4KNDA

Thioredoxin from anaeromyxobacter dehalogenans.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
DVVVLQDSTFEQEVLKSDTPVLVDFWAVWCGPCKAIAPVVDDLAARYKGKLKVAKMDVDQHQGVPQQYGIRSIPTLLVFKGGRVVDTVIGADKTRLEDSVKKAIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin
publication title Thioredoxin from Anaeromyxobacter dehalogenans.
rcsb
source organism Anaeromyxobacter dehalogenans
total genus 28
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4kndA00
3C71A 3GNJA 5J4UA 2R4VA 4KAEA 3M3MA 3GX0A 17GSA 5IPGA 4O32A 1IYIA 1QQ2A 1SK0A 2GVPA 1NM3A 4ISDA 5AIVA 4F82A 4V2NA 5D9TA 2LQOA 2NPBA 3IK7A 1RQMA 1M2AA 1XW6A 5AGYA 2OJLA 3BJ5A 1TXXA 1BJXA 5IOWA 4TXVA 2H6XA 4EL1A 2XC2A 3FYGA 3IXRA 1FB0A 4ECJA 2B1KA 2H19A 3UVHA 2V2GA 1EOGA 4MPFA 1GWCA 4OCFA 1Q4JA 5GZZB 4KDXA 2M46A 2HLSA 2IMFA 4XS6A 5LCZA 2NDOA 3D4TA 1PL1A 4MMMA 2WDUA 2OACA 2WJUA 2CZ3A 2JZTA 1XZOA 5G1LA 4ID0A 3BCKA 2FWEA 2HFDA 2GZZA 1B48A 4MDCA 4MH3A 4J57E 1O85A 2FA4A 2PN8A 3TGZA 2MMZA 3ERFA 2RUFA 3WD6A 1K0CA 7GSSA 5DQYA 4LLRA 4KSMA 1SJ6A 1A2MA 2I4AA 3D4MA 2KHPA 4BWQA 3EWLA 2O87A 2P31A 2CA8A 4OFNA 1U6TA 1G7EA 3I43A 2A4VA 1Z7PA 2L5LA 2WB9A 4GF0A 4I5QA 2GQMA 2J9HA 3GH9A 1FB6A 3KP9A 3QAVA 2AHEA 2AB6A 3LFLA 1HD2A 3KMOA 5IMVA 4L5LA 3Q6OA 2GDRA 2LEGA 2YWMA 4EUYA 3LXZA 2E7PA 1AQVA 2C80A 5CAXA 3P2AA 1A0RP 2X99A 1SJZA 1GTUA 3Q18A 3ZIVA 2BMXA 3ZITA 2I3YA 4HU9A 1SL2B 4GQFA 1F2EA 3E0UA 3PR8A 1UN2A 2IMIA 1X9SB 3TKQA 2MBSA 1FO5A 3VPTA 3P7XA 3J7Yb 4MJAA 2H73A 1U88A 4BL7A 2C3NA 5LD0A 1WPIA 1A8YA 3GTUA 2C1YA 4PGTA 1U3IA 1VGLA 1V40A 4G2EA 3RBTA 1JZRA 3WGXA 4TOPA 8GSSA 1X0RA 5ELGA 5EPFA 4PXOA 2E2GA 2QC7A 3APSA 3TUEA 4EC0A 1JHBA 4PNGA 3ZVJA 3I6AA 1M9AA 2YOIA 1MEKA 2DJ3A 4NMUA 2DJ2A 3KMNA 4WR4A 3JCML 5E4WA 2IFQA 5FWGA 1HNBA 3G7YA 2YN1A 5DDLA 2HSHA 1QMVA 1XBSA 3H93A 1ERWA 4ZB8A 3ZTLA 3IC4A 5F8BA 5GSTA 5JWRB 1Y25A 1LJRA 2GQLA 4WKWA 3FZ4A 1B9YC 3EYTA 1R26A 2DJ0A 1X5DA 3ZFLA 2X8GA 4D73A 4AJ8A 2RIIA 3UIWA 3GFKA 2CVKA 5CRGA 4N0VA 5IO0A 3LXTA 5H5QA 1TOFA 2VAFA 2DBCA 4ML1A 4NHZA 3LJRA 1ERVA 2VM1A 3ERWA 4QL7A 3PH9A 2HRFA 2HZEB 2VLUA 2OE3A 1MDIA 2JSYA 3APQA 2H75A 4GRFA 3TRXA 2M72A 3TKSA 2F8FA 2VCQA 3P8WA 4NWYA 2IFQB 4IJIA 2H1AA 1HQOA 4RI6A 5DCHA 3IE3A 5IMFA 3U5RE 4LMWA 5KN3A 2YV9A 2FLSA 1SJIA 1TDIA 4RUVA 3EMPA 4IQAA 3D21A 1OKTA 5ECKB 2VL3A 4V1Ag 3QD9A 4KB3A 2NTOA 5CNWA 2DMMA 2HYXA 4MZBA 3MSZA 4I8BA 2CX4A 4G9HA 2GT5A 12GSA 4PX1A 4DEJA 14GSA 2MZCA 3FK8A 3FR3A 5D9WA 2LRNA 2N5FA 3GMFA 1KTEA 5JWQB 13GSA 1YQ1A 2DJJA 6GSXA 1T7PB 4ACSA 1K3YA 2KOKA 3HXSA 4TR3A 3UOMA 1EGOA 5EY6A 1WRYA 2XBQA 4HDEA 5ECIB 1PN9A 3F6DA 2KP2A 1OC8A 1TRUA 4EF0A 6GSYA 1F6MC 5G1KA 5DALA 2LS5A 1AQXA 2C4JA 1S3CA 3V1WA 4BWSA 3C7MA 5CYYA 3ZRDA 4HQSA 3FZAA 1PA3A 3KEBA 4CDOA 1LBKA 2DJKA 1PRXA 1NW2A 1JZDA 1QK8A 4YH2A 1HYUA 4JRRA 4NPBA 2JZSA 1NSWA 5CRDA 3F6FA 1R5PA 1SU9A 2VM2A 3FW2A 2HNLA 3CSHA 2Z9SA 4JZQA 3M9JA 4XRAA 1YF0A 4HJ2A 4H86A 1R7HA 2H0IA 4MP4A 1AUCA 3LG6A 1GNWA 3F4SA 2VD1A 5HR3A 1GTIA 4K8MA 4HI7A 2OBKA 2FGXA 5J9CA 1GH2A 2IL3A 3HYPA 4WETA 2XPDA 1GLQA 5D93A 1H4OA 5DALB 1XXUA 4N0ZA 4EDYA 1WE0A 2AAWA 1ZL9A 4I2UA 2DC5A 4F0CA 3CYNA 3W8SA 2HXKA 1QXHA 1QGVA 3ZMKA 2YZHA 3U6VA 1TU7A 1MD3A 4XCSA 1R4WA 3SBCA 4G10A 1CQGA 3A2WA 1V98A 1X5EA 3DD3A 1JLVA 2H74A 4WBRD 3IAM2 2P5RA 4K2DA 4XIHA 1EP8A 1GL8A 1TK5B 4I2TA 1VF3A 1Z6NA 4IBPA 2PERA 3MNGA 2R5GA 3ZYWA 4F2IA 3ME8A 4IVFA 5ECOB 3GUSA 3KM6A 3IK9A 5F07A 5GAPD 3DIEA 5B6NA 4F0BA 5HFKA 4ECBA 3H4KA 3FKFA 5EL8A 9GSSA 2V32A 3HZ4A 5ID2A 1HNCA 5KN0A 1AC1A 5ECMB 2CZ2A 1GSSA 2RLIA 2YWNA 5IM9A 3LYKA 3TB2A 5ECSA 1GLPA 2CX3A 4J2FA 4MF7A 1I9DA 4KUNA 1PD21 3GN3A 4KX4A 5C04A 5J9BA 4HQZA 1TK8B 1GUKA 2FWGA 4TR0A 4YAVA 5D9VA 4X43A 1A0FA 3KXOA 3LQ7A 1TTZA 3J7Yk 1O8XA 2CT6A 1ZYQB 3GRXA 3O76A 3HHVA 3UARA 3LWAA 1VF2A 1WMJA 5HQPA 2H1BA 3NOFA 3H8QA 1V57A 4DSQA 2VL2C 1MTCA 5E59A 2PU9C 1RW1A 1XVWA 22GSA 2IPAA 1T4ZA 5ID2B 1QFNA 3TJKA 4KCEA 3D0ZA 4YQMA 2PPTA 3DVWA 4JE1A 3UBKA 3ZFBA 3ZVJD 1BG5A 2FD3A 1W4VA 1FAAA 3WGEA 16GSA 2H1GA 4TRXA 1YY7A 2EIOA 2G0FA 4AGSA 1NHYA 2F8AA 1Y6EA 1HNAA 1SL0B 3FR6A 4ZBBA 3HA9A 2I9HA 5H5SA 1R5AA 3H1NA 3VWUA 1DE1A 3VK9A 4EO3A 4JR4A 1MDKA 4L0WA 1FHEA 2DSAA 2C3QA 3IOSA 1TP9A 2C3TA 4GTUA 3BD2A 2GTUA 1YF1A 1Z5YE 1GTAA 4BA7A 1EV4A 2GT6A 3FZ9A 3HVSA 3IPZA 3E3EA 5ECLB 3GHAA 4LL1B 1VF1A 3TCOA 4TR1B 2E2MA 4KDYA 4MLYA 4TN8A 4FIWA 2V41A 5B8BA 3DVXA 2H8LA 2VOCA 3TOTA 2HT9A 2MMNA 4ZB6A 2XHFA 3IHQA 2BTOT 2MBTA 2L4QA 3ZL5A 1B8XA 2YWIA 3MWHA 1GUMA 2GSQA 2H0HA 2MMOA 2L5OA 4V2MA 4PURA 4NV2A 11GSA 1TRVA 1OE7A 4OD7A 5HR0A 3KGKA 2ALBA 2C0EA 5HFIA 3GSSA 1M7TA 4ZL8A 3L0HA 2GLRA 4K7OA 1G6WA 2E0QA 2K8VA 3VWWA 3C73A 4JEDA 1OC9B 2KUCA 3QAWA 2BJXA 2LJAA 2HI7A 2HZEA 3G7IA 1JFUA 4ECCA 4CW9A 4YQVA 4P3YB 3GL3A 1T4YA 3QDNA 1PX6A 5G31A 3TKRA 3N5OA 2DIYA 3FY7A 3LORA 4E8HA 1ACVA 1FG4A 2FCHA 4E8EA 2GSRA 1BQ7A 2LJKA 1TRSA 4KA0A 3ZLPA 3F4RA 3CBUA 3MDKA 4HEA2 1VRSD 2B5XA 1TW9A 4LA1A 3M9KA 3TRQA 2O8VB 3HKRA 1XOAA 3DMLA 5GSSA 3KTBA 1TI3A 2K8SA 1QUWA 3GSTA 3GURA 2B7JA 5AISA 1M0UA 4QL9A 4MJBA 2ZNMA 1GULA 4KW6A 1ERUA 3F63A 4FYCA 1XWKA 4DSSB 1ABAA 4LMVA 3I69A 2NVLA 18GSA 19GSA 1MDJA 1EGRA 1I5GA 4K7NA 1YZXA 3QFAC 3UEMA 5FHIA 2CAIA 2TIRA 3F9UA 3TKPA 5JWOB 1E6BA 2AV4A 4XS4B 2HRNA 1YEPA 5J5NA 3VWXA 4GLTA 1YDKA 3FHKA 2F51A 4IP1A 4IELA 5IMAA 2YNXA 4AF2A 2ZCTA 2GQKA 4I6XA 1UC7A 1Z6MA 1PSQA 3A2XA 1LU4A 1F3AA 3ME7A 2XBIA 4WF5A 5DAKA 6GSTA 2R37A 3H79A 3O3TA 2OKAA 2YJ7A 5ABRA 3VI5A 3E9JB 1M2DA 1XW9A 1SK1A 1OC3A 2FNOA 2YJHA 2B5EA 5F0GA 5ECPB 1YKCA 4JR6A 4DSRA 3KD0A 3DGQA 4MZWA 4TR4A 2DIZA 3D6IA 1ML6A 3US3A 3EINA 1ZOFA 2H30A 4MCUA 3ZIJA 2RM5A 4IKHA 3VURA 2B7KA 3TJGA 2H01A 3LYPA 2LNSA 2EIRA 2B5YA 2AYTA 3DXBA 3VLNA 3BOAA 3GX8A 1JLWA 2ES7A 3EURA 4KDUA 5G5EA 4FYBA 1JZOA 1VF4A 1XVQA 1EZKA 3C8EA 2V1MA 2K18A 3D22A 1XW5A 2HSYA 2IMEA 5DAKB 1E2YA 3Q74A 5IPHA 2PMTA 3RAZA 1K0AA 3Q19A 4OWYA 5KN1A 2LKUA 1ERTA 1F3BA 4OFTA 5IO2A 1XCCA 4IP6A 3QPMA 2WS2A 5F06A 3UMAA 3N9JA 5CP1A 1UA5A 1WIKA 2TRCP 1PGTA 3QCPA 4EVMA 1YKAA 2LNTA 2KLXA 5HR1A 4V2LA 2C8UA 5INYA 5C00A 4WR5A 2LV3A 2OE1A 3QR6A 4KGIA 3A3TA 2QSIA 4IN0A 3IRAA 5JCGA 2V6KA 4MJEA 5COHA 4POLA 2JL4A 5CRHA 2N5AA 2P5QA 2ON5A 5DCGA 3ZREA 4AJ7A 4ZB9A 3RHBA 3PGTA 4KCAA 5B7CA 4JBBA 5DBQA 4KE3A 4KNDA 5H5RA 3L78A 4O92A 3A5WA 3F3RA 1A8LA 3UJ1A 4EDZA 3HY2A 1DSBA 3L9UA 2H76A 4F9ZA 5A4WA 3DWVA 3VI7A 1K3LA 2PVOC 4L8EA 4MA9A 2VCVA 5JCUA 1XFLA 5AIXA 4IW9A 1K0BA 2CQ9A 1OAZA 4Q5FA 1EEMA 1PX7A 2PGTA 1O73A 3L9SA 1EV9A 5G5FA 3GA4A 3CRUA 2ZUPA 3UAPA 2LJRA 4K0GA 3QFBC 5ECQB 1M9BA 2VL9A 2L57A 4X0XA 6GSUA 4ZXGA 3EC3A 1SENA 3P90A 1K0OA 1N8JA 2DJ1A 1JZWA 2WFCA 2X64A 1NHOA 1THXA 1XWCA 4K6XA 3MAKA 4YAPA 3I9V2 3EE2A 3IR4A 4I97A 1G0TA 1CQHA 4TVEA 2AJQB 2YZUA 5KEJA 4DVCA 4IHUA 3WGDA 1O7UA 2B6MA 1XWGA 4BPYA 5HR2A 3CXGA 2L4CA 4IJ3A 2LTKA 6GSVA 2IN3A 3W6GA 1K0MA 3A2VA 1MD4A 4ZBAA 1YJ6A 1FVJA 5A4VA 2O7KA 1K0NA 3QMXA 1PQNA 4EXJA 1OE8A 2VCTA 5J41A 5B8AA 1U87A 2OBIA 1EEJA 1K3OA 4IGJA 2JACA 4Z7XA 4HU7A 3AY8A 1O6JA 3HVXA 3RHCA 1Q98A 2K6VA 1Z7RA 1BAYA 2H66A 5ECHB 2ON7A 4RI7A 3SWLA 4BVXA 2H6ZA 3KZQA 1TK0B 3L9VA 2VO4A 5LNKe 1PMTA 1AQWA 4WBJA 4TKYA 5B6MA 1B4PA 1USBA 3FRCA 5DJMA 3EMXA 4ZIJA 1XWAA 3TKSE 2VCWA 4K0NA 2A2RA 5D73A 1AW9A 4POKA 4ZILA 2YV7A 4TR1A 2I81A 4ML6A 3KP8A 1O8WA 4Q5QA 2LQQA 2IJYA 4ECIA 3IBHA 2CAQA 2QKEA 1PL2A 3K8NA 3F3QA 4Q5RA 1SK2A 5IMZA 4ZL7A 4WF4A 4GSSA 2L59A 3W8JA 1C72A 1ZYEA 2C0FA 3ISOA 1FW1A 3C1SA 1KBNA 2RUEA 1TI1A 2X8CA 1BX9A 3CSJA 1V9WA 3TKSC 4V1Ap 2P0GA 3LGCA 2YCDA 3M1GA 1KNGA 2VCXA 3S9FA 3DRNA 5D8IA 4K1FA 1A23A 3KJYA 2C0DA 4K9ZA 4TW5A 1T3BA 2O89A 3LEFA 4GCIA 4HZ2A 1GSUA 1OC9A 4PQIA 4PQHA 3HDCA 10GSA 2OE0A 2LUSA 2OADA 3ZMLA 1ILOA 1DE2A 4NV5A 3FR9A 2EIQA 3KH7A 1SYXA 5G2ZA 3F4TA 4KSOA 2PVQA 4CHSA 4IQ1A 3F0IA 3D5JA 3HJOA 2FWHA 1SL1B 4N10A 1B4QA 2L6CA 2MYGA 3IAS2 3WT1A 3ZZXA 5GAND 2FUG2 3ERGA 3UVTA 1EWXA 1FOVA 1X5CA 2WRTA 2B3SA 4PNFA 3WYWA 4NHWA 4X1UA 4KH7A 4PQ1A 3HJMA 1Z9HA 4FO5A 2DLXA 6GSSA 3GKXA 3O6TA 2EC4A 4YQUA 1J0FA 4OFMA 1XIYA 1EOHA 2PWJA 4G19A 1T00A 3CTFA 3GKKA 5ECRB 2VLTA 4DSSA 2CV4A 1F9MA 4HS1A 5AN1A 2REMA 1BYEA 3WT2A 4MH2A 3NIVA 4XS4A 4HZ4A 5ELAA 2YPMA 4NXIA 2H72A 2GZYA 3CSIA 2JADA 3R2QA 3HCZA 3GKNA 5A5KA 3DKSA 2H71A 1SKWB 2WZ9A 2JU5A 2MMAA 5IOXA 1GSYA 3UL3A 1X9WB 3ED3A 1ON4A 4GSNA 1X9MB 2LSTA 4WEYA 3EVIA 4HOJA 1DBYA 3TJJA 1ZMAA 4EE0A 4MF5A 2H0GA 1N2AA 3TDGA 3OR5A 4GSTA 3PINA 3F8UA 1GSDA 4MK3A 4MF6A 2J23A 2HE3A 1WP0A 2H1DA 3GL5A 1GSFA 4BVYA 3CTGA 2VL2A 1J08A 1RK4A 3GV1A 4MABA 2RM6A 1OYJA 1TRWA 1URMA 2YP6A 3TOUA 2F3MA 2GSSA 3G7JA 3GTUB 4XHMA 5IQYA 2JSZA 1IYHA 2IIYA 2WULA 4ILFA 1J9BA 3KIJA 3QAGA 2FA8A 3IA1A 5DQSA 5G30A 2FWFA 5CO3A 1V58A 3FZ5A 3GH6A 2F9SA 3RDWA 1A24A 4PUAA 2K9FA 1BEDA 1H75A 1YEXA 3KTLA 1G6YA 2R3XA 3BBYA 2FHEA 1XOBA 3GKMA 2PBJA 1O81A 5EVOA 3RPNA 1SYRA 1ZZYA 1WOUA 2AUVA 1U3AA 2H6YA 2CVDA 1TU8A 4ZBDA 1T8EB 2DMLA 3EU3A 5ENUA 4XTSA 2QGVA 2FY6A 1ZCPA 3KH9A 2GZPA 1UVZA 4GXZA 4OO5A 3BCIA 3C1RA 1GUHA 1M99A 4O7HA 1WWJA 2OA7A 3G9BA 4D73B 2VUPA 3HZ8A 4WXTA 1THOA 4RQRA 1ZGNA 2WGRA 5IMDA 3IDVA 3TRPA 2V6OA 4OO4A 3TJFA 4AJ6A 5DJLA 1FVKA 3APOA 3VFIA 3EU4A 2KP1A 4OMVA 4F03A 2IWTA 2VD0A 4GWRA 1G7OA 1SKSB 3M8NA 6GSWA 2LRCA 1A2JA 2C0GA 4HJMA 1OKDA 2GSTA 5KN2A 5DVBA 1GSQA 3VWVA 1DUGA 2GGTA 1SD9A 4O5RA 3QOUA 5D96A 3TJBA 4N11A 3FEUA 3NZNA 4TXOA 20GSA 2R2JA 4OCEA 2N5BA 4ULXA 3LSZA 1GP1A 5JCWA 1K0DA 2GS3A 4IS0A 5J3RA 1SKRB 4HUAA 4XS1A 3RPPA 3CRTA 5L71A 4L5OA 2G2QA 1S3DA 1T1VA 4ZL9A 1TJDA 2XPEA 3HD5A 4FYUA 1ST9A 1AXDA 2HZFA 2CVBA 3GIXA 4L0UA 4K7IA 4MJCA 1TKDB 5CRWA 2B1LA 4NAXA 5IMCA 3CMIA 4GQCA 4JU5A 5IIZA 4QQ7A 1XWBA 1PKZA 2YANA 2H70A 3HVVA 1XPVA 2R6KA 2A2SA 5F05A 1W89A 1SD8A 4TXOB 3UBLA 4FH8A 2L6DA 4PUFC 2JZRA 4MZCA 5A4UA 2I1UA 1Z3EA 1PKWA 2IMDA 4XRDA 1GSEA 1GTBA 4N30A 1B9XC 1F37A 1OVNA 1V2AA 2VCZA 1GRXA 2O85A 5FT3A 4POBA 3DEXA 3DYRA 5HFGA 2IMKA 2PUKC 2X8HA 4RQXA 5CREA 3VPQA 4Q5NA 2VIMA 2YWOA 1S3AA 4EKZA 2VLVA 1EP7A 3L4NA 1A2LA 2TRXA 1KEBA 1GNEA 3IV4A 4MPGA 2LRTA 1WJKA 2M80A 4POMA 4J56E 1AAZA 3KCMA 5ECNB 1AIUA 2NBSA 3M0FA 3GYKA 2WCIA 5D9XA 3HJPA 2D2ZA 1M2BA 4LL4B
chains in the Genus database with same CATH superfamily
3C71A 3GNJA 5J4UA 2R4VA 4KAEA 3M3MA 3GX0A 17GSA 5IPGA 4O32A 1IYIA 1QQ2A 1SK0A 2GVPA 1NM3A 4ISDA 5AIVA 4F82A 4V2NA 5D9TA 2LQOA 2NPBA 3IK7A 1RQMA 1M2AA 1XW6A 5AGYA 2OJLA 3BJ5A 1TXXA 1BJXA 5IOWA 4TXVA 2H6XA 4EL1A 2XC2A 3FYGA 3IXRA 1FB0A 4ECJA 2B1KA 2H19A 3UVHA 2V2GA 1EOGA 4MPFA 1GWCA 4OCFA 1Q4JA 5GZZB 4KDXA 1PN0A 2X4AA 4K5SA 5KOXA 2M46A 2HLSA 2IMFA 4XS6A 5LCZA 2NDOA 3D4TA 1PL1A 4MMMA 2WDUA 2OACA 2WJUA 2CZ3A 2JZTA 1XZOA 5G1LA 4ID0A 3BCKA 2FWEA 2HFDA 2GZZA 1B48A 4MDCA 4MH3A 4J57E 1O85A 2FA4A 2PN8A 3TGZA 2MMZA 3ERFA 2RUFA 3WD6A 1K0CA 7GSSA 5DQYA 4LLRA 4KSMA 1SJ6A 4YKFA 1A2MA 2I4AA 3D4MA 2KHPA 4BWQA 3EWLA 2O87A 1FOHA 2P31A 2CA8A 4OFNA 1U6TA 1G7EA 3I43A 2A4VA 1Z7PA 2L5LA 2WB9A 4GF0A 4I5QA 2GQMA 2J9HA 3GH9A 1FB6A 3KP9A 3QAVA 2AHEA 2AB6A 3LFLA 1HD2A 3KMOA 5IMVA 4L5LA 3Q6OA 3IC8A 2GDRA 2LEGA 2YWMA 4EUYA 3LXZA 5KOWA 2E7PA 1AQVA 2C80A 5CAXA 3P2AA 1A0RP 2X99A 1SJZA 1GTUA 3Q18A 3ZIVA 2BMXA 3ZITA 2I3YA 4HU9A 1SL2B 3A5IA 4GQFA 1F2EA 3E0UA 3PR8A 1UN2A 2IMIA 1X9SB 3TKQA 2MBSA 1ZYNA 1FO5A 3VPTA 3P7XA 3J7Yb 4MJAA 2H73A 1U88A 4BL7A 2C3NA 5LD0A 1WPIA 1A8YA 3GTUA 2C1YA 4PGTA 1U3IA 1VGLA 1V40A 4G2EA 3RBTA 1JZRA 3WGXA 4TOPA 8GSSA 1X0RA 5ELGA 5EPFA 4PXOA 2E2GA 2QC7A 3APSA 3TUEA 4EC0A 1JHBA 4PNGA 2R0PA 3ZVJA 3I6AA 1M9AA 2YOIA 1MEKA 2DJ3A 4NMUA 2DJ2A 3KMNA 4WR4A 3JCML 5E4WA 2IFQA 5FWGA 1HNBA 3G7YA 2YN1A 5DDLA 2HSHA 1QMVA 1XBSA 3H93A 1ERWA 4ZB8A 3ZTLA 4MNNA 3IC4A 5F8BA 5GSTA 5JWRB 1Y25A 2QA1A 1LJRA 2GQLA 4EIPA 4WKWA 3FZ4A 1B9YC 3EYTA 1R26A 2DJ0A 1X5DA 2X49A 3ZFLA 2X8GA 4D73A 4AJ8A 2RIIA 3UIWA 3GFKA 2CVKA 5CRGA 4N0VA 5IO0A 3LXTA 5H5QA 1TOFA 2VAFA 2DBCA 4ML1A 4NHZA 3LJRA 1ERVA 2VM1A 3ERWA 4QL7A 3PH9A 2HRFA 2HZEB 2VLUA 2OE3A 1MDIA 2JSYA 3APQA 2H75A 4GRFA 3TRXA 2M72A 3TKSA 2F8FA 2VCQA 3P8WA 4NWYA 2IFQB 3FMWA 4IJIA 2H1AA 1HQOA 4RI6A 5DCHA 3IE3A 5IMFA 3U5RE 4LMWA 5KN3A 2YV9A 2FLSA 1SJIA 1TDIA 4RUVA 3EMPA 4IQAA 3D21A 1OKTA 5ECKB 1XG8A 2A2PA 2VL3A 4V1Ag 3QD9A 4KB3A 2NTOA 5CNWA 2DMMA 2HYXA 4MZBA 3MSZA 4I8BA 2CX4A 4G9HA 2GT5A 12GSA 4PX1A 4DEJA 14GSA 2MZCA 3FK8A 3FR3A 5D9WA 2LRNA 2N5FA 3GMFA 1KTEA 5JWQB 13GSA 1YQ1A 2DJJA 6GSXA 1T7PB 4ACSA 1K3YA 2KOKA 3HXSA 4TR3A 3UOMA 1EGOA 5EY6A 1WRYA 2XBQA 2HRKA 4HDEA 5ECIB 1PN9A 3CQFA 3F6DA 2KP2A 1OC8A 1TRUA 4EF0A 6GSYA 1F6MC 5G1KA 5DALA 2LS5A 1AQXA 2C4JA 1S3CA 3V1WA 4BWSA 3C7MA 5CYYA 3ZRDA 4HQSA 3FZAA 1PA3A 3KEBA 4CDOA 1LBKA 2DJKA 1PRXA 1NW2A 1JZDA 1QK8A 4YH2A 1HYUA 4JRRA 4NPBA 2JZSA 1NSWA 5CRDA 3F6FA 1R5PA 1SU9A 2VM2A 3FW2A 2HNLA 3CSHA 2Z9SA 4JZQA 3M9JA 4XRAA 1YF0A 4HJ2A 4H86A 1R7HA 2H0IA 4MP4A 1AUCA 3LG6A 1GNWA 3F4SA 2R0GA 2VD1A 5HR3A 1GTIA 4K8MA 4HI7A 2OBKA 2FGXA 5J9CA 1GH2A 2IL3A 3HYPA 4WETA 2XPDA 1GLQA 5D93A 1H4OA 5DALB 1XXUA 4N0ZA 4EDYA 1WE0A 4Z2UA 2AAWA 1ZL9A 4I2UA 2DC5A 4F0CA 3CYNA 3W8SA 2HXKA 1QXHA 1QGVA 3ZMKA 2YZHA 3U6VA 1TU7A 1MD3A 4XCSA 1R4WA 3SBCA 4G10A 1CQGA 3A2WA 1V98A 1X5EA 3DD3A 1JLVA 4Z2TA 4EIQA 2H74A 4BIKA 4WBRD 3IAM2 2P5RA 4K2DA 4XIHA 1EP8A 1GL8A 1TK5B 4I2TA 1VF3A 1Z6NA 4IBPA 2PERA 3MNGA 2R5GA 3ZYWA 4F2IA 3ME8A 4IVFA 5ECOB 3GUSA 3KM6A 3IK9A 5F07A 5GAPD 3DIEA 5B6NA 4F0BA 5HFKA 4ECBA 3H4KA 3FKFA 2A4HA 5EL8A 9GSSA 2V32A 3HZ4A 5ID2A 1HNCA 5KN0A 1AC1A 5ECMB 2CZ2A 1GSSA 2RLIA 2YWNA 5IM9A 3LYKA 3TB2A 5ECSA 1GLPA 2CX3A 4J2FA 4MF7A 1I9DA 4KUNA 1PD21 3GN3A 4KX4A 5C04A 5J9BA 4HQZA 1TK8B 1GUKA 2FWGA 4TR0A 4YAVA 5D9VA 4X43A 1A0FA 3KXOA 3LQ7A 1TTZA 3J7Yk 1O8XA 2CT6A 4O5UA 1ZYQB 3GRXA 3O76A 3HHVA 3UARA 3LWAA 1VF2A 1WMJA 5HQPA 2H1BA 3NOFA 3H8QA 1V57A 4DSQA 2VL2C 1MTCA 5E59A 2PU9C 1RW1A 1XVWA 22GSA 2IPAA 1T4ZA 5ID2B 1QFNA 3TJKA 4KCEA 3D0ZA 3HVNA 4YQMA 2PPTA 3DVWA 4JE1A 3UBKA 3ZFBA 3ZVJD 1BG5A 2FD3A 1W4VA 1FAAA 3WGEA 16GSA 2H1GA 4TRXA 1YY7A 2EIOA 2G0FA 4AGSA 1NHYA 2F8AA 1Y6EA 1HNAA 1SL0B 3FR6A 4ZBBA 3HA9A 2I9HA 5H5SA 1R5AA 3H1NA 3VWUA 1DE1A 3VK9A 4EO3A 4JR4A 1MDKA 4L0WA 1FHEA 2DSAA 2C3QA 3IOSA 1TP9A 2C3TA 4GTUA 3BD2A 2GTUA 1YF1A 1Z5YE 1GTAA 4BA7A 1EV4A 2GT6A 4KF9A 3FZ9A 3HVSA 3IPZA 3E3EA 5ECLB 3GHAA 4LL1B 1VF1A 3TCOA 4TR1B 2E2MA 4KDYA 4MLYA 4TN8A 4FIWA 2V41A 5B8BA 3DVXA 2H8LA 2VOCA 3TOTA 2HT9A 2MMNA 4ZB6A 2XHFA 3IHQA 2BTOT 2MBTA 2L4QA 3ZL5A 1B8XA 2YWIA 3MWHA 1GUMA 2GSQA 2H0HA 2MMOA 2L5OA 4V2MA 4PURA 4NV2A 11GSA 1TRVA 1OE7A 4OD7A 5HR0A 3KGKA 2ALBA 2C0EA 5HFIA 3GSSA 1M7TA 4ZL8A 3L0HA 2GLRA 4K7OA 1G6WA 2E0QA 2K8VA 3VWWA 3C73A 4JEDA 1OC9B 4PTSA 2KUCA 3QAWA 2BJXA 2LJAA 2HI7A 2HZEA 3G7IA 1JFUA 4ECCA 4CW9A 4YQVA 4P3YB 3GL3A 1T4YA 3QDNA 1PX6A 5G31A 3TKRA 3N5OA 2DIYA 3FY7A 3LORA 4E8HA 1ACVA 1FG4A 2FCHA 4E8EA 2GSRA 1BQ7A 2LJKA 1TRSA 4KA0A 3ZLPA 3F4RA 3CBUA 3MDKA 4HEA2 1VRSD 2B5XA 1TW9A 4LA1A 3M9KA 3TRQA 2O8VB 3HKRA 1XOAA 3DMLA 5GSSA 3KTBA 1TI3A 2K8SA 4X4JA 1QUWA 3GSTA 3GURA 2B7JA 5AISA 1M0UA 4QL9A 4MJBA 2ZNMA 1GULA 4G0LA 4KW6A 1ERUA 3F63A 4FYCA 1XWKA 4DSSB 1ABAA 4LMVA 3I69A 2NVLA 18GSA 19GSA 1MDJA 1EGRA 1I5GA 4K7NA 1YZXA 3QFAC 3UEMA 5FHIA 2CAIA 2TIRA 3F9UA 3TKPA 5JWOB 1E6BA 2AV4A 4XS4B 2HRNA 1YEPA 4G0IA 5J5NA 3VWXA 4GLTA 1YDKA 3FHKA 2F51A 4IP1A 4IELA 5IMAA 2YNXA 4AF2A 2ZCTA 4CY6A 2GQKA 4I6XA 1UC7A 1Z6MA 1PSQA 3A2XA 1LU4A 1F3AA 3ME7A 2XBIA 4WF5A 5DAKA 6GSTA 2R37A 3H79A 3O3TA 2OKAA 2YJ7A 5ABRA 3VI5A 3E9JB 1M2DA 1XW9A 1SK1A 1OC3A 2FNOA 2YJHA 2B5EA 5F0GA 5ECPB 1YKCA 4JR6A 4DSRA 3KD0A 3DGQA 4MZWA 4TR4A 2DIZA 3D6IA 1ML6A 2R0CA 3US3A 3EINA 4G0KA 3MIXA 1ZOFA 2H30A 4MCUA 3ZIJA 2RM5A 4IKHA 3VURA 2B7KA 3TJGA 2H01A 3LYPA 2LNSA 2EIRA 2B5YA 2AYTA 3DXBA 3VLNA 3BOAA 3GX8A 1JLWA 2ES7A 3EURA 4KDUA 5G5EA 4FYBA 1JZOA 1VF4A 1XVQA 1EZKA 3C8EA 2V1MA 2K18A 3D22A 1XW5A 2HSYA 2IMEA 5DAKB 1E2YA 3Q74A 5IPHA 2PMTA 3RAZA 1K0AA 3Q19A 4OWYA 5KN1A 2LKUA 1ERTA 1F3BA 4OFTA 5IO2A 1XCCA 4IP6A 3QPMA 2WS2A 5F06A 3UMAA 3N9JA 2UZ8A 5CP1A 1UA5A 1WIKA 2TRCP 1PGTA 3QCPA 4EVMA 1YKAA 2LNTA 2KLXA 5HR1A 4V2LA 2C8UA 5INYA 5C00A 4WR5A 2LV3A 2OE1A 3QR6A 4KGIA 3A3TA 2QSIA 4IN0A 3IRAA 5JCGA 2V6KA 4MJEA 5COHA 4POLA 2JL4A 5CRHA 2N5AA 2P5QA 2ON5A 5DCGA 3ZREA 4HSCX 4AJ7A 4ZB9A 3RHBA 3PGTA 4KCAA 1ZYPA 5B7CA 4JBBA 5DBQA 4KE3A 4KNDA 5H5RA 3L78A 4O92A 3A5WA 3F3RA 1A8LA 3UJ1A 4EDZA 3HY2A 1DSBA 3L9UA 2H76A 4F9ZA 3PPUA 5A4WA 3DWVA 3VI7A 1K3LA 2PVOC 4L8EA 4MA9A 2VCVA 5JCUA 1XFLA 5AIXA 4IW9A 1K0BA 2CQ9A 1OAZA 4Q5FA 1EEMA 1PX7A 2PGTA 1O73A 3L9SA 1EV9A 5G5FA 3GA4A 3CRUA 2ZUPA 3UAPA 2LJRA 4K0GA 3QFBC 5BMUA 5ECQB 1M9BA 2VL9A 2L57A 4X0XA 6GSUA 4ZXGA 3EC3A 1SENA 3P90A 1K0OA 1N8JA 2DJ1A 1JZWA 2WFCA 2X64A 1NHOA 1THXA 1XWCA 4K6XA 3MAKA 4YAPA 4CY8A 3I9V2 3EE2A 3IR4A 4I97A 1G0TA 1CQHA 4TVEA 2AJQB 2YZUA 5KEJA 4DVCA 4IHUA 3WGDA 1O7UA 2B6MA 1XWGA 4BPYA 5HR2A 3CXGA 2L4CA 4IJ3A 2LTKA 6GSVA 2IN3A 3W6GA 1K0MA 3A2VA 1MD4A 4ZBAA 1YJ6A 1FVJA 5A4VA 2O7KA 1K0NA 3QMXA 1PQNA 4EXJA 1OE8A 2VCTA 5J41A 5B8AA 1U87A 2OBIA 1EEJA 1K3OA 4IGJA 2JACA 4Z7XA 4HU7A 3AY8A 1O6JA 3HVXA 3RHCA 1Q98A 2K6VA 1Z7RA 1BAYA 2H66A 5ECHB 2ON7A 4RI7A 3SWLA 4BVXA 1PFOA 2H6ZA 3KZQA 1TK0B 3L9VA 2VO4A 5LNKe 1PMTA 1AQWA 4WBJA 4TKYA 5B6MA 1B4PA 1USBA 3FRCA 5DJMA 3EMXA 4ZIJA 1XWAA 1M3IA 3TKSE 2VCWA 4K0NA 2A2RA 5D73A 1AW9A 4POKA 4ZILA 2YV7A 4TR1A 2I81A 4ML6A 3KP8A 1O8WA 4Q5QA 2LQQA 2IJYA 4ECIA 3IBHA 2CAQA 2QKEA 1PL2A 3K8NA 2QA2A 3F3QA 4Q5RA 1SK2A 5IMZA 4ZL7A 4WF4A 4GSSA 2L59A 3W8JA 1C72A 1ZYEA 2C0FA 3ISOA 1FW1A 3C1SA 1KBNA 2RUEA 1TI1A 2X8CA 1BX9A 3CSJA 1V9WA 3TKSC 4BVXB 4V1Ap 2P0GA 3LGCA 2YCDA 3M1GA 1KNGA 2VCXA 3S9FA 3DRNA 5D8IA 4K1FA 1A23A 3KJYA 2C0DA 4K9ZA 4TW5A 1T3BA 2O89A 3LEFA 4GCIA 4HZ2A 1GSUA 1OC9A 4PQIA 4PQHA 3HDCA 10GSA 2OE0A 2DKHA 2LUSA 2OADA 3ZMLA 1ILOA 1DE2A 4NV5A 3FR9A 2EIQA 3KH7A 1SYXA 5G2ZA 3F4TA 4KSOA 2PVQA 4CHSA 4IQ1A 3F0IA 3D5JA 3HJOA 2FWHA 1SL1B 4N10A 1B4QA 2L6CA 2MYGA 3IAS2 3WT1A 3ZZXA 5GAND 4FQUA 2FUG2 3ERGA 3R3EA 3UVTA 3EPTA 1EWXA 1FOVA 1X5CA 2WRTA 2B3SA 4PNFA 3WYWA 4NHWA 4X1UA 4KH7A 4PQ1A 3HJMA 1Z9HA 4FO5A 2DLXA 6GSSA 3GKXA 3O6TA 2EC4A 4YQUA 4Z2RA 1J0FA 4OFMA 1XIYA 1EOHA 2PWJA 4G19A 4A5PA 1T00A 3CTFA 3GKKA 5ECRB 2VLTA 4DSSA 2CV4A 1F9MA 4HS1A 5AN1A 2REMA 4O5QA 1BYEA 3WT2A 4MH2A 3NIVA 4XS4A 4HZ4A 5ELAA 2YPMA 4NXIA 2H72A 2GZYA 3CSIA 2JADA 4USSA 3R2QA 3HCZA 3GKNA 5A5KA 3DKSA 2H71A 1SKWB 3IHGA 2WZ9A 2JU5A 2MMAA 5IOXA 1GSYA 3UL3A 1X9WB 3ED3A 1ON4A 4GSNA 1X9MB 2LSTA 4WEYA 3EVIA 4HOJA 1DBYA 3TJJA 1ZMAA 4EE0A 4MF5A 2H0GA 1N2AA 3TDGA 3OR5A 4GSTA 3PINA 3F8UA 1GSDA 4MK3A 4MF6A 2J23A 2HE3A 1WP0A 2H1DA 3GL5A 1GSFA 4BVYA 3CTGA 2VL2A 1J08A 1RK4A 3GV1A 4MABA 2RM6A 1OYJA 1TRWA 1URMA 2YP6A 3TOUA 2F3MA 2GSSA 3G7JA 4BL7B 3GTUB 4ICYA 4XHMA 5IQYA 1S3RA 2JSZA 1IYHA 2IIYA 2WULA 4ILFA 1J9BA 3KIJA 3QAGA 2FA8A 3IA1A 5DQSA 5G30A 2FWFA 5CO3A 1V58A 3FZ5A 3GH6A 2F9SA 3RDWA 1A24A 4PUAA 2K9FA 1BEDA 1H75A 1YEXA 3KTLA 1G6YA 2R3XA 3BBYA 2FHEA 5BRTA 1XOBA 3GKMA 2PBJA 1O81A 5EVOA 3RPNA 1SYRA 2HSMA 1ZZYA 3MYDA 1WOUA 2AUVA 1U3AA 2H6YA 2CVDA 1TU8A 4ZBDA 1T8EB 2DMLA 3EU3A 5ENUA 4XTSA 2QGVA 2FY6A 4K2XA 1ZCPA 3KH9A 4BVYB 2GZPA 1UVZA 4GXZA 4OO5A 3BCIA 3C1RA 1GUHA 1M99A 4O7HA 1WWJA 2OA7A 3G9BA 4D73B 2VUPA 3HZ8A 4WXTA 1THOA 4RQRA 1ZGNA 2WGRA 4K5RA 5IMDA 3IDVA 3TRPA 2V6OA 4OO4A 3TJFA 4AJ6A 5DJLA 1FVKA 3APOA 3VFIA 3EU4A 2KP1A 4OMVA 4F03A 2IWTA 2VD0A 4GWRA 1G7OA 1SKSB 3M8NA 6GSWA 2LRCA 1A2JA 2C0GA 4HJMA 1OKDA 2GSTA 5KN2A 5DVBA 1GSQA 3VWVA 1DUGA 2GGTA 1SD9A 4O5RA 3QOUA 5D96A 3TJBA 4N11A 3FEUA 3NZNA 4TXOA 20GSA 2R2JA 4OCEA 2DKIA 2N5BA 4ULXA 3LSZA 1GP1A 5JCWA 1K0DA 2GS3A 4IS0A 5J3RA 1SKRB 4HUAA 4XS1A 3RPPA 3CRTA 5L71A 4L5OA 2G2QA 1S3DA 1T1VA 4ZL9A 1TJDA 2XPEA 3HD5A 4FYUA 1ST9A 1AXDA 2HZFA 2CVBA 3GIXA 4L0UA 4K7IA 1M3JA 4MJCA 1TKDB 5CRWA 2B1LA 4NAXA 5IMCA 3CMIA 4GQCA 4JU5A 5IIZA 4QQ7A 1XWBA 1PKZA 2YANA 2H70A 3HVVA 1XPVA 2R6KA 2A2SA 5F05A 1W89A 1SD8A 4TXOB 2HRAA 3UBLA 4FH8A 2L6DA 4PUFC 2JZRA 3LW9A 4MZCA 5A4UA 2I1UA 1Z3EA 1PKWA 2IMDA 4XRDA 1GSEA 1GTBA 4N30A 1B9XC 1F37A 1OVNA 1V2AA 2VCZA 1GRXA 2O85A 5FT3A 4POBA 3DEXA 3DYRA 5HFGA 2IMKA 2PUKC 2X8HA 4RQXA 5CREA 3VPQA 4Q5NA 2VIMA 2YWOA 1S3AA 4EKZA 2VLVA 1EP7A 3L4NA 1A2LA 2TRXA 4YKGA 1KEBA 1GNEA 3IV4A 4MPGA 2LRTA 1WJKA 2M80A 4POMA 4J56E 1AAZA 3KCMA 5ECNB 1AIUA 2NBSA 3M0FA 3GYKA 2WCIA 5D9XA 3HJPA 2D2ZA 1M2BA 4LL4B
chains in the Genus database with same CATH topology
3C71A 3GNJA 5J4UA 2R4VA 4KAEA 3M3MA 3GX0A 17GSA 5IPGA 4O32A 1IYIA 1QQ2A 1SK0A 2GVPA 1NM3A 4ISDA 5AIVA 4F82A 4V2NA 5D9TA 2LQOA 2NPBA 3IK7A 1RQMA 1M2AA 1XW6A 5AGYA 2OJLA 3BJ5A 1TXXA 1BJXA 5IOWA 4TXVA 2H6XA 4EL1A 2XC2A 3FYGA 3IXRA 1FB0A 4ECJA 2B1KA 2H19A 3UVHA 2V2GA 1EOGA 4MPFA 1GWCA 4OCFA 1Q4JA 5GZZB 4KDXA 1PN0A 2X4AA 4K5SA 5KOXA 2M46A 2HLSA 2IMFA 4XS6A 5LCZA 2NDOA 3D4TA 1PL1A 4MMMA 2WDUA 2OACA 2WJUA 2CZ3A 2JZTA 1XZOA 5G1LA 4ID0A 3BCKA 2FWEA 2HFDA 2GZZA 1B48A 4MDCA 4MH3A 4J57E 1O85A 2FA4A 2PN8A 3TGZA 2MMZA 3ERFA 2RUFA 3WD6A 1K0CA 7GSSA 5DQYA 4LLRA 4KSMA 1SJ6A 4YKFA 1A2MA 2I4AA 3D4MA 2KHPA 4BWQA 3EWLA 2O87A 1FOHA 2P31A 2CA8A 4OFNA 1U6TA 1G7EA 3I43A 2A4VA 1Z7PA 2L5LA 2WB9A 4GF0A 4I5QA 2GQMA 2J9HA 3GH9A 1FB6A 3KP9A 3QAVA 2AHEA 2AB6A 3LFLA 1HD2A 3KMOA 5IMVA 4L5LA 3Q6OA 3IC8A 2GDRA 2LEGA 2YWMA 4EUYA 3LXZA 5KOWA 2E7PA 1AQVA 2C80A 5CAXA 3P2AA 1A0RP 2X99A 1SJZA 1GTUA 3Q18A 3ZIVA 2BMXA 3ZITA 2I3YA 4HU9A 1SL2B 3A5IA 4GQFA 1F2EA 3E0UA 3PR8A 1UN2A 2IMIA 1X9SB 3TKQA 2MBSA 1ZYNA 1FO5A 3VPTA 3P7XA 3J7Yb 4MJAA 2H73A 1U88A 4BL7A 2C3NA 5LD0A 1WPIA 1A8YA 3GTUA 2C1YA 4PGTA 1U3IA 1VGLA 1V40A 4G2EA 3RBTA 1JZRA 3WGXA 4TOPA 8GSSA 1X0RA 5ELGA 5EPFA 4PXOA 2E2GA 2QC7A 3APSA 3TUEA 4EC0A 1JHBA 4PNGA 2R0PA 3ZVJA 3I6AA 1M9AA 2YOIA 1MEKA 2DJ3A 4NMUA 2DJ2A 3KMNA 4WR4A 3JCML 5E4WA 2IFQA 5FWGA 1HNBA 3G7YA 2YN1A 5DDLA 2HSHA 1QMVA 1XBSA 3H93A 1ERWA 4ZB8A 3ZTLA 4MNNA 3IC4A 5F8BA 5GSTA 5JWRB 1Y25A 2QA1A 1LJRA 2GQLA 4EIPA 4WKWA 3FZ4A 1B9YC 3EYTA 1R26A 2DJ0A 1X5DA 2X49A 3ZFLA 2X8GA 4D73A 4AJ8A 2RIIA 3UIWA 3GFKA 2CVKA 5CRGA 4N0VA 5IO0A 3LXTA 5H5QA 1TOFA 2VAFA 2DBCA 4ML1A 4NHZA 3LJRA 1ERVA 2VM1A 3ERWA 4QL7A 3PH9A 2HRFA 2HZEB 2VLUA 2OE3A 1MDIA 2JSYA 3APQA 2H75A 4GRFA 3TRXA 2M72A 3TKSA 2F8FA 2VCQA 3P8WA 4NWYA 2IFQB 3FMWA 4IJIA 2H1AA 1HQOA 4RI6A 5DCHA 3IE3A 5IMFA 3U5RE 4LMWA 5KN3A 2YV9A 2FLSA 1SJIA 1TDIA 4RUVA 3EMPA 4IQAA 3D21A 1OKTA 5ECKB 2A2PA 2VL3A 4V1Ag 3QD9A 4KB3A 2NTOA 5CNWA 2DMMA 2HYXA 4MZBA 3MSZA 4I8BA 2CX4A 4G9HA 2GT5A 12GSA 4PX1A 4DEJA 14GSA 2MZCA 3FK8A 3FR3A 5D9WA 2LRNA 2N5FA 3GMFA 1KTEA 5JWQB 13GSA 1YQ1A 2DJJA 6GSXA 1T7PB 4ACSA 1K3YA 2KOKA 3HXSA 4TR3A 3UOMA 1EGOA 5EY6A 1WRYA 2XBQA 2HRKA 4HDEA 5ECIB 1PN9A 3F6DA 2KP2A 1OC8A 1TRUA 4EF0A 6GSYA 1F6MC 5G1KA 5DALA 2LS5A 1AQXA 2C4JA 1S3CA 3V1WA 4BWSA 3C7MA 5CYYA 3ZRDA 4HQSA 3FZAA 1PA3A 3KEBA 4CDOA 1LBKA 2DJKA 1PRXA 1NW2A 1JZDA 1QK8A 4YH2A 1HYUA 4JRRA 4NPBA 2JZSA 1NSWA 5CRDA 3F6FA 1R5PA 1SU9A 2VM2A 3FW2A 2HNLA 3CSHA 2Z9SA 4JZQA 3M9JA 4XRAA 1YF0A 4HJ2A 4H86A 1R7HA 2H0IA 4MP4A 1AUCA 3LG6A 1GNWA 3F4SA 2R0GA 2VD1A 5HR3A 1GTIA 4K8MA 4HI7A 2OBKA 2FGXA 5J9CA 1GH2A 2IL3A 3HYPA 4WETA 2XPDA 1GLQA 5D93A 1H4OA 5DALB 1XXUA 4N0ZA 4EDYA 1WE0A 4Z2UA 2AAWA 1ZL9A 4I2UA 2DC5A 4F0CA 3CYNA 3W8SA 2HXKA 1QXHA 1QGVA 3ZMKA 2YZHA 3U6VA 1TU7A 1MD3A 4XCSA 1R4WA 3SBCA 4G10A 1CQGA 3A2WA 1V98A 1X5EA 3DD3A 1JLVA 4Z2TA 4EIQA 2H74A 4WBRD 3IAM2 2P5RA 4K2DA 4XIHA 1EP8A 1GL8A 1TK5B 4I2TA 1VF3A 1Z6NA 4IBPA 2PERA 3MNGA 2R5GA 3ZYWA 4F2IA 3ME8A 4IVFA 5ECOB 3GUSA 3KM6A 3IK9A 5F07A 5GAPD 3DIEA 5B6NA 4F0BA 5HFKA 4ECBA 3H4KA 3FKFA 2A4HA 5EL8A 9GSSA 2V32A 3HZ4A 5ID2A 1HNCA 5KN0A 1AC1A 5ECMB 2CZ2A 1GSSA 2RLIA 2YWNA 5IM9A 3LYKA 3TB2A 5ECSA 1GLPA 2CX3A 4J2FA 4MF7A 1I9DA 4KUNA 1PD21 3GN3A 4KX4A 5C04A 5J9BA 4HQZA 1TK8B 1GUKA 2FWGA 4TR0A 4YAVA 5D9VA 4X43A 1A0FA 3KXOA 3LQ7A 1TTZA 3J7Yk 1O8XA 2CT6A 4O5UA 1ZYQB 3GRXA 3O76A 3HHVA 3UARA 3LWAA 1VF2A 1WMJA 5HQPA 2H1BA 3NOFA 3H8QA 1V57A 4DSQA 2VL2C 1MTCA 5E59A 2PU9C 1RW1A 1XVWA 22GSA 2IPAA 1T4ZA 5ID2B 1QFNA 3TJKA 4KCEA 3D0ZA 4YQMA 2PPTA 3DVWA 4JE1A 3UBKA 3ZFBA 3ZVJD 1BG5A 2FD3A 1W4VA 1FAAA 3WGEA 16GSA 2H1GA 4TRXA 1YY7A 2EIOA 2G0FA 4AGSA 1NHYA 2F8AA 1Y6EA 1HNAA 1SL0B 3FR6A 4ZBBA 3HA9A 2I9HA 5H5SA 1R5AA 3H1NA 3VWUA 1DE1A 3VK9A 4EO3A 4JR4A 1MDKA 4L0WA 1FHEA 2DSAA 2C3QA 3IOSA 1TP9A 2C3TA 4GTUA 3BD2A 2GTUA 1YF1A 1Z5YE 1GTAA 4BA7A 1EV4A 2GT6A 4KF9A 3FZ9A 3HVSA 3IPZA 3E3EA 5ECLB 3GHAA 4LL1B 1VF1A 3TCOA 4TR1B 2E2MA 4KDYA 4MLYA 4TN8A 4FIWA 2V41A 5B8BA 3DVXA 2H8LA 2VOCA 3TOTA 2HT9A 2MMNA 4ZB6A 2XHFA 3IHQA 2BTOT 2MBTA 2L4QA 3ZL5A 1B8XA 2YWIA 3MWHA 1GUMA 2GSQA 2H0HA 2MMOA 2L5OA 4V2MA 4PURA 4NV2A 11GSA 1TRVA 1OE7A 4OD7A 5HR0A 3KGKA 2ALBA 2C0EA 5HFIA 3GSSA 1M7TA 4ZL8A 3L0HA 2GLRA 4K7OA 1G6WA 2E0QA 2K8VA 3VWWA 3C73A 4JEDA 1OC9B 4PTSA 2KUCA 3QAWA 2BJXA 2LJAA 2HI7A 2HZEA 3G7IA 1JFUA 4ECCA 4CW9A 4YQVA 4P3YB 3GL3A 1T4YA 3QDNA 1PX6A 5G31A 3TKRA 3N5OA 2DIYA 3FY7A 3LORA 4E8HA 1ACVA 1FG4A 2FCHA 4E8EA 2GSRA 1BQ7A 2LJKA 1TRSA 4KA0A 3ZLPA 3F4RA 3CBUA 3MDKA 4HEA2 1VRSD 2B5XA 1TW9A 4LA1A 3M9KA 3TRQA 2O8VB 3HKRA 1XOAA 3DMLA 5GSSA 3KTBA 1TI3A 2K8SA 4X4JA 1QUWA 3GSTA 3GURA 2B7JA 5AISA 1M0UA 4QL9A 4MJBA 2ZNMA 1GULA 4G0LA 4KW6A 1ERUA 3F63A 4FYCA 1XWKA 4DSSB 1ABAA 4LMVA 3I69A 2NVLA 18GSA 19GSA 1MDJA 1EGRA 1I5GA 4K7NA 1YZXA 3QFAC 3UEMA 5FHIA 2CAIA 2TIRA 3F9UA 3TKPA 5JWOB 1E6BA 2AV4A 4XS4B 2HRNA 1YEPA 4G0IA 5J5NA 3VWXA 4GLTA 1YDKA 3FHKA 2F51A 4IP1A 4IELA 5IMAA 2YNXA 4AF2A 2ZCTA 4CY6A 2GQKA 4I6XA 1UC7A 1Z6MA 1PSQA 3A2XA 1LU4A 1F3AA 3ME7A 2XBIA 4WF5A 5DAKA 6GSTA 2R37A 3H79A 3O3TA 2OKAA 2YJ7A 5ABRA 3VI5A 3E9JB 1M2DA 1XW9A 1SK1A 1OC3A 2FNOA 2YJHA 2B5EA 5F0GA 5ECPB 1YKCA 4JR6A 4DSRA 3KD0A 3DGQA 4MZWA 4TR4A 2DIZA 3D6IA 1ML6A 2R0CA 3US3A 3EINA 4G0KA 3MIXA 1ZOFA 2H30A 4MCUA 3ZIJA 2RM5A 4IKHA 3VURA 2B7KA 3TJGA 2H01A 3LYPA 2LNSA 2EIRA 2B5YA 2AYTA 3DXBA 3VLNA 3BOAA 3GX8A 1JLWA 2ES7A 3EURA 4KDUA 5G5EA 4FYBA 1JZOA 1VF4A 1XVQA 1EZKA 3C8EA 2V1MA 2K18A 3D22A 1XW5A 2HSYA 2IMEA 5DAKB 1E2YA 3Q74A 5IPHA 2PMTA 3RAZA 1K0AA 3Q19A 4OWYA 5KN1A 2LKUA 1ERTA 1F3BA 4OFTA 5IO2A 1XCCA 4IP6A 3QPMA 2WS2A 5F06A 3UMAA 3N9JA 2UZ8A 5CP1A 1UA5A 1WIKA 2TRCP 1PGTA 3QCPA 4EVMA 1YKAA 2LNTA 2KLXA 5HR1A 4V2LA 2C8UA 5INYA 5C00A 4WR5A 2LV3A 2OE1A 3QR6A 4KGIA 3A3TA 2QSIA 4IN0A 3IRAA 5JCGA 2V6KA 4MJEA 5COHA 4POLA 2JL4A 5CRHA 2N5AA 2P5QA 2ON5A 5DCGA 3ZREA 4AJ7A 4ZB9A 3RHBA 3PGTA 4KCAA 1ZYPA 5B7CA 4JBBA 5DBQA 4KE3A 4KNDA 5H5RA 3L78A 4O92A 3A5WA 3F3RA 1A8LA 3UJ1A 4EDZA 3HY2A 1DSBA 3L9UA 2H76A 4F9ZA 3PPUA 5A4WA 3DWVA 3VI7A 1K3LA 2PVOC 4L8EA 4MA9A 2VCVA 5JCUA 1XFLA 5AIXA 4IW9A 1K0BA 2CQ9A 1OAZA 4Q5FA 1EEMA 1PX7A 2PGTA 1O73A 3L9SA 1EV9A 5G5FA 3GA4A 3CRUA 2ZUPA 3UAPA 2LJRA 4K0GA 3QFBC 5BMUA 5ECQB 1M9BA 2VL9A 2L57A 4X0XA 6GSUA 4ZXGA 3EC3A 1SENA 3P90A 1K0OA 1N8JA 2DJ1A 1JZWA 2WFCA 2X64A 1NHOA 1THXA 1XWCA 4K6XA 3MAKA 4YAPA 4CY8A 3I9V2 3EE2A 3IR4A 4I97A 1G0TA 1CQHA 4TVEA 2AJQB 2YZUA 5KEJA 4DVCA 4IHUA 3WGDA 1O7UA 2B6MA 1XWGA 4BPYA 5HR2A 3CXGA 2L4CA 4IJ3A 2LTKA 6GSVA 2IN3A 3W6GA 1K0MA 3A2VA 1MD4A 4ZBAA 1YJ6A 1FVJA 5A4VA 2O7KA 1K0NA 3QMXA 1PQNA 4EXJA 1OE8A 2VCTA 5J41A 5B8AA 1U87A 2OBIA 1EEJA 1K3OA 4IGJA 2JACA 4Z7XA 4HU7A 3AY8A 1O6JA 3HVXA 3RHCA 1Q98A 2K6VA 1Z7RA 1BAYA 2H66A 5ECHB 2ON7A 4RI7A 3SWLA 4BVXA 2H6ZA 3KZQA 1TK0B 3L9VA 2VO4A 5LNKe 1PMTA 1AQWA 4WBJA 4TKYA 5B6MA 1B4PA 1USBA 3FRCA 5DJMA 3EMXA 4ZIJA 1XWAA 3TKSE 2VCWA 4K0NA 2A2RA 5D73A 1AW9A 4POKA 4ZILA 2YV7A 4TR1A 2I81A 4ML6A 3KP8A 1O8WA 4Q5QA 2LQQA 2IJYA 4ECIA 3IBHA 2CAQA 2QKEA 1PL2A 3K8NA 2QA2A 3F3QA 4Q5RA 1SK2A 5IMZA 4ZL7A 4WF4A 4GSSA 2L59A 3W8JA 1C72A 1ZYEA 2C0FA 3ISOA 1FW1A 3C1SA 1KBNA 2RUEA 1TI1A 2X8CA 1BX9A 3CSJA 1V9WA 3TKSC 4BVXB 4V1Ap 2P0GA 3LGCA 2YCDA 3M1GA 1KNGA 2VCXA 3S9FA 3DRNA 5D8IA 4K1FA 1A23A 3KJYA 2C0DA 4K9ZA 4TW5A 1T3BA 2O89A 3LEFA 4GCIA 4HZ2A 1GSUA 1OC9A 4PQIA 4PQHA 3HDCA 10GSA 2OE0A 2DKHA 2LUSA 2OADA 3ZMLA 1ILOA 1DE2A 4NV5A 3FR9A 2EIQA 3KH7A 1SYXA 5G2ZA 3F4TA 4KSOA 2PVQA 4CHSA 4IQ1A 3F0IA 3D5JA 3HJOA 2FWHA 1SL1B 4N10A 1B4QA 2L6CA 2MYGA 3IAS2 3WT1A 3ZZXA 5GAND 4FQUA 2FUG2 3ERGA 3R3EA 3UVTA 3EPTA 1EWXA 1FOVA 1X5CA 2WRTA 2B3SA 4PNFA 3WYWA 4NHWA 4X1UA 4KH7A 4PQ1A 3HJMA 1Z9HA 4FO5A 2DLXA 6GSSA 3GKXA 3O6TA 2EC4A 4YQUA 4Z2RA 1J0FA 4OFMA 1XIYA 1EOHA 2PWJA 4G19A 4A5PA 1T00A 3CTFA 3GKKA 5ECRB 2VLTA 4DSSA 2CV4A 1F9MA 4HS1A 5AN1A 2REMA 4O5QA 1BYEA 3WT2A 4MH2A 3NIVA 4XS4A 4HZ4A 5ELAA 2YPMA 4NXIA 2H72A 2GZYA 3CSIA 2JADA 4USSA 3R2QA 3HCZA 3GKNA 5A5KA 3DKSA 2H71A 1SKWB 3IHGA 2WZ9A 2JU5A 2MMAA 5IOXA 1GSYA 3UL3A 1X9WB 3ED3A 1ON4A 4GSNA 1X9MB 2LSTA 4WEYA 3EVIA 4HOJA 1DBYA 3TJJA 1ZMAA 4EE0A 4MF5A 2H0GA 1N2AA 3TDGA 3OR5A 4GSTA 3PINA 3F8UA 1GSDA 4MK3A 4MF6A 2J23A 2HE3A 1WP0A 2H1DA 3GL5A 1GSFA 4BVYA 3CTGA 2VL2A 1J08A 1RK4A 3GV1A 4MABA 2RM6A 1OYJA 1TRWA 1URMA 2YP6A 3TOUA 2F3MA 2GSSA 3G7JA 4BL7B 3GTUB 4ICYA 4XHMA 5IQYA 2JSZA 1IYHA 2IIYA 2WULA 4ILFA 1J9BA 3KIJA 3QAGA 2FA8A 3IA1A 5DQSA 5G30A 2FWFA 5CO3A 1V58A 3FZ5A 3GH6A 2F9SA 3RDWA 1A24A 4PUAA 2K9FA 1BEDA 1H75A 1YEXA 3KTLA 1G6YA 2R3XA 3BBYA 2FHEA 5BRTA 1XOBA 3GKMA 2PBJA 1O81A 5EVOA 3RPNA 1SYRA 2HSMA 1ZZYA 3MYDA 1WOUA 2AUVA 1U3AA 2H6YA 2CVDA 1TU8A 4ZBDA 1T8EB 2DMLA 3EU3A 5ENUA 4XTSA 2QGVA 2FY6A 4K2XA 1ZCPA 3KH9A 4BVYB 2GZPA 1UVZA 4GXZA 4OO5A 3BCIA 3C1RA 1GUHA 1M99A 4O7HA 1WWJA 2OA7A 3G9BA 4D73B 2VUPA 3HZ8A 4WXTA 1THOA 4RQRA 1ZGNA 2WGRA 4K5RA 5IMDA 3IDVA 3TRPA 2V6OA 4OO4A 3TJFA 4AJ6A 5DJLA 1FVKA 3APOA 3VFIA 3EU4A 2KP1A 4OMVA 4F03A 2IWTA 2VD0A 4GWRA 1G7OA 1SKSB 3M8NA 6GSWA 2LRCA 1A2JA 2C0GA 4HJMA 1OKDA 2GSTA 5KN2A 5DVBA 1GSQA 3VWVA 1DUGA 2GGTA 1SD9A 4O5RA 3QOUA 5D96A 3TJBA 4N11A 3FEUA 3NZNA 4TXOA 20GSA 2R2JA 4OCEA 2DKIA 2N5BA 4ULXA 3LSZA 1GP1A 5JCWA 1K0DA 2GS3A 4IS0A 5J3RA 1SKRB 4HUAA 4XS1A 3RPPA 3CRTA 5L71A 4L5OA 2G2QA 1S3DA 1T1VA 4ZL9A 1TJDA 2XPEA 3HD5A 4FYUA 1ST9A 1AXDA 2HZFA 2CVBA 3GIXA 4L0UA 4K7IA 4MJCA 1TKDB 5CRWA 2B1LA 4NAXA 5IMCA 3CMIA 4GQCA 4JU5A 5IIZA 4QQ7A 1XWBA 1PKZA 2YANA 2H70A 3HVVA 1XPVA 2R6KA 2A2SA 5F05A 1W89A 1SD8A 4TXOB 2HRAA 3UBLA 4FH8A 2L6DA 4PUFC 2JZRA 3LW9A 4MZCA 5A4UA 2I1UA 1Z3EA 1PKWA 2IMDA 4XRDA 1GSEA 1GTBA 4N30A 1B9XC 1F37A 1OVNA 1V2AA 2VCZA 1GRXA 2O85A 5FT3A 4POBA 3DEXA 3DYRA 5HFGA 2IMKA 2PUKC 2X8HA 4RQXA 5CREA 3VPQA 4Q5NA 2VIMA 2YWOA 1S3AA 4EKZA 2VLVA 1EP7A 3L4NA 1A2LA 2TRXA 4YKGA 1KEBA 1GNEA 3IV4A 4MPGA 2LRTA 1WJKA 2M80A 4POMA 4J56E 1AAZA 3KCMA 5ECNB 1AIUA 2NBSA 3M0FA 3GYKA 2WCIA 5D9XA 3HJPA 2D2ZA 1M2BA 4LL4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C71 A;  3GNJ A;  5J4U A;  2R4V A;  4KAE A;  3M3M A;  3GX0 A;  17GS A;  5IPG A;  4O32 A;  1IYI A;  1QQ2 A;  1SK0 A;  2GVP A;  1NM3 A;  4ISD A;  5AIV A;  4F82 A;  4V2N A;  5D9T A;  2LQO A;  2NPB A;  3IK7 A;  1RQM A;  1M2A A;  1XW6 A;  5AGY A;  2OJL A;  3BJ5 A;  1TXX A;  1BJX A;  5IOW A;  4TXV A;  2H6X A;  4EL1 A;  2XC2 A;  3FYG A;  3IXR A;  1FB0 A;  4ECJ A;  2B1K A;  2H19 A;  3UVH A;  2V2G A;  1EOG A;  4MPF A;  1GWC A;  4OCF A;  1Q4J A;  5GZZ B;  4KDX A;  2M46 A;  2HLS A;  2IMF A;  4XS6 A;  5LCZ A;  2NDO A;  3D4T A;  1PL1 A;  4MMM A;  2WDU A;  2OAC A;  2WJU A;  2CZ3 A;  2JZT A;  1XZO A;  5G1L A;  4ID0 A;  3BCK A;  2FWE A;  2HFD A;  2GZZ A;  1B48 A;  4MDC A;  4MH3 A;  4J57 E;  1O85 A;  2FA4 A;  2PN8 A;  3TGZ A;  2MMZ A;  3ERF A;  2RUF A;  3WD6 A;  1K0C A;  7GSS A;  5DQY A;  4LLR A;  4KSM A;  1SJ6 A;  1A2M A;  2I4A A;  3D4M A;  2KHP A;  4BWQ A;  3EWL A;  2O87 A;  2P31 A;  2CA8 A;  4OFN A;  1U6T A;  1G7E A;  3I43 A;  2A4V A;  1Z7P A;  2L5L A;  2WB9 A;  4GF0 A;  4I5Q A;  2GQM A;  2J9H A;  3GH9 A;  1FB6 A;  3KP9 A;  3QAV A;  2AHE A;  2AB6 A;  3LFL A;  1HD2 A;  3KMO A;  5IMV A;  4L5L A;  3Q6O A;  2GDR A;  2LEG A;  2YWM A;  4EUY A;  3LXZ A;  2E7P A;  1AQV A;  2C80 A;  5CAX A;  3P2A A;  1A0R P;  2X99 A;  1SJZ A;  1GTU A;  3Q18 A;  3ZIV A;  2BMX A;  3ZIT A;  2I3Y A;  4HU9 A;  1SL2 B;  4GQF A;  1F2E A;  3E0U A;  3PR8 A;  1UN2 A;  2IMI A;  1X9S B;  3TKQ A;  2MBS A;  1FO5 A;  3VPT A;  3P7X A;  3J7Y b;  4MJA A;  2H73 A;  1U88 A;  4BL7 A;  2C3N A;  5LD0 A;  1WPI A;  1A8Y A;  3GTU A;  2C1Y A;  4PGT A;  1U3I A;  1VGL A;  1V40 A;  4G2E A;  3RBT A;  1JZR A;  3WGX A;  4TOP A;  8GSS A;  1X0R A;  5ELG A;  5EPF A;  4PXO A;  2E2G A;  2QC7 A;  3APS A;  3TUE A;  4EC0 A;  1JHB A;  4PNG A;  3ZVJ A;  3I6A A;  1M9A A;  2YOI A;  1MEK A;  2DJ3 A;  4NMU A;  2DJ2 A;  3KMN A;  4WR4 A;  3JCM L;  5E4W A;  2IFQ A;  5FWG A;  1HNB A;  3G7Y A;  2YN1 A;  5DDL A;  2HSH A;  1QMV A;  1XBS A;  3H93 A;  1ERW A;  4ZB8 A;  3ZTL A;  3IC4 A;  5F8B A;  5GST A;  5JWR B;  1Y25 A;  1LJR A;  2GQL A;  4WKW A;  3FZ4 A;  1B9Y C;  3EYT A;  1R26 A;  2DJ0 A;  1X5D A;  3ZFL A;  2X8G A;  4D73 A;  4AJ8 A;  2RII A;  3UIW A;  3GFK A;  2CVK A;  5CRG A;  4N0V A;  5IO0 A;  3LXT A;  5H5Q A;  1TOF A;  2VAF A;  2DBC A;  4ML1 A;  4NHZ A;  3LJR A;  1ERV A;  2VM1 A;  3ERW A;  4QL7 A;  3PH9 A;  2HRF A;  2HZE B;  2VLU A;  2OE3 A;  1MDI A;  2JSY A;  3APQ A;  2H75 A;  4GRF A;  3TRX A;  2M72 A;  3TKS A;  2F8F A;  2VCQ A;  3P8W A;  4NWY A;  2IFQ B;  4IJI A;  2H1A A;  1HQO A;  4RI6 A;  5DCH A;  3IE3 A;  5IMF A;  3U5R E;  4LMW A;  5KN3 A;  2YV9 A;  2FLS A;  1SJI A;  1TDI A;  4RUV A;  3EMP A;  4IQA A;  3D21 A;  1OKT A;  5ECK B;  2VL3 A;  4V1A g;  3QD9 A;  4KB3 A;  2NTO A;  5CNW A;  2DMM A;  2HYX A;  4MZB A;  3MSZ A;  4I8B A;  2CX4 A;  4G9H A;  2GT5 A;  12GS A;  4PX1 A;  4DEJ A;  14GS A;  2MZC A;  3FK8 A;  3FR3 A;  5D9W A;  2LRN A;  2N5F A;  3GMF A;  1KTE A;  5JWQ B;  13GS A;  1YQ1 A;  2DJJ A;  6GSX A;  1T7P B;  4ACS A;  1K3Y A;  2KOK A;  3HXS A;  4TR3 A;  3UOM A;  1EGO A;  5EY6 A;  1WRY A;  2XBQ A;  4HDE A;  5ECI B;  1PN9 A;  3F6D A;  2KP2 A;  1OC8 A;  1TRU A;  4EF0 A;  6GSY A;  1F6M C;  5G1K A;  5DAL A;  2LS5 A;  1AQX A;  2C4J A;  1S3C A;  3V1W A;  4BWS A;  3C7M A;  5CYY A;  3ZRD A;  4HQS A;  3FZA A;  1PA3 A;  3KEB A;  4CDO A;  1LBK A;  2DJK A;  1PRX A;  1NW2 A;  1JZD A;  1QK8 A;  4YH2 A;  1HYU A;  4JRR A;  4NPB A;  2JZS A;  1NSW A;  5CRD A;  3F6F A;  1R5P A;  1SU9 A;  2VM2 A;  3FW2 A;  2HNL A;  3CSH A;  2Z9S A;  4JZQ A;  3M9J A;  4XRA A;  1YF0 A;  4HJ2 A;  4H86 A;  1R7H A;  2H0I A;  4MP4 A;  1AUC A;  3LG6 A;  1GNW A;  3F4S A;  2VD1 A;  5HR3 A;  1GTI A;  4K8M A;  4HI7 A;  2OBK A;  2FGX A;  5J9C A;  1GH2 A;  2IL3 A;  3HYP A;  4WET A;  2XPD A;  1GLQ A;  5D93 A;  1H4O A;  5DAL B;  1XXU A;  4N0Z A;  4EDY A;  1WE0 A;  2AAW A;  1ZL9 A;  4I2U A;  2DC5 A;  4F0C A;  3CYN A;  3W8S A;  2HXK A;  1QXH A;  1QGV A;  3ZMK A;  2YZH A;  3U6V A;  1TU7 A;  1MD3 A;  4XCS A;  1R4W A;  3SBC A;  4G10 A;  1CQG A;  3A2W A;  1V98 A;  1X5E A;  3DD3 A;  1JLV A;  2H74 A;  4WBR D;  3IAM 2;  2P5R A;  4K2D A;  4XIH A;  1EP8 A;  1GL8 A;  1TK5 B;  4I2T A;  1VF3 A;  1Z6N A;  4IBP A;  2PER A;  3MNG A;  2R5G A;  3ZYW A;  4F2I A;  3ME8 A;  4IVF A;  5ECO B;  3GUS A;  3KM6 A;  3IK9 A;  5F07 A;  5GAP D;  3DIE A;  5B6N A;  4F0B A;  5HFK A;  4ECB A;  3H4K A;  3FKF A;  5EL8 A;  9GSS A;  2V32 A;  3HZ4 A;  5ID2 A;  1HNC A;  5KN0 A;  1AC1 A;  5ECM B;  2CZ2 A;  1GSS A;  2RLI A;  2YWN A;  5IM9 A;  3LYK A;  3TB2 A;  5ECS A;  1GLP A;  2CX3 A;  4J2F A;  4MF7 A;  1I9D A;  4KUN A;  1PD2 1;  3GN3 A;  4KX4 A;  5C04 A;  5J9B A;  4HQZ A;  1TK8 B;  1GUK A;  2FWG A;  4TR0 A;  4YAV A;  5D9V A;  4X43 A;  1A0F A;  3KXO A;  3LQ7 A;  1TTZ A;  3J7Y k;  1O8X A;  2CT6 A;  1ZYQ B;  3GRX A;  3O76 A;  3HHV A;  3UAR A;  3LWA A;  1VF2 A;  1WMJ A;  5HQP A;  2H1B A;  3NOF A;  3H8Q A;  1V57 A;  4DSQ A;  2VL2 C;  1MTC A;  5E59 A;  2PU9 C;  1RW1 A;  1XVW A;  22GS A;  2IPA A;  1T4Z A;  5ID2 B;  1QFN A;  3TJK A;  4KCE A;  3D0Z A;  4YQM A;  2PPT A;  3DVW A;  4JE1 A;  3UBK A;  3ZFB A;  3ZVJ D;  1BG5 A;  2FD3 A;  1W4V A;  1FAA A;  3WGE A;  16GS A;  2H1G A;  4TRX A;  1YY7 A;  2EIO A;  2G0F A;  4AGS A;  1NHY A;  2F8A A;  1Y6E A;  1HNA A;  1SL0 B;  3FR6 A;  4ZBB A;  3HA9 A;  2I9H A;  5H5S A;  1R5A A;  3H1N A;  3VWU A;  1DE1 A;  3VK9 A;  4EO3 A;  4JR4 A;  1MDK A;  4L0W A;  1FHE A;  2DSA A;  2C3Q A;  3IOS A;  1TP9 A;  2C3T A;  4GTU A;  3BD2 A;  2GTU A;  1YF1 A;  1Z5Y E;  1GTA A;  4BA7 A;  1EV4 A;  2GT6 A;  3FZ9 A;  3HVS A;  3IPZ A;  3E3E A;  5ECL B;  3GHA A;  4LL1 B;  1VF1 A;  3TCO A;  4TR1 B;  2E2M A;  4KDY A;  4MLY A;  4TN8 A;  4FIW A;  2V41 A;  5B8B A;  3DVX A;  2H8L A;  2VOC A;  3TOT A;  2HT9 A;  2MMN A;  4ZB6 A;  2XHF A;  3IHQ A;  2BTO T;  2MBT A;  2L4Q A;  3ZL5 A;  1B8X A;  2YWI A;  3MWH A;  1GUM A;  2GSQ A;  2H0H A;  2MMO A;  2L5O A;  4V2M A;  4PUR A;  4NV2 A;  11GS A;  1TRV A;  1OE7 A;  4OD7 A;  5HR0 A;  3KGK A;  2ALB A;  2C0E A;  5HFI A;  3GSS A;  1M7T A;  4ZL8 A;  3L0H A;  2GLR A;  4K7O A;  1G6W A;  2E0Q A;  2K8V A;  3VWW A;  3C73 A;  4JED A;  1OC9 B;  2KUC A;  3QAW A;  2BJX A;  2LJA A;  2HI7 A;  2HZE A;  3G7I A;  1JFU A;  4ECC A;  4CW9 A;  4YQV A;  4P3Y B;  3GL3 A;  1T4Y A;  3QDN A;  1PX6 A;  5G31 A;  3TKR A;  3N5O A;  2DIY A;  3FY7 A;  3LOR A;  4E8H A;  1ACV A;  1FG4 A;  2FCH A;  4E8E A;  2GSR A;  1BQ7 A;  2LJK A;  1TRS A;  4KA0 A;  3ZLP A;  3F4R A;  3CBU A;  3MDK A;  4HEA 2;  1VRS D;  2B5X A;  1TW9 A;  4LA1 A;  3M9K A;  3TRQ A;  2O8V B;  3HKR A;  1XOA A;  3DML A;  5GSS A;  3KTB A;  1TI3 A;  2K8S A;  1QUW A;  3GST A;  3GUR A;  2B7J A;  5AIS A;  1M0U A;  4QL9 A;  4MJB A;  2ZNM A;  1GUL A;  4KW6 A;  1ERU A;  3F63 A;  4FYC A;  1XWK A;  4DSS B;  1ABA A;  4LMV A;  3I69 A;  2NVL A;  18GS A;  19GS A;  1MDJ A;  1EGR A;  1I5G A;  4K7N A;  1YZX A;  3QFA C;  3UEM A;  5FHI A;  2CAI A;  2TIR A;  3F9U A;  3TKP A;  5JWO B;  1E6B A;  2AV4 A;  4XS4 B;  2HRN A;  1YEP A;  5J5N A;  3VWX A;  4GLT A;  1YDK A;  3FHK A;  2F51 A;  4IP1 A;  4IEL A;  5IMA A;  2YNX A;  4AF2 A;  2ZCT A;  2GQK A;  4I6X A;  1UC7 A;  1Z6M A;  1PSQ A;  3A2X A;  1LU4 A;  1F3A A;  3ME7 A;  2XBI A;  4WF5 A;  5DAK A;  6GST A;  2R37 A;  3H79 A;  3O3T A;  2OKA A;  2YJ7 A;  5ABR A;  3VI5 A;  3E9J B;  1M2D A;  1XW9 A;  1SK1 A;  1OC3 A;  2FNO A;  2YJH A;  2B5E A;  5F0G A;  5ECP B;  1YKC A;  4JR6 A;  4DSR A;  3KD0 A;  3DGQ A;  4MZW A;  4TR4 A;  2DIZ A;  3D6I A;  1ML6 A;  3US3 A;  3EIN A;  1ZOF A;  2H30 A;  4MCU A;  3ZIJ A;  2RM5 A;  4IKH A;  3VUR A;  2B7K A;  3TJG A;  2H01 A;  3LYP A;  2LNS A;  2EIR A;  2B5Y A;  2AYT A;  3DXB A;  3VLN A;  3BOA A;  3GX8 A;  1JLW A;  2ES7 A;  3EUR A;  4KDU A;  5G5E A;  4FYB A;  1JZO A;  1VF4 A;  1XVQ A;  1EZK A;  3C8E A;  2V1M A;  2K18 A;  3D22 A;  1XW5 A;  2HSY A;  2IME A;  5DAK B;  1E2Y A;  3Q74 A;  5IPH A;  2PMT A;  3RAZ A;  1K0A A;  3Q19 A;  4OWY A;  5KN1 A;  2LKU A;  1ERT A;  1F3B A;  4OFT A;  5IO2 A;  1XCC A;  4IP6 A;  3QPM A;  2WS2 A;  5F06 A;  3UMA A;  3N9J A;  5CP1 A;  1UA5 A;  1WIK A;  2TRC P;  1PGT A;  3QCP A;  4EVM A;  1YKA A;  2LNT A;  2KLX A;  5HR1 A;  4V2L A;  2C8U A;  5INY A;  5C00 A;  4WR5 A;  2LV3 A;  2OE1 A;  3QR6 A;  4KGI A;  3A3T A;  2QSI A;  4IN0 A;  3IRA A;  5JCG A;  2V6K A;  4MJE A;  5COH A;  4POL A;  2JL4 A;  5CRH A;  2N5A A;  2P5Q A;  2ON5 A;  5DCG A;  3ZRE A;  4AJ7 A;  4ZB9 A;  3RHB A;  3PGT A;  4KCA A;  5B7C A;  4JBB A;  5DBQ A;  4KE3 A;  4KND A;  5H5R A;  3L78 A;  4O92 A;  3A5W A;  3F3R A;  1A8L A;  3UJ1 A;  4EDZ A;  3HY2 A;  1DSB A;  3L9U A;  2H76 A;  4F9Z A;  5A4W A;  3DWV A;  3VI7 A;  1K3L A;  2PVO C;  4L8E A;  4MA9 A;  2VCV A;  5JCU A;  1XFL A;  5AIX A;  4IW9 A;  1K0B A;  2CQ9 A;  1OAZ A;  4Q5F A;  1EEM A;  1PX7 A;  2PGT A;  1O73 A;  3L9S A;  1EV9 A;  5G5F A;  3GA4 A;  3CRU A;  2ZUP A;  3UAP A;  2LJR A;  4K0G A;  3QFB C;  5ECQ B;  1M9B A;  2VL9 A;  2L57 A;  4X0X A;  6GSU A;  4ZXG A;  3EC3 A;  1SEN A;  3P90 A;  1K0O A;  1N8J A;  2DJ1 A;  1JZW A;  2WFC A;  2X64 A;  1NHO A;  1THX A;  1XWC A;  4K6X A;  3MAK A;  4YAP A;  3I9V 2;  3EE2 A;  3IR4 A;  4I97 A;  1G0T A;  1CQH A;  4TVE A;  2AJQ B;  2YZU A;  5KEJ A;  4DVC A;  4IHU A;  3WGD A;  1O7U A;  2B6M A;  1XWG A;  4BPY A;  5HR2 A;  3CXG A;  2L4C A;  4IJ3 A;  2LTK A;  6GSV A;  2IN3 A;  3W6G A;  1K0M A;  3A2V A;  1MD4 A;  4ZBA A;  1YJ6 A;  1FVJ A;  5A4V A;  2O7K A;  1K0N A;  3QMX A;  1PQN A;  4EXJ A;  1OE8 A;  2VCT A;  5J41 A;  5B8A A;  1U87 A;  2OBI A;  1EEJ A;  1K3O A;  4IGJ A;  2JAC A;  4Z7X A;  4HU7 A;  3AY8 A;  1O6J A;  3HVX A;  3RHC A;  1Q98 A;  2K6V A;  1Z7R A;  1BAY A;  2H66 A;  5ECH B;  2ON7 A;  4RI7 A;  3SWL A;  4BVX A;  2H6Z A;  3KZQ A;  1TK0 B;  3L9V A;  2VO4 A;  5LNK e;  1PMT A;  1AQW A;  4WBJ A;  4TKY A;  5B6M A;  1B4P A;  1USB A;  3FRC A;  5DJM A;  3EMX A;  4ZIJ A;  1XWA A;  3TKS E;  2VCW A;  4K0N A;  2A2R A;  5D73 A;  1AW9 A;  4POK A;  4ZIL A;  2YV7 A;  4TR1 A;  2I81 A;  4ML6 A;  3KP8 A;  1O8W A;  4Q5Q A;  2LQQ A;  2IJY A;  4ECI A;  3IBH A;  2CAQ A;  2QKE A;  1PL2 A;  3K8N A;  3F3Q A;  4Q5R A;  1SK2 A;  5IMZ A;  4ZL7 A;  4WF4 A;  4GSS A;  2L59 A;  3W8J A;  1C72 A;  1ZYE A;  2C0F A;  3ISO A;  1FW1 A;  3C1S A;  1KBN A;  2RUE A;  1TI1 A;  2X8C A;  1BX9 A;  3CSJ A;  1V9W A;  3TKS C;  4V1A p;  2P0G A;  3LGC A;  2YCD A;  3M1G A;  1KNG A;  2VCX A;  3S9F A;  3DRN A;  5D8I A;  4K1F A;  1A23 A;  3KJY A;  2C0D A;  4K9Z A;  4TW5 A;  1T3B A;  2O89 A;  3LEF A;  4GCI A;  4HZ2 A;  1GSU A;  1OC9 A;  4PQI A;  4PQH A;  3HDC A;  10GS A;  2OE0 A;  2LUS A;  2OAD A;  3ZML A;  1ILO A;  1DE2 A;  4NV5 A;  3FR9 A;  2EIQ A;  3KH7 A;  1SYX A;  5G2Z A;  3F4T A;  4KSO A;  2PVQ A;  4CHS A;  4IQ1 A;  3F0I A;  3D5J A;  3HJO A;  2FWH A;  1SL1 B;  4N10 A;  1B4Q A;  2L6C A;  2MYG A;  3IAS 2;  3WT1 A;  3ZZX A;  5GAN D;  2FUG 2;  3ERG A;  3UVT A;  1EWX A;  1FOV A;  1X5C A;  2WRT A;  2B3S A;  4PNF A;  3WYW A;  4NHW A;  4X1U A;  4KH7 A;  4PQ1 A;  3HJM A;  1Z9H A;  4FO5 A;  2DLX A;  6GSS A;  3GKX A;  3O6T A;  2EC4 A;  4YQU A;  1J0F A;  4OFM A;  1XIY A;  1EOH A;  2PWJ A;  4G19 A;  1T00 A;  3CTF A;  3GKK A;  5ECR B;  2VLT A;  4DSS A;  2CV4 A;  1F9M A;  4HS1 A;  5AN1 A;  2REM A;  1BYE A;  3WT2 A;  4MH2 A;  3NIV A;  4XS4 A;  4HZ4 A;  5ELA A;  2YPM A;  4NXI A;  2H72 A;  2GZY A;  3CSI A;  2JAD A;  3R2Q A;  3HCZ A;  3GKN A;  5A5K A;  3DKS A;  2H71 A;  1SKW B;  2WZ9 A;  2JU5 A;  2MMA A;  5IOX A;  1GSY A;  3UL3 A;  1X9W B;  3ED3 A;  1ON4 A;  4GSN A;  1X9M B;  2LST A;  4WEY A;  3EVI A;  4HOJ A;  1DBY A;  3TJJ A;  1ZMA A;  4EE0 A;  4MF5 A;  2H0G A;  1N2A A;  3TDG A;  3OR5 A;  4GST A;  3PIN A;  3F8U A;  1GSD A;  4MK3 A;  4MF6 A;  2J23 A;  2HE3 A;  1WP0 A;  2H1D A;  3GL5 A;  1GSF A;  4BVY A;  3CTG A;  2VL2 A;  1J08 A;  1RK4 A;  3GV1 A;  4MAB A;  2RM6 A;  1OYJ A;  1TRW A;  1URM A;  2YP6 A;  3TOU A;  2F3M A;  2GSS A;  3G7J A;  3GTU B;  4XHM A;  5IQY A;  2JSZ A;  1IYH A;  2IIY A;  2WUL A;  4ILF A;  1J9B A;  3KIJ A;  3QAG A;  2FA8 A;  3IA1 A;  5DQS A;  5G30 A;  2FWF A;  5CO3 A;  1V58 A;  3FZ5 A;  3GH6 A;  2F9S A;  3RDW A;  1A24 A;  4PUA A;  2K9F A;  1BED A;  1H75 A;  1YEX A;  3KTL A;  1G6Y A;  2R3X A;  3BBY A;  2FHE A;  1XOB A;  3GKM A;  2PBJ A;  1O81 A;  5EVO A;  3RPN A;  1SYR A;  1ZZY A;  1WOU A;  2AUV A;  1U3A A;  2H6Y A;  2CVD A;  1TU8 A;  4ZBD A;  1T8E B;  2DML A;  3EU3 A;  5ENU A;  4XTS A;  2QGV A;  2FY6 A;  1ZCP A;  3KH9 A;  2GZP A;  1UVZ A;  4GXZ A;  4OO5 A;  3BCI A;  3C1R A;  1GUH A;  1M99 A;  4O7H A;  1WWJ A;  2OA7 A;  3G9B A;  4D73 B;  2VUP A;  3HZ8 A;  4WXT A;  1THO A;  4RQR A;  1ZGN A;  2WGR A;  5IMD A;  3IDV A;  3TRP A;  2V6O A;  4OO4 A;  3TJF A;  4AJ6 A;  5DJL A;  1FVK A;  3APO A;  3VFI A;  3EU4 A;  2KP1 A;  4OMV A;  4F03 A;  2IWT A;  2VD0 A;  4GWR A;  1G7O A;  1SKS B;  3M8N A;  6GSW A;  2LRC A;  1A2J A;  2C0G A;  4HJM A;  1OKD A;  2GST A;  5KN2 A;  5DVB A;  1GSQ A;  3VWV A;  1DUG A;  2GGT A;  1SD9 A;  4O5R A;  3QOU A;  5D96 A;  3TJB A;  4N11 A;  3FEU A;  3NZN A;  4TXO A;  20GS A;  2R2J A;  4OCE A;  2N5B A;  4ULX A;  3LSZ A;  1GP1 A;  5JCW A;  1K0D A;  2GS3 A;  4IS0 A;  5J3R A;  1SKR B;  4HUA A;  4XS1 A;  3RPP A;  3CRT A;  5L71 A;  4L5O A;  2G2Q A;  1S3D A;  1T1V A;  4ZL9 A;  1TJD A;  2XPE A;  3HD5 A;  4FYU A;  1ST9 A;  1AXD A;  2HZF A;  2CVB A;  3GIX A;  4L0U A;  4K7I A;  4MJC A;  1TKD B;  5CRW A;  2B1L A;  4NAX A;  5IMC A;  3CMI A;  4GQC A;  4JU5 A;  5IIZ A;  4QQ7 A;  1XWB A;  1PKZ A;  2YAN A;  2H70 A;  3HVV A;  1XPV A;  2R6K A;  2A2S A;  5F05 A;  1W89 A;  1SD8 A;  4TXO B;  3UBL A;  4FH8 A;  2L6D A;  4PUF C;  2JZR A;  4MZC A;  5A4U A;  2I1U A;  1Z3E A;  1PKW A;  2IMD A;  4XRD A;  1GSE A;  1GTB A;  4N30 A;  1B9X C;  1F37 A;  1OVN A;  1V2A A;  2VCZ A;  1GRX A;  2O85 A;  5FT3 A;  4POB A;  3DEX A;  3DYR A;  5HFG A;  2IMK A;  2PUK C;  2X8H A;  4RQX A;  5CRE A;  3VPQ A;  4Q5N A;  2VIM A;  2YWO A;  1S3A A;  4EKZ A;  2VLV A;  1EP7 A;  3L4N A;  1A2L A;  2TRX A;  1KEB A;  1GNE A;  3IV4 A;  4MPG A;  2LRT A;  1WJK A;  2M80 A;  4POM A;  4J56 E;  1AAZ A;  3KCM A;  5ECN B;  1AIU A;  2NBS A;  3M0F A;  3GYK A;  2WCI A;  5D9X A;  3HJP A;  2D2Z A;  1M2B A;  4LL4 B; 
#chains in the Genus database with same CATH topology
 3C71 A;  3GNJ A;  5J4U A;  2R4V A;  4KAE A;  3M3M A;  3GX0 A;  17GS A;  5IPG A;  4O32 A;  1IYI A;  1QQ2 A;  1SK0 A;  2GVP A;  1NM3 A;  4ISD A;  5AIV A;  4F82 A;  4V2N A;  5D9T A;  2LQO A;  2NPB A;  3IK7 A;  1RQM A;  1M2A A;  1XW6 A;  5AGY A;  2OJL A;  3BJ5 A;  1TXX A;  1BJX A;  5IOW A;  4TXV A;  2H6X A;  4EL1 A;  2XC2 A;  3FYG A;  3IXR A;  1FB0 A;  4ECJ A;  2B1K A;  2H19 A;  3UVH A;  2V2G A;  1EOG A;  4MPF A;  1GWC A;  4OCF A;  1Q4J A;  5GZZ B;  4KDX A;  1PN0 A;  2X4A A;  4K5S A;  5KOX A;  2M46 A;  2HLS A;  2IMF A;  4XS6 A;  5LCZ A;  2NDO A;  3D4T A;  1PL1 A;  4MMM A;  2WDU A;  2OAC A;  2WJU A;  2CZ3 A;  2JZT A;  1XZO A;  5G1L A;  4ID0 A;  3BCK A;  2FWE A;  2HFD A;  2GZZ A;  1B48 A;  4MDC A;  4MH3 A;  4J57 E;  1O85 A;  2FA4 A;  2PN8 A;  3TGZ A;  2MMZ A;  3ERF A;  2RUF A;  3WD6 A;  1K0C A;  7GSS A;  5DQY A;  4LLR A;  4KSM A;  1SJ6 A;  4YKF A;  1A2M A;  2I4A A;  3D4M A;  2KHP A;  4BWQ A;  3EWL A;  2O87 A;  1FOH A;  2P31 A;  2CA8 A;  4OFN A;  1U6T A;  1G7E A;  3I43 A;  2A4V A;  1Z7P A;  2L5L A;  2WB9 A;  4GF0 A;  4I5Q A;  2GQM A;  2J9H A;  3GH9 A;  1FB6 A;  3KP9 A;  3QAV A;  2AHE A;  2AB6 A;  3LFL A;  1HD2 A;  3KMO A;  5IMV A;  4L5L A;  3Q6O A;  3IC8 A;  2GDR A;  2LEG A;  2YWM A;  4EUY A;  3LXZ A;  5KOW A;  2E7P A;  1AQV A;  2C80 A;  5CAX A;  3P2A A;  1A0R P;  2X99 A;  1SJZ A;  1GTU A;  3Q18 A;  3ZIV A;  2BMX A;  3ZIT A;  2I3Y A;  4HU9 A;  1SL2 B;  3A5I A;  4GQF A;  1F2E A;  3E0U A;  3PR8 A;  1UN2 A;  2IMI A;  1X9S B;  3TKQ A;  2MBS A;  1ZYN A;  1FO5 A;  3VPT A;  3P7X A;  3J7Y b;  4MJA A;  2H73 A;  1U88 A;  4BL7 A;  2C3N A;  5LD0 A;  1WPI A;  1A8Y A;  3GTU A;  2C1Y A;  4PGT A;  1U3I A;  1VGL A;  1V40 A;  4G2E A;  3RBT A;  1JZR A;  3WGX A;  4TOP A;  8GSS A;  1X0R A;  5ELG A;  5EPF A;  4PXO A;  2E2G A;  2QC7 A;  3APS A;  3TUE A;  4EC0 A;  1JHB A;  4PNG A;  2R0P A;  3ZVJ A;  3I6A A;  1M9A A;  2YOI A;  1MEK A;  2DJ3 A;  4NMU A;  2DJ2 A;  3KMN A;  4WR4 A;  3JCM L;  5E4W A;  2IFQ A;  5FWG A;  1HNB A;  3G7Y A;  2YN1 A;  5DDL A;  2HSH A;  1QMV A;  1XBS A;  3H93 A;  1ERW A;  4ZB8 A;  3ZTL A;  4MNN A;  3IC4 A;  5F8B A;  5GST A;  5JWR B;  1Y25 A;  2QA1 A;  1LJR A;  2GQL A;  4EIP A;  4WKW A;  3FZ4 A;  1B9Y C;  3EYT A;  1R26 A;  2DJ0 A;  1X5D A;  2X49 A;  3ZFL A;  2X8G A;  4D73 A;  4AJ8 A;  2RII A;  3UIW A;  3GFK A;  2CVK A;  5CRG A;  4N0V A;  5IO0 A;  3LXT A;  5H5Q A;  1TOF A;  2VAF A;  2DBC A;  4ML1 A;  4NHZ A;  3LJR A;  1ERV A;  2VM1 A;  3ERW A;  4QL7 A;  3PH9 A;  2HRF A;  2HZE B;  2VLU A;  2OE3 A;  1MDI A;  2JSY A;  3APQ A;  2H75 A;  4GRF A;  3TRX A;  2M72 A;  3TKS A;  2F8F A;  2VCQ A;  3P8W A;  4NWY A;  2IFQ B;  3FMW A;  4IJI A;  2H1A A;  1HQO A;  4RI6 A;  5DCH A;  3IE3 A;  5IMF A;  3U5R E;  4LMW A;  5KN3 A;  2YV9 A;  2FLS A;  1SJI A;  1TDI A;  4RUV A;  3EMP A;  4IQA A;  3D21 A;  1OKT A;  5ECK B;  1XG8 A;  2A2P A;  2VL3 A;  4V1A g;  3QD9 A;  4KB3 A;  2NTO A;  5CNW A;  2DMM A;  2HYX A;  4MZB A;  3MSZ A;  4I8B A;  2CX4 A;  4G9H A;  2GT5 A;  12GS A;  4PX1 A;  4DEJ A;  14GS A;  2MZC A;  3FK8 A;  3FR3 A;  5D9W A;  2LRN A;  2N5F A;  3GMF A;  1KTE A;  5JWQ B;  13GS A;  1YQ1 A;  2DJJ A;  6GSX A;  1T7P B;  4ACS A;  1K3Y A;  2KOK A;  3HXS A;  4TR3 A;  3UOM A;  1EGO A;  5EY6 A;  1WRY A;  2XBQ A;  2HRK A;  4HDE A;  5ECI B;  1PN9 A;  3CQF A;  3F6D A;  2KP2 A;  1OC8 A;  1TRU A;  4EF0 A;  6GSY A;  1F6M C;  5G1K A;  5DAL A;  2LS5 A;  1AQX A;  2C4J A;  1S3C A;  3V1W A;  4BWS A;  3C7M A;  5CYY A;  3ZRD A;  4HQS A;  3FZA A;  1PA3 A;  3KEB A;  4CDO A;  1LBK A;  2DJK A;  1PRX A;  1NW2 A;  1JZD A;  1QK8 A;  4YH2 A;  1HYU A;  4JRR A;  4NPB A;  2JZS A;  1NSW A;  5CRD A;  3F6F A;  1R5P A;  1SU9 A;  2VM2 A;  3FW2 A;  2HNL A;  3CSH A;  2Z9S A;  4JZQ A;  3M9J A;  4XRA A;  1YF0 A;  4HJ2 A;  4H86 A;  1R7H A;  2H0I A;  4MP4 A;  1AUC A;  3LG6 A;  1GNW A;  3F4S A;  2R0G A;  2VD1 A;  5HR3 A;  1GTI A;  4K8M A;  4HI7 A;  2OBK A;  2FGX A;  5J9C A;  1GH2 A;  2IL3 A;  3HYP A;  4WET A;  2XPD A;  1GLQ A;  5D93 A;  1H4O A;  5DAL B;  1XXU A;  4N0Z A;  4EDY A;  1WE0 A;  4Z2U A;  2AAW A;  1ZL9 A;  4I2U A;  2DC5 A;  4F0C A;  3CYN A;  3W8S A;  2HXK A;  1QXH A;  1QGV A;  3ZMK A;  2YZH A;  3U6V A;  1TU7 A;  1MD3 A;  4XCS A;  1R4W A;  3SBC A;  4G10 A;  1CQG A;  3A2W A;  1V98 A;  1X5E A;  3DD3 A;  1JLV A;  4Z2T A;  4EIQ A;  2H74 A;  4BIK A;  4WBR D;  3IAM 2;  2P5R A;  4K2D A;  4XIH A;  1EP8 A;  1GL8 A;  1TK5 B;  4I2T A;  1VF3 A;  1Z6N A;  4IBP A;  2PER A;  3MNG A;  2R5G A;  3ZYW A;  4F2I A;  3ME8 A;  4IVF A;  5ECO B;  3GUS A;  3KM6 A;  3IK9 A;  5F07 A;  5GAP D;  3DIE A;  5B6N A;  4F0B A;  5HFK A;  4ECB A;  3H4K A;  3FKF A;  2A4H A;  5EL8 A;  9GSS A;  2V32 A;  3HZ4 A;  5ID2 A;  1HNC A;  5KN0 A;  1AC1 A;  5ECM B;  2CZ2 A;  1GSS A;  2RLI A;  2YWN A;  5IM9 A;  3LYK A;  3TB2 A;  5ECS A;  1GLP A;  2CX3 A;  4J2F A;  4MF7 A;  1I9D A;  4KUN A;  1PD2 1;  3GN3 A;  4KX4 A;  5C04 A;  5J9B A;  4HQZ A;  1TK8 B;  1GUK A;  2FWG A;  4TR0 A;  4YAV A;  5D9V A;  4X43 A;  1A0F A;  3KXO A;  3LQ7 A;  1TTZ A;  3J7Y k;  1O8X A;  2CT6 A;  4O5U A;  1ZYQ B;  3GRX A;  3O76 A;  3HHV A;  3UAR A;  3LWA A;  1VF2 A;  1WMJ A;  5HQP A;  2H1B A;  3NOF A;  3H8Q A;  1V57 A;  4DSQ A;  2VL2 C;  1MTC A;  5E59 A;  2PU9 C;  1RW1 A;  1XVW A;  22GS A;  2IPA A;  1T4Z A;  5ID2 B;  1QFN A;  3TJK A;  4KCE A;  3D0Z A;  3HVN A;  4YQM A;  2PPT A;  3DVW A;  4JE1 A;  3UBK A;  3ZFB A;  3ZVJ D;  1BG5 A;  2FD3 A;  1W4V A;  1FAA A;  3WGE A;  16GS A;  2H1G A;  4TRX A;  1YY7 A;  2EIO A;  2G0F A;  4AGS A;  1NHY A;  2F8A A;  1Y6E A;  1HNA A;  1SL0 B;  3FR6 A;  4ZBB A;  3HA9 A;  2I9H A;  5H5S A;  1R5A A;  3H1N A;  3VWU A;  1DE1 A;  3VK9 A;  4EO3 A;  4JR4 A;  1MDK A;  4L0W A;  1FHE A;  2DSA A;  2C3Q A;  3IOS A;  1TP9 A;  2C3T A;  4GTU A;  3BD2 A;  2GTU A;  1YF1 A;  1Z5Y E;  1GTA A;  4BA7 A;  1EV4 A;  2GT6 A;  4KF9 A;  3FZ9 A;  3HVS A;  3IPZ A;  3E3E A;  5ECL B;  3GHA A;  4LL1 B;  1VF1 A;  3TCO A;  4TR1 B;  2E2M A;  4KDY A;  4MLY A;  4TN8 A;  4FIW A;  2V41 A;  5B8B A;  3DVX A;  2H8L A;  2VOC A;  3TOT A;  2HT9 A;  2MMN A;  4ZB6 A;  2XHF A;  3IHQ A;  2BTO T;  2MBT A;  2L4Q A;  3ZL5 A;  1B8X A;  2YWI A;  3MWH A;  1GUM A;  2GSQ A;  2H0H A;  2MMO A;  2L5O A;  4V2M A;  4PUR A;  4NV2 A;  11GS A;  1TRV A;  1OE7 A;  4OD7 A;  5HR0 A;  3KGK A;  2ALB A;  2C0E A;  5HFI A;  3GSS A;  1M7T A;  4ZL8 A;  3L0H A;  2GLR A;  4K7O A;  1G6W A;  2E0Q A;  2K8V A;  3VWW A;  3C73 A;  4JED A;  1OC9 B;  4PTS A;  2KUC A;  3QAW A;  2BJX A;  2LJA A;  2HI7 A;  2HZE A;  3G7I A;  1JFU A;  4ECC A;  4CW9 A;  4YQV A;  4P3Y B;  3GL3 A;  1T4Y A;  3QDN A;  1PX6 A;  5G31 A;  3TKR A;  3N5O A;  2DIY A;  3FY7 A;  3LOR A;  4E8H A;  1ACV A;  1FG4 A;  2FCH A;  4E8E A;  2GSR A;  1BQ7 A;  2LJK A;  1TRS A;  4KA0 A;  3ZLP A;  3F4R A;  3CBU A;  3MDK A;  4HEA 2;  1VRS D;  2B5X A;  1TW9 A;  4LA1 A;  3M9K A;  3TRQ A;  2O8V B;  3HKR A;  1XOA A;  3DML A;  5GSS A;  3KTB A;  1TI3 A;  2K8S A;  4X4J A;  1QUW A;  3GST A;  3GUR A;  2B7J A;  5AIS A;  1M0U A;  4QL9 A;  4MJB A;  2ZNM A;  1GUL A;  4G0L A;  4KW6 A;  1ERU A;  3F63 A;  4FYC A;  1XWK A;  4DSS B;  1ABA A;  4LMV A;  3I69 A;  2NVL A;  18GS A;  19GS A;  1MDJ A;  1EGR A;  1I5G A;  4K7N A;  1YZX A;  3QFA C;  3UEM A;  5FHI A;  2CAI A;  2TIR A;  3F9U A;  3TKP A;  5JWO B;  1E6B A;  2AV4 A;  4XS4 B;  2HRN A;  1YEP A;  4G0I A;  5J5N A;  3VWX A;  4GLT A;  1YDK A;  3FHK A;  2F51 A;  4IP1 A;  4IEL A;  5IMA A;  2YNX A;  4AF2 A;  2ZCT A;  4CY6 A;  2GQK A;  4I6X A;  1UC7 A;  1Z6M A;  1PSQ A;  3A2X A;  1LU4 A;  1F3A A;  3ME7 A;  2XBI A;  4WF5 A;  5DAK A;  6GST A;  2R37 A;  3H79 A;  3O3T A;  2OKA A;  2YJ7 A;  5ABR A;  3VI5 A;  3E9J B;  1M2D A;  1XW9 A;  1SK1 A;  1OC3 A;  2FNO A;  2YJH A;  2B5E A;  5F0G A;  5ECP B;  1YKC A;  4JR6 A;  4DSR A;  3KD0 A;  3DGQ A;  4MZW A;  4TR4 A;  2DIZ A;  3D6I A;  1ML6 A;  2R0C A;  3US3 A;  3EIN A;  4G0K A;  3MIX A;  1ZOF A;  2H30 A;  4MCU A;  3ZIJ A;  2RM5 A;  4IKH A;  3VUR A;  2B7K A;  3TJG A;  2H01 A;  3LYP A;  2LNS A;  2EIR A;  2B5Y A;  2AYT A;  3DXB A;  3VLN A;  3BOA A;  3GX8 A;  1JLW A;  2ES7 A;  3EUR A;  4KDU A;  5G5E A;  4FYB A;  1JZO A;  1VF4 A;  1XVQ A;  1EZK A;  3C8E A;  2V1M A;  2K18 A;  3D22 A;  1XW5 A;  2HSY A;  2IME A;  5DAK B;  1E2Y A;  3Q74 A;  5IPH A;  2PMT A;  3RAZ A;  1K0A A;  3Q19 A;  4OWY A;  5KN1 A;  2LKU A;  1ERT A;  1F3B A;  4OFT A;  5IO2 A;  1XCC A;  4IP6 A;  3QPM A;  2WS2 A;  5F06 A;  3UMA A;  3N9J A;  2UZ8 A;  5CP1 A;  1UA5 A;  1WIK A;  2TRC P;  1PGT A;  3QCP A;  4EVM A;  1YKA A;  2LNT A;  2KLX A;  5HR1 A;  4V2L A;  2C8U A;  5INY A;  5C00 A;  4WR5 A;  2LV3 A;  2OE1 A;  3QR6 A;  4KGI A;  3A3T A;  2QSI A;  4IN0 A;  3IRA A;  5JCG A;  2V6K A;  4MJE A;  5COH A;  4POL A;  2JL4 A;  5CRH A;  2N5A A;  2P5Q A;  2ON5 A;  5DCG A;  3ZRE A;  4HSC X;  4AJ7 A;  4ZB9 A;  3RHB A;  3PGT A;  4KCA A;  1ZYP A;  5B7C A;  4JBB A;  5DBQ A;  4KE3 A;  4KND A;  5H5R A;  3L78 A;  4O92 A;  3A5W A;  3F3R A;  1A8L A;  3UJ1 A;  4EDZ A;  3HY2 A;  1DSB A;  3L9U A;  2H76 A;  4F9Z A;  3PPU A;  5A4W A;  3DWV A;  3VI7 A;  1K3L A;  2PVO C;  4L8E A;  4MA9 A;  2VCV A;  5JCU A;  1XFL A;  5AIX A;  4IW9 A;  1K0B A;  2CQ9 A;  1OAZ A;  4Q5F A;  1EEM A;  1PX7 A;  2PGT A;  1O73 A;  3L9S A;  1EV9 A;  5G5F A;  3GA4 A;  3CRU A;  2ZUP A;  3UAP A;  2LJR A;  4K0G A;  3QFB C;  5BMU A;  5ECQ B;  1M9B A;  2VL9 A;  2L57 A;  4X0X A;  6GSU A;  4ZXG A;  3EC3 A;  1SEN A;  3P90 A;  1K0O A;  1N8J A;  2DJ1 A;  1JZW A;  2WFC A;  2X64 A;  1NHO A;  1THX A;  1XWC A;  4K6X A;  3MAK A;  4YAP A;  4CY8 A;  3I9V 2;  3EE2 A;  3IR4 A;  4I97 A;  1G0T A;  1CQH A;  4TVE A;  2AJQ B;  2YZU A;  5KEJ A;  4DVC A;  4IHU A;  3WGD A;  1O7U A;  2B6M A;  1XWG A;  4BPY A;  5HR2 A;  3CXG A;  2L4C A;  4IJ3 A;  2LTK A;  6GSV A;  2IN3 A;  3W6G A;  1K0M A;  3A2V A;  1MD4 A;  4ZBA A;  1YJ6 A;  1FVJ A;  5A4V A;  2O7K A;  1K0N A;  3QMX A;  1PQN A;  4EXJ A;  1OE8 A;  2VCT A;  5J41 A;  5B8A A;  1U87 A;  2OBI A;  1EEJ A;  1K3O A;  4IGJ A;  2JAC A;  4Z7X A;  4HU7 A;  3AY8 A;  1O6J A;  3HVX A;  3RHC A;  1Q98 A;  2K6V A;  1Z7R A;  1BAY A;  2H66 A;  5ECH B;  2ON7 A;  4RI7 A;  3SWL A;  4BVX A;  1PFO A;  2H6Z A;  3KZQ A;  1TK0 B;  3L9V A;  2VO4 A;  5LNK e;  1PMT A;  1AQW A;  4WBJ A;  4TKY A;  5B6M A;  1B4P A;  1USB A;  3FRC A;  5DJM A;  3EMX A;  4ZIJ A;  1XWA A;  1M3I A;  3TKS E;  2VCW A;  4K0N A;  2A2R A;  5D73 A;  1AW9 A;  4POK A;  4ZIL A;  2YV7 A;  4TR1 A;  2I81 A;  4ML6 A;  3KP8 A;  1O8W A;  4Q5Q A;  2LQQ A;  2IJY A;  4ECI A;  3IBH A;  2CAQ A;  2QKE A;  1PL2 A;  3K8N A;  2QA2 A;  3F3Q A;  4Q5R A;  1SK2 A;  5IMZ A;  4ZL7 A;  4WF4 A;  4GSS A;  2L59 A;  3W8J A;  1C72 A;  1ZYE A;  2C0F A;  3ISO A;  1FW1 A;  3C1S A;  1KBN A;  2RUE A;  1TI1 A;  2X8C A;  1BX9 A;  3CSJ A;  1V9W A;  3TKS C;  4BVX B;  4V1A p;  2P0G A;  3LGC A;  2YCD A;  3M1G A;  1KNG A;  2VCX A;  3S9F A;  3DRN A;  5D8I A;  4K1F A;  1A23 A;  3KJY A;  2C0D A;  4K9Z A;  4TW5 A;  1T3B A;  2O89 A;  3LEF A;  4GCI A;  4HZ2 A;  1GSU A;  1OC9 A;  4PQI A;  4PQH A;  3HDC A;  10GS A;  2OE0 A;  2DKH A;  2LUS A;  2OAD A;  3ZML A;  1ILO A;  1DE2 A;  4NV5 A;  3FR9 A;  2EIQ A;  3KH7 A;  1SYX A;  5G2Z A;  3F4T A;  4KSO A;  2PVQ A;  4CHS A;  4IQ1 A;  3F0I A;  3D5J A;  3HJO A;  2FWH A;  1SL1 B;  4N10 A;  1B4Q A;  2L6C A;  2MYG A;  3IAS 2;  3WT1 A;  3ZZX A;  5GAN D;  4FQU A;  2FUG 2;  3ERG A;  3R3E A;  3UVT A;  3EPT A;  1EWX A;  1FOV A;  1X5C A;  2WRT A;  2B3S A;  4PNF A;  3WYW A;  4NHW A;  4X1U A;  4KH7 A;  4PQ1 A;  3HJM A;  1Z9H A;  4FO5 A;  2DLX A;  6GSS A;  3GKX A;  3O6T A;  2EC4 A;  4YQU A;  4Z2R A;  1J0F A;  4OFM A;  1XIY A;  1EOH A;  2PWJ A;  4G19 A;  4A5P A;  1T00 A;  3CTF A;  3GKK A;  5ECR B;  2VLT A;  4DSS A;  2CV4 A;  1F9M A;  4HS1 A;  5AN1 A;  2REM A;  4O5Q A;  1BYE A;  3WT2 A;  4MH2 A;  3NIV A;  4XS4 A;  4HZ4 A;  5ELA A;  2YPM A;  4NXI A;  2H72 A;  2GZY A;  3CSI A;  2JAD A;  4USS A;  3R2Q A;  3HCZ A;  3GKN A;  5A5K A;  3DKS A;  2H71 A;  1SKW B;  3IHG A;  2WZ9 A;  2JU5 A;  2MMA A;  5IOX A;  1GSY A;  3UL3 A;  1X9W B;  3ED3 A;  1ON4 A;  4GSN A;  1X9M B;  2LST A;  4WEY A;  3EVI A;  4HOJ A;  1DBY A;  3TJJ A;  1ZMA A;  4EE0 A;  4MF5 A;  2H0G A;  1N2A A;  3TDG A;  3OR5 A;  4GST A;  3PIN A;  3F8U A;  1GSD A;  4MK3 A;  4MF6 A;  2J23 A;  2HE3 A;  1WP0 A;  2H1D A;  3GL5 A;  1GSF A;  4BVY A;  3CTG A;  2VL2 A;  1J08 A;  1RK4 A;  3GV1 A;  4MAB A;  2RM6 A;  1OYJ A;  1TRW A;  1URM A;  2YP6 A;  3TOU A;  2F3M A;  2GSS A;  3G7J A;  4BL7 B;  3GTU B;  4ICY A;  4XHM A;  5IQY A;  1S3R A;  2JSZ A;  1IYH A;  2IIY A;  2WUL A;  4ILF A;  1J9B A;  3KIJ A;  3QAG A;  2FA8 A;  3IA1 A;  5DQS A;  5G30 A;  2FWF A;  5CO3 A;  1V58 A;  3FZ5 A;  3GH6 A;  2F9S A;  3RDW A;  1A24 A;  4PUA A;  2K9F A;  1BED A;  1H75 A;  1YEX A;  3KTL A;  1G6Y A;  2R3X A;  3BBY A;  2FHE A;  5BRT A;  1XOB A;  3GKM A;  2PBJ A;  1O81 A;  5EVO A;  3RPN A;  1SYR A;  2HSM A;  1ZZY A;  3MYD A;  1WOU A;  2AUV A;  1U3A A;  2H6Y A;  2CVD A;  1TU8 A;  4ZBD A;  1T8E B;  2DML A;  3EU3 A;  5ENU A;  4XTS A;  2QGV A;  2FY6 A;  4K2X A;  1ZCP A;  3KH9 A;  4BVY B;  2GZP A;  1UVZ A;  4GXZ A;  4OO5 A;  3BCI A;  3C1R A;  1GUH A;  1M99 A;  4O7H A;  1WWJ A;  2OA7 A;  3G9B A;  4D73 B;  2VUP A;  3HZ8 A;  4WXT A;  1THO A;  4RQR A;  1ZGN A;  2WGR A;  4K5R A;  5IMD A;  3IDV A;  3TRP A;  2V6O A;  4OO4 A;  3TJF A;  4AJ6 A;  5DJL A;  1FVK A;  3APO A;  3VFI A;  3EU4 A;  2KP1 A;  4OMV A;  4F03 A;  2IWT A;  2VD0 A;  4GWR A;  1G7O A;  1SKS B;  3M8N A;  6GSW A;  2LRC A;  1A2J A;  2C0G A;  4HJM A;  1OKD A;  2GST A;  5KN2 A;  5DVB A;  1GSQ A;  3VWV A;  1DUG A;  2GGT A;  1SD9 A;  4O5R A;  3QOU A;  5D96 A;  3TJB A;  4N11 A;  3FEU A;  3NZN A;  4TXO A;  20GS A;  2R2J A;  4OCE A;  2DKI A;  2N5B A;  4ULX A;  3LSZ A;  1GP1 A;  5JCW A;  1K0D A;  2GS3 A;  4IS0 A;  5J3R A;  1SKR B;  4HUA A;  4XS1 A;  3RPP A;  3CRT A;  5L71 A;  4L5O A;  2G2Q A;  1S3D A;  1T1V A;  4ZL9 A;  1TJD A;  2XPE A;  3HD5 A;  4FYU A;  1ST9 A;  1AXD A;  2HZF A;  2CVB A;  3GIX A;  4L0U A;  4K7I A;  1M3J A;  4MJC A;  1TKD B;  5CRW A;  2B1L A;  4NAX A;  5IMC A;  3CMI A;  4GQC A;  4JU5 A;  5IIZ A;  4QQ7 A;  1XWB A;  1PKZ A;  2YAN A;  2H70 A;  3HVV A;  1XPV A;  2R6K A;  2A2S A;  5F05 A;  1W89 A;  1SD8 A;  4TXO B;  2HRA A;  3UBL A;  4FH8 A;  2L6D A;  4PUF C;  2JZR A;  3LW9 A;  4MZC A;  5A4U A;  2I1U A;  1Z3E A;  1PKW A;  2IMD A;  4XRD A;  1GSE A;  1GTB A;  4N30 A;  1B9X C;  1F37 A;  1OVN A;  1V2A A;  2VCZ A;  1GRX A;  2O85 A;  5FT3 A;  4POB A;  3DEX A;  3DYR A;  5HFG A;  2IMK A;  2PUK C;  2X8H A;  4RQX A;  5CRE A;  3VPQ A;  4Q5N A;  2VIM A;  2YWO A;  1S3A A;  4EKZ A;  2VLV A;  1EP7 A;  3L4N A;  1A2L A;  2TRX A;  4YKG A;  1KEB A;  1GNE A;  3IV4 A;  4MPG A;  2LRT A;  1WJK A;  2M80 A;  4POM A;  4J56 E;  1AAZ A;  3KCM A;  5ECN B;  1AIU A;  2NBS A;  3M0F A;  3GYK A;  2WCI A;  5D9X A;  3HJP A;  2D2Z A;  1M2B A;  4LL4 B; 
#chains in the Genus database with same CATH homology
 3C71 A;  3GNJ A;  5J4U A;  2R4V A;  4KAE A;  3M3M A;  3GX0 A;  17GS A;  5IPG A;  4O32 A;  1IYI A;  1QQ2 A;  1SK0 A;  2GVP A;  1NM3 A;  4ISD A;  5AIV A;  4F82 A;  4V2N A;  5D9T A;  2LQO A;  2NPB A;  3IK7 A;  1RQM A;  1M2A A;  1XW6 A;  5AGY A;  2OJL A;  3BJ5 A;  1TXX A;  1BJX A;  5IOW A;  4TXV A;  2H6X A;  4EL1 A;  2XC2 A;  3FYG A;  3IXR A;  1FB0 A;  4ECJ A;  2B1K A;  2H19 A;  3UVH A;  2V2G A;  1EOG A;  4MPF A;  1GWC A;  4OCF A;  1Q4J A;  5GZZ B;  4KDX A;  1PN0 A;  2X4A A;  4K5S A;  5KOX A;  2M46 A;  2HLS A;  2IMF A;  4XS6 A;  5LCZ A;  2NDO A;  3D4T A;  1PL1 A;  4MMM A;  2WDU A;  2OAC A;  2WJU A;  2CZ3 A;  2JZT A;  1XZO A;  5G1L A;  4ID0 A;  3BCK A;  2FWE A;  2HFD A;  2GZZ A;  1B48 A;  4MDC A;  4MH3 A;  4J57 E;  1O85 A;  2FA4 A;  2PN8 A;  3TGZ A;  2MMZ A;  3ERF A;  2RUF A;  3WD6 A;  1K0C A;  7GSS A;  5DQY A;  4LLR A;  4KSM A;  1SJ6 A;  4YKF A;  1A2M A;  2I4A A;  3D4M A;  2KHP A;  4BWQ A;  3EWL A;  2O87 A;  1FOH A;  2P31 A;  2CA8 A;  4OFN A;  1U6T A;  1G7E A;  3I43 A;  2A4V A;  1Z7P A;  2L5L A;  2WB9 A;  4GF0 A;  4I5Q A;  2GQM A;  2J9H A;  3GH9 A;  1FB6 A;  3KP9 A;  3QAV A;  2AHE A;  2AB6 A;  3LFL A;  1HD2 A;  3KMO A;  5IMV A;  4L5L A;  3Q6O A;  3IC8 A;  2GDR A;  2LEG A;  2YWM A;  4EUY A;  3LXZ A;  5KOW A;  2E7P A;  1AQV A;  2C80 A;  5CAX A;  3P2A A;  1A0R P;  2X99 A;  1SJZ A;  1GTU A;  3Q18 A;  3ZIV A;  2BMX A;  3ZIT A;  2I3Y A;  4HU9 A;  1SL2 B;  3A5I A;  4GQF A;  1F2E A;  3E0U A;  3PR8 A;  1UN2 A;  2IMI A;  1X9S B;  3TKQ A;  2MBS A;  1ZYN A;  1FO5 A;  3VPT A;  3P7X A;  3J7Y b;  4MJA A;  2H73 A;  1U88 A;  4BL7 A;  2C3N A;  5LD0 A;  1WPI A;  1A8Y A;  3GTU A;  2C1Y A;  4PGT A;  1U3I A;  1VGL A;  1V40 A;  4G2E A;  3RBT A;  1JZR A;  3WGX A;  4TOP A;  8GSS A;  1X0R A;  5ELG A;  5EPF A;  4PXO A;  2E2G A;  2QC7 A;  3APS A;  3TUE A;  4EC0 A;  1JHB A;  4PNG A;  2R0P A;  3ZVJ A;  3I6A A;  1M9A A;  2YOI A;  1MEK A;  2DJ3 A;  4NMU A;  2DJ2 A;  3KMN A;  4WR4 A;  3JCM L;  5E4W A;  2IFQ A;  5FWG A;  1HNB A;  3G7Y A;  2YN1 A;  5DDL A;  2HSH A;  1QMV A;  1XBS A;  3H93 A;  1ERW A;  4ZB8 A;  3ZTL A;  4MNN A;  3IC4 A;  5F8B A;  5GST A;  5JWR B;  1Y25 A;  2QA1 A;  1LJR A;  2GQL A;  4EIP A;  4WKW A;  3FZ4 A;  1B9Y C;  3EYT A;  1R26 A;  2DJ0 A;  1X5D A;  2X49 A;  3ZFL A;  2X8G A;  4D73 A;  4AJ8 A;  2RII A;  3UIW A;  3GFK A;  2CVK A;  5CRG A;  4N0V A;  5IO0 A;  3LXT A;  5H5Q A;  1TOF A;  2VAF A;  2DBC A;  4ML1 A;  4NHZ A;  3LJR A;  1ERV A;  2VM1 A;  3ERW A;  4QL7 A;  3PH9 A;  2HRF A;  2HZE B;  2VLU A;  2OE3 A;  1MDI A;  2JSY A;  3APQ A;  2H75 A;  4GRF A;  3TRX A;  2M72 A;  3TKS A;  2F8F A;  2VCQ A;  3P8W A;  4NWY A;  2IFQ B;  3FMW A;  4IJI A;  2H1A A;  1HQO A;  4RI6 A;  5DCH A;  3IE3 A;  5IMF A;  3U5R E;  4LMW A;  5KN3 A;  2YV9 A;  2FLS A;  1SJI A;  1TDI A;  4RUV A;  3EMP A;  4IQA A;  3D21 A;  1OKT A;  5ECK B;  2A2P A;  2VL3 A;  4V1A g;  3QD9 A;  4KB3 A;  2NTO A;  5CNW A;  2DMM A;  2HYX A;  4MZB A;  3MSZ A;  4I8B A;  2CX4 A;  4G9H A;  2GT5 A;  12GS A;  4PX1 A;  4DEJ A;  14GS A;  2MZC A;  3FK8 A;  3FR3 A;  5D9W A;  2LRN A;  2N5F A;  3GMF A;  1KTE A;  5JWQ B;  13GS A;  1YQ1 A;  2DJJ A;  6GSX A;  1T7P B;  4ACS A;  1K3Y A;  2KOK A;  3HXS A;  4TR3 A;  3UOM A;  1EGO A;  5EY6 A;  1WRY A;  2XBQ A;  2HRK A;  4HDE A;  5ECI B;  1PN9 A;  3F6D A;  2KP2 A;  1OC8 A;  1TRU A;  4EF0 A;  6GSY A;  1F6M C;  5G1K A;  5DAL A;  2LS5 A;  1AQX A;  2C4J A;  1S3C A;  3V1W A;  4BWS A;  3C7M A;  5CYY A;  3ZRD A;  4HQS A;  3FZA A;  1PA3 A;  3KEB A;  4CDO A;  1LBK A;  2DJK A;  1PRX A;  1NW2 A;  1JZD A;  1QK8 A;  4YH2 A;  1HYU A;  4JRR A;  4NPB A;  2JZS A;  1NSW A;  5CRD A;  3F6F A;  1R5P A;  1SU9 A;  2VM2 A;  3FW2 A;  2HNL A;  3CSH A;  2Z9S A;  4JZQ A;  3M9J A;  4XRA A;  1YF0 A;  4HJ2 A;  4H86 A;  1R7H A;  2H0I A;  4MP4 A;  1AUC A;  3LG6 A;  1GNW A;  3F4S A;  2R0G A;  2VD1 A;  5HR3 A;  1GTI A;  4K8M A;  4HI7 A;  2OBK A;  2FGX A;  5J9C A;  1GH2 A;  2IL3 A;  3HYP A;  4WET A;  2XPD A;  1GLQ A;  5D93 A;  1H4O A;  5DAL B;  1XXU A;  4N0Z A;  4EDY A;  1WE0 A;  4Z2U A;  2AAW A;  1ZL9 A;  4I2U A;  2DC5 A;  4F0C A;  3CYN A;  3W8S A;  2HXK A;  1QXH A;  1QGV A;  3ZMK A;  2YZH A;  3U6V A;  1TU7 A;  1MD3 A;  4XCS A;  1R4W A;  3SBC A;  4G10 A;  1CQG A;  3A2W A;  1V98 A;  1X5E A;  3DD3 A;  1JLV A;  4Z2T A;  4EIQ A;  2H74 A;  4WBR D;  3IAM 2;  2P5R A;  4K2D A;  4XIH A;  1EP8 A;  1GL8 A;  1TK5 B;  4I2T A;  1VF3 A;  1Z6N A;  4IBP A;  2PER A;  3MNG A;  2R5G A;  3ZYW A;  4F2I A;  3ME8 A;  4IVF A;  5ECO B;  3GUS A;  3KM6 A;  3IK9 A;  5F07 A;  5GAP D;  3DIE A;  5B6N A;  4F0B A;  5HFK A;  4ECB A;  3H4K A;  3FKF A;  2A4H A;  5EL8 A;  9GSS A;  2V32 A;  3HZ4 A;  5ID2 A;  1HNC A;  5KN0 A;  1AC1 A;  5ECM B;  2CZ2 A;  1GSS A;  2RLI A;  2YWN A;  5IM9 A;  3LYK A;  3TB2 A;  5ECS A;  1GLP A;  2CX3 A;  4J2F A;  4MF7 A;  1I9D A;  4KUN A;  1PD2 1;  3GN3 A;  4KX4 A;  5C04 A;  5J9B A;  4HQZ A;  1TK8 B;  1GUK A;  2FWG A;  4TR0 A;  4YAV A;  5D9V A;  4X43 A;  1A0F A;  3KXO A;  3LQ7 A;  1TTZ A;  3J7Y k;  1O8X A;  2CT6 A;  4O5U A;  1ZYQ B;  3GRX A;  3O76 A;  3HHV A;  3UAR A;  3LWA A;  1VF2 A;  1WMJ A;  5HQP A;  2H1B A;  3NOF A;  3H8Q A;  1V57 A;  4DSQ A;  2VL2 C;  1MTC A;  5E59 A;  2PU9 C;  1RW1 A;  1XVW A;  22GS A;  2IPA A;  1T4Z A;  5ID2 B;  1QFN A;  3TJK A;  4KCE A;  3D0Z A;  4YQM A;  2PPT A;  3DVW A;  4JE1 A;  3UBK A;  3ZFB A;  3ZVJ D;  1BG5 A;  2FD3 A;  1W4V A;  1FAA A;  3WGE A;  16GS A;  2H1G A;  4TRX A;  1YY7 A;  2EIO A;  2G0F A;  4AGS A;  1NHY A;  2F8A A;  1Y6E A;  1HNA A;  1SL0 B;  3FR6 A;  4ZBB A;  3HA9 A;  2I9H A;  5H5S A;  1R5A A;  3H1N A;  3VWU A;  1DE1 A;  3VK9 A;  4EO3 A;  4JR4 A;  1MDK A;  4L0W A;  1FHE A;  2DSA A;  2C3Q A;  3IOS A;  1TP9 A;  2C3T A;  4GTU A;  3BD2 A;  2GTU A;  1YF1 A;  1Z5Y E;  1GTA A;  4BA7 A;  1EV4 A;  2GT6 A;  4KF9 A;  3FZ9 A;  3HVS A;  3IPZ A;  3E3E A;  5ECL B;  3GHA A;  4LL1 B;  1VF1 A;  3TCO A;  4TR1 B;  2E2M A;  4KDY A;  4MLY A;  4TN8 A;  4FIW A;  2V41 A;  5B8B A;  3DVX A;  2H8L A;  2VOC A;  3TOT A;  2HT9 A;  2MMN A;  4ZB6 A;  2XHF A;  3IHQ A;  2BTO T;  2MBT A;  2L4Q A;  3ZL5 A;  1B8X A;  2YWI A;  3MWH A;  1GUM A;  2GSQ A;  2H0H A;  2MMO A;  2L5O A;  4V2M A;  4PUR A;  4NV2 A;  11GS A;  1TRV A;  1OE7 A;  4OD7 A;  5HR0 A;  3KGK A;  2ALB A;  2C0E A;  5HFI A;  3GSS A;  1M7T A;  4ZL8 A;  3L0H A;  2GLR A;  4K7O A;  1G6W A;  2E0Q A;  2K8V A;  3VWW A;  3C73 A;  4JED A;  1OC9 B;  4PTS A;  2KUC A;  3QAW A;  2BJX A;  2LJA A;  2HI7 A;  2HZE A;  3G7I A;  1JFU A;  4ECC A;  4CW9 A;  4YQV A;  4P3Y B;  3GL3 A;  1T4Y A;  3QDN A;  1PX6 A;  5G31 A;  3TKR A;  3N5O A;  2DIY A;  3FY7 A;  3LOR A;  4E8H A;  1ACV A;  1FG4 A;  2FCH A;  4E8E A;  2GSR A;  1BQ7 A;  2LJK A;  1TRS A;  4KA0 A;  3ZLP A;  3F4R A;  3CBU A;  3MDK A;  4HEA 2;  1VRS D;  2B5X A;  1TW9 A;  4LA1 A;  3M9K A;  3TRQ A;  2O8V B;  3HKR A;  1XOA A;  3DML A;  5GSS A;  3KTB A;  1TI3 A;  2K8S A;  4X4J A;  1QUW A;  3GST A;  3GUR A;  2B7J A;  5AIS A;  1M0U A;  4QL9 A;  4MJB A;  2ZNM A;  1GUL A;  4G0L A;  4KW6 A;  1ERU A;  3F63 A;  4FYC A;  1XWK A;  4DSS B;  1ABA A;  4LMV A;  3I69 A;  2NVL A;  18GS A;  19GS A;  1MDJ A;  1EGR A;  1I5G A;  4K7N A;  1YZX A;  3QFA C;  3UEM A;  5FHI A;  2CAI A;  2TIR A;  3F9U A;  3TKP A;  5JWO B;  1E6B A;  2AV4 A;  4XS4 B;  2HRN A;  1YEP A;  4G0I A;  5J5N A;  3VWX A;  4GLT A;  1YDK A;  3FHK A;  2F51 A;  4IP1 A;  4IEL A;  5IMA A;  2YNX A;  4AF2 A;  2ZCT A;  4CY6 A;  2GQK A;  4I6X A;  1UC7 A;  1Z6M A;  1PSQ A;  3A2X A;  1LU4 A;  1F3A A;  3ME7 A;  2XBI A;  4WF5 A;  5DAK A;  6GST A;  2R37 A;  3H79 A;  3O3T A;  2OKA A;  2YJ7 A;  5ABR A;  3VI5 A;  3E9J B;  1M2D A;  1XW9 A;  1SK1 A;  1OC3 A;  2FNO A;  2YJH A;  2B5E A;  5F0G A;  5ECP B;  1YKC A;  4JR6 A;  4DSR A;  3KD0 A;  3DGQ A;  4MZW A;  4TR4 A;  2DIZ A;  3D6I A;  1ML6 A;  2R0C A;  3US3 A;  3EIN A;  4G0K A;  3MIX A;  1ZOF A;  2H30 A;  4MCU A;  3ZIJ A;  2RM5 A;  4IKH A;  3VUR A;  2B7K A;  3TJG A;  2H01 A;  3LYP A;  2LNS A;  2EIR A;  2B5Y A;  2AYT A;  3DXB A;  3VLN A;  3BOA A;  3GX8 A;  1JLW A;  2ES7 A;  3EUR A;  4KDU A;  5G5E A;  4FYB A;  1JZO A;  1VF4 A;  1XVQ A;  1EZK A;  3C8E A;  2V1M A;  2K18 A;  3D22 A;  1XW5 A;  2HSY A;  2IME A;  5DAK B;  1E2Y A;  3Q74 A;  5IPH A;  2PMT A;  3RAZ A;  1K0A A;  3Q19 A;  4OWY A;  5KN1 A;  2LKU A;  1ERT A;  1F3B A;  4OFT A;  5IO2 A;  1XCC A;  4IP6 A;  3QPM A;  2WS2 A;  5F06 A;  3UMA A;  3N9J A;  2UZ8 A;  5CP1 A;  1UA5 A;  1WIK A;  2TRC P;  1PGT A;  3QCP A;  4EVM A;  1YKA A;  2LNT A;  2KLX A;  5HR1 A;  4V2L A;  2C8U A;  5INY A;  5C00 A;  4WR5 A;  2LV3 A;  2OE1 A;  3QR6 A;  4KGI A;  3A3T A;  2QSI A;  4IN0 A;  3IRA A;  5JCG A;  2V6K A;  4MJE A;  5COH A;  4POL A;  2JL4 A;  5CRH A;  2N5A A;  2P5Q A;  2ON5 A;  5DCG A;  3ZRE A;  4AJ7 A;  4ZB9 A;  3RHB A;  3PGT A;  4KCA A;  1ZYP A;  5B7C A;  4JBB A;  5DBQ A;  4KE3 A;  4KND A;  5H5R A;  3L78 A;  4O92 A;  3A5W A;  3F3R A;  1A8L A;  3UJ1 A;  4EDZ A;  3HY2 A;  1DSB A;  3L9U A;  2H76 A;  4F9Z A;  3PPU A;  5A4W A;  3DWV A;  3VI7 A;  1K3L A;  2PVO C;  4L8E A;  4MA9 A;  2VCV A;  5JCU A;  1XFL A;  5AIX A;  4IW9 A;  1K0B A;  2CQ9 A;  1OAZ A;  4Q5F A;  1EEM A;  1PX7 A;  2PGT A;  1O73 A;  3L9S A;  1EV9 A;  5G5F A;  3GA4 A;  3CRU A;  2ZUP A;  3UAP A;  2LJR A;  4K0G A;  3QFB C;  5BMU A;  5ECQ B;  1M9B A;  2VL9 A;  2L57 A;  4X0X A;  6GSU A;  4ZXG A;  3EC3 A;  1SEN A;  3P90 A;  1K0O A;  1N8J A;  2DJ1 A;  1JZW A;  2WFC A;  2X64 A;  1NHO A;  1THX A;  1XWC A;  4K6X A;  3MAK A;  4YAP A;  4CY8 A;  3I9V 2;  3EE2 A;  3IR4 A;  4I97 A;  1G0T A;  1CQH A;  4TVE A;  2AJQ B;  2YZU A;  5KEJ A;  4DVC A;  4IHU A;  3WGD A;  1O7U A;  2B6M A;  1XWG A;  4BPY A;  5HR2 A;  3CXG A;  2L4C A;  4IJ3 A;  2LTK A;  6GSV A;  2IN3 A;  3W6G A;  1K0M A;  3A2V A;  1MD4 A;  4ZBA A;  1YJ6 A;  1FVJ A;  5A4V A;  2O7K A;  1K0N A;  3QMX A;  1PQN A;  4EXJ A;  1OE8 A;  2VCT A;  5J41 A;  5B8A A;  1U87 A;  2OBI A;  1EEJ A;  1K3O A;  4IGJ A;  2JAC A;  4Z7X A;  4HU7 A;  3AY8 A;  1O6J A;  3HVX A;  3RHC A;  1Q98 A;  2K6V A;  1Z7R A;  1BAY A;  2H66 A;  5ECH B;  2ON7 A;  4RI7 A;  3SWL A;  4BVX A;  2H6Z A;  3KZQ A;  1TK0 B;  3L9V A;  2VO4 A;  5LNK e;  1PMT A;  1AQW A;  4WBJ A;  4TKY A;  5B6M A;  1B4P A;  1USB A;  3FRC A;  5DJM A;  3EMX A;  4ZIJ A;  1XWA A;  3TKS E;  2VCW A;  4K0N A;  2A2R A;  5D73 A;  1AW9 A;  4POK A;  4ZIL A;  2YV7 A;  4TR1 A;  2I81 A;  4ML6 A;  3KP8 A;  1O8W A;  4Q5Q A;  2LQQ A;  2IJY A;  4ECI A;  3IBH A;  2CAQ A;  2QKE A;  1PL2 A;  3K8N A;  2QA2 A;  3F3Q A;  4Q5R A;  1SK2 A;  5IMZ A;  4ZL7 A;  4WF4 A;  4GSS A;  2L59 A;  3W8J A;  1C72 A;  1ZYE A;  2C0F A;  3ISO A;  1FW1 A;  3C1S A;  1KBN A;  2RUE A;  1TI1 A;  2X8C A;  1BX9 A;  3CSJ A;  1V9W A;  3TKS C;  4BVX B;  4V1A p;  2P0G A;  3LGC A;  2YCD A;  3M1G A;  1KNG A;  2VCX A;  3S9F A;  3DRN A;  5D8I A;  4K1F A;  1A23 A;  3KJY A;  2C0D A;  4K9Z A;  4TW5 A;  1T3B A;  2O89 A;  3LEF A;  4GCI A;  4HZ2 A;  1GSU A;  1OC9 A;  4PQI A;  4PQH A;  3HDC A;  10GS A;  2OE0 A;  2DKH A;  2LUS A;  2OAD A;  3ZML A;  1ILO A;  1DE2 A;  4NV5 A;  3FR9 A;  2EIQ A;  3KH7 A;  1SYX A;  5G2Z A;  3F4T A;  4KSO A;  2PVQ A;  4CHS A;  4IQ1 A;  3F0I A;  3D5J A;  3HJO A;  2FWH A;  1SL1 B;  4N10 A;  1B4Q A;  2L6C A;  2MYG A;  3IAS 2;  3WT1 A;  3ZZX A;  5GAN D;  4FQU A;  2FUG 2;  3ERG A;  3R3E A;  3UVT A;  3EPT A;  1EWX A;  1FOV A;  1X5C A;  2WRT A;  2B3S A;  4PNF A;  3WYW A;  4NHW A;  4X1U A;  4KH7 A;  4PQ1 A;  3HJM A;  1Z9H A;  4FO5 A;  2DLX A;  6GSS A;  3GKX A;  3O6T A;  2EC4 A;  4YQU A;  4Z2R A;  1J0F A;  4OFM A;  1XIY A;  1EOH A;  2PWJ A;  4G19 A;  4A5P A;  1T00 A;  3CTF A;  3GKK A;  5ECR B;  2VLT A;  4DSS A;  2CV4 A;  1F9M A;  4HS1 A;  5AN1 A;  2REM A;  4O5Q A;  1BYE A;  3WT2 A;  4MH2 A;  3NIV A;  4XS4 A;  4HZ4 A;  5ELA A;  2YPM A;  4NXI A;  2H72 A;  2GZY A;  3CSI A;  2JAD A;  4USS A;  3R2Q A;  3HCZ A;  3GKN A;  5A5K A;  3DKS A;  2H71 A;  1SKW B;  3IHG A;  2WZ9 A;  2JU5 A;  2MMA A;  5IOX A;  1GSY A;  3UL3 A;  1X9W B;  3ED3 A;  1ON4 A;  4GSN A;  1X9M B;  2LST A;  4WEY A;  3EVI A;  4HOJ A;  1DBY A;  3TJJ A;  1ZMA A;  4EE0 A;  4MF5 A;  2H0G A;  1N2A A;  3TDG A;  3OR5 A;  4GST A;  3PIN A;  3F8U A;  1GSD A;  4MK3 A;  4MF6 A;  2J23 A;  2HE3 A;  1WP0 A;  2H1D A;  3GL5 A;  1GSF A;  4BVY A;  3CTG A;  2VL2 A;  1J08 A;  1RK4 A;  3GV1 A;  4MAB A;  2RM6 A;  1OYJ A;  1TRW A;  1URM A;  2YP6 A;  3TOU A;  2F3M A;  2GSS A;  3G7J A;  4BL7 B;  3GTU B;  4ICY A;  4XHM A;  5IQY A;  2JSZ A;  1IYH A;  2IIY A;  2WUL A;  4ILF A;  1J9B A;  3KIJ A;  3QAG A;  2FA8 A;  3IA1 A;  5DQS A;  5G30 A;  2FWF A;  5CO3 A;  1V58 A;  3FZ5 A;  3GH6 A;  2F9S A;  3RDW A;  1A24 A;  4PUA A;  2K9F A;  1BED A;  1H75 A;  1YEX A;  3KTL A;  1G6Y A;  2R3X A;  3BBY A;  2FHE A;  5BRT A;  1XOB A;  3GKM A;  2PBJ A;  1O81 A;  5EVO A;  3RPN A;  1SYR A;  2HSM A;  1ZZY A;  3MYD A;  1WOU A;  2AUV A;  1U3A A;  2H6Y A;  2CVD A;  1TU8 A;  4ZBD A;  1T8E B;  2DML A;  3EU3 A;  5ENU A;  4XTS A;  2QGV A;  2FY6 A;  4K2X A;  1ZCP A;  3KH9 A;  4BVY B;  2GZP A;  1UVZ A;  4GXZ A;  4OO5 A;  3BCI A;  3C1R A;  1GUH A;  1M99 A;  4O7H A;  1WWJ A;  2OA7 A;  3G9B A;  4D73 B;  2VUP A;  3HZ8 A;  4WXT A;  1THO A;  4RQR A;  1ZGN A;  2WGR A;  4K5R A;  5IMD A;  3IDV A;  3TRP A;  2V6O A;  4OO4 A;  3TJF A;  4AJ6 A;  5DJL A;  1FVK A;  3APO A;  3VFI A;  3EU4 A;  2KP1 A;  4OMV A;  4F03 A;  2IWT A;  2VD0 A;  4GWR A;  1G7O A;  1SKS B;  3M8N A;  6GSW A;  2LRC A;  1A2J A;  2C0G A;  4HJM A;  1OKD A;  2GST A;  5KN2 A;  5DVB A;  1GSQ A;  3VWV A;  1DUG A;  2GGT A;  1SD9 A;  4O5R A;  3QOU A;  5D96 A;  3TJB A;  4N11 A;  3FEU A;  3NZN A;  4TXO A;  20GS A;  2R2J A;  4OCE A;  2DKI A;  2N5B A;  4ULX A;  3LSZ A;  1GP1 A;  5JCW A;  1K0D A;  2GS3 A;  4IS0 A;  5J3R A;  1SKR B;  4HUA A;  4XS1 A;  3RPP A;  3CRT A;  5L71 A;  4L5O A;  2G2Q A;  1S3D A;  1T1V A;  4ZL9 A;  1TJD A;  2XPE A;  3HD5 A;  4FYU A;  1ST9 A;  1AXD A;  2HZF A;  2CVB A;  3GIX A;  4L0U A;  4K7I A;  4MJC A;  1TKD B;  5CRW A;  2B1L A;  4NAX A;  5IMC A;  3CMI A;  4GQC A;  4JU5 A;  5IIZ A;  4QQ7 A;  1XWB A;  1PKZ A;  2YAN A;  2H70 A;  3HVV A;  1XPV A;  2R6K A;  2A2S A;  5F05 A;  1W89 A;  1SD8 A;  4TXO B;  2HRA A;  3UBL A;  4FH8 A;  2L6D A;  4PUF C;  2JZR A;  3LW9 A;  4MZC A;  5A4U A;  2I1U A;  1Z3E A;  1PKW A;  2IMD A;  4XRD A;  1GSE A;  1GTB A;  4N30 A;  1B9X C;  1F37 A;  1OVN A;  1V2A A;  2VCZ A;  1GRX A;  2O85 A;  5FT3 A;  4POB A;  3DEX A;  3DYR A;  5HFG A;  2IMK A;  2PUK C;  2X8H A;  4RQX A;  5CRE A;  3VPQ A;  4Q5N A;  2VIM A;  2YWO A;  1S3A A;  4EKZ A;  2VLV A;  1EP7 A;  3L4N A;  1A2L A;  2TRX A;  4YKG A;  1KEB A;  1GNE A;  3IV4 A;  4MPG A;  2LRT A;  1WJK A;  2M80 A;  4POM A;  4J56 E;  1AAZ A;  3KCM A;  5ECN B;  1AIU A;  2NBS A;  3M0F A;  3GYK A;  2WCI A;  5D9X A;  3HJP A;  2D2Z A;  1M2B A;  4LL4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...