4KNDA

Thioredoxin from anaeromyxobacter dehalogenans.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
b'DVVVLQDSTFEQEVLKSDTPVLVDFWAVWCGPCKAIAPVVDDLAARYKGKLKVAKMDVDQHQGVPQQYGIRSIPTLLVFKGGRVVDTVIGADKTRLEDSVKKAIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Thioredoxin from Anaeromyxobacter dehalogenans.
rcsb
source organism Anaeromyxobacter dehalogenans
molecule tags Oxidoreductase
total genus 28
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4kndA00
1ZZYA 1V58A 2C0EA 2R37A 4JZQA 4QL9A 2L4QA 2HYXA 2PU9C 1CQGA 2B1KA 3H8QA 3LGCA 3HXSA 5CRHA 2OACA 4LMVA 5F06A 3ZYWA 5J3RA 2CX3A 5IIZA 3DVWA 3TOUA 2K9FA 1S3AA 3G9BA 3TKRA 3VPTA 2IN3A 1XWBA 3QPMA 3L78A 3TRPA 1M2DA 1TTZA 1TDIA 4JE1A 1KBNA 2G0FA 2CAIA 4XCSA 4JBBA 1UC7A 4X1UA 3FR9A 2C0DA 2OBKA 3C1SA 2YCDA 1ZYEA 1TK5B 1EGRA 1B9YC 3DGQA 3A2VA 1SL2B 2X8HA 4MF5A 1EP8A 2L4CA 2JZSA 5FHIA 1AIUA 1M0UA 1AXDA 3U5RE 2C3TA 1TOFA 5DALB 2L57A 4D73A 4ZL8A 2JZTA 2GSQA 3GN3A 5FT3A 4O92A 5JCWA 4TRXA 2K8SA 1BQ7A 1WPIA 5EVOA 4KAEA 3EU3A 2YANA 1F3BA 2VL9A 3KEBA 3M1GA 1SU9A 3JCML 1TRVA 4KCEA 1X5DA 4XS6A 1M2AA 4I8BA 4PGTA 4XHMA 4LMWA 5B7CA 4ECJA 5F8BA 4JEDA 2ZUPA 4KDXA 3IA1A 5ELGA 3FZ4A 4O7HA 5GSTA 1TJDA 3KM6A 4Q5RA 2VO4A 3HCZA 4WXTA 2FWHA 3IC4A 4ZB6A 5IMDA 3IOSA 1FVJA 1GULA 4L8EA 3O6TA 3QDNA 3ME7A 1V40A 4D73B 1PL1A 1Z7RA 5IMFA 5INYA 3IAS2 18GSA 4YQUA 4FO5A 3GL5A 1WIKA 1R5AA 3GSTA 1NHYA 4I2TA 1KNGA 5G2ZA 5ECLB 4I2UA 3F8UA 3GTUA 3VI5A 4CW9A 3HZ8A 4TOPA 2WDUA 1X5EA 1HQOA 4WBRD 5A4UA 3ZIVA 1NHOA 1U3IA 4IJIA 4PQHA 1B4PA 5JWRB 1JHBA 4MCUA 2D2ZA 2VUPA 2NPBA 2P31A 2OA7A 3GIXA 4BA7A 1MTCA 3O76A 1E2YA 4J56E 1OE8A 4AJ8A 5IM9A 3EU4A 4TR0A 4EO3A 4F82A 5AGYA 5HQPA 1GSDA 1SD9A 6GSSA 3D6IA 2O7KA 4F03A 2GSTA 3HDCA 2ALBA 1SKWB 4KW6A 5CREA 2FWGA 1YDKA 3RAZA 3IK7A 3FW2A 4EXJA 3LORA 4OFTA 1DE1A 2C1YA 1ZYQB 1I5GA 1YQ1A 4PX1A 4WF5A 4ECBA 3PGTA 2YJHA 2GGTA 2H30A 1T1VA 1GSQA 2GSRA 2MBTA 4MH3A 3FHKA 3VWXA 2LKUA 1A2JA 1THXA 2CZ2A 4N30A 4XS4A 3A5WA 1V98A 2I81A 4EE0A 3F63A 3GTUB 3GA4A 5D8IA 1OYJA 2AB6A 1E6BA 3TKSC 4PQ1A 3DRNA 1BAYA 2PBJA 4HUAA 5DBQA 3LFLA 4V1Ag 3LXTA 3ME8A 1AAZA 3DIEA 3RDWA 1GTBA 4AJ7A 2XC2A 1XFLA 4YQVA 5JCUA 5J4UA 1ON4A 1JFUA 2YWMA 4FH8A 1PX7A 4F0BA 2IPAA 4GXZA 4TR1A 2YNXA 2O89A 1EOGA 2P5RA 5J9CA 3E0UA 3GURA 3Q18A 2OKAA 2B6MA 3VK9A 3TUEA 2B5XA 2L5OA 4XRAA 2YZUA 3P8WA 1Y25A 4XS4B 1O85A 1GL8A 3NOFA 4F0CA 1FOVA 2MMZA 4GSNA 1FW1A 1UA5A 1ML6A 3GH6A 2VIMA 3FKFA 4TXOA 1OKTA 3I43A 1Q98A 4WR4A 4GWRA 3IBHA 1O81A 4K8MA 2IJYA 3L0HA 5D73A 1G6WA 1LJRA 3US3A 5JWOB 3M3MA 4HOJA 4XTSA 2FA8A 3MNGA 4TR1B 1GSUA 1FB6A 1C72A 1ILOA 4RI6A 2F3MA 2MYGA 4EVMA 1XXUA 1GSEA 1J08A 3A2XA 3L9VA 5HR1A 2AV4A 3EINA 2DSAA 3UIWA 1X0RA 3LQ7A 9GSSA 3HJOA 2X8CA 5D9XA 2FCHA 3KMOA 1FO5A 1AQVA 3BD2A 3MSZA 1A2LA 1FB0A 1TKDB 1PD21 2YWIA 4WR5A 3V1WA 3GH9A 6GSYA 3VI7A 2LJAA 1SJZA 1QK8A 1GUMA 2RM5A 2OE1A 3EE2A 2H71A 2LUSA 4TXOB 4FIWA 3ERFA 2GT6A 1ST9A 1YEXA 2BMXA 1T00A 3HYPA 1TI3A 2MMOA 4NXIA 4OFMA 4MA9A 3CSHA 5CRGA 3CRTA 4Z7XA 4KCAA 5G30A 4OWYA 1XW6A 2REMA 3MAKA 2V2GA 1G7EA 3QAVA 4CHSA 2C8UA 1DSBA 3LYPA 5CYYA 1LU4A 4AF2A 3KJYA 4YAPA 3VFIA 2GSSA 1SYRA 4K0GA 2LRNA 2FWEA 2WJUA 1JZRA 2F51A 4IN0A 2JACA 1EEJA 5IMCA 1MEKA 3I6AA 2VL2C 5E4WA 2DMMA 14GSA 2H75A 1PQNA 3L9UA 6GSVA 1XCCA 2PERA 4NAXA 3F0IA 3F4RA 1Z3EA 4E8HA 1GP1A 2H19A 3FEUA 1SKRB 2F8AA 3HY2A 1O73A 3R2QA 4WETA 2HSYA 2BTOT 1FHEA 5CAXA 5HR3A 4EC0A 2P0GA 1K0DA 2CA8A 5ECMB 2KUCA 3WGEA 3LEFA 2FY6A 2MMNA 4N11A 4BWQA 2FWFA 4KSOA 1WOUA 2J23A 5HR2A 3HVXA 3Q74A 1VRSD 3UL3A 3HA9A 2HZEA 1HYUA 1TXXA 4FYBA 3UVTA 1SJIA 3C7MA 3PR8A 4EKZA 1BEDA 2EIQA 1FAAA 2AHEA 2WFCA 3P90A 2C80A 2VOCA 3UJ1A 3GKMA 3ZVJA 2HT9A 4K0NA 2GQMA 1XWAA 2WCIA 2R4VA 4GSTA 4ZBBA 5HR0A 1MD4A 5GSSA 2H1DA 1VGLA 1ERUA 4RQRA 1EWXA 4RI7A 1DE2A 1XOAA 2OBIA 4POKA 2NBSA 2TIRA 3H1NA 1GUHA 2VLTA 2QSIA 3I9V2 2V6KA 4ZIJA 1K0AA 2DLXA 2RM6A 2KP2A 2DJ3A 2HZEB 3CBUA 3M8NA 3VURA 5AIXA 2HFDA 3KP9A 3TKPA 1M9AA 3TKQA 1G6YA 2H76A 3F9UA 3M9JA 2E2GA 2R6KA 3C1RA 3TJKA 2B1LA 3H93A 5CO3A 4GF0A 1X5CA 1TP9A 4HU9A 1GTIA 1NSWA 5D96A 3SWLA 3G7YA 4DSRA 1OC9B 4OMVA 4X43A 4MF6A 2VCTA 4MABA 1GTAA 1V2AA 1O6JA 3ZREA 3FR3A 1M7TA 2PMTA 4WF4A 3S9FA 1SKSB 1YZXA 2C3NA 4LA1A 4MLYA 4BL7A 2N5BA 5B8BA 1EZKA 5ECQB 3ZRDA 4FYCA 5IPHA 3TGZA 1ZCPA 4JR6A 1SL1B 2HNLA 1F9MA 3SBCA 1A24A 2LEGA 1WMJA 3FR6A 4MH2A 2VCVA 4N0ZA 2VM1A 4MJEA 3TDGA 4PUAA 3CXGA 4G9HA 2XPEA 5ECOB 5KEJA 1U6TA 1A8YA 2AYTA 1RK4A 1QUWA 4GLTA 5LD0A 4POLA 3GUSA 2DJ2A 1T7PB 1YKCA 4YAVA 2H73A 4NV2A 4E8EA 5G1LA 3TJGA 3NIVA 2JL4A 1GLQA 2V6OA 5JCGA 2HI7A 2DJKA 4OO5A 3TB2A 5ECPB 4MJCA 1ERTA 3N9JA 4DSQA 1BG5A 2CQ9A 17GSA 2GT5A 3P2AA 3W6GA 3G7JA 3M9KA 1YEPA 5IO0A 1GWCA 1K0NA 2H70A 5G31A 3PINA 1XBSA 1NW2A 1PA3A 4GTUA 5ID2A 2O87A 1ERWA 2EIRA 1MDIA 2HLSA 1VF4A 2MMAA 3WD6A 5ECIB 4V1Ap 2B5EA 4PURA 5HFKA 2GZYA 3EMPA 3HJMA 1O7UA 1ERVA 2P5QA 3HHVA 4YH2A 4GQCA 1PN9A 3GSSA 2H1BA 4Q5FA 3ZIJA 1SENA 1X9SB 1AQXA 3TKSA 4EDYA 2DIZA 2OJLA 4XRDA 1PGTA 2H6XA 3ZITA 1XPVA 3L4NA 3ERGA 1Q4JA 3IK9A 2H74A 2JADA 2GS3A 6GSWA 1A23A 4ILFA 3HKRA 2LQQA 4PQIA 1I9DA 2XHFA 4ECCA 2VLVA 3TKSE 2VD0A 1QMVA 1WWJA 3F4SA 3KTBA 2TRXA 2PPTA 1OE7A 4MPGA 3HJPA 4EDZA 1SK0A 1EP7A 4MJBA 5ID2B 4KB3A 6GSTA 2HE3A 5ECHB 2PVOC 1O8WA 3KGKA 4ZBAA 1LBKA 2WS2A 20GSA 4MF7A 3TJBA 4AJ6A 4KDYA 4KH7A 1HNAA 5CNWA 5B6NA 4HZ2A 2YV9A 4K6XA 1JZOA 4KA0A 2E7PA 2OE0A 3D21A 5LNKe 3TOTA 1OVNA 2H0HA 3PH9A 1QQ2A 2NDOA 4HQSA 3F6FA 4GSSA 2R5GA 1TRSA 4TN8A 2B3SA 2IFQA 2A2SA 3EMXA 2IIYA 5ELAA 4IQ1A 4MDCA 3C73A 4IHUA 3U6VA 1H75A 4LL1B 2YV7A 3KZQA 2H8LA 2IWTA 4ISDA 3GKXA 5DAKA 2ZCTA 1XVWA 2I1UA 3CTFA 2LJKA 5D9WA 4DVCA 1T4YA 5L71A 2HXKA 2VCQA 1PX6A 1GNWA 4CDOA 4EF0A 2CVBA 1U87A 1W4VA 1TRUA 5C00A 1ACVA 2DC5A 4MMMA 2QC7A 4TW5A 3ZLPA 4BWSA 5EY6A 4I6XA 1R7HA 1AQWA 5B8AA 4F9ZA 1K0OA 2M80A 3P7XA 1WJKA 2H72A 2RLIA 3GNJA 3D4TA 3GYKA 2IFQB 3VWWA 1V9WA 2C4JA 4ML6A 1JZWA 3ZFBA 2WZ9A 1B48A 2YN1A 3QOUA 3QD9A 3BBYA 5ABRA 2J9HA 1USBA 2X64A 5DAKB 4G19A 1Z6MA 4L0UA 2LJRA 3DVXA 2H1AA 2LRCA 5A5KA 5F05A 2C3QA 4IBPA 3GMFA 3ZZXA 4O5RA 3W8JA 4JRRA 2LQOA 16GSA 4NPBA 2VL2A 2B7JA 4ML1A 5AIVA 5DCGA 2YWNA 1VF1A 1WRYA 3WGDA 5KN2A 19GSA 2PVQA 3CRUA 1T3BA 2I3YA 4K2DA 4NHWA 2ON5A 5A4VA 2A4VA 4MK3A 3CMIA 1SK1A 4BVXA 4NWYA 3EWLA 5G5EA 2EC4A 2HRFA 4TXVA 4BVYA 3D4MA 1QGVA 2GDRA 2I4AA 2K6VA 2NVLA 5H5QA 5AN1A 4K1FA 4K7NA 1B4QA 3C8EA 3GKNA 5DCHA 7GSSA 2B7KA 2AAWA 4XIHA 3EC3A 2GTUA 3QFAC 1XW5A 1U88A 4POMA 3ZTLA 1TU7A 4F2IA 5AISA 2ZNMA 5KN3A 2AJQB 4Q5NA 2XBQA 3KH7A 2CVDA 1HNBA 1K3YA 4QL7A 1XZOA 1T4ZA 5KN0A 3TCOA 3QAWA 3FZ9A 1OC3A 4DSSB 2DIYA 1J0FA 1OKDA 2E2MA 4N0VA 3J7Yb 4G10A 2VAFA 4HU7A 2L6DA 3UAPA 3KTLA 1QXHA 1X9MB 3KD0A 4V2LA 1FVKA 3F6DA 4G2EA 12GSA 2QKEA 5IMZA 3ED3A 4H86A 2RUEA 4IS0A 4EL1A 3MDKA 3FZAA 2R3XA 2FUG2 4MJAA 5CP1A 2PWJA 1SJ6A 1GSSA 2HZFA 1PKZA 1F37A 1R5PA 3GV1A 5D93A 2GZPA 2O8VB 1M9BA 13GSA 3DKSA 1GRXA 4PUFC 1OAZA 4IP1A 1Z5YE 2O85A 4IGJA 1THOA 5ECSA 4O32A 5GAPD 1OC9A 3ZMKA 3CTGA 4HDEA 6GSUA 2FA4A 3HVVA 3BCIA 1BX9A 5HFIA 3UVHA 2R2JA 4OCFA 1EGOA 3VWVA 1SL0B 2VCXA 2CZ3A 5J9BA 4V2NA 5ENUA 3KMNA 5EPFA 4OCEA 4IJ3A 5F07A 2XBIA 1KTEA 5EL8A 3Q19A 2LNSA 4PXOA 1GSYA 1PL2A 3LWAA 2H0GA 4L5LA 4ACSA 5IOXA 1TI1A 4QQ7A 2JSYA 1YF0A 1TK0B 3DWVA 4Q5QA 4ZL7A 2CV4A 3VPQA 4NMUA 3APSA 11GSA 2I9HA 3KCMA 5G1KA 2WRTA 2JU5A 1CQHA 3UARA 3E3EA 5DVBA 1J9BA 2JSZA 2ON7A 3D22A 1PSQA 3RHCA 1R26A 1OC8A 3UBKA 2TRCP 2E0QA 3LYKA 4IELA 1BJXA 2M72A 3KIJA 4ZXGA 3TJFA 3J7Yk 1WE0A 1M99A 2GVPA 3IPZA 5COHA 3F3QA 2A2RA 3KH9A 2H6ZA 3OR5A 2H01A 4NV5A 4X0XA 2N5FA 3RHBA 2RIIA 5B6MA 2FD3A 1EV9A 1N8JA 2LS5A 5GZZB 1VF2A 4OD7A 5DDLA 3LSZA 1TU8A 1HD2A 3VWUA 2MZCA 5GAND 2FHEA 1Z9HA 3FZ5A 2OADA 3GX8A 4GRFA 2LRTA 2C0FA 3KP8A 2DJ0A 1WP0A 3WGXA 1G7OA 1EEMA 2AUVA 4BPYA 4V2MA 1NM3A 4KNDA 3FYGA 2L59A 4KSMA 1MDJA 3EURA 22GSA 5IQYA 4HEA2 2L6CA 4DEJA 1FG4A 1GTUA 4TVEA 3I69A 2PUKC 1IYIA 4MPFA 2HSHA 3UEMA 2GLRA 4EUYA 2WB9A 2VL3A 1GUKA 1Z7PA 2V1MA 3HVSA 1JLVA 2K18A 2FGXA 5IPGA 4JU5A 4K9ZA 3EVIA 3H4KA 3QFBC 5IMAA 2FLSA 1MD3A 4LL4B 5DJMA 3K8NA 3ISOA 2KHPA 5A4WA 1F3AA 3DD3A 2X99A 3ERWA 4I97A 3LJRA 5ECRB 4HZ4A 4POBA 1VF3A 4AGSA 5JWQB 1URMA 2B5YA 5DQYA 4KUNA 2NTOA 3IE3A 3E9JB 2IMFA 3RPNA 1GH2A 1HNCA 2YJ7A 3DMLA 3RBTA 4HQZA 2IMIA 5G5FA 2KLXA 4HJ2A 4K7OA 2BJXA 1R4WA 3GFKA 4KDUA 10GSA 4PNGA 3D5JA 1T8EB 3GKKA 3IRAA 5LCZA 2VCZA 4WBJA 2CVKA 5D9TA 2DJ1A 1N2AA 1AW9A 2DJJA 3UMAA 3IAM2 5HFGA 4OO4A 3TRXA 4ZBDA 4HS1A 1W89A 3QR6A 1A0FA 3BOAA 5IMVA 4XS1A 4LLRA 3F3RA 4WEYA 1K3LA 1EOHA 1PKWA 1PRXA 1QFNA 1YY7A 3QAGA 2X8GA 3N5OA 2GZZA 4TKYA 2IMEA 4J57E 1AC1A 5DQSA 2YZHA 1YF1A 2Z9SA 1YKAA 3TRQA 3CSJA 1A0RP 1TW9A 4ZL9A 1GSFA 5CRDA 3Q6OA 3TJJA 5KN1A 3BCKA 1V57A 5J5NA 1K0CA 2OE3A 2EIOA 2HRNA 1TK8B 3H79A 1ABAA 5D9VA 1ZMAA 3HZ4A 1YJ6A 4IQAA 2H66A 3WT1A 1ZGNA 5IO2A 1UVZA 1JZDA 4KX4A 2VCWA 1Y6EA 3L9SA 2KOKA 3VLNA 2LTKA 3D0ZA 4KGIA 3FY7A 1A8LA 3IXRA 4L5OA 1XVQA 4ZB8A 1XIYA 2F9SA 2VLUA 1PMTA 2RUFA 2YP6A 3RPPA 4ID0A 4J2FA 4RUVA 1AUCA 3APQA 4I5QA 4ECIA 2H0IA 1H4OA 5IOWA 3DEXA 5CRWA 1XWCA 2VM2A 2GQKA 1UN2A 1DBYA 1TRWA 1O8XA 2ES7A 2L5LA 3G7IA 4MZCA 3IV4A 4HJMA 1B8XA 3WT2A 2KP1A 1M2BA 1K3OA 1A2MA 3NZNA 1RW1A 1G0TA 4HI7A 5DJLA 3AY8A 3IR4A 2JZRA 4PNFA 1RQMA 3GX0A 2H6YA 3ZL5A 1BYEA 5ECKB 3DYRA 3M0FA 3WYWA 4P3YB 2IL3A 5E59A 4DSSA 2DBCA 4MZWA 2G2QA 4WKWA 5FWGA 1ZOFA 1U3AA 1F2EA 2IMKA 1KEBA 3UOMA 3BJ5A 2CAQA 4KE3A 1F6MC 1XOBA 4NHZA 4K7IA 2PN8A 1GNEA 1K0MA 3DXBA 5J41A 3ZVJD 1SK2A 2PGTA 2IMDA 3A2WA 2M46A 1XWGA 2WGRA 3O3TA 4IP6A 3HD5A 3C71A 5ECNB 3A3TA 3F4TA 2CX4A 3GRXA 3KXOA 4ZILA 3ZMLA 1JLWA 2WULA 1K0BA 5F0GA 6GSXA 1ZL9A 2N5AA 3QMXA 1SD8A 2C0GA 3IDVA 1IYHA 4N10A 5H5SA 3APOA 2XPDA 5C04A 2QGVA 3LG6A 2GQLA 1SYXA 4GCIA 2V32A 4IW9A 2LV3A 3LXZA 2F8FA 2K8VA 1B9XC 4YQMA 2LNTA 2DMLA 1DUGA 1GLPA 2VD1A 4FYUA 3FK8A 1Z6NA 1MDKA 4JR4A 4IVFA 2CT6A 3GHAA 4GQFA 3GL3A 2YPMA 3IHQA 4TR4A 1EV4A 3QCPA 4ZB9A 3W8SA 3CSIA 2MBSA 4IKHA 1XW9A 1XWKA 1S3CA 3UBLA 4MP4A 5H5RA 1X9WB 5DALA 2YWOA 2V41A 4ULXA 3FRCA 4TR3A 3EYTA 4L0WA 4RQXA 2H1GA 4MZBA 2FNOA 2YOIA 3CYNA 3ZFLA 1S3DA 8GSSA 2LSTA 3MWHA 4OFNA
chains in the Genus database with same CATH superfamily
1ZZYA 1V58A 2C0EA 2R37A 4JZQA 4QL9A 2L4QA 2HYXA 2PU9C 1CQGA 2B1KA 3H8QA 3LGCA 3HXSA 5CRHA 2OACA 4LMVA 5F06A 3ZYWA 5J3RA 2CX3A 5IIZA 3DVWA 3TOUA 2K9FA 1S3AA 3G9BA 3TKRA 3VPTA 2IN3A 1XWBA 3QPMA 3L78A 3TRPA 1M2DA 1TTZA 1TDIA 4JE1A 1KBNA 2G0FA 2CAIA 4XCSA 4JBBA 1UC7A 4X1UA 3FR9A 2C0DA 2OBKA 3C1SA 2YCDA 1ZYEA 1TK5B 1EGRA 1B9YC 3DGQA 3A2VA 1SL2B 2X8HA 4MF5A 1EP8A 2L4CA 3A5IA 2JZSA 5FHIA 4EIPA 1AIUA 1M0UA 1AXDA 3U5RE 2C3TA 1TOFA 5DALB 2L57A 4D73A 4ZL8A 2JZTA 2GSQA 3GN3A 5FT3A 4O92A 5JCWA 4TRXA 2K8SA 1BQ7A 1WPIA 5EVOA 4FQUA 4KAEA 3EU3A 2YANA 1F3BA 2VL9A 3KEBA 3M1GA 1SU9A 3JCML 1TRVA 4KCEA 1X5DA 2QA1A 4XS6A 1M2AA 4I8BA 4PGTA 4XHMA 4LMWA 4Z2UA 5B7CA 4ECJA 5F8BA 4JEDA 2ZUPA 4KDXA 3IA1A 5ELGA 3FZ4A 4O7HA 5GSTA 1TJDA 3KM6A 4Q5RA 2VO4A 1PFOA 3HCZA 4WXTA 2FWHA 3IC4A 4ZB6A 5IMDA 3IOSA 1FVJA 1GULA 4L8EA 3O6TA 3QDNA 3ME7A 1V40A 4D73B 1PL1A 1Z7RA 5IMFA 5INYA 3IAS2 18GSA 4YQUA 2QA2A 4FO5A 3GL5A 1WIKA 1R5AA 3GSTA 1NHYA 4I2TA 1KNGA 5G2ZA 5ECLB 4I2UA 3F8UA 3GTUA 3VI5A 4CW9A 3HZ8A 4TOPA 2WDUA 1X5EA 1HQOA 4WBRD 5A4UA 3ZIVA 1NHOA 1U3IA 4IJIA 4PQHA 1B4PA 5JWRB 1JHBA 4MCUA 2D2ZA 2VUPA 2NPBA 2P31A 2OA7A 3GIXA 4BA7A 1MTCA 3O76A 1E2YA 4J56E 1OE8A 4AJ8A 5IM9A 3EU4A 4TR0A 4EO3A 4F82A 5AGYA 5HQPA 1GSDA 1SD9A 6GSSA 3D6IA 2O7KA 4F03A 2GSTA 3HDCA 2ALBA 1SKWB 4KW6A 5CREA 2FWGA 1YDKA 3RAZA 3IK7A 3FW2A 4EXJA 3LORA 4OFTA 1DE1A 2C1YA 1ZYQB 1I5GA 1YQ1A 4PX1A 4WF5A 4ECBA 3PGTA 2YJHA 2GGTA 2H30A 1T1VA 1GSQA 2GSRA 2MBTA 4MH3A 3FHKA 3VWXA 2LKUA 1A2JA 1THXA 2CZ2A 4N30A 4XS4A 3A5WA 1V98A 2I81A 4EE0A 3F63A 3GTUB 3GA4A 5D8IA 1OYJA 2AB6A 1E6BA 3TKSC 4PQ1A 3DRNA 1BAYA 2PBJA 4HUAA 3LFLA 3LXTA 4V1Ag 3ME8A 5DBQA 1AAZA 3DIEA 3RDWA 1GTBA 4AJ7A 4G0LA 2XC2A 1XFLA 4BIKA 4YQVA 5JCUA 5J4UA 1ON4A 1JFUA 2YWMA 4FH8A 1PX7A 4F0BA 2IPAA 4GXZA 4TR1A 2YNXA 2O89A 1EOGA 2P5RA 5J9CA 2X4AA 3E0UA 3GURA 3Q18A 2OKAA 2B6MA 4YKFA 3VK9A 3TUEA 2B5XA 2L5OA 4XRAA 2YZUA 3P8WA 1Y25A 4XS4B 1O85A 1GL8A 3NOFA 4F0CA 1FOVA 2MMZA 4GSNA 1FW1A 1UA5A 1ML6A 3GH6A 2VIMA 3FKFA 4TXOA 1OKTA 3I43A 1Q98A 4WR4A 4GWRA 3IBHA 1O81A 4K8MA 2IJYA 3L0HA 5D73A 1G6WA 1LJRA 3US3A 5JWOB 3M3MA 4HOJA 4XTSA 2FA8A 3MNGA 4TR1B 1GSUA 1FB6A 1C72A 1ILOA 4RI6A 2F3MA 2MYGA 4EVMA 1XXUA 1GSEA 1J08A 3A2XA 1ZYPA 3L9VA 5HR1A 2AV4A 3EINA 2DSAA 3UIWA 1X0RA 3LQ7A 9GSSA 3HJOA 2X8CA 5D9XA 2FCHA 3KMOA 1FO5A 3R3EA 1AQVA 3BD2A 3MSZA 1A2LA 1FB0A 2DKIA 1TKDB 1PD21 2YWIA 4WR5A 3V1WA 3GH9A 6GSYA 3VI7A 2LJAA 1SJZA 1QK8A 1GUMA 2RM5A 2OE1A 3EE2A 2H71A 2LUSA 4TXOB 4FIWA 3ERFA 2GT6A 1ST9A 1YEXA 2BMXA 1T00A 3HYPA 1TI3A 2MMOA 4NXIA 4OFMA 4MA9A 3CSHA 5CRGA 2R0CA 3CRTA 4Z7XA 4KCAA 5G30A 4OWYA 1XW6A 2REMA 3MAKA 2V2GA 1G7EA 3QAVA 4CHSA 2C8UA 1DSBA 3LYPA 5CYYA 1LU4A 4AF2A 3KJYA 4YAPA 3VFIA 2GSSA 4MNNA 1SYRA 4K0GA 2LRNA 2FWEA 2WJUA 1JZRA 2F51A 4IN0A 2JACA 1EEJA 5IMCA 1MEKA 3I6AA 2VL2C 1XG8A 5E4WA 2DMMA 14GSA 2H75A 2R0GA 1PQNA 3L9UA 6GSVA 1XCCA 2PERA 4NAXA 3F0IA 3F4RA 1Z3EA 4E8HA 1GP1A 2H19A 3FEUA 1SKRB 2F8AA 3HY2A 1O73A 3R2QA 4WETA 2HSYA 2BTOT 1FHEA 5CAXA 5HR3A 4EC0A 2P0GA 1K0DA 2CA8A 5ECMB 2KUCA 3WGEA 3LEFA 2FY6A 4KF9A 2MMNA 4N11A 4BWQA 2FWFA 4KSOA 1WOUA 2J23A 5HR2A 3HVXA 3Q74A 1VRSD 3UL3A 3HA9A 2HZEA 1HYUA 4BVXB 1TXXA 4FYBA 3UVTA 1SJIA 3C7MA 3PR8A 4EKZA 1BEDA 2EIQA 1FAAA 2AHEA 2WFCA 3P90A 2C80A 2VOCA 3UJ1A 3GKMA 3ZVJA 2HT9A 4K0NA 2GQMA 1XWAA 2WCIA 2R4VA 4GSTA 4ZBBA 5HR0A 1MD4A 5GSSA 2H1DA 1VGLA 1ERUA 4RQRA 1EWXA 4RI7A 1DE2A 1XOAA 2OBIA 4POKA 2NBSA 2TIRA 3H1NA 1GUHA 2VLTA 2QSIA 3I9V2 2V6KA 4ZIJA 1K0AA 1ZYNA 2DLXA 2RM6A 2KP2A 2DJ3A 2HZEB 3CBUA 3M8NA 3VURA 5AIXA 2HFDA 3KP9A 3TKPA 1M9AA 3TKQA 1G6YA 2H76A 3F9UA 3M9JA 2E2GA 2R6KA 3C1RA 3TJKA 2B1LA 3H93A 5CO3A 4GF0A 1X5CA 1TP9A 4HU9A 3EPTA 1GTIA 1NSWA 5D96A 3SWLA 3G7YA 4DSRA 1OC9B 4OMVA 4X43A 4MF6A 2VCTA 4MABA 1GTAA 1V2AA 1O6JA 3ZREA 3FR3A 1M7TA 2PMTA 4WF4A 3S9FA 1SKSB 4G0KA 1YZXA 2C3NA 4LA1A 4MLYA 4BL7A 2UZ8A 2N5BA 5B8BA 1EZKA 5ECQB 3ZRDA 4FYCA 5IPHA 3TGZA 1ZCPA 4JR6A 1SL1B 2HNLA 1F9MA 3SBCA 1A24A 2LEGA 1WMJA 3FR6A 4MH2A 2VCVA 4N0ZA 2VM1A 4MJEA 3TDGA 4PUAA 3CXGA 4G9HA 2XPEA 5ECOB 5KEJA 1U6TA 1A8YA 2AYTA 1RK4A 1QUWA 4GLTA 5LD0A 4POLA 3CQFA 3GUSA 2DJ2A 1T7PB 1YKCA 4YAVA 2H73A 4NV2A 4E8EA 5G1LA 3TJGA 3NIVA 2JL4A 1GLQA 2V6OA 5JCGA 2HI7A 2DJKA 4OO5A 3TB2A 5ECPB 4MJCA 1ERTA 3N9JA 4DSQA 1BG5A 2CQ9A 17GSA 2GT5A 3P2AA 3W6GA 3G7JA 3M9KA 1YEPA 1M3IA 5IO0A 1GWCA 4USSA 1K0NA 2H70A 5G31A 3PINA 1XBSA 1NW2A 1PA3A 4GTUA 5ID2A 2O87A 1ERWA 2EIRA 4BL7B 1MDIA 2HLSA 2HRAA 1VF4A 2MMAA 3WD6A 5ECIB 4V1Ap 2B5EA 4Z2RA 4PURA 5HFKA 2GZYA 3EMPA 3HJMA 1O7UA 1ERVA 2P5QA 3HHVA 4YH2A 4GQCA 1PN9A 3GSSA 2H1BA 4Q5FA 3ZIJA 4YKGA 1SENA 1X9SB 1AQXA 3TKSA 4EDYA 2DIZA 2OJLA 4XRDA 1PGTA 2H6XA 3ZITA 1XPVA 3L4NA 3ERGA 1Q4JA 2X49A 3IK9A 3PPUA 2H74A 2JADA 2GS3A 6GSWA 1A23A 4ILFA 3HKRA 2LQQA 1M3JA 1I9DA 4PQIA 2XHFA 4ECCA 2VLVA 3TKSE 2VD0A 1QMVA 1WWJA 3F4SA 3KTBA 2TRXA 2PPTA 1OE7A 4MPGA 3HJPA 4EDZA 1SK0A 1EP7A 4MJBA 5ID2B 4KB3A 6GSTA 2HE3A 5ECHB 2PVOC 1O8WA 3KGKA 4ZBAA 1LBKA 2WS2A 20GSA 4MF7A 3TJBA 4AJ6A 4KDYA 4K5RA 4KH7A 1HNAA 5CNWA 5B6NA 4HZ2A 2YV9A 4K6XA 1JZOA 4KA0A 2E7PA 2OE0A 3D21A 5LNKe 3TOTA 1OVNA 4X4JA 2H0HA 3PH9A 1QQ2A 2NDOA 4HQSA 3F6FA 4GSSA 2R5GA 1TRSA 4TN8A 2B3SA 2IFQA 2A2SA 3EMXA 2IIYA 5ELAA 4IQ1A 4MDCA 3C73A 4IHUA 3U6VA 1H75A 4LL1B 2YV7A 3KZQA 2H8LA 2IWTA 4ISDA 3GKXA 5DAKA 2ZCTA 1XVWA 2I1UA 3CTFA 2LJKA 5D9WA 4DVCA 1T4YA 5L71A 2HXKA 2VCQA 1PX6A 1GNWA 4CDOA 4EF0A 2CVBA 3MYDA 1U87A 1W4VA 1TRUA 5C00A 1ACVA 3FMWA 2DC5A 4MMMA 2QC7A 4TW5A 3ZLPA 4BWSA 5EY6A 4I6XA 1R7HA 1AQWA 5B8AA 4F9ZA 1K0OA 2M80A 3P7XA 1WJKA 2H72A 2RLIA 3GNJA 3D4TA 3GYKA 2IFQB 3VWWA 1V9WA 2C4JA 4ML6A 1JZWA 3ZFBA 2WZ9A 1B48A 2YN1A 3QOUA 3QD9A 3BBYA 5ABRA 2J9HA 1USBA 2X64A 5DAKB 4G19A 1Z6MA 4L0UA 2LJRA 3DVXA 2H1AA 2LRCA 5A5KA 5F05A 2C3QA 4IBPA 3GMFA 3ZZXA 4O5RA 3W8JA 4JRRA 2LQOA 16GSA 4NPBA 2VL2A 2B7JA 4ML1A 5AIVA 5DCGA 2YWNA 1VF1A 1WRYA 3WGDA 5KN2A 19GSA 2PVQA 3CRUA 1T3BA 2I3YA 4K2DA 4NHWA 2ON5A 5A4VA 2A4VA 4MK3A 3CMIA 1SK1A 4BVXA 4NWYA 3EWLA 5G5EA 2EC4A 2HRFA 4TXVA 4BVYA 3D4MA 1QGVA 2GDRA 2I4AA 2K6VA 2NVLA 5H5QA 5AN1A 4K1FA 4K7NA 1B4QA 3C8EA 3GKNA 1S3RA 5DCHA 7GSSA 2B7KA 2AAWA 4XIHA 3EC3A 2GTUA 3QFAC 1XW5A 1U88A 4POMA 3ZTLA 1TU7A 4F2IA 5AISA 2ZNMA 5KN3A 2AJQB 4Q5NA 2XBQA 3KH7A 2CVDA 4EIQA 1HNBA 4HSCX 1K3YA 4QL7A 1XZOA 1T4ZA 5KN0A 3TCOA 3QAWA 3FZ9A 1OC3A 4DSSB 2DIYA 4Z2TA 1J0FA 1OKDA 2E2MA 4N0VA 3J7Yb 4G10A 2VAFA 4HU7A 2L6DA 3UAPA 3KTLA 1QXHA 1X9MB 3KD0A 4V2LA 1FVKA 3F6DA 4G2EA 12GSA 2QKEA 5IMZA 3ED3A 4H86A 2RUEA 4IS0A 4EL1A 3MDKA 3FZAA 2R3XA 4BVYB 2FUG2 4MJAA 5CP1A 2PWJA 1SJ6A 1GSSA 2A2PA 1PKZA 2HZFA 1F37A 1R5PA 3GV1A 5D93A 2GZPA 2O8VB 1M9BA 13GSA 2A4HA 3DKSA 1GRXA 4PUFC 1OAZA 4IP1A 1Z5YE 2O85A 4IGJA 1THOA 5ECSA 4O32A 5GAPD 1OC9A 3ZMKA 3CTGA 4HDEA 6GSUA 2FA4A 3HVVA 3BCIA 1BX9A 5HFIA 3UVHA 2R2JA 4OCFA 1EGOA 3VWVA 1SL0B 2VCXA 2CZ3A 5J9BA 4V2NA 5ENUA 3KMNA 4OCEA 5EPFA 4IJ3A 5F07A 2XBIA 1KTEA 5EL8A 3Q19A 2LNSA 4PXOA 1GSYA 1PL2A 3LWAA 2H0GA 4L5LA 4ACSA 5IOXA 1TI1A 4QQ7A 5KOXA 2JSYA 1YF0A 1TK0B 3DWVA 4Q5QA 4ZL7A 2CV4A 3VPQA 4NMUA 3APSA 11GSA 2I9HA 3KCMA 1PN0A 5G1KA 2WRTA 2JU5A 1CQHA 3UARA 3E3EA 5DVBA 1J9BA 2JSZA 2ON7A 3D22A 1PSQA 3RHCA 1R26A 1OC8A 3UBKA 2TRCP 2E0QA 3LYKA 4IELA 1BJXA 2M72A 3KIJA 4ZXGA 3TJFA 3J7Yk 1WE0A 1M99A 2GVPA 3IPZA 5COHA 3F3QA 4PTSA 2A2RA 3KH9A 2H6ZA 3OR5A 2H01A 4NV5A 4X0XA 2N5FA 3RHBA 2RIIA 5B6MA 2FD3A 5KOWA 1EV9A 1N8JA 2LS5A 5GZZB 1VF2A 4OD7A 5DDLA 3LSZA 1TU8A 1HD2A 3VWUA 2MZCA 5GAND 2FHEA 1Z9HA 3FZ5A 2OADA 3GX8A 4GRFA 2LRTA 2C0FA 4O5UA 3KP8A 2DJ0A 1WP0A 3WGXA 1G7OA 1EEMA 2AUVA 4BPYA 4V2MA 2R0PA 1NM3A 4KNDA 3FYGA 2L59A 4KSMA 1MDJA 3EURA 22GSA 5IQYA 4HEA2 2L6CA 4DEJA 1FG4A 1GTUA 4TVEA 2HRKA 2PUKC 1IYIA 3I69A 4MPFA 2HSHA 3UEMA 2GLRA 4EUYA 2WB9A 2VL3A 1GUKA 1Z7PA 2V1MA 3HVSA 1JLVA 2K18A 2FGXA 5IPGA 4JU5A 4K9ZA 3EVIA 3H4KA 3QFBC 5IMAA 2FLSA 1MD3A 4LL4B 5DJMA 3HVNA 3K8NA 3ISOA 2KHPA 5A4WA 4O5QA 1F3AA 3IHGA 3DD3A 2X99A 3ERWA 4I97A 3LJRA 5ECRB 4HZ4A 4POBA 1VF3A 4AGSA 5JWQB 1URMA 2B5YA 3MIXA 5DQYA 4KUNA 2NTOA 3IE3A 3E9JB 2IMFA 3RPNA 1GH2A 1HNCA 2YJ7A 3DMLA 3RBTA 4HQZA 2IMIA 5G5FA 2KLXA 4HJ2A 4K7OA 2BJXA 1R4WA 3GFKA 4KDUA 10GSA 4PNGA 3D5JA 1T8EB 3GKKA 3IRAA 5LCZA 2VCZA 4WBJA 2CVKA 5D9TA 2DJ1A 1N2AA 1AW9A 2DJJA 3UMAA 3IAM2 5HFGA 4OO4A 3TRXA 2HSMA 4ZBDA 4HS1A 1W89A 3QR6A 1A0FA 3BOAA 5IMVA 4XS1A 4LLRA 3F3RA 4WEYA 1K3LA 1EOHA 1PKWA 1PRXA 1QFNA 1YY7A 3QAGA 2X8GA 3N5OA 2GZZA 4TKYA 2IMEA 4J57E 1AC1A 5DQSA 2YZHA 1YF1A 2Z9SA 1YKAA 3TRQA 3CSJA 1A0RP 1TW9A 4ZL9A 1GSFA 5CRDA 3Q6OA 3TJJA 5KN1A 3BCKA 1V57A 5J5NA 1K0CA 2OE3A 2EIOA 2HRNA 1TK8B 3H79A 1ABAA 5D9VA 1ZMAA 3HZ4A 1YJ6A 4IQAA 2H66A 3WT1A 1ZGNA 4K5SA 5IO2A 1UVZA 1JZDA 4KX4A 2VCWA 1Y6EA 3L9SA 4CY6A 2KOKA 3VLNA 2LTKA 3D0ZA 4KGIA 3FY7A 1A8LA 3IXRA 4L5OA 1XVQA 4ZB8A 1XIYA 2F9SA 2VLUA 1PMTA 2RUFA 2YP6A 3RPPA 4ID0A 4J2FA 4RUVA 1AUCA 3APQA 4I5QA 4ECIA 2H0IA 1H4OA 5IOWA 3DEXA 5CRWA 1XWCA 2VM2A 2GQKA 1UN2A 1DBYA 1TRWA 1O8XA 4K2XA 2ES7A 2L5LA 3G7IA 4MZCA 3IV4A 4HJMA 1B8XA 3WT2A 2KP1A 1M2BA 1K3OA 1A2MA 3NZNA 1RW1A 1G0TA 4HI7A 5DJLA 3AY8A 3IR4A 2JZRA 4PNFA 1RQMA 3GX0A 2H6YA 3ZL5A 1BYEA 5BRTA 5ECKB 3DYRA 3M0FA 3WYWA 4P3YB 2IL3A 5E59A 4DSSA 2DBCA 4MZWA 2G2QA 4WKWA 5FWGA 1ZOFA 1U3AA 1F2EA 2IMKA 1KEBA 3UOMA 3BJ5A 2CAQA 4KE3A 1F6MC 4G0IA 1XOBA 4NHZA 4K7IA 2PN8A 1GNEA 1K0MA 3DXBA 5J41A 3ZVJD 1SK2A 2PGTA 2IMDA 3A2WA 2M46A 1XWGA 2WGRA 3O3TA 4IP6A 3HD5A 3C71A 5ECNB 3A3TA 3F4TA 5BMUA 2CX4A 4CY8A 3GRXA 3KXOA 4ZILA 3ZMLA 2DKHA 1JLWA 2WULA 1K0BA 5F0GA 1FOHA 6GSXA 1ZL9A 2N5AA 3QMXA 1SD8A 2C0GA 3IDVA 4ICYA 1IYHA 4N10A 5H5SA 3APOA 2XPDA 5C04A 4A5PA 2QGVA 3LG6A 2GQLA 1SYXA 4GCIA 2V32A 4IW9A 2LV3A 3LXZA 2F8FA 2K8VA 1B9XC 4YQMA 2LNTA 3IC8A 2DMLA 1DUGA 1GLPA 2VD1A 4FYUA 3FK8A 1Z6NA 1MDKA 4JR4A 4IVFA 2CT6A 3GHAA 4GQFA 3GL3A 2YPMA 3IHQA 4TR4A 1EV4A 3QCPA 4ZB9A 3W8SA 3CSIA 2MBSA 4IKHA 1XW9A 1XWKA 1S3CA 3UBLA 4MP4A 5H5RA 1X9WB 5DALA 2YWOA 2V41A 4ULXA 3LW9A 3FRCA 4TR3A 3EYTA 4L0WA 4RQXA 2H1GA 4MZBA 2FNOA 2YOIA 3CYNA 3ZFLA 1S3DA 8GSSA 2LSTA 3MWHA 4OFNA
chains in the Genus database with same CATH topology
1ZZYA 1V58A 2C0EA 2R37A 4JZQA 4QL9A 2L4QA 2HYXA 2PU9C 1CQGA 2B1KA 3H8QA 3LGCA 3HXSA 5CRHA 2OACA 4LMVA 5F06A 3ZYWA 5J3RA 2CX3A 5IIZA 3DVWA 3TOUA 2K9FA 1S3AA 3G9BA 3TKRA 3VPTA 2IN3A 1XWBA 3QPMA 3L78A 3TRPA 1M2DA 1TTZA 1TDIA 4JE1A 1KBNA 2G0FA 2CAIA 4XCSA 4JBBA 1UC7A 4X1UA 3FR9A 2C0DA 2OBKA 3C1SA 2YCDA 1ZYEA 1TK5B 1EGRA 1B9YC 3DGQA 3A2VA 1SL2B 2X8HA 4MF5A 1EP8A 2L4CA 3A5IA 2JZSA 5FHIA 4EIPA 1AIUA 1M0UA 1AXDA 3U5RE 2C3TA 1TOFA 5DALB 2L57A 4D73A 4ZL8A 2JZTA 2GSQA 3GN3A 5FT3A 4O92A 5JCWA 4TRXA 2K8SA 1BQ7A 1WPIA 5EVOA 4FQUA 4KAEA 3EU3A 2YANA 1F3BA 2VL9A 3KEBA 3M1GA 1SU9A 3JCML 1TRVA 4KCEA 1X5DA 2QA1A 4XS6A 1M2AA 4I8BA 4PGTA 4XHMA 4LMWA 4Z2UA 5B7CA 4ECJA 5F8BA 4JEDA 2ZUPA 4KDXA 3IA1A 5ELGA 3FZ4A 4O7HA 5GSTA 1TJDA 3KM6A 4Q5RA 2VO4A 3HCZA 4WXTA 2FWHA 3IC4A 4ZB6A 5IMDA 3IOSA 1FVJA 1GULA 4L8EA 3O6TA 3QDNA 3ME7A 1V40A 4D73B 1PL1A 1Z7RA 5IMFA 5INYA 3IAS2 18GSA 4YQUA 2QA2A 4FO5A 3GL5A 1WIKA 1R5AA 3GSTA 1NHYA 4I2TA 1KNGA 5G2ZA 5ECLB 4I2UA 3F8UA 3GTUA 3VI5A 4CW9A 3HZ8A 4TOPA 2WDUA 1X5EA 1HQOA 4WBRD 5A4UA 3ZIVA 1NHOA 1U3IA 4IJIA 4PQHA 1B4PA 5JWRB 1JHBA 4MCUA 2D2ZA 2VUPA 2NPBA 2P31A 2OA7A 3GIXA 4BA7A 1MTCA 3O76A 1E2YA 4J56E 1OE8A 4AJ8A 5IM9A 3EU4A 4TR0A 4EO3A 4F82A 5AGYA 5HQPA 1GSDA 1SD9A 6GSSA 3D6IA 2O7KA 4F03A 2GSTA 3HDCA 2ALBA 1SKWB 4KW6A 5CREA 2FWGA 1YDKA 3RAZA 3IK7A 3FW2A 4EXJA 3LORA 4OFTA 1DE1A 2C1YA 1ZYQB 1I5GA 1YQ1A 4PX1A 4WF5A 4ECBA 3PGTA 2YJHA 2GGTA 2H30A 1T1VA 1GSQA 2GSRA 2MBTA 4MH3A 3FHKA 3VWXA 2LKUA 1A2JA 1THXA 2CZ2A 4N30A 4XS4A 3A5WA 1V98A 2I81A 4EE0A 3F63A 3GTUB 3GA4A 5D8IA 1OYJA 2AB6A 1E6BA 3TKSC 4PQ1A 3DRNA 1BAYA 2PBJA 4HUAA 3LFLA 3LXTA 4V1Ag 3ME8A 5DBQA 1AAZA 3DIEA 3RDWA 1GTBA 4AJ7A 4G0LA 2XC2A 1XFLA 4YQVA 5JCUA 5J4UA 1ON4A 1JFUA 2YWMA 4FH8A 1PX7A 4F0BA 2IPAA 4GXZA 4TR1A 2YNXA 2O89A 1EOGA 2P5RA 5J9CA 2X4AA 3E0UA 3GURA 3Q18A 2OKAA 2B6MA 4YKFA 3VK9A 3TUEA 2B5XA 2L5OA 4XRAA 2YZUA 3P8WA 1Y25A 4XS4B 1O85A 1GL8A 3NOFA 4F0CA 1FOVA 2MMZA 4GSNA 1FW1A 1UA5A 1ML6A 3GH6A 2VIMA 3FKFA 4TXOA 1OKTA 3I43A 1Q98A 4WR4A 4GWRA 3IBHA 1O81A 4K8MA 2IJYA 3L0HA 5D73A 1G6WA 1LJRA 3US3A 5JWOB 3M3MA 4HOJA 4XTSA 2FA8A 3MNGA 4TR1B 1GSUA 1FB6A 1C72A 1ILOA 4RI6A 2F3MA 2MYGA 4EVMA 1XXUA 1GSEA 1J08A 3A2XA 1ZYPA 3L9VA 5HR1A 2AV4A 3EINA 2DSAA 3UIWA 1X0RA 3LQ7A 9GSSA 3HJOA 2X8CA 5D9XA 2FCHA 3KMOA 1FO5A 3R3EA 1AQVA 3BD2A 3MSZA 1A2LA 1FB0A 2DKIA 1TKDB 1PD21 2YWIA 4WR5A 3V1WA 3GH9A 6GSYA 3VI7A 2LJAA 1SJZA 1QK8A 1GUMA 2RM5A 2OE1A 3EE2A 2H71A 2LUSA 4TXOB 4FIWA 3ERFA 2GT6A 1ST9A 1YEXA 2BMXA 1T00A 3HYPA 1TI3A 2MMOA 4NXIA 4OFMA 4MA9A 3CSHA 5CRGA 2R0CA 3CRTA 4Z7XA 4KCAA 5G30A 4OWYA 1XW6A 2REMA 3MAKA 2V2GA 1G7EA 3QAVA 4CHSA 2C8UA 1DSBA 3LYPA 5CYYA 1LU4A 4AF2A 3KJYA 4YAPA 3VFIA 2GSSA 4MNNA 1SYRA 4K0GA 2LRNA 2FWEA 2WJUA 1JZRA 2F51A 4IN0A 2JACA 1EEJA 5IMCA 1MEKA 3I6AA 2VL2C 5E4WA 2DMMA 14GSA 2H75A 2R0GA 1PQNA 3L9UA 6GSVA 1XCCA 2PERA 4NAXA 3F0IA 3F4RA 1Z3EA 4E8HA 1GP1A 2H19A 3FEUA 1SKRB 2F8AA 3HY2A 1O73A 3R2QA 4WETA 2HSYA 2BTOT 1FHEA 5CAXA 5HR3A 4EC0A 2P0GA 1K0DA 2CA8A 5ECMB 2KUCA 3WGEA 3LEFA 2FY6A 4KF9A 2MMNA 4N11A 4BWQA 2FWFA 4KSOA 1WOUA 2J23A 5HR2A 3HVXA 3Q74A 1VRSD 3UL3A 3HA9A 2HZEA 1HYUA 4BVXB 1TXXA 4FYBA 3UVTA 1SJIA 3C7MA 3PR8A 4EKZA 1BEDA 2EIQA 1FAAA 2AHEA 2WFCA 3P90A 2C80A 2VOCA 3UJ1A 3GKMA 3ZVJA 2HT9A 4K0NA 2GQMA 1XWAA 2WCIA 2R4VA 4GSTA 4ZBBA 5HR0A 1MD4A 5GSSA 2H1DA 1VGLA 1ERUA 4RQRA 1EWXA 4RI7A 1DE2A 1XOAA 2OBIA 4POKA 2NBSA 2TIRA 3H1NA 1GUHA 2VLTA 2QSIA 3I9V2 2V6KA 4ZIJA 1K0AA 1ZYNA 2DLXA 2RM6A 2KP2A 2DJ3A 2HZEB 3CBUA 3M8NA 3VURA 5AIXA 2HFDA 3KP9A 3TKPA 1M9AA 3TKQA 1G6YA 2H76A 3F9UA 3M9JA 2E2GA 2R6KA 3C1RA 3TJKA 2B1LA 3H93A 5CO3A 4GF0A 1X5CA 1TP9A 4HU9A 3EPTA 1GTIA 1NSWA 5D96A 3SWLA 3G7YA 4DSRA 1OC9B 4OMVA 4X43A 4MF6A 2VCTA 4MABA 1GTAA 1V2AA 1O6JA 3ZREA 3FR3A 1M7TA 2PMTA 4WF4A 3S9FA 1SKSB 4G0KA 1YZXA 2C3NA 4LA1A 4MLYA 4BL7A 2UZ8A 2N5BA 5B8BA 1EZKA 5ECQB 3ZRDA 4FYCA 5IPHA 3TGZA 1ZCPA 4JR6A 1SL1B 2HNLA 1F9MA 3SBCA 1A24A 2LEGA 1WMJA 3FR6A 4MH2A 2VCVA 4N0ZA 2VM1A 4MJEA 3TDGA 4PUAA 3CXGA 4G9HA 2XPEA 5ECOB 5KEJA 1U6TA 1A8YA 2AYTA 1RK4A 1QUWA 4GLTA 5LD0A 4POLA 3GUSA 2DJ2A 1T7PB 1YKCA 4YAVA 2H73A 4NV2A 4E8EA 5G1LA 3TJGA 3NIVA 2JL4A 1GLQA 2V6OA 5JCGA 2HI7A 2DJKA 4OO5A 3TB2A 5ECPB 4MJCA 1ERTA 3N9JA 4DSQA 1BG5A 2CQ9A 17GSA 2GT5A 3P2AA 3W6GA 3G7JA 3M9KA 1YEPA 5IO0A 1GWCA 4USSA 1K0NA 2H70A 5G31A 3PINA 1XBSA 1NW2A 1PA3A 4GTUA 5ID2A 2O87A 1ERWA 2EIRA 4BL7B 1MDIA 2HLSA 2HRAA 1VF4A 2MMAA 3WD6A 5ECIB 4V1Ap 2B5EA 4Z2RA 4PURA 5HFKA 2GZYA 3EMPA 3HJMA 1O7UA 1ERVA 2P5QA 3HHVA 4YH2A 4GQCA 1PN9A 3GSSA 2H1BA 4Q5FA 3ZIJA 4YKGA 1SENA 1X9SB 1AQXA 3TKSA 4EDYA 2DIZA 2OJLA 4XRDA 1PGTA 2H6XA 3ZITA 1XPVA 3L4NA 3ERGA 1Q4JA 2X49A 3IK9A 3PPUA 2H74A 2JADA 2GS3A 6GSWA 1A23A 4ILFA 3HKRA 2LQQA 4PQIA 1I9DA 2XHFA 4ECCA 2VLVA 3TKSE 2VD0A 1QMVA 1WWJA 3F4SA 3KTBA 2TRXA 2PPTA 1OE7A 4MPGA 3HJPA 4EDZA 1SK0A 1EP7A 4MJBA 5ID2B 4KB3A 6GSTA 2HE3A 5ECHB 2PVOC 1O8WA 3KGKA 4ZBAA 1LBKA 2WS2A 20GSA 4MF7A 3TJBA 4AJ6A 4KDYA 4K5RA 4KH7A 1HNAA 5CNWA 5B6NA 4HZ2A 2YV9A 4K6XA 1JZOA 4KA0A 2E7PA 2OE0A 3D21A 5LNKe 3TOTA 1OVNA 4X4JA 2H0HA 3PH9A 1QQ2A 2NDOA 4HQSA 3F6FA 4GSSA 2R5GA 1TRSA 4TN8A 2B3SA 2IFQA 2A2SA 3EMXA 2IIYA 5ELAA 4IQ1A 4MDCA 3C73A 4IHUA 3U6VA 1H75A 4LL1B 2YV7A 3KZQA 2H8LA 2IWTA 4ISDA 3GKXA 5DAKA 2ZCTA 1XVWA 2I1UA 3CTFA 2LJKA 5D9WA 4DVCA 1T4YA 5L71A 2HXKA 2VCQA 1PX6A 1GNWA 4CDOA 4EF0A 2CVBA 3MYDA 1U87A 1W4VA 1TRUA 5C00A 1ACVA 3FMWA 2DC5A 4MMMA 2QC7A 4TW5A 3ZLPA 4BWSA 5EY6A 4I6XA 1R7HA 1AQWA 5B8AA 4F9ZA 1K0OA 2M80A 3P7XA 1WJKA 2H72A 2RLIA 3GNJA 3D4TA 3GYKA 2IFQB 3VWWA 1V9WA 2C4JA 4ML6A 1JZWA 3ZFBA 2WZ9A 1B48A 2YN1A 3QOUA 3QD9A 3BBYA 5ABRA 2J9HA 1USBA 2X64A 5DAKB 4G19A 1Z6MA 4L0UA 2LJRA 3DVXA 2H1AA 2LRCA 5A5KA 5F05A 2C3QA 4IBPA 3GMFA 3ZZXA 4O5RA 3W8JA 4JRRA 2LQOA 16GSA 4NPBA 2VL2A 2B7JA 4ML1A 5AIVA 5DCGA 2YWNA 1VF1A 1WRYA 3WGDA 5KN2A 19GSA 2PVQA 3CRUA 1T3BA 2I3YA 4K2DA 4NHWA 2ON5A 5A4VA 2A4VA 4MK3A 3CMIA 1SK1A 4BVXA 4NWYA 3EWLA 5G5EA 2EC4A 2HRFA 4TXVA 4BVYA 3D4MA 1QGVA 2GDRA 2I4AA 2K6VA 2NVLA 5H5QA 5AN1A 4K1FA 4K7NA 1B4QA 3C8EA 3GKNA 5DCHA 7GSSA 2B7KA 2AAWA 4XIHA 3EC3A 2GTUA 3QFAC 1XW5A 1U88A 4POMA 3ZTLA 1TU7A 4F2IA 5AISA 2ZNMA 5KN3A 2AJQB 4Q5NA 2XBQA 3KH7A 2CVDA 4EIQA 1HNBA 1K3YA 4QL7A 1XZOA 1T4ZA 5KN0A 3TCOA 3QAWA 3FZ9A 1OC3A 4DSSB 2DIYA 4Z2TA 1J0FA 1OKDA 2E2MA 4N0VA 3J7Yb 4G10A 2VAFA 4HU7A 2L6DA 3UAPA 3KTLA 1QXHA 1X9MB 3KD0A 4V2LA 1FVKA 3F6DA 4G2EA 12GSA 2QKEA 5IMZA 3ED3A 4H86A 2RUEA 4IS0A 4EL1A 3MDKA 3FZAA 2R3XA 4BVYB 2FUG2 4MJAA 5CP1A 2PWJA 1SJ6A 1GSSA 2A2PA 1PKZA 2HZFA 1F37A 1R5PA 3GV1A 5D93A 2GZPA 2O8VB 1M9BA 13GSA 2A4HA 3DKSA 1GRXA 4PUFC 1OAZA 4IP1A 1Z5YE 2O85A 4IGJA 1THOA 5ECSA 4O32A 5GAPD 1OC9A 3ZMKA 3CTGA 4HDEA 6GSUA 2FA4A 3HVVA 3BCIA 1BX9A 5HFIA 3UVHA 2R2JA 4OCFA 1EGOA 3VWVA 1SL0B 2VCXA 2CZ3A 5J9BA 4V2NA 5ENUA 3KMNA 4OCEA 5EPFA 4IJ3A 5F07A 2XBIA 1KTEA 5EL8A 3Q19A 2LNSA 4PXOA 1GSYA 1PL2A 3LWAA 2H0GA 4L5LA 4ACSA 5IOXA 1TI1A 4QQ7A 5KOXA 2JSYA 1YF0A 1TK0B 3DWVA 4Q5QA 4ZL7A 2CV4A 3VPQA 4NMUA 3APSA 11GSA 2I9HA 3KCMA 1PN0A 5G1KA 2WRTA 2JU5A 1CQHA 3UARA 3E3EA 5DVBA 1J9BA 2JSZA 2ON7A 3D22A 1PSQA 3RHCA 1R26A 1OC8A 3UBKA 2TRCP 2E0QA 3LYKA 4IELA 1BJXA 2M72A 3KIJA 4ZXGA 3TJFA 3J7Yk 1WE0A 1M99A 2GVPA 3IPZA 5COHA 3F3QA 4PTSA 2A2RA 3KH9A 2H6ZA 3OR5A 2H01A 4NV5A 4X0XA 2N5FA 3RHBA 2RIIA 5B6MA 2FD3A 5KOWA 1EV9A 1N8JA 2LS5A 5GZZB 1VF2A 4OD7A 5DDLA 3LSZA 1TU8A 1HD2A 3VWUA 2MZCA 5GAND 2FHEA 1Z9HA 3FZ5A 2OADA 3GX8A 4GRFA 2LRTA 2C0FA 4O5UA 3KP8A 2DJ0A 1WP0A 3WGXA 1G7OA 1EEMA 2AUVA 4BPYA 4V2MA 2R0PA 1NM3A 4KNDA 3FYGA 2L59A 4KSMA 1MDJA 3EURA 22GSA 5IQYA 4HEA2 2L6CA 4DEJA 1FG4A 1GTUA 4TVEA 2HRKA 2PUKC 1IYIA 3I69A 4MPFA 2HSHA 3UEMA 2GLRA 4EUYA 2WB9A 2VL3A 1GUKA 1Z7PA 2V1MA 3HVSA 1JLVA 2K18A 2FGXA 5IPGA 4JU5A 4K9ZA 3EVIA 3H4KA 3QFBC 5IMAA 2FLSA 1MD3A 4LL4B 5DJMA 3K8NA 3ISOA 2KHPA 5A4WA 4O5QA 1F3AA 3IHGA 3DD3A 2X99A 3ERWA 4I97A 3LJRA 5ECRB 4HZ4A 4POBA 1VF3A 4AGSA 5JWQB 1URMA 2B5YA 3MIXA 5DQYA 4KUNA 2NTOA 3IE3A 3E9JB 2IMFA 3RPNA 1GH2A 1HNCA 2YJ7A 3DMLA 3RBTA 4HQZA 2IMIA 5G5FA 2KLXA 4HJ2A 4K7OA 2BJXA 1R4WA 3GFKA 4KDUA 10GSA 4PNGA 3D5JA 1T8EB 3GKKA 3IRAA 5LCZA 2VCZA 4WBJA 2CVKA 5D9TA 2DJ1A 1N2AA 1AW9A 2DJJA 3UMAA 3IAM2 5HFGA 4OO4A 3TRXA 2HSMA 4ZBDA 4HS1A 1W89A 3QR6A 1A0FA 3BOAA 5IMVA 4XS1A 4LLRA 3F3RA 4WEYA 1K3LA 1EOHA 1PKWA 1PRXA 1QFNA 1YY7A 3QAGA 2X8GA 3N5OA 2GZZA 4TKYA 2IMEA 4J57E 1AC1A 5DQSA 2YZHA 1YF1A 2Z9SA 1YKAA 3TRQA 3CSJA 1A0RP 1TW9A 4ZL9A 1GSFA 5CRDA 3Q6OA 3TJJA 5KN1A 3BCKA 1V57A 5J5NA 1K0CA 2OE3A 2EIOA 2HRNA 1TK8B 3H79A 1ABAA 5D9VA 1ZMAA 3HZ4A 1YJ6A 4IQAA 2H66A 3WT1A 1ZGNA 4K5SA 5IO2A 1UVZA 1JZDA 4KX4A 2VCWA 1Y6EA 3L9SA 4CY6A 2KOKA 3VLNA 2LTKA 3D0ZA 4KGIA 3FY7A 1A8LA 3IXRA 4L5OA 1XVQA 4ZB8A 1XIYA 2F9SA 2VLUA 1PMTA 2RUFA 2YP6A 3RPPA 4ID0A 4J2FA 4RUVA 1AUCA 3APQA 4I5QA 4ECIA 2H0IA 1H4OA 5IOWA 3DEXA 5CRWA 1XWCA 2VM2A 2GQKA 1UN2A 1DBYA 1TRWA 1O8XA 4K2XA 2ES7A 2L5LA 3G7IA 4MZCA 3IV4A 4HJMA 1B8XA 3WT2A 2KP1A 1M2BA 1K3OA 1A2MA 3NZNA 1RW1A 1G0TA 4HI7A 5DJLA 3AY8A 3IR4A 2JZRA 4PNFA 1RQMA 3GX0A 2H6YA 3ZL5A 1BYEA 5BRTA 5ECKB 3DYRA 3M0FA 3WYWA 4P3YB 2IL3A 5E59A 4DSSA 2DBCA 4MZWA 2G2QA 4WKWA 5FWGA 1ZOFA 1U3AA 1F2EA 2IMKA 1KEBA 3UOMA 3BJ5A 2CAQA 4KE3A 1F6MC 4G0IA 1XOBA 4NHZA 4K7IA 2PN8A 1GNEA 1K0MA 3DXBA 5J41A 3ZVJD 1SK2A 2PGTA 2IMDA 3A2WA 2M46A 1XWGA 2WGRA 3O3TA 4IP6A 3HD5A 3C71A 5ECNB 3A3TA 3F4TA 5BMUA 2CX4A 4CY8A 3GRXA 3KXOA 4ZILA 3ZMLA 2DKHA 1JLWA 2WULA 1K0BA 5F0GA 1FOHA 6GSXA 1ZL9A 2N5AA 3QMXA 1SD8A 2C0GA 3IDVA 4ICYA 1IYHA 4N10A 5H5SA 3APOA 2XPDA 5C04A 4A5PA 2QGVA 3LG6A 2GQLA 1SYXA 4GCIA 2V32A 4IW9A 2LV3A 3LXZA 2F8FA 2K8VA 1B9XC 4YQMA 2LNTA 3IC8A 2DMLA 1DUGA 1GLPA 2VD1A 4FYUA 3FK8A 1Z6NA 1MDKA 4JR4A 4IVFA 2CT6A 3GHAA 4GQFA 3GL3A 2YPMA 3IHQA 4TR4A 1EV4A 3QCPA 4ZB9A 3W8SA 3CSIA 2MBSA 4IKHA 1XW9A 1XWKA 1S3CA 3UBLA 4MP4A 5H5RA 1X9WB 5DALA 2YWOA 2V41A 4ULXA 3LW9A 3FRCA 4TR3A 3EYTA 4L0WA 4RQXA 2H1GA 4MZBA 2FNOA 2YOIA 3CYNA 3ZFLA 1S3DA 8GSSA 2LSTA 3MWHA 4OFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZZY A;  1V58 A;  2C0E A;  2R37 A;  4JZQ A;  4QL9 A;  2L4Q A;  2HYX A;  2PU9 C;  1CQG A;  2B1K A;  3H8Q A;  3LGC A;  3HXS A;  5CRH A;  2OAC A;  4LMV A;  5F06 A;  3ZYW A;  5J3R A;  2CX3 A;  5IIZ A;  3DVW A;  3TOU A;  2K9F A;  1S3A A;  3G9B A;  3TKR A;  3VPT A;  2IN3 A;  1XWB A;  3QPM A;  3L78 A;  3TRP A;  1M2D A;  1TTZ A;  1TDI A;  4JE1 A;  1KBN A;  2G0F A;  2CAI A;  4XCS A;  4JBB A;  1UC7 A;  4X1U A;  3FR9 A;  2C0D A;  2OBK A;  3C1S A;  2YCD A;  1ZYE A;  1TK5 B;  1EGR A;  1B9Y C;  3DGQ A;  3A2V A;  1SL2 B;  2X8H A;  4MF5 A;  1EP8 A;  2L4C A;  2JZS A;  5FHI A;  1AIU A;  1M0U A;  1AXD A;  3U5R E;  2C3T A;  1TOF A;  5DAL B;  2L57 A;  4D73 A;  4ZL8 A;  2JZT A;  2GSQ A;  3GN3 A;  5FT3 A;  4O92 A;  5JCW A;  4TRX A;  2K8S A;  1BQ7 A;  1WPI A;  5EVO A;  4KAE A;  3EU3 A;  2YAN A;  1F3B A;  2VL9 A;  3KEB A;  3M1G A;  1SU9 A;  3JCM L;  1TRV A;  4KCE A;  1X5D A;  4XS6 A;  1M2A A;  4I8B A;  4PGT A;  4XHM A;  4LMW A;  5B7C A;  4ECJ A;  5F8B A;  4JED A;  2ZUP A;  4KDX A;  3IA1 A;  5ELG A;  3FZ4 A;  4O7H A;  5GST A;  1TJD A;  3KM6 A;  4Q5R A;  2VO4 A;  3HCZ A;  4WXT A;  2FWH A;  3IC4 A;  4ZB6 A;  5IMD A;  3IOS A;  1FVJ A;  1GUL A;  4L8E A;  3O6T A;  3QDN A;  3ME7 A;  1V40 A;  4D73 B;  1PL1 A;  1Z7R A;  5IMF A;  5INY A;  3IAS 2;  18GS A;  4YQU A;  4FO5 A;  3GL5 A;  1WIK A;  1R5A A;  3GST A;  1NHY A;  4I2T A;  1KNG A;  5G2Z A;  5ECL B;  4I2U A;  3F8U A;  3GTU A;  3VI5 A;  4CW9 A;  3HZ8 A;  4TOP A;  2WDU A;  1X5E A;  1HQO A;  4WBR D;  5A4U A;  3ZIV A;  1NHO A;  1U3I A;  4IJI A;  4PQH A;  1B4P A;  5JWR B;  1JHB A;  4MCU A;  2D2Z A;  2VUP A;  2NPB A;  2P31 A;  2OA7 A;  3GIX A;  4BA7 A;  1MTC A;  3O76 A;  1E2Y A;  4J56 E;  1OE8 A;  4AJ8 A;  5IM9 A;  3EU4 A;  4TR0 A;  4EO3 A;  4F82 A;  5AGY A;  5HQP A;  1GSD A;  1SD9 A;  6GSS A;  3D6I A;  2O7K A;  4F03 A;  2GST A;  3HDC A;  2ALB A;  1SKW B;  4KW6 A;  5CRE A;  2FWG A;  1YDK A;  3RAZ A;  3IK7 A;  3FW2 A;  4EXJ A;  3LOR A;  4OFT A;  1DE1 A;  2C1Y A;  1ZYQ B;  1I5G A;  1YQ1 A;  4PX1 A;  4WF5 A;  4ECB A;  3PGT A;  2YJH A;  2GGT A;  2H30 A;  1T1V A;  1GSQ A;  2GSR A;  2MBT A;  4MH3 A;  3FHK A;  3VWX A;  2LKU A;  1A2J A;  1THX A;  2CZ2 A;  4N30 A;  4XS4 A;  3A5W A;  1V98 A;  2I81 A;  4EE0 A;  3F63 A;  3GTU B;  3GA4 A;  5D8I A;  1OYJ A;  2AB6 A;  1E6B A;  3TKS C;  4PQ1 A;  3DRN A;  1BAY A;  2PBJ A;  4HUA A;  5DBQ A;  3LFL A;  4V1A g;  3LXT A;  3ME8 A;  1AAZ A;  3DIE A;  3RDW A;  1GTB A;  4AJ7 A;  2XC2 A;  1XFL A;  4YQV A;  5JCU A;  5J4U A;  1ON4 A;  1JFU A;  2YWM A;  4FH8 A;  1PX7 A;  4F0B A;  2IPA A;  4GXZ A;  4TR1 A;  2YNX A;  2O89 A;  1EOG A;  2P5R A;  5J9C A;  3E0U A;  3GUR A;  3Q18 A;  2OKA A;  2B6M A;  3VK9 A;  3TUE A;  2B5X A;  2L5O A;  4XRA A;  2YZU A;  3P8W A;  1Y25 A;  4XS4 B;  1O85 A;  1GL8 A;  3NOF A;  4F0C A;  1FOV A;  2MMZ A;  4GSN A;  1FW1 A;  1UA5 A;  1ML6 A;  3GH6 A;  2VIM A;  3FKF A;  4TXO A;  1OKT A;  3I43 A;  1Q98 A;  4WR4 A;  4GWR A;  3IBH A;  1O81 A;  4K8M A;  2IJY A;  3L0H A;  5D73 A;  1G6W A;  1LJR A;  3US3 A;  5JWO B;  3M3M A;  4HOJ A;  4XTS A;  2FA8 A;  3MNG A;  4TR1 B;  1GSU A;  1FB6 A;  1C72 A;  1ILO A;  4RI6 A;  2F3M A;  2MYG A;  4EVM A;  1XXU A;  1GSE A;  1J08 A;  3A2X A;  3L9V A;  5HR1 A;  2AV4 A;  3EIN A;  2DSA A;  3UIW A;  1X0R A;  3LQ7 A;  9GSS A;  3HJO A;  2X8C A;  5D9X A;  2FCH A;  3KMO A;  1FO5 A;  1AQV A;  3BD2 A;  3MSZ A;  1A2L A;  1FB0 A;  1TKD B;  1PD2 1;  2YWI A;  4WR5 A;  3V1W A;  3GH9 A;  6GSY A;  3VI7 A;  2LJA A;  1SJZ A;  1QK8 A;  1GUM A;  2RM5 A;  2OE1 A;  3EE2 A;  2H71 A;  2LUS A;  4TXO B;  4FIW A;  3ERF A;  2GT6 A;  1ST9 A;  1YEX A;  2BMX A;  1T00 A;  3HYP A;  1TI3 A;  2MMO A;  4NXI A;  4OFM A;  4MA9 A;  3CSH A;  5CRG A;  3CRT A;  4Z7X A;  4KCA A;  5G30 A;  4OWY A;  1XW6 A;  2REM A;  3MAK A;  2V2G A;  1G7E A;  3QAV A;  4CHS A;  2C8U A;  1DSB A;  3LYP A;  5CYY A;  1LU4 A;  4AF2 A;  3KJY A;  4YAP A;  3VFI A;  2GSS A;  1SYR A;  4K0G A;  2LRN A;  2FWE A;  2WJU A;  1JZR A;  2F51 A;  4IN0 A;  2JAC A;  1EEJ A;  5IMC A;  1MEK A;  3I6A A;  2VL2 C;  5E4W A;  2DMM A;  14GS A;  2H75 A;  1PQN A;  3L9U A;  6GSV A;  1XCC A;  2PER A;  4NAX A;  3F0I A;  3F4R A;  1Z3E A;  4E8H A;  1GP1 A;  2H19 A;  3FEU A;  1SKR B;  2F8A A;  3HY2 A;  1O73 A;  3R2Q A;  4WET A;  2HSY A;  2BTO T;  1FHE A;  5CAX A;  5HR3 A;  4EC0 A;  2P0G A;  1K0D A;  2CA8 A;  5ECM B;  2KUC A;  3WGE A;  3LEF A;  2FY6 A;  2MMN A;  4N11 A;  4BWQ A;  2FWF A;  4KSO A;  1WOU A;  2J23 A;  5HR2 A;  3HVX A;  3Q74 A;  1VRS D;  3UL3 A;  3HA9 A;  2HZE A;  1HYU A;  1TXX A;  4FYB A;  3UVT A;  1SJI A;  3C7M A;  3PR8 A;  4EKZ A;  1BED A;  2EIQ A;  1FAA A;  2AHE A;  2WFC A;  3P90 A;  2C80 A;  2VOC A;  3UJ1 A;  3GKM A;  3ZVJ A;  2HT9 A;  4K0N A;  2GQM A;  1XWA A;  2WCI A;  2R4V A;  4GST A;  4ZBB A;  5HR0 A;  1MD4 A;  5GSS A;  2H1D A;  1VGL A;  1ERU A;  4RQR A;  1EWX A;  4RI7 A;  1DE2 A;  1XOA A;  2OBI A;  4POK A;  2NBS A;  2TIR A;  3H1N A;  1GUH A;  2VLT A;  2QSI A;  3I9V 2;  2V6K A;  4ZIJ A;  1K0A A;  2DLX A;  2RM6 A;  2KP2 A;  2DJ3 A;  2HZE B;  3CBU A;  3M8N A;  3VUR A;  5AIX A;  2HFD A;  3KP9 A;  3TKP A;  1M9A A;  3TKQ A;  1G6Y A;  2H76 A;  3F9U A;  3M9J A;  2E2G A;  2R6K A;  3C1R A;  3TJK A;  2B1L A;  3H93 A;  5CO3 A;  4GF0 A;  1X5C A;  1TP9 A;  4HU9 A;  1GTI A;  1NSW A;  5D96 A;  3SWL A;  3G7Y A;  4DSR A;  1OC9 B;  4OMV A;  4X43 A;  4MF6 A;  2VCT A;  4MAB A;  1GTA A;  1V2A A;  1O6J A;  3ZRE A;  3FR3 A;  1M7T A;  2PMT A;  4WF4 A;  3S9F A;  1SKS B;  1YZX A;  2C3N A;  4LA1 A;  4MLY A;  4BL7 A;  2N5B A;  5B8B A;  1EZK A;  5ECQ B;  3ZRD A;  4FYC A;  5IPH A;  3TGZ A;  1ZCP A;  4JR6 A;  1SL1 B;  2HNL A;  1F9M A;  3SBC A;  1A24 A;  2LEG A;  1WMJ A;  3FR6 A;  4MH2 A;  2VCV A;  4N0Z A;  2VM1 A;  4MJE A;  3TDG A;  4PUA A;  3CXG A;  4G9H A;  2XPE A;  5ECO B;  5KEJ A;  1U6T A;  1A8Y A;  2AYT A;  1RK4 A;  1QUW A;  4GLT A;  5LD0 A;  4POL A;  3GUS A;  2DJ2 A;  1T7P B;  1YKC A;  4YAV A;  2H73 A;  4NV2 A;  4E8E A;  5G1L A;  3TJG A;  3NIV A;  2JL4 A;  1GLQ A;  2V6O A;  5JCG A;  2HI7 A;  2DJK A;  4OO5 A;  3TB2 A;  5ECP B;  4MJC A;  1ERT A;  3N9J A;  4DSQ A;  1BG5 A;  2CQ9 A;  17GS A;  2GT5 A;  3P2A A;  3W6G A;  3G7J A;  3M9K A;  1YEP A;  5IO0 A;  1GWC A;  1K0N A;  2H70 A;  5G31 A;  3PIN A;  1XBS A;  1NW2 A;  1PA3 A;  4GTU A;  5ID2 A;  2O87 A;  1ERW A;  2EIR A;  1MDI A;  2HLS A;  1VF4 A;  2MMA A;  3WD6 A;  5ECI B;  4V1A p;  2B5E A;  4PUR A;  5HFK A;  2GZY A;  3EMP A;  3HJM A;  1O7U A;  1ERV A;  2P5Q A;  3HHV A;  4YH2 A;  4GQC A;  1PN9 A;  3GSS A;  2H1B A;  4Q5F A;  3ZIJ A;  1SEN A;  1X9S B;  1AQX A;  3TKS A;  4EDY A;  2DIZ A;  2OJL A;  4XRD A;  1PGT A;  2H6X A;  3ZIT A;  1XPV A;  3L4N A;  3ERG A;  1Q4J A;  3IK9 A;  2H74 A;  2JAD A;  2GS3 A;  6GSW A;  1A23 A;  4ILF A;  3HKR A;  2LQQ A;  4PQI A;  1I9D A;  2XHF A;  4ECC A;  2VLV A;  3TKS E;  2VD0 A;  1QMV A;  1WWJ A;  3F4S A;  3KTB A;  2TRX A;  2PPT A;  1OE7 A;  4MPG A;  3HJP A;  4EDZ A;  1SK0 A;  1EP7 A;  4MJB A;  5ID2 B;  4KB3 A;  6GST A;  2HE3 A;  5ECH B;  2PVO C;  1O8W A;  3KGK A;  4ZBA A;  1LBK A;  2WS2 A;  20GS A;  4MF7 A;  3TJB A;  4AJ6 A;  4KDY A;  4KH7 A;  1HNA A;  5CNW A;  5B6N A;  4HZ2 A;  2YV9 A;  4K6X A;  1JZO A;  4KA0 A;  2E7P A;  2OE0 A;  3D21 A;  5LNK e;  3TOT A;  1OVN A;  2H0H A;  3PH9 A;  1QQ2 A;  2NDO A;  4HQS A;  3F6F A;  4GSS A;  2R5G A;  1TRS A;  4TN8 A;  2B3S A;  2IFQ A;  2A2S A;  3EMX A;  2IIY A;  5ELA A;  4IQ1 A;  4MDC A;  3C73 A;  4IHU A;  3U6V A;  1H75 A;  4LL1 B;  2YV7 A;  3KZQ A;  2H8L A;  2IWT A;  4ISD A;  3GKX A;  5DAK A;  2ZCT A;  1XVW A;  2I1U A;  3CTF A;  2LJK A;  5D9W A;  4DVC A;  1T4Y A;  5L71 A;  2HXK A;  2VCQ A;  1PX6 A;  1GNW A;  4CDO A;  4EF0 A;  2CVB A;  1U87 A;  1W4V A;  1TRU A;  5C00 A;  1ACV A;  2DC5 A;  4MMM A;  2QC7 A;  4TW5 A;  3ZLP A;  4BWS A;  5EY6 A;  4I6X A;  1R7H A;  1AQW A;  5B8A A;  4F9Z A;  1K0O A;  2M80 A;  3P7X A;  1WJK A;  2H72 A;  2RLI A;  3GNJ A;  3D4T A;  3GYK A;  2IFQ B;  3VWW A;  1V9W A;  2C4J A;  4ML6 A;  1JZW A;  3ZFB A;  2WZ9 A;  1B48 A;  2YN1 A;  3QOU A;  3QD9 A;  3BBY A;  5ABR A;  2J9H A;  1USB A;  2X64 A;  5DAK B;  4G19 A;  1Z6M A;  4L0U A;  2LJR A;  3DVX A;  2H1A A;  2LRC A;  5A5K A;  5F05 A;  2C3Q A;  4IBP A;  3GMF A;  3ZZX A;  4O5R A;  3W8J A;  4JRR A;  2LQO A;  16GS A;  4NPB A;  2VL2 A;  2B7J A;  4ML1 A;  5AIV A;  5DCG A;  2YWN A;  1VF1 A;  1WRY A;  3WGD A;  5KN2 A;  19GS A;  2PVQ A;  3CRU A;  1T3B A;  2I3Y A;  4K2D A;  4NHW A;  2ON5 A;  5A4V A;  2A4V A;  4MK3 A;  3CMI A;  1SK1 A;  4BVX A;  4NWY A;  3EWL A;  5G5E A;  2EC4 A;  2HRF A;  4TXV A;  4BVY A;  3D4M A;  1QGV A;  2GDR A;  2I4A A;  2K6V A;  2NVL A;  5H5Q A;  5AN1 A;  4K1F A;  4K7N A;  1B4Q A;  3C8E A;  3GKN A;  5DCH A;  7GSS A;  2B7K A;  2AAW A;  4XIH A;  3EC3 A;  2GTU A;  3QFA C;  1XW5 A;  1U88 A;  4POM A;  3ZTL A;  1TU7 A;  4F2I A;  5AIS A;  2ZNM A;  5KN3 A;  2AJQ B;  4Q5N A;  2XBQ A;  3KH7 A;  2CVD A;  1HNB A;  1K3Y A;  4QL7 A;  1XZO A;  1T4Z A;  5KN0 A;  3TCO A;  3QAW A;  3FZ9 A;  1OC3 A;  4DSS B;  2DIY A;  1J0F A;  1OKD A;  2E2M A;  4N0V A;  3J7Y b;  4G10 A;  2VAF A;  4HU7 A;  2L6D A;  3UAP A;  3KTL A;  1QXH A;  1X9M B;  3KD0 A;  4V2L A;  1FVK A;  3F6D A;  4G2E A;  12GS A;  2QKE A;  5IMZ A;  3ED3 A;  4H86 A;  2RUE A;  4IS0 A;  4EL1 A;  3MDK A;  3FZA A;  2R3X A;  2FUG 2;  4MJA A;  5CP1 A;  2PWJ A;  1SJ6 A;  1GSS A;  2HZF A;  1PKZ A;  1F37 A;  1R5P A;  3GV1 A;  5D93 A;  2GZP A;  2O8V B;  1M9B A;  13GS A;  3DKS A;  1GRX A;  4PUF C;  1OAZ A;  4IP1 A;  1Z5Y E;  2O85 A;  4IGJ A;  1THO A;  5ECS A;  4O32 A;  5GAP D;  1OC9 A;  3ZMK A;  3CTG A;  4HDE A;  6GSU A;  2FA4 A;  3HVV A;  3BCI A;  1BX9 A;  5HFI A;  3UVH A;  2R2J A;  4OCF A;  1EGO A;  3VWV A;  1SL0 B;  2VCX A;  2CZ3 A;  5J9B A;  4V2N A;  5ENU A;  3KMN A;  5EPF A;  4OCE A;  4IJ3 A;  5F07 A;  2XBI A;  1KTE A;  5EL8 A;  3Q19 A;  2LNS A;  4PXO A;  1GSY A;  1PL2 A;  3LWA A;  2H0G A;  4L5L A;  4ACS A;  5IOX A;  1TI1 A;  4QQ7 A;  2JSY A;  1YF0 A;  1TK0 B;  3DWV A;  4Q5Q A;  4ZL7 A;  2CV4 A;  3VPQ A;  4NMU A;  3APS A;  11GS A;  2I9H A;  3KCM A;  5G1K A;  2WRT A;  2JU5 A;  1CQH A;  3UAR A;  3E3E A;  5DVB A;  1J9B A;  2JSZ A;  2ON7 A;  3D22 A;  1PSQ A;  3RHC A;  1R26 A;  1OC8 A;  3UBK A;  2TRC P;  2E0Q A;  3LYK A;  4IEL A;  1BJX A;  2M72 A;  3KIJ A;  4ZXG A;  3TJF A;  3J7Y k;  1WE0 A;  1M99 A;  2GVP A;  3IPZ A;  5COH A;  3F3Q A;  2A2R A;  3KH9 A;  2H6Z A;  3OR5 A;  2H01 A;  4NV5 A;  4X0X A;  2N5F A;  3RHB A;  2RII A;  5B6M A;  2FD3 A;  1EV9 A;  1N8J A;  2LS5 A;  5GZZ B;  1VF2 A;  4OD7 A;  5DDL A;  3LSZ A;  1TU8 A;  1HD2 A;  3VWU A;  2MZC A;  5GAN D;  2FHE A;  1Z9H A;  3FZ5 A;  2OAD A;  3GX8 A;  4GRF A;  2LRT A;  2C0F A;  3KP8 A;  2DJ0 A;  1WP0 A;  3WGX A;  1G7O A;  1EEM A;  2AUV A;  4BPY A;  4V2M A;  1NM3 A;  4KND A;  3FYG A;  2L59 A;  4KSM A;  1MDJ A;  3EUR A;  22GS A;  5IQY A;  4HEA 2;  2L6C A;  4DEJ A;  1FG4 A;  1GTU A;  4TVE A;  3I69 A;  2PUK C;  1IYI A;  4MPF A;  2HSH A;  3UEM A;  2GLR A;  4EUY A;  2WB9 A;  2VL3 A;  1GUK A;  1Z7P A;  2V1M A;  3HVS A;  1JLV A;  2K18 A;  2FGX A;  5IPG A;  4JU5 A;  4K9Z A;  3EVI A;  3H4K A;  3QFB C;  5IMA A;  2FLS A;  1MD3 A;  4LL4 B;  5DJM A;  3K8N A;  3ISO A;  2KHP A;  5A4W A;  1F3A A;  3DD3 A;  2X99 A;  3ERW A;  4I97 A;  3LJR A;  5ECR B;  4HZ4 A;  4POB A;  1VF3 A;  4AGS A;  5JWQ B;  1URM A;  2B5Y A;  5DQY A;  4KUN A;  2NTO A;  3IE3 A;  3E9J B;  2IMF A;  3RPN A;  1GH2 A;  1HNC A;  2YJ7 A;  3DML A;  3RBT A;  4HQZ A;  2IMI A;  5G5F A;  2KLX A;  4HJ2 A;  4K7O A;  2BJX A;  1R4W A;  3GFK A;  4KDU A;  10GS A;  4PNG A;  3D5J A;  1T8E B;  3GKK A;  3IRA A;  5LCZ A;  2VCZ A;  4WBJ A;  2CVK A;  5D9T A;  2DJ1 A;  1N2A A;  1AW9 A;  2DJJ A;  3UMA A;  3IAM 2;  5HFG A;  4OO4 A;  3TRX A;  4ZBD A;  4HS1 A;  1W89 A;  3QR6 A;  1A0F A;  3BOA A;  5IMV A;  4XS1 A;  4LLR A;  3F3R A;  4WEY A;  1K3L A;  1EOH A;  1PKW A;  1PRX A;  1QFN A;  1YY7 A;  3QAG A;  2X8G A;  3N5O A;  2GZZ A;  4TKY A;  2IME A;  4J57 E;  1AC1 A;  5DQS A;  2YZH A;  1YF1 A;  2Z9S A;  1YKA A;  3TRQ A;  3CSJ A;  1A0R P;  1TW9 A;  4ZL9 A;  1GSF A;  5CRD A;  3Q6O A;  3TJJ A;  5KN1 A;  3BCK A;  1V57 A;  5J5N A;  1K0C A;  2OE3 A;  2EIO A;  2HRN A;  1TK8 B;  3H79 A;  1ABA A;  5D9V A;  1ZMA A;  3HZ4 A;  1YJ6 A;  4IQA A;  2H66 A;  3WT1 A;  1ZGN A;  5IO2 A;  1UVZ A;  1JZD A;  4KX4 A;  2VCW A;  1Y6E A;  3L9S A;  2KOK A;  3VLN A;  2LTK A;  3D0Z A;  4KGI A;  3FY7 A;  1A8L A;  3IXR A;  4L5O A;  1XVQ A;  4ZB8 A;  1XIY A;  2F9S A;  2VLU A;  1PMT A;  2RUF A;  2YP6 A;  3RPP A;  4ID0 A;  4J2F A;  4RUV A;  1AUC A;  3APQ A;  4I5Q A;  4ECI A;  2H0I A;  1H4O A;  5IOW A;  3DEX A;  5CRW A;  1XWC A;  2VM2 A;  2GQK A;  1UN2 A;  1DBY A;  1TRW A;  1O8X A;  2ES7 A;  2L5L A;  3G7I A;  4MZC A;  3IV4 A;  4HJM A;  1B8X A;  3WT2 A;  2KP1 A;  1M2B A;  1K3O A;  1A2M A;  3NZN A;  1RW1 A;  1G0T A;  4HI7 A;  5DJL A;  3AY8 A;  3IR4 A;  2JZR A;  4PNF A;  1RQM A;  3GX0 A;  2H6Y A;  3ZL5 A;  1BYE A;  5ECK B;  3DYR A;  3M0F A;  3WYW A;  4P3Y B;  2IL3 A;  5E59 A;  4DSS A;  2DBC A;  4MZW A;  2G2Q A;  4WKW A;  5FWG A;  1ZOF A;  1U3A A;  1F2E A;  2IMK A;  1KEB A;  3UOM A;  3BJ5 A;  2CAQ A;  4KE3 A;  1F6M C;  1XOB A;  4NHZ A;  4K7I A;  2PN8 A;  1GNE A;  1K0M A;  3DXB A;  5J41 A;  3ZVJ D;  1SK2 A;  2PGT A;  2IMD A;  3A2W A;  2M46 A;  1XWG A;  2WGR A;  3O3T A;  4IP6 A;  3HD5 A;  3C71 A;  5ECN B;  3A3T A;  3F4T A;  2CX4 A;  3GRX A;  3KXO A;  4ZIL A;  3ZML A;  1JLW A;  2WUL A;  1K0B A;  5F0G A;  6GSX A;  1ZL9 A;  2N5A A;  3QMX A;  1SD8 A;  2C0G A;  3IDV A;  1IYH A;  4N10 A;  5H5S A;  3APO A;  2XPD A;  5C04 A;  2QGV A;  3LG6 A;  2GQL A;  1SYX A;  4GCI A;  2V32 A;  4IW9 A;  2LV3 A;  3LXZ A;  2F8F A;  2K8V A;  1B9X C;  4YQM A;  2LNT A;  2DML A;  1DUG A;  1GLP A;  2VD1 A;  4FYU A;  3FK8 A;  1Z6N A;  1MDK A;  4JR4 A;  4IVF A;  2CT6 A;  3GHA A;  4GQF A;  3GL3 A;  2YPM A;  3IHQ A;  4TR4 A;  1EV4 A;  3QCP A;  4ZB9 A;  3W8S A;  3CSI A;  2MBS A;  4IKH A;  1XW9 A;  1XWK A;  1S3C A;  3UBL A;  4MP4 A;  5H5R A;  1X9W B;  5DAL A;  2YWO A;  2V41 A;  4ULX A;  3FRC A;  4TR3 A;  3EYT A;  4L0W A;  4RQX A;  2H1G A;  4MZB A;  2FNO A;  2YOI A;  3CYN A;  3ZFL A;  1S3D A;  8GSS A;  2LST A;  3MWH A;  4OFN A; 
#chains in the Genus database with same CATH topology
 1ZZY A;  1V58 A;  2C0E A;  2R37 A;  4JZQ A;  4QL9 A;  2L4Q A;  2HYX A;  2PU9 C;  1CQG A;  2B1K A;  3H8Q A;  3LGC A;  3HXS A;  5CRH A;  2OAC A;  4LMV A;  5F06 A;  3ZYW A;  5J3R A;  2CX3 A;  5IIZ A;  3DVW A;  3TOU A;  2K9F A;  1S3A A;  3G9B A;  3TKR A;  3VPT A;  2IN3 A;  1XWB A;  3QPM A;  3L78 A;  3TRP A;  1M2D A;  1TTZ A;  1TDI A;  4JE1 A;  1KBN A;  2G0F A;  2CAI A;  4XCS A;  4JBB A;  1UC7 A;  4X1U A;  3FR9 A;  2C0D A;  2OBK A;  3C1S A;  2YCD A;  1ZYE A;  1TK5 B;  1EGR A;  1B9Y C;  3DGQ A;  3A2V A;  1SL2 B;  2X8H A;  4MF5 A;  1EP8 A;  2L4C A;  3A5I A;  2JZS A;  5FHI A;  4EIP A;  1AIU A;  1M0U A;  1AXD A;  3U5R E;  2C3T A;  1TOF A;  5DAL B;  2L57 A;  4D73 A;  4ZL8 A;  2JZT A;  2GSQ A;  3GN3 A;  5FT3 A;  4O92 A;  5JCW A;  4TRX A;  2K8S A;  1BQ7 A;  1WPI A;  5EVO A;  4FQU A;  4KAE A;  3EU3 A;  2YAN A;  1F3B A;  2VL9 A;  3KEB A;  3M1G A;  1SU9 A;  3JCM L;  1TRV A;  4KCE A;  1X5D A;  2QA1 A;  4XS6 A;  1M2A A;  4I8B A;  4PGT A;  4XHM A;  4LMW A;  4Z2U A;  5B7C A;  4ECJ A;  5F8B A;  4JED A;  2ZUP A;  4KDX A;  3IA1 A;  5ELG A;  3FZ4 A;  4O7H A;  5GST A;  1TJD A;  3KM6 A;  4Q5R A;  2VO4 A;  1PFO A;  3HCZ A;  4WXT A;  2FWH A;  3IC4 A;  4ZB6 A;  5IMD A;  3IOS A;  1FVJ A;  1GUL A;  4L8E A;  3O6T A;  3QDN A;  3ME7 A;  1V40 A;  4D73 B;  1PL1 A;  1Z7R A;  5IMF A;  5INY A;  3IAS 2;  18GS A;  4YQU A;  2QA2 A;  4FO5 A;  3GL5 A;  1WIK A;  1R5A A;  3GST A;  1NHY A;  4I2T A;  1KNG A;  5G2Z A;  5ECL B;  4I2U A;  3F8U A;  3GTU A;  3VI5 A;  4CW9 A;  3HZ8 A;  4TOP A;  2WDU A;  1X5E A;  1HQO A;  4WBR D;  5A4U A;  3ZIV A;  1NHO A;  1U3I A;  4IJI A;  4PQH A;  1B4P A;  5JWR B;  1JHB A;  4MCU A;  2D2Z A;  2VUP A;  2NPB A;  2P31 A;  2OA7 A;  3GIX A;  4BA7 A;  1MTC A;  3O76 A;  1E2Y A;  4J56 E;  1OE8 A;  4AJ8 A;  5IM9 A;  3EU4 A;  4TR0 A;  4EO3 A;  4F82 A;  5AGY A;  5HQP A;  1GSD A;  1SD9 A;  6GSS A;  3D6I A;  2O7K A;  4F03 A;  2GST A;  3HDC A;  2ALB A;  1SKW B;  4KW6 A;  5CRE A;  2FWG A;  1YDK A;  3RAZ A;  3IK7 A;  3FW2 A;  4EXJ A;  3LOR A;  4OFT A;  1DE1 A;  2C1Y A;  1ZYQ B;  1I5G A;  1YQ1 A;  4PX1 A;  4WF5 A;  4ECB A;  3PGT A;  2YJH A;  2GGT A;  2H30 A;  1T1V A;  1GSQ A;  2GSR A;  2MBT A;  4MH3 A;  3FHK A;  3VWX A;  2LKU A;  1A2J A;  1THX A;  2CZ2 A;  4N30 A;  4XS4 A;  3A5W A;  1V98 A;  2I81 A;  4EE0 A;  3F63 A;  3GTU B;  3GA4 A;  5D8I A;  1OYJ A;  2AB6 A;  1E6B A;  3TKS C;  4PQ1 A;  3DRN A;  1BAY A;  2PBJ A;  4HUA A;  3LFL A;  3LXT A;  4V1A g;  3ME8 A;  5DBQ A;  1AAZ A;  3DIE A;  3RDW A;  1GTB A;  4AJ7 A;  4G0L A;  2XC2 A;  1XFL A;  4BIK A;  4YQV A;  5JCU A;  5J4U A;  1ON4 A;  1JFU A;  2YWM A;  4FH8 A;  1PX7 A;  4F0B A;  2IPA A;  4GXZ A;  4TR1 A;  2YNX A;  2O89 A;  1EOG A;  2P5R A;  5J9C A;  2X4A A;  3E0U A;  3GUR A;  3Q18 A;  2OKA A;  2B6M A;  4YKF A;  3VK9 A;  3TUE A;  2B5X A;  2L5O A;  4XRA A;  2YZU A;  3P8W A;  1Y25 A;  4XS4 B;  1O85 A;  1GL8 A;  3NOF A;  4F0C A;  1FOV A;  2MMZ A;  4GSN A;  1FW1 A;  1UA5 A;  1ML6 A;  3GH6 A;  2VIM A;  3FKF A;  4TXO A;  1OKT A;  3I43 A;  1Q98 A;  4WR4 A;  4GWR A;  3IBH A;  1O81 A;  4K8M A;  2IJY A;  3L0H A;  5D73 A;  1G6W A;  1LJR A;  3US3 A;  5JWO B;  3M3M A;  4HOJ A;  4XTS A;  2FA8 A;  3MNG A;  4TR1 B;  1GSU A;  1FB6 A;  1C72 A;  1ILO A;  4RI6 A;  2F3M A;  2MYG A;  4EVM A;  1XXU A;  1GSE A;  1J08 A;  3A2X A;  1ZYP A;  3L9V A;  5HR1 A;  2AV4 A;  3EIN A;  2DSA A;  3UIW A;  1X0R A;  3LQ7 A;  9GSS A;  3HJO A;  2X8C A;  5D9X A;  2FCH A;  3KMO A;  1FO5 A;  3R3E A;  1AQV A;  3BD2 A;  3MSZ A;  1A2L A;  1FB0 A;  2DKI A;  1TKD B;  1PD2 1;  2YWI A;  4WR5 A;  3V1W A;  3GH9 A;  6GSY A;  3VI7 A;  2LJA A;  1SJZ A;  1QK8 A;  1GUM A;  2RM5 A;  2OE1 A;  3EE2 A;  2H71 A;  2LUS A;  4TXO B;  4FIW A;  3ERF A;  2GT6 A;  1ST9 A;  1YEX A;  2BMX A;  1T00 A;  3HYP A;  1TI3 A;  2MMO A;  4NXI A;  4OFM A;  4MA9 A;  3CSH A;  5CRG A;  2R0C A;  3CRT A;  4Z7X A;  4KCA A;  5G30 A;  4OWY A;  1XW6 A;  2REM A;  3MAK A;  2V2G A;  1G7E A;  3QAV A;  4CHS A;  2C8U A;  1DSB A;  3LYP A;  5CYY A;  1LU4 A;  4AF2 A;  3KJY A;  4YAP A;  3VFI A;  2GSS A;  4MNN A;  1SYR A;  4K0G A;  2LRN A;  2FWE A;  2WJU A;  1JZR A;  2F51 A;  4IN0 A;  2JAC A;  1EEJ A;  5IMC A;  1MEK A;  3I6A A;  2VL2 C;  1XG8 A;  5E4W A;  2DMM A;  14GS A;  2H75 A;  2R0G A;  1PQN A;  3L9U A;  6GSV A;  1XCC A;  2PER A;  4NAX A;  3F0I A;  3F4R A;  1Z3E A;  4E8H A;  1GP1 A;  2H19 A;  3FEU A;  1SKR B;  2F8A A;  3HY2 A;  1O73 A;  3R2Q A;  4WET A;  2HSY A;  2BTO T;  1FHE A;  5CAX A;  5HR3 A;  4EC0 A;  2P0G A;  1K0D A;  2CA8 A;  5ECM B;  2KUC A;  3WGE A;  3LEF A;  2FY6 A;  4KF9 A;  2MMN A;  4N11 A;  4BWQ A;  2FWF A;  4KSO A;  1WOU A;  2J23 A;  5HR2 A;  3HVX A;  3Q74 A;  1VRS D;  3UL3 A;  3HA9 A;  2HZE A;  1HYU A;  4BVX B;  1TXX A;  4FYB A;  3UVT A;  1SJI A;  3C7M A;  3PR8 A;  4EKZ A;  1BED A;  2EIQ A;  1FAA A;  2AHE A;  2WFC A;  3P90 A;  2C80 A;  2VOC A;  3UJ1 A;  3GKM A;  3ZVJ A;  2HT9 A;  4K0N A;  2GQM A;  1XWA A;  2WCI A;  2R4V A;  4GST A;  4ZBB A;  5HR0 A;  1MD4 A;  5GSS A;  2H1D A;  1VGL A;  1ERU A;  4RQR A;  1EWX A;  4RI7 A;  1DE2 A;  1XOA A;  2OBI A;  4POK A;  2NBS A;  2TIR A;  3H1N A;  1GUH A;  2VLT A;  2QSI A;  3I9V 2;  2V6K A;  4ZIJ A;  1K0A A;  1ZYN A;  2DLX A;  2RM6 A;  2KP2 A;  2DJ3 A;  2HZE B;  3CBU A;  3M8N A;  3VUR A;  5AIX A;  2HFD A;  3KP9 A;  3TKP A;  1M9A A;  3TKQ A;  1G6Y A;  2H76 A;  3F9U A;  3M9J A;  2E2G A;  2R6K A;  3C1R A;  3TJK A;  2B1L A;  3H93 A;  5CO3 A;  4GF0 A;  1X5C A;  1TP9 A;  4HU9 A;  3EPT A;  1GTI A;  1NSW A;  5D96 A;  3SWL A;  3G7Y A;  4DSR A;  1OC9 B;  4OMV A;  4X43 A;  4MF6 A;  2VCT A;  4MAB A;  1GTA A;  1V2A A;  1O6J A;  3ZRE A;  3FR3 A;  1M7T A;  2PMT A;  4WF4 A;  3S9F A;  1SKS B;  4G0K A;  1YZX A;  2C3N A;  4LA1 A;  4MLY A;  4BL7 A;  2UZ8 A;  2N5B A;  5B8B A;  1EZK A;  5ECQ B;  3ZRD A;  4FYC A;  5IPH A;  3TGZ A;  1ZCP A;  4JR6 A;  1SL1 B;  2HNL A;  1F9M A;  3SBC A;  1A24 A;  2LEG A;  1WMJ A;  3FR6 A;  4MH2 A;  2VCV A;  4N0Z A;  2VM1 A;  4MJE A;  3TDG A;  4PUA A;  3CXG A;  4G9H A;  2XPE A;  5ECO B;  5KEJ A;  1U6T A;  1A8Y A;  2AYT A;  1RK4 A;  1QUW A;  4GLT A;  5LD0 A;  4POL A;  3CQF A;  3GUS A;  2DJ2 A;  1T7P B;  1YKC A;  4YAV A;  2H73 A;  4NV2 A;  4E8E A;  5G1L A;  3TJG A;  3NIV A;  2JL4 A;  1GLQ A;  2V6O A;  5JCG A;  2HI7 A;  2DJK A;  4OO5 A;  3TB2 A;  5ECP B;  4MJC A;  1ERT A;  3N9J A;  4DSQ A;  1BG5 A;  2CQ9 A;  17GS A;  2GT5 A;  3P2A A;  3W6G A;  3G7J A;  3M9K A;  1YEP A;  1M3I A;  5IO0 A;  1GWC A;  4USS A;  1K0N A;  2H70 A;  5G31 A;  3PIN A;  1XBS A;  1NW2 A;  1PA3 A;  4GTU A;  5ID2 A;  2O87 A;  1ERW A;  2EIR A;  4BL7 B;  1MDI A;  2HLS A;  2HRA A;  1VF4 A;  2MMA A;  3WD6 A;  5ECI B;  4V1A p;  2B5E A;  4Z2R A;  4PUR A;  5HFK A;  2GZY A;  3EMP A;  3HJM A;  1O7U A;  1ERV A;  2P5Q A;  3HHV A;  4YH2 A;  4GQC A;  1PN9 A;  3GSS A;  2H1B A;  4Q5F A;  3ZIJ A;  4YKG A;  1SEN A;  1X9S B;  1AQX A;  3TKS A;  4EDY A;  2DIZ A;  2OJL A;  4XRD A;  1PGT A;  2H6X A;  3ZIT A;  1XPV A;  3L4N A;  3ERG A;  1Q4J A;  2X49 A;  3IK9 A;  3PPU A;  2H74 A;  2JAD A;  2GS3 A;  6GSW A;  1A23 A;  4ILF A;  3HKR A;  2LQQ A;  1M3J A;  1I9D A;  4PQI A;  2XHF A;  4ECC A;  2VLV A;  3TKS E;  2VD0 A;  1QMV A;  1WWJ A;  3F4S A;  3KTB A;  2TRX A;  2PPT A;  1OE7 A;  4MPG A;  3HJP A;  4EDZ A;  1SK0 A;  1EP7 A;  4MJB A;  5ID2 B;  4KB3 A;  6GST A;  2HE3 A;  5ECH B;  2PVO C;  1O8W A;  3KGK A;  4ZBA A;  1LBK A;  2WS2 A;  20GS A;  4MF7 A;  3TJB A;  4AJ6 A;  4KDY A;  4K5R A;  4KH7 A;  1HNA A;  5CNW A;  5B6N A;  4HZ2 A;  2YV9 A;  4K6X A;  1JZO A;  4KA0 A;  2E7P A;  2OE0 A;  3D21 A;  5LNK e;  3TOT A;  1OVN A;  4X4J A;  2H0H A;  3PH9 A;  1QQ2 A;  2NDO A;  4HQS A;  3F6F A;  4GSS A;  2R5G A;  1TRS A;  4TN8 A;  2B3S A;  2IFQ A;  2A2S A;  3EMX A;  2IIY A;  5ELA A;  4IQ1 A;  4MDC A;  3C73 A;  4IHU A;  3U6V A;  1H75 A;  4LL1 B;  2YV7 A;  3KZQ A;  2H8L A;  2IWT A;  4ISD A;  3GKX A;  5DAK A;  2ZCT A;  1XVW A;  2I1U A;  3CTF A;  2LJK A;  5D9W A;  4DVC A;  1T4Y A;  5L71 A;  2HXK A;  2VCQ A;  1PX6 A;  1GNW A;  4CDO A;  4EF0 A;  2CVB A;  3MYD A;  1U87 A;  1W4V A;  1TRU A;  5C00 A;  1ACV A;  3FMW A;  2DC5 A;  4MMM A;  2QC7 A;  4TW5 A;  3ZLP A;  4BWS A;  5EY6 A;  4I6X A;  1R7H A;  1AQW A;  5B8A A;  4F9Z A;  1K0O A;  2M80 A;  3P7X A;  1WJK A;  2H72 A;  2RLI A;  3GNJ A;  3D4T A;  3GYK A;  2IFQ B;  3VWW A;  1V9W A;  2C4J A;  4ML6 A;  1JZW A;  3ZFB A;  2WZ9 A;  1B48 A;  2YN1 A;  3QOU A;  3QD9 A;  3BBY A;  5ABR A;  2J9H A;  1USB A;  2X64 A;  5DAK B;  4G19 A;  1Z6M A;  4L0U A;  2LJR A;  3DVX A;  2H1A A;  2LRC A;  5A5K A;  5F05 A;  2C3Q A;  4IBP A;  3GMF A;  3ZZX A;  4O5R A;  3W8J A;  4JRR A;  2LQO A;  16GS A;  4NPB A;  2VL2 A;  2B7J A;  4ML1 A;  5AIV A;  5DCG A;  2YWN A;  1VF1 A;  1WRY A;  3WGD A;  5KN2 A;  19GS A;  2PVQ A;  3CRU A;  1T3B A;  2I3Y A;  4K2D A;  4NHW A;  2ON5 A;  5A4V A;  2A4V A;  4MK3 A;  3CMI A;  1SK1 A;  4BVX A;  4NWY A;  3EWL A;  5G5E A;  2EC4 A;  2HRF A;  4TXV A;  4BVY A;  3D4M A;  1QGV A;  2GDR A;  2I4A A;  2K6V A;  2NVL A;  5H5Q A;  5AN1 A;  4K1F A;  4K7N A;  1B4Q A;  3C8E A;  3GKN A;  1S3R A;  5DCH A;  7GSS A;  2B7K A;  2AAW A;  4XIH A;  3EC3 A;  2GTU A;  3QFA C;  1XW5 A;  1U88 A;  4POM A;  3ZTL A;  1TU7 A;  4F2I A;  5AIS A;  2ZNM A;  5KN3 A;  2AJQ B;  4Q5N A;  2XBQ A;  3KH7 A;  2CVD A;  4EIQ A;  1HNB A;  4HSC X;  1K3Y A;  4QL7 A;  1XZO A;  1T4Z A;  5KN0 A;  3TCO A;  3QAW A;  3FZ9 A;  1OC3 A;  4DSS B;  2DIY A;  4Z2T A;  1J0F A;  1OKD A;  2E2M A;  4N0V A;  3J7Y b;  4G10 A;  2VAF A;  4HU7 A;  2L6D A;  3UAP A;  3KTL A;  1QXH A;  1X9M B;  3KD0 A;  4V2L A;  1FVK A;  3F6D A;  4G2E A;  12GS A;  2QKE A;  5IMZ A;  3ED3 A;  4H86 A;  2RUE A;  4IS0 A;  4EL1 A;  3MDK A;  3FZA A;  2R3X A;  4BVY B;  2FUG 2;  4MJA A;  5CP1 A;  2PWJ A;  1SJ6 A;  1GSS A;  2A2P A;  1PKZ A;  2HZF A;  1F37 A;  1R5P A;  3GV1 A;  5D93 A;  2GZP A;  2O8V B;  1M9B A;  13GS A;  2A4H A;  3DKS A;  1GRX A;  4PUF C;  1OAZ A;  4IP1 A;  1Z5Y E;  2O85 A;  4IGJ A;  1THO A;  5ECS A;  4O32 A;  5GAP D;  1OC9 A;  3ZMK A;  3CTG A;  4HDE A;  6GSU A;  2FA4 A;  3HVV A;  3BCI A;  1BX9 A;  5HFI A;  3UVH A;  2R2J A;  4OCF A;  1EGO A;  3VWV A;  1SL0 B;  2VCX A;  2CZ3 A;  5J9B A;  4V2N A;  5ENU A;  3KMN A;  4OCE A;  5EPF A;  4IJ3 A;  5F07 A;  2XBI A;  1KTE A;  5EL8 A;  3Q19 A;  2LNS A;  4PXO A;  1GSY A;  1PL2 A;  3LWA A;  2H0G A;  4L5L A;  4ACS A;  5IOX A;  1TI1 A;  4QQ7 A;  5KOX A;  2JSY A;  1YF0 A;  1TK0 B;  3DWV A;  4Q5Q A;  4ZL7 A;  2CV4 A;  3VPQ A;  4NMU A;  3APS A;  11GS A;  2I9H A;  3KCM A;  1PN0 A;  5G1K A;  2WRT A;  2JU5 A;  1CQH A;  3UAR A;  3E3E A;  5DVB A;  1J9B A;  2JSZ A;  2ON7 A;  3D22 A;  1PSQ A;  3RHC A;  1R26 A;  1OC8 A;  3UBK A;  2TRC P;  2E0Q A;  3LYK A;  4IEL A;  1BJX A;  2M72 A;  3KIJ A;  4ZXG A;  3TJF A;  3J7Y k;  1WE0 A;  1M99 A;  2GVP A;  3IPZ A;  5COH A;  3F3Q A;  4PTS A;  2A2R A;  3KH9 A;  2H6Z A;  3OR5 A;  2H01 A;  4NV5 A;  4X0X A;  2N5F A;  3RHB A;  2RII A;  5B6M A;  2FD3 A;  5KOW A;  1EV9 A;  1N8J A;  2LS5 A;  5GZZ B;  1VF2 A;  4OD7 A;  5DDL A;  3LSZ A;  1TU8 A;  1HD2 A;  3VWU A;  2MZC A;  5GAN D;  2FHE A;  1Z9H A;  3FZ5 A;  2OAD A;  3GX8 A;  4GRF A;  2LRT A;  2C0F A;  4O5U A;  3KP8 A;  2DJ0 A;  1WP0 A;  3WGX A;  1G7O A;  1EEM A;  2AUV A;  4BPY A;  4V2M A;  2R0P A;  1NM3 A;  4KND A;  3FYG A;  2L59 A;  4KSM A;  1MDJ A;  3EUR A;  22GS A;  5IQY A;  4HEA 2;  2L6C A;  4DEJ A;  1FG4 A;  1GTU A;  4TVE A;  2HRK A;  2PUK C;  1IYI A;  3I69 A;  4MPF A;  2HSH A;  3UEM A;  2GLR A;  4EUY A;  2WB9 A;  2VL3 A;  1GUK A;  1Z7P A;  2V1M A;  3HVS A;  1JLV A;  2K18 A;  2FGX A;  5IPG A;  4JU5 A;  4K9Z A;  3EVI A;  3H4K A;  3QFB C;  5IMA A;  2FLS A;  1MD3 A;  4LL4 B;  5DJM A;  3HVN A;  3K8N A;  3ISO A;  2KHP A;  5A4W A;  4O5Q A;  1F3A A;  3IHG A;  3DD3 A;  2X99 A;  3ERW A;  4I97 A;  3LJR A;  5ECR B;  4HZ4 A;  4POB A;  1VF3 A;  4AGS A;  5JWQ B;  1URM A;  2B5Y A;  3MIX A;  5DQY A;  4KUN A;  2NTO A;  3IE3 A;  3E9J B;  2IMF A;  3RPN A;  1GH2 A;  1HNC A;  2YJ7 A;  3DML A;  3RBT A;  4HQZ A;  2IMI A;  5G5F A;  2KLX A;  4HJ2 A;  4K7O A;  2BJX A;  1R4W A;  3GFK A;  4KDU A;  10GS A;  4PNG A;  3D5J A;  1T8E B;  3GKK A;  3IRA A;  5LCZ A;  2VCZ A;  4WBJ A;  2CVK A;  5D9T A;  2DJ1 A;  1N2A A;  1AW9 A;  2DJJ A;  3UMA A;  3IAM 2;  5HFG A;  4OO4 A;  3TRX A;  2HSM A;  4ZBD A;  4HS1 A;  1W89 A;  3QR6 A;  1A0F A;  3BOA A;  5IMV A;  4XS1 A;  4LLR A;  3F3R A;  4WEY A;  1K3L A;  1EOH A;  1PKW A;  1PRX A;  1QFN A;  1YY7 A;  3QAG A;  2X8G A;  3N5O A;  2GZZ A;  4TKY A;  2IME A;  4J57 E;  1AC1 A;  5DQS A;  2YZH A;  1YF1 A;  2Z9S A;  1YKA A;  3TRQ A;  3CSJ A;  1A0R P;  1TW9 A;  4ZL9 A;  1GSF A;  5CRD A;  3Q6O A;  3TJJ A;  5KN1 A;  3BCK A;  1V57 A;  5J5N A;  1K0C A;  2OE3 A;  2EIO A;  2HRN A;  1TK8 B;  3H79 A;  1ABA A;  5D9V A;  1ZMA A;  3HZ4 A;  1YJ6 A;  4IQA A;  2H66 A;  3WT1 A;  1ZGN A;  4K5S A;  5IO2 A;  1UVZ A;  1JZD A;  4KX4 A;  2VCW A;  1Y6E A;  3L9S A;  4CY6 A;  2KOK A;  3VLN A;  2LTK A;  3D0Z A;  4KGI A;  3FY7 A;  1A8L A;  3IXR A;  4L5O A;  1XVQ A;  4ZB8 A;  1XIY A;  2F9S A;  2VLU A;  1PMT A;  2RUF A;  2YP6 A;  3RPP A;  4ID0 A;  4J2F A;  4RUV A;  1AUC A;  3APQ A;  4I5Q A;  4ECI A;  2H0I A;  1H4O A;  5IOW A;  3DEX A;  5CRW A;  1XWC A;  2VM2 A;  2GQK A;  1UN2 A;  1DBY A;  1TRW A;  1O8X A;  4K2X A;  2ES7 A;  2L5L A;  3G7I A;  4MZC A;  3IV4 A;  4HJM A;  1B8X A;  3WT2 A;  2KP1 A;  1M2B A;  1K3O A;  1A2M A;  3NZN A;  1RW1 A;  1G0T A;  4HI7 A;  5DJL A;  3AY8 A;  3IR4 A;  2JZR A;  4PNF A;  1RQM A;  3GX0 A;  2H6Y A;  3ZL5 A;  1BYE A;  5BRT A;  5ECK B;  3DYR A;  3M0F A;  3WYW A;  4P3Y B;  2IL3 A;  5E59 A;  4DSS A;  2DBC A;  4MZW A;  2G2Q A;  4WKW A;  5FWG A;  1ZOF A;  1U3A A;  1F2E A;  2IMK A;  1KEB A;  3UOM A;  3BJ5 A;  2CAQ A;  4KE3 A;  1F6M C;  4G0I A;  1XOB A;  4NHZ A;  4K7I A;  2PN8 A;  1GNE A;  1K0M A;  3DXB A;  5J41 A;  3ZVJ D;  1SK2 A;  2PGT A;  2IMD A;  3A2W A;  2M46 A;  1XWG A;  2WGR A;  3O3T A;  4IP6 A;  3HD5 A;  3C71 A;  5ECN B;  3A3T A;  3F4T A;  5BMU A;  2CX4 A;  4CY8 A;  3GRX A;  3KXO A;  4ZIL A;  3ZML A;  2DKH A;  1JLW A;  2WUL A;  1K0B A;  5F0G A;  1FOH A;  6GSX A;  1ZL9 A;  2N5A A;  3QMX A;  1SD8 A;  2C0G A;  3IDV A;  4ICY A;  1IYH A;  4N10 A;  5H5S A;  3APO A;  2XPD A;  5C04 A;  4A5P A;  2QGV A;  3LG6 A;  2GQL A;  1SYX A;  4GCI A;  2V32 A;  4IW9 A;  2LV3 A;  3LXZ A;  2F8F A;  2K8V A;  1B9X C;  4YQM A;  2LNT A;  3IC8 A;  2DML A;  1DUG A;  1GLP A;  2VD1 A;  4FYU A;  3FK8 A;  1Z6N A;  1MDK A;  4JR4 A;  4IVF A;  2CT6 A;  3GHA A;  4GQF A;  3GL3 A;  2YPM A;  3IHQ A;  4TR4 A;  1EV4 A;  3QCP A;  4ZB9 A;  3W8S A;  3CSI A;  2MBS A;  4IKH A;  1XW9 A;  1XWK A;  1S3C A;  3UBL A;  4MP4 A;  5H5R A;  1X9W B;  5DAL A;  2YWO A;  2V41 A;  4ULX A;  3LW9 A;  3FRC A;  4TR3 A;  3EYT A;  4L0W A;  4RQX A;  2H1G A;  4MZB A;  2FNO A;  2YOI A;  3CYN A;  3ZFL A;  1S3D A;  8GSS A;  2LST A;  3MWH A;  4OFN A; 
#chains in the Genus database with same CATH homology
 1ZZY A;  1V58 A;  2C0E A;  2R37 A;  4JZQ A;  4QL9 A;  2L4Q A;  2HYX A;  2PU9 C;  1CQG A;  2B1K A;  3H8Q A;  3LGC A;  3HXS A;  5CRH A;  2OAC A;  4LMV A;  5F06 A;  3ZYW A;  5J3R A;  2CX3 A;  5IIZ A;  3DVW A;  3TOU A;  2K9F A;  1S3A A;  3G9B A;  3TKR A;  3VPT A;  2IN3 A;  1XWB A;  3QPM A;  3L78 A;  3TRP A;  1M2D A;  1TTZ A;  1TDI A;  4JE1 A;  1KBN A;  2G0F A;  2CAI A;  4XCS A;  4JBB A;  1UC7 A;  4X1U A;  3FR9 A;  2C0D A;  2OBK A;  3C1S A;  2YCD A;  1ZYE A;  1TK5 B;  1EGR A;  1B9Y C;  3DGQ A;  3A2V A;  1SL2 B;  2X8H A;  4MF5 A;  1EP8 A;  2L4C A;  3A5I A;  2JZS A;  5FHI A;  4EIP A;  1AIU A;  1M0U A;  1AXD A;  3U5R E;  2C3T A;  1TOF A;  5DAL B;  2L57 A;  4D73 A;  4ZL8 A;  2JZT A;  2GSQ A;  3GN3 A;  5FT3 A;  4O92 A;  5JCW A;  4TRX A;  2K8S A;  1BQ7 A;  1WPI A;  5EVO A;  4FQU A;  4KAE A;  3EU3 A;  2YAN A;  1F3B A;  2VL9 A;  3KEB A;  3M1G A;  1SU9 A;  3JCM L;  1TRV A;  4KCE A;  1X5D A;  2QA1 A;  4XS6 A;  1M2A A;  4I8B A;  4PGT A;  4XHM A;  4LMW A;  4Z2U A;  5B7C A;  4ECJ A;  5F8B A;  4JED A;  2ZUP A;  4KDX A;  3IA1 A;  5ELG A;  3FZ4 A;  4O7H A;  5GST A;  1TJD A;  3KM6 A;  4Q5R A;  2VO4 A;  3HCZ A;  4WXT A;  2FWH A;  3IC4 A;  4ZB6 A;  5IMD A;  3IOS A;  1FVJ A;  1GUL A;  4L8E A;  3O6T A;  3QDN A;  3ME7 A;  1V40 A;  4D73 B;  1PL1 A;  1Z7R A;  5IMF A;  5INY A;  3IAS 2;  18GS A;  4YQU A;  2QA2 A;  4FO5 A;  3GL5 A;  1WIK A;  1R5A A;  3GST A;  1NHY A;  4I2T A;  1KNG A;  5G2Z A;  5ECL B;  4I2U A;  3F8U A;  3GTU A;  3VI5 A;  4CW9 A;  3HZ8 A;  4TOP A;  2WDU A;  1X5E A;  1HQO A;  4WBR D;  5A4U A;  3ZIV A;  1NHO A;  1U3I A;  4IJI A;  4PQH A;  1B4P A;  5JWR B;  1JHB A;  4MCU A;  2D2Z A;  2VUP A;  2NPB A;  2P31 A;  2OA7 A;  3GIX A;  4BA7 A;  1MTC A;  3O76 A;  1E2Y A;  4J56 E;  1OE8 A;  4AJ8 A;  5IM9 A;  3EU4 A;  4TR0 A;  4EO3 A;  4F82 A;  5AGY A;  5HQP A;  1GSD A;  1SD9 A;  6GSS A;  3D6I A;  2O7K A;  4F03 A;  2GST A;  3HDC A;  2ALB A;  1SKW B;  4KW6 A;  5CRE A;  2FWG A;  1YDK A;  3RAZ A;  3IK7 A;  3FW2 A;  4EXJ A;  3LOR A;  4OFT A;  1DE1 A;  2C1Y A;  1ZYQ B;  1I5G A;  1YQ1 A;  4PX1 A;  4WF5 A;  4ECB A;  3PGT A;  2YJH A;  2GGT A;  2H30 A;  1T1V A;  1GSQ A;  2GSR A;  2MBT A;  4MH3 A;  3FHK A;  3VWX A;  2LKU A;  1A2J A;  1THX A;  2CZ2 A;  4N30 A;  4XS4 A;  3A5W A;  1V98 A;  2I81 A;  4EE0 A;  3F63 A;  3GTU B;  3GA4 A;  5D8I A;  1OYJ A;  2AB6 A;  1E6B A;  3TKS C;  4PQ1 A;  3DRN A;  1BAY A;  2PBJ A;  4HUA A;  3LFL A;  3LXT A;  4V1A g;  3ME8 A;  5DBQ A;  1AAZ A;  3DIE A;  3RDW A;  1GTB A;  4AJ7 A;  4G0L A;  2XC2 A;  1XFL A;  4YQV A;  5JCU A;  5J4U A;  1ON4 A;  1JFU A;  2YWM A;  4FH8 A;  1PX7 A;  4F0B A;  2IPA A;  4GXZ A;  4TR1 A;  2YNX A;  2O89 A;  1EOG A;  2P5R A;  5J9C A;  2X4A A;  3E0U A;  3GUR A;  3Q18 A;  2OKA A;  2B6M A;  4YKF A;  3VK9 A;  3TUE A;  2B5X A;  2L5O A;  4XRA A;  2YZU A;  3P8W A;  1Y25 A;  4XS4 B;  1O85 A;  1GL8 A;  3NOF A;  4F0C A;  1FOV A;  2MMZ A;  4GSN A;  1FW1 A;  1UA5 A;  1ML6 A;  3GH6 A;  2VIM A;  3FKF A;  4TXO A;  1OKT A;  3I43 A;  1Q98 A;  4WR4 A;  4GWR A;  3IBH A;  1O81 A;  4K8M A;  2IJY A;  3L0H A;  5D73 A;  1G6W A;  1LJR A;  3US3 A;  5JWO B;  3M3M A;  4HOJ A;  4XTS A;  2FA8 A;  3MNG A;  4TR1 B;  1GSU A;  1FB6 A;  1C72 A;  1ILO A;  4RI6 A;  2F3M A;  2MYG A;  4EVM A;  1XXU A;  1GSE A;  1J08 A;  3A2X A;  1ZYP A;  3L9V A;  5HR1 A;  2AV4 A;  3EIN A;  2DSA A;  3UIW A;  1X0R A;  3LQ7 A;  9GSS A;  3HJO A;  2X8C A;  5D9X A;  2FCH A;  3KMO A;  1FO5 A;  3R3E A;  1AQV A;  3BD2 A;  3MSZ A;  1A2L A;  1FB0 A;  2DKI A;  1TKD B;  1PD2 1;  2YWI A;  4WR5 A;  3V1W A;  3GH9 A;  6GSY A;  3VI7 A;  2LJA A;  1SJZ A;  1QK8 A;  1GUM A;  2RM5 A;  2OE1 A;  3EE2 A;  2H71 A;  2LUS A;  4TXO B;  4FIW A;  3ERF A;  2GT6 A;  1ST9 A;  1YEX A;  2BMX A;  1T00 A;  3HYP A;  1TI3 A;  2MMO A;  4NXI A;  4OFM A;  4MA9 A;  3CSH A;  5CRG A;  2R0C A;  3CRT A;  4Z7X A;  4KCA A;  5G30 A;  4OWY A;  1XW6 A;  2REM A;  3MAK A;  2V2G A;  1G7E A;  3QAV A;  4CHS A;  2C8U A;  1DSB A;  3LYP A;  5CYY A;  1LU4 A;  4AF2 A;  3KJY A;  4YAP A;  3VFI A;  2GSS A;  4MNN A;  1SYR A;  4K0G A;  2LRN A;  2FWE A;  2WJU A;  1JZR A;  2F51 A;  4IN0 A;  2JAC A;  1EEJ A;  5IMC A;  1MEK A;  3I6A A;  2VL2 C;  5E4W A;  2DMM A;  14GS A;  2H75 A;  2R0G A;  1PQN A;  3L9U A;  6GSV A;  1XCC A;  2PER A;  4NAX A;  3F0I A;  3F4R A;  1Z3E A;  4E8H A;  1GP1 A;  2H19 A;  3FEU A;  1SKR B;  2F8A A;  3HY2 A;  1O73 A;  3R2Q A;  4WET A;  2HSY A;  2BTO T;  1FHE A;  5CAX A;  5HR3 A;  4EC0 A;  2P0G A;  1K0D A;  2CA8 A;  5ECM B;  2KUC A;  3WGE A;  3LEF A;  2FY6 A;  4KF9 A;  2MMN A;  4N11 A;  4BWQ A;  2FWF A;  4KSO A;  1WOU A;  2J23 A;  5HR2 A;  3HVX A;  3Q74 A;  1VRS D;  3UL3 A;  3HA9 A;  2HZE A;  1HYU A;  4BVX B;  1TXX A;  4FYB A;  3UVT A;  1SJI A;  3C7M A;  3PR8 A;  4EKZ A;  1BED A;  2EIQ A;  1FAA A;  2AHE A;  2WFC A;  3P90 A;  2C80 A;  2VOC A;  3UJ1 A;  3GKM A;  3ZVJ A;  2HT9 A;  4K0N A;  2GQM A;  1XWA A;  2WCI A;  2R4V A;  4GST A;  4ZBB A;  5HR0 A;  1MD4 A;  5GSS A;  2H1D A;  1VGL A;  1ERU A;  4RQR A;  1EWX A;  4RI7 A;  1DE2 A;  1XOA A;  2OBI A;  4POK A;  2NBS A;  2TIR A;  3H1N A;  1GUH A;  2VLT A;  2QSI A;  3I9V 2;  2V6K A;  4ZIJ A;  1K0A A;  1ZYN A;  2DLX A;  2RM6 A;  2KP2 A;  2DJ3 A;  2HZE B;  3CBU A;  3M8N A;  3VUR A;  5AIX A;  2HFD A;  3KP9 A;  3TKP A;  1M9A A;  3TKQ A;  1G6Y A;  2H76 A;  3F9U A;  3M9J A;  2E2G A;  2R6K A;  3C1R A;  3TJK A;  2B1L A;  3H93 A;  5CO3 A;  4GF0 A;  1X5C A;  1TP9 A;  4HU9 A;  3EPT A;  1GTI A;  1NSW A;  5D96 A;  3SWL A;  3G7Y A;  4DSR A;  1OC9 B;  4OMV A;  4X43 A;  4MF6 A;  2VCT A;  4MAB A;  1GTA A;  1V2A A;  1O6J A;  3ZRE A;  3FR3 A;  1M7T A;  2PMT A;  4WF4 A;  3S9F A;  1SKS B;  4G0K A;  1YZX A;  2C3N A;  4LA1 A;  4MLY A;  4BL7 A;  2UZ8 A;  2N5B A;  5B8B A;  1EZK A;  5ECQ B;  3ZRD A;  4FYC A;  5IPH A;  3TGZ A;  1ZCP A;  4JR6 A;  1SL1 B;  2HNL A;  1F9M A;  3SBC A;  1A24 A;  2LEG A;  1WMJ A;  3FR6 A;  4MH2 A;  2VCV A;  4N0Z A;  2VM1 A;  4MJE A;  3TDG A;  4PUA A;  3CXG A;  4G9H A;  2XPE A;  5ECO B;  5KEJ A;  1U6T A;  1A8Y A;  2AYT A;  1RK4 A;  1QUW A;  4GLT A;  5LD0 A;  4POL A;  3GUS A;  2DJ2 A;  1T7P B;  1YKC A;  4YAV A;  2H73 A;  4NV2 A;  4E8E A;  5G1L A;  3TJG A;  3NIV A;  2JL4 A;  1GLQ A;  2V6O A;  5JCG A;  2HI7 A;  2DJK A;  4OO5 A;  3TB2 A;  5ECP B;  4MJC A;  1ERT A;  3N9J A;  4DSQ A;  1BG5 A;  2CQ9 A;  17GS A;  2GT5 A;  3P2A A;  3W6G A;  3G7J A;  3M9K A;  1YEP A;  5IO0 A;  1GWC A;  4USS A;  1K0N A;  2H70 A;  5G31 A;  3PIN A;  1XBS A;  1NW2 A;  1PA3 A;  4GTU A;  5ID2 A;  2O87 A;  1ERW A;  2EIR A;  4BL7 B;  1MDI A;  2HLS A;  2HRA A;  1VF4 A;  2MMA A;  3WD6 A;  5ECI B;  4V1A p;  2B5E A;  4Z2R A;  4PUR A;  5HFK A;  2GZY A;  3EMP A;  3HJM A;  1O7U A;  1ERV A;  2P5Q A;  3HHV A;  4YH2 A;  4GQC A;  1PN9 A;  3GSS A;  2H1B A;  4Q5F A;  3ZIJ A;  4YKG A;  1SEN A;  1X9S B;  1AQX A;  3TKS A;  4EDY A;  2DIZ A;  2OJL A;  4XRD A;  1PGT A;  2H6X A;  3ZIT A;  1XPV A;  3L4N A;  3ERG A;  1Q4J A;  2X49 A;  3IK9 A;  3PPU A;  2H74 A;  2JAD A;  2GS3 A;  6GSW A;  1A23 A;  4ILF A;  3HKR A;  2LQQ A;  4PQI A;  1I9D A;  2XHF A;  4ECC A;  2VLV A;  3TKS E;  2VD0 A;  1QMV A;  1WWJ A;  3F4S A;  3KTB A;  2TRX A;  2PPT A;  1OE7 A;  4MPG A;  3HJP A;  4EDZ A;  1SK0 A;  1EP7 A;  4MJB A;  5ID2 B;  4KB3 A;  6GST A;  2HE3 A;  5ECH B;  2PVO C;  1O8W A;  3KGK A;  4ZBA A;  1LBK A;  2WS2 A;  20GS A;  4MF7 A;  3TJB A;  4AJ6 A;  4KDY A;  4K5R A;  4KH7 A;  1HNA A;  5CNW A;  5B6N A;  4HZ2 A;  2YV9 A;  4K6X A;  1JZO A;  4KA0 A;  2E7P A;  2OE0 A;  3D21 A;  5LNK e;  3TOT A;  1OVN A;  4X4J A;  2H0H A;  3PH9 A;  1QQ2 A;  2NDO A;  4HQS A;  3F6F A;  4GSS A;  2R5G A;  1TRS A;  4TN8 A;  2B3S A;  2IFQ A;  2A2S A;  3EMX A;  2IIY A;  5ELA A;  4IQ1 A;  4MDC A;  3C73 A;  4IHU A;  3U6V A;  1H75 A;  4LL1 B;  2YV7 A;  3KZQ A;  2H8L A;  2IWT A;  4ISD A;  3GKX A;  5DAK A;  2ZCT A;  1XVW A;  2I1U A;  3CTF A;  2LJK A;  5D9W A;  4DVC A;  1T4Y A;  5L71 A;  2HXK A;  2VCQ A;  1PX6 A;  1GNW A;  4CDO A;  4EF0 A;  2CVB A;  3MYD A;  1U87 A;  1W4V A;  1TRU A;  5C00 A;  1ACV A;  3FMW A;  2DC5 A;  4MMM A;  2QC7 A;  4TW5 A;  3ZLP A;  4BWS A;  5EY6 A;  4I6X A;  1R7H A;  1AQW A;  5B8A A;  4F9Z A;  1K0O A;  2M80 A;  3P7X A;  1WJK A;  2H72 A;  2RLI A;  3GNJ A;  3D4T A;  3GYK A;  2IFQ B;  3VWW A;  1V9W A;  2C4J A;  4ML6 A;  1JZW A;  3ZFB A;  2WZ9 A;  1B48 A;  2YN1 A;  3QOU A;  3QD9 A;  3BBY A;  5ABR A;  2J9H A;  1USB A;  2X64 A;  5DAK B;  4G19 A;  1Z6M A;  4L0U A;  2LJR A;  3DVX A;  2H1A A;  2LRC A;  5A5K A;  5F05 A;  2C3Q A;  4IBP A;  3GMF A;  3ZZX A;  4O5R A;  3W8J A;  4JRR A;  2LQO A;  16GS A;  4NPB A;  2VL2 A;  2B7J A;  4ML1 A;  5AIV A;  5DCG A;  2YWN A;  1VF1 A;  1WRY A;  3WGD A;  5KN2 A;  19GS A;  2PVQ A;  3CRU A;  1T3B A;  2I3Y A;  4K2D A;  4NHW A;  2ON5 A;  5A4V A;  2A4V A;  4MK3 A;  3CMI A;  1SK1 A;  4BVX A;  4NWY A;  3EWL A;  5G5E A;  2EC4 A;  2HRF A;  4TXV A;  4BVY A;  3D4M A;  1QGV A;  2GDR A;  2I4A A;  2K6V A;  2NVL A;  5H5Q A;  5AN1 A;  4K1F A;  4K7N A;  1B4Q A;  3C8E A;  3GKN A;  5DCH A;  7GSS A;  2B7K A;  2AAW A;  4XIH A;  3EC3 A;  2GTU A;  3QFA C;  1XW5 A;  1U88 A;  4POM A;  3ZTL A;  1TU7 A;  4F2I A;  5AIS A;  2ZNM A;  5KN3 A;  2AJQ B;  4Q5N A;  2XBQ A;  3KH7 A;  2CVD A;  4EIQ A;  1HNB A;  1K3Y A;  4QL7 A;  1XZO A;  1T4Z A;  5KN0 A;  3TCO A;  3QAW A;  3FZ9 A;  1OC3 A;  4DSS B;  2DIY A;  4Z2T A;  1J0F A;  1OKD A;  2E2M A;  4N0V A;  3J7Y b;  4G10 A;  2VAF A;  4HU7 A;  2L6D A;  3UAP A;  3KTL A;  1QXH A;  1X9M B;  3KD0 A;  4V2L A;  1FVK A;  3F6D A;  4G2E A;  12GS A;  2QKE A;  5IMZ A;  3ED3 A;  4H86 A;  2RUE A;  4IS0 A;  4EL1 A;  3MDK A;  3FZA A;  2R3X A;  4BVY B;  2FUG 2;  4MJA A;  5CP1 A;  2PWJ A;  1SJ6 A;  1GSS A;  2A2P A;  1PKZ A;  2HZF A;  1F37 A;  1R5P A;  3GV1 A;  5D93 A;  2GZP A;  2O8V B;  1M9B A;  13GS A;  2A4H A;  3DKS A;  1GRX A;  4PUF C;  1OAZ A;  4IP1 A;  1Z5Y E;  2O85 A;  4IGJ A;  1THO A;  5ECS A;  4O32 A;  5GAP D;  1OC9 A;  3ZMK A;  3CTG A;  4HDE A;  6GSU A;  2FA4 A;  3HVV A;  3BCI A;  1BX9 A;  5HFI A;  3UVH A;  2R2J A;  4OCF A;  1EGO A;  3VWV A;  1SL0 B;  2VCX A;  2CZ3 A;  5J9B A;  4V2N A;  5ENU A;  3KMN A;  4OCE A;  5EPF A;  4IJ3 A;  5F07 A;  2XBI A;  1KTE A;  5EL8 A;  3Q19 A;  2LNS A;  4PXO A;  1GSY A;  1PL2 A;  3LWA A;  2H0G A;  4L5L A;  4ACS A;  5IOX A;  1TI1 A;  4QQ7 A;  5KOX A;  2JSY A;  1YF0 A;  1TK0 B;  3DWV A;  4Q5Q A;  4ZL7 A;  2CV4 A;  3VPQ A;  4NMU A;  3APS A;  11GS A;  2I9H A;  3KCM A;  1PN0 A;  5G1K A;  2WRT A;  2JU5 A;  1CQH A;  3UAR A;  3E3E A;  5DVB A;  1J9B A;  2JSZ A;  2ON7 A;  3D22 A;  1PSQ A;  3RHC A;  1R26 A;  1OC8 A;  3UBK A;  2TRC P;  2E0Q A;  3LYK A;  4IEL A;  1BJX A;  2M72 A;  3KIJ A;  4ZXG A;  3TJF A;  3J7Y k;  1WE0 A;  1M99 A;  2GVP A;  3IPZ A;  5COH A;  3F3Q A;  4PTS A;  2A2R A;  3KH9 A;  2H6Z A;  3OR5 A;  2H01 A;  4NV5 A;  4X0X A;  2N5F A;  3RHB A;  2RII A;  5B6M A;  2FD3 A;  5KOW A;  1EV9 A;  1N8J A;  2LS5 A;  5GZZ B;  1VF2 A;  4OD7 A;  5DDL A;  3LSZ A;  1TU8 A;  1HD2 A;  3VWU A;  2MZC A;  5GAN D;  2FHE A;  1Z9H A;  3FZ5 A;  2OAD A;  3GX8 A;  4GRF A;  2LRT A;  2C0F A;  4O5U A;  3KP8 A;  2DJ0 A;  1WP0 A;  3WGX A;  1G7O A;  1EEM A;  2AUV A;  4BPY A;  4V2M A;  2R0P A;  1NM3 A;  4KND A;  3FYG A;  2L59 A;  4KSM A;  1MDJ A;  3EUR A;  22GS A;  5IQY A;  4HEA 2;  2L6C A;  4DEJ A;  1FG4 A;  1GTU A;  4TVE A;  2HRK A;  2PUK C;  1IYI A;  3I69 A;  4MPF A;  2HSH A;  3UEM A;  2GLR A;  4EUY A;  2WB9 A;  2VL3 A;  1GUK A;  1Z7P A;  2V1M A;  3HVS A;  1JLV A;  2K18 A;  2FGX A;  5IPG A;  4JU5 A;  4K9Z A;  3EVI A;  3H4K A;  3QFB C;  5IMA A;  2FLS A;  1MD3 A;  4LL4 B;  5DJM A;  3K8N A;  3ISO A;  2KHP A;  5A4W A;  4O5Q A;  1F3A A;  3IHG A;  3DD3 A;  2X99 A;  3ERW A;  4I97 A;  3LJR A;  5ECR B;  4HZ4 A;  4POB A;  1VF3 A;  4AGS A;  5JWQ B;  1URM A;  2B5Y A;  3MIX A;  5DQY A;  4KUN A;  2NTO A;  3IE3 A;  3E9J B;  2IMF A;  3RPN A;  1GH2 A;  1HNC A;  2YJ7 A;  3DML A;  3RBT A;  4HQZ A;  2IMI A;  5G5F A;  2KLX A;  4HJ2 A;  4K7O A;  2BJX A;  1R4W A;  3GFK A;  4KDU A;  10GS A;  4PNG A;  3D5J A;  1T8E B;  3GKK A;  3IRA A;  5LCZ A;  2VCZ A;  4WBJ A;  2CVK A;  5D9T A;  2DJ1 A;  1N2A A;  1AW9 A;  2DJJ A;  3UMA A;  3IAM 2;  5HFG A;  4OO4 A;  3TRX A;  2HSM A;  4ZBD A;  4HS1 A;  1W89 A;  3QR6 A;  1A0F A;  3BOA A;  5IMV A;  4XS1 A;  4LLR A;  3F3R A;  4WEY A;  1K3L A;  1EOH A;  1PKW A;  1PRX A;  1QFN A;  1YY7 A;  3QAG A;  2X8G A;  3N5O A;  2GZZ A;  4TKY A;  2IME A;  4J57 E;  1AC1 A;  5DQS A;  2YZH A;  1YF1 A;  2Z9S A;  1YKA A;  3TRQ A;  3CSJ A;  1A0R P;  1TW9 A;  4ZL9 A;  1GSF A;  5CRD A;  3Q6O A;  3TJJ A;  5KN1 A;  3BCK A;  1V57 A;  5J5N A;  1K0C A;  2OE3 A;  2EIO A;  2HRN A;  1TK8 B;  3H79 A;  1ABA A;  5D9V A;  1ZMA A;  3HZ4 A;  1YJ6 A;  4IQA A;  2H66 A;  3WT1 A;  1ZGN A;  4K5S A;  5IO2 A;  1UVZ A;  1JZD A;  4KX4 A;  2VCW A;  1Y6E A;  3L9S A;  4CY6 A;  2KOK A;  3VLN A;  2LTK A;  3D0Z A;  4KGI A;  3FY7 A;  1A8L A;  3IXR A;  4L5O A;  1XVQ A;  4ZB8 A;  1XIY A;  2F9S A;  2VLU A;  1PMT A;  2RUF A;  2YP6 A;  3RPP A;  4ID0 A;  4J2F A;  4RUV A;  1AUC A;  3APQ A;  4I5Q A;  4ECI A;  2H0I A;  1H4O A;  5IOW A;  3DEX A;  5CRW A;  1XWC A;  2VM2 A;  2GQK A;  1UN2 A;  1DBY A;  1TRW A;  1O8X A;  4K2X A;  2ES7 A;  2L5L A;  3G7I A;  4MZC A;  3IV4 A;  4HJM A;  1B8X A;  3WT2 A;  2KP1 A;  1M2B A;  1K3O A;  1A2M A;  3NZN A;  1RW1 A;  1G0T A;  4HI7 A;  5DJL A;  3AY8 A;  3IR4 A;  2JZR A;  4PNF A;  1RQM A;  3GX0 A;  2H6Y A;  3ZL5 A;  1BYE A;  5BRT A;  5ECK B;  3DYR A;  3M0F A;  3WYW A;  4P3Y B;  2IL3 A;  5E59 A;  4DSS A;  2DBC A;  4MZW A;  2G2Q A;  4WKW A;  5FWG A;  1ZOF A;  1U3A A;  1F2E A;  2IMK A;  1KEB A;  3UOM A;  3BJ5 A;  2CAQ A;  4KE3 A;  1F6M C;  4G0I A;  1XOB A;  4NHZ A;  4K7I A;  2PN8 A;  1GNE A;  1K0M A;  3DXB A;  5J41 A;  3ZVJ D;  1SK2 A;  2PGT A;  2IMD A;  3A2W A;  2M46 A;  1XWG A;  2WGR A;  3O3T A;  4IP6 A;  3HD5 A;  3C71 A;  5ECN B;  3A3T A;  3F4T A;  5BMU A;  2CX4 A;  4CY8 A;  3GRX A;  3KXO A;  4ZIL A;  3ZML A;  2DKH A;  1JLW A;  2WUL A;  1K0B A;  5F0G A;  1FOH A;  6GSX A;  1ZL9 A;  2N5A A;  3QMX A;  1SD8 A;  2C0G A;  3IDV A;  4ICY A;  1IYH A;  4N10 A;  5H5S A;  3APO A;  2XPD A;  5C04 A;  4A5P A;  2QGV A;  3LG6 A;  2GQL A;  1SYX A;  4GCI A;  2V32 A;  4IW9 A;  2LV3 A;  3LXZ A;  2F8F A;  2K8V A;  1B9X C;  4YQM A;  2LNT A;  3IC8 A;  2DML A;  1DUG A;  1GLP A;  2VD1 A;  4FYU A;  3FK8 A;  1Z6N A;  1MDK A;  4JR4 A;  4IVF A;  2CT6 A;  3GHA A;  4GQF A;  3GL3 A;  2YPM A;  3IHQ A;  4TR4 A;  1EV4 A;  3QCP A;  4ZB9 A;  3W8S A;  3CSI A;  2MBS A;  4IKH A;  1XW9 A;  1XWK A;  1S3C A;  3UBL A;  4MP4 A;  5H5R A;  1X9W B;  5DAL A;  2YWO A;  2V41 A;  4ULX A;  3LW9 A;  3FRC A;  4TR3 A;  3EYT A;  4L0W A;  4RQX A;  2H1G A;  4MZB A;  2FNO A;  2YOI A;  3CYN A;  3ZFL A;  1S3D A;  8GSS A;  2LST A;  3MWH A;  4OFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...