4FIWA

X-ray crystal structure of corynebacterium glutamicum nrdh-redoxin at 1.5a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
76
structure length
76
Chain Sequence
AITVYTKPACVQCNATKKALDRAGLEYDLVDISLDEEAREYVLALGYLQAPVVVADGSHWSGFRPERIREMATAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative glutaredoxin NrdH
publication title NrdH-redoxin of Mycobacterium tuberculosis and Corynebacterium glutamicum Dimerizes at High Protein Concentration and Exclusively Receives Electrons from Thioredoxin Reductase.
pubmed doi rcsb
source organism Corynebacterium glutamicum
total genus 21
structure length 76
sequence length 76
ec nomenclature ec 1.20.4.3: Mycoredoxin.
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4fiwA00
2C4JA 4D73B 5G31A 3IAS2 3DD3A 4FYBA 4ML6A 1M2BA 2VCWA 2L4CA 2NPBA 3TKSE 1PN9A 1Z3EA 2D2ZA 5IMCA 4WETA 2L6DA 3FZ4A 4O92A 2X99A 3KTLA 1HNAA 1OC9B 3FYGA 4ECJA 2V2GA 1PRXA 3M0FA 3IHQA 1ST9A 1VRSD 2FWEA 1MTCA 4XS1A 4QL7A 2H6YA 5HFIA 4PUFC 3GHAA 4EKZA 1NW2A 1TI3A 1A2JA 4DSRA 3UMAA 1JLWA 5IO0A 5KN2A 1F2EA 3TKPA 2IMKA 4EC0A 3C73A 3I6AA 2BMXA 4GQFA 4TXOA 1Y6EA 1PKZA 1UA5A 2WB9A 3KTBA 1OKDA 2YPMA 3TJBA 3DVWA 3FR6A 4ZL8A 4KAEA 4JR4A 1MDJA 4GXZA 2H6ZA 4HDEA 4K8MA 1U6TA 3GX8A 3R2QA 3C8EA 4F0CA 2PVQA 1S3CA 1EGRA 5IMVA 4HJMA 2H01A 3VPTA 4FYUA 3I43A 3GX0A 4IVFA 3TRQA 1TXXA 4KX4A 2E0QA 3GL5A 3IPZA 4BVXA 4N11A 1V2AA 2FY6A 2LRNA 3FKFA 1WWJA 4Z7XA 5DBQA 2HSHA 4FH8A 4HU7A 1V58A 2YJHA 4XIHA 2G0FA 4IQAA 2H0GA 3LYKA 1M7TA 4IKHA 3NOFA 2H6XA 4GLTA 2WGRA 2TRCP 3P8WA 3GURA 1DBYA 4X1UA 3QCPA 2VCZA 2JACA 2GT6A 4G10A 5J5NA 4HOJA 2KHPA 5E59A 2MMOA 2AJQB 3QAGA 3QAVA 1T4ZA 1URMA 1U88A 1A0FA 2I1UA 2CX4A 2V1MA 3NIVA 4LMWA 1ZYEA 1M9BA 2YN1A 1KNGA 2CQ9A 1TJDA 2VUPA 1VF3A 1M99A 3Q19A 4ILFA 1X0RA 4NMUA 4WKWA 1QQ2A 2XHFA 3AY8A 1GP1A 1Z7RA 4EO3A 3LQ7A 6GSVA 5JWRB 1WE0A 3KMNA 4TRXA 4WR5A 2HE3A 3CRUA 1Z7PA 2CVDA 2DJJA 1EOHA 3H4KA 4K7NA 3LYPA 1B8XA 18GSA 4OD7A 3E3EA 1FO5A 3P2AA 5B8AA 3F6FA 1G7OA 3KZQA 3HCZA 2YZHA 2FUG2 3D21A 2YWNA 5GSSA 3HJPA 2HZEB 3BCKA 3H93A 1S3DA 2O7KA 1T7PB 3EMPA 3GKMA 4PQIA 2H0IA 1JFUA 5IPGA 2KOKA 2ES7A 4AGSA 1SJ6A 1MDKA 2P5QA 4IN0A 5AIXA 2WJUA 4POMA 5A4UA 1FB0A 2O87A 4IELA 4ZB6A 2H0HA 4PQHA 4IGJA 3JCML 2HI7A 4KDXA 4NAXA 4L0WA 1XVWA 2WDUA 6GSTA 5DQYA 4EDYA 2H19A 1YF1A 4F9ZA 1S3AA 4NXIA 2A4VA 5CREA 2LQOA 1XWGA 3G7YA 4KNDA 4GSTA 1KBNA 4XS4B 1RK4A 4E8HA 7GSSA 4YAPA 2DC5A 1GL8A 2C3NA 1ML6A 2J9HA 1YKAA 5D93A 4NV5A 4TR1A 2QGVA 4OWYA 3ZMKA 3K8NA 2LTKA 1GSFA 1LJRA 1GULA 5DAKB 2B5XA 4J2FA 3BBYA 3GKXA 3KH9A 4EUYA 4MABA 3TKSC 4RI7A 2E2GA 3US3A 3CRTA 3D4TA 2AB6A 2MZCA 4ECCA 1SYRA 1M9AA 1EGOA 3M3MA 4OCEA 2N5FA 5F0GA 3W8SA 2B5YA 22GSA 5DALA 1GSYA 4GQCA 1XW9A 2JL4A 4KW6A 4AJ8A 1I5GA 3EU3A 2VL2C 5DVBA 3DWVA 2V6OA 1OC3A 2OBKA 3N9JA 2MBSA 2VOCA 5AN1A 1TU8A 2N5BA 2RM6A 3KD0A 5EPFA 3F8UA 4AJ7A 2PUKC 2VO4A 5ID2B 2DLXA 3QFAC 3ZIJA 2F3MA 1EP8A 2AV4A 1OE7A 2IN3A 1TRWA 2TIRA 3CTFA 4MA9A 1Z6NA 4GTUA 4OFMA 3D4MA 1R4WA 3GV1A 3MWHA 1FG4A 4OFTA 3TJGA 5ELGA 4EDZA 4MJAA 5IMDA 3D0ZA 3WT2A 1EV9A 3KM6A 3TOUA 2C80A 2V6KA 4PNGA 5A4VA 1FOVA 1ERVA 1TP9A 2VL2A 1TK5B 4RQRA 4MPFA 2HSYA 5CRWA 3N5OA 4HS1A 1AUCA 2H8LA 2OE3A 2XBIA 2GQLA 3ME8A 4DSSA 5IMZA 2HZFA 3HJMA 2YNXA 4KCAA 1U3AA 5L71A 3QMXA 2JADA 2DMLA 2QSIA 2P31A 5J3RA 1V98A 3ZREA 1F3AA 1V40A 2FNOA 5IMFA 4JE1A 2B5EA 4X0XA 3C1RA 3CSHA 4O5RA 4HI7A 1YEPA 4PNFA 5ECKB 5ECMB 2XC2A 1OAZA 1G7EA 1K0AA 4MZBA 1PQNA 2B1KA 3KXOA 3G7JA 1SENA 1X9MB 4LLRA 1EZKA 4FYCA 1GSDA 1AAZA 3H1NA 3QAWA 4XHMA 2XBQA 3IRAA 2LUSA 3EWLA 5JWQB 1F37A 3CYNA 5ECNB 2FCHA 4XTSA 5ECOB 2C0DA 4TN8A 3PINA 5ECQB 6GSWA 4MCUA 2B7KA 2GLRA 1TDIA 3HYPA 2IJYA 3FR9A 5LNKe 3LXTA 1BYEA 4V2MA 5IM9A 1T1VA 2FHEA 1K0CA 1V9WA 4OCFA 4WF4A 3TJFA 1SD8A 1QMVA 3TRPA 2B1LA 3IAM2 19GSA 5CNWA 2R4VA 3UOMA 5HQPA 3FHKA 5D9XA 5IMAA 2ZCTA 3F0IA 1A2LA 2C8UA 2GS3A 4KA0A 4KGIA 2LQQA 3ZFLA 4K2DA 3BJ5A 1YEXA 1Z5YE 2OJLA 2X8CA 3DVXA 4WEYA 2BJXA 1J9BA 4L0UA 5EL8A 5B8BA 2F51A 3H8QA 1KEBA 2I9HA 3GYKA 5F05A 1AW9A 1FW1A 2FA8A 5JCGA 2HLSA 4F2IA 3CSIA 2X8GA 1Q4JA 2IMEA 1M2DA 1K3YA 3UVHA 1A8YA 4HZ4A 4IJ3A 2ON5A 3GUSA 3WYWA 3GIXA 2GDRA 2GQMA 1GNWA 11GSA 1SKRB 2YWOA 2WCIA 1CQGA 5J4UA 2C3TA 2JZTA 2VLTA 3ZMLA 3G9BA 1ZYQB 3ZVJA 1ON4A 1GTAA 2DSAA 3IV4A 4E8EA 1G0TA 1YJ6A 1GUKA 13GSA 2VD0A 1KTEA 1FVKA 2H76A 1T4YA 2PMTA 4IS0A 1E6BA 3TJKA 1XWKA 1HQOA 3WGEA 1A23A 3MSZA 2VLUA 2NBSA 3CMIA 3C71A 4MK3A 1ZZYA 2X64A 1K0DA 4FIWA 2DJ3A 4NWYA 3BOAA 4PX1A 3F4SA 3IK7A 1X5CA 5GZZB 5CYYA 2GZPA 2L5OA 1W89A 1SK1A 4ZIJA 2CA8A 3ERGA 1MD4A 3RHCA 2MMNA 3IA1A 6GSXA 2H75A 1GLQA 1C72A 4D73A 3HA9A 2ZNMA 3L0HA 3MDKA 4ZILA 3GTUB 1TTZA 2F9SA 3C7MA 5F06A 3TDGA 3F3QA 3ISOA 3FW2A 5D96A 4JZQA 4MLYA 2CAQA 2MMAA 1OC9A 2TRXA 2RIIA 1U3IA 2HYXA 3LWAA 3UBKA 2EC4A 3HZ8A 4TKYA 4ZL9A 3QDNA 2PVOC 3A3TA 3NZNA 4YQMA 4XRAA 1X9WB 3QOUA 5DJLA 2I4AA 2AUVA 2L4QA 5JCWA 4LA1A 3TKQA 4PGTA 1QUWA 4F0BA 1UC7A 2ZUPA 3GFKA 1MEKA 4JRRA 1JLVA 1O7UA 4DEJA 2LRTA 2VAFA 2PN8A 3VLNA 4I2UA 1QK8A 3GMFA 3I69A 4TW5A 4TVEA 14GSA 3TJJA 2O89A 5D8IA 4IW9A 4Q5NA 3ZVJD 3ZITA 3VWVA 1RQMA 4EF0A 2IFQB 2WRTA 1K0MA 5JCUA 3C1SA 2R37A 5D9TA 2H66A 2C0GA 3P90A 4GF0A 4Q5QA 3HY2A 1EV4A 1M2AA 3J7Yk 3DEXA 4MZCA 2GTUA 1XOBA 2ON7A 3GSTA 3RPPA 5H5SA 9GSSA 1QFNA 3TKRA 3H79A 1NHOA 4GRFA 1EWXA 4V2NA 5CRHA 5ENUA 5CRDA 1J08A 2O8VB 1WP0A 2IPAA 4AJ6A 3DRNA 4NHWA 2VCVA 5C00A 4DSQA 3D22A 2R5GA 2GSTA 5ECLB 3RBTA 5D9VA 4MP4A 5DCHA 3VK9A 1GSUA 1G6WA 4I97A 1UN2A 3FZ9A 16GSA 1QGVA 2M80A 2OBIA 3UIWA 4I5QA 4CHSA 3IXRA 2FA4A 5G1KA 3GL3A 2MYGA 1BEDA 4I6XA 4V2LA 4BA7A 2VL3A 3CTGA 5LD0A 5ECRB 2P0GA 4ZL7A 5AIVA 4RQXA 1DE1A 2VCXA 5J9BA 4ML1A 1AXDA 2IL3A 1ZOFA 2YANA 2V32A 2X8HA 4PQ1A 4GCIA 2OE1A 1O85A 5DCGA 4Q5FA 2PBJA 5GAPD 2OACA 4J57E 1SL0B 2GVPA 2YV9A 5KN0A 3A2VA 3BCIA 5GSTA 4PUAA 3DMLA 4G9HA 1SJIA 3FY7A 1PD21 4CDOA 1ERWA 3E9JB 3KP9A 3W6GA 1Z9HA 1U87A 4O32A 2HZEA 1MD3A 20GSA 5G2ZA 3J7Yb 3UVTA 1TK0B 1R7HA 3Q6OA 2H72A 4K7OA 1J0FA 2GSQA 2RUEA 5D9WA 4LL4B 3HVVA 1DUGA 4K7IA 2CX3A 4TR3A 3TKSA 1OE8A 2LJKA 2REMA 2VCTA 4ISDA 1A24A 2L57A 1F3BA 2K18A 4TR0A 4WF5A 3IK9A 1A8LA 3ZL5A 5ABRA 4KB3A 3F3RA 2C0EA 1YQ1A 4KDUA 4DVCA 5HR1A 4BWSA 3ERFA 2JU5A 4ID0A 1VF1A 1HYUA 1XW5A 4BVYA 3RPNA 3EU4A 4FO5A 1PKWA 5EY6A 2GZYA 4XS4A 1XWBA 2NDOA 5IO2A 1O73A 3L78A 3VI5A 2XPEA 4K0GA 4TR4A 2WULA 4X43A 4IHUA 2WFCA 4ZB8A 5DAKA 4K9ZA 3GRXA 2K8SA 3IC4A 6GSUA 2JZSA 3LG6A 4MPGA 1I9DA 5AGYA 3DXBA 2JZRA 3UEMA 3VWXA 5KEJA 1YY7A 3KIJA 1XXUA 1K0OA 2HXKA 1TOFA 4L8EA 4NPBA 4YQVA 1GSQA 1TU7A 5C04A 1FHEA 4WBRD 1EOGA 3D5JA 1HNCA 3SWLA 4RI6A 2H70A 2CAIA 5ECIB 4ZXGA 4TXOB 2LS5A 4I8BA 3M9JA 3WT1A 5IOXA 5HR3A 2IMDA 4IP6A 5E4WA 3UJ1A 2PPTA 2JSYA 2HT9A 2O85A 4LL1B 1B9XC 3ME7A 3RAZA 5ID2A 4TOPA 5HR0A 1RW1A 5DJMA 1XPVA 1B4PA 1Y25A 3L9UA 3W8JA 4GWRA 3MNGA 4HU9A 3G7IA 1BAYA 4KUNA 2R3XA 3F9UA 1PSQA 2CV4A 4HEA2 2AHEA 3L4NA 3EMXA 3HVSA 2H1BA 1M0UA 3UAPA 5A4WA 3A2WA 1BQ7A 1BX9A 3DYRA 5G30A 3UARA 3QPMA 1SD9A 4L5LA 2DIYA 4KE3A 1LBKA 5CRGA 1OKTA 5H5QA 3ZRDA 3KH7A 1GLPA 1XZOA 3M1GA 4N0VA 2PWJA 1ZL9A 1N8JA 4IBPA 3TCOA 1YF0A 5FT3A 3FZAA 2IMIA 3I9V2 4MF6A 2YJ7A 1X9SB 4V1Ap 1K3LA 1R5PA 1K0BA 3WGDA 2DJ1A 3UBLA 2ALBA 2I81A 1SKWB 4MMMA 3VFIA 4KSOA 2PGTA 3APSA 2VCQA 3QFBC 5EVOA 4EXJA 2DJ0A 3GSSA 3LXZA 2JSZA 2VLVA 1SL2B 1GSSA 4JBBA 3HVXA 5J9CA 1B9YC 3PGTA 3ERWA 2C1YA 1B4QA 4MJCA 4ZB9A 2CZ2A 5DDLA 4TXVA 3KCMA 1JHBA 3WGXA 4ZBDA 3PR8A 1SKSB 1FAAA 4F03A 2A2SA 3CSJA 4HZ2A 5GAND 4Q5RA 5KN3A 4MDCA 4WR4A 3TB2A 1PL1A 1SYXA 3F4TA 2H1AA 4N30A 2K6VA 4LMVA 3VI7A 1AQVA 4MF5A 2HRFA 2YCDA 2BTOT 3ZLPA 1USBA 5G5EA 1ERUA 2QKEA 1YZXA 4MZWA 4CW9A 3IE3A 4GSSA 4ZBAA 2R6KA 1K0NA 1NHYA 3EYTA 5B6NA 3IR4A 1GUHA 1EP7A 1XFLA 2LEGA 3ZYWA 5F07A 3IOSA 2YWMA 1LU4A 2LV3A 4O7HA 3CXGA 3VWUA 1XWAA 1F9MA 1VF4A 3KJYA 2FD3A 4JR6A 4F82A 1WIKA 3HXSA 3P7XA 5AISA 3GNJA 3LGCA 3QD9A 2I3YA 2NTOA 3GA4A 12GSA 2H74A 5D73A 3EC3A 2CT6A 3F6DA 1DSBA 1MDIA 1YDKA 1ZMAA 2PU9C 1SK0A 4QQ7A 2KP1A 5B7CA 2B3SA 5A5KA 2AYTA 5CAXA 1AQWA 2YV7A 2EIQA 1WOUA 4QL9A 2YWIA 1TI1A 1GTIA 3Q74A 1PL2A 3DKSA 2EIOA 3A2XA 2R2JA 2E7PA 2VM1A 1O6JA 2N5AA 4OFNA 1VF2A 2FWGA 1K3OA 4NHZA 5IQYA 3M8NA 2FGXA 1BG5A 2VD1A 3F63A 2MMZA 2VL9A 3ZIVA 2DJKA 1WJKA 5CP1A 2VIMA 1AQXA 1WPIA 1SJZA 1ABAA 3ED3A 1TKDB 2OADA 1GH2A 2CVKA 2H1GA 2KP2A 4TR1B 4BWQA 4KCEA 1E2YA 1XIYA 1TRSA 1HD2A 3CBUA 2QC7A 3FEUA 1TRVA 2LNTA 3OR5A 4G2EA 2GSSA 2HRNA 3QR6A 3F4RA 17GSA 3ZFBA 1F6MC 1GTBA 1EEJA 1GUMA 1HNBA 1SL1B 1THOA 3SBCA 1ILOA 2FWFA 4KSMA 8GSSA 1IYHA 4POKA 2L6CA 1UVZA 5DALB 3GKKA 2KLXA 4V1Ag 4K0NA 3ZTLA 1FB6A 1GWCA 4N10A 1BJXA 1T00A 1PGTA 4P3YB 2LNSA 1GRXA 3LSZA 1PMTA 2DJ2A 3GTUA 3LEFA 3FZ5A 2L59A 3GKNA 2K8VA 5HFKA 2LKUA 5HFGA 5FWGA 3M9KA 2AAWA 5F8BA 3TOTA 2FWHA 3EE2A 2VM2A 3FK8A 3FRCA 1DE2A 1A0RP 2YP6A 3HZ4A 2G2QA 1THXA 4YH2A 2MBTA 5CO3A 4HQSA 4GSNA 2IWTA 1AC1A 2WZ9A 5ECSA 1SK2A 1B48A 4N0ZA 2FLSA 1O8WA 4I2TA 2GSRA 1XBSA 1PX7A 4OO4A 4KDYA 3WD6A 5KN1A 4XS6A 2GQKA 2GGTA 2K9FA 3DIEA 4L5OA 2XPDA 5IPHA 3RHBA 3GH6A 4PXOA 3Q18A 4IP1A 4DSSB 4HQZA 1SU9A 4ECBA 3DGQA 1VGLA 1R26A 3TRXA 1JZWA 2IFQA 2RM5A 5H5RA 4BPYA 5ECPB 4J56E 3KMOA 2L5LA 6GSSA 2GZZA 1T3BA 2Z9SA 2OA7A 4EL1A 3D6IA 1OC8A 2A2RA 4ULXA 1TW9A 1O81A 4POLA 3S9FA 3EINA 4MJBA 2IMFA 3ZZXA 2EIRA 1ZCPA 4EE0A 5ECHB 4KH7A 1W4VA 3VPQA 2F8AA 1PX6A 3LFLA 2LRCA 5J41A 3HDCA 1V57A 2DBCA 1TK8B 2OE0A 3GH9A 1XW6A 4ECIA 5COHA 2DIZA 2RLIA 4EVMA 10GSA 5DQSA 1Z6MA 2HFDA 2IIYA 1XWCA 4ACSA 2E2MA 2H71A 3O6TA 2C3QA 1X5DA 1G6YA 4WXTA 1T8EB 4H86A 4POBA 2YZUA 1WMJA 2LSTA 3U5RE 4WBJA 1TRUA 5G5FA 3RDWA 4NV2A 1JZDA 1OYJA 3BD2A 1XVQA 4K1FA 3U6VA 3KGKA 1GSEA 2YOIA 3L9VA 4IJIA 1H4OA 2CZ3A 2J23A 1FVJA 3FR3A 1XOAA 3VWWA 1O8XA 3HD5A 4BL7A 3UL3A 2P5RA 2F8FA 1R5AA 1X5EA 4XCSA 3O76A 1PA3A 1ACVA 5HR2A 4JU5A 3APQA 1GTUA 3L9SA 4MH2A 1EEMA 3TUEA 5LCZA 2DMMA 4OMVA 2LJRA 1OVNA 1WRYA 5FHIA 2B6MA 5IIZA 4G19A 1QXHA 3HHVA 3LORA 2H1DA 3GN3A 3HKRA 1N2AA 3E0UA 4AF2A 2C0FA 1AIUA 4OO5A 3MAKA 3A5WA 6GSYA 4HJ2A 3APOA 4MH3A 1IYIA 4PURA 2V41A 2LJAA 3VURA 1Q98A 2B7JA 3PH9A 4RUVA 4MF7A 4K6XA 2PERA 2HNLA 2GT5A 1YKCA 4HUAA 4ZBBA 2CVBA 3EURA 3IBHA 1JZRA 3KP8A 2M72A 3IDVA 1ERTA 1CQHA 5JWOB 1A2MA 1H75A 1GNEA 2RUFA 5G1LA 3O3TA 2M46A 5B6MA 4XRDA 2H30A 3HJOA 1NSWA 2H73A 3KEBA 5IOWA 3V1WA 1JZOA 3EVIA 4IQ1A 1XCCA 4YQUA 1NM3A 2OKAA 5INYA 5ELAA 1ZGNA 2WS2A 2KUCA 2NVLA 4YAVA 3LJRA 4MJEA 4JEDA 3TGZA
chains in the Genus database with same CATH superfamily
2C4JA 4D73B 4O5UA 5G31A 3IAS2 3DD3A 4FYBA 4ML6A 1M2BA 2VCWA 2L4CA 2NPBA 3TKSE 1PN9A 1Z3EA 2D2ZA 5IMCA 4WETA 2L6DA 3FZ4A 4O92A 2X99A 3KTLA 1HNAA 1OC9B 3FYGA 4ECJA 2V2GA 1PRXA 3M0FA 3IHQA 1ST9A 1VRSD 2FWEA 1MTCA 4XS1A 4QL7A 2H6YA 5HFIA 4PUFC 3GHAA 4EKZA 1NW2A 1TI3A 1A2JA 4DSRA 3UMAA 1JLWA 5IO0A 5KN2A 1F2EA 3TKPA 2IMKA 4EC0A 3C73A 3I6AA 1M3JA 2BMXA 4GQFA 4TXOA 1Y6EA 1PKZA 1UA5A 2WB9A 3KTBA 3IHGA 1OKDA 2YPMA 3TJBA 3DVWA 3FR6A 4ZL8A 4KAEA 4JR4A 1MDJA 4GXZA 2H6ZA 4HDEA 4K8MA 1U6TA 3GX8A 3R2QA 3C8EA 4F0CA 2A2PA 1PN0A 2PVQA 1S3CA 1EGRA 5IMVA 4HJMA 2H01A 3VPTA 4FYUA 3I43A 3GX0A 4IVFA 3TRQA 1TXXA 4KX4A 2E0QA 3GL5A 3IPZA 4BVXA 4N11A 1V2AA 2FY6A 2LRNA 3FKFA 1WWJA 4Z7XA 5DBQA 2HSHA 4FH8A 4HU7A 1V58A 2YJHA 4XIHA 2G0FA 4IQAA 2H0GA 2R0GA 3LYKA 1M7TA 4IKHA 3NOFA 5BMUA 2H6XA 4GLTA 2WGRA 4CY8A 2TRCP 3P8WA 3GURA 1DBYA 3MIXA 4X1UA 3QCPA 2VCZA 2JACA 2GT6A 4G10A 5J5NA 4HOJA 2KHPA 5E59A 2MMOA 2AJQB 3QAGA 3QAVA 1T4ZA 1URMA 1U88A 1A0FA 2I1UA 2CX4A 2V1MA 3NIVA 4LMWA 1ZYEA 1M9BA 2YN1A 1KNGA 2CQ9A 1TJDA 2VUPA 1VF3A 1M99A 3Q19A 4ILFA 1X0RA 4NMUA 4WKWA 1QQ2A 2XHFA 3AY8A 1GP1A 1Z7RA 4EO3A 3LQ7A 6GSVA 5JWRB 1WE0A 3KMNA 4TRXA 4WR5A 2HE3A 3CRUA 1Z7PA 2CVDA 2DJJA 1EOHA 3H4KA 4K7NA 3LYPA 1B8XA 18GSA 4OD7A 3E3EA 1FO5A 3P2AA 5B8AA 3F6FA 1G7OA 3KZQA 3HCZA 2YZHA 2FUG2 3D21A 2YWNA 5GSSA 3HJPA 2HZEB 3BCKA 3H93A 1S3DA 2O7KA 1T7PB 3EMPA 3GKMA 4PQIA 2H0IA 1JFUA 5IPGA 2KOKA 2ES7A 4AGSA 1SJ6A 1MDKA 2P5QA 4IN0A 5AIXA 2WJUA 4POMA 5A4UA 1FB0A 2O87A 4IELA 4ZB6A 5KOWA 2H0HA 4PQHA 4IGJA 3JCML 2HI7A 1ZYNA 4KDXA 4NAXA 4L0WA 1XVWA 2WDUA 6GSTA 3HVNA 5DQYA 4EDYA 2H19A 1YF1A 4F9ZA 1S3AA 4NXIA 2A4VA 5CREA 4BVYB 2LQOA 1XWGA 3G7YA 4KNDA 4GSTA 1KBNA 4XS4B 1RK4A 4E8HA 7GSSA 4YAPA 2DC5A 1GL8A 2C3NA 1ML6A 2J9HA 1YKAA 5D93A 4NV5A 4TR1A 2QGVA 4OWYA 3ZMKA 3K8NA 4Z2UA 2LTKA 1GSFA 1LJRA 1GULA 5DAKB 2B5XA 4J2FA 3BBYA 3GKXA 3KH9A 4EUYA 4MABA 3TKSC 4RI7A 2E2GA 3US3A 3CRTA 3D4TA 2AB6A 2MZCA 4ECCA 1SYRA 1M9AA 1EGOA 3M3MA 4OCEA 2N5FA 5F0GA 3W8SA 2B5YA 22GSA 5DALA 1GSYA 4GQCA 1XW9A 2JL4A 4KW6A 4AJ8A 1I5GA 3EU3A 2VL2C 5DVBA 3DWVA 2V6OA 1OC3A 2OBKA 3N9JA 2MBSA 2VOCA 5AN1A 1TU8A 3PPUA 2N5BA 2RM6A 3KD0A 1XG8A 3F8UA 5EPFA 4HSCX 4AJ7A 2PUKC 2VO4A 5ID2B 2DLXA 3QFAC 3ZIJA 2F3MA 1EP8A 2AV4A 1OE7A 2IN3A 1TRWA 2TIRA 3CTFA 4MA9A 1Z6NA 4GTUA 4OFMA 3D4MA 1R4WA 3GV1A 3MWHA 1FG4A 4OFTA 3TJGA 5ELGA 4EDZA 4MJAA 5IMDA 3D0ZA 2HRKA 3WT2A 1EV9A 3KM6A 3TOUA 2C80A 2V6KA 4PNGA 5A4VA 1FOVA 1ERVA 1TP9A 2VL2A 1TK5B 4RQRA 4MPFA 2HSYA 5CRWA 3N5OA 4HS1A 1AUCA 2H8LA 2OE3A 2XBIA 2GQLA 3ME8A 4DSSA 5IMZA 2HZFA 3HJMA 2YNXA 1ZYPA 4KCAA 1U3AA 5L71A 3QMXA 2JADA 2DMLA 2QSIA 2P31A 5J3RA 1V98A 3ZREA 1F3AA 3IC8A 1V40A 2FNOA 5IMFA 4JE1A 2B5EA 4X0XA 3C1RA 3CSHA 4O5RA 4HI7A 1YEPA 4PNFA 5ECKB 5ECMB 2XC2A 3LW9A 1OAZA 1G7EA 1M3IA 1K0AA 4MZBA 1PQNA 2R0PA 2B1KA 3KXOA 3G7JA 1SENA 4K5RA 1X9MB 4LLRA 1EZKA 4FYCA 1GSDA 3MYDA 1AAZA 3H1NA 3QAWA 4XHMA 2XBQA 3IRAA 4Z2TA 2LUSA 3EWLA 5JWQB 1F37A 3CYNA 5ECNB 2FCHA 4XTSA 2UZ8A 5ECOB 2C0DA 4TN8A 3PINA 5ECQB 6GSWA 4MCUA 2B7KA 2GLRA 1TDIA 3HYPA 2IJYA 3FR9A 5LNKe 3LXTA 1BYEA 4V2MA 5IM9A 1T1VA 2FHEA 1K0CA 1V9WA 4OCFA 4WF4A 3TJFA 1SD8A 1QMVA 3TRPA 2B1LA 3IAM2 19GSA 4X4JA 5CNWA 2R4VA 3UOMA 5HQPA 3FHKA 5D9XA 2HRAA 5IMAA 2ZCTA 3F0IA 1A2LA 2C8UA 2GS3A 4KA0A 4KGIA 2LQQA 3ZFLA 4K2DA 3BJ5A 1YEXA 1Z5YE 2OJLA 2X8CA 3DVXA 4WEYA 2BJXA 1J9BA 4L0UA 5EL8A 5B8BA 2F51A 3H8QA 1KEBA 2I9HA 3GYKA 5F05A 1AW9A 1FW1A 2FA8A 5JCGA 2HLSA 4F2IA 3CSIA 2X8GA 1Q4JA 2HSMA 4G0LA 2IMEA 1M2DA 1K3YA 3UVHA 1A8YA 4HZ4A 4IJ3A 2ON5A 3GUSA 3WYWA 3GIXA 2GDRA 2GQMA 1GNWA 11GSA 1SKRB 2YWOA 2WCIA 1CQGA 5J4UA 2C3TA 2JZTA 2VLTA 3ZMLA 3G9BA 1ZYQB 3ZVJA 1ON4A 1GTAA 2DSAA 3IV4A 2DKHA 4E8EA 1G0TA 1YJ6A 1GUKA 13GSA 2VD0A 1KTEA 1FVKA 2H76A 1T4YA 2PMTA 4IS0A 1E6BA 3TJKA 1XWKA 1HQOA 3WGEA 1A23A 3MSZA 2VLUA 2NBSA 3CMIA 3C71A 4MK3A 1ZZYA 2X64A 1K0DA 4FIWA 2DJ3A 4NWYA 3BOAA 4PX1A 3F4SA 3IK7A 1X5CA 5GZZB 5CYYA 2GZPA 2L5OA 1W89A 1SK1A 4ZIJA 2CA8A 3ERGA 1MD4A 3RHCA 2MMNA 3IA1A 6GSXA 2H75A 1GLQA 1C72A 4D73A 3HA9A 2ZNMA 3L0HA 3MDKA 4ZILA 3GTUB 1TTZA 2F9SA 3C7MA 5F06A 3TDGA 3F3QA 3ISOA 3FW2A 5D96A 4JZQA 4MLYA 2CAQA 2MMAA 1OC9A 2TRXA 2RIIA 4K2XA 1U3IA 2HYXA 3LWAA 3UBKA 2EC4A 3HZ8A 4TKYA 4ZL9A 3QDNA 2PVOC 3A3TA 3NZNA 4YQMA 1FOHA 4XRAA 1X9WB 3QOUA 5DJLA 2I4AA 2AUVA 2L4QA 5JCWA 4LA1A 3TKQA 4PGTA 1QUWA 4F0BA 1UC7A 2ZUPA 3GFKA 1MEKA 2X49A 4JRRA 1JLVA 1O7UA 4DEJA 2LRTA 2VAFA 2PN8A 2DKIA 3VLNA 4I2UA 1QK8A 3GMFA 3I69A 4TW5A 4TVEA 14GSA 3TJJA 2O89A 5D8IA 4IW9A 2QA2A 4Q5NA 3ZVJD 3ZITA 3VWVA 1RQMA 4EF0A 2IFQB 2WRTA 1K0MA 5JCUA 3C1SA 2A4HA 2R37A 5D9TA 2H66A 2C0GA 3P90A 4GF0A 4Q5QA 3HY2A 1EV4A 1M2AA 3J7Yk 3DEXA 4MZCA 2GTUA 1XOBA 2ON7A 3GSTA 3RPPA 5H5SA 9GSSA 1QFNA 3TKRA 3H79A 1NHOA 4GRFA 1EWXA 4V2NA 5CRHA 5ENUA 5CRDA 1J08A 2O8VB 1WP0A 2IPAA 4AJ6A 3DRNA 4NHWA 2VCVA 5C00A 4DSQA 3D22A 2R5GA 2GSTA 5ECLB 3RBTA 5D9VA 4MP4A 5DCHA 3VK9A 1GSUA 1G6WA 4I97A 1UN2A 3FZ9A 16GSA 5KOXA 1QGVA 2M80A 2OBIA 3UIWA 4I5QA 4CHSA 3IXRA 2FA4A 5G1KA 3GL3A 2MYGA 5BRTA 1BEDA 4I6XA 4V2LA 4BA7A 2VL3A 3CTGA 5LD0A 4O5QA 5ECRB 2P0GA 4FQUA 4BL7B 4PTSA 4ZL7A 5AIVA 4RQXA 1DE1A 2VCXA 5J9BA 4ML1A 1AXDA 2IL3A 1ZOFA 2YANA 2V32A 2X8HA 4PQ1A 4GCIA 2OE1A 1O85A 5DCGA 4Q5FA 1PFOA 3CQFA 2PBJA 5GAPD 2OACA 4J57E 1SL0B 2GVPA 2YV9A 5KN0A 3A2VA 3BCIA 5GSTA 4PUAA 3DMLA 4G9HA 1SJIA 3FY7A 1PD21 4CDOA 1ERWA 3E9JB 3KP9A 3W6GA 1Z9HA 1U87A 4O32A 2HZEA 4YKGA 1MD3A 20GSA 5G2ZA 3J7Yb 3UVTA 1TK0B 1R7HA 3Q6OA 2H72A 4K7OA 1J0FA 2GSQA 2RUEA 5D9WA 4LL4B 3HVVA 1DUGA 4K7IA 2CX3A 4TR3A 3TKSA 1OE8A 2LJKA 2REMA 2VCTA 4ISDA 1A24A 2L57A 1F3BA 2K18A 4TR0A 4WF5A 3IK9A 1A8LA 3ZL5A 5ABRA 4KB3A 3F3RA 2C0EA 1YQ1A 4KDUA 4DVCA 5HR1A 4BWSA 3ERFA 2JU5A 4ID0A 1VF1A 1HYUA 1XW5A 4BVYA 3RPNA 3EU4A 4FO5A 1PKWA 5EY6A 2GZYA 4XS4A 1XWBA 2NDOA 5IO2A 1O73A 3L78A 3VI5A 2XPEA 4K0GA 4TR4A 2WULA 4X43A 4IHUA 2WFCA 4ZB8A 5DAKA 4K9ZA 3GRXA 2K8SA 3IC4A 6GSUA 4KF9A 2JZSA 3LG6A 4MPGA 3FMWA 1I9DA 5AGYA 3DXBA 2JZRA 3UEMA 3VWXA 5KEJA 1YY7A 3KIJA 1XXUA 1K0OA 2HXKA 1TOFA 4L8EA 4NPBA 4YQVA 1GSQA 1TU7A 5C04A 1FHEA 4WBRD 1EOGA 3D5JA 1HNCA 3SWLA 4RI6A 2H70A 2CAIA 5ECIB 4ZXGA 4TXOB 2LS5A 4I8BA 3M9JA 3WT1A 5IOXA 5HR3A 2IMDA 4IP6A 5E4WA 3UJ1A 2PPTA 2JSYA 2HT9A 2O85A 4LL1B 1B9XC 3ME7A 3RAZA 5ID2A 4TOPA 5HR0A 1RW1A 5DJMA 1XPVA 1B4PA 1Y25A 3L9UA 3W8JA 4GWRA 3MNGA 4HU9A 3G7IA 1BAYA 4KUNA 2R3XA 3F9UA 1PSQA 2CV4A 4HEA2 2AHEA 3L4NA 3EMXA 3HVSA 2H1BA 1M0UA 3UAPA 5A4WA 3A2WA 1BQ7A 2R0CA 1BX9A 3DYRA 5G30A 3UARA 3QPMA 1SD9A 4L5LA 2DIYA 4KE3A 1LBKA 5CRGA 1OKTA 5H5QA 4BVXB 3ZRDA 3KH7A 1GLPA 1XZOA 3M1GA 4N0VA 2PWJA 1ZL9A 1N8JA 4BIKA 4IBPA 3TCOA 1YF0A 5FT3A 3FZAA 2IMIA 3I9V2 4MF6A 2YJ7A 1X9SB 4V1Ap 1K3LA 1R5PA 1K0BA 3WGDA 2DJ1A 3UBLA 2ALBA 2I81A 1SKWB 4MMMA 3VFIA 4KSOA 2PGTA 3APSA 2VCQA 3QFBC 5EVOA 4EXJA 2DJ0A 3GSSA 3LXZA 2JSZA 2VLVA 1SL2B 1GSSA 4JBBA 3HVXA 5J9CA 1B9YC 3PGTA 3ERWA 2C1YA 1B4QA 4MJCA 4ZB9A 2CZ2A 4G0IA 5DDLA 4TXVA 3KCMA 1JHBA 3WGXA 4ZBDA 3PR8A 1SKSB 1FAAA 4F03A 2A2SA 3CSJA 4HZ2A 5GAND 4Q5RA 4MNNA 4MDCA 4WR4A 5KN3A 3TB2A 1PL1A 1SYXA 3F4TA 2H1AA 4N30A 2K6VA 4LMVA 3VI7A 1AQVA 4MF5A 2HRFA 2YCDA 2BTOT 3ZLPA 1USBA 5G5EA 1ERUA 2QKEA 1YZXA 4MZWA 4CW9A 3IE3A 4GSSA 4ZBAA 2R6KA 1K0NA 1NHYA 3EYTA 5B6NA 3IR4A 1GUHA 1EP7A 1XFLA 2LEGA 3ZYWA 5F07A 3IOSA 2YWMA 1LU4A 2LV3A 4O7HA 3CXGA 3VWUA 1XWAA 1F9MA 1VF4A 3KJYA 2FD3A 4JR6A 4F82A 1WIKA 3HXSA 3P7XA 5AISA 3GNJA 3LGCA 3QD9A 2I3YA 2NTOA 3GA4A 12GSA 2H74A 5D73A 3EC3A 2CT6A 3F6DA 1DSBA 1MDIA 1YDKA 1ZMAA 2PU9C 1SK0A 4QQ7A 2KP1A 4A5PA 5B7CA 2B3SA 5A5KA 2AYTA 5CAXA 1AQWA 2YV7A 2EIQA 1WOUA 4QL9A 2YWIA 1TI1A 1GTIA 3Q74A 1PL2A 3DKSA 2EIOA 3A2XA 2R2JA 2E7PA 2VM1A 1O6JA 2N5AA 4OFNA 1VF2A 2FWGA 1K3OA 4NHZA 5IQYA 3M8NA 2FGXA 1BG5A 2VD1A 3F63A 2MMZA 2VL9A 3ZIVA 4USSA 2DJKA 1WJKA 5CP1A 2VIMA 1AQXA 1WPIA 1SJZA 1ABAA 3ED3A 1TKDB 2OADA 1GH2A 2CVKA 2H1GA 2KP2A 4TR1B 4BWQA 4KCEA 1E2YA 1XIYA 1TRSA 1HD2A 3CBUA 2QC7A 3FEUA 1TRVA 2LNTA 3OR5A 4G2EA 2GSSA 2HRNA 3QR6A 3F4RA 17GSA 3ZFBA 1F6MC 1GTBA 1EEJA 1GUMA 1HNBA 1SL1B 1THOA 3SBCA 1ILOA 2FWFA 4KSMA 8GSSA 1IYHA 4POKA 2L6CA 1UVZA 5DALB 3GKKA 2KLXA 4V1Ag 4K0NA 3ZTLA 1FB6A 1GWCA 4N10A 1BJXA 1T00A 1PGTA 4P3YB 2LNSA 1GRXA 3LSZA 1PMTA 2DJ2A 3GTUA 4K5SA 3LEFA 3FZ5A 2L59A 3GKNA 2K8VA 5HFKA 2LKUA 5HFGA 5FWGA 1S3RA 3M9KA 2QA1A 2AAWA 4CY6A 5F8BA 3TOTA 3EPTA 2FWHA 3EE2A 2VM2A 3FK8A 3FRCA 1DE2A 1A0RP 2YP6A 3HZ4A 2G2QA 1THXA 4YH2A 2MBTA 5CO3A 4HQSA 4GSNA 2IWTA 1AC1A 2WZ9A 5ECSA 1SK2A 1B48A 4N0ZA 2FLSA 1O8WA 4I2TA 2GSRA 1XBSA 1PX7A 4OO4A 4KDYA 3WD6A 5KN1A 4EIPA 4XS6A 2GQKA 2GGTA 2K9FA 3DIEA 4L5OA 2XPDA 5IPHA 3RHBA 3GH6A 4PXOA 3Q18A 4IP1A 4DSSB 4HQZA 1SU9A 4ECBA 3DGQA 1VGLA 3R3EA 1R26A 3TRXA 1JZWA 2IFQA 4ICYA 2RM5A 5H5RA 4BPYA 5ECPB 4J56E 3KMOA 2L5LA 6GSSA 2GZZA 1T3BA 2Z9SA 2OA7A 4EL1A 3D6IA 1OC8A 2A2RA 4G0KA 4ULXA 1TW9A 1O81A 4POLA 3S9FA 3EINA 4MJBA 2IMFA 3ZZXA 2EIRA 1ZCPA 4EE0A 5ECHB 4KH7A 1W4VA 3VPQA 2F8AA 1PX6A 3LFLA 2LRCA 5J41A 3HDCA 1V57A 2DBCA 1TK8B 2OE0A 3GH9A 1XW6A 4ECIA 5COHA 2DIZA 2RLIA 4EVMA 10GSA 5DQSA 1Z6MA 2HFDA 2IIYA 1XWCA 4ACSA 2E2MA 2H71A 3O6TA 2C3QA 1X5DA 1G6YA 4WXTA 1T8EB 4H86A 4POBA 2YZUA 1WMJA 2LSTA 3U5RE 4WBJA 1TRUA 5G5FA 3RDWA 4NV2A 1JZDA 1OYJA 3BD2A 1XVQA 4K1FA 3U6VA 3KGKA 1GSEA 2YOIA 3L9VA 4IJIA 1H4OA 2CZ3A 2J23A 1FVJA 3FR3A 1XOAA 3VWWA 1O8XA 3HD5A 4BL7A 3UL3A 2P5RA 2F8FA 1R5AA 1X5EA 4XCSA 3O76A 1PA3A 1ACVA 5HR2A 4JU5A 3APQA 1GTUA 3L9SA 4MH2A 1EEMA 3TUEA 5LCZA 2DMMA 4OMVA 2LJRA 1OVNA 1WRYA 5FHIA 2B6MA 5IIZA 4G19A 1QXHA 3HHVA 3LORA 2H1DA 2X4AA 3GN3A 3HKRA 1N2AA 3E0UA 4AF2A 2C0FA 1AIUA 4OO5A 3MAKA 3A5WA 6GSYA 4HJ2A 3APOA 4MH3A 1IYIA 4PURA 2V41A 2LJAA 3VURA 1Q98A 2B7JA 3PH9A 4RUVA 4MF7A 4K6XA 4Z2RA 2PERA 2HNLA 2GT5A 1YKCA 4HUAA 4ZBBA 2CVBA 3EURA 3IBHA 1JZRA 3KP8A 2M72A 3IDVA 1ERTA 1CQHA 5JWOB 1A2MA 1H75A 1GNEA 2RUFA 3A5IA 5G1LA 3O3TA 2M46A 5B6MA 4XRDA 4EIQA 2H30A 3HJOA 1NSWA 2H73A 3KEBA 5IOWA 3V1WA 1JZOA 3EVIA 4IQ1A 1XCCA 4YQUA 1NM3A 2OKAA 5INYA 4YKFA 5ELAA 1ZGNA 2WS2A 2KUCA 2NVLA 4YAVA 3LJRA 4MJEA 4JEDA 3TGZA
chains in the Genus database with same CATH topology
2C4JA 4D73B 4O5UA 5G31A 3IAS2 3DD3A 4FYBA 4ML6A 1M2BA 2VCWA 2L4CA 2NPBA 3TKSE 1PN9A 1Z3EA 2D2ZA 5IMCA 4WETA 2L6DA 3FZ4A 4O92A 2X99A 3KTLA 1HNAA 1OC9B 3FYGA 4ECJA 2V2GA 1PRXA 3M0FA 3IHQA 1ST9A 1VRSD 2FWEA 1MTCA 4XS1A 4QL7A 2H6YA 5HFIA 4PUFC 3GHAA 4EKZA 1NW2A 1TI3A 1A2JA 4DSRA 3UMAA 1JLWA 5IO0A 5KN2A 1F2EA 3TKPA 2IMKA 4EC0A 3C73A 3I6AA 2BMXA 4GQFA 4TXOA 1Y6EA 1PKZA 1UA5A 2WB9A 3KTBA 3IHGA 1OKDA 2YPMA 3TJBA 3DVWA 3FR6A 4ZL8A 4KAEA 4JR4A 1MDJA 4GXZA 2H6ZA 4HDEA 4K8MA 1U6TA 3GX8A 3R2QA 3C8EA 4F0CA 2A2PA 1PN0A 2PVQA 1S3CA 1EGRA 5IMVA 4HJMA 2H01A 3VPTA 4FYUA 3I43A 3GX0A 4IVFA 3TRQA 1TXXA 4KX4A 2E0QA 3GL5A 3IPZA 4BVXA 4N11A 1V2AA 2FY6A 2LRNA 3FKFA 1WWJA 4Z7XA 5DBQA 2HSHA 4FH8A 4HU7A 1V58A 2YJHA 4XIHA 2G0FA 4IQAA 2H0GA 2R0GA 3LYKA 1M7TA 4IKHA 3NOFA 5BMUA 2H6XA 4GLTA 2WGRA 4CY8A 2TRCP 3P8WA 3GURA 1DBYA 3MIXA 4X1UA 3QCPA 2VCZA 2JACA 2GT6A 4G10A 5J5NA 4HOJA 2KHPA 5E59A 2MMOA 2AJQB 3QAGA 3QAVA 1T4ZA 1URMA 1U88A 1A0FA 2I1UA 2CX4A 2V1MA 3NIVA 4LMWA 1ZYEA 1M9BA 2YN1A 1KNGA 2CQ9A 1TJDA 2VUPA 1VF3A 1M99A 3Q19A 4ILFA 1X0RA 4NMUA 4WKWA 1QQ2A 2XHFA 3AY8A 1GP1A 1Z7RA 4EO3A 3LQ7A 6GSVA 5JWRB 1WE0A 3KMNA 4TRXA 4WR5A 2HE3A 3CRUA 1Z7PA 2CVDA 2DJJA 1EOHA 3H4KA 4K7NA 3LYPA 1B8XA 18GSA 4OD7A 3E3EA 1FO5A 3P2AA 5B8AA 3F6FA 1G7OA 3KZQA 3HCZA 2YZHA 2FUG2 3D21A 2YWNA 5GSSA 3HJPA 2HZEB 3BCKA 3H93A 1S3DA 2O7KA 1T7PB 3EMPA 3GKMA 4PQIA 2H0IA 1JFUA 5IPGA 2KOKA 2ES7A 4AGSA 1SJ6A 1MDKA 2P5QA 4IN0A 5AIXA 2WJUA 4POMA 5A4UA 1FB0A 2O87A 4IELA 4ZB6A 5KOWA 2H0HA 4PQHA 4IGJA 3JCML 2HI7A 1ZYNA 4KDXA 4NAXA 4L0WA 1XVWA 2WDUA 6GSTA 5DQYA 4EDYA 2H19A 1YF1A 4F9ZA 1S3AA 4NXIA 2A4VA 5CREA 4BVYB 2LQOA 1XWGA 3G7YA 4KNDA 4GSTA 1KBNA 4XS4B 1RK4A 4E8HA 7GSSA 4YAPA 2DC5A 1GL8A 2C3NA 1ML6A 2J9HA 1YKAA 5D93A 4NV5A 4TR1A 2QGVA 4OWYA 3ZMKA 3K8NA 4Z2UA 2LTKA 1GSFA 1LJRA 1GULA 5DAKB 2B5XA 4J2FA 3BBYA 3GKXA 3KH9A 4EUYA 4MABA 3TKSC 4RI7A 2E2GA 3US3A 3CRTA 3D4TA 2AB6A 2MZCA 4ECCA 1SYRA 1M9AA 1EGOA 3M3MA 4OCEA 2N5FA 5F0GA 3W8SA 2B5YA 22GSA 5DALA 1GSYA 4GQCA 1XW9A 2JL4A 4KW6A 4AJ8A 1I5GA 3EU3A 2VL2C 5DVBA 3DWVA 2V6OA 1OC3A 2OBKA 3N9JA 2MBSA 2VOCA 5AN1A 1TU8A 3PPUA 2N5BA 2RM6A 3KD0A 5EPFA 3F8UA 4AJ7A 2PUKC 2VO4A 5ID2B 2DLXA 3QFAC 3ZIJA 2F3MA 1EP8A 2AV4A 1OE7A 2IN3A 1TRWA 2TIRA 3CTFA 4MA9A 1Z6NA 4GTUA 4OFMA 3D4MA 1R4WA 3GV1A 3MWHA 1FG4A 4OFTA 3TJGA 5ELGA 4EDZA 4MJAA 5IMDA 3D0ZA 2HRKA 3WT2A 1EV9A 3KM6A 3TOUA 2C80A 2V6KA 4PNGA 5A4VA 1FOVA 1ERVA 1TP9A 2VL2A 1TK5B 4RQRA 4MPFA 2HSYA 5CRWA 3N5OA 4HS1A 1AUCA 2H8LA 2OE3A 2XBIA 2GQLA 3ME8A 4DSSA 5IMZA 2HZFA 3HJMA 2YNXA 1ZYPA 4KCAA 1U3AA 5L71A 3QMXA 2JADA 2DMLA 2QSIA 2P31A 5J3RA 1V98A 3ZREA 1F3AA 3IC8A 1V40A 2FNOA 5IMFA 4JE1A 2B5EA 4X0XA 3C1RA 3CSHA 4O5RA 4HI7A 1YEPA 4PNFA 5ECKB 5ECMB 2XC2A 3LW9A 1OAZA 1G7EA 1K0AA 4MZBA 1PQNA 2R0PA 2B1KA 3KXOA 3G7JA 1SENA 4K5RA 1X9MB 4LLRA 1EZKA 4FYCA 1GSDA 3MYDA 1AAZA 3H1NA 3QAWA 4XHMA 2XBQA 3IRAA 4Z2TA 2LUSA 3EWLA 5JWQB 1F37A 3CYNA 5ECNB 2FCHA 4XTSA 2UZ8A 5ECOB 2C0DA 4TN8A 3PINA 5ECQB 6GSWA 4MCUA 2B7KA 2GLRA 1TDIA 3HYPA 2IJYA 3FR9A 5LNKe 3LXTA 1BYEA 4V2MA 5IM9A 1T1VA 2FHEA 1K0CA 1V9WA 4OCFA 4WF4A 3TJFA 1SD8A 1QMVA 3TRPA 2B1LA 3IAM2 19GSA 4X4JA 5CNWA 2R4VA 3UOMA 5HQPA 3FHKA 5D9XA 2HRAA 5IMAA 2ZCTA 3F0IA 1A2LA 2C8UA 2GS3A 4KA0A 4KGIA 2LQQA 3ZFLA 4K2DA 3BJ5A 1YEXA 1Z5YE 2OJLA 2X8CA 3DVXA 4WEYA 2BJXA 1J9BA 4L0UA 5EL8A 5B8BA 2F51A 3H8QA 1KEBA 2I9HA 3GYKA 5F05A 1AW9A 1FW1A 2FA8A 5JCGA 2HLSA 4F2IA 3CSIA 2X8GA 1Q4JA 2HSMA 4G0LA 2IMEA 1M2DA 1K3YA 3UVHA 1A8YA 4HZ4A 4IJ3A 2ON5A 3GUSA 3WYWA 3GIXA 2GDRA 2GQMA 1GNWA 11GSA 1SKRB 2YWOA 2WCIA 1CQGA 5J4UA 2C3TA 2JZTA 2VLTA 3ZMLA 3G9BA 1ZYQB 3ZVJA 1ON4A 1GTAA 2DSAA 3IV4A 2DKHA 4E8EA 1G0TA 1YJ6A 1GUKA 13GSA 2VD0A 1KTEA 1FVKA 2H76A 1T4YA 2PMTA 4IS0A 1E6BA 3TJKA 1XWKA 1HQOA 3WGEA 1A23A 3MSZA 2VLUA 2NBSA 3CMIA 3C71A 4MK3A 1ZZYA 2X64A 1K0DA 4FIWA 2DJ3A 4NWYA 3BOAA 4PX1A 3F4SA 3IK7A 1X5CA 5GZZB 5CYYA 2GZPA 2L5OA 1W89A 1SK1A 4ZIJA 2CA8A 3ERGA 1MD4A 3RHCA 2MMNA 3IA1A 6GSXA 2H75A 1GLQA 1C72A 4D73A 3HA9A 2ZNMA 3L0HA 3MDKA 4ZILA 3GTUB 1TTZA 2F9SA 3C7MA 5F06A 3TDGA 3F3QA 3ISOA 3FW2A 5D96A 4JZQA 4MLYA 2CAQA 2MMAA 1OC9A 2TRXA 2RIIA 4K2XA 1U3IA 2HYXA 3LWAA 3UBKA 2EC4A 3HZ8A 4TKYA 4ZL9A 3QDNA 2PVOC 3A3TA 3NZNA 4YQMA 1FOHA 4XRAA 1X9WB 3QOUA 5DJLA 2I4AA 2AUVA 2L4QA 5JCWA 4LA1A 3TKQA 4PGTA 1QUWA 4F0BA 1UC7A 2ZUPA 3GFKA 1MEKA 2X49A 4JRRA 1JLVA 1O7UA 4DEJA 2LRTA 2VAFA 2PN8A 2DKIA 3VLNA 4I2UA 1QK8A 3GMFA 3I69A 4TW5A 4TVEA 14GSA 3TJJA 2O89A 5D8IA 4IW9A 2QA2A 4Q5NA 3ZVJD 3ZITA 3VWVA 1RQMA 4EF0A 2IFQB 2WRTA 1K0MA 5JCUA 3C1SA 2A4HA 2R37A 5D9TA 2H66A 2C0GA 3P90A 4GF0A 4Q5QA 3HY2A 1EV4A 1M2AA 3J7Yk 3DEXA 4MZCA 2GTUA 1XOBA 2ON7A 3GSTA 3RPPA 5H5SA 9GSSA 1QFNA 3TKRA 3H79A 1NHOA 4GRFA 1EWXA 4V2NA 5CRHA 5ENUA 5CRDA 1J08A 2O8VB 1WP0A 2IPAA 4AJ6A 3DRNA 4NHWA 2VCVA 5C00A 4DSQA 3D22A 2R5GA 2GSTA 5ECLB 3RBTA 5D9VA 4MP4A 5DCHA 3VK9A 1GSUA 1G6WA 4I97A 1UN2A 3FZ9A 16GSA 5KOXA 1QGVA 2M80A 2OBIA 3UIWA 4I5QA 4CHSA 3IXRA 2FA4A 5G1KA 3GL3A 2MYGA 5BRTA 1BEDA 4I6XA 4V2LA 4BA7A 2VL3A 3CTGA 5LD0A 4O5QA 5ECRB 2P0GA 4FQUA 4BL7B 4PTSA 4ZL7A 5AIVA 4RQXA 1DE1A 2VCXA 5J9BA 4ML1A 1AXDA 2IL3A 1ZOFA 2YANA 2V32A 2X8HA 4PQ1A 4GCIA 2OE1A 1O85A 5DCGA 4Q5FA 2PBJA 5GAPD 2OACA 4J57E 1SL0B 2GVPA 2YV9A 5KN0A 3A2VA 3BCIA 5GSTA 4PUAA 3DMLA 4G9HA 1SJIA 3FY7A 1PD21 4CDOA 1ERWA 3E9JB 3KP9A 3W6GA 1Z9HA 1U87A 4O32A 2HZEA 4YKGA 1MD3A 20GSA 5G2ZA 3J7Yb 3UVTA 1TK0B 1R7HA 3Q6OA 2H72A 4K7OA 1J0FA 2GSQA 2RUEA 5D9WA 4LL4B 3HVVA 1DUGA 4K7IA 2CX3A 4TR3A 3TKSA 1OE8A 2LJKA 2REMA 2VCTA 4ISDA 1A24A 2L57A 1F3BA 2K18A 4TR0A 4WF5A 3IK9A 1A8LA 3ZL5A 5ABRA 4KB3A 3F3RA 2C0EA 1YQ1A 4KDUA 4DVCA 5HR1A 4BWSA 3ERFA 2JU5A 4ID0A 1VF1A 1HYUA 1XW5A 4BVYA 3RPNA 3EU4A 4FO5A 1PKWA 5EY6A 2GZYA 4XS4A 1XWBA 2NDOA 5IO2A 1O73A 3L78A 3VI5A 2XPEA 4K0GA 4TR4A 2WULA 4X43A 4IHUA 2WFCA 4ZB8A 5DAKA 4K9ZA 3GRXA 2K8SA 3IC4A 6GSUA 4KF9A 2JZSA 3LG6A 4MPGA 3FMWA 1I9DA 5AGYA 3DXBA 2JZRA 3UEMA 3VWXA 5KEJA 1YY7A 3KIJA 1XXUA 1K0OA 2HXKA 1TOFA 4L8EA 4NPBA 4YQVA 1GSQA 1TU7A 5C04A 1FHEA 4WBRD 1EOGA 3D5JA 1HNCA 3SWLA 4RI6A 2H70A 2CAIA 5ECIB 4ZXGA 4TXOB 2LS5A 4I8BA 3M9JA 3WT1A 5IOXA 5HR3A 2IMDA 4IP6A 5E4WA 3UJ1A 2PPTA 2JSYA 2HT9A 2O85A 4LL1B 1B9XC 3ME7A 3RAZA 5ID2A 4TOPA 5HR0A 1RW1A 5DJMA 1XPVA 1B4PA 1Y25A 3L9UA 3W8JA 4GWRA 3MNGA 4HU9A 3G7IA 1BAYA 4KUNA 2R3XA 3F9UA 1PSQA 2CV4A 4HEA2 2AHEA 3L4NA 3EMXA 3HVSA 2H1BA 1M0UA 3UAPA 5A4WA 3A2WA 1BQ7A 2R0CA 1BX9A 3DYRA 5G30A 3UARA 3QPMA 1SD9A 4L5LA 2DIYA 4KE3A 1LBKA 5CRGA 1OKTA 5H5QA 4BVXB 3ZRDA 3KH7A 1GLPA 1XZOA 3M1GA 4N0VA 2PWJA 1ZL9A 1N8JA 4IBPA 3TCOA 1YF0A 5FT3A 3FZAA 2IMIA 3I9V2 4MF6A 2YJ7A 1X9SB 4V1Ap 1K3LA 1R5PA 1K0BA 3WGDA 2DJ1A 3UBLA 2ALBA 2I81A 1SKWB 4MMMA 3VFIA 4KSOA 2PGTA 3APSA 2VCQA 3QFBC 5EVOA 4EXJA 2DJ0A 3GSSA 3LXZA 2JSZA 2VLVA 1SL2B 1GSSA 4JBBA 3HVXA 5J9CA 1B9YC 3PGTA 3ERWA 2C1YA 1B4QA 4MJCA 4ZB9A 2CZ2A 4G0IA 5DDLA 4TXVA 3KCMA 1JHBA 3WGXA 4ZBDA 3PR8A 1SKSB 1FAAA 4F03A 2A2SA 3CSJA 4HZ2A 5GAND 4Q5RA 4MNNA 4MDCA 4WR4A 5KN3A 3TB2A 1PL1A 1SYXA 3F4TA 2H1AA 4N30A 2K6VA 4LMVA 3VI7A 1AQVA 4MF5A 2HRFA 2YCDA 2BTOT 3ZLPA 1USBA 5G5EA 1ERUA 2QKEA 1YZXA 4MZWA 4CW9A 3IE3A 4GSSA 4ZBAA 2R6KA 1K0NA 1NHYA 3EYTA 5B6NA 3IR4A 1GUHA 1EP7A 1XFLA 2LEGA 3ZYWA 5F07A 3IOSA 2YWMA 1LU4A 2LV3A 4O7HA 3CXGA 3VWUA 1XWAA 1F9MA 1VF4A 3KJYA 2FD3A 4JR6A 4F82A 1WIKA 3HXSA 3P7XA 5AISA 3GNJA 3LGCA 3QD9A 2I3YA 2NTOA 3GA4A 12GSA 2H74A 5D73A 3EC3A 2CT6A 3F6DA 1DSBA 1MDIA 1YDKA 1ZMAA 2PU9C 1SK0A 4QQ7A 2KP1A 4A5PA 5B7CA 2B3SA 5A5KA 2AYTA 5CAXA 1AQWA 2YV7A 2EIQA 1WOUA 4QL9A 2YWIA 1TI1A 1GTIA 3Q74A 1PL2A 3DKSA 2EIOA 3A2XA 2R2JA 2E7PA 2VM1A 1O6JA 2N5AA 4OFNA 1VF2A 2FWGA 1K3OA 4NHZA 5IQYA 3M8NA 2FGXA 1BG5A 2VD1A 3F63A 2MMZA 2VL9A 3ZIVA 4USSA 2DJKA 1WJKA 5CP1A 2VIMA 1AQXA 1WPIA 1SJZA 1ABAA 3ED3A 1TKDB 2OADA 1GH2A 2CVKA 2H1GA 2KP2A 4TR1B 4BWQA 4KCEA 1E2YA 1XIYA 1TRSA 1HD2A 3CBUA 2QC7A 3FEUA 1TRVA 2LNTA 3OR5A 4G2EA 2GSSA 2HRNA 3QR6A 3F4RA 17GSA 3ZFBA 1F6MC 1GTBA 1EEJA 1GUMA 1HNBA 1SL1B 1THOA 3SBCA 1ILOA 2FWFA 4KSMA 8GSSA 1IYHA 4POKA 2L6CA 1UVZA 5DALB 3GKKA 2KLXA 4V1Ag 4K0NA 3ZTLA 1FB6A 1GWCA 4N10A 1BJXA 1T00A 1PGTA 4P3YB 2LNSA 1GRXA 3LSZA 1PMTA 2DJ2A 3GTUA 4K5SA 3LEFA 3FZ5A 2L59A 3GKNA 2K8VA 5HFKA 2LKUA 5HFGA 5FWGA 3M9KA 2QA1A 2AAWA 4CY6A 5F8BA 3TOTA 3EPTA 2FWHA 3EE2A 2VM2A 3FK8A 3FRCA 1DE2A 1A0RP 2YP6A 3HZ4A 2G2QA 1THXA 4YH2A 2MBTA 5CO3A 4HQSA 4GSNA 2IWTA 1AC1A 2WZ9A 5ECSA 1SK2A 1B48A 4N0ZA 2FLSA 1O8WA 4I2TA 2GSRA 1XBSA 1PX7A 4OO4A 4KDYA 3WD6A 5KN1A 4EIPA 4XS6A 2GQKA 2GGTA 2K9FA 3DIEA 4L5OA 2XPDA 5IPHA 3RHBA 3GH6A 4PXOA 3Q18A 4IP1A 4DSSB 4HQZA 1SU9A 4ECBA 3DGQA 1VGLA 3R3EA 1R26A 3TRXA 1JZWA 2IFQA 4ICYA 2RM5A 5H5RA 4BPYA 5ECPB 4J56E 3KMOA 2L5LA 6GSSA 2GZZA 1T3BA 2Z9SA 2OA7A 4EL1A 3D6IA 1OC8A 2A2RA 4G0KA 4ULXA 1TW9A 1O81A 4POLA 3S9FA 3EINA 4MJBA 2IMFA 3ZZXA 2EIRA 1ZCPA 4EE0A 5ECHB 4KH7A 1W4VA 3VPQA 2F8AA 1PX6A 3LFLA 2LRCA 5J41A 3HDCA 1V57A 2DBCA 1TK8B 2OE0A 3GH9A 1XW6A 4ECIA 5COHA 2DIZA 2RLIA 4EVMA 10GSA 5DQSA 1Z6MA 2HFDA 2IIYA 1XWCA 4ACSA 2E2MA 2H71A 3O6TA 2C3QA 1X5DA 1G6YA 4WXTA 1T8EB 4H86A 4POBA 2YZUA 1WMJA 2LSTA 3U5RE 4WBJA 1TRUA 5G5FA 3RDWA 4NV2A 1JZDA 1OYJA 3BD2A 1XVQA 4K1FA 3U6VA 3KGKA 1GSEA 2YOIA 3L9VA 4IJIA 1H4OA 2CZ3A 2J23A 1FVJA 3FR3A 1XOAA 3VWWA 1O8XA 3HD5A 4BL7A 3UL3A 2P5RA 2F8FA 1R5AA 1X5EA 4XCSA 3O76A 1PA3A 1ACVA 5HR2A 4JU5A 3APQA 1GTUA 3L9SA 4MH2A 1EEMA 3TUEA 5LCZA 2DMMA 4OMVA 2LJRA 1OVNA 1WRYA 5FHIA 2B6MA 5IIZA 4G19A 1QXHA 3HHVA 3LORA 2H1DA 2X4AA 3GN3A 3HKRA 1N2AA 3E0UA 4AF2A 2C0FA 1AIUA 4OO5A 3MAKA 3A5WA 6GSYA 4HJ2A 3APOA 4MH3A 1IYIA 4PURA 2V41A 2LJAA 3VURA 1Q98A 2B7JA 3PH9A 4RUVA 4MF7A 4K6XA 4Z2RA 2PERA 2HNLA 2GT5A 1YKCA 4HUAA 4ZBBA 2CVBA 3EURA 3IBHA 1JZRA 3KP8A 2M72A 3IDVA 1ERTA 1CQHA 5JWOB 1A2MA 1H75A 1GNEA 2RUFA 3A5IA 5G1LA 3O3TA 2M46A 5B6MA 4XRDA 4EIQA 2H30A 3HJOA 1NSWA 2H73A 3KEBA 5IOWA 3V1WA 1JZOA 3EVIA 4IQ1A 1XCCA 4YQUA 1NM3A 2OKAA 5INYA 4YKFA 5ELAA 1ZGNA 2WS2A 2KUCA 2NVLA 4YAVA 3LJRA 4MJEA 4JEDA 3TGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C4J A;  4D73 B;  5G31 A;  3IAS 2;  3DD3 A;  4FYB A;  4ML6 A;  1M2B A;  2VCW A;  2L4C A;  2NPB A;  3TKS E;  1PN9 A;  1Z3E A;  2D2Z A;  5IMC A;  4WET A;  2L6D A;  3FZ4 A;  4O92 A;  2X99 A;  3KTL A;  1HNA A;  1OC9 B;  3FYG A;  4ECJ A;  2V2G A;  1PRX A;  3M0F A;  3IHQ A;  1ST9 A;  1VRS D;  2FWE A;  1MTC A;  4XS1 A;  4QL7 A;  2H6Y A;  5HFI A;  4PUF C;  3GHA A;  4EKZ A;  1NW2 A;  1TI3 A;  1A2J A;  4DSR A;  3UMA A;  1JLW A;  5IO0 A;  5KN2 A;  1F2E A;  3TKP A;  2IMK A;  4EC0 A;  3C73 A;  3I6A A;  2BMX A;  4GQF A;  4TXO A;  1Y6E A;  1PKZ A;  1UA5 A;  2WB9 A;  3KTB A;  1OKD A;  2YPM A;  3TJB A;  3DVW A;  3FR6 A;  4ZL8 A;  4KAE A;  4JR4 A;  1MDJ A;  4GXZ A;  2H6Z A;  4HDE A;  4K8M A;  1U6T A;  3GX8 A;  3R2Q A;  3C8E A;  4F0C A;  2PVQ A;  1S3C A;  1EGR A;  5IMV A;  4HJM A;  2H01 A;  3VPT A;  4FYU A;  3I43 A;  3GX0 A;  4IVF A;  3TRQ A;  1TXX A;  4KX4 A;  2E0Q A;  3GL5 A;  3IPZ A;  4BVX A;  4N11 A;  1V2A A;  2FY6 A;  2LRN A;  3FKF A;  1WWJ A;  4Z7X A;  5DBQ A;  2HSH A;  4FH8 A;  4HU7 A;  1V58 A;  2YJH A;  4XIH A;  2G0F A;  4IQA A;  2H0G A;  3LYK A;  1M7T A;  4IKH A;  3NOF A;  2H6X A;  4GLT A;  2WGR A;  2TRC P;  3P8W A;  3GUR A;  1DBY A;  4X1U A;  3QCP A;  2VCZ A;  2JAC A;  2GT6 A;  4G10 A;  5J5N A;  4HOJ A;  2KHP A;  5E59 A;  2MMO A;  2AJQ B;  3QAG A;  3QAV A;  1T4Z A;  1URM A;  1U88 A;  1A0F A;  2I1U A;  2CX4 A;  2V1M A;  3NIV A;  4LMW A;  1ZYE A;  1M9B A;  2YN1 A;  1KNG A;  2CQ9 A;  1TJD A;  2VUP A;  1VF3 A;  1M99 A;  3Q19 A;  4ILF A;  1X0R A;  4NMU A;  4WKW A;  1QQ2 A;  2XHF A;  3AY8 A;  1GP1 A;  1Z7R A;  4EO3 A;  3LQ7 A;  6GSV A;  5JWR B;  1WE0 A;  3KMN A;  4TRX A;  4WR5 A;  2HE3 A;  3CRU A;  1Z7P A;  2CVD A;  2DJJ A;  1EOH A;  3H4K A;  4K7N A;  3LYP A;  1B8X A;  18GS A;  4OD7 A;  3E3E A;  1FO5 A;  3P2A A;  5B8A A;  3F6F A;  1G7O A;  3KZQ A;  3HCZ A;  2YZH A;  2FUG 2;  3D21 A;  2YWN A;  5GSS A;  3HJP A;  2HZE B;  3BCK A;  3H93 A;  1S3D A;  2O7K A;  1T7P B;  3EMP A;  3GKM A;  4PQI A;  2H0I A;  1JFU A;  5IPG A;  2KOK A;  2ES7 A;  4AGS A;  1SJ6 A;  1MDK A;  2P5Q A;  4IN0 A;  5AIX A;  2WJU A;  4POM A;  5A4U A;  1FB0 A;  2O87 A;  4IEL A;  4ZB6 A;  2H0H A;  4PQH A;  4IGJ A;  3JCM L;  2HI7 A;  4KDX A;  4NAX A;  4L0W A;  1XVW A;  2WDU A;  6GST A;  5DQY A;  4EDY A;  2H19 A;  1YF1 A;  4F9Z A;  1S3A A;  4NXI A;  2A4V A;  5CRE A;  2LQO A;  1XWG A;  3G7Y A;  4KND A;  4GST A;  1KBN A;  4XS4 B;  1RK4 A;  4E8H A;  7GSS A;  4YAP A;  2DC5 A;  1GL8 A;  2C3N A;  1ML6 A;  2J9H A;  1YKA A;  5D93 A;  4NV5 A;  4TR1 A;  2QGV A;  4OWY A;  3ZMK A;  3K8N A;  2LTK A;  1GSF A;  1LJR A;  1GUL A;  5DAK B;  2B5X A;  4J2F A;  3BBY A;  3GKX A;  3KH9 A;  4EUY A;  4MAB A;  3TKS C;  4RI7 A;  2E2G A;  3US3 A;  3CRT A;  3D4T A;  2AB6 A;  2MZC A;  4ECC A;  1SYR A;  1M9A A;  1EGO A;  3M3M A;  4OCE A;  2N5F A;  5F0G A;  3W8S A;  2B5Y A;  22GS A;  5DAL A;  1GSY A;  4GQC A;  1XW9 A;  2JL4 A;  4KW6 A;  4AJ8 A;  1I5G A;  3EU3 A;  2VL2 C;  5DVB A;  3DWV A;  2V6O A;  1OC3 A;  2OBK A;  3N9J A;  2MBS A;  2VOC A;  5AN1 A;  1TU8 A;  2N5B A;  2RM6 A;  3KD0 A;  5EPF A;  3F8U A;  4AJ7 A;  2PUK C;  2VO4 A;  5ID2 B;  2DLX A;  3QFA C;  3ZIJ A;  2F3M A;  1EP8 A;  2AV4 A;  1OE7 A;  2IN3 A;  1TRW A;  2TIR A;  3CTF A;  4MA9 A;  1Z6N A;  4GTU A;  4OFM A;  3D4M A;  1R4W A;  3GV1 A;  3MWH A;  1FG4 A;  4OFT A;  3TJG A;  5ELG A;  4EDZ A;  4MJA A;  5IMD A;  3D0Z A;  3WT2 A;  1EV9 A;  3KM6 A;  3TOU A;  2C80 A;  2V6K A;  4PNG A;  5A4V A;  1FOV A;  1ERV A;  1TP9 A;  2VL2 A;  1TK5 B;  4RQR A;  4MPF A;  2HSY A;  5CRW A;  3N5O A;  4HS1 A;  1AUC A;  2H8L A;  2OE3 A;  2XBI A;  2GQL A;  3ME8 A;  4DSS A;  5IMZ A;  2HZF A;  3HJM A;  2YNX A;  4KCA A;  1U3A A;  5L71 A;  3QMX A;  2JAD A;  2DML A;  2QSI A;  2P31 A;  5J3R A;  1V98 A;  3ZRE A;  1F3A A;  1V40 A;  2FNO A;  5IMF A;  4JE1 A;  2B5E A;  4X0X A;  3C1R A;  3CSH A;  4O5R A;  4HI7 A;  1YEP A;  4PNF A;  5ECK B;  5ECM B;  2XC2 A;  1OAZ A;  1G7E A;  1K0A A;  4MZB A;  1PQN A;  2B1K A;  3KXO A;  3G7J A;  1SEN A;  1X9M B;  4LLR A;  1EZK A;  4FYC A;  1GSD A;  1AAZ A;  3H1N A;  3QAW A;  4XHM A;  2XBQ A;  3IRA A;  2LUS A;  3EWL A;  5JWQ B;  1F37 A;  3CYN A;  5ECN B;  2FCH A;  4XTS A;  5ECO B;  2C0D A;  4TN8 A;  3PIN A;  5ECQ B;  6GSW A;  4MCU A;  2B7K A;  2GLR A;  1TDI A;  3HYP A;  2IJY A;  3FR9 A;  5LNK e;  3LXT A;  1BYE A;  4V2M A;  5IM9 A;  1T1V A;  2FHE A;  1K0C A;  1V9W A;  4OCF A;  4WF4 A;  3TJF A;  1SD8 A;  1QMV A;  3TRP A;  2B1L A;  3IAM 2;  19GS A;  5CNW A;  2R4V A;  3UOM A;  5HQP A;  3FHK A;  5D9X A;  5IMA A;  2ZCT A;  3F0I A;  1A2L A;  2C8U A;  2GS3 A;  4KA0 A;  4KGI A;  2LQQ A;  3ZFL A;  4K2D A;  3BJ5 A;  1YEX A;  1Z5Y E;  2OJL A;  2X8C A;  3DVX A;  4WEY A;  2BJX A;  1J9B A;  4L0U A;  5EL8 A;  5B8B A;  2F51 A;  3H8Q A;  1KEB A;  2I9H A;  3GYK A;  5F05 A;  1AW9 A;  1FW1 A;  2FA8 A;  5JCG A;  2HLS A;  4F2I A;  3CSI A;  2X8G A;  1Q4J A;  2IME A;  1M2D A;  1K3Y A;  3UVH A;  1A8Y A;  4HZ4 A;  4IJ3 A;  2ON5 A;  3GUS A;  3WYW A;  3GIX A;  2GDR A;  2GQM A;  1GNW A;  11GS A;  1SKR B;  2YWO A;  2WCI A;  1CQG A;  5J4U A;  2C3T A;  2JZT A;  2VLT A;  3ZML A;  3G9B A;  1ZYQ B;  3ZVJ A;  1ON4 A;  1GTA A;  2DSA A;  3IV4 A;  4E8E A;  1G0T A;  1YJ6 A;  1GUK A;  13GS A;  2VD0 A;  1KTE A;  1FVK A;  2H76 A;  1T4Y A;  2PMT A;  4IS0 A;  1E6B A;  3TJK A;  1XWK A;  1HQO A;  3WGE A;  1A23 A;  3MSZ A;  2VLU A;  2NBS A;  3CMI A;  3C71 A;  4MK3 A;  1ZZY A;  2X64 A;  1K0D A;  4FIW A;  2DJ3 A;  4NWY A;  3BOA A;  4PX1 A;  3F4S A;  3IK7 A;  1X5C A;  5GZZ B;  5CYY A;  2GZP A;  2L5O A;  1W89 A;  1SK1 A;  4ZIJ A;  2CA8 A;  3ERG A;  1MD4 A;  3RHC A;  2MMN A;  3IA1 A;  6GSX A;  2H75 A;  1GLQ A;  1C72 A;  4D73 A;  3HA9 A;  2ZNM A;  3L0H A;  3MDK A;  4ZIL A;  3GTU B;  1TTZ A;  2F9S A;  3C7M A;  5F06 A;  3TDG A;  3F3Q A;  3ISO A;  3FW2 A;  5D96 A;  4JZQ A;  4MLY A;  2CAQ A;  2MMA A;  1OC9 A;  2TRX A;  2RII A;  1U3I A;  2HYX A;  3LWA A;  3UBK A;  2EC4 A;  3HZ8 A;  4TKY A;  4ZL9 A;  3QDN A;  2PVO C;  3A3T A;  3NZN A;  4YQM A;  4XRA A;  1X9W B;  3QOU A;  5DJL A;  2I4A A;  2AUV A;  2L4Q A;  5JCW A;  4LA1 A;  3TKQ A;  4PGT A;  1QUW A;  4F0B A;  1UC7 A;  2ZUP A;  3GFK A;  1MEK A;  4JRR A;  1JLV A;  1O7U A;  4DEJ A;  2LRT A;  2VAF A;  2PN8 A;  3VLN A;  4I2U A;  1QK8 A;  3GMF A;  3I69 A;  4TW5 A;  4TVE A;  14GS A;  3TJJ A;  2O89 A;  5D8I A;  4IW9 A;  4Q5N A;  3ZVJ D;  3ZIT A;  3VWV A;  1RQM A;  4EF0 A;  2IFQ B;  2WRT A;  1K0M A;  5JCU A;  3C1S A;  2R37 A;  5D9T A;  2H66 A;  2C0G A;  3P90 A;  4GF0 A;  4Q5Q A;  3HY2 A;  1EV4 A;  1M2A A;  3J7Y k;  3DEX A;  4MZC A;  2GTU A;  1XOB A;  2ON7 A;  3GST A;  3RPP A;  5H5S A;  9GSS A;  1QFN A;  3TKR A;  3H79 A;  1NHO A;  4GRF A;  1EWX A;  4V2N A;  5CRH A;  5ENU A;  5CRD A;  1J08 A;  2O8V B;  1WP0 A;  2IPA A;  4AJ6 A;  3DRN A;  4NHW A;  2VCV A;  5C00 A;  4DSQ A;  3D22 A;  2R5G A;  2GST A;  5ECL B;  3RBT A;  5D9V A;  4MP4 A;  5DCH A;  3VK9 A;  1GSU A;  1G6W A;  4I97 A;  1UN2 A;  3FZ9 A;  16GS A;  1QGV A;  2M80 A;  2OBI A;  3UIW A;  4I5Q A;  4CHS A;  3IXR A;  2FA4 A;  5G1K A;  3GL3 A;  2MYG A;  1BED A;  4I6X A;  4V2L A;  4BA7 A;  2VL3 A;  3CTG A;  5LD0 A;  5ECR B;  2P0G A;  4ZL7 A;  5AIV A;  4RQX A;  1DE1 A;  2VCX A;  5J9B A;  4ML1 A;  1AXD A;  2IL3 A;  1ZOF A;  2YAN A;  2V32 A;  2X8H A;  4PQ1 A;  4GCI A;  2OE1 A;  1O85 A;  5DCG A;  4Q5F A;  2PBJ A;  5GAP D;  2OAC A;  4J57 E;  1SL0 B;  2GVP A;  2YV9 A;  5KN0 A;  3A2V A;  3BCI A;  5GST A;  4PUA A;  3DML A;  4G9H A;  1SJI A;  3FY7 A;  1PD2 1;  4CDO A;  1ERW A;  3E9J B;  3KP9 A;  3W6G A;  1Z9H A;  1U87 A;  4O32 A;  2HZE A;  1MD3 A;  20GS A;  5G2Z A;  3J7Y b;  3UVT A;  1TK0 B;  1R7H A;  3Q6O A;  2H72 A;  4K7O A;  1J0F A;  2GSQ A;  2RUE A;  5D9W A;  4LL4 B;  3HVV A;  1DUG A;  4K7I A;  2CX3 A;  4TR3 A;  3TKS A;  1OE8 A;  2LJK A;  2REM A;  2VCT A;  4ISD A;  1A24 A;  2L57 A;  1F3B A;  2K18 A;  4TR0 A;  4WF5 A;  3IK9 A;  1A8L A;  3ZL5 A;  5ABR A;  4KB3 A;  3F3R A;  2C0E A;  1YQ1 A;  4KDU A;  4DVC A;  5HR1 A;  4BWS A;  3ERF A;  2JU5 A;  4ID0 A;  1VF1 A;  1HYU A;  1XW5 A;  4BVY A;  3RPN A;  3EU4 A;  4FO5 A;  1PKW A;  5EY6 A;  2GZY A;  4XS4 A;  1XWB A;  2NDO A;  5IO2 A;  1O73 A;  3L78 A;  3VI5 A;  2XPE A;  4K0G A;  4TR4 A;  2WUL A;  4X43 A;  4IHU A;  2WFC A;  4ZB8 A;  5DAK A;  4K9Z A;  3GRX A;  2K8S A;  3IC4 A;  6GSU A;  2JZS A;  3LG6 A;  4MPG A;  1I9D A;  5AGY A;  3DXB A;  2JZR A;  3UEM A;  3VWX A;  5KEJ A;  1YY7 A;  3KIJ A;  1XXU A;  1K0O A;  2HXK A;  1TOF A;  4L8E A;  4NPB A;  4YQV A;  1GSQ A;  1TU7 A;  5C04 A;  1FHE A;  4WBR D;  1EOG A;  3D5J A;  1HNC A;  3SWL A;  4RI6 A;  2H70 A;  2CAI A;  5ECI B;  4ZXG A;  4TXO B;  2LS5 A;  4I8B A;  3M9J A;  3WT1 A;  5IOX A;  5HR3 A;  2IMD A;  4IP6 A;  5E4W A;  3UJ1 A;  2PPT A;  2JSY A;  2HT9 A;  2O85 A;  4LL1 B;  1B9X C;  3ME7 A;  3RAZ A;  5ID2 A;  4TOP A;  5HR0 A;  1RW1 A;  5DJM A;  1XPV A;  1B4P A;  1Y25 A;  3L9U A;  3W8J A;  4GWR A;  3MNG A;  4HU9 A;  3G7I A;  1BAY A;  4KUN A;  2R3X A;  3F9U A;  1PSQ A;  2CV4 A;  4HEA 2;  2AHE A;  3L4N A;  3EMX A;  3HVS A;  2H1B A;  1M0U A;  3UAP A;  5A4W A;  3A2W A;  1BQ7 A;  1BX9 A;  3DYR A;  5G30 A;  3UAR A;  3QPM A;  1SD9 A;  4L5L A;  2DIY A;  4KE3 A;  1LBK A;  5CRG A;  1OKT A;  5H5Q A;  3ZRD A;  3KH7 A;  1GLP A;  1XZO A;  3M1G A;  4N0V A;  2PWJ A;  1ZL9 A;  1N8J A;  4IBP A;  3TCO A;  1YF0 A;  5FT3 A;  3FZA A;  2IMI A;  3I9V 2;  4MF6 A;  2YJ7 A;  1X9S B;  4V1A p;  1K3L A;  1R5P A;  1K0B A;  3WGD A;  2DJ1 A;  3UBL A;  2ALB A;  2I81 A;  1SKW B;  4MMM A;  3VFI A;  4KSO A;  2PGT A;  3APS A;  2VCQ A;  3QFB C;  5EVO A;  4EXJ A;  2DJ0 A;  3GSS A;  3LXZ A;  2JSZ A;  2VLV A;  1SL2 B;  1GSS A;  4JBB A;  3HVX A;  5J9C A;  1B9Y C;  3PGT A;  3ERW A;  2C1Y A;  1B4Q A;  4MJC A;  4ZB9 A;  2CZ2 A;  5DDL A;  4TXV A;  3KCM A;  1JHB A;  3WGX A;  4ZBD A;  3PR8 A;  1SKS B;  1FAA A;  4F03 A;  2A2S A;  3CSJ A;  4HZ2 A;  5GAN D;  4Q5R A;  5KN3 A;  4MDC A;  4WR4 A;  3TB2 A;  1PL1 A;  1SYX A;  3F4T A;  2H1A A;  4N30 A;  2K6V A;  4LMV A;  3VI7 A;  1AQV A;  4MF5 A;  2HRF A;  2YCD A;  2BTO T;  3ZLP A;  1USB A;  5G5E A;  1ERU A;  2QKE A;  1YZX A;  4MZW A;  4CW9 A;  3IE3 A;  4GSS A;  4ZBA A;  2R6K A;  1K0N A;  1NHY A;  3EYT A;  5B6N A;  3IR4 A;  1GUH A;  1EP7 A;  1XFL A;  2LEG A;  3ZYW A;  5F07 A;  3IOS A;  2YWM A;  1LU4 A;  2LV3 A;  4O7H A;  3CXG A;  3VWU A;  1XWA A;  1F9M A;  1VF4 A;  3KJY A;  2FD3 A;  4JR6 A;  4F82 A;  1WIK A;  3HXS A;  3P7X A;  5AIS A;  3GNJ A;  3LGC A;  3QD9 A;  2I3Y A;  2NTO A;  3GA4 A;  12GS A;  2H74 A;  5D73 A;  3EC3 A;  2CT6 A;  3F6D A;  1DSB A;  1MDI A;  1YDK A;  1ZMA A;  2PU9 C;  1SK0 A;  4QQ7 A;  2KP1 A;  5B7C A;  2B3S A;  5A5K A;  2AYT A;  5CAX A;  1AQW A;  2YV7 A;  2EIQ A;  1WOU A;  4QL9 A;  2YWI A;  1TI1 A;  1GTI A;  3Q74 A;  1PL2 A;  3DKS A;  2EIO A;  3A2X A;  2R2J A;  2E7P A;  2VM1 A;  1O6J A;  2N5A A;  4OFN A;  1VF2 A;  2FWG A;  1K3O A;  4NHZ A;  5IQY A;  3M8N A;  2FGX A;  1BG5 A;  2VD1 A;  3F63 A;  2MMZ A;  2VL9 A;  3ZIV A;  2DJK A;  1WJK A;  5CP1 A;  2VIM A;  1AQX A;  1WPI A;  1SJZ A;  1ABA A;  3ED3 A;  1TKD B;  2OAD A;  1GH2 A;  2CVK A;  2H1G A;  2KP2 A;  4TR1 B;  4BWQ A;  4KCE A;  1E2Y A;  1XIY A;  1TRS A;  1HD2 A;  3CBU A;  2QC7 A;  3FEU A;  1TRV A;  2LNT A;  3OR5 A;  4G2E A;  2GSS A;  2HRN A;  3QR6 A;  3F4R A;  17GS A;  3ZFB A;  1F6M C;  1GTB A;  1EEJ A;  1GUM A;  1HNB A;  1SL1 B;  1THO A;  3SBC A;  1ILO A;  2FWF A;  4KSM A;  8GSS A;  1IYH A;  4POK A;  2L6C A;  1UVZ A;  5DAL B;  3GKK A;  2KLX A;  4V1A g;  4K0N A;  3ZTL A;  1FB6 A;  1GWC A;  4N10 A;  1BJX A;  1T00 A;  1PGT A;  4P3Y B;  2LNS A;  1GRX A;  3LSZ A;  1PMT A;  2DJ2 A;  3GTU A;  3LEF A;  3FZ5 A;  2L59 A;  3GKN A;  2K8V A;  5HFK A;  2LKU A;  5HFG A;  5FWG A;  3M9K A;  2AAW A;  5F8B A;  3TOT A;  2FWH A;  3EE2 A;  2VM2 A;  3FK8 A;  3FRC A;  1DE2 A;  1A0R P;  2YP6 A;  3HZ4 A;  2G2Q A;  1THX A;  4YH2 A;  2MBT A;  5CO3 A;  4HQS A;  4GSN A;  2IWT A;  1AC1 A;  2WZ9 A;  5ECS A;  1SK2 A;  1B48 A;  4N0Z A;  2FLS A;  1O8W A;  4I2T A;  2GSR A;  1XBS A;  1PX7 A;  4OO4 A;  4KDY A;  3WD6 A;  5KN1 A;  4XS6 A;  2GQK A;  2GGT A;  2K9F A;  3DIE A;  4L5O A;  2XPD A;  5IPH A;  3RHB A;  3GH6 A;  4PXO A;  3Q18 A;  4IP1 A;  4DSS B;  4HQZ A;  1SU9 A;  4ECB A;  3DGQ A;  1VGL A;  1R26 A;  3TRX A;  1JZW A;  2IFQ A;  2RM5 A;  5H5R A;  4BPY A;  5ECP B;  4J56 E;  3KMO A;  2L5L A;  6GSS A;  2GZZ A;  1T3B A;  2Z9S A;  2OA7 A;  4EL1 A;  3D6I A;  1OC8 A;  2A2R A;  4ULX A;  1TW9 A;  1O81 A;  4POL A;  3S9F A;  3EIN A;  4MJB A;  2IMF A;  3ZZX A;  2EIR A;  1ZCP A;  4EE0 A;  5ECH B;  4KH7 A;  1W4V A;  3VPQ A;  2F8A A;  1PX6 A;  3LFL A;  2LRC A;  5J41 A;  3HDC A;  1V57 A;  2DBC A;  1TK8 B;  2OE0 A;  3GH9 A;  1XW6 A;  4ECI A;  5COH A;  2DIZ A;  2RLI A;  4EVM A;  10GS A;  5DQS A;  1Z6M A;  2HFD A;  2IIY A;  1XWC A;  4ACS A;  2E2M A;  2H71 A;  3O6T A;  2C3Q A;  1X5D A;  1G6Y A;  4WXT A;  1T8E B;  4H86 A;  4POB A;  2YZU A;  1WMJ A;  2LST A;  3U5R E;  4WBJ A;  1TRU A;  5G5F A;  3RDW A;  4NV2 A;  1JZD A;  1OYJ A;  3BD2 A;  1XVQ A;  4K1F A;  3U6V A;  3KGK A;  1GSE A;  2YOI A;  3L9V A;  4IJI A;  1H4O A;  2CZ3 A;  2J23 A;  1FVJ A;  3FR3 A;  1XOA A;  3VWW A;  1O8X A;  3HD5 A;  4BL7 A;  3UL3 A;  2P5R A;  2F8F A;  1R5A A;  1X5E A;  4XCS A;  3O76 A;  1PA3 A;  1ACV A;  5HR2 A;  4JU5 A;  3APQ A;  1GTU A;  3L9S A;  4MH2 A;  1EEM A;  3TUE A;  5LCZ A;  2DMM A;  4OMV A;  2LJR A;  1OVN A;  1WRY A;  5FHI A;  2B6M A;  5IIZ A;  4G19 A;  1QXH A;  3HHV A;  3LOR A;  2H1D A;  3GN3 A;  3HKR A;  1N2A A;  3E0U A;  4AF2 A;  2C0F A;  1AIU A;  4OO5 A;  3MAK A;  3A5W A;  6GSY A;  4HJ2 A;  3APO A;  4MH3 A;  1IYI A;  4PUR A;  2V41 A;  2LJA A;  3VUR A;  1Q98 A;  2B7J A;  3PH9 A;  4RUV A;  4MF7 A;  4K6X A;  2PER A;  2HNL A;  2GT5 A;  1YKC A;  4HUA A;  4ZBB A;  2CVB A;  3EUR A;  3IBH A;  1JZR A;  3KP8 A;  2M72 A;  3IDV A;  1ERT A;  1CQH A;  5JWO B;  1A2M A;  1H75 A;  1GNE A;  2RUF A;  5G1L A;  3O3T A;  2M46 A;  5B6M A;  4XRD A;  2H30 A;  3HJO A;  1NSW A;  2H73 A;  3KEB A;  5IOW A;  3V1W A;  1JZO A;  3EVI A;  4IQ1 A;  1XCC A;  4YQU A;  1NM3 A;  2OKA A;  5INY A;  5ELA A;  1ZGN A;  2WS2 A;  2KUC A;  2NVL A;  4YAV A;  3LJR A;  4MJE A;  4JED A;  3TGZ A; 
#chains in the Genus database with same CATH topology
 2C4J A;  4D73 B;  4O5U A;  5G31 A;  3IAS 2;  3DD3 A;  4FYB A;  4ML6 A;  1M2B A;  2VCW A;  2L4C A;  2NPB A;  3TKS E;  1PN9 A;  1Z3E A;  2D2Z A;  5IMC A;  4WET A;  2L6D A;  3FZ4 A;  4O92 A;  2X99 A;  3KTL A;  1HNA A;  1OC9 B;  3FYG A;  4ECJ A;  2V2G A;  1PRX A;  3M0F A;  3IHQ A;  1ST9 A;  1VRS D;  2FWE A;  1MTC A;  4XS1 A;  4QL7 A;  2H6Y A;  5HFI A;  4PUF C;  3GHA A;  4EKZ A;  1NW2 A;  1TI3 A;  1A2J A;  4DSR A;  3UMA A;  1JLW A;  5IO0 A;  5KN2 A;  1F2E A;  3TKP A;  2IMK A;  4EC0 A;  3C73 A;  3I6A A;  1M3J A;  2BMX A;  4GQF A;  4TXO A;  1Y6E A;  1PKZ A;  1UA5 A;  2WB9 A;  3KTB A;  3IHG A;  1OKD A;  2YPM A;  3TJB A;  3DVW A;  3FR6 A;  4ZL8 A;  4KAE A;  4JR4 A;  1MDJ A;  4GXZ A;  2H6Z A;  4HDE A;  4K8M A;  1U6T A;  3GX8 A;  3R2Q A;  3C8E A;  4F0C A;  2A2P A;  1PN0 A;  2PVQ A;  1S3C A;  1EGR A;  5IMV A;  4HJM A;  2H01 A;  3VPT A;  4FYU A;  3I43 A;  3GX0 A;  4IVF A;  3TRQ A;  1TXX A;  4KX4 A;  2E0Q A;  3GL5 A;  3IPZ A;  4BVX A;  4N11 A;  1V2A A;  2FY6 A;  2LRN A;  3FKF A;  1WWJ A;  4Z7X A;  5DBQ A;  2HSH A;  4FH8 A;  4HU7 A;  1V58 A;  2YJH A;  4XIH A;  2G0F A;  4IQA A;  2H0G A;  2R0G A;  3LYK A;  1M7T A;  4IKH A;  3NOF A;  5BMU A;  2H6X A;  4GLT A;  2WGR A;  4CY8 A;  2TRC P;  3P8W A;  3GUR A;  1DBY A;  3MIX A;  4X1U A;  3QCP A;  2VCZ A;  2JAC A;  2GT6 A;  4G10 A;  5J5N A;  4HOJ A;  2KHP A;  5E59 A;  2MMO A;  2AJQ B;  3QAG A;  3QAV A;  1T4Z A;  1URM A;  1U88 A;  1A0F A;  2I1U A;  2CX4 A;  2V1M A;  3NIV A;  4LMW A;  1ZYE A;  1M9B A;  2YN1 A;  1KNG A;  2CQ9 A;  1TJD A;  2VUP A;  1VF3 A;  1M99 A;  3Q19 A;  4ILF A;  1X0R A;  4NMU A;  4WKW A;  1QQ2 A;  2XHF A;  3AY8 A;  1GP1 A;  1Z7R A;  4EO3 A;  3LQ7 A;  6GSV A;  5JWR B;  1WE0 A;  3KMN A;  4TRX A;  4WR5 A;  2HE3 A;  3CRU A;  1Z7P A;  2CVD A;  2DJJ A;  1EOH A;  3H4K A;  4K7N A;  3LYP A;  1B8X A;  18GS A;  4OD7 A;  3E3E A;  1FO5 A;  3P2A A;  5B8A A;  3F6F A;  1G7O A;  3KZQ A;  3HCZ A;  2YZH A;  2FUG 2;  3D21 A;  2YWN A;  5GSS A;  3HJP A;  2HZE B;  3BCK A;  3H93 A;  1S3D A;  2O7K A;  1T7P B;  3EMP A;  3GKM A;  4PQI A;  2H0I A;  1JFU A;  5IPG A;  2KOK A;  2ES7 A;  4AGS A;  1SJ6 A;  1MDK A;  2P5Q A;  4IN0 A;  5AIX A;  2WJU A;  4POM A;  5A4U A;  1FB0 A;  2O87 A;  4IEL A;  4ZB6 A;  5KOW A;  2H0H A;  4PQH A;  4IGJ A;  3JCM L;  2HI7 A;  1ZYN A;  4KDX A;  4NAX A;  4L0W A;  1XVW A;  2WDU A;  6GST A;  3HVN A;  5DQY A;  4EDY A;  2H19 A;  1YF1 A;  4F9Z A;  1S3A A;  4NXI A;  2A4V A;  5CRE A;  4BVY B;  2LQO A;  1XWG A;  3G7Y A;  4KND A;  4GST A;  1KBN A;  4XS4 B;  1RK4 A;  4E8H A;  7GSS A;  4YAP A;  2DC5 A;  1GL8 A;  2C3N A;  1ML6 A;  2J9H A;  1YKA A;  5D93 A;  4NV5 A;  4TR1 A;  2QGV A;  4OWY A;  3ZMK A;  3K8N A;  4Z2U A;  2LTK A;  1GSF A;  1LJR A;  1GUL A;  5DAK B;  2B5X A;  4J2F A;  3BBY A;  3GKX A;  3KH9 A;  4EUY A;  4MAB A;  3TKS C;  4RI7 A;  2E2G A;  3US3 A;  3CRT A;  3D4T A;  2AB6 A;  2MZC A;  4ECC A;  1SYR A;  1M9A A;  1EGO A;  3M3M A;  4OCE A;  2N5F A;  5F0G A;  3W8S A;  2B5Y A;  22GS A;  5DAL A;  1GSY A;  4GQC A;  1XW9 A;  2JL4 A;  4KW6 A;  4AJ8 A;  1I5G A;  3EU3 A;  2VL2 C;  5DVB A;  3DWV A;  2V6O A;  1OC3 A;  2OBK A;  3N9J A;  2MBS A;  2VOC A;  5AN1 A;  1TU8 A;  3PPU A;  2N5B A;  2RM6 A;  3KD0 A;  1XG8 A;  3F8U A;  5EPF A;  4HSC X;  4AJ7 A;  2PUK C;  2VO4 A;  5ID2 B;  2DLX A;  3QFA C;  3ZIJ A;  2F3M A;  1EP8 A;  2AV4 A;  1OE7 A;  2IN3 A;  1TRW A;  2TIR A;  3CTF A;  4MA9 A;  1Z6N A;  4GTU A;  4OFM A;  3D4M A;  1R4W A;  3GV1 A;  3MWH A;  1FG4 A;  4OFT A;  3TJG A;  5ELG A;  4EDZ A;  4MJA A;  5IMD A;  3D0Z A;  2HRK A;  3WT2 A;  1EV9 A;  3KM6 A;  3TOU A;  2C80 A;  2V6K A;  4PNG A;  5A4V A;  1FOV A;  1ERV A;  1TP9 A;  2VL2 A;  1TK5 B;  4RQR A;  4MPF A;  2HSY A;  5CRW A;  3N5O A;  4HS1 A;  1AUC A;  2H8L A;  2OE3 A;  2XBI A;  2GQL A;  3ME8 A;  4DSS A;  5IMZ A;  2HZF A;  3HJM A;  2YNX A;  1ZYP A;  4KCA A;  1U3A A;  5L71 A;  3QMX A;  2JAD A;  2DML A;  2QSI A;  2P31 A;  5J3R A;  1V98 A;  3ZRE A;  1F3A A;  3IC8 A;  1V40 A;  2FNO A;  5IMF A;  4JE1 A;  2B5E A;  4X0X A;  3C1R A;  3CSH A;  4O5R A;  4HI7 A;  1YEP A;  4PNF A;  5ECK B;  5ECM B;  2XC2 A;  3LW9 A;  1OAZ A;  1G7E A;  1M3I A;  1K0A A;  4MZB A;  1PQN A;  2R0P A;  2B1K A;  3KXO A;  3G7J A;  1SEN A;  4K5R A;  1X9M B;  4LLR A;  1EZK A;  4FYC A;  1GSD A;  3MYD A;  1AAZ A;  3H1N A;  3QAW A;  4XHM A;  2XBQ A;  3IRA A;  4Z2T A;  2LUS A;  3EWL A;  5JWQ B;  1F37 A;  3CYN A;  5ECN B;  2FCH A;  4XTS A;  2UZ8 A;  5ECO B;  2C0D A;  4TN8 A;  3PIN A;  5ECQ B;  6GSW A;  4MCU A;  2B7K A;  2GLR A;  1TDI A;  3HYP A;  2IJY A;  3FR9 A;  5LNK e;  3LXT A;  1BYE A;  4V2M A;  5IM9 A;  1T1V A;  2FHE A;  1K0C A;  1V9W A;  4OCF A;  4WF4 A;  3TJF A;  1SD8 A;  1QMV A;  3TRP A;  2B1L A;  3IAM 2;  19GS A;  4X4J A;  5CNW A;  2R4V A;  3UOM A;  5HQP A;  3FHK A;  5D9X A;  2HRA A;  5IMA A;  2ZCT A;  3F0I A;  1A2L A;  2C8U A;  2GS3 A;  4KA0 A;  4KGI A;  2LQQ A;  3ZFL A;  4K2D A;  3BJ5 A;  1YEX A;  1Z5Y E;  2OJL A;  2X8C A;  3DVX A;  4WEY A;  2BJX A;  1J9B A;  4L0U A;  5EL8 A;  5B8B A;  2F51 A;  3H8Q A;  1KEB A;  2I9H A;  3GYK A;  5F05 A;  1AW9 A;  1FW1 A;  2FA8 A;  5JCG A;  2HLS A;  4F2I A;  3CSI A;  2X8G A;  1Q4J A;  2HSM A;  4G0L A;  2IME A;  1M2D A;  1K3Y A;  3UVH A;  1A8Y A;  4HZ4 A;  4IJ3 A;  2ON5 A;  3GUS A;  3WYW A;  3GIX A;  2GDR A;  2GQM A;  1GNW A;  11GS A;  1SKR B;  2YWO A;  2WCI A;  1CQG A;  5J4U A;  2C3T A;  2JZT A;  2VLT A;  3ZML A;  3G9B A;  1ZYQ B;  3ZVJ A;  1ON4 A;  1GTA A;  2DSA A;  3IV4 A;  2DKH A;  4E8E A;  1G0T A;  1YJ6 A;  1GUK A;  13GS A;  2VD0 A;  1KTE A;  1FVK A;  2H76 A;  1T4Y A;  2PMT A;  4IS0 A;  1E6B A;  3TJK A;  1XWK A;  1HQO A;  3WGE A;  1A23 A;  3MSZ A;  2VLU A;  2NBS A;  3CMI A;  3C71 A;  4MK3 A;  1ZZY A;  2X64 A;  1K0D A;  4FIW A;  2DJ3 A;  4NWY A;  3BOA A;  4PX1 A;  3F4S A;  3IK7 A;  1X5C A;  5GZZ B;  5CYY A;  2GZP A;  2L5O A;  1W89 A;  1SK1 A;  4ZIJ A;  2CA8 A;  3ERG A;  1MD4 A;  3RHC A;  2MMN A;  3IA1 A;  6GSX A;  2H75 A;  1GLQ A;  1C72 A;  4D73 A;  3HA9 A;  2ZNM A;  3L0H A;  3MDK A;  4ZIL A;  3GTU B;  1TTZ A;  2F9S A;  3C7M A;  5F06 A;  3TDG A;  3F3Q A;  3ISO A;  3FW2 A;  5D96 A;  4JZQ A;  4MLY A;  2CAQ A;  2MMA A;  1OC9 A;  2TRX A;  2RII A;  4K2X A;  1U3I A;  2HYX A;  3LWA A;  3UBK A;  2EC4 A;  3HZ8 A;  4TKY A;  4ZL9 A;  3QDN A;  2PVO C;  3A3T A;  3NZN A;  4YQM A;  1FOH A;  4XRA A;  1X9W B;  3QOU A;  5DJL A;  2I4A A;  2AUV A;  2L4Q A;  5JCW A;  4LA1 A;  3TKQ A;  4PGT A;  1QUW A;  4F0B A;  1UC7 A;  2ZUP A;  3GFK A;  1MEK A;  2X49 A;  4JRR A;  1JLV A;  1O7U A;  4DEJ A;  2LRT A;  2VAF A;  2PN8 A;  2DKI A;  3VLN A;  4I2U A;  1QK8 A;  3GMF A;  3I69 A;  4TW5 A;  4TVE A;  14GS A;  3TJJ A;  2O89 A;  5D8I A;  4IW9 A;  2QA2 A;  4Q5N A;  3ZVJ D;  3ZIT A;  3VWV A;  1RQM A;  4EF0 A;  2IFQ B;  2WRT A;  1K0M A;  5JCU A;  3C1S A;  2A4H A;  2R37 A;  5D9T A;  2H66 A;  2C0G A;  3P90 A;  4GF0 A;  4Q5Q A;  3HY2 A;  1EV4 A;  1M2A A;  3J7Y k;  3DEX A;  4MZC A;  2GTU A;  1XOB A;  2ON7 A;  3GST A;  3RPP A;  5H5S A;  9GSS A;  1QFN A;  3TKR A;  3H79 A;  1NHO A;  4GRF A;  1EWX A;  4V2N A;  5CRH A;  5ENU A;  5CRD A;  1J08 A;  2O8V B;  1WP0 A;  2IPA A;  4AJ6 A;  3DRN A;  4NHW A;  2VCV A;  5C00 A;  4DSQ A;  3D22 A;  2R5G A;  2GST A;  5ECL B;  3RBT A;  5D9V A;  4MP4 A;  5DCH A;  3VK9 A;  1GSU A;  1G6W A;  4I97 A;  1UN2 A;  3FZ9 A;  16GS A;  5KOX A;  1QGV A;  2M80 A;  2OBI A;  3UIW A;  4I5Q A;  4CHS A;  3IXR A;  2FA4 A;  5G1K A;  3GL3 A;  2MYG A;  5BRT A;  1BED A;  4I6X A;  4V2L A;  4BA7 A;  2VL3 A;  3CTG A;  5LD0 A;  4O5Q A;  5ECR B;  2P0G A;  4FQU A;  4BL7 B;  4PTS A;  4ZL7 A;  5AIV A;  4RQX A;  1DE1 A;  2VCX A;  5J9B A;  4ML1 A;  1AXD A;  2IL3 A;  1ZOF A;  2YAN A;  2V32 A;  2X8H A;  4PQ1 A;  4GCI A;  2OE1 A;  1O85 A;  5DCG A;  4Q5F A;  1PFO A;  3CQF A;  2PBJ A;  5GAP D;  2OAC A;  4J57 E;  1SL0 B;  2GVP A;  2YV9 A;  5KN0 A;  3A2V A;  3BCI A;  5GST A;  4PUA A;  3DML A;  4G9H A;  1SJI A;  3FY7 A;  1PD2 1;  4CDO A;  1ERW A;  3E9J B;  3KP9 A;  3W6G A;  1Z9H A;  1U87 A;  4O32 A;  2HZE A;  4YKG A;  1MD3 A;  20GS A;  5G2Z A;  3J7Y b;  3UVT A;  1TK0 B;  1R7H A;  3Q6O A;  2H72 A;  4K7O A;  1J0F A;  2GSQ A;  2RUE A;  5D9W A;  4LL4 B;  3HVV A;  1DUG A;  4K7I A;  2CX3 A;  4TR3 A;  3TKS A;  1OE8 A;  2LJK A;  2REM A;  2VCT A;  4ISD A;  1A24 A;  2L57 A;  1F3B A;  2K18 A;  4TR0 A;  4WF5 A;  3IK9 A;  1A8L A;  3ZL5 A;  5ABR A;  4KB3 A;  3F3R A;  2C0E A;  1YQ1 A;  4KDU A;  4DVC A;  5HR1 A;  4BWS A;  3ERF A;  2JU5 A;  4ID0 A;  1VF1 A;  1HYU A;  1XW5 A;  4BVY A;  3RPN A;  3EU4 A;  4FO5 A;  1PKW A;  5EY6 A;  2GZY A;  4XS4 A;  1XWB A;  2NDO A;  5IO2 A;  1O73 A;  3L78 A;  3VI5 A;  2XPE A;  4K0G A;  4TR4 A;  2WUL A;  4X43 A;  4IHU A;  2WFC A;  4ZB8 A;  5DAK A;  4K9Z A;  3GRX A;  2K8S A;  3IC4 A;  6GSU A;  4KF9 A;  2JZS A;  3LG6 A;  4MPG A;  3FMW A;  1I9D A;  5AGY A;  3DXB A;  2JZR A;  3UEM A;  3VWX A;  5KEJ A;  1YY7 A;  3KIJ A;  1XXU A;  1K0O A;  2HXK A;  1TOF A;  4L8E A;  4NPB A;  4YQV A;  1GSQ A;  1TU7 A;  5C04 A;  1FHE A;  4WBR D;  1EOG A;  3D5J A;  1HNC A;  3SWL A;  4RI6 A;  2H70 A;  2CAI A;  5ECI B;  4ZXG A;  4TXO B;  2LS5 A;  4I8B A;  3M9J A;  3WT1 A;  5IOX A;  5HR3 A;  2IMD A;  4IP6 A;  5E4W A;  3UJ1 A;  2PPT A;  2JSY A;  2HT9 A;  2O85 A;  4LL1 B;  1B9X C;  3ME7 A;  3RAZ A;  5ID2 A;  4TOP A;  5HR0 A;  1RW1 A;  5DJM A;  1XPV A;  1B4P A;  1Y25 A;  3L9U A;  3W8J A;  4GWR A;  3MNG A;  4HU9 A;  3G7I A;  1BAY A;  4KUN A;  2R3X A;  3F9U A;  1PSQ A;  2CV4 A;  4HEA 2;  2AHE A;  3L4N A;  3EMX A;  3HVS A;  2H1B A;  1M0U A;  3UAP A;  5A4W A;  3A2W A;  1BQ7 A;  2R0C A;  1BX9 A;  3DYR A;  5G30 A;  3UAR A;  3QPM A;  1SD9 A;  4L5L A;  2DIY A;  4KE3 A;  1LBK A;  5CRG A;  1OKT A;  5H5Q A;  4BVX B;  3ZRD A;  3KH7 A;  1GLP A;  1XZO A;  3M1G A;  4N0V A;  2PWJ A;  1ZL9 A;  1N8J A;  4BIK A;  4IBP A;  3TCO A;  1YF0 A;  5FT3 A;  3FZA A;  2IMI A;  3I9V 2;  4MF6 A;  2YJ7 A;  1X9S B;  4V1A p;  1K3L A;  1R5P A;  1K0B A;  3WGD A;  2DJ1 A;  3UBL A;  2ALB A;  2I81 A;  1SKW B;  4MMM A;  3VFI A;  4KSO A;  2PGT A;  3APS A;  2VCQ A;  3QFB C;  5EVO A;  4EXJ A;  2DJ0 A;  3GSS A;  3LXZ A;  2JSZ A;  2VLV A;  1SL2 B;  1GSS A;  4JBB A;  3HVX A;  5J9C A;  1B9Y C;  3PGT A;  3ERW A;  2C1Y A;  1B4Q A;  4MJC A;  4ZB9 A;  2CZ2 A;  4G0I A;  5DDL A;  4TXV A;  3KCM A;  1JHB A;  3WGX A;  4ZBD A;  3PR8 A;  1SKS B;  1FAA A;  4F03 A;  2A2S A;  3CSJ A;  4HZ2 A;  5GAN D;  4Q5R A;  4MNN A;  4MDC A;  4WR4 A;  5KN3 A;  3TB2 A;  1PL1 A;  1SYX A;  3F4T A;  2H1A A;  4N30 A;  2K6V A;  4LMV A;  3VI7 A;  1AQV A;  4MF5 A;  2HRF A;  2YCD A;  2BTO T;  3ZLP A;  1USB A;  5G5E A;  1ERU A;  2QKE A;  1YZX A;  4MZW A;  4CW9 A;  3IE3 A;  4GSS A;  4ZBA A;  2R6K A;  1K0N A;  1NHY A;  3EYT A;  5B6N A;  3IR4 A;  1GUH A;  1EP7 A;  1XFL A;  2LEG A;  3ZYW A;  5F07 A;  3IOS A;  2YWM A;  1LU4 A;  2LV3 A;  4O7H A;  3CXG A;  3VWU A;  1XWA A;  1F9M A;  1VF4 A;  3KJY A;  2FD3 A;  4JR6 A;  4F82 A;  1WIK A;  3HXS A;  3P7X A;  5AIS A;  3GNJ A;  3LGC A;  3QD9 A;  2I3Y A;  2NTO A;  3GA4 A;  12GS A;  2H74 A;  5D73 A;  3EC3 A;  2CT6 A;  3F6D A;  1DSB A;  1MDI A;  1YDK A;  1ZMA A;  2PU9 C;  1SK0 A;  4QQ7 A;  2KP1 A;  4A5P A;  5B7C A;  2B3S A;  5A5K A;  2AYT A;  5CAX A;  1AQW A;  2YV7 A;  2EIQ A;  1WOU A;  4QL9 A;  2YWI A;  1TI1 A;  1GTI A;  3Q74 A;  1PL2 A;  3DKS A;  2EIO A;  3A2X A;  2R2J A;  2E7P A;  2VM1 A;  1O6J A;  2N5A A;  4OFN A;  1VF2 A;  2FWG A;  1K3O A;  4NHZ A;  5IQY A;  3M8N A;  2FGX A;  1BG5 A;  2VD1 A;  3F63 A;  2MMZ A;  2VL9 A;  3ZIV A;  4USS A;  2DJK A;  1WJK A;  5CP1 A;  2VIM A;  1AQX A;  1WPI A;  1SJZ A;  1ABA A;  3ED3 A;  1TKD B;  2OAD A;  1GH2 A;  2CVK A;  2H1G A;  2KP2 A;  4TR1 B;  4BWQ A;  4KCE A;  1E2Y A;  1XIY A;  1TRS A;  1HD2 A;  3CBU A;  2QC7 A;  3FEU A;  1TRV A;  2LNT A;  3OR5 A;  4G2E A;  2GSS A;  2HRN A;  3QR6 A;  3F4R A;  17GS A;  3ZFB A;  1F6M C;  1GTB A;  1EEJ A;  1GUM A;  1HNB A;  1SL1 B;  1THO A;  3SBC A;  1ILO A;  2FWF A;  4KSM A;  8GSS A;  1IYH A;  4POK A;  2L6C A;  1UVZ A;  5DAL B;  3GKK A;  2KLX A;  4V1A g;  4K0N A;  3ZTL A;  1FB6 A;  1GWC A;  4N10 A;  1BJX A;  1T00 A;  1PGT A;  4P3Y B;  2LNS A;  1GRX A;  3LSZ A;  1PMT A;  2DJ2 A;  3GTU A;  4K5S A;  3LEF A;  3FZ5 A;  2L59 A;  3GKN A;  2K8V A;  5HFK A;  2LKU A;  5HFG A;  5FWG A;  1S3R A;  3M9K A;  2QA1 A;  2AAW A;  4CY6 A;  5F8B A;  3TOT A;  3EPT A;  2FWH A;  3EE2 A;  2VM2 A;  3FK8 A;  3FRC A;  1DE2 A;  1A0R P;  2YP6 A;  3HZ4 A;  2G2Q A;  1THX A;  4YH2 A;  2MBT A;  5CO3 A;  4HQS A;  4GSN A;  2IWT A;  1AC1 A;  2WZ9 A;  5ECS A;  1SK2 A;  1B48 A;  4N0Z A;  2FLS A;  1O8W A;  4I2T A;  2GSR A;  1XBS A;  1PX7 A;  4OO4 A;  4KDY A;  3WD6 A;  5KN1 A;  4EIP A;  4XS6 A;  2GQK A;  2GGT A;  2K9F A;  3DIE A;  4L5O A;  2XPD A;  5IPH A;  3RHB A;  3GH6 A;  4PXO A;  3Q18 A;  4IP1 A;  4DSS B;  4HQZ A;  1SU9 A;  4ECB A;  3DGQ A;  1VGL A;  3R3E A;  1R26 A;  3TRX A;  1JZW A;  2IFQ A;  4ICY A;  2RM5 A;  5H5R A;  4BPY A;  5ECP B;  4J56 E;  3KMO A;  2L5L A;  6GSS A;  2GZZ A;  1T3B A;  2Z9S A;  2OA7 A;  4EL1 A;  3D6I A;  1OC8 A;  2A2R A;  4G0K A;  4ULX A;  1TW9 A;  1O81 A;  4POL A;  3S9F A;  3EIN A;  4MJB A;  2IMF A;  3ZZX A;  2EIR A;  1ZCP A;  4EE0 A;  5ECH B;  4KH7 A;  1W4V A;  3VPQ A;  2F8A A;  1PX6 A;  3LFL A;  2LRC A;  5J41 A;  3HDC A;  1V57 A;  2DBC A;  1TK8 B;  2OE0 A;  3GH9 A;  1XW6 A;  4ECI A;  5COH A;  2DIZ A;  2RLI A;  4EVM A;  10GS A;  5DQS A;  1Z6M A;  2HFD A;  2IIY A;  1XWC A;  4ACS A;  2E2M A;  2H71 A;  3O6T A;  2C3Q A;  1X5D A;  1G6Y A;  4WXT A;  1T8E B;  4H86 A;  4POB A;  2YZU A;  1WMJ A;  2LST A;  3U5R E;  4WBJ A;  1TRU A;  5G5F A;  3RDW A;  4NV2 A;  1JZD A;  1OYJ A;  3BD2 A;  1XVQ A;  4K1F A;  3U6V A;  3KGK A;  1GSE A;  2YOI A;  3L9V A;  4IJI A;  1H4O A;  2CZ3 A;  2J23 A;  1FVJ A;  3FR3 A;  1XOA A;  3VWW A;  1O8X A;  3HD5 A;  4BL7 A;  3UL3 A;  2P5R A;  2F8F A;  1R5A A;  1X5E A;  4XCS A;  3O76 A;  1PA3 A;  1ACV A;  5HR2 A;  4JU5 A;  3APQ A;  1GTU A;  3L9S A;  4MH2 A;  1EEM A;  3TUE A;  5LCZ A;  2DMM A;  4OMV A;  2LJR A;  1OVN A;  1WRY A;  5FHI A;  2B6M A;  5IIZ A;  4G19 A;  1QXH A;  3HHV A;  3LOR A;  2H1D A;  2X4A A;  3GN3 A;  3HKR A;  1N2A A;  3E0U A;  4AF2 A;  2C0F A;  1AIU A;  4OO5 A;  3MAK A;  3A5W A;  6GSY A;  4HJ2 A;  3APO A;  4MH3 A;  1IYI A;  4PUR A;  2V41 A;  2LJA A;  3VUR A;  1Q98 A;  2B7J A;  3PH9 A;  4RUV A;  4MF7 A;  4K6X A;  4Z2R A;  2PER A;  2HNL A;  2GT5 A;  1YKC A;  4HUA A;  4ZBB A;  2CVB A;  3EUR A;  3IBH A;  1JZR A;  3KP8 A;  2M72 A;  3IDV A;  1ERT A;  1CQH A;  5JWO B;  1A2M A;  1H75 A;  1GNE A;  2RUF A;  3A5I A;  5G1L A;  3O3T A;  2M46 A;  5B6M A;  4XRD A;  4EIQ A;  2H30 A;  3HJO A;  1NSW A;  2H73 A;  3KEB A;  5IOW A;  3V1W A;  1JZO A;  3EVI A;  4IQ1 A;  1XCC A;  4YQU A;  1NM3 A;  2OKA A;  5INY A;  4YKF A;  5ELA A;  1ZGN A;  2WS2 A;  2KUC A;  2NVL A;  4YAV A;  3LJR A;  4MJE A;  4JED A;  3TGZ A; 
#chains in the Genus database with same CATH homology
 2C4J A;  4D73 B;  4O5U A;  5G31 A;  3IAS 2;  3DD3 A;  4FYB A;  4ML6 A;  1M2B A;  2VCW A;  2L4C A;  2NPB A;  3TKS E;  1PN9 A;  1Z3E A;  2D2Z A;  5IMC A;  4WET A;  2L6D A;  3FZ4 A;  4O92 A;  2X99 A;  3KTL A;  1HNA A;  1OC9 B;  3FYG A;  4ECJ A;  2V2G A;  1PRX A;  3M0F A;  3IHQ A;  1ST9 A;  1VRS D;  2FWE A;  1MTC A;  4XS1 A;  4QL7 A;  2H6Y A;  5HFI A;  4PUF C;  3GHA A;  4EKZ A;  1NW2 A;  1TI3 A;  1A2J A;  4DSR A;  3UMA A;  1JLW A;  5IO0 A;  5KN2 A;  1F2E A;  3TKP A;  2IMK A;  4EC0 A;  3C73 A;  3I6A A;  2BMX A;  4GQF A;  4TXO A;  1Y6E A;  1PKZ A;  1UA5 A;  2WB9 A;  3KTB A;  3IHG A;  1OKD A;  2YPM A;  3TJB A;  3DVW A;  3FR6 A;  4ZL8 A;  4KAE A;  4JR4 A;  1MDJ A;  4GXZ A;  2H6Z A;  4HDE A;  4K8M A;  1U6T A;  3GX8 A;  3R2Q A;  3C8E A;  4F0C A;  2A2P A;  1PN0 A;  2PVQ A;  1S3C A;  1EGR A;  5IMV A;  4HJM A;  2H01 A;  3VPT A;  4FYU A;  3I43 A;  3GX0 A;  4IVF A;  3TRQ A;  1TXX A;  4KX4 A;  2E0Q A;  3GL5 A;  3IPZ A;  4BVX A;  4N11 A;  1V2A A;  2FY6 A;  2LRN A;  3FKF A;  1WWJ A;  4Z7X A;  5DBQ A;  2HSH A;  4FH8 A;  4HU7 A;  1V58 A;  2YJH A;  4XIH A;  2G0F A;  4IQA A;  2H0G A;  2R0G A;  3LYK A;  1M7T A;  4IKH A;  3NOF A;  5BMU A;  2H6X A;  4GLT A;  2WGR A;  4CY8 A;  2TRC P;  3P8W A;  3GUR A;  1DBY A;  3MIX A;  4X1U A;  3QCP A;  2VCZ A;  2JAC A;  2GT6 A;  4G10 A;  5J5N A;  4HOJ A;  2KHP A;  5E59 A;  2MMO A;  2AJQ B;  3QAG A;  3QAV A;  1T4Z A;  1URM A;  1U88 A;  1A0F A;  2I1U A;  2CX4 A;  2V1M A;  3NIV A;  4LMW A;  1ZYE A;  1M9B A;  2YN1 A;  1KNG A;  2CQ9 A;  1TJD A;  2VUP A;  1VF3 A;  1M99 A;  3Q19 A;  4ILF A;  1X0R A;  4NMU A;  4WKW A;  1QQ2 A;  2XHF A;  3AY8 A;  1GP1 A;  1Z7R A;  4EO3 A;  3LQ7 A;  6GSV A;  5JWR B;  1WE0 A;  3KMN A;  4TRX A;  4WR5 A;  2HE3 A;  3CRU A;  1Z7P A;  2CVD A;  2DJJ A;  1EOH A;  3H4K A;  4K7N A;  3LYP A;  1B8X A;  18GS A;  4OD7 A;  3E3E A;  1FO5 A;  3P2A A;  5B8A A;  3F6F A;  1G7O A;  3KZQ A;  3HCZ A;  2YZH A;  2FUG 2;  3D21 A;  2YWN A;  5GSS A;  3HJP A;  2HZE B;  3BCK A;  3H93 A;  1S3D A;  2O7K A;  1T7P B;  3EMP A;  3GKM A;  4PQI A;  2H0I A;  1JFU A;  5IPG A;  2KOK A;  2ES7 A;  4AGS A;  1SJ6 A;  1MDK A;  2P5Q A;  4IN0 A;  5AIX A;  2WJU A;  4POM A;  5A4U A;  1FB0 A;  2O87 A;  4IEL A;  4ZB6 A;  5KOW A;  2H0H A;  4PQH A;  4IGJ A;  3JCM L;  2HI7 A;  1ZYN A;  4KDX A;  4NAX A;  4L0W A;  1XVW A;  2WDU A;  6GST A;  5DQY A;  4EDY A;  2H19 A;  1YF1 A;  4F9Z A;  1S3A A;  4NXI A;  2A4V A;  5CRE A;  4BVY B;  2LQO A;  1XWG A;  3G7Y A;  4KND A;  4GST A;  1KBN A;  4XS4 B;  1RK4 A;  4E8H A;  7GSS A;  4YAP A;  2DC5 A;  1GL8 A;  2C3N A;  1ML6 A;  2J9H A;  1YKA A;  5D93 A;  4NV5 A;  4TR1 A;  2QGV A;  4OWY A;  3ZMK A;  3K8N A;  4Z2U A;  2LTK A;  1GSF A;  1LJR A;  1GUL A;  5DAK B;  2B5X A;  4J2F A;  3BBY A;  3GKX A;  3KH9 A;  4EUY A;  4MAB A;  3TKS C;  4RI7 A;  2E2G A;  3US3 A;  3CRT A;  3D4T A;  2AB6 A;  2MZC A;  4ECC A;  1SYR A;  1M9A A;  1EGO A;  3M3M A;  4OCE A;  2N5F A;  5F0G A;  3W8S A;  2B5Y A;  22GS A;  5DAL A;  1GSY A;  4GQC A;  1XW9 A;  2JL4 A;  4KW6 A;  4AJ8 A;  1I5G A;  3EU3 A;  2VL2 C;  5DVB A;  3DWV A;  2V6O A;  1OC3 A;  2OBK A;  3N9J A;  2MBS A;  2VOC A;  5AN1 A;  1TU8 A;  3PPU A;  2N5B A;  2RM6 A;  3KD0 A;  5EPF A;  3F8U A;  4AJ7 A;  2PUK C;  2VO4 A;  5ID2 B;  2DLX A;  3QFA C;  3ZIJ A;  2F3M A;  1EP8 A;  2AV4 A;  1OE7 A;  2IN3 A;  1TRW A;  2TIR A;  3CTF A;  4MA9 A;  1Z6N A;  4GTU A;  4OFM A;  3D4M A;  1R4W A;  3GV1 A;  3MWH A;  1FG4 A;  4OFT A;  3TJG A;  5ELG A;  4EDZ A;  4MJA A;  5IMD A;  3D0Z A;  2HRK A;  3WT2 A;  1EV9 A;  3KM6 A;  3TOU A;  2C80 A;  2V6K A;  4PNG A;  5A4V A;  1FOV A;  1ERV A;  1TP9 A;  2VL2 A;  1TK5 B;  4RQR A;  4MPF A;  2HSY A;  5CRW A;  3N5O A;  4HS1 A;  1AUC A;  2H8L A;  2OE3 A;  2XBI A;  2GQL A;  3ME8 A;  4DSS A;  5IMZ A;  2HZF A;  3HJM A;  2YNX A;  1ZYP A;  4KCA A;  1U3A A;  5L71 A;  3QMX A;  2JAD A;  2DML A;  2QSI A;  2P31 A;  5J3R A;  1V98 A;  3ZRE A;  1F3A A;  3IC8 A;  1V40 A;  2FNO A;  5IMF A;  4JE1 A;  2B5E A;  4X0X A;  3C1R A;  3CSH A;  4O5R A;  4HI7 A;  1YEP A;  4PNF A;  5ECK B;  5ECM B;  2XC2 A;  3LW9 A;  1OAZ A;  1G7E A;  1K0A A;  4MZB A;  1PQN A;  2R0P A;  2B1K A;  3KXO A;  3G7J A;  1SEN A;  4K5R A;  1X9M B;  4LLR A;  1EZK A;  4FYC A;  1GSD A;  3MYD A;  1AAZ A;  3H1N A;  3QAW A;  4XHM A;  2XBQ A;  3IRA A;  4Z2T A;  2LUS A;  3EWL A;  5JWQ B;  1F37 A;  3CYN A;  5ECN B;  2FCH A;  4XTS A;  2UZ8 A;  5ECO B;  2C0D A;  4TN8 A;  3PIN A;  5ECQ B;  6GSW A;  4MCU A;  2B7K A;  2GLR A;  1TDI A;  3HYP A;  2IJY A;  3FR9 A;  5LNK e;  3LXT A;  1BYE A;  4V2M A;  5IM9 A;  1T1V A;  2FHE A;  1K0C A;  1V9W A;  4OCF A;  4WF4 A;  3TJF A;  1SD8 A;  1QMV A;  3TRP A;  2B1L A;  3IAM 2;  19GS A;  4X4J A;  5CNW A;  2R4V A;  3UOM A;  5HQP A;  3FHK A;  5D9X A;  2HRA A;  5IMA A;  2ZCT A;  3F0I A;  1A2L A;  2C8U A;  2GS3 A;  4KA0 A;  4KGI A;  2LQQ A;  3ZFL A;  4K2D A;  3BJ5 A;  1YEX A;  1Z5Y E;  2OJL A;  2X8C A;  3DVX A;  4WEY A;  2BJX A;  1J9B A;  4L0U A;  5EL8 A;  5B8B A;  2F51 A;  3H8Q A;  1KEB A;  2I9H A;  3GYK A;  5F05 A;  1AW9 A;  1FW1 A;  2FA8 A;  5JCG A;  2HLS A;  4F2I A;  3CSI A;  2X8G A;  1Q4J A;  2HSM A;  4G0L A;  2IME A;  1M2D A;  1K3Y A;  3UVH A;  1A8Y A;  4HZ4 A;  4IJ3 A;  2ON5 A;  3GUS A;  3WYW A;  3GIX A;  2GDR A;  2GQM A;  1GNW A;  11GS A;  1SKR B;  2YWO A;  2WCI A;  1CQG A;  5J4U A;  2C3T A;  2JZT A;  2VLT A;  3ZML A;  3G9B A;  1ZYQ B;  3ZVJ A;  1ON4 A;  1GTA A;  2DSA A;  3IV4 A;  2DKH A;  4E8E A;  1G0T A;  1YJ6 A;  1GUK A;  13GS A;  2VD0 A;  1KTE A;  1FVK A;  2H76 A;  1T4Y A;  2PMT A;  4IS0 A;  1E6B A;  3TJK A;  1XWK A;  1HQO A;  3WGE A;  1A23 A;  3MSZ A;  2VLU A;  2NBS A;  3CMI A;  3C71 A;  4MK3 A;  1ZZY A;  2X64 A;  1K0D A;  4FIW A;  2DJ3 A;  4NWY A;  3BOA A;  4PX1 A;  3F4S A;  3IK7 A;  1X5C A;  5GZZ B;  5CYY A;  2GZP A;  2L5O A;  1W89 A;  1SK1 A;  4ZIJ A;  2CA8 A;  3ERG A;  1MD4 A;  3RHC A;  2MMN A;  3IA1 A;  6GSX A;  2H75 A;  1GLQ A;  1C72 A;  4D73 A;  3HA9 A;  2ZNM A;  3L0H A;  3MDK A;  4ZIL A;  3GTU B;  1TTZ A;  2F9S A;  3C7M A;  5F06 A;  3TDG A;  3F3Q A;  3ISO A;  3FW2 A;  5D96 A;  4JZQ A;  4MLY A;  2CAQ A;  2MMA A;  1OC9 A;  2TRX A;  2RII A;  4K2X A;  1U3I A;  2HYX A;  3LWA A;  3UBK A;  2EC4 A;  3HZ8 A;  4TKY A;  4ZL9 A;  3QDN A;  2PVO C;  3A3T A;  3NZN A;  4YQM A;  1FOH A;  4XRA A;  1X9W B;  3QOU A;  5DJL A;  2I4A A;  2AUV A;  2L4Q A;  5JCW A;  4LA1 A;  3TKQ A;  4PGT A;  1QUW A;  4F0B A;  1UC7 A;  2ZUP A;  3GFK A;  1MEK A;  2X49 A;  4JRR A;  1JLV A;  1O7U A;  4DEJ A;  2LRT A;  2VAF A;  2PN8 A;  2DKI A;  3VLN A;  4I2U A;  1QK8 A;  3GMF A;  3I69 A;  4TW5 A;  4TVE A;  14GS A;  3TJJ A;  2O89 A;  5D8I A;  4IW9 A;  2QA2 A;  4Q5N A;  3ZVJ D;  3ZIT A;  3VWV A;  1RQM A;  4EF0 A;  2IFQ B;  2WRT A;  1K0M A;  5JCU A;  3C1S A;  2A4H A;  2R37 A;  5D9T A;  2H66 A;  2C0G A;  3P90 A;  4GF0 A;  4Q5Q A;  3HY2 A;  1EV4 A;  1M2A A;  3J7Y k;  3DEX A;  4MZC A;  2GTU A;  1XOB A;  2ON7 A;  3GST A;  3RPP A;  5H5S A;  9GSS A;  1QFN A;  3TKR A;  3H79 A;  1NHO A;  4GRF A;  1EWX A;  4V2N A;  5CRH A;  5ENU A;  5CRD A;  1J08 A;  2O8V B;  1WP0 A;  2IPA A;  4AJ6 A;  3DRN A;  4NHW A;  2VCV A;  5C00 A;  4DSQ A;  3D22 A;  2R5G A;  2GST A;  5ECL B;  3RBT A;  5D9V A;  4MP4 A;  5DCH A;  3VK9 A;  1GSU A;  1G6W A;  4I97 A;  1UN2 A;  3FZ9 A;  16GS A;  5KOX A;  1QGV A;  2M80 A;  2OBI A;  3UIW A;  4I5Q A;  4CHS A;  3IXR A;  2FA4 A;  5G1K A;  3GL3 A;  2MYG A;  5BRT A;  1BED A;  4I6X A;  4V2L A;  4BA7 A;  2VL3 A;  3CTG A;  5LD0 A;  4O5Q A;  5ECR B;  2P0G A;  4FQU A;  4BL7 B;  4PTS A;  4ZL7 A;  5AIV A;  4RQX A;  1DE1 A;  2VCX A;  5J9B A;  4ML1 A;  1AXD A;  2IL3 A;  1ZOF A;  2YAN A;  2V32 A;  2X8H A;  4PQ1 A;  4GCI A;  2OE1 A;  1O85 A;  5DCG A;  4Q5F A;  2PBJ A;  5GAP D;  2OAC A;  4J57 E;  1SL0 B;  2GVP A;  2YV9 A;  5KN0 A;  3A2V A;  3BCI A;  5GST A;  4PUA A;  3DML A;  4G9H A;  1SJI A;  3FY7 A;  1PD2 1;  4CDO A;  1ERW A;  3E9J B;  3KP9 A;  3W6G A;  1Z9H A;  1U87 A;  4O32 A;  2HZE A;  4YKG A;  1MD3 A;  20GS A;  5G2Z A;  3J7Y b;  3UVT A;  1TK0 B;  1R7H A;  3Q6O A;  2H72 A;  4K7O A;  1J0F A;  2GSQ A;  2RUE A;  5D9W A;  4LL4 B;  3HVV A;  1DUG A;  4K7I A;  2CX3 A;  4TR3 A;  3TKS A;  1OE8 A;  2LJK A;  2REM A;  2VCT A;  4ISD A;  1A24 A;  2L57 A;  1F3B A;  2K18 A;  4TR0 A;  4WF5 A;  3IK9 A;  1A8L A;  3ZL5 A;  5ABR A;  4KB3 A;  3F3R A;  2C0E A;  1YQ1 A;  4KDU A;  4DVC A;  5HR1 A;  4BWS A;  3ERF A;  2JU5 A;  4ID0 A;  1VF1 A;  1HYU A;  1XW5 A;  4BVY A;  3RPN A;  3EU4 A;  4FO5 A;  1PKW A;  5EY6 A;  2GZY A;  4XS4 A;  1XWB A;  2NDO A;  5IO2 A;  1O73 A;  3L78 A;  3VI5 A;  2XPE A;  4K0G A;  4TR4 A;  2WUL A;  4X43 A;  4IHU A;  2WFC A;  4ZB8 A;  5DAK A;  4K9Z A;  3GRX A;  2K8S A;  3IC4 A;  6GSU A;  4KF9 A;  2JZS A;  3LG6 A;  4MPG A;  3FMW A;  1I9D A;  5AGY A;  3DXB A;  2JZR A;  3UEM A;  3VWX A;  5KEJ A;  1YY7 A;  3KIJ A;  1XXU A;  1K0O A;  2HXK A;  1TOF A;  4L8E A;  4NPB A;  4YQV A;  1GSQ A;  1TU7 A;  5C04 A;  1FHE A;  4WBR D;  1EOG A;  3D5J A;  1HNC A;  3SWL A;  4RI6 A;  2H70 A;  2CAI A;  5ECI B;  4ZXG A;  4TXO B;  2LS5 A;  4I8B A;  3M9J A;  3WT1 A;  5IOX A;  5HR3 A;  2IMD A;  4IP6 A;  5E4W A;  3UJ1 A;  2PPT A;  2JSY A;  2HT9 A;  2O85 A;  4LL1 B;  1B9X C;  3ME7 A;  3RAZ A;  5ID2 A;  4TOP A;  5HR0 A;  1RW1 A;  5DJM A;  1XPV A;  1B4P A;  1Y25 A;  3L9U A;  3W8J A;  4GWR A;  3MNG A;  4HU9 A;  3G7I A;  1BAY A;  4KUN A;  2R3X A;  3F9U A;  1PSQ A;  2CV4 A;  4HEA 2;  2AHE A;  3L4N A;  3EMX A;  3HVS A;  2H1B A;  1M0U A;  3UAP A;  5A4W A;  3A2W A;  1BQ7 A;  2R0C A;  1BX9 A;  3DYR A;  5G30 A;  3UAR A;  3QPM A;  1SD9 A;  4L5L A;  2DIY A;  4KE3 A;  1LBK A;  5CRG A;  1OKT A;  5H5Q A;  4BVX B;  3ZRD A;  3KH7 A;  1GLP A;  1XZO A;  3M1G A;  4N0V A;  2PWJ A;  1ZL9 A;  1N8J A;  4IBP A;  3TCO A;  1YF0 A;  5FT3 A;  3FZA A;  2IMI A;  3I9V 2;  4MF6 A;  2YJ7 A;  1X9S B;  4V1A p;  1K3L A;  1R5P A;  1K0B A;  3WGD A;  2DJ1 A;  3UBL A;  2ALB A;  2I81 A;  1SKW B;  4MMM A;  3VFI A;  4KSO A;  2PGT A;  3APS A;  2VCQ A;  3QFB C;  5EVO A;  4EXJ A;  2DJ0 A;  3GSS A;  3LXZ A;  2JSZ A;  2VLV A;  1SL2 B;  1GSS A;  4JBB A;  3HVX A;  5J9C A;  1B9Y C;  3PGT A;  3ERW A;  2C1Y A;  1B4Q A;  4MJC A;  4ZB9 A;  2CZ2 A;  4G0I A;  5DDL A;  4TXV A;  3KCM A;  1JHB A;  3WGX A;  4ZBD A;  3PR8 A;  1SKS B;  1FAA A;  4F03 A;  2A2S A;  3CSJ A;  4HZ2 A;  5GAN D;  4Q5R A;  4MNN A;  4MDC A;  4WR4 A;  5KN3 A;  3TB2 A;  1PL1 A;  1SYX A;  3F4T A;  2H1A A;  4N30 A;  2K6V A;  4LMV A;  3VI7 A;  1AQV A;  4MF5 A;  2HRF A;  2YCD A;  2BTO T;  3ZLP A;  1USB A;  5G5E A;  1ERU A;  2QKE A;  1YZX A;  4MZW A;  4CW9 A;  3IE3 A;  4GSS A;  4ZBA A;  2R6K A;  1K0N A;  1NHY A;  3EYT A;  5B6N A;  3IR4 A;  1GUH A;  1EP7 A;  1XFL A;  2LEG A;  3ZYW A;  5F07 A;  3IOS A;  2YWM A;  1LU4 A;  2LV3 A;  4O7H A;  3CXG A;  3VWU A;  1XWA A;  1F9M A;  1VF4 A;  3KJY A;  2FD3 A;  4JR6 A;  4F82 A;  1WIK A;  3HXS A;  3P7X A;  5AIS A;  3GNJ A;  3LGC A;  3QD9 A;  2I3Y A;  2NTO A;  3GA4 A;  12GS A;  2H74 A;  5D73 A;  3EC3 A;  2CT6 A;  3F6D A;  1DSB A;  1MDI A;  1YDK A;  1ZMA A;  2PU9 C;  1SK0 A;  4QQ7 A;  2KP1 A;  4A5P A;  5B7C A;  2B3S A;  5A5K A;  2AYT A;  5CAX A;  1AQW A;  2YV7 A;  2EIQ A;  1WOU A;  4QL9 A;  2YWI A;  1TI1 A;  1GTI A;  3Q74 A;  1PL2 A;  3DKS A;  2EIO A;  3A2X A;  2R2J A;  2E7P A;  2VM1 A;  1O6J A;  2N5A A;  4OFN A;  1VF2 A;  2FWG A;  1K3O A;  4NHZ A;  5IQY A;  3M8N A;  2FGX A;  1BG5 A;  2VD1 A;  3F63 A;  2MMZ A;  2VL9 A;  3ZIV A;  4USS A;  2DJK A;  1WJK A;  5CP1 A;  2VIM A;  1AQX A;  1WPI A;  1SJZ A;  1ABA A;  3ED3 A;  1TKD B;  2OAD A;  1GH2 A;  2CVK A;  2H1G A;  2KP2 A;  4TR1 B;  4BWQ A;  4KCE A;  1E2Y A;  1XIY A;  1TRS A;  1HD2 A;  3CBU A;  2QC7 A;  3FEU A;  1TRV A;  2LNT A;  3OR5 A;  4G2E A;  2GSS A;  2HRN A;  3QR6 A;  3F4R A;  17GS A;  3ZFB A;  1F6M C;  1GTB A;  1EEJ A;  1GUM A;  1HNB A;  1SL1 B;  1THO A;  3SBC A;  1ILO A;  2FWF A;  4KSM A;  8GSS A;  1IYH A;  4POK A;  2L6C A;  1UVZ A;  5DAL B;  3GKK A;  2KLX A;  4V1A g;  4K0N A;  3ZTL A;  1FB6 A;  1GWC A;  4N10 A;  1BJX A;  1T00 A;  1PGT A;  4P3Y B;  2LNS A;  1GRX A;  3LSZ A;  1PMT A;  2DJ2 A;  3GTU A;  4K5S A;  3LEF A;  3FZ5 A;  2L59 A;  3GKN A;  2K8V A;  5HFK A;  2LKU A;  5HFG A;  5FWG A;  3M9K A;  2QA1 A;  2AAW A;  4CY6 A;  5F8B A;  3TOT A;  3EPT A;  2FWH A;  3EE2 A;  2VM2 A;  3FK8 A;  3FRC A;  1DE2 A;  1A0R P;  2YP6 A;  3HZ4 A;  2G2Q A;  1THX A;  4YH2 A;  2MBT A;  5CO3 A;  4HQS A;  4GSN A;  2IWT A;  1AC1 A;  2WZ9 A;  5ECS A;  1SK2 A;  1B48 A;  4N0Z A;  2FLS A;  1O8W A;  4I2T A;  2GSR A;  1XBS A;  1PX7 A;  4OO4 A;  4KDY A;  3WD6 A;  5KN1 A;  4EIP A;  4XS6 A;  2GQK A;  2GGT A;  2K9F A;  3DIE A;  4L5O A;  2XPD A;  5IPH A;  3RHB A;  3GH6 A;  4PXO A;  3Q18 A;  4IP1 A;  4DSS B;  4HQZ A;  1SU9 A;  4ECB A;  3DGQ A;  1VGL A;  3R3E A;  1R26 A;  3TRX A;  1JZW A;  2IFQ A;  4ICY A;  2RM5 A;  5H5R A;  4BPY A;  5ECP B;  4J56 E;  3KMO A;  2L5L A;  6GSS A;  2GZZ A;  1T3B A;  2Z9S A;  2OA7 A;  4EL1 A;  3D6I A;  1OC8 A;  2A2R A;  4G0K A;  4ULX A;  1TW9 A;  1O81 A;  4POL A;  3S9F A;  3EIN A;  4MJB A;  2IMF A;  3ZZX A;  2EIR A;  1ZCP A;  4EE0 A;  5ECH B;  4KH7 A;  1W4V A;  3VPQ A;  2F8A A;  1PX6 A;  3LFL A;  2LRC A;  5J41 A;  3HDC A;  1V57 A;  2DBC A;  1TK8 B;  2OE0 A;  3GH9 A;  1XW6 A;  4ECI A;  5COH A;  2DIZ A;  2RLI A;  4EVM A;  10GS A;  5DQS A;  1Z6M A;  2HFD A;  2IIY A;  1XWC A;  4ACS A;  2E2M A;  2H71 A;  3O6T A;  2C3Q A;  1X5D A;  1G6Y A;  4WXT A;  1T8E B;  4H86 A;  4POB A;  2YZU A;  1WMJ A;  2LST A;  3U5R E;  4WBJ A;  1TRU A;  5G5F A;  3RDW A;  4NV2 A;  1JZD A;  1OYJ A;  3BD2 A;  1XVQ A;  4K1F A;  3U6V A;  3KGK A;  1GSE A;  2YOI A;  3L9V A;  4IJI A;  1H4O A;  2CZ3 A;  2J23 A;  1FVJ A;  3FR3 A;  1XOA A;  3VWW A;  1O8X A;  3HD5 A;  4BL7 A;  3UL3 A;  2P5R A;  2F8F A;  1R5A A;  1X5E A;  4XCS A;  3O76 A;  1PA3 A;  1ACV A;  5HR2 A;  4JU5 A;  3APQ A;  1GTU A;  3L9S A;  4MH2 A;  1EEM A;  3TUE A;  5LCZ A;  2DMM A;  4OMV A;  2LJR A;  1OVN A;  1WRY A;  5FHI A;  2B6M A;  5IIZ A;  4G19 A;  1QXH A;  3HHV A;  3LOR A;  2H1D A;  2X4A A;  3GN3 A;  3HKR A;  1N2A A;  3E0U A;  4AF2 A;  2C0F A;  1AIU A;  4OO5 A;  3MAK A;  3A5W A;  6GSY A;  4HJ2 A;  3APO A;  4MH3 A;  1IYI A;  4PUR A;  2V41 A;  2LJA A;  3VUR A;  1Q98 A;  2B7J A;  3PH9 A;  4RUV A;  4MF7 A;  4K6X A;  4Z2R A;  2PER A;  2HNL A;  2GT5 A;  1YKC A;  4HUA A;  4ZBB A;  2CVB A;  3EUR A;  3IBH A;  1JZR A;  3KP8 A;  2M72 A;  3IDV A;  1ERT A;  1CQH A;  5JWO B;  1A2M A;  1H75 A;  1GNE A;  2RUF A;  3A5I A;  5G1L A;  3O3T A;  2M46 A;  5B6M A;  4XRD A;  4EIQ A;  2H30 A;  3HJO A;  1NSW A;  2H73 A;  3KEB A;  5IOW A;  3V1W A;  1JZO A;  3EVI A;  4IQ1 A;  1XCC A;  4YQU A;  1NM3 A;  2OKA A;  5INY A;  4YKF A;  5ELA A;  1ZGN A;  2WS2 A;  2KUC A;  2NVL A;  4YAV A;  3LJR A;  4MJE A;  4JED A;  3TGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...