSTA 1G6YA 1GSEA 4V2LA 1S3DA 1SK1A 3EWLA 2VL3A 2N5BA 3TGZA 2EIQA 4HZ4A 3KH7A 2F8AA 2CAQA 2HYXA 2MMAA 1A24A 4O92A 1SKSB 4QL9A 2NPBA 9GSSA 5EL8A 5ECNB 4DVCA 3DMLA 5ECLB 4WETA 5CREA 3FZ9A 3L9UA 3VWVA 2XPDA 4NXIA 1YF1A 4MF6A 2PVOC 3LG6A 2QKEA 5CRWA 3ZZXA 3IPZA 1OYJA 1B9YC 1GTUA 2GT6A 3GV1A 4OFTA 2MMZA 4IP1A 1GNEA 2FWHA 2C4JA 4PNFA 2AV4A 1TJDA 2ALBA 3TJJA 2PWJA 3D22A 4TXVA 3UBKA 4RI7A 4XS1A 1OE8A 1AQWA 5IMVA 4K2XA 5C00A 3BJ5A 2MBSA 3GTUB 3UMAA 1BEDA 1XWKA 4ZB6A 3APSA 2C8UA 4FYBA 4IJIA 4X0XA 5J3RA 1X5EA 1XW5A 1J08A 3PH9A 4WF5A 3UARA 5KOWA 2F8FA 4KX4A 4O32A 1DUGA 1JZRA 3L78A 1KEBA 1LBKA 2E2GA 2FWGA 4Z7XA 3IK9A 2YWMA 2JSZA 2GGTA 3ZRDA 5FHIA 13GSA 2GS3A 2X8HA 1C72A 4G10A 4LL1B 3KJYA 4NHZA 2IMDA 1GSFA 1FOVA 4K7NA 3Q74A 3S9FA 1TTZA 2PUKC 2I81A 2P0GA 5B8AA 3AY8A 2L5LA 2PPTA 1GULA 3LXTA 4HJ2A 2AUVA 4MF7A 3W8SA 1Q4JA 3W8JA 1TRVA 3FZAA 2LRNA 3RHCA 1A2LA 2O85A 3WD6A 4MDCA 3ME8A 1SL1B 5J9BA 4O5RA 5J4UA 3LORA 3DYRA 2WB9A 2FWFA 2PU9C 3C73A 2WFCA 1VF3A 2C0GA 2E7PA 4YAPA 1XW6A 3ZIVA 2CVDA 2BMXA 3ZYWA 4I2TA 3RPNA 2DLXA 3APOA 5JWRB 4IW9A 3F3QA 1GTIA 4L0WA 2R4VA 1XFLA 1NHYA 5ELAA 3UIWA 1ZZYA 3WGXA 2X99A 4D73A 3HDCA 3QR6A 3ERWA 3HXSA 3UL3A 5JWOB 4XIHA 4N11A 4F2IA 5ECHB 4OCEA 1A8YA 6GSSA 4GSSA 2MZCA 3FR6A 4G9HA 1TOFA 3EMPA 4ZBBA 1PL2A 3GNJA 1ERWA 1B9XC 2GQLA 5CRGA 1FHEA 2B1LA 5B8BA 2QSIA 1QK8A 5DAKB 3HZ4A 5ECSA 1K0NA 3GH9A 3IV4A 2ZCTA 3ZLPA 4JU5A 1PKZA 1G6WA 2V2GA 3IHQA 1HQOA 5DAKA 1EP7A 1YQ1A 4JR6A 4OCFA 4J56E 1V2AA 4JBBA 1WIKA 2GZPA 4YQUA 2FCHA 3HVXA 1GP1A 4G2EA 5ECPB 1YEPA 1XVWA 4F0BA 1W4VA 2PGTA 3DIEA 1F6MC 2YP6A 3FR9A 2K8VA 4POMA 1B8XA 4ZB8A 4O5QA 5DALB 4MABA 4J57E 1F9MA 2FGXA 4G0IA 2AAWA 4IGJA 4N0ZA 18GSA 5DALA 2QA2A 5JWQB 2GZYA 3C1SA 1SKRB 1O7UA 3SBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSU A;  2TRC P;  4ML6 A;  1PKW A;  2B7J A;  1M2D A;  3E0U A;  4DSR A;  4ZBD A;  1AQX A;  4POL A;  1J0F A;  3EVI A;  1NW2 A;  5E59 A;  4ECC A;  3CYN A;  1Z5Y E;  3F0I A;  3ME7 A;  5HR1 A;  3L9S A;  3DEX A;  4HS1 A;  3J7Y b;  4WR4 A;  5AN1 A;  5F0G A;  3CSH A;  3H1N A;  2AJQ B;  7GSS A;  2JZR A;  1JZW A;  1GSD A;  1SK0 A;  4IP6 A;  4V1A g;  1X5C A;  3I69 A;  2JAD A;  2ON7 A;  5A4W A;  3QAV A;  5DJM A;  2FY6 A;  3IAM 2;  3KH9 A;  2JU5 A;  4WKW A;  1AUC A;  2KLX A;  1U87 A;  4K9Z A;  4TN8 A;  2IFQ B;  3IR4 A;  1DE2 A;  2RUE A;  4MJA A;  1SD9 A;  2VL2 C;  4KSO A;  1R5A A;  2OAD A;  4PUF C;  2LEG A;  2IJY A;  2LTK A;  1KBN A;  4I2U A;  2C0E A;  2IFQ A;  3VI5 A;  1WMJ A;  2CX3 A;  1EGO A;  1XWB A;  4GTU A;  4KGI A;  4ACS A;  5FT3 A;  3O3T A;  1FO5 A;  3F8U A;  1Z6M A;  2O87 A;  5D96 A;  4FH8 A;  1K0B A;  1Y6E A;  5D9T A;  3GX8 A;  5DJL A;  1B4P A;  4HEA 2;  2G0F A;  2I3Y A;  1QFN A;  1XOB A;  1OKT A;  1YEX A;  4LMV A;  4WEY A;  3UJ1 A;  1G0T A;  2WZ9 A;  3M3M A;  2XC2 A;  2CVB A;  2QGV A;  3TRP A;  3TRQ A;  1OC9 B;  3LJR A;  1VF2 A;  1TK5 B;  1PSQ A;  4AJ6 A;  1PA3 A;  6GSU A;  1MEK A;  2ES7 A;  1U6T A;  2L4C A;  1BJX A;  2IWT A;  4GWR A;  2EIR A;  2Z9S A;  2YZU A;  4L0U A;  2B6M A;  2IN3 A;  4KDX A;  4XRA A;  5E4W A;  2C3Q A;  3L4N A;  5KN2 A;  3GIX A;  4BWS A;  1GRX A;  4OFM A;  4GSN A;  2MYG A;  3BCI A;  2GQK A;  3TRX A;  1GL8 A;  2GSR A;  3IC4 A;  4FIW A;  5GSS A;  2DBC A;  2I1U A;  22GS A;  3LFL A;  1SEN A;  4K1F A;  1ZMA A;  4BWQ A;  5D73 A;  1T8E B;  2JZT A;  2OE3 A;  5KN1 A;  5IO2 A;  4XCS A;  3BOA A;  4K7O A;  3RDW A;  1OC8 A;  4KB3 A;  3TKQ A;  3GKX A;  3ZIJ A;  2CQ9 A;  3GKN A;  4MZB A;  4K0N A;  1BYE A;  5ABR A;  1B48 A;  1T7P B;  4TW5 A;  4GQF A;  4TOP A;  4IKH A;  5IO0 A;  1E6B A;  4KCE A;  2B5Y A;  3SWL A;  2KOK A;  1OVN A;  1XIY A;  4ISD A;  2VCZ A;  4AGS A;  3GUR A;  3QOU A;  1SL2 B;  4K0G A;  2F9S A;  5LD0 A;  4ZIJ A;  3C71 A;  1Z3E A;  4CDO A;  1Z7P A;  1GNW A;  1AIU A;  4L5L A;  3ZFL A;  1GLP A;  2VLT A;  3P8W A;  4POB A;  1GSQ A;  3ZFB A;  5J41 A;  1SKW B;  3GMF A;  3EUR A;  1JZO A;  2RII A;  2WCI A;  2V1M A;  5D9X A;  1NHO A;  3DKS A;  5CYY A;  5DQS A;  14GS A;  3TJG A;  3DVW A;  2AYT A;  1HD2 A;  1O73 A;  4KAE A;  2RLI A;  1K0O A;  4ID0 A;  2PN8 A;  4NMU A;  1USB A;  2R3X A;  3KD0 A;  4HU9 A;  2DIZ A;  2KP2 A;  4OFN A;  1R4W A;  4MF5 A;  3FK8 A;  1V57 A;  2I4A A;  5HFI A;  3BD2 A;  3US3 A;  4AJ7 A;  2F51 A;  2B1K A;  4ILF A;  3TJB A;  2HXK A;  2REM A;  4PUR A;  2K9F A;  4XTS A;  1I5G A;  1M7T A;  1WPI A;  3FRC A;  2IMI A;  3LGC A;  2R2J A;  2H6Y A;  5KEJ A;  4OO5 A;  3RBT A;  4O7H A;  3VPQ A;  2DJ3 A;  5HR2 A;  4KW6 A;  5JCG A;  2N5F A;  4MH3 A;  4HZ2 A;  1EGR A;  4QQ7 A;  1EV9 A;  1S3A A;  3UVT A;  4ZL8 A;  3FYG A;  5G1K A;  4TR4 A;  3DD3 A;  2OKA A;  2QC7 A;  3BBY A;  2LQQ A;  1TI3 A;  4GCI A;  3P2A A;  2DJ0 A;  3J7Y k;  3QFB C;  2VIM A;  5B6M A;  4TR0 A;  4WF4 A;  5A4U A;  1BQ7 A;  3L9V A;  1TXX A;  3O6T A;  1XCC A;  2HT9 A;  1FVK A;  2DIY A;  4HQS A;  1V58 A;  3GX0 A;  4MP4 A;  1X9M B;  4H86 A;  1WWJ A;  2MMN A;  2IME A;  2WDU A;  3GTU A;  3IRA A;  2WRT A;  1SL0 B;  2L6D A;  3ZVJ A;  3GKK A;  1SD8 A;  3TCO A;  2HNL A;  4YH2 A;  4K8M A;  3KTB A;  2PER A;  3M9K A;  1WP0 A;  4G19 A;  3MDK A;  2X8G A;  2VL9 A;  4HUA A;  4Q5R A;  1A2J A;  5CRH A;  1AQV A;  2HZF A;  3ERF A;  4ECB A;  4EVM A;  1G7E A;  3RHB A;  3RPP A;  20GS A;  5ECO B;  1ZCP A;  3IA1 A;  3O76 A;  3KMO A;  4I97 A;  2V6O A;  2H6X A;  2P5Q A;  3MWH A;  2JZS A;  1F3A A;  3CSI A;  2IMK A;  16GS A;  1TU8 A;  1TP9 A;  2YWO A;  2NBS A;  3EYT A;  2LQO A;  5CAX A;  3C1R A;  1M99 A;  2R37 A;  3FW2 A;  1A23 A;  2CAI A;  2XHF A;  1OAZ A;  4V1A p;  4HDE A;  1OC3 A;  2VCX A;  1HNC A;  4YAV A;  2V32 A;  4K6X A;  1N2A A;  3ERG A;  5ENU A;  3GFK A;  3ZTL A;  2IL3 A;  2M72 A;  4POK A;  3F4S A;  2GTU A;  3D0Z A;  5IMA A;  4TKY A;  4TR1 B;  1ZYQ B;  1TI1 A;  2M80 A;  4OO4 A;  3FHK A;  4ML1 A;  2C80 A;  4ECJ A;  3M8N A;  3HJM A;  4TR1 A;  5ECQ B;  1YY7 A;  2N5A A;  3OR5 A;  2YNX A;  1ERT A;  3VUR A;  5IOW A;  5H5Q A;  4YQM A;  1LJR A;  2ZUP A;  2CT6 A;  1A8L A;  3HKR A;  2DC5 A;  4GRF A;  2FA4 A;  3KGK A;  2YJH A;  3ED3 A;  1XWA A;  4GF0 A;  3IOS A;  4FYC A;  3HD5 A;  3GKM A;  1O85 A;  2LRC A;  1F37 A;  4XHM A;  1T4Z A;  2C0D A;  4JED A;  4HI7 A;  3MAK A;  1WOU A;  2C0F A;  2JAC A;  3MSZ A;  4PXO A;  3U6V A;  4ZL7 A;  3GH6 A;  4RQX A;  3NIV A;  1GSY A;  4OD7 A;  3VWX A;  2LNS A;  6GSV A;  1M9A A;  2GVP A;  4N10 A;  2CVK A;  1RK4 A;  5INY A;  4J2F A;  1PRX A;  3N5O A;  4TRX A;  2GST A;  5G30 A;  4TVE A;  4ZBA A;  2H8L A;  3KIJ A;  4BL7 A;  2MMO A;  5IPH A;  1B4Q A;  3H8Q A;  1I9D A;  1V40 A;  2H1B A;  1GLQ A;  4WR5 A;  5GZZ B;  1TDI A;  2H66 A;  1UC7 A;  4WXT A;  3TKS E;  2H0G A;  4KH7 A;  1U88 A;  1KTE A;  2DMM A;  4F0C A;  2MBT A;  3UVH A;  3V1W A;  5G1L A;  3APQ A;  3GSS A;  1WRY A;  5J5N A;  4JZQ A;  5GAP D;  5AIS A;  3CMI A;  2AB6 A;  2LJR A;  3ZRE A;  6GSX A;  1Z9H A;  3K8N A;  3LYP A;  1THO A;  1JHB A;  3F9U A;  5D9W A;  2YJ7 A;  5AIV A;  3ZIT A;  4MZC A;  4F03 A;  2H30 A;  4MZW A;  5ECR B;  4K7I A;  1JFU A;  5EPF A;  5HFG A;  5IM9 A;  3PIN A;  2KHP A;  4EXJ A;  5GAN D;  1OE7 A;  5ID2 B;  4I8B A;  2XPE A;  4PQI A;  2YPM A;  4IHU A;  5ID2 A;  1NSW A;  2H73 A;  4KA0 A;  5IMC A;  3UAP A;  1IYI A;  5CNW A;  4GQC A;  4RQR A;  1RQM A;  3DGQ A;  2VLV A;  2HLS A;  1GUH A;  1MD3 A;  3TOU A;  1EEJ A;  4MJB A;  3GHA A;  8GSS A;  4MPG A;  2K18 A;  4P3Y B;  3LYK A;  3ISO A;  3GL5 A;  3N9J A;  4PX1 A;  1CQH A;  1DSB A;  2KP1 A;  3GL3 A;  5B6N A;  4ECI A;  1GH2 A;  3QAG A;  3WGD A;  1EV4 A;  1HYU A;  1SYX A;  3I6A A;  5H5R A;  3C7M A;  1OC9 A;  2YOI A;  1X0R A;  2L57 A;  1PQN A;  2V6K A;  2KUC A;  2AHE A;  2L4Q A;  2LV3 A;  1XW9 A;  5FWG A;  2JSY A;  1AXD A;  4V2M A;  2NVL A;  4LL4 B;  1FG4 A;  3WT1 A;  1ON4 A;  2VCQ A;  5G5F A;  3NZN A;  1SK2 A;  3GYK A;  4F82 A;  3MNG A;  1A0R P;  2XBQ A;  1Z6N A;  2H72 A;  1CQG A;  2K6V A;  3FEU A;  1MDJ A;  4LLR A;  4EC0 A;  10GS A;  4AF2 A;  1DBY A;  3ZMK A;  4N30 A;  5KN3 A;  1X9W B;  2HSH A;  4EDZ A;  2HZE B;  1XZO A;  2CX4 A;  1ZYE A;  5DCG A;  5DDL A;  1XWC A;  1LU4 A;  3G7Y A;  2HRN A;  4HJM A;  3IK7 A;  3LWA A;  3CRT A;  2OE0 A;  1TW9 A;  1K0M A;  1PD2 1;  1XOA A;  3KM6 A;  5DCH A;  1UN2 A;  1XVQ A;  2J9H A;  3EU3 A;  5AIX A;  3EU4 A;  3PR8 A;  3KXO A;  1K3Y A;  4YQV A;  3F4R A;  2R6K A;  4FYU A;  1DE1 A;  4ZIL A;  5B7C A;  4V2N A;  1ERV A;  4PQH A;  1MTC A;  2H1A A;  2YCD A;  3R2Q A;  3L0H A;  1SJI A;  1T1V A;  1JZD A;  1TK0 B;  5DBQ A;  5AGY A;  3IE3 A;  3F6D A;  5JCU A;  4BPY A;  1BAY A;  2FWE A;  3F6F A;  4EO3 A;  3FKF A;  1X5D A;  1U3A A;  1UA5 A;  1XBS A;  3VK9 A;  3A5W A;  1R5P A;  2YWI A;  2DJ2 A;  4NPB A;  1M2B A;  2FHE A;  3TKP A;  1N8J A;  1NM3 A;  2IPA A;  2HE3 A;  2H1G A;  1EOH A;  3HA9 A;  4GLT A;  5A4V A;  3H93 A;  2GSS A;  3TKS C;  3KEB A;  3EC3 A;  3DXB A;  2YV7 A;  5KN0 A;  1BX9 A;  2VCW A;  2GDR A;  2OE1 A;  2YV9 A;  5EVO A;  1FVJ A;  4MMM A;  1RW1 A;  1O8W A;  4IS0 A;  1VRS D;  5IOX A;  3A2X A;  3C8E A;  1EWX A;  1PX7 A;  1XPV A;  2C3N A;  1QXH A;  5F05 A;  2HSY A;  4IQA A;  3GN3 A;  4KCA A;  4MA9 A;  2YAN A;  2CZ2 A;  3P90 A;  5IMF A;  2A2R A;  4LMW A;  4EF0 A;  4I6X A;  2CA8 A;  1J9B A;  1TU7 A;  1ILO A;  1GWC A;  4EE0 A;  4IEL A;  3LEF A;  3G7J A;  3WT2 A;  4FO5 A;  2G2Q A;  4MLY A;  4PUA A;  3KP8 A;  1MDK A;  2FD3 A;  2J23 A;  3ZVJ D;  1V98 A;  3TJK A;  4DSS B;  2WS2 A;  2DML A;  2GSQ A;  4DEJ A;  3TKR A;  3CSJ A;  3TUE A;  3E3E A;  1YDK A;  4DSS A;  3M0F A;  1ERU A;  1FW1 A;  2PVQ A;  4JRR A;  1W89 A;  5ECK B;  2GT5 A;  3KCM A;  3DVX A;  1T4Y A;  2RM5 A;  3D5J A;  2C1Y A;  3PGT A;  1ST9 A;  1PN9 A;  1ACV A;  3Q18 A;  1T3B A;  3M1G A;  1TRW A;  2P5R A;  1AC1 A;  4KDU A;  2VCV A;  4HQZ A;  1TKD B;  4XS6 A;  4I5Q A;  1K3O A;  3QD9 A;  4E8E A;  1URM A;  3LXZ A;  2M46 A;  1EZK A;  1Y25 A;  3CBU A;  1ABA A;  5J9C A;  3H79 A;  6GSW A;  3HVS A;  3M9J A;  3UBL A;  2L59 A;  2RM6 A;  2BTO T;  3HVV A;  3GRX A;  3U5R E;  3VLN A;  1M2A A;  3HZ8 A;  5LCZ A;  3IBH A;  1R26 A;  5IMD A;  4QL7 A;  4IJ3 A;  1ML6 A;  4WBJ A;  5G2Z A;  3KZQ A;  2OBK A;  1IYH A;  3VFI A;  4X1U A;  2H01 A;  4MCU A;  1YZX A;  4AJ8 A;  3VWU A;  1V9W A;  2F3M A;  2VUP A;  4D73 B;  1SU9 A;  2H75 A;  5G5E A;  3G7I A;  5COH A;  3A2V A;  2O7K A;  2DJ1 A;  1R7H A;  1ZL9 A;  3TOT A;  3UOM A;  2HFD A;  1PL1 A;  3I43 A;  4ZB9 A;  2E0Q A;  3F3R A;  3IDV A;  3I9V 2;  3Q6O A;  3RAZ A;  1HNB A;  2X8C A;  5DQY A;  1G7O A;  2DSA A;  4MJE A;  2B5X A;  2L6C A;  1AW9 A;  4KND A;  4BA7 A;  2ON5 A;  4HOJ A;  2BJX A;  2H6Z A;  2O8V B;  1FAA A;  4LA1 A;  3WGE A;  1K0A A;  5G31 A;  1OKD A;  4L5O A;  4MJC A;  3QMX A;  2EC4 A;  1GUK A;  1YJ6 A;  3GST A;  5CO3 A;  2LJK A;  2P31 A;  2VM1 A;  4BVX A;  2OJL A;  1YF0 A;  3BCK A;  4NV5 A;  2EIO A;  17GS A;  11GS A;  2FNO A;  3F4T A;  2VD0 A;  3FZ5 A;  3VI7 A;  1UVZ A;  2GZZ A;  1FB0 A;  1QUW A;  2TRX A;  1O6J A;  2HRF A;  1GTA A;  5L71 A;  5EY6 A;  3KMN A;  3TB2 A;  1JLW A;  4ZXG A;  2VL2 A;  2OBI A;  4XRD A;  1MDI A;  4MPF A;  1F3B A;  2CV4 A;  3HJO A;  1PMT A;  1KNG A;  3KTL A;  2OA7 A;  3DWV A;  5CRD A;  2CZ3 A;  4N0V A;  2H70 A;  1H75 A;  3FR3 A;  1EP8 A;  2B5E A;  4KSM A;  1X9S B;  2B7K A;  3UEM A;  3QCP A;  4KE3 A;  4K2D A;  12GS A;  1QMV A;  19GS A;  1EEM A;  2TIR A;  2GLR A;  2H71 A;  2VLU A;  5D93 A;  2O89 A;  3LSZ A;  4MK3 A;  2LKU A;  1O8X A;  3CTG A;  1Q98 A;  2V41 A;  2LRT A;  1GUM A;  1EOG A;  1PX6 A;  3Q19 A;  5C04 A;  4PNG A;  1XWG A;  2B3S A;  2PMT A;  4XS4 B;  5ECI B;  1TRU A;  2H0I A;  1T00 A;  1WJK A;  2DJJ A;  3QPM A;  2K8S A;  3FY7 A;  3CXG A;  4TXO B;  4XS4 A;  5HFK A;  2VO4 A;  3D4T A;  1O81 A;  2NDO A;  3EE2 A;  2WJU A;  1FB6 A;  3F63 A;  1HNA A;  4TXO A;  1PGT A;  2A4V A;  1XXU A;  2YWN A;  1TRS A;  2WGR A;  4X43 A;  4EKZ A;  2JL4 A;  5F06 A;  5F8B A;  5IPG A;  3G9B A;  4ULX A;  4Q5Q A;  2WUL A;  4IN0 A;  5IMZ A;  4E8H A;  4EUY A;  2XBI A;  4JR4 A;  4GST A;  4KUN A;  3NOF A;  1ZGN A;  3HCZ A;  4Q5F A;  1U3I A;  1VGL A;  1VF1 A;  5IQY A;  3IAS 2;  3W6G A;  1VF4 A;  2NTO A;  2LNT A;  3D21 A;  4EDY A;  1A2M A;  2IIY A;  2FLS A;  5LNK e;  5ECM B;  1H4O A;  5DVB A;  1QGV A;  3QAW A;  1E2Y A;  4IVF A;  1GTB A;  2R5G A;  3LQ7 A;  2VM2 A;  5IIZ A;  2C3T A;  5CP1 A;  6GST A;  2HI7 A;  3HJP A;  2H76 A;  1YKC A;  4WBR D;  4Q5N A;  4GXZ A;  4OWY A;  4NAX A;  2GQM A;  4F9Z A;  1MD4 A;  4RUV A;  4RI6 A;  1K3L A;  3EMX A;  2FUG 2;  3KP9 A;  2L5O A;  5HR3 A;  1AAZ A;  3GA4 A;  3TDG A;  5D9V A;  2HZE A;  1M9B A;  3A2W A;  2PBJ A;  5ELG A;  3H4K A;  5H5S A;  4TR3 A;  5A5K A;  3HY2 A;  3IXR A;  4JE1 A;  3VPT A;  3CRU A;  2I9H A;  2YN1 A;  2FA8 A;  1YKA A;  5GST A;  4NHW A;  3FZ4 A;  2YZH A;  1THX A;  5JCW A;  4NV2 A;  1SJZ A;  1A0F A;  2H1D A;  3D6I A;  4PGT A;  1K0C A;  3CTF A;  3EIN A;  5D8I A;  4BVY A;  2DJK A;  2VCT A;  2OAC A;  6GSY A;  2IMF A;  2VOC A;  3VWW A;  2H0H A;  2RUF A;  2X64 A;  2LJA A;  4CW9 A;  1GSS A;  1JLV A;  4EL1 A;  1ZOF A;  5HR0 A;  2ZNM A;  1F2E A;  4HU7 A;  3QFA C;  3D4M A;  4PQ1 A;  2D2Z A;  3TKS A;  2H74 A;  4ZL9 A;  3WYW A;  3ZL5 A;  4CHS A;  4L8E A;  4OMV A;  1S3C A;  1Z7R A;  3GUS A;  2LS5 A;  4DSQ A;  4NWY A;  3HHV A;  4MH2 A;  3TJF A;  1SYR A;  2A2S A;  2VAF A;  3QDN A;  1BG5 A;  3P7X A;  1K0D A;  4IBP A;  2VD1 A;  3ZML A;  3A3T A;  2LUS A;  5HQP A;  4KDY A;  1QQ2 A;  1M0U A;  1SJ6 A;  1WE0 A;  2E2M A;  3JCM L;  3E9J B;  2H19 A;  3HYP A;  1TK8 B;  4IQ1 A;  5F07 A;  3DRN A;  2LST A;  1G6Y A;  1GSE A;  4V2L A;  1S3D A;  1SK1 A;  3EWL A;  2VL3 A;  2N5B A;  3TGZ A;  2EIQ A;  4HZ4 A;  3KH7 A;  2F8A A;  2CAQ A;  2HYX A;  2MMA A;  1A24 A;  4O92 A;  1SKS B;  4QL9 A;  2NPB A;  9GSS A;  5EL8 A;  5ECN B;  4DVC A;  3DML A;  5ECL B;  4WET A;  5CRE A;  3FZ9 A;  3L9U A;  3VWV A;  2XPD A;  4NXI A;  1YF1 A;  4MF6 A;  2PVO C;  3LG6 A;  2QKE A;  5CRW A;  3ZZX A;  3IPZ A;  1OYJ A;  1B9Y C;  1GTU A;  2GT6 A;  3GV1 A;  4OFT A;  2MMZ A;  4IP1 A;  1GNE A;  2FWH A;  2C4J A;  4PNF A;  2AV4 A;  1TJD A;  2ALB A;  3TJJ A;  2PWJ A;  3D22 A;  4TXV A;  3UBK A;  4RI7 A;  4XS1 A;  1OE8 A;  1AQW A;  5IMV A;  5C00 A;  3BJ5 A;  2MBS A;  3GTU B;  3UMA A;  1BED A;  1XWK A;  4ZB6 A;  3APS A;  2C8U A;  4FYB A;  4IJI A;  4X0X A;  5J3R A;  1X5E A;  1XW5 A;  1J08 A;  3PH9 A;  4WF5 A;  3UAR A;  2F8F A;  4KX4 A;  4O32 A;  1DUG A;  1JZR A;  3L78 A;  1KEB A;  1LBK A;  2E2G A;  2FWG A;  4Z7X A;  3IK9 A;  2YWM A;  2JSZ A;  2GGT A;  3ZRD A;  5FHI A;  13GS A;  2GS3 A;  2X8H A;  1C72 A;  4G10 A;  4LL1 B;  3KJY A;  4NHZ A;  2IMD A;  1GSF A;  1FOV A;  4K7N A;  3Q74 A;  3S9F A;  1TTZ A;  2PUK C;  2I81 A;  2P0G A;  5B8A A;  3AY8 A;  2L5L A;  2PPT A;  1GUL A;  3LXT A;  4HJ2 A;  2AUV A;  4MF7 A;  3W8S A;  1Q4J A;  3W8J A;  1TRV A;  3FZA A;  2LRN A;  3RHC A;  1A2L A;  2O85 A;  3WD6 A;  4MDC A;  3ME8 A;  1SL1 B;  5J9B A;  4O5R A;  5J4U A;  3LOR A;  3DYR A;  2WB9 A;  2FWF A;  2PU9 C;  3C73 A;  2WFC A;  1VF3 A;  2C0G A;  2E7P A;  4YAP A;  1XW6 A;  3ZIV A;  2CVD A;  2BMX A;  3ZYW A;  4I2T A;  3RPN A;  2DLX A;  3APO A;  5JWR B;  4IW9 A;  3F3Q A;  1GTI A;  4L0W A;  2R4V A;  1XFL A;  5ELA A;  1NHY A;  3UIW A;  1ZZY A;  3WGX A;  2X99 A;  4D73 A;  3HDC A;  3QR6 A;  3ERW A;  3HXS A;  3UL3 A;  5JWO B;  4XIH A;  4N11 A;  4F2I A;  5ECH B;  4OCE A;  1A8Y A;  6GSS A;  4GSS A;  2MZC A;  3FR6 A;  4G9H A;  1TOF A;  3EMP A;  4ZBB A;  1PL2 A;  3GNJ A;  1ERW A;  1B9X C;  2GQL A;  5CRG A;  1FHE A;  2B1L A;  5B8B A;  2QSI A;  1QK8 A;  5DAK B;  3HZ4 A;  5ECS A;  1K0N A;  3GH9 A;  3IV4 A;  2ZCT A;  3ZLP A;  4JU5 A;  1PKZ A;  1G6W A;  2V2G A;  3IHQ A;  1HQO A;  5DAK A;  1EP7 A;  1YQ1 A;  4JR6 A;  4OCF A;  4J56 E;  1V2A A;  4JBB A;  1WIK A;  2GZP A;  4YQU A;  2FCH A;  3HVX A;  1GP1 A;  4G2E A;  5ECP B;  1YEP A;  1XVW A;  4F0B A;  1W4V A;  2PGT A;  3DIE A;  1F6M C;  2YP6 A;  3FR9 A;  2K8V A;  4POM A;  1B8X A;  4ZB8 A;  5DAL B;  4MAB A;  4J57 E;  1F9M A;  2FGX A;  4IGJ A;  2AAW A;  4N0Z A;  18GS A;  5DAL A;  5JWQ B;  2GZY A;  3C1S A;  1SKR B;  1O7U A;  3SBC A; 
#chains in the Genus database with same CATH topology
 1GSU A;  2TRC P;  4ML6 A;  1PKW A;  2B7J A;  1M2D A;  3E0U A;  4DSR A;  4ZBD A;  1AQX A;  4POL A;  1J0F A;  3EVI A;  1NW2 A;  5E59 A;  4ECC A;  3CYN A;  1Z5Y E;  3F0I A;  3ME7 A;  5HR1 A;  3IC8 A;  3L9S A;  3DEX A;  4HS1 A;  3J7Y b;  4WR4 A;  5AN1 A;  4EIQ A;  5F0G A;  4KF9 A;  3CSH A;  3H1N A;  2AJQ B;  7GSS A;  2JZR A;  1JZW A;  1GSD A;  1SK0 A;  4IP6 A;  4V1A g;  1X5C A;  3I69 A;  2JAD A;  2ON7 A;  5A4W A;  3QAV A;  5DJM A;  2FY6 A;  3IAM 2;  3KH9 A;  2JU5 A;  4WKW A;  1AUC A;  2KLX A;  1U87 A;  4K9Z A;  4TN8 A;  2IFQ B;  3IR4 A;  1DE2 A;  2RUE A;  4MJA A;  1SD9 A;  2VL2 C;  4KSO A;  1R5A A;  2OAD A;  4PUF C;  2LEG A;  2IJY A;  2LTK A;  1KBN A;  4I2U A;  2C0E A;  2IFQ A;  3VI5 A;  1WMJ A;  2CX3 A;  1EGO A;  1XWB A;  4HSC X;  4GTU A;  4KGI A;  4ACS A;  5FT3 A;  3O3T A;  1FO5 A;  3F8U A;  1Z6M A;  2O87 A;  5D96 A;  4FH8 A;  5KOX A;  1K0B A;  1Y6E A;  1M3J A;  5D9T A;  3GX8 A;  5DJL A;  1B4P A;  4HEA 2;  2G0F A;  2I3Y A;  1QFN A;  1XOB A;  1OKT A;  1YEX A;  4LMV A;  4WEY A;  3UJ1 A;  1G0T A;  2WZ9 A;  3M3M A;  2XC2 A;  2CVB A;  2QGV A;  3TRP A;  3TRQ A;  1OC9 B;  3LJR A;  1VF2 A;  1TK5 B;  1PSQ A;  4AJ6 A;  1PA3 A;  6GSU A;  1MEK A;  2ES7 A;  1U6T A;  2L4C A;  1BJX A;  2IWT A;  4GWR A;  2EIR A;  2Z9S A;  2YZU A;  4L0U A;  2B6M A;  2IN3 A;  4KDX A;  4XRA A;  5E4W A;  2C3Q A;  3L4N A;  5KN2 A;  3GIX A;  4BWS A;  1GRX A;  4OFM A;  4GSN A;  2MYG A;  3BCI A;  2GQK A;  3TRX A;  1GL8 A;  2GSR A;  3IC4 A;  4FIW A;  5GSS A;  2DBC A;  2I1U A;  22GS A;  3LFL A;  1SEN A;  4K1F A;  1ZMA A;  4BWQ A;  5D73 A;  1T8E B;  2JZT A;  2OE3 A;  5KN1 A;  5IO2 A;  4XCS A;  3BOA A;  4K7O A;  3RDW A;  1OC8 A;  4KB3 A;  3TKQ A;  3GKX A;  3ZIJ A;  2CQ9 A;  3GKN A;  4CY6 A;  2QA1 A;  4MZB A;  4K0N A;  1BYE A;  5ABR A;  1B48 A;  1T7P B;  4TW5 A;  4GQF A;  4TOP A;  4IKH A;  5IO0 A;  1E6B A;  4KCE A;  2B5Y A;  3SWL A;  2KOK A;  1OVN A;  1XIY A;  4ISD A;  2VCZ A;  4AGS A;  3GUR A;  3QOU A;  1SL2 B;  4K0G A;  2F9S A;  5LD0 A;  1FOH A;  4ZIJ A;  3C71 A;  1Z3E A;  4CDO A;  1Z7P A;  1GNW A;  1AIU A;  4L5L A;  3ZFL A;  1GLP A;  2VLT A;  3P8W A;  4POB A;  1GSQ A;  3ZFB A;  5J41 A;  1SKW B;  3GMF A;  3EUR A;  1JZO A;  2HRA A;  2RII A;  2WCI A;  2V1M A;  5D9X A;  1NHO A;  3DKS A;  5CYY A;  5DQS A;  14GS A;  3TJG A;  3DVW A;  2AYT A;  1HD2 A;  1O73 A;  4KAE A;  2RLI A;  1K0O A;  4ID0 A;  2PN8 A;  4NMU A;  1USB A;  2R3X A;  3KD0 A;  4HU9 A;  2DIZ A;  2KP2 A;  4OFN A;  1R4W A;  4MF5 A;  3FK8 A;  1V57 A;  2I4A A;  5HFI A;  3BD2 A;  3US3 A;  4AJ7 A;  2F51 A;  2B1K A;  4ILF A;  3TJB A;  2HXK A;  2REM A;  4PUR A;  2K9F A;  4XTS A;  1I5G A;  1M7T A;  1WPI A;  3FRC A;  2IMI A;  3LGC A;  2R2J A;  2H6Y A;  5KEJ A;  4ICY A;  4OO5 A;  3RBT A;  4O7H A;  3VPQ A;  2DJ3 A;  5HR2 A;  4KW6 A;  5JCG A;  2N5F A;  4MH3 A;  4HZ2 A;  1EGR A;  4QQ7 A;  1EV9 A;  1S3A A;  3UVT A;  4ZL8 A;  4X4J A;  3LW9 A;  3FYG A;  5G1K A;  4TR4 A;  3DD3 A;  3EPT A;  2OKA A;  2QC7 A;  3BBY A;  2LQQ A;  1TI3 A;  4GCI A;  3P2A A;  2DJ0 A;  3J7Y k;  3QFB C;  2VIM A;  5B6M A;  4TR0 A;  4WF4 A;  5A4U A;  1BQ7 A;  3L9V A;  1TXX A;  3O6T A;  1XCC A;  2HT9 A;  1FVK A;  2DIY A;  4HQS A;  1V58 A;  3GX0 A;  4MP4 A;  1X9M B;  4H86 A;  1WWJ A;  2MMN A;  2IME A;  2WDU A;  3GTU A;  3IRA A;  2WRT A;  1SL0 B;  2L6D A;  3ZVJ A;  3GKK A;  1SD8 A;  3TCO A;  2HNL A;  4YH2 A;  4K8M A;  3KTB A;  2PER A;  3M9K A;  1WP0 A;  4G19 A;  3MDK A;  2X8G A;  2VL9 A;  4HUA A;  4Q5R A;  1A2J A;  5CRH A;  1AQV A;  2HZF A;  3ERF A;  4ECB A;  4EVM A;  1G7E A;  3RHB A;  3RPP A;  20GS A;  5ECO B;  1ZCP A;  3IA1 A;  3O76 A;  3KMO A;  4I97 A;  2V6O A;  2H6X A;  2P5Q A;  3MWH A;  2JZS A;  1F3A A;  3CSI A;  2IMK A;  16GS A;  1TU8 A;  1TP9 A;  2YWO A;  2NBS A;  3EYT A;  2LQO A;  5CAX A;  3C1R A;  1M99 A;  2R37 A;  3FW2 A;  1A23 A;  2CAI A;  2XHF A;  1OAZ A;  4V1A p;  4HDE A;  4O5U A;  1OC3 A;  2VCX A;  1HNC A;  4YAV A;  2V32 A;  4K6X A;  1N2A A;  4Z2T A;  3ERG A;  5ENU A;  3GFK A;  3ZTL A;  2IL3 A;  2M72 A;  4POK A;  3F4S A;  2GTU A;  3D0Z A;  5IMA A;  4TKY A;  4TR1 B;  1ZYQ B;  1TI1 A;  2M80 A;  4OO4 A;  3FHK A;  4ML1 A;  2C80 A;  4ECJ A;  3M8N A;  3HJM A;  4TR1 A;  5ECQ B;  1YY7 A;  3A5I A;  2N5A A;  3OR5 A;  2YNX A;  1ERT A;  3VUR A;  5IOW A;  5H5Q A;  4YQM A;  1LJR A;  2ZUP A;  2CT6 A;  1A8L A;  3HKR A;  2DC5 A;  4GRF A;  2FA4 A;  3KGK A;  2YJH A;  3ED3 A;  1XWA A;  4GF0 A;  3IOS A;  4FYC A;  3HD5 A;  3GKM A;  1O85 A;  2LRC A;  1F37 A;  4XHM A;  1T4Z A;  2C0D A;  4JED A;  4HI7 A;  3MAK A;  1WOU A;  2C0F A;  2JAC A;  3MSZ A;  4BVX B;  4PXO A;  3U6V A;  4ZL7 A;  3GH6 A;  4RQX A;  3NIV A;  1GSY A;  4OD7 A;  3VWX A;  2LNS A;  6GSV A;  1M9A A;  2GVP A;  4N10 A;  2CVK A;  1RK4 A;  4BL7 B;  5INY A;  4J2F A;  1PRX A;  3N5O A;  4TRX A;  2GST A;  5G30 A;  4TVE A;  4ZBA A;  1PN0 A;  2H8L A;  3KIJ A;  4BL7 A;  2MMO A;  5IPH A;  1B4Q A;  2UZ8 A;  3H8Q A;  2R0P A;  1I9D A;  1V40 A;  2H1B A;  1GLQ A;  4WR5 A;  5GZZ B;  1TDI A;  2H66 A;  1UC7 A;  4WXT A;  3TKS E;  2H0G A;  4KH7 A;  1U88 A;  3MIX A;  1KTE A;  2DMM A;  4F0C A;  2MBT A;  3UVH A;  3V1W A;  5G1L A;  3APQ A;  3GSS A;  1WRY A;  5J5N A;  4JZQ A;  5GAP D;  5AIS A;  3CMI A;  2AB6 A;  2LJR A;  3ZRE A;  6GSX A;  1Z9H A;  3K8N A;  3LYP A;  1THO A;  1JHB A;  3F9U A;  5D9W A;  2YJ7 A;  5AIV A;  3ZIT A;  4MZC A;  4F03 A;  2HSM A;  2H30 A;  4MZW A;  3PPU A;  5ECR B;  4K7I A;  3MYD A;  1JFU A;  5EPF A;  5HFG A;  4PTS A;  3PIN A;  5IM9 A;  2KHP A;  4EXJ A;  5GAN D;  1OE7 A;  5ID2 B;  4I8B A;  2XPE A;  4PQI A;  2YPM A;  4IHU A;  5ID2 A;  1NSW A;  2H73 A;  4KA0 A;  5IMC A;  3UAP A;  1IYI A;  5CNW A;  4GQC A;  4RQR A;  4EIP A;  1RQM A;  3DGQ A;  2VLV A;  2HLS A;  1GUH A;  1MD3 A;  3TOU A;  1EEJ A;  4MJB A;  3GHA A;  8GSS A;  4MPG A;  2K18 A;  4P3Y B;  3LYK A;  3ISO A;  3GL5 A;  3N9J A;  4PX1 A;  1CQH A;  4K5R A;  1DSB A;  2KP1 A;  3GL3 A;  5B6N A;  4ECI A;  1GH2 A;  3QAG A;  3WGD A;  1EV4 A;  1HYU A;  1SYX A;  3I6A A;  5H5R A;  3C7M A;  1OC9 A;  2YOI A;  1X0R A;  2L57 A;  1PQN A;  2V6K A;  1XG8 A;  2KUC A;  2AHE A;  2L4Q A;  1M3I A;  2LV3 A;  1XW9 A;  5FWG A;  2JSY A;  1AXD A;  4V2M A;  2NVL A;  4LL4 B;  1FG4 A;  3WT1 A;  4MNN A;  1ON4 A;  2VCQ A;  5G5F A;  3NZN A;  1SK2 A;  3GYK A;  2A2P A;  4F82 A;  3MNG A;  1A0R P;  2XBQ A;  1Z6N A;  2H72 A;  1CQG A;  2K6V A;  3FEU A;  1PFO A;  1MDJ A;  4LLR A;  4EC0 A;  10GS A;  4AF2 A;  1DBY A;  3ZMK A;  4N30 A;  5KN3 A;  1X9W B;  2HSH A;  4EDZ A;  2HZE B;  1XZO A;  2CX4 A;  1ZYE A;  5DCG A;  5DDL A;  1XWC A;  1LU4 A;  3G7Y A;  2HRN A;  4HJM A;  3IK7 A;  3LWA A;  3CRT A;  2OE0 A;  1TW9 A;  1K0M A;  1PD2 1;  1XOA A;  3KM6 A;  4FQU A;  5DCH A;  1UN2 A;  1XVQ A;  2J9H A;  3EU3 A;  5AIX A;  4BVY B;  3EU4 A;  3PR8 A;  3KXO A;  2X4A A;  1K3Y A;  4YQV A;  3F4R A;  2R6K A;  4FYU A;  1DE1 A;  4ZIL A;  5B7C A;  4V2N A;  1ERV A;  4PQH A;  1MTC A;  2R0G A;  2H1A A;  2YCD A;  3R2Q A;  3L0H A;  1SJI A;  1T1V A;  1JZD A;  1TK0 B;  5DBQ A;  5AGY A;  3IE3 A;  3F6D A;  5JCU A;  4BPY A;  1BAY A;  2FWE A;  3F6F A;  4EO3 A;  3FKF A;  1X5D A;  1U3A A;  1UA5 A;  1XBS A;  3VK9 A;  3A5W A;  1R5P A;  2YWI A;  2DJ2 A;  4NPB A;  1M2B A;  2FHE A;  3TKP A;  1N8J A;  1NM3 A;  2IPA A;  2HE3 A;  2H1G A;  1EOH A;  3HA9 A;  1S3R A;  4GLT A;  5A4V A;  3H93 A;  2GSS A;  3TKS C;  3KEB A;  3EC3 A;  3DXB A;  2YV7 A;  5KN0 A;  1BX9 A;  2VCW A;  2GDR A;  2OE1 A;  2YV9 A;  5EVO A;  1FVJ A;  4MMM A;  1RW1 A;  1O8W A;  4IS0 A;  1VRS D;  5IOX A;  3A2X A;  3C8E A;  1EWX A;  2X49 A;  1PX7 A;  1XPV A;  2C3N A;  1QXH A;  5F05 A;  2HSY A;  4IQA A;  3GN3 A;  4KCA A;  4MA9 A;  2YAN A;  2CZ2 A;  3P90 A;  5IMF A;  2A2R A;  4LMW A;  4EF0 A;  4I6X A;  2CA8 A;  1J9B A;  5BRT A;  1TU7 A;  1ILO A;  1GWC A;  4EE0 A;  4IEL A;  3LEF A;  3G7J A;  3WT2 A;  4FO5 A;  2G2Q A;  4MLY A;  4PUA A;  3KP8 A;  1MDK A;  2FD3 A;  2J23 A;  4Z2U A;  3ZVJ D;  1V98 A;  3TJK A;  4DSS B;  2WS2 A;  2DML A;  2GSQ A;  4DEJ A;  3TKR A;  5BMU A;  3CSJ A;  3TUE A;  3E3E A;  2R0C A;  1YDK A;  4DSS A;  3M0F A;  4Z2R A;  1ERU A;  1FW1 A;  2PVQ A;  4JRR A;  2HRK A;  1W89 A;  5ECK B;  2GT5 A;  3IHG A;  3KCM A;  3DVX A;  1T4Y A;  2RM5 A;  3D5J A;  2C1Y A;  3PGT A;  1ST9 A;  1PN9 A;  1ACV A;  3Q18 A;  1T3B A;  3M1G A;  1TRW A;  2P5R A;  1AC1 A;  4KDU A;  2VCV A;  4HQZ A;  1TKD B;  4XS6 A;  4I5Q A;  1K3O A;  3QD9 A;  4E8E A;  1URM A;  2DKH A;  3LXZ A;  2M46 A;  1EZK A;  1Y25 A;  3CBU A;  1ABA A;  5J9C A;  3H79 A;  6GSW A;  3HVN A;  3HVS A;  3M9J A;  3UBL A;  2L59 A;  2RM6 A;  2BTO T;  3HVV A;  3GRX A;  3U5R E;  3VLN A;  1M2A A;  3HZ8 A;  5LCZ A;  3IBH A;  1R26 A;  5IMD A;  4YKF A;  4QL7 A;  4IJ3 A;  1ML6 A;  4WBJ A;  5G2Z A;  3KZQ A;  2OBK A;  1IYH A;  3VFI A;  4X1U A;  2H01 A;  4MCU A;  1YZX A;  4AJ8 A;  3VWU A;  1V9W A;  2F3M A;  4USS A;  2VUP A;  4D73 B;  1SU9 A;  2H75 A;  5G5E A;  3G7I A;  5COH A;  3A2V A;  2O7K A;  2DJ1 A;  1R7H A;  4YKG A;  1ZL9 A;  3TOT A;  3UOM A;  2HFD A;  1PL1 A;  3I43 A;  4ZB9 A;  2E0Q A;  3F3R A;  3IDV A;  3I9V 2;  3Q6O A;  3RAZ A;  1HNB A;  2X8C A;  5DQY A;  1G7O A;  2DSA A;  4MJE A;  2B5X A;  2L6C A;  1AW9 A;  4KND A;  4BA7 A;  2ON5 A;  4HOJ A;  2BJX A;  2H6Z A;  2O8V B;  1FAA A;  4LA1 A;  3WGE A;  1K0A A;  5G31 A;  1OKD A;  4L5O A;  4MJC A;  3QMX A;  2EC4 A;  1GUK A;  1YJ6 A;  1ZYN A;  3GST A;  5CO3 A;  2LJK A;  2P31 A;  2VM1 A;  4BVX A;  2OJL A;  1YF0 A;  3BCK A;  4NV5 A;  2EIO A;  17GS A;  11GS A;  2FNO A;  3F4T A;  2VD0 A;  3FZ5 A;  3VI7 A;  1UVZ A;  2GZZ A;  1FB0 A;  1QUW A;  2TRX A;  1O6J A;  2HRF A;  1GTA A;  5L71 A;  5EY6 A;  3KMN A;  3TB2 A;  1JLW A;  4ZXG A;  2VL2 A;  2OBI A;  4XRD A;  2DKI A;  1MDI A;  4MPF A;  1F3B A;  2CV4 A;  3HJO A;  1PMT A;  4BIK A;  1KNG A;  3KTL A;  2A4H A;  2OA7 A;  3DWV A;  5CRD A;  2CZ3 A;  4N0V A;  2H70 A;  1H75 A;  3FR3 A;  1EP8 A;  2B5E A;  4KSM A;  1X9S B;  2B7K A;  3UEM A;  3QCP A;  4KE3 A;  4K2D A;  12GS A;  1QMV A;  19GS A;  1EEM A;  2TIR A;  2GLR A;  2H71 A;  2VLU A;  5D93 A;  2O89 A;  3LSZ A;  4MK3 A;  2LKU A;  1O8X A;  3CTG A;  1Q98 A;  2V41 A;  2LRT A;  1GUM A;  1EOG A;  1PX6 A;  3Q19 A;  5C04 A;  4PNG A;  1XWG A;  2B3S A;  2PMT A;  4XS4 B;  5ECI B;  1TRU A;  2H0I A;  1T00 A;  4K5S A;  1WJK A;  2DJJ A;  3QPM A;  2K8S A;  3FY7 A;  3CXG A;  4TXO B;  4XS4 A;  5HFK A;  2VO4 A;  3D4T A;  1O81 A;  2NDO A;  3EE2 A;  2WJU A;  1FB6 A;  3F63 A;  1HNA A;  4TXO A;  1PGT A;  2A4V A;  1XXU A;  2YWN A;  1TRS A;  2WGR A;  4X43 A;  4EKZ A;  2JL4 A;  5F06 A;  5F8B A;  5IPG A;  3G9B A;  4ULX A;  4Q5Q A;  2WUL A;  4IN0 A;  5IMZ A;  4E8H A;  4EUY A;  2XBI A;  4JR4 A;  3R3E A;  4GST A;  4KUN A;  3NOF A;  1ZGN A;  3HCZ A;  4Q5F A;  1U3I A;  1VGL A;  1VF1 A;  5IQY A;  3IAS 2;  3W6G A;  1VF4 A;  4G0L A;  2NTO A;  2LNT A;  3D21 A;  4EDY A;  1A2M A;  2IIY A;  2FLS A;  5LNK e;  5ECM B;  1H4O A;  3CQF A;  5DVB A;  1ZYP A;  1QGV A;  3QAW A;  1E2Y A;  4IVF A;  1GTB A;  2R5G A;  3LQ7 A;  2VM2 A;  5IIZ A;  2C3T A;  5CP1 A;  6GST A;  2HI7 A;  3HJP A;  2H76 A;  1YKC A;  4WBR D;  4Q5N A;  4GXZ A;  4OWY A;  4NAX A;  2GQM A;  4F9Z A;  1MD4 A;  4RUV A;  4RI6 A;  1K3L A;  3EMX A;  2FUG 2;  3KP9 A;  2L5O A;  5HR3 A;  1AAZ A;  3GA4 A;  3TDG A;  5D9V A;  2HZE A;  1M9B A;  3A2W A;  2PBJ A;  5ELG A;  3FMW A;  3H4K A;  5H5S A;  4TR3 A;  5A5K A;  3HY2 A;  3IXR A;  4JE1 A;  3VPT A;  3CRU A;  2I9H A;  2YN1 A;  2FA8 A;  1YKA A;  5GST A;  4NHW A;  3FZ4 A;  2YZH A;  1THX A;  5JCW A;  4NV2 A;  1SJZ A;  1A0F A;  2H1D A;  3D6I A;  4PGT A;  1K0C A;  3CTF A;  3EIN A;  5D8I A;  4BVY A;  2DJK A;  2VCT A;  2OAC A;  6GSY A;  2IMF A;  2VOC A;  4G0K A;  3VWW A;  2H0H A;  2RUF A;  2X64 A;  2LJA A;  4CW9 A;  1GSS A;  1JLV A;  4EL1 A;  1ZOF A;  4CY8 A;  5HR0 A;  2ZNM A;  1F2E A;  4HU7 A;  3QFA C;  3D4M A;  4PQ1 A;  2D2Z A;  3TKS A;  2H74 A;  4ZL9 A;  3WYW A;  3ZL5 A;  4CHS A;  4L8E A;  4OMV A;  1S3C A;  1Z7R A;  3GUS A;  2LS5 A;  4DSQ A;  4NWY A;  3HHV A;  4MH2 A;  4A5P A;  3TJF A;  1SYR A;  2A2S A;  2VAF A;  3QDN A;  1BG5 A;  3P7X A;  1K0D A;  4IBP A;  2VD1 A;  3ZML A;  3A3T A;  2LUS A;  5HQP A;  4KDY A;  1QQ2 A;  1M0U A;  1SJ6 A;  1WE0 A;  2E2M A;  3JCM L;  3E9J B;  2H19 A;  3HYP A;  1TK8 B;  4IQ1 A;  5F07 A;  3DRN A;  2LST A;  1G6Y A;  1GSE A;  4V2L A;  1S3D A;  1SK1 A;  3EWL A;  2VL3 A;  2N5B A;  3TGZ A;  2EIQ A;  4HZ4 A;  3KH7 A;  2F8A A;  2CAQ A;  2HYX A;  2MMA A;  1A24 A;  4O92 A;  1SKS B;  4QL9 A;  2NPB A;  9GSS A;  5EL8 A;  5ECN B;  4DVC A;  3DML A;  5ECL B;  4WET A;  5CRE A;  3FZ9 A;  3L9U A;  3VWV A;  2XPD A;  4NXI A;  1YF1 A;  4MF6 A;  2PVO C;  3LG6 A;  2QKE A;  5CRW A;  3ZZX A;  3IPZ A;  1OYJ A;  1B9Y C;  1GTU A;  2GT6 A;  3GV1 A;  4OFT A;  2MMZ A;  4IP1 A;  1GNE A;  2FWH A;  2C4J A;  4PNF A;  2AV4 A;  1TJD A;  2ALB A;  3TJJ A;  2PWJ A;  3D22 A;  4TXV A;  3UBK A;  4RI7 A;  4XS1 A;  1OE8 A;  1AQW A;  5IMV A;  4K2X A;  5C00 A;  3BJ5 A;  2MBS A;  3GTU B;  3UMA A;  1BED A;  1XWK A;  4ZB6 A;  3APS A;  2C8U A;  4FYB A;  4IJI A;  4X0X A;  5J3R A;  1X5E A;  1XW5 A;  1J08 A;  3PH9 A;  4WF5 A;  3UAR A;  5KOW A;  2F8F A;  4KX4 A;  4O32 A;  1DUG A;  1JZR A;  3L78 A;  1KEB A;  1LBK A;  2E2G A;  2FWG A;  4Z7X A;  3IK9 A;  2YWM A;  2JSZ A;  2GGT A;  3ZRD A;  5FHI A;  13GS A;  2GS3 A;  2X8H A;  1C72 A;  4G10 A;  4LL1 B;  3KJY A;  4NHZ A;  2IMD A;  1GSF A;  1FOV A;  4K7N A;  3Q74 A;  3S9F A;  1TTZ A;  2PUK C;  2I81 A;  2P0G A;  5B8A A;  3AY8 A;  2L5L A;  2PPT A;  1GUL A;  3LXT A;  4HJ2 A;  2AUV A;  4MF7 A;  3W8S A;  1Q4J A;  3W8J A;  1TRV A;  3FZA A;  2LRN A;  3RHC A;  1A2L A;  2O85 A;  3WD6 A;  4MDC A;  3ME8 A;  1SL1 B;  5J9B A;  4O5R A;  5J4U A;  3LOR A;  3DYR A;  2WB9 A;  2FWF A;  2PU9 C;  3C73 A;  2WFC A;  1VF3 A;  2C0G A;  2E7P A;  4YAP A;  1XW6 A;  3ZIV A;  2CVD A;  2BMX A;  3ZYW A;  4I2T A;  3RPN A;  2DLX A;  3APO A;  5JWR B;  4IW9 A;  3F3Q A;  1GTI A;  4L0W A;  2R4V A;  1XFL A;  1NHY A;  5ELA A;  3UIW A;  1ZZY A;  3WGX A;  2X99 A;  4D73 A;  3HDC A;  3QR6 A;  3ERW A;  3HXS A;  3UL3 A;  5JWO B;  4XIH A;  4N11 A;  4F2I A;  5ECH B;  4OCE A;  1A8Y A;  6GSS A;  4GSS A;  2MZC A;  3FR6 A;  4G9H A;  1TOF A;  3EMP A;  4ZBB A;  1PL2 A;  3GNJ A;  1ERW A;  1B9X C;  2GQL A;  5CRG A;  1FHE A;  2B1L A;  5B8B A;  2QSI A;  1QK8 A;  5DAK B;  3HZ4 A;  5ECS A;  1K0N A;  3GH9 A;  3IV4 A;  2ZCT A;  3ZLP A;  4JU5 A;  1PKZ A;  1G6W A;  2V2G A;  3IHQ A;  1HQO A;  5DAK A;  1EP7 A;  1YQ1 A;  4JR6 A;  4OCF A;  4J56 E;  1V2A A;  4JBB A;  1WIK A;  2GZP A;  4YQU A;  2FCH A;  3HVX A;  1GP1 A;  4G2E A;  5ECP B;  1YEP A;  1XVW A;  4F0B A;  1W4V A;  2PGT A;  3DIE A;  1F6M C;  2YP6 A;  3FR9 A;  2K8V A;  4POM A;  1B8X A;  4ZB8 A;  4O5Q A;  5DAL B;  4MAB A;  4J57 E;  1F9M A;  2FGX A;  4G0I A;  2AAW A;  4IGJ A;  4N0Z A;  18GS A;  5DAL A;  2QA2 A;  5JWQ B;  2GZY A;  3C1S A;  1SKR B;  1O7U A;  3SBC A; 
#chains in the Genus database with same CATH homology
 1GSU A;  2TRC P;  4ML6 A;  1PKW A;  2B7J A;  1M2D A;  3E0U A;  4DSR A;  4ZBD A;  1AQX A;  4POL A;  1J0F A;  3EVI A;  1NW2 A;  5E59 A;  4ECC A;  3CYN A;  1Z5Y E;  3F0I A;  3ME7 A;  5HR1 A;  3IC8 A;  3L9S A;  3DEX A;  4HS1 A;  3J7Y b;  4WR4 A;  5AN1 A;  4EIQ A;  5F0G A;  4KF9 A;  3CSH A;  3H1N A;  2AJQ B;  7GSS A;  2JZR A;  1JZW A;  1GSD A;  1SK0 A;  4IP6 A;  4V1A g;  1X5C A;  3I69 A;  2JAD A;  2ON7 A;  5A4W A;  3QAV A;  5DJM A;  2FY6 A;  3IAM 2;  3KH9 A;  2JU5 A;  4WKW A;  1AUC A;  2KLX A;  1U87 A;  4K9Z A;  4TN8 A;  2IFQ B;  3IR4 A;  1DE2 A;  2RUE A;  4MJA A;  1SD9 A;  2VL2 C;  4KSO A;  1R5A A;  2OAD A;  4PUF C;  2LEG A;  2IJY A;  2LTK A;  1KBN A;  4I2U A;  2C0E A;  2IFQ A;  3VI5 A;  1WMJ A;  2CX3 A;  1EGO A;  1XWB A;  4GTU A;  4KGI A;  4ACS A;  5FT3 A;  3O3T A;  1FO5 A;  3F8U A;  1Z6M A;  2O87 A;  5D96 A;  4FH8 A;  5KOX A;  1K0B A;  1Y6E A;  5D9T A;  3GX8 A;  5DJL A;  1B4P A;  4HEA 2;  2G0F A;  2I3Y A;  1QFN A;  1XOB A;  1OKT A;  1YEX A;  4LMV A;  4WEY A;  3UJ1 A;  1G0T A;  2WZ9 A;  3M3M A;  2XC2 A;  2CVB A;  2QGV A;  3TRP A;  3TRQ A;  1OC9 B;  3LJR A;  1VF2 A;  1TK5 B;  1PSQ A;  4AJ6 A;  1PA3 A;  6GSU A;  1MEK A;  2ES7 A;  1U6T A;  2L4C A;  1BJX A;  2IWT A;  4GWR A;  2EIR A;  2Z9S A;  2YZU A;  4L0U A;  2B6M A;  2IN3 A;  4KDX A;  4XRA A;  5E4W A;  2C3Q A;  3L4N A;  5KN2 A;  3GIX A;  4BWS A;  1GRX A;  4OFM A;  4GSN A;  2MYG A;  3BCI A;  2GQK A;  3TRX A;  1GL8 A;  2GSR A;  3IC4 A;  4FIW A;  5GSS A;  2DBC A;  2I1U A;  22GS A;  3LFL A;  1SEN A;  4K1F A;  1ZMA A;  4BWQ A;  5D73 A;  1T8E B;  2JZT A;  2OE3 A;  5KN1 A;  5IO2 A;  4XCS A;  3BOA A;  4K7O A;  3RDW A;  1OC8 A;  4KB3 A;  3TKQ A;  3GKX A;  3ZIJ A;  2CQ9 A;  3GKN A;  4CY6 A;  2QA1 A;  4MZB A;  4K0N A;  1BYE A;  5ABR A;  1B48 A;  1T7P B;  4TW5 A;  4GQF A;  4TOP A;  4IKH A;  5IO0 A;  1E6B A;  4KCE A;  2B5Y A;  3SWL A;  2KOK A;  1OVN A;  1XIY A;  4ISD A;  2VCZ A;  4AGS A;  3GUR A;  3QOU A;  1SL2 B;  4K0G A;  2F9S A;  5LD0 A;  1FOH A;  4ZIJ A;  3C71 A;  1Z3E A;  4CDO A;  1Z7P A;  1GNW A;  1AIU A;  4L5L A;  3ZFL A;  1GLP A;  2VLT A;  3P8W A;  4POB A;  1GSQ A;  3ZFB A;  5J41 A;  1SKW B;  3GMF A;  3EUR A;  1JZO A;  2HRA A;  2RII A;  2WCI A;  2V1M A;  5D9X A;  1NHO A;  3DKS A;  5CYY A;  5DQS A;  14GS A;  3TJG A;  3DVW A;  2AYT A;  1HD2 A;  1O73 A;  4KAE A;  2RLI A;  1K0O A;  4ID0 A;  2PN8 A;  4NMU A;  1USB A;  2R3X A;  3KD0 A;  4HU9 A;  2DIZ A;  2KP2 A;  4OFN A;  1R4W A;  4MF5 A;  3FK8 A;  1V57 A;  2I4A A;  5HFI A;  3BD2 A;  3US3 A;  4AJ7 A;  2F51 A;  2B1K A;  4ILF A;  3TJB A;  2HXK A;  2REM A;  4PUR A;  2K9F A;  4XTS A;  1I5G A;  1M7T A;  1WPI A;  3FRC A;  2IMI A;  3LGC A;  2R2J A;  2H6Y A;  5KEJ A;  4ICY A;  4OO5 A;  3RBT A;  4O7H A;  3VPQ A;  2DJ3 A;  5HR2 A;  4KW6 A;  5JCG A;  2N5F A;  4MH3 A;  4HZ2 A;  1EGR A;  4QQ7 A;  1EV9 A;  1S3A A;  3UVT A;  4ZL8 A;  4X4J A;  3LW9 A;  3FYG A;  5G1K A;  4TR4 A;  3DD3 A;  3EPT A;  2OKA A;  2QC7 A;  3BBY A;  2LQQ A;  1TI3 A;  4GCI A;  3P2A A;  2DJ0 A;  3J7Y k;  3QFB C;  2VIM A;  5B6M A;  4TR0 A;  4WF4 A;  5A4U A;  1BQ7 A;  3L9V A;  1TXX A;  3O6T A;  1XCC A;  2HT9 A;  1FVK A;  2DIY A;  4HQS A;  1V58 A;  3GX0 A;  4MP4 A;  1X9M B;  4H86 A;  1WWJ A;  2MMN A;  2IME A;  2WDU A;  3GTU A;  3IRA A;  2WRT A;  1SL0 B;  2L6D A;  3ZVJ A;  3GKK A;  1SD8 A;  3TCO A;  2HNL A;  4YH2 A;  4K8M A;  3KTB A;  2PER A;  3M9K A;  1WP0 A;  4G19 A;  3MDK A;  2X8G A;  2VL9 A;  4HUA A;  4Q5R A;  1A2J A;  5CRH A;  1AQV A;  2HZF A;  3ERF A;  4ECB A;  4EVM A;  1G7E A;  3RHB A;  3RPP A;  20GS A;  5ECO B;  1ZCP A;  3IA1 A;  3O76 A;  3KMO A;  4I97 A;  2V6O A;  2H6X A;  2P5Q A;  3MWH A;  2JZS A;  1F3A A;  3CSI A;  2IMK A;  16GS A;  1TU8 A;  1TP9 A;  2YWO A;  2NBS A;  3EYT A;  2LQO A;  5CAX A;  3C1R A;  1M99 A;  2R37 A;  3FW2 A;  1A23 A;  2CAI A;  2XHF A;  1OAZ A;  4V1A p;  4HDE A;  4O5U A;  1OC3 A;  2VCX A;  1HNC A;  4YAV A;  2V32 A;  4K6X A;  1N2A A;  4Z2T A;  3ERG A;  5ENU A;  3GFK A;  3ZTL A;  2IL3 A;  2M72 A;  4POK A;  3F4S A;  2GTU A;  3D0Z A;  5IMA A;  4TKY A;  4TR1 B;  1ZYQ B;  1TI1 A;  2M80 A;  4OO4 A;  3FHK A;  4ML1 A;  2C80 A;  4ECJ A;  3M8N A;  3HJM A;  4TR1 A;  5ECQ B;  1YY7 A;  3A5I A;  2N5A A;  3OR5 A;  2YNX A;  1ERT A;  3VUR A;  5IOW A;  5H5Q A;  4YQM A;  1LJR A;  2ZUP A;  2CT6 A;  1A8L A;  3HKR A;  2DC5 A;  4GRF A;  2FA4 A;  3KGK A;  2YJH A;  3ED3 A;  1XWA A;  4GF0 A;  3IOS A;  4FYC A;  3HD5 A;  3GKM A;  1O85 A;  2LRC A;  1F37 A;  4XHM A;  1T4Z A;  2C0D A;  4JED A;  4HI7 A;  3MAK A;  1WOU A;  2C0F A;  2JAC A;  3MSZ A;  4BVX B;  4PXO A;  3U6V A;  4ZL7 A;  3GH6 A;  4RQX A;  3NIV A;  1GSY A;  4OD7 A;  3VWX A;  2LNS A;  6GSV A;  1M9A A;  2GVP A;  4N10 A;  2CVK A;  1RK4 A;  4BL7 B;  5INY A;  4J2F A;  1PRX A;  3N5O A;  4TRX A;  2GST A;  5G30 A;  4TVE A;  4ZBA A;  1PN0 A;  2H8L A;  3KIJ A;  4BL7 A;  2MMO A;  5IPH A;  1B4Q A;  2UZ8 A;  3H8Q A;  2R0P A;  1I9D A;  1V40 A;  2H1B A;  1GLQ A;  4WR5 A;  5GZZ B;  1TDI A;  2H66 A;  1UC7 A;  4WXT A;  3TKS E;  2H0G A;  4KH7 A;  1U88 A;  3MIX A;  1KTE A;  2DMM A;  4F0C A;  2MBT A;  3UVH A;  3V1W A;  5G1L A;  3APQ A;  3GSS A;  1WRY A;  5J5N A;  4JZQ A;  5GAP D;  5AIS A;  3CMI A;  2AB6 A;  2LJR A;  3ZRE A;  6GSX A;  1Z9H A;  3K8N A;  3LYP A;  1THO A;  1JHB A;  3F9U A;  5D9W A;  2YJ7 A;  5AIV A;  3ZIT A;  4MZC A;  4F03 A;  2HSM A;  2H30 A;  4MZW A;  3PPU A;  5ECR B;  4K7I A;  3MYD A;  1JFU A;  5EPF A;  5HFG A;  4PTS A;  3PIN A;  5IM9 A;  2KHP A;  4EXJ A;  5GAN D;  1OE7 A;  5ID2 B;  4I8B A;  2XPE A;  4PQI A;  2YPM A;  4IHU A;  5ID2 A;  1NSW A;  2H73 A;  4KA0 A;  5IMC A;  3UAP A;  1IYI A;  5CNW A;  4GQC A;  4RQR A;  4EIP A;  1RQM A;  3DGQ A;  2VLV A;  2HLS A;  1GUH A;  1MD3 A;  3TOU A;  1EEJ A;  4MJB A;  3GHA A;  8GSS A;  4MPG A;  2K18 A;  4P3Y B;  3LYK A;  3ISO A;  3GL5 A;  3N9J A;  4PX1 A;  1CQH A;  4K5R A;  1DSB A;  2KP1 A;  3GL3 A;  5B6N A;  4ECI A;  1GH2 A;  3QAG A;  3WGD A;  1EV4 A;  1HYU A;  1SYX A;  3I6A A;  5H5R A;  3C7M A;  1OC9 A;  2YOI A;  1X0R A;  2L57 A;  1PQN A;  2V6K A;  2KUC A;  2AHE A;  2L4Q A;  2LV3 A;  1XW9 A;  5FWG A;  2JSY A;  1AXD A;  4V2M A;  2NVL A;  4LL4 B;  1FG4 A;  3WT1 A;  4MNN A;  1ON4 A;  2VCQ A;  5G5F A;  3NZN A;  1SK2 A;  3GYK A;  2A2P A;  4F82 A;  3MNG A;  1A0R P;  2XBQ A;  1Z6N A;  2H72 A;  1CQG A;  2K6V A;  3FEU A;  1MDJ A;  4LLR A;  4EC0 A;  10GS A;  4AF2 A;  1DBY A;  3ZMK A;  4N30 A;  5KN3 A;  1X9W B;  2HSH A;  4EDZ A;  2HZE B;  1XZO A;  2CX4 A;  1ZYE A;  5DCG A;  5DDL A;  1XWC A;  1LU4 A;  3G7Y A;  2HRN A;  4HJM A;  3IK7 A;  3LWA A;  3CRT A;  2OE0 A;  1TW9 A;  1K0M A;  1PD2 1;  1XOA A;  3KM6 A;  4FQU A;  5DCH A;  1UN2 A;  1XVQ A;  2J9H A;  3EU3 A;  5AIX A;  4BVY B;  3EU4 A;  3PR8 A;  3KXO A;  2X4A A;  1K3Y A;  4YQV A;  3F4R A;  2R6K A;  4FYU A;  1DE1 A;  4ZIL A;  5B7C A;  4V2N A;  1ERV A;  4PQH A;  1MTC A;  2R0G A;  2H1A A;  2YCD A;  3R2Q A;  3L0H A;  1SJI A;  1T1V A;  1JZD A;  1TK0 B;  5DBQ A;  5AGY A;  3IE3 A;  3F6D A;  5JCU A;  4BPY A;  1BAY A;  2FWE A;  3F6F A;  4EO3 A;  3FKF A;  1X5D A;  1U3A A;  1UA5 A;  1XBS A;  3VK9 A;  3A5W A;  1R5P A;  2YWI A;  2DJ2 A;  4NPB A;  1M2B A;  2FHE A;  3TKP A;  1N8J A;  1NM3 A;  2IPA A;  2HE3 A;  2H1G A;  1EOH A;  3HA9 A;  4GLT A;  5A4V A;  3H93 A;  2GSS A;  3TKS C;  3KEB A;  3EC3 A;  3DXB A;  2YV7 A;  5KN0 A;  1BX9 A;  2VCW A;  2GDR A;  2OE1 A;  2YV9 A;  5EVO A;  1FVJ A;  4MMM A;  1RW1 A;  1O8W A;  4IS0 A;  1VRS D;  5IOX A;  3A2X A;  3C8E A;  1EWX A;  2X49 A;  1PX7 A;  1XPV A;  2C3N A;  1QXH A;  5F05 A;  2HSY A;  4IQA A;  3GN3 A;  4KCA A;  4MA9 A;  2YAN A;  2CZ2 A;  3P90 A;  5IMF A;  2A2R A;  4LMW A;  4EF0 A;  4I6X A;  2CA8 A;  1J9B A;  5BRT A;  1TU7 A;  1ILO A;  1GWC A;  4EE0 A;  4IEL A;  3LEF A;  3G7J A;  3WT2 A;  4FO5 A;  2G2Q A;  4MLY A;  4PUA A;  3KP8 A;  1MDK A;  2FD3 A;  2J23 A;  4Z2U A;  3ZVJ D;  1V98 A;  3TJK A;  4DSS B;  2WS2 A;  2DML A;  2GSQ A;  4DEJ A;  3TKR A;  5BMU A;  3CSJ A;  3TUE A;  3E3E A;  2R0C A;  1YDK A;  4DSS A;  3M0F A;  4Z2R A;  1ERU A;  1FW1 A;  2PVQ A;  4JRR A;  2HRK A;  1W89 A;  5ECK B;  2GT5 A;  3IHG A;  3KCM A;  3DVX A;  1T4Y A;  2RM5 A;  3D5J A;  2C1Y A;  3PGT A;  1ST9 A;  1PN9 A;  1ACV A;  3Q18 A;  1T3B A;  3M1G A;  1TRW A;  2P5R A;  1AC1 A;  4KDU A;  2VCV A;  4HQZ A;  1TKD B;  4XS6 A;  4I5Q A;  1K3O A;  3QD9 A;  4E8E A;  1URM A;  2DKH A;  3LXZ A;  2M46 A;  1EZK A;  1Y25 A;  3CBU A;  1ABA A;  5J9C A;  3H79 A;  6GSW A;  3HVS A;  3M9J A;  3UBL A;  2L59 A;  2RM6 A;  2BTO T;  3HVV A;  3GRX A;  3U5R E;  3VLN A;  1M2A A;  3HZ8 A;  5LCZ A;  3IBH A;  1R26 A;  5IMD A;  4YKF A;  4QL7 A;  4IJ3 A;  1ML6 A;  4WBJ A;  5G2Z A;  3KZQ A;  2OBK A;  1IYH A;  3VFI A;  4X1U A;  2H01 A;  4MCU A;  1YZX A;  4AJ8 A;  3VWU A;  1V9W A;  2F3M A;  4USS A;  2VUP A;  4D73 B;  1SU9 A;  2H75 A;  5G5E A;  3G7I A;  5COH A;  3A2V A;  2O7K A;  2DJ1 A;  1R7H A;  4YKG A;  1ZL9 A;  3TOT A;  3UOM A;  2HFD A;  1PL1 A;  3I43 A;  4ZB9 A;  2E0Q A;  3F3R A;  3IDV A;  3I9V 2;  3Q6O A;  3RAZ A;  1HNB A;  2X8C A;  5DQY A;  1G7O A;  2DSA A;  4MJE A;  2B5X A;  2L6C A;  1AW9 A;  4KND A;  4BA7 A;  2ON5 A;  4HOJ A;  2BJX A;  2H6Z A;  2O8V B;  1FAA A;  4LA1 A;  3WGE A;  1K0A A;  5G31 A;  1OKD A;  4L5O A;  4MJC A;  3QMX A;  2EC4 A;  1GUK A;  1YJ6 A;  1ZYN A;  3GST A;  5CO3 A;  2LJK A;  2P31 A;  2VM1 A;  4BVX A;  2OJL A;  1YF0 A;  3BCK A;  4NV5 A;  2EIO A;  17GS A;  11GS A;  2FNO A;  3F4T A;  2VD0 A;  3FZ5 A;  3VI7 A;  1UVZ A;  2GZZ A;  1FB0 A;  1QUW A;  2TRX A;  1O6J A;  2HRF A;  1GTA A;  5L71 A;  5EY6 A;  3KMN A;  3TB2 A;  1JLW A;  4ZXG A;  2VL2 A;  2OBI A;  4XRD A;  2DKI A;  1MDI A;  4MPF A;  1F3B A;  2CV4 A;  3HJO A;  1PMT A;  1KNG A;  3KTL A;  2A4H A;  2OA7 A;  3DWV A;  5CRD A;  2CZ3 A;  4N0V A;  2H70 A;  1H75 A;  3FR3 A;  1EP8 A;  2B5E A;  4KSM A;  1X9S B;  2B7K A;  3UEM A;  3QCP A;  4KE3 A;  4K2D A;  12GS A;  1QMV A;  19GS A;  1EEM A;  2TIR A;  2GLR A;  2H71 A;  2VLU A;  5D93 A;  2O89 A;  3LSZ A;  4MK3 A;  2LKU A;  1O8X A;  3CTG A;  1Q98 A;  2V41 A;  2LRT A;  1GUM A;  1EOG A;  1PX6 A;  3Q19 A;  5C04 A;  4PNG A;  1XWG A;  2B3S A;  2PMT A;  4XS4 B;  5ECI B;  1TRU A;  2H0I A;  1T00 A;  4K5S A;  1WJK A;  2DJJ A;  3QPM A;  2K8S A;  3FY7 A;  3CXG A;  4TXO B;  4XS4 A;  5HFK A;  2VO4 A;  3D4T A;  1O81 A;  2NDO A;  3EE2 A;  2WJU A;  1FB6 A;  3F63 A;  1HNA A;  4TXO A;  1PGT A;  2A4V A;  1XXU A;  2YWN A;  1TRS A;  2WGR A;  4X43 A;  4EKZ A;  2JL4 A;  5F06 A;  5F8B A;  5IPG A;  3G9B A;  4ULX A;  4Q5Q A;  2WUL A;  4IN0 A;  5IMZ A;  4E8H A;  4EUY A;  2XBI A;  4JR4 A;  3R3E A;  4GST A;  4KUN A;  3NOF A;  1ZGN A;  3HCZ A;  4Q5F A;  1U3I A;  1VGL A;  1VF1 A;  5IQY A;  3IAS 2;  3W6G A;  1VF4 A;  4G0L A;  2NTO A;  2LNT A;  3D21 A;  4EDY A;  1A2M A;  2IIY A;  2FLS A;  5LNK e;  5ECM B;  1H4O A;  5DVB A;  1ZYP A;  1QGV A;  3QAW A;  1E2Y A;  4IVF A;  1GTB A;  2R5G A;  3LQ7 A;  2VM2 A;  5IIZ A;  2C3T A;  5CP1 A;  6GST A;  2HI7 A;  3HJP A;  2H76 A;  1YKC A;  4WBR D;  4Q5N A;  4GXZ A;  4OWY A;  4NAX A;  2GQM A;  4F9Z A;  1MD4 A;  4RUV A;  4RI6 A;  1K3L A;  3EMX A;  2FUG 2;  3KP9 A;  2L5O A;  5HR3 A;  1AAZ A;  3GA4 A;  3TDG A;  5D9V A;  2HZE A;  1M9B A;  3A2W A;  2PBJ A;  5ELG A;  3FMW A;  3H4K A;  5H5S A;  4TR3 A;  5A5K A;  3HY2 A;  3IXR A;  4JE1 A;  3VPT A;  3CRU A;  2I9H A;  2YN1 A;  2FA8 A;  1YKA A;  5GST A;  4NHW A;  3FZ4 A;  2YZH A;  1THX A;  5JCW A;  4NV2 A;  1SJZ A;  1A0F A;  2H1D A;  3D6I A;  4PGT A;  1K0C A;  3CTF A;  3EIN A;  5D8I A;  4BVY A;  2DJK A;  2VCT A;  2OAC A;  6GSY A;  2IMF A;  2VOC A;  4G0K A;  3VWW A;  2H0H A;  2RUF A;  2X64 A;  2LJA A;  4CW9 A;  1GSS A;  1JLV A;  4EL1 A;  1ZOF A;  4CY8 A;  5HR0 A;  2ZNM A;  1F2E A;  4HU7 A;  3QFA C;  3D4M A;  4PQ1 A;  2D2Z A;  3TKS A;  2H74 A;  4ZL9 A;  3WYW A;  3ZL5 A;  4CHS A;  4L8E A;  4OMV A;  1S3C A;  1Z7R A;  3GUS A;  2LS5 A;  4DSQ A;  4NWY A;  3HHV A;  4MH2 A;  4A5P A;  3TJF A;  1SYR A;  2A2S A;  2VAF A;  3QDN A;  1BG5 A;  3P7X A;  1K0D A;  4IBP A;  2VD1 A;  3ZML A;  3A3T A;  2LUS A;  5HQP A;  4KDY A;  1QQ2 A;  1M0U A;  1SJ6 A;  1WE0 A;  2E2M A;  3JCM L;  3E9J B;  2H19 A;  3HYP A;  1TK8 B;  4IQ1 A;  5F07 A;  3DRN A;  2LST A;  1G6Y A;  1GSE A;  4V2L A;  1S3D A;  1SK1 A;  3EWL A;  2VL3 A;  2N5B A;  3TGZ A;  2EIQ A;  4HZ4 A;  3KH7 A;  2F8A A;  2CAQ A;  2HYX A;  2MMA A;  1A24 A;  4O92 A;  1SKS B;  4QL9 A;  2NPB A;  9GSS A;  5EL8 A;  5ECN B;  4DVC A;  3DML A;  5ECL B;  4WET A;  5CRE A;  3FZ9 A;  3L9U A;  3VWV A;  2XPD A;  4NXI A;  1YF1 A;  4MF6 A;  2PVO C;  3LG6 A;  2QKE A;  5CRW A;  3ZZX A;  3IPZ A;  1OYJ A;  1B9Y C;  1GTU A;  2GT6 A;  3GV1 A;  4OFT A;  2MMZ A;  4IP1 A;  1GNE A;  2FWH A;  2C4J A;  4PNF A;  2AV4 A;  1TJD A;  2ALB A;  3TJJ A;  2PWJ A;  3D22 A;  4TXV A;  3UBK A;  4RI7 A;  4XS1 A;  1OE8 A;  1AQW A;  5IMV A;  4K2X A;  5C00 A;  3BJ5 A;  2MBS A;  3GTU B;  3UMA A;  1BED A;  1XWK A;  4ZB6 A;  3APS A;  2C8U A;  4FYB A;  4IJI A;  4X0X A;  5J3R A;  1X5E A;  1XW5 A;  1J08 A;  3PH9 A;  4WF5 A;  3UAR A;  5KOW A;  2F8F A;  4KX4 A;  4O32 A;  1DUG A;  1JZR A;  3L78 A;  1KEB A;  1LBK A;  2E2G A;  2FWG A;  4Z7X A;  3IK9 A;  2YWM A;  2JSZ A;  2GGT A;  3ZRD A;  5FHI A;  13GS A;  2GS3 A;  2X8H A;  1C72 A;  4G10 A;  4LL1 B;  3KJY A;  4NHZ A;  2IMD A;  1GSF A;  1FOV A;  4K7N A;  3Q74 A;  3S9F A;  1TTZ A;  2PUK C;  2I81 A;  2P0G A;  5B8A A;  3AY8 A;  2L5L A;  2PPT A;  1GUL A;  3LXT A;  4HJ2 A;  2AUV A;  4MF7 A;  3W8S A;  1Q4J A;  3W8J A;  1TRV A;  3FZA A;  2LRN A;  3RHC A;  1A2L A;  2O85 A;  3WD6 A;  4MDC A;  3ME8 A;  1SL1 B;  5J9B A;  4O5R A;  5J4U A;  3LOR A;  3DYR A;  2WB9 A;  2FWF A;  2PU9 C;  3C73 A;  2WFC A;  1VF3 A;  2C0G A;  2E7P A;  4YAP A;  1XW6 A;  3ZIV A;  2CVD A;  2BMX A;  3ZYW A;  4I2T A;  3RPN A;  2DLX A;  3APO A;  5JWR B;  4IW9 A;  3F3Q A;  1GTI A;  4L0W A;  2R4V A;  1XFL A;  1NHY A;  5ELA A;  3UIW A;  1ZZY A;  3WGX A;  2X99 A;  4D73 A;  3HDC A;  3QR6 A;  3ERW A;  3HXS A;  3UL3 A;  5JWO B;  4XIH A;  4N11 A;  4F2I A;  5ECH B;  4OCE A;  1A8Y A;  6GSS A;  4GSS A;  2MZC A;  3FR6 A;  4G9H A;  1TOF A;  3EMP A;  4ZBB A;  1PL2 A;  3GNJ A;  1ERW A;  1B9X C;  2GQL A;  5CRG A;  1FHE A;  2B1L A;  5B8B A;  2QSI A;  1QK8 A;  5DAK B;  3HZ4 A;  5ECS A;  1K0N A;  3GH9 A;  3IV4 A;  2ZCT A;  3ZLP A;  4JU5 A;  1PKZ A;  1G6W A;  2V2G A;  3IHQ A;  1HQO A;  5DAK A;  1EP7 A;  1YQ1 A;  4JR6 A;  4OCF A;  4J56 E;  1V2A A;  4JBB A;  1WIK A;  2GZP A;  4YQU A;  2FCH A;  3HVX A;  1GP1 A;  4G2E A;  5ECP B;  1YEP A;  1XVW A;  4F0B A;  1W4V A;  2PGT A;  3DIE A;  1F6M C;  2YP6 A;  3FR9 A;  2K8V A;  4POM A;  1B8X A;  4ZB8 A;  4O5Q A;  5DAL B;  4MAB A;  4J57 E;  1F9M A;  2FGX A;  4G0I A;  2AAW A;  4IGJ A;  4N0Z A;  18GS A;  5DAL A;  2QA2 A;  5JWQ B;  2GZY A;  3C1S A;  1SKR B;  1O7U A;  3SBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...