1V98A

Crystal structure analysis of thioredoxin from thermus thermophilus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
92
Chain Sequence
GAPLTLVDFFAPWCGPCRLVSPILEELARDHAGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGASPRRVLEERLRPYLEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords thioredoxin
publication title Crystallographic Analysis of Thioredoxin from the Thermophilic Bacteria Thermus thermophilus
rcsb
source organism Thermus thermophilus
total genus 23
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1v98A00
1QMVA 3BCKA 4NAXA 3UAPA 4ECBA 3M3MA 1SL2B 2PPTA 4WF5A 3FZAA 5J5NA 2KUCA 5ECRB 1M99A 3ZREA 3GTUB 5HFIA 5G5FA 4HOJA 1OC8A 1GUKA 2E7PA 3N9JA 2C0GA 2OKAA 2DMMA 3HVSA 2H8LA 2HRFA 2GSQA 3GNJA 5IM9A 4XIHA 2EIRA 4J56E 5KEJA 3APOA 3ZFBA 3F6DA 3CRTA 4AJ7A 4Q5NA 3ZFLA 3IR4A 3TKPA 3EE2A 3IC4A 4I5QA 5ECLB 1YY7A 1XPVA 1YQ1A 3CSJA 3FYGA 4GWRA 4NXIA 2ZNMA 4OWYA 2GT5A 1YF0A 5G1KA 2YWMA 3UEMA 1Z7PA 3SBCA 4ECIA 3EU3A 4EDZA 1JZDA 4ILFA 1U88A 2O7KA 4O5RA 1NSWA 4ECJA 3QOUA 4YAVA 1XXUA 4K7NA 3QAWA 4TOPA 4WF4A 2EIOA 4L0UA 1T3BA 1FAAA 3LORA 1Z6MA 2IJYA 1E2YA 2HT9A 3IA1A 3DGQA 2I1UA 5IIZA 2OE0A 3GRXA 3IK9A 3VWVA 4KDXA 3GHAA 3ZITA 4F0BA 3ZIJA 2H1BA 5IOWA 3TJBA 3P90A 2NTOA 3EYTA 3VLNA 4HS1A 5AISA 4DSQA 3TOTA 2MYGA 1J0FA 3GA4A 3H79A 3ZYWA 1TU7A 2GVPA 3L9SA 3QPMA 4GRFA 3QDNA 5CRWA 1SD9A 1WOUA 3MAKA 1GNEA 1HQOA 5A4VA 1ZL9A 1K0AA 2N5FA 2P31A 2ON7A 3ZZXA 2I81A 3G7JA 1ERTA 2H6ZA 3LSZA 1PGTA 2NPBA 1CQGA 2YWOA 1K0BA 1R5AA 2TRXA 4JBBA 3FR6A 4AGSA 2H6YA 3DYRA 5DALA 3E9JB 1OC3A 3HVXA 1JZRA 4PNFA 1BAYA 5EY6A 3TJJA 4KSMA 3HVVA 4IJ3A 1YEXA 2OE3A 1OE7A 2OACA 4JRRA 1PX6A 4MF6A 1JLWA 3L78A 3HXSA 4L0WA 3KM6A 4H86A 5E4WA 4RQRA 1EGOA 3PH9A 2YZUA 4GF0A 4MA9A 2VCXA 3G9BA 1Q4JA 4E8EA 4I97A 3V1WA 1SENA 1TRVA 1DSBA 4FO5A 5F0GA 3ISOA 3UJ1A 1HD2A 2MMNA 1EV9A 4MJAA 5ECPB 4JE1A 4Q5FA 4CW9A 2GTUA 3ME7A 1NM3A 3A2VA 3DXBA 2DIZA 2G0FA 4LL4B 2DJ1A 2FLSA 1K0DA 3TGZA 2FUG2 5ENUA 3FHKA 2R4VA 2HZEA 4HQZA 3QCPA 3GL3A 4WEYA 5JCWA 3KEBA 5ECIB 1ON4A 3EC3A 1M9BA 1W89A 1TW9A 2VO4A 4GLTA 5COHA 5CO3A 3MDKA 4TXOA 5JWQB 3WD6A 1TI3A 2F8AA 4HZ2A 5GSTA 5KN3A 2GSSA 4OFTA 3GYKA 2C3TA 1V2AA 4I8BA 2GSTA 3UARA 3AY8A 2L5LA 4EE0A 1W4VA 3RBTA 3TRPA 1B9YC 4YQUA 1X5CA 5DJLA 3ZVJD 4KCEA 2JZTA 4NPBA 4PUAA 1O8XA 1TK0B 4XS6A 2GZPA 2LNTA 2LKUA 2BMXA 2PN8A 4E8HA 4IP6A 5A4WA 2GZZA 4GTUA 3QFAC 5HFKA 4BA7A 4RI6A 3FZ4A 1JFUA 5HQPA 2B1KA 2MBTA 2VLVA 4PURA 3UMAA 1F3AA 1B4QA 4XRDA 4PQHA 3TB2A 3HJMA 1NHYA 1T8EB 3HJPA 1ZZYA 1OC9B 3FR3A 2VM1A 4OD7A 4PQIA 2PERA 1THXA 2I3YA 4WXTA 5CRGA 4X0XA 5J3RA 5B8BA 3UVHA 5D73A 4IHUA 3O6TA 4MPFA 2DLXA 1TRWA 1X9SB 2ZCTA 2VLUA 1XWGA 2P5RA 4N11A 4F9ZA 3BJ5A 5HR2A 4WKWA 4KA0A 1F6MC 3KD0A 5JCGA 3EINA 6GSUA 2RLIA 4JR6A 3C7MA 4FYUA 2V6OA 2M46A 2MMOA 2H19A 2O8VB 2WGRA 2LEGA 1AC1A 2QSIA 2Z9SA 13GSA 4KGIA 5HR3A 6GSYA 1AQVA 2H0HA 2L59A 4PXOA 5GAPD 5JWRB 4TW5A 1ZOFA 1SYRA 2L57A 3M1GA 2KHPA 4EKZA 1GSYA 3TRXA 4RI7A 1QUWA 4XS4B 2FY6A 1YDKA 16GSA 5H5RA 1QK8A 1EOHA 4K7IA 1MEKA 2C0DA 2FHEA 2CVDA 2TIRA 2YANA 4GSTA 3I9V2 2MMAA 3CMIA 1X5DA 3F3RA 4KUNA 1TK8B 3GURA 3IAM2 1F9MA 2HI7A 3GN3A 4DSRA 3IHQA 1JHBA 3EVIA 2LUSA 1GTUA 1KEBA 1GSDA 4NMUA 1XIYA 5E59A 2A4VA 2IMFA 5D93A 3WYWA 1GUHA 1U6TA 5DCGA 1SU9A 4WBJA 2E2GA 1FVJA 3ZL5A 2CA8A 1H75A 1XWCA 1Z5YE 4K0NA 5IO0A 2HZFA 5C04A 2B7KA 2XBQA 3UIWA 14GSA 3GKXA 2H70A 1PKZA 4N0VA 2JU5A 4ZB9A 2REMA 4IQAA 2F3MA 4GQFA 4TR1B 4IW9A 2R5GA 3D4MA 5G31A 3ZRDA 1ERVA 1M7TA 2DJ2A 2WJUA 1J08A 4Q5RA 4YQVA 1TDIA 1X0RA 3D0ZA 4KDYA 3ERFA 1SKWB 2GT6A 3CXGA 2CVBA 4AJ8A 1ZYEA 3F8UA 2F8FA 1O81A 3WT2A 4ZBBA 4K9ZA 4GSNA 5HR1A 3WT1A 2NBSA 5DQYA 3DD3A 4KH7A 5CNWA 3RHBA 4EF0A 4TVEA 3KGKA 3TKRA 1KBNA 5HFGA 3IV4A 2P5QA 1A2LA 1B9XC 3DRNA 3Q6OA 3KZQA 5EPFA 4K1FA 1AUCA 1THOA 4FIWA 2C8UA 2B6MA 4MJBA 5DVBA 4ACSA 18GSA 1EP7A 4MJCA 2HFDA 5KN2A 1G6YA 2OADA 2TRCP 4PNGA 2GQKA 3GTUA 3H4KA 4TR0A 5ID2B 1SKSB 2E0QA 4F82A 4V2LA 1TRSA 2C0FA 2VAFA 3DWVA 1TP9A 2JZRA 3QMXA 4F2IA 4MH2A 5ID2A 2DJKA 3HJOA 1I9DA 4XCSA 3GUSA 3ZLPA 2GS3A 2V1MA 3A5WA 4EL1A 2JZSA 4ML6A 1V98A 1O8WA 2YN1A 3TKQA 5FT3A 2YJ7A 2GDRA 2JACA 2C1YA 4O7HA 3KTLA 4XTSA 4TKYA 2H72A 1SJ6A 5AIVA 5D9TA 2AYTA 2YWNA 5L71A 1K3OA 3WGDA 3D5JA 1PL1A 4XRAA 4ZL7A 4YH2A 1SKRB 3L4NA 5F07A 5IMFA 2CX4A 1Q98A 5FHIA 2WFCA 2N5AA 2I9HA 2M80A 1UA5A 2O85A 3GX8A 2PVOC 1T4ZA 5DQSA 2K8VA 1Z3EA 2QKEA 4N0ZA 2AJQB 1GSQA 3VWUA 3FZ5A 5ABRA 1SL0B 2B5EA 3H8QA 5ECQB 1S3AA 3K8NA 2L6DA 2GSRA 2X64A 3O3TA 3KH9A 5DAKB 1VRSD 3D22A 3ED3A 3QAVA 4IQ1A 3VWWA 5HR0A 5DAKA 1OAZA 1OKDA 5INYA 2WRTA 2YJHA 4ZBAA 2LRTA 4BPYA 3M8NA 1MD4A 5A4UA 3GSSA 3M0FA 3BD2A 1GNWA 3F0IA 4JEDA 1JZOA 2MMZA 4MP4A 4DEJA 1DE2A 3CYNA 1DBYA 3EU4A 4JZQA 3J7Yk 2CZ3A 1HNAA 3LG6A 1EOGA 1V40A 3A3TA 4KAEA 1URMA 4P3YB 1WJKA 5G2ZA 1WIKA 1C72A 3RPNA 2FWGA 2LV3A 4O92A 2OBIA 1AW9A 2LJKA 5CP1A 4TR3A 4HU9A 3VFIA 4IS0A 3BOAA 5ELAA 4OCEA 4OFMA 1BEDA 1GP1A 1YKAA 1ST9A 1MD3A 1HYUA 3DVWA 1T7PB 2VCZA 3EURA 1O7UA 4BWQA 1Y6EA 1R7HA 17GSA 2IIYA 2FGXA 2LQOA 3VI5A 2PGTA 3F4RA 2JSYA 2X99A 1PX7A 5ECMB 1O73A 5J41A 3IK7A 1SJIA 4IGJA 3HDCA 5JCUA 1FB6A 5CYYA 1EWXA 3R2QA 3LJRA 1GRXA 3IDVA 5A5KA 2DJ0A 3TJGA 1O85A 1R4WA 1QXHA 3LYKA 3IRAA 2CAQA 1SYXA 3IOSA 3Q74A 4K2DA 2X8GA 4RQXA 2YZHA 5H5SA 1GLQA 1YKCA 1YZXA 1M9AA 3PR8A 2HLSA 5GAND 2RIIA 4OCFA 8GSSA 1NW2A 1GSSA 4TR4A 2X8CA 4HZ4A 3HD5A 4POKA 4N10A 3KP9A 2FA4A 2F9SA 5CAXA 2VL2A 4OO5A 2V2GA 1K0CA 5IMCA 5C00A 1BJXA 3DKSA 4I2UA 4DVCA 4JU5A 4IN0A 1MTCA 1OKTA 2XPDA 1TKDB 2R37A 3Q18A 1MDKA 4TXVA 2LNSA 1PKWA 4G10A 7GSSA 3H1NA 2R6KA 4YQMA 2DIYA 1FVKA 4ZBDA 1YF1A 2CX3A 4ML1A 5B8AA 3LYPA 1OC9A 4LL1B 1TRUA 1GH2A 1R26A 1T4YA 4L5OA 4V1Ap 3GIXA 4EO3A 3KMOA 1X9MB 2XHFA 2WB9A 3GL5A 1F37A 1A8LA 1U87A 1AQWA 2R2JA 3RDWA 3L9UA 2I4AA 2LQQA 1B8XA 5GZZB 3Q19A 5J9BA 4NHZA 2HSHA 2EC4A 1G7EA 3GKNA 3JCML 3UOMA 2R3XA 1XCCA 3EMPA 2YV9A 2FWFA 4LLRA 1FG4A 5F06A 1A8YA 1S3CA 2LJRA 4ZB8A 5GSSA 4MDCA 5DCHA 1X5EA 4WR5A 2OBKA 3LGCA 2V32A 2DJ3A 3RAZA 3US3A 2WDUA 4V2MA 3HKRA 3TCOA 4POLA 2PUKC 2JADA 2H66A 1B4PA 1BG5A 4X1UA 3SWLA 2VCVA 3HZ4A 2VL9A 4KCAA 4F03A 1T1VA 4ZL8A 2H75A 9GSSA 4HEA2 3GMFA 3L9VA 3P7XA 4QL9A 4XS4A 3CRUA 5B7CA 1M2AA 3HYPA 3CTGA 2EIQA 1A0RP 1XVQA 3GKKA 4OO4A 4RUVA 3ZMLA 3W6GA 3NIVA 4K6XA 5ELGA 6GSTA 1EP8A 3CBUA 4OMVA 4EUYA 4I6XA 1AQXA 1UC7A 2K9FA 1XVWA 2OE1A 4WR4A 2DJJA 2LSTA 1V57A 2KP2A 3UVTA 5D8IA 3C8EA 2OJLA 2K18A 3E3EA 4HU7A 5IMDA 2AB6A 1CQHA 2YWIA 1V58A 3PGTA 4O32A 4JR4A 3U5RE 1EV4A 5EL8A 1A2MA 2C80A 1XW9A 1OYJA 1HNBA 5DBQA 2IFQB 2WZ9A 4HJ2A 5LNKe 3M9KA 3FKFA 3KIJA 4TR1A 3D4TA 1F3BA 1XOAA 1K3LA 3C71A 4ID0A 1RW1A 2GZYA 2IFQA 1R5PA 4V1Ag 1NHOA 5IPHA 2BTOT 5G30A 1ACVA 4GSSA 2CQ9A 3HHVA 4IKHA 4EC0A 3LWAA 3MNGA 1DUGA 3D21A 4F0CA 2AV4A 1PRXA 1ILOA 4MF7A 3LXTA 4G2EA 2NDOA 2GGTA 4MZBA 2PWJA 2A2SA 1EZKA 1XZOA 3G7YA 3EMXA 4TN8A 5F05A 1ERUA 3IE3A 5IMZA 2QC7A 1G6WA 4LMWA 2YOIA 3APSA 4MZWA 3P2AA 4KB3A 4N30A 3OR5A 5ECSA 1YEPA 4NV5A 5J4UA 4IJIA 2H1DA 1J9BA 3C1RA 2VOCA 2FD3A 1GSUA 3W8SA 5D9XA 1YJ6A 3A2WA 5CRHA 1U3IA 1SD8A 2VL3A 1FW1A 3VI7A 2LRCA 4MABA 3HCZA 1SK2A 2KLXA 3FEUA 1UVZA 1PA3A 2O87A 4Z7XA 2YPMA 3BCIA 2H1AA 3QAGA 4GQCA 1GLPA 4QQ7A 5AIXA 2VL2C 5B6MA 1WRYA 2CZ2A 2WULA 5H5QA 2KP1A 1V9WA 4AF2A 1ZMAA 3C73A 2RUFA 3KJYA 2E2MA 1TOFA 2CAIA 2F51A 3CSHA 4BL7A 3F9UA 3VURA 1WWJA 4KSOA 2H6XA 4NHWA 2RM6A 4NV2A 1AIUA 1Y25A 3WGEA 5KN0A 2C0EA 4FYBA 1GULA 6GSSA 2ON5A 1OE8A 3HZ8A 2IMEA 2HRNA 1DE1A 1I5GA 5J9CA 3RPPA 1ABAA 2J9HA 4HDEA 1XW5A 3FR9A 4CHSA 4IELA 1K0OA 4KX4A 4ISDA 3F4TA 2YCDA 1Z7RA 3QD9A 2H01A 1IYIA 1K0MA 3TKSA 3TJFA 3KMNA 4ZB6A 4MK3A 1PSQA 3I69A 4OFNA 4MMMA 3F4SA 1VF3A 1XW6A 1TU8A 2XC2A 1SJZA 4MLYA 2VCQA 4HJMA 1QGVA 4ECCA 2VLTA 1F2EA 2PBJA 1PMTA 5DALB 4MF5A 3QR6A 5EVOA 3MWHA 4I2TA 3KXOA 3I6AA 1Z9HA 2B5XA 2DMLA 2A2RA 4HUAA 2L5OA 2L4QA 1JZWA 4NWYA 2QGVA 1AXDA 2GQMA 1G7OA 4K8MA 11GSA 3KCMA 4CDOA 1N2AA 5G1LA 1PQNA 1XWKA 2VD0A 1VGLA 3GH9A 2N5BA 2JSZA 1PL2A 3S9FA 4X43A 1A2JA 3IBHA 4ZILA 3TKSE 5G5EA 2B5YA 1IYHA 3VWXA 4K7OA 5KN1A 2PU9C 4EXJA 1LBKA 2BJXA 3PINA 1A0FA 1KNGA 3F3QA 1BX9A 4ZIJA 5ECKB 1PN9A 10GSA 3KH7A 3HA9A 2L6CA 1GSEA 3IPZA 3A2XA 1GWCA 1K0NA 2FNOA 2HYXA 1X9WB 2VUPA 1JLVA 2D2ZA 2HZEB 1EEJA 2GQLA 4PX1A 3ME8A 3KTBA 3L0HA 3ZTLA 1GTBA 1MDJA 3TDGA 2K8SA 4BVXA 5FWGA 3FRCA 1G0TA 2VIMA 4MPGA 4TXOB 3LQ7A 1TJDA 1GTIA 3DMLA 2ZUPA 5IMVA 5ECNB 3TUEA 2P0GA 3M9JA 2IWTA 1ERWA 3ZMKA 3GKMA 5AGYA 5CREA 2YV7A 3E0UA 1XBSA 2B3SA 4HQSA 1MDIA 5AN1A 1FHEA 12GSA 3DVXA 2WCIA 1XFLA 4KE3A 4ZXGA 2AHEA 4POBA 2L4CA 4PGTA 3NOFA 2PMTA 2H74A 2XPEA 4Q5QA 3N5OA 4J57E 4KDUA 1FOVA 3GFKA 3CSIA 2O89A 1XWAA 19GSA 4GCIA 3HY2A 4IP1A 1OVNA 3GSTA 3DEXA 5B6NA 2HE3A 1LU4A 4WBRD 4TRXA 2IMDA 3LFLA 2JL4A 2H0GA 2C4JA 2IN3A 3D6IA 2DC5A 1M2DA 2K6VA 4IVFA 4FH8A 2H30A 1VF1A 3KP8A 2VCTA 2CV4A 1ZCPA 1WMJA 1SL1B 1VF2A 1FB0A 3G7IA 4IBPA 4YAPA 2XBIA 4LA1A 5JWOB 1TI1A 2PVQA 2ALBA 3APQA 3BBYA 2AUVA 3ZVJA 4XHMA 2HXKA 2LS5A 2H1GA 1QQ2A 4J2FA 3UBKA 5DJMA 2G2QA 4EDYA 2YNXA 2IPAA 1ZGNA 4DSSB 4D73B 4BWSA 1EEMA 3FW2A 2HSYA 20GSA 3IAS2 1SK0A 2H0IA 3ZIVA 5DDLA 4DSSA 1SK1A 2VCWA 3NZNA 2OA7A 4D73A 4EVMA 2DBCA 3CTFA 2VD1A 2DSAA 1TXXA 3GV1A 3F63A 4KW6A 2KOKA 1TTZA 4G19A 3J7Yb 4PUFC 3UL3A 5IQYA 2MZCA 3LXZA 1E6BA 1B48A 3IXRA 2M72A 1PD21 1WE0A 3H93A 1WP0A 5IOXA 3TOUA 5IMAA 1GL8A 5D96A 4V2NA 2X8HA 4GXZA 1VF4A 2RUEA 4MZCA 3TKSC 1LJRA 1BQ7A 5IPGA 5F8BA 2FWHA 3FY7A 5D9WA 3ERWA 3VPQA 4L8EA 1UN2A 4WETA 1ZYQB 3WGXA 2GLRA 3GH6A 2VM2A 22GSA 1GTAA 2RM5A 1TK5B 4AJ6A 2CT6A 5CRDA 4KNDA 2LJAA 1BYEA 1HNCA 3ERGA 2LRNA 2H73A 3FZ9A 2B1LA 6GSWA 2WS2A 5ECHB 4G9HA 1USBA 2FCHA 3O76A 2V41A 3VK9A 4QL7A 1QFNA 2B7JA 4ZL9A 1GSFA 1EGRA 1S3DA 2IL3A 2V6KA 4HI7A 4PQ1A 3I43A 4MJEA 4POMA 6GSVA 1WPIA 1A23A 2FA8A 4ULXA 1RQMA 4XS1A 3TRQA 2MBSA 1M0UA 2H76A 4L5LA 1XOBA 5ECOB 2H71A 1O6JA 3LEFA 2NVLA 5D9VA 1AAZA 2IMIA 1K3YA 2C3QA 1XWBA 2LTKA 1GUMA 4MCUA 1M2BA 3UBLA 3F6FA 3EWLA 1U3AA 3DIEA 3RHCA 4BVYA 1N8JA 5IO2A 4MH3A 3P8WA 5LCZA 2CVKA 3TJKA 1KTEA 1RK4A 2J23A 4LMVA 5LD0A 3W8JA 4K0GA 1FO5A 2HNLA 3C1SA 1T00A 1A24A 3U6VA 2ES7A 3GX0A 2C3NA 2AAWA 2YP6A 3MSZA 1Z6NA 2FWEA 1H4OA 4FYCA 1ML6A 2IMKA 3FK8A 6GSXA 3VPTA 3QFBC
chains in the Genus database with same CATH superfamily
1QMVA 3BCKA 4NAXA 3UAPA 4ECBA 3M3MA 1SL2B 2PPTA 4WF5A 3FZAA 5J5NA 2KUCA 5ECRB 1M99A 3ZREA 3GTUB 5HFIA 5G5FA 4HOJA 1OC8A 1GUKA 2E7PA 3N9JA 2C0GA 2OKAA 2DMMA 3HVSA 2H8LA 2HRFA 2GSQA 3GNJA 5IM9A 4XIHA 2EIRA 4J56E 5KEJA 3APOA 3ZFBA 3F6DA 3CRTA 4AJ7A 4Q5NA 3ZFLA 3IR4A 3TKPA 3EE2A 3IC4A 4I5QA 5ECLB 1YY7A 1XPVA 1YQ1A 3CSJA 3FYGA 4GWRA 4NXIA 2ZNMA 4OWYA 2GT5A 1YF0A 5G1KA 2YWMA 3UEMA 1Z7PA 3SBCA 4ECIA 3EU3A 4EDZA 1JZDA 4ILFA 1U88A 2O7KA 4O5RA 1NSWA 4ECJA 3QOUA 4YAVA 1XXUA 4K7NA 3QAWA 4TOPA 4WF4A 2EIOA 4L0UA 1T3BA 1FAAA 3LORA 1Z6MA 2IJYA 1E2YA 2HT9A 4Z2RA 3IA1A 3DGQA 2I1UA 5IIZA 2OE0A 3GRXA 3IK9A 3VWVA 4KDXA 3GHAA 3ZITA 5KOXA 4F0BA 3ZIJA 2H1BA 5IOWA 3TJBA 3P90A 1FOHA 2NTOA 3EYTA 3VLNA 4HS1A 5AISA 4DSQA 3TOTA 2MYGA 1J0FA 3GA4A 3H79A 3ZYWA 1TU7A 2GVPA 3L9SA 3QPMA 4GRFA 3QDNA 5CRWA 1SD9A 1WOUA 3MAKA 1GNEA 1HQOA 5A4VA 1ZL9A 1K0AA 2N5FA 2P31A 4G0LA 2ON7A 3ZZXA 2I81A 3G7JA 1ERTA 2H6ZA 3LSZA 1PGTA 2NPBA 1CQGA 2YWOA 1K0BA 1R5AA 2TRXA 4JBBA 3FR6A 4AGSA 2H6YA 3DYRA 5DALA 3E9JB 1OC3A 3HVXA 1JZRA 4PNFA 1BAYA 5EY6A 3TJJA 4KSMA 3HVVA 4IJ3A 1YEXA 2OE3A 1OE7A 2OACA 4JRRA 1PX6A 4MF6A 1JLWA 3L78A 3HXSA 4L0WA 3KM6A 2DKHA 4H86A 5E4WA 4RQRA 1EGOA 3PH9A 2YZUA 4GF0A 4MA9A 2VCXA 3G9BA 1Q4JA 4E8EA 4I97A 3V1WA 1SENA 1TRVA 1DSBA 4FO5A 5F0GA 3ISOA 3UJ1A 1HD2A 2MMNA 2X4AA 1EV9A 4MJAA 5ECPB 4JE1A 4Q5FA 4CW9A 2GTUA 3ME7A 1NM3A 3A2VA 3DXBA 2DIZA 2G0FA 4LL4B 2DJ1A 2FLSA 1K0DA 3TGZA 2FUG2 5ENUA 3FHKA 2R4VA 2HZEA 4HQZA 3QCPA 3GL3A 4K5SA 4WEYA 5JCWA 3KEBA 5ECIB 1ON4A 3EC3A 1M9BA 1W89A 1TW9A 2VO4A 4GLTA 5COHA 5CO3A 3MDKA 4TXOA 5JWQB 3WD6A 1TI3A 2F8AA 4HZ2A 5GSTA 5KN3A 2GSSA 4OFTA 3GYKA 2A2PA 2C3TA 1V2AA 4I8BA 2GSTA 3UARA 3AY8A 2L5LA 4EE0A 1W4VA 3RBTA 3TRPA 1B9YC 4YQUA 1X5CA 5DJLA 3ZVJD 4KCEA 2JZTA 4NPBA 4PUAA 1O8XA 1TK0B 4XS6A 2GZPA 2LNTA 2LKUA 2BMXA 2PN8A 4E8HA 4IP6A 5A4WA 2GZZA 3HVNA 4GTUA 3QFAC 5HFKA 4BA7A 4RI6A 1XG8A 3FZ4A 1JFUA 5HQPA 2B1KA 2MBTA 2VLVA 4PURA 3UMAA 1F3AA 1B4QA 4XRDA 4PQHA 3TB2A 3HJMA 1NHYA 1T8EB 3HJPA 1ZZYA 1OC9B 3FR3A 2VM1A 4OD7A 4PQIA 2PERA 4Z2TA 1THXA 2I3YA 4WXTA 5CRGA 4X0XA 5J3RA 3MIXA 5B8BA 3UVHA 5D73A 4IHUA 3O6TA 4MPFA 2DLXA 1TRWA 1X9SB 2ZCTA 2VLUA 1XWGA 2P5RA 4N11A 4F9ZA 3BJ5A 5HR2A 4WKWA 4KA0A 1F6MC 3KD0A 1ZYNA 5JCGA 3EINA 6GSUA 2RLIA 4JR6A 3C7MA 4FYUA 2V6OA 2M46A 2MMOA 2H19A 2O8VB 2WGRA 2LEGA 1AC1A 2QSIA 2Z9SA 13GSA 4FQUA 4KGIA 5HR3A 6GSYA 1AQVA 2H0HA 2L59A 4PXOA 5GAPD 5JWRB 4TW5A 1ZOFA 1M3JA 1SYRA 2HRAA 2L57A 3M1GA 2KHPA 4EKZA 1GSYA 3TRXA 4RI7A 1QUWA 4XS4B 2FY6A 1YDKA 16GSA 5H5RA 1QK8A 1EOHA 4K7IA 1MEKA 2C0DA 2FHEA 2CVDA 2TIRA 2YANA 4GSTA 3I9V2 5BRTA 2MMAA 3CMIA 1X5DA 3F3RA 4KUNA 1TK8B 3GURA 3IAM2 1F9MA 2HI7A 3GN3A 4DSRA 3IHQA 1JHBA 3EVIA 2LUSA 1GTUA 1KEBA 1GSDA 4NMUA 2R0CA 1XIYA 5E59A 2A4VA 2IMFA 5D93A 3WYWA 1GUHA 1U6TA 5DCGA 1SU9A 4WBJA 2A4HA 2E2GA 1FVJA 3ZL5A 2CA8A 1H75A 1XWCA 1Z5YE 4K0NA 5IO0A 2HZFA 5C04A 2B7KA 2XBQA 3UIWA 14GSA 3GKXA 2H70A 1PKZA 4N0VA 2JU5A 4ZB9A 2REMA 4IQAA 2F3MA 4GQFA 4TR1B 4IW9A 2R5GA 3D4MA 5G31A 3ZRDA 1ERVA 1M7TA 4YKFA 2DJ2A 2WJUA 1J08A 4Q5RA 4YQVA 4HSCX 1TDIA 1X0RA 3D0ZA 4KDYA 3ERFA 1SKWB 2GT6A 3CXGA 2CVBA 4AJ8A 1ZYEA 3F8UA 2F8FA 1O81A 3WT2A 4ZBBA 4K9ZA 4GSNA 5HR1A 3WT1A 2NBSA 5DQYA 3DD3A 4KH7A 5CNWA 3RHBA 4EF0A 4TVEA 3KGKA 3TKRA 1KBNA 5HFGA 3IV4A 2P5QA 1A2LA 1B9XC 3DRNA 3Q6OA 3KZQA 5EPFA 4K1FA 1AUCA 1THOA 4FIWA 2C8UA 3CQFA 2B6MA 4MJBA 5DVBA 4ACSA 18GSA 1EP7A 4MJCA 2HFDA 4EIQA 5KN2A 1G6YA 2OADA 2TRCP 4PNGA 2GQKA 3GTUA 3H4KA 4TR0A 5ID2B 1SKSB 2E0QA 4F82A 4V2LA 1TRSA 2C0FA 2VAFA 3DWVA 1TP9A 2JZRA 3QMXA 4F2IA 4MH2A 5ID2A 2DJKA 3HJOA 1I9DA 4XCSA 3GUSA 3IHGA 2GS3A 3ZLPA 2V1MA 3A5WA 4EL1A 2JZSA 4ML6A 1V98A 1O8WA 2YN1A 3TKQA 5FT3A 2YJ7A 2GDRA 2JACA 2C1YA 4O7HA 3KTLA 4XTSA 4TKYA 2H72A 1SJ6A 5AIVA 5D9TA 2AYTA 2YWNA 5L71A 1K3OA 3WGDA 3D5JA 1PL1A 4XRAA 4CY6A 4YKGA 4ZL7A 4YH2A 1SKRB 3L4NA 5F07A 5IMFA 4ICYA 2CX4A 1Q98A 5FHIA 2WFCA 2HSMA 2N5AA 2I9HA 2M80A 1UA5A 2O85A 3GX8A 2PVOC 1T4ZA 5DQSA 2K8VA 1Z3EA 2QKEA 4N0ZA 2AJQB 1GSQA 3VWUA 3FZ5A 5ABRA 1SL0B 2B5EA 3H8QA 5ECQB 1S3AA 3K8NA 2L6DA 2GSRA 2X64A 3O3TA 3KH9A 5DAKB 1VRSD 3D22A 3ED3A 3QAVA 4IQ1A 3VWWA 5HR0A 5DAKA 1OAZA 1OKDA 5INYA 2WRTA 2YJHA 4ZBAA 2LRTA 4BPYA 3M8NA 1MD4A 5A4UA 3GSSA 3M0FA 4O5QA 3BD2A 1GNWA 3F0IA 4JEDA 1JZOA 2MMZA 4MP4A 4DEJA 1DE2A 3CYNA 1DBYA 3EU4A 4JZQA 3J7Yk 2CZ3A 1HNAA 3LG6A 1EOGA 1V40A 3A3TA 4KAEA 1URMA 4P3YB 1WJKA 5G2ZA 1WIKA 1C72A 3RPNA 2FWGA 2LV3A 4KF9A 4O92A 2OBIA 1AW9A 4A5PA 2LJKA 5CP1A 4TR3A 4HU9A 3VFIA 4IS0A 3BOAA 5ELAA 4OCEA 4OFMA 1BEDA 1GP1A 1YKAA 1ST9A 1MD3A 4BVXB 1HYUA 3DVWA 1T7PB 2VCZA 3EURA 1O7UA 4BWQA 1Y6EA 1R7HA 17GSA 2IIYA 2FGXA 2LQOA 3VI5A 2PGTA 3F4RA 2JSYA 2X99A 1PX7A 4K5RA 5ECMB 1O73A 5J41A 3IK7A 1SJIA 4IGJA 3HDCA 5JCUA 1FB6A 5CYYA 1EWXA 3R2QA 3LJRA 4EIPA 1GRXA 3IDVA 5A5KA 2DJ0A 3TJGA 1O85A 1R4WA 1QXHA 3LYKA 3IRAA 2CAQA 1SYXA 3IOSA 3Q74A 4K2DA 2X8GA 4RQXA 2YZHA 5H5SA 1GLQA 1YKCA 1YZXA 1M9AA 3PR8A 2HLSA 5GAND 2RIIA 4OCFA 8GSSA 1NW2A 1GSSA 4TR4A 2X8CA 4HZ4A 3HD5A 4POKA 4N10A 3KP9A 2FA4A 2F9SA 5CAXA 2VL2A 4OO5A 2V2GA 1K0CA 5IMCA 5C00A 1BJXA 3DKSA 4I2UA 4DVCA 4JU5A 4IN0A 1MTCA 1OKTA 2XPDA 1TKDB 2R37A 3Q18A 1MDKA 4TXVA 2LNSA 1PKWA 4G10A 7GSSA 3H1NA 2R6KA 4YQMA 2DIYA 1FVKA 4ZBDA 1YF1A 2CX3A 2UZ8A 4ML1A 5B8AA 3LYPA 1OC9A 4LL1B 1TRUA 1GH2A 1R26A 1T4YA 4L5OA 4V1Ap 3GIXA 4EO3A 3KMOA 1X9MB 2XHFA 3PPUA 2WB9A 3GL5A 1F37A 1A8LA 1U87A 1AQWA 1PN0A 2R2JA 3A5IA 3RDWA 3L9UA 2I4AA 2LQQA 1B8XA 5GZZB 3Q19A 5J9BA 4NHZA 2HSHA 2EC4A 1G7EA 1ZYPA 3GKNA 3JCML 3UOMA 2R3XA 1XCCA 3EMPA 2YV9A 2FWFA 4LLRA 1FG4A 5F06A 1A8YA 1S3CA 2LJRA 4ZB8A 5GSSA 4MDCA 5DCHA 1X5EA 4WR5A 2OBKA 3LGCA 2V32A 2DJ3A 3RAZA 3US3A 2WDUA 4V2MA 3HKRA 3TCOA 4POLA 2PUKC 2JADA 2H66A 1B4PA 1BG5A 4X1UA 3SWLA 2VCVA 3HZ4A 2VL9A 4KCAA 4F03A 1T1VA 4ZL8A 2H75A 4G0IA 9GSSA 4HEA2 3GMFA 3L9VA 3P7XA 4QL9A 4XS4A 3CRUA 5B7CA 1M2AA 3HYPA 3CTGA 2EIQA 1A0RP 1XVQA 4PTSA 3GKKA 4OO4A 4RUVA 3ZMLA 3W6GA 3NIVA 4K6XA 5ELGA 6GSTA 1EP8A 3CBUA 4OMVA 4EUYA 4I6XA 1AQXA 1UC7A 2R0GA 2K9FA 1XVWA 2OE1A 4WR4A 2QA2A 2DJJA 2LSTA 3IC8A 1S3RA 1V57A 2KP2A 3UVTA 5D8IA 3C8EA 2OJLA 5KOWA 2K18A 3E3EA 4HU7A 5IMDA 2AB6A 1CQHA 2YWIA 1V58A 3PGTA 4O32A 4JR4A 3U5RE 1EV4A 5EL8A 1A2MA 2C80A 1XW9A 1OYJA 1HNBA 5DBQA 2IFQB 3MYDA 2WZ9A 4HJ2A 5LNKe 3M9KA 3FKFA 3KIJA 4TR1A 4BVYB 3D4TA 1F3BA 1XOAA 1K3LA 3C71A 4ID0A 1RW1A 2GZYA 2IFQA 1R5PA 4V1Ag 1NHOA 5IPHA 2BTOT 5G30A 1ACVA 4GSSA 2CQ9A 3HHVA 4IKHA 4EC0A 3LWAA 3MNGA 1DUGA 3D21A 4F0CA 2AV4A 1PRXA 1ILOA 4MF7A 3LXTA 4G2EA 2NDOA 2GGTA 4MZBA 2PWJA 2A2SA 1EZKA 1XZOA 3G7YA 3EMXA 4TN8A 5F05A 1ERUA 3IE3A 5IMZA 2QC7A 1G6WA 3EPTA 4LMWA 2X49A 2YOIA 4USSA 3APSA 4MZWA 3P2AA 4KB3A 4N30A 3OR5A 5ECSA 1YEPA 4NV5A 5J4UA 4IJIA 2H1DA 1J9BA 3C1RA 2VOCA 2FD3A 5BMUA 1GSUA 3W8SA 5D9XA 1YJ6A 3A2WA 5CRHA 1U3IA 1SD8A 2VL3A 1FW1A 3VI7A 4MABA 2LRCA 3HCZA 1SK2A 2KLXA 3FEUA 1UVZA 1PA3A 2O87A 4Z7XA 2YPMA 3BCIA 2H1AA 3QAGA 4GQCA 1GLPA 4QQ7A 2DKIA 5AIXA 2VL2C 5B6MA 1WRYA 2CZ2A 2WULA 5H5QA 2KP1A 1V9WA 4BL7B 4AF2A 1ZMAA 3C73A 2RUFA 3KJYA 2E2MA 1TOFA 2CAIA 2F51A 3CSHA 4BL7A 3F9UA 3VURA 1WWJA 4KSOA 2H6XA 4NHWA 2RM6A 4NV2A 1AIUA 1Y25A 3WGEA 5KN0A 2C0EA 4FYBA 1GULA 6GSSA 2ON5A 1OE8A 3HZ8A 2IMEA 2HRNA 1DE1A 1I5GA 5J9CA 3RPPA 1ABAA 2J9HA 4HDEA 1XW5A 3FR9A 4CHSA 4IELA 1K0OA 4KX4A 4ISDA 3F4TA 2YCDA 1Z7RA 3QD9A 2H01A 1IYIA 1K0MA 3TKSA 3TJFA 3KMNA 4ZB6A 4MK3A 1PSQA 3I69A 4OFNA 4MMMA 3F4SA 1VF3A 1XW6A 1TU8A 2XC2A 1SJZA 4MLYA 2VCQA 4HJMA 1QGVA 4ECCA 2VLTA 1F2EA 2PBJA 1PMTA 5DALB 4MF5A 3QR6A 5EVOA 3MWHA 4I2TA 3KXOA 3I6AA 1Z9HA 2B5XA 2DMLA 2A2RA 4HUAA 2L5OA 2L4QA 1JZWA 4NWYA 2QGVA 1M3IA 1AXDA 4G0KA 2GQMA 1G7OA 4K8MA 11GSA 3KCMA 4CDOA 1N2AA 5G1LA 1PQNA 1XWKA 2VD0A 1VGLA 3GH9A 2N5BA 2JSZA 1PL2A 3S9FA 4X43A 1A2JA 3IBHA 4ZILA 3TKSE 5G5EA 2B5YA 1IYHA 3VWXA 3R3EA 4K7OA 5KN1A 2PU9C 4EXJA 1LBKA 2BJXA 3PINA 1A0FA 1KNGA 3F3QA 1BX9A 4ZIJA 5ECKB 1PN9A 10GSA 3KH7A 3HA9A 2L6CA 1GSEA 3IPZA 3A2XA 1GWCA 1K0NA 2FNOA 2HYXA 1X9WB 2VUPA 1JLVA 2D2ZA 2HZEB 1EEJA 2GQLA 4Z2UA 4PX1A 3ME8A 3KTBA 3L0HA 3ZTLA 1GTBA 1MDJA 3TDGA 2K8SA 4BVXA 5FWGA 3FRCA 1G0TA 2VIMA 4MPGA 4TXOB 3LQ7A 1TJDA 1GTIA 3DMLA 2ZUPA 5IMVA 5ECNB 3TUEA 2P0GA 3M9JA 2IWTA 1ERWA 3ZMKA 3GKMA 5AGYA 5CREA 2YV7A 3E0UA 1XBSA 2B3SA 4HQSA 1MDIA 5AN1A 1FHEA 12GSA 3DVXA 2WCIA 1XFLA 4KE3A 4ZXGA 2AHEA 4POBA 2L4CA 4PGTA 3NOFA 2PMTA 2H74A 3LW9A 2XPEA 4Q5QA 3N5OA 3FMWA 4J57E 4KDUA 1FOVA 3GFKA 3CSIA 2O89A 1XWAA 19GSA 4GCIA 3HY2A 4IP1A 1OVNA 3GSTA 3DEXA 5B6NA 2HE3A 1LU4A 4WBRD 4TRXA 2IMDA 3LFLA 2JL4A 2H0GA 2C4JA 2IN3A 3D6IA 2DC5A 1M2DA 2K6VA 4IVFA 4FH8A 2H30A 1VF1A 4X4JA 3KP8A 2VCTA 2CV4A 1ZCPA 1WMJA 1SL1B 1VF2A 1FB0A 3G7IA 4IBPA 4YAPA 2XBIA 4LA1A 5JWOB 1TI1A 2HRKA 2PVQA 2ALBA 3APQA 3BBYA 2AUVA 3ZVJA 4XHMA 2HXKA 2LS5A 2H1GA 1QQ2A 4J2FA 3UBKA 5DJMA 2G2QA 4EDYA 2YNXA 2IPAA 1ZGNA 4DSSB 4D73B 4BWSA 1EEMA 4BIKA 3FW2A 2HSYA 20GSA 4O5UA 3IAS2 1SK0A 2H0IA 3ZIVA 5DDLA 4DSSA 1SK1A 2VCWA 3NZNA 2OA7A 4D73A 4EVMA 2DBCA 3CTFA 2VD1A 2DSAA 1TXXA 3GV1A 3F63A 4KW6A 2KOKA 1TTZA 4G19A 3J7Yb 4PUFC 3UL3A 5IQYA 2MZCA 3LXZA 1E6BA 1B48A 3IXRA 2M72A 1PD21 1WE0A 3H93A 1WP0A 5IOXA 3TOUA 5IMAA 1GL8A 2R0PA 5D96A 4V2NA 2X8HA 4GXZA 1VF4A 2RUEA 4MZCA 3TKSC 1LJRA 1BQ7A 5IPGA 5F8BA 2FWHA 3FY7A 5D9WA 3ERWA 3VPQA 4L8EA 1UN2A 4WETA 1ZYQB 3WGXA 2GLRA 3GH6A 2VM2A 22GSA 1GTAA 2RM5A 1TK5B 4AJ6A 2CT6A 5CRDA 4KNDA 2LJAA 1BYEA 1HNCA 3ERGA 2LRNA 2H73A 3FZ9A 2B1LA 6GSWA 2WS2A 5ECHB 4G9HA 1USBA 2FCHA 3O76A 4MNNA 2V41A 3VK9A 4QL7A 1QFNA 2B7JA 4CY8A 4ZL9A 1GSFA 1EGRA 1S3DA 2IL3A 2V6KA 4HI7A 4PQ1A 3I43A 4MJEA 4POMA 6GSVA 1WPIA 1A23A 2FA8A 4ULXA 1RQMA 4XS1A 3TRQA 2MBSA 1M0UA 2H76A 4L5LA 1XOBA 5ECOB 2H71A 1O6JA 3LEFA 2NVLA 5D9VA 1AAZA 2IMIA 1K3YA 2C3QA 1XWBA 2LTKA 1GUMA 4MCUA 1M2BA 3UBLA 3F6FA 3EWLA 1U3AA 4K2XA 3DIEA 3RHCA 4BVYA 1N8JA 5IO2A 4MH3A 3P8WA 5LCZA 2CVKA 3TJKA 1KTEA 1RK4A 2J23A 4LMVA 5LD0A 3W8JA 4K0GA 1FO5A 2HNLA 3C1SA 1T00A 1A24A 3U6VA 2ES7A 3GX0A 1PFOA 2C3NA 2AAWA 2YP6A 3MSZA 1Z6NA 2FWEA 2QA1A 1H4OA 4FYCA 1ML6A 2IMKA 3FK8A 6GSXA 3VPTA 3QFBC
chains in the Genus database with same CATH topology
1QMVA 3BCKA 4NAXA 3UAPA 4ECBA 3M3MA 1SL2B 2PPTA 4WF5A 3FZAA 5J5NA 2KUCA 5ECRB 1M99A 3ZREA 3GTUB 5HFIA 5G5FA 4HOJA 1OC8A 1GUKA 2E7PA 3N9JA 2C0GA 2OKAA 2DMMA 3HVSA 2H8LA 2HRFA 2GSQA 3GNJA 5IM9A 4XIHA 2EIRA 4J56E 5KEJA 3APOA 3ZFBA 3F6DA 3CRTA 4AJ7A 4Q5NA 3ZFLA 3IR4A 3TKPA 3EE2A 3IC4A 4I5QA 5ECLB 1YY7A 1XPVA 1YQ1A 3CSJA 3FYGA 4GWRA 4NXIA 2ZNMA 4OWYA 2GT5A 1YF0A 5G1KA 2YWMA 3UEMA 1Z7PA 3SBCA 4ECIA 3EU3A 4EDZA 1JZDA 4ILFA 1U88A 2O7KA 4O5RA 1NSWA 4ECJA 3QOUA 4YAVA 1XXUA 4K7NA 3QAWA 4TOPA 4WF4A 2EIOA 4L0UA 1T3BA 1FAAA 3LORA 1Z6MA 2IJYA 1E2YA 2HT9A 4Z2RA 3IA1A 3DGQA 2I1UA 5IIZA 2OE0A 3GRXA 3IK9A 3VWVA 4KDXA 3GHAA 3ZITA 5KOXA 4F0BA 3ZIJA 2H1BA 5IOWA 3TJBA 3P90A 1FOHA 2NTOA 3EYTA 3VLNA 4HS1A 5AISA 4DSQA 3TOTA 2MYGA 1J0FA 3GA4A 3H79A 3ZYWA 1TU7A 2GVPA 3L9SA 3QPMA 4GRFA 3QDNA 5CRWA 1SD9A 1WOUA 3MAKA 1GNEA 1HQOA 5A4VA 1ZL9A 1K0AA 2N5FA 2P31A 4G0LA 2ON7A 3ZZXA 2I81A 3G7JA 1ERTA 2H6ZA 3LSZA 1PGTA 2NPBA 1CQGA 2YWOA 1K0BA 1R5AA 2TRXA 4JBBA 3FR6A 4AGSA 2H6YA 3DYRA 5DALA 3E9JB 1OC3A 3HVXA 1JZRA 4PNFA 1BAYA 5EY6A 3TJJA 4KSMA 3HVVA 4IJ3A 1YEXA 2OE3A 1OE7A 2OACA 4JRRA 1PX6A 4MF6A 1JLWA 3L78A 3HXSA 4L0WA 3KM6A 2DKHA 4H86A 5E4WA 4RQRA 1EGOA 3PH9A 2YZUA 4GF0A 4MA9A 2VCXA 3G9BA 1Q4JA 4E8EA 4I97A 3V1WA 1SENA 1TRVA 1DSBA 4FO5A 5F0GA 3ISOA 3UJ1A 1HD2A 2MMNA 2X4AA 1EV9A 4MJAA 5ECPB 4JE1A 4Q5FA 4CW9A 2GTUA 3ME7A 1NM3A 3A2VA 3DXBA 2DIZA 2G0FA 4LL4B 2DJ1A 2FLSA 1K0DA 3TGZA 2FUG2 5ENUA 3FHKA 2R4VA 2HZEA 4HQZA 3QCPA 3GL3A 4K5SA 4WEYA 5JCWA 3KEBA 5ECIB 1ON4A 3EC3A 1M9BA 1W89A 1TW9A 2VO4A 4GLTA 5COHA 5CO3A 3MDKA 4TXOA 5JWQB 3WD6A 1TI3A 2F8AA 4HZ2A 5GSTA 5KN3A 2GSSA 4OFTA 3GYKA 2A2PA 2C3TA 1V2AA 4I8BA 2GSTA 3UARA 3AY8A 2L5LA 4EE0A 1W4VA 3RBTA 3TRPA 1B9YC 4YQUA 1X5CA 5DJLA 3ZVJD 4KCEA 2JZTA 4NPBA 4PUAA 1O8XA 1TK0B 4XS6A 2GZPA 2LNTA 2LKUA 2BMXA 2PN8A 4E8HA 4IP6A 5A4WA 2GZZA 4GTUA 3QFAC 5HFKA 4BA7A 4RI6A 3FZ4A 1JFUA 5HQPA 2B1KA 2MBTA 2VLVA 4PURA 3UMAA 1F3AA 1B4QA 4XRDA 4PQHA 3TB2A 3HJMA 1NHYA 1T8EB 3HJPA 1ZZYA 1OC9B 3FR3A 2VM1A 4OD7A 4PQIA 2PERA 4Z2TA 1THXA 2I3YA 4WXTA 5CRGA 4X0XA 5J3RA 3MIXA 5B8BA 3UVHA 5D73A 4IHUA 3O6TA 4MPFA 2DLXA 1TRWA 1X9SB 2ZCTA 2VLUA 1XWGA 2P5RA 4N11A 4F9ZA 3BJ5A 5HR2A 4WKWA 4KA0A 1F6MC 3KD0A 1ZYNA 5JCGA 3EINA 6GSUA 2RLIA 4JR6A 3C7MA 4FYUA 2V6OA 2M46A 2MMOA 2H19A 2O8VB 2WGRA 2LEGA 1AC1A 2QSIA 2Z9SA 13GSA 4FQUA 4KGIA 5HR3A 6GSYA 1AQVA 2H0HA 2L59A 4PXOA 5GAPD 5JWRB 4TW5A 1ZOFA 1SYRA 2HRAA 2L57A 3M1GA 2KHPA 4EKZA 1GSYA 3TRXA 4RI7A 1QUWA 4XS4B 2FY6A 1YDKA 16GSA 5H5RA 1QK8A 1EOHA 4K7IA 1MEKA 2C0DA 2FHEA 2CVDA 2TIRA 2YANA 4GSTA 3I9V2 5BRTA 2MMAA 3CMIA 1X5DA 3F3RA 4KUNA 1TK8B 3GURA 3IAM2 1F9MA 2HI7A 3GN3A 4DSRA 3IHQA 1JHBA 3EVIA 2LUSA 1GTUA 1KEBA 1GSDA 4NMUA 2R0CA 1XIYA 5E59A 2A4VA 2IMFA 5D93A 3WYWA 1GUHA 1U6TA 5DCGA 1SU9A 4WBJA 2A4HA 2E2GA 1FVJA 3ZL5A 2CA8A 1H75A 1XWCA 1Z5YE 4K0NA 5IO0A 2HZFA 5C04A 2B7KA 2XBQA 3UIWA 14GSA 3GKXA 2H70A 1PKZA 4N0VA 2JU5A 4ZB9A 2REMA 4IQAA 2F3MA 4GQFA 4TR1B 4IW9A 2R5GA 3D4MA 5G31A 3ZRDA 1ERVA 1M7TA 4YKFA 2DJ2A 2WJUA 1J08A 4Q5RA 4YQVA 1TDIA 1X0RA 3D0ZA 4KDYA 3ERFA 1SKWB 2GT6A 3CXGA 2CVBA 4AJ8A 1ZYEA 3F8UA 2F8FA 1O81A 3WT2A 4ZBBA 4K9ZA 4GSNA 5HR1A 3WT1A 2NBSA 5DQYA 3DD3A 4KH7A 5CNWA 3RHBA 4EF0A 4TVEA 3KGKA 3TKRA 1KBNA 5HFGA 3IV4A 2P5QA 1A2LA 1B9XC 3DRNA 3Q6OA 3KZQA 5EPFA 4K1FA 1AUCA 1THOA 4FIWA 2C8UA 2B6MA 4MJBA 5DVBA 4ACSA 18GSA 1EP7A 4MJCA 2HFDA 4EIQA 5KN2A 1G6YA 2OADA 2TRCP 4PNGA 2GQKA 3GTUA 3H4KA 4TR0A 5ID2B 1SKSB 2E0QA 4F82A 4V2LA 1TRSA 2C0FA 2VAFA 3DWVA 1TP9A 2JZRA 3QMXA 4F2IA 4MH2A 5ID2A 2DJKA 3HJOA 1I9DA 4XCSA 3GUSA 3IHGA 2GS3A 3ZLPA 2V1MA 3A5WA 4EL1A 2JZSA 4ML6A 1V98A 1O8WA 2YN1A 3TKQA 5FT3A 2YJ7A 2GDRA 2JACA 2C1YA 4O7HA 3KTLA 4XTSA 4TKYA 2H72A 1SJ6A 5AIVA 5D9TA 2AYTA 2YWNA 5L71A 1K3OA 3WGDA 3D5JA 1PL1A 4XRAA 4CY6A 4YKGA 4ZL7A 4YH2A 1SKRB 3L4NA 5F07A 5IMFA 4ICYA 2CX4A 1Q98A 5FHIA 2WFCA 2HSMA 2N5AA 2I9HA 2M80A 1UA5A 2O85A 3GX8A 2PVOC 1T4ZA 5DQSA 2K8VA 1Z3EA 2QKEA 4N0ZA 2AJQB 1GSQA 3VWUA 3FZ5A 5ABRA 1SL0B 2B5EA 3H8QA 5ECQB 1S3AA 3K8NA 2L6DA 2GSRA 2X64A 3O3TA 3KH9A 5DAKB 1VRSD 3D22A 3ED3A 3QAVA 4IQ1A 3VWWA 5HR0A 5DAKA 1OAZA 1OKDA 5INYA 2WRTA 2YJHA 4ZBAA 2LRTA 4BPYA 3M8NA 1MD4A 5A4UA 3GSSA 3M0FA 4O5QA 3BD2A 1GNWA 3F0IA 4JEDA 1JZOA 2MMZA 4MP4A 4DEJA 1DE2A 3CYNA 1DBYA 3EU4A 4JZQA 3J7Yk 2CZ3A 1HNAA 3LG6A 1EOGA 1V40A 3A3TA 4KAEA 1URMA 4P3YB 1WJKA 5G2ZA 1WIKA 1C72A 3RPNA 2FWGA 2LV3A 4KF9A 4O92A 2OBIA 1AW9A 4A5PA 2LJKA 5CP1A 4TR3A 4HU9A 3VFIA 4IS0A 3BOAA 5ELAA 4OCEA 4OFMA 1BEDA 1GP1A 1YKAA 1ST9A 1MD3A 4BVXB 1HYUA 3DVWA 1T7PB 2VCZA 3EURA 1O7UA 4BWQA 1Y6EA 1R7HA 17GSA 2IIYA 2FGXA 2LQOA 3VI5A 2PGTA 3F4RA 2JSYA 2X99A 1PX7A 4K5RA 5ECMB 1O73A 5J41A 3IK7A 1SJIA 4IGJA 3HDCA 5JCUA 1FB6A 5CYYA 1EWXA 3R2QA 3LJRA 4EIPA 1GRXA 3IDVA 5A5KA 2DJ0A 3TJGA 1O85A 1R4WA 1QXHA 3LYKA 3IRAA 2CAQA 1SYXA 3IOSA 3Q74A 4K2DA 2X8GA 4RQXA 2YZHA 5H5SA 1GLQA 1YKCA 1YZXA 1M9AA 3PR8A 2HLSA 5GAND 2RIIA 4OCFA 8GSSA 1NW2A 1GSSA 4TR4A 2X8CA 4HZ4A 3HD5A 4POKA 4N10A 3KP9A 2FA4A 2F9SA 5CAXA 2VL2A 4OO5A 2V2GA 1K0CA 5IMCA 5C00A 1BJXA 3DKSA 4I2UA 4DVCA 4JU5A 4IN0A 1MTCA 1OKTA 2XPDA 1TKDB 2R37A 3Q18A 1MDKA 4TXVA 2LNSA 1PKWA 4G10A 7GSSA 3H1NA 2R6KA 4YQMA 2DIYA 1FVKA 4ZBDA 1YF1A 2CX3A 2UZ8A 4ML1A 5B8AA 3LYPA 1OC9A 4LL1B 1TRUA 1GH2A 1R26A 1T4YA 4L5OA 4V1Ap 3GIXA 4EO3A 3KMOA 1X9MB 2XHFA 3PPUA 2WB9A 3GL5A 1F37A 1A8LA 1U87A 1AQWA 1PN0A 2R2JA 3A5IA 3RDWA 3L9UA 2I4AA 2LQQA 1B8XA 5GZZB 3Q19A 5J9BA 4NHZA 2HSHA 2EC4A 1G7EA 1ZYPA 3GKNA 3JCML 3UOMA 2R3XA 1XCCA 3EMPA 2YV9A 2FWFA 4LLRA 1FG4A 5F06A 1A8YA 1S3CA 2LJRA 4ZB8A 5GSSA 4MDCA 5DCHA 1X5EA 4WR5A 2OBKA 3LGCA 2V32A 2DJ3A 3RAZA 3US3A 2WDUA 4V2MA 3HKRA 3TCOA 4POLA 2PUKC 2JADA 2H66A 1B4PA 1BG5A 4X1UA 3SWLA 2VCVA 3HZ4A 2VL9A 4KCAA 4F03A 1T1VA 4ZL8A 2H75A 4G0IA 9GSSA 4HEA2 3GMFA 3L9VA 3P7XA 4QL9A 4XS4A 3CRUA 5B7CA 1M2AA 3HYPA 3CTGA 2EIQA 1A0RP 1XVQA 4PTSA 3GKKA 4OO4A 4RUVA 3ZMLA 3W6GA 3NIVA 4K6XA 5ELGA 6GSTA 1EP8A 3CBUA 4OMVA 4EUYA 4I6XA 1AQXA 1UC7A 2R0GA 2K9FA 1XVWA 2OE1A 4WR4A 2QA2A 2DJJA 2LSTA 3IC8A 1V57A 2KP2A 3UVTA 5D8IA 3C8EA 2OJLA 5KOWA 2K18A 3E3EA 4HU7A 5IMDA 2AB6A 1CQHA 2YWIA 1V58A 3PGTA 4O32A 4JR4A 3U5RE 1EV4A 5EL8A 1A2MA 2C80A 1XW9A 1OYJA 1HNBA 5DBQA 2IFQB 3MYDA 2WZ9A 4HJ2A 5LNKe 3M9KA 3FKFA 3KIJA 4TR1A 4BVYB 3D4TA 1F3BA 1XOAA 1K3LA 3C71A 4ID0A 1RW1A 2GZYA 2IFQA 1R5PA 4V1Ag 1NHOA 5IPHA 2BTOT 5G30A 1ACVA 4GSSA 2CQ9A 3HHVA 4IKHA 4EC0A 3LWAA 3MNGA 1DUGA 3D21A 4F0CA 2AV4A 1PRXA 1ILOA 4MF7A 3LXTA 4G2EA 2NDOA 2GGTA 4MZBA 2PWJA 2A2SA 1EZKA 1XZOA 3G7YA 3EMXA 4TN8A 5F05A 1ERUA 3IE3A 5IMZA 2QC7A 1G6WA 3EPTA 4LMWA 2X49A 2YOIA 4USSA 3APSA 4MZWA 3P2AA 4KB3A 4N30A 3OR5A 5ECSA 1YEPA 4NV5A 5J4UA 4IJIA 2H1DA 1J9BA 3C1RA 2VOCA 2FD3A 5BMUA 1GSUA 3W8SA 5D9XA 1YJ6A 3A2WA 5CRHA 1U3IA 1SD8A 2VL3A 1FW1A 3VI7A 2LRCA 4MABA 3HCZA 1SK2A 2KLXA 3FEUA 1UVZA 1PA3A 2O87A 4Z7XA 2YPMA 3BCIA 2H1AA 3QAGA 4GQCA 1GLPA 4QQ7A 2DKIA 5AIXA 2VL2C 5B6MA 1WRYA 2CZ2A 2WULA 5H5QA 2KP1A 1V9WA 4BL7B 4AF2A 1ZMAA 3C73A 2RUFA 3KJYA 2E2MA 1TOFA 2CAIA 2F51A 3CSHA 4BL7A 3F9UA 3VURA 1WWJA 4KSOA 2H6XA 4NHWA 2RM6A 4NV2A 1AIUA 1Y25A 3WGEA 5KN0A 2C0EA 4FYBA 1GULA 6GSSA 2ON5A 1OE8A 3HZ8A 2IMEA 2HRNA 1DE1A 1I5GA 5J9CA 3RPPA 1ABAA 2J9HA 4HDEA 1XW5A 3FR9A 4CHSA 4IELA 1K0OA 4KX4A 4ISDA 3F4TA 2YCDA 1Z7RA 3QD9A 2H01A 1IYIA 1K0MA 3TKSA 3TJFA 3KMNA 4ZB6A 4MK3A 1PSQA 3I69A 4OFNA 4MMMA 3F4SA 1VF3A 1XW6A 1TU8A 2XC2A 1SJZA 4MLYA 2VCQA 4HJMA 1QGVA 4ECCA 2VLTA 1F2EA 2PBJA 1PMTA 5DALB 4MF5A 3QR6A 5EVOA 3MWHA 4I2TA 3KXOA 3I6AA 1Z9HA 2B5XA 2DMLA 2A2RA 4HUAA 2L5OA 2L4QA 1JZWA 4NWYA 2QGVA 1AXDA 4G0KA 2GQMA 1G7OA 4K8MA 11GSA 3KCMA 4CDOA 1N2AA 5G1LA 1PQNA 1XWKA 2VD0A 1VGLA 3GH9A 2N5BA 2JSZA 1PL2A 3S9FA 4X43A 1A2JA 3IBHA 4ZILA 3TKSE 5G5EA 2B5YA 1IYHA 3VWXA 3R3EA 4K7OA 5KN1A 2PU9C 4EXJA 1LBKA 2BJXA 3PINA 1A0FA 1KNGA 3F3QA 1BX9A 4ZIJA 5ECKB 1PN9A 10GSA 3KH7A 3HA9A 2L6CA 1GSEA 3IPZA 3A2XA 1GWCA 1K0NA 2FNOA 2HYXA 1X9WB 2VUPA 1JLVA 2D2ZA 2HZEB 1EEJA 2GQLA 4Z2UA 4PX1A 3ME8A 3KTBA 3L0HA 3ZTLA 1GTBA 1MDJA 3TDGA 2K8SA 4BVXA 5FWGA 3FRCA 1G0TA 2VIMA 4MPGA 4TXOB 3LQ7A 1TJDA 1GTIA 3DMLA 2ZUPA 5IMVA 5ECNB 3TUEA 2P0GA 3M9JA 2IWTA 1ERWA 3ZMKA 3GKMA 5AGYA 5CREA 2YV7A 3E0UA 1XBSA 2B3SA 4HQSA 1MDIA 5AN1A 1FHEA 12GSA 3DVXA 2WCIA 1XFLA 4KE3A 4ZXGA 2AHEA 4POBA 2L4CA 4PGTA 3NOFA 2PMTA 2H74A 3LW9A 2XPEA 4Q5QA 3N5OA 3FMWA 4J57E 4KDUA 1FOVA 3GFKA 3CSIA 2O89A 1XWAA 19GSA 4GCIA 3HY2A 4IP1A 1OVNA 3GSTA 3DEXA 5B6NA 2HE3A 1LU4A 4WBRD 4TRXA 2IMDA 3LFLA 2JL4A 2H0GA 2C4JA 2IN3A 3D6IA 2DC5A 1M2DA 2K6VA 4IVFA 4FH8A 2H30A 1VF1A 4X4JA 3KP8A 2VCTA 2CV4A 1ZCPA 1WMJA 1SL1B 1VF2A 1FB0A 3G7IA 4IBPA 4YAPA 2XBIA 4LA1A 5JWOB 1TI1A 2HRKA 2PVQA 2ALBA 3APQA 3BBYA 2AUVA 3ZVJA 4XHMA 2HXKA 2LS5A 2H1GA 1QQ2A 4J2FA 3UBKA 5DJMA 2G2QA 4EDYA 2YNXA 2IPAA 1ZGNA 4DSSB 4D73B 4BWSA 1EEMA 3FW2A 2HSYA 20GSA 4O5UA 3IAS2 1SK0A 2H0IA 3ZIVA 5DDLA 4DSSA 1SK1A 2VCWA 3NZNA 2OA7A 4D73A 4EVMA 2DBCA 3CTFA 2VD1A 2DSAA 1TXXA 3GV1A 3F63A 4KW6A 2KOKA 1TTZA 4G19A 3J7Yb 4PUFC 3UL3A 5IQYA 2MZCA 3LXZA 1E6BA 1B48A 3IXRA 2M72A 1PD21 1WE0A 3H93A 1WP0A 5IOXA 3TOUA 5IMAA 1GL8A 2R0PA 5D96A 4V2NA 2X8HA 4GXZA 1VF4A 2RUEA 4MZCA 3TKSC 1LJRA 1BQ7A 5IPGA 5F8BA 2FWHA 3FY7A 5D9WA 3ERWA 3VPQA 4L8EA 1UN2A 4WETA 1ZYQB 3WGXA 2GLRA 3GH6A 2VM2A 22GSA 1GTAA 2RM5A 1TK5B 4AJ6A 2CT6A 5CRDA 4KNDA 2LJAA 1BYEA 1HNCA 3ERGA 2LRNA 2H73A 3FZ9A 2B1LA 6GSWA 2WS2A 5ECHB 4G9HA 1USBA 2FCHA 3O76A 4MNNA 2V41A 3VK9A 4QL7A 1QFNA 2B7JA 4CY8A 4ZL9A 1GSFA 1EGRA 1S3DA 2IL3A 2V6KA 4HI7A 4PQ1A 3I43A 4MJEA 4POMA 6GSVA 1WPIA 1A23A 2FA8A 4ULXA 1RQMA 4XS1A 3TRQA 2MBSA 1M0UA 2H76A 4L5LA 1XOBA 5ECOB 2H71A 1O6JA 3LEFA 2NVLA 5D9VA 1AAZA 2IMIA 1K3YA 2C3QA 1XWBA 2LTKA 1GUMA 4MCUA 1M2BA 3UBLA 3F6FA 3EWLA 1U3AA 4K2XA 3DIEA 3RHCA 4BVYA 1N8JA 5IO2A 4MH3A 3P8WA 5LCZA 2CVKA 3TJKA 1KTEA 1RK4A 2J23A 4LMVA 5LD0A 3W8JA 4K0GA 1FO5A 2HNLA 3C1SA 1T00A 1A24A 3U6VA 2ES7A 3GX0A 2C3NA 2AAWA 2YP6A 3MSZA 1Z6NA 2FWEA 2QA1A 1H4OA 4FYCA 1ML6A 2IMKA 3FK8A 6GSXA 3VPTA 3QFBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QMV A;  3BCK A;  4NAX A;  3UAP A;  4ECB A;  3M3M A;  1SL2 B;  2PPT A;  4WF5 A;  3FZA A;  5J5N A;  2KUC A;  5ECR B;  1M99 A;  3ZRE A;  3GTU B;  5HFI A;  5G5F A;  4HOJ A;  1OC8 A;  1GUK A;  2E7P A;  3N9J A;  2C0G A;  2OKA A;  2DMM A;  3HVS A;  2H8L A;  2HRF A;  2GSQ A;  3GNJ A;  5IM9 A;  4XIH A;  2EIR A;  4J56 E;  5KEJ A;  3APO A;  3ZFB A;  3F6D A;  3CRT A;  4AJ7 A;  4Q5N A;  3ZFL A;  3IR4 A;  3TKP A;  3EE2 A;  3IC4 A;  4I5Q A;  5ECL B;  1YY7 A;  1XPV A;  1YQ1 A;  3CSJ A;  3FYG A;  4GWR A;  4NXI A;  2ZNM A;  4OWY A;  2GT5 A;  1YF0 A;  5G1K A;  2YWM A;  3UEM A;  1Z7P A;  3SBC A;  4ECI A;  3EU3 A;  4EDZ A;  1JZD A;  4ILF A;  1U88 A;  2O7K A;  4O5R A;  1NSW A;  4ECJ A;  3QOU A;  4YAV A;  1XXU A;  4K7N A;  3QAW A;  4TOP A;  4WF4 A;  2EIO A;  4L0U A;  1T3B A;  1FAA A;  3LOR A;  1Z6M A;  2IJY A;  1E2Y A;  2HT9 A;  3IA1 A;  3DGQ A;  2I1U A;  5IIZ A;  2OE0 A;  3GRX A;  3IK9 A;  3VWV A;  4KDX A;  3GHA A;  3ZIT A;  4F0B A;  3ZIJ A;  2H1B A;  5IOW A;  3TJB A;  3P90 A;  2NTO A;  3EYT A;  3VLN A;  4HS1 A;  5AIS A;  4DSQ A;  3TOT A;  2MYG A;  1J0F A;  3GA4 A;  3H79 A;  3ZYW A;  1TU7 A;  2GVP A;  3L9S A;  3QPM A;  4GRF A;  3QDN A;  5CRW A;  1SD9 A;  1WOU A;  3MAK A;  1GNE A;  1HQO A;  5A4V A;  1ZL9 A;  1K0A A;  2N5F A;  2P31 A;  2ON7 A;  3ZZX A;  2I81 A;  3G7J A;  1ERT A;  2H6Z A;  3LSZ A;  1PGT A;  2NPB A;  1CQG A;  2YWO A;  1K0B A;  1R5A A;  2TRX A;  4JBB A;  3FR6 A;  4AGS A;  2H6Y A;  3DYR A;  5DAL A;  3E9J B;  1OC3 A;  3HVX A;  1JZR A;  4PNF A;  1BAY A;  5EY6 A;  3TJJ A;  4KSM A;  3HVV A;  4IJ3 A;  1YEX A;  2OE3 A;  1OE7 A;  2OAC A;  4JRR A;  1PX6 A;  4MF6 A;  1JLW A;  3L78 A;  3HXS A;  4L0W A;  3KM6 A;  4H86 A;  5E4W A;  4RQR A;  1EGO A;  3PH9 A;  2YZU A;  4GF0 A;  4MA9 A;  2VCX A;  3G9B A;  1Q4J A;  4E8E A;  4I97 A;  3V1W A;  1SEN A;  1TRV A;  1DSB A;  4FO5 A;  5F0G A;  3ISO A;  3UJ1 A;  1HD2 A;  2MMN A;  1EV9 A;  4MJA A;  5ECP B;  4JE1 A;  4Q5F A;  4CW9 A;  2GTU A;  3ME7 A;  1NM3 A;  3A2V A;  3DXB A;  2DIZ A;  2G0F A;  4LL4 B;  2DJ1 A;  2FLS A;  1K0D A;  3TGZ A;  2FUG 2;  5ENU A;  3FHK A;  2R4V A;  2HZE A;  4HQZ A;  3QCP A;  3GL3 A;  4WEY A;  5JCW A;  3KEB A;  5ECI B;  1ON4 A;  3EC3 A;  1M9B A;  1W89 A;  1TW9 A;  2VO4 A;  4GLT A;  5COH A;  5CO3 A;  3MDK A;  4TXO A;  5JWQ B;  3WD6 A;  1TI3 A;  2F8A A;  4HZ2 A;  5GST A;  5KN3 A;  2GSS A;  4OFT A;  3GYK A;  2C3T A;  1V2A A;  4I8B A;  2GST A;  3UAR A;  3AY8 A;  2L5L A;  4EE0 A;  1W4V A;  3RBT A;  3TRP A;  1B9Y C;  4YQU A;  1X5C A;  5DJL A;  3ZVJ D;  4KCE A;  2JZT A;  4NPB A;  4PUA A;  1O8X A;  1TK0 B;  4XS6 A;  2GZP A;  2LNT A;  2LKU A;  2BMX A;  2PN8 A;  4E8H A;  4IP6 A;  5A4W A;  2GZZ A;  4GTU A;  3QFA C;  5HFK A;  4BA7 A;  4RI6 A;  3FZ4 A;  1JFU A;  5HQP A;  2B1K A;  2MBT A;  2VLV A;  4PUR A;  3UMA A;  1F3A A;  1B4Q A;  4XRD A;  4PQH A;  3TB2 A;  3HJM A;  1NHY A;  1T8E B;  3HJP A;  1ZZY A;  1OC9 B;  3FR3 A;  2VM1 A;  4OD7 A;  4PQI A;  2PER A;  1THX A;  2I3Y A;  4WXT A;  5CRG A;  4X0X A;  5J3R A;  5B8B A;  3UVH A;  5D73 A;  4IHU A;  3O6T A;  4MPF A;  2DLX A;  1TRW A;  1X9S B;  2ZCT A;  2VLU A;  1XWG A;  2P5R A;  4N11 A;  4F9Z A;  3BJ5 A;  5HR2 A;  4WKW A;  4KA0 A;  1F6M C;  3KD0 A;  5JCG A;  3EIN A;  6GSU A;  2RLI A;  4JR6 A;  3C7M A;  4FYU A;  2V6O A;  2M46 A;  2MMO A;  2H19 A;  2O8V B;  2WGR A;  2LEG A;  1AC1 A;  2QSI A;  2Z9S A;  13GS A;  4KGI A;  5HR3 A;  6GSY A;  1AQV A;  2H0H A;  2L59 A;  4PXO A;  5GAP D;  5JWR B;  4TW5 A;  1ZOF A;  1SYR A;  2L57 A;  3M1G A;  2KHP A;  4EKZ A;  1GSY A;  3TRX A;  4RI7 A;  1QUW A;  4XS4 B;  2FY6 A;  1YDK A;  16GS A;  5H5R A;  1QK8 A;  1EOH A;  4K7I A;  1MEK A;  2C0D A;  2FHE A;  2CVD A;  2TIR A;  2YAN A;  4GST A;  3I9V 2;  2MMA A;  3CMI A;  1X5D A;  3F3R A;  4KUN A;  1TK8 B;  3GUR A;  3IAM 2;  1F9M A;  2HI7 A;  3GN3 A;  4DSR A;  3IHQ A;  1JHB A;  3EVI A;  2LUS A;  1GTU A;  1KEB A;  1GSD A;  4NMU A;  1XIY A;  5E59 A;  2A4V A;  2IMF A;  5D93 A;  3WYW A;  1GUH A;  1U6T A;  5DCG A;  1SU9 A;  4WBJ A;  2E2G A;  1FVJ A;  3ZL5 A;  2CA8 A;  1H75 A;  1XWC A;  1Z5Y E;  4K0N A;  5IO0 A;  2HZF A;  5C04 A;  2B7K A;  2XBQ A;  3UIW A;  14GS A;  3GKX A;  2H70 A;  1PKZ A;  4N0V A;  2JU5 A;  4ZB9 A;  2REM A;  4IQA A;  2F3M A;  4GQF A;  4TR1 B;  4IW9 A;  2R5G A;  3D4M A;  5G31 A;  3ZRD A;  1ERV A;  1M7T A;  2DJ2 A;  2WJU A;  1J08 A;  4Q5R A;  4YQV A;  1TDI A;  1X0R A;  3D0Z A;  4KDY A;  3ERF A;  1SKW B;  2GT6 A;  3CXG A;  2CVB A;  4AJ8 A;  1ZYE A;  3F8U A;  2F8F A;  1O81 A;  3WT2 A;  4ZBB A;  4K9Z A;  4GSN A;  5HR1 A;  3WT1 A;  2NBS A;  5DQY A;  3DD3 A;  4KH7 A;  5CNW A;  3RHB A;  4EF0 A;  4TVE A;  3KGK A;  3TKR A;  1KBN A;  5HFG A;  3IV4 A;  2P5Q A;  1A2L A;  1B9X C;  3DRN A;  3Q6O A;  3KZQ A;  5EPF A;  4K1F A;  1AUC A;  1THO A;  4FIW A;  2C8U A;  2B6M A;  4MJB A;  5DVB A;  4ACS A;  18GS A;  1EP7 A;  4MJC A;  2HFD A;  5KN2 A;  1G6Y A;  2OAD A;  2TRC P;  4PNG A;  2GQK A;  3GTU A;  3H4K A;  4TR0 A;  5ID2 B;  1SKS B;  2E0Q A;  4F82 A;  4V2L A;  1TRS A;  2C0F A;  2VAF A;  3DWV A;  1TP9 A;  2JZR A;  3QMX A;  4F2I A;  4MH2 A;  5ID2 A;  2DJK A;  3HJO A;  1I9D A;  4XCS A;  3GUS A;  3ZLP A;  2GS3 A;  2V1M A;  3A5W A;  4EL1 A;  2JZS A;  4ML6 A;  1V98 A;  1O8W A;  2YN1 A;  3TKQ A;  5FT3 A;  2YJ7 A;  2GDR A;  2JAC A;  2C1Y A;  4O7H A;  3KTL A;  4XTS A;  4TKY A;  2H72 A;  1SJ6 A;  5AIV A;  5D9T A;  2AYT A;  2YWN A;  5L71 A;  1K3O A;  3WGD A;  3D5J A;  1PL1 A;  4XRA A;  4ZL7 A;  4YH2 A;  1SKR B;  3L4N A;  5F07 A;  5IMF A;  2CX4 A;  1Q98 A;  5FHI A;  2WFC A;  2N5A A;  2I9H A;  2M80 A;  1UA5 A;  2O85 A;  3GX8 A;  2PVO C;  1T4Z A;  5DQS A;  2K8V A;  1Z3E A;  2QKE A;  4N0Z A;  2AJQ B;  1GSQ A;  3VWU A;  3FZ5 A;  5ABR A;  1SL0 B;  2B5E A;  3H8Q A;  5ECQ B;  1S3A A;  3K8N A;  2L6D A;  2GSR A;  2X64 A;  3O3T A;  3KH9 A;  5DAK B;  1VRS D;  3D22 A;  3ED3 A;  3QAV A;  4IQ1 A;  3VWW A;  5HR0 A;  5DAK A;  1OAZ A;  1OKD A;  5INY A;  2WRT A;  2YJH A;  4ZBA A;  2LRT A;  4BPY A;  3M8N A;  1MD4 A;  5A4U A;  3GSS A;  3M0F A;  3BD2 A;  1GNW A;  3F0I A;  4JED A;  1JZO A;  2MMZ A;  4MP4 A;  4DEJ A;  1DE2 A;  3CYN A;  1DBY A;  3EU4 A;  4JZQ A;  3J7Y k;  2CZ3 A;  1HNA A;  3LG6 A;  1EOG A;  1V40 A;  3A3T A;  4KAE A;  1URM A;  4P3Y B;  1WJK A;  5G2Z A;  1WIK A;  1C72 A;  3RPN A;  2FWG A;  2LV3 A;  4O92 A;  2OBI A;  1AW9 A;  2LJK A;  5CP1 A;  4TR3 A;  4HU9 A;  3VFI A;  4IS0 A;  3BOA A;  5ELA A;  4OCE A;  4OFM A;  1BED A;  1GP1 A;  1YKA A;  1ST9 A;  1MD3 A;  1HYU A;  3DVW A;  1T7P B;  2VCZ A;  3EUR A;  1O7U A;  4BWQ A;  1Y6E A;  1R7H A;  17GS A;  2IIY A;  2FGX A;  2LQO A;  3VI5 A;  2PGT A;  3F4R A;  2JSY A;  2X99 A;  1PX7 A;  5ECM B;  1O73 A;  5J41 A;  3IK7 A;  1SJI A;  4IGJ A;  3HDC A;  5JCU A;  1FB6 A;  5CYY A;  1EWX A;  3R2Q A;  3LJR A;  1GRX A;  3IDV A;  5A5K A;  2DJ0 A;  3TJG A;  1O85 A;  1R4W A;  1QXH A;  3LYK A;  3IRA A;  2CAQ A;  1SYX A;  3IOS A;  3Q74 A;  4K2D A;  2X8G A;  4RQX A;  2YZH A;  5H5S A;  1GLQ A;  1YKC A;  1YZX A;  1M9A A;  3PR8 A;  2HLS A;  5GAN D;  2RII A;  4OCF A;  8GSS A;  1NW2 A;  1GSS A;  4TR4 A;  2X8C A;  4HZ4 A;  3HD5 A;  4POK A;  4N10 A;  3KP9 A;  2FA4 A;  2F9S A;  5CAX A;  2VL2 A;  4OO5 A;  2V2G A;  1K0C A;  5IMC A;  5C00 A;  1BJX A;  3DKS A;  4I2U A;  4DVC A;  4JU5 A;  4IN0 A;  1MTC A;  1OKT A;  2XPD A;  1TKD B;  2R37 A;  3Q18 A;  1MDK A;  4TXV A;  2LNS A;  1PKW A;  4G10 A;  7GSS A;  3H1N A;  2R6K A;  4YQM A;  2DIY A;  1FVK A;  4ZBD A;  1YF1 A;  2CX3 A;  4ML1 A;  5B8A A;  3LYP A;  1OC9 A;  4LL1 B;  1TRU A;  1GH2 A;  1R26 A;  1T4Y A;  4L5O A;  4V1A p;  3GIX A;  4EO3 A;  3KMO A;  1X9M B;  2XHF A;  2WB9 A;  3GL5 A;  1F37 A;  1A8L A;  1U87 A;  1AQW A;  2R2J A;  3RDW A;  3L9U A;  2I4A A;  2LQQ A;  1B8X A;  5GZZ B;  3Q19 A;  5J9B A;  4NHZ A;  2HSH A;  2EC4 A;  1G7E A;  3GKN A;  3JCM L;  3UOM A;  2R3X A;  1XCC A;  3EMP A;  2YV9 A;  2FWF A;  4LLR A;  1FG4 A;  5F06 A;  1A8Y A;  1S3C A;  2LJR A;  4ZB8 A;  5GSS A;  4MDC A;  5DCH A;  1X5E A;  4WR5 A;  2OBK A;  3LGC A;  2V32 A;  2DJ3 A;  3RAZ A;  3US3 A;  2WDU A;  4V2M A;  3HKR A;  3TCO A;  4POL A;  2PUK C;  2JAD A;  2H66 A;  1B4P A;  1BG5 A;  4X1U A;  3SWL A;  2VCV A;  3HZ4 A;  2VL9 A;  4KCA A;  4F03 A;  1T1V A;  4ZL8 A;  2H75 A;  9GSS A;  4HEA 2;  3GMF A;  3L9V A;  3P7X A;  4QL9 A;  4XS4 A;  3CRU A;  5B7C A;  1M2A A;  3HYP A;  3CTG A;  2EIQ A;  1A0R P;  1XVQ A;  3GKK A;  4OO4 A;  4RUV A;  3ZML A;  3W6G A;  3NIV A;  4K6X A;  5ELG A;  6GST A;  1EP8 A;  3CBU A;  4OMV A;  4EUY A;  4I6X A;  1AQX A;  1UC7 A;  2K9F A;  1XVW A;  2OE1 A;  4WR4 A;  2DJJ A;  2LST A;  1V57 A;  2KP2 A;  3UVT A;  5D8I A;  3C8E A;  2OJL A;  2K18 A;  3E3E A;  4HU7 A;  5IMD A;  2AB6 A;  1CQH A;  2YWI A;  1V58 A;  3PGT A;  4O32 A;  4JR4 A;  3U5R E;  1EV4 A;  5EL8 A;  1A2M A;  2C80 A;  1XW9 A;  1OYJ A;  1HNB A;  5DBQ A;  2IFQ B;  2WZ9 A;  4HJ2 A;  5LNK e;  3M9K A;  3FKF A;  3KIJ A;  4TR1 A;  3D4T A;  1F3B A;  1XOA A;  1K3L A;  3C71 A;  4ID0 A;  1RW1 A;  2GZY A;  2IFQ A;  1R5P A;  4V1A g;  1NHO A;  5IPH A;  2BTO T;  5G30 A;  1ACV A;  4GSS A;  2CQ9 A;  3HHV A;  4IKH A;  4EC0 A;  3LWA A;  3MNG A;  1DUG A;  3D21 A;  4F0C A;  2AV4 A;  1PRX A;  1ILO A;  4MF7 A;  3LXT A;  4G2E A;  2NDO A;  2GGT A;  4MZB A;  2PWJ A;  2A2S A;  1EZK A;  1XZO A;  3G7Y A;  3EMX A;  4TN8 A;  5F05 A;  1ERU A;  3IE3 A;  5IMZ A;  2QC7 A;  1G6W A;  4LMW A;  2YOI A;  3APS A;  4MZW A;  3P2A A;  4KB3 A;  4N30 A;  3OR5 A;  5ECS A;  1YEP A;  4NV5 A;  5J4U A;  4IJI A;  2H1D A;  1J9B A;  3C1R A;  2VOC A;  2FD3 A;  1GSU A;  3W8S A;  5D9X A;  1YJ6 A;  3A2W A;  5CRH A;  1U3I A;  1SD8 A;  2VL3 A;  1FW1 A;  3VI7 A;  2LRC A;  4MAB A;  3HCZ A;  1SK2 A;  2KLX A;  3FEU A;  1UVZ A;  1PA3 A;  2O87 A;  4Z7X A;  2YPM A;  3BCI A;  2H1A A;  3QAG A;  4GQC A;  1GLP A;  4QQ7 A;  5AIX A;  2VL2 C;  5B6M A;  1WRY A;  2CZ2 A;  2WUL A;  5H5Q A;  2KP1 A;  1V9W A;  4AF2 A;  1ZMA A;  3C73 A;  2RUF A;  3KJY A;  2E2M A;  1TOF A;  2CAI A;  2F51 A;  3CSH A;  4BL7 A;  3F9U A;  3VUR A;  1WWJ A;  4KSO A;  2H6X A;  4NHW A;  2RM6 A;  4NV2 A;  1AIU A;  1Y25 A;  3WGE A;  5KN0 A;  2C0E A;  4FYB A;  1GUL A;  6GSS A;  2ON5 A;  1OE8 A;  3HZ8 A;  2IME A;  2HRN A;  1DE1 A;  1I5G A;  5J9C A;  3RPP A;  1ABA A;  2J9H A;  4HDE A;  1XW5 A;  3FR9 A;  4CHS A;  4IEL A;  1K0O A;  4KX4 A;  4ISD A;  3F4T A;  2YCD A;  1Z7R A;  3QD9 A;  2H01 A;  1IYI A;  1K0M A;  3TKS A;  3TJF A;  3KMN A;  4ZB6 A;  4MK3 A;  1PSQ A;  3I69 A;  4OFN A;  4MMM A;  3F4S A;  1VF3 A;  1XW6 A;  1TU8 A;  2XC2 A;  1SJZ A;  4MLY A;  2VCQ A;  4HJM A;  1QGV A;  4ECC A;  2VLT A;  1F2E A;  2PBJ A;  1PMT A;  5DAL B;  4MF5 A;  3QR6 A;  5EVO A;  3MWH A;  4I2T A;  3KXO A;  3I6A A;  1Z9H A;  2B5X A;  2DML A;  2A2R A;  4HUA A;  2L5O A;  2L4Q A;  1JZW A;  4NWY A;  2QGV A;  1AXD A;  2GQM A;  1G7O A;  4K8M A;  11GS A;  3KCM A;  4CDO A;  1N2A A;  5G1L A;  1PQN A;  1XWK A;  2VD0 A;  1VGL A;  3GH9 A;  2N5B A;  2JSZ A;  1PL2 A;  3S9F A;  4X43 A;  1A2J A;  3IBH A;  4ZIL A;  3TKS E;  5G5E A;  2B5Y A;  1IYH A;  3VWX A;  4K7O A;  5KN1 A;  2PU9 C;  4EXJ A;  1LBK A;  2BJX A;  3PIN A;  1A0F A;  1KNG A;  3F3Q A;  1BX9 A;  4ZIJ A;  5ECK B;  1PN9 A;  10GS A;  3KH7 A;  3HA9 A;  2L6C A;  1GSE A;  3IPZ A;  3A2X A;  1GWC A;  1K0N A;  2FNO A;  2HYX A;  1X9W B;  2VUP A;  1JLV A;  2D2Z A;  2HZE B;  1EEJ A;  2GQL A;  4PX1 A;  3ME8 A;  3KTB A;  3L0H A;  3ZTL A;  1GTB A;  1MDJ A;  3TDG A;  2K8S A;  4BVX A;  5FWG A;  3FRC A;  1G0T A;  2VIM A;  4MPG A;  4TXO B;  3LQ7 A;  1TJD A;  1GTI A;  3DML A;  2ZUP A;  5IMV A;  5ECN B;  3TUE A;  2P0G A;  3M9J A;  2IWT A;  1ERW A;  3ZMK A;  3GKM A;  5AGY A;  5CRE A;  2YV7 A;  3E0U A;  1XBS A;  2B3S A;  4HQS A;  1MDI A;  5AN1 A;  1FHE A;  12GS A;  3DVX A;  2WCI A;  1XFL A;  4KE3 A;  4ZXG A;  2AHE A;  4POB A;  2L4C A;  4PGT A;  3NOF A;  2PMT A;  2H74 A;  2XPE A;  4Q5Q A;  3N5O A;  4J57 E;  4KDU A;  1FOV A;  3GFK A;  3CSI A;  2O89 A;  1XWA A;  19GS A;  4GCI A;  3HY2 A;  4IP1 A;  1OVN A;  3GST A;  3DEX A;  5B6N A;  2HE3 A;  1LU4 A;  4WBR D;  4TRX A;  2IMD A;  3LFL A;  2JL4 A;  2H0G A;  2C4J A;  2IN3 A;  3D6I A;  2DC5 A;  1M2D A;  2K6V A;  4IVF A;  4FH8 A;  2H30 A;  1VF1 A;  3KP8 A;  2VCT A;  2CV4 A;  1ZCP A;  1WMJ A;  1SL1 B;  1VF2 A;  1FB0 A;  3G7I A;  4IBP A;  4YAP A;  2XBI A;  4LA1 A;  5JWO B;  1TI1 A;  2PVQ A;  2ALB A;  3APQ A;  3BBY A;  2AUV A;  3ZVJ A;  4XHM A;  2HXK A;  2LS5 A;  2H1G A;  1QQ2 A;  4J2F A;  3UBK A;  5DJM A;  2G2Q A;  4EDY A;  2YNX A;  2IPA A;  1ZGN A;  4DSS B;  4D73 B;  4BWS A;  1EEM A;  3FW2 A;  2HSY A;  20GS A;  3IAS 2;  1SK0 A;  2H0I A;  3ZIV A;  5DDL A;  4DSS A;  1SK1 A;  2VCW A;  3NZN A;  2OA7 A;  4D73 A;  4EVM A;  2DBC A;  3CTF A;  2VD1 A;  2DSA A;  1TXX A;  3GV1 A;  3F63 A;  4KW6 A;  2KOK A;  1TTZ A;  4G19 A;  3J7Y b;  4PUF C;  3UL3 A;  5IQY A;  2MZC A;  3LXZ A;  1E6B A;  1B48 A;  3IXR A;  2M72 A;  1PD2 1;  1WE0 A;  3H93 A;  1WP0 A;  5IOX A;  3TOU A;  5IMA A;  1GL8 A;  5D96 A;  4V2N A;  2X8H A;  4GXZ A;  1VF4 A;  2RUE A;  4MZC A;  3TKS C;  1LJR A;  1BQ7 A;  5IPG A;  5F8B A;  2FWH A;  3FY7 A;  5D9W A;  3ERW A;  3VPQ A;  4L8E A;  1UN2 A;  4WET A;  1ZYQ B;  3WGX A;  2GLR A;  3GH6 A;  2VM2 A;  22GS A;  1GTA A;  2RM5 A;  1TK5 B;  4AJ6 A;  2CT6 A;  5CRD A;  4KND A;  2LJA A;  1BYE A;  1HNC A;  3ERG A;  2LRN A;  2H73 A;  3FZ9 A;  2B1L A;  6GSW A;  2WS2 A;  5ECH B;  4G9H A;  1USB A;  2FCH A;  3O76 A;  2V41 A;  3VK9 A;  4QL7 A;  1QFN A;  2B7J A;  4ZL9 A;  1GSF A;  1EGR A;  1S3D A;  2IL3 A;  2V6K A;  4HI7 A;  4PQ1 A;  3I43 A;  4MJE A;  4POM A;  6GSV A;  1WPI A;  1A23 A;  2FA8 A;  4ULX A;  1RQM A;  4XS1 A;  3TRQ A;  2MBS A;  1M0U A;  2H76 A;  4L5L A;  1XOB A;  5ECO B;  2H71 A;  1O6J A;  3LEF A;  2NVL A;  5D9V A;  1AAZ A;  2IMI A;  1K3Y A;  2C3Q A;  1XWB A;  2LTK A;  1GUM A;  4MCU A;  1M2B A;  3UBL A;  3F6F A;  3EWL A;  1U3A A;  3DIE A;  3RHC A;  4BVY A;  1N8J A;  5IO2 A;  4MH3 A;  3P8W A;  5LCZ A;  2CVK A;  3TJK A;  1KTE A;  1RK4 A;  2J23 A;  4LMV A;  5LD0 A;  3W8J A;  4K0G A;  1FO5 A;  2HNL A;  3C1S A;  1T00 A;  1A24 A;  3U6V A;  2ES7 A;  3GX0 A;  2C3N A;  2AAW A;  2YP6 A;  3MSZ A;  1Z6N A;  2FWE A;  1H4O A;  4FYC A;  1ML6 A;  2IMK A;  3FK8 A;  6GSX A;  3VPT A;  3QFB C; 
#chains in the Genus database with same CATH topology
 1QMV A;  3BCK A;  4NAX A;  3UAP A;  4ECB A;  3M3M A;  1SL2 B;  2PPT A;  4WF5 A;  3FZA A;  5J5N A;  2KUC A;  5ECR B;  1M99 A;  3ZRE A;  3GTU B;  5HFI A;  5G5F A;  4HOJ A;  1OC8 A;  1GUK A;  2E7P A;  3N9J A;  2C0G A;  2OKA A;  2DMM A;  3HVS A;  2H8L A;  2HRF A;  2GSQ A;  3GNJ A;  5IM9 A;  4XIH A;  2EIR A;  4J56 E;  5KEJ A;  3APO A;  3ZFB A;  3F6D A;  3CRT A;  4AJ7 A;  4Q5N A;  3ZFL A;  3IR4 A;  3TKP A;  3EE2 A;  3IC4 A;  4I5Q A;  5ECL B;  1YY7 A;  1XPV A;  1YQ1 A;  3CSJ A;  3FYG A;  4GWR A;  4NXI A;  2ZNM A;  4OWY A;  2GT5 A;  1YF0 A;  5G1K A;  2YWM A;  3UEM A;  1Z7P A;  3SBC A;  4ECI A;  3EU3 A;  4EDZ A;  1JZD A;  4ILF A;  1U88 A;  2O7K A;  4O5R A;  1NSW A;  4ECJ A;  3QOU A;  4YAV A;  1XXU A;  4K7N A;  3QAW A;  4TOP A;  4WF4 A;  2EIO A;  4L0U A;  1T3B A;  1FAA A;  3LOR A;  1Z6M A;  2IJY A;  1E2Y A;  2HT9 A;  4Z2R A;  3IA1 A;  3DGQ A;  2I1U A;  5IIZ A;  2OE0 A;  3GRX A;  3IK9 A;  3VWV A;  4KDX A;  3GHA A;  3ZIT A;  5KOX A;  4F0B A;  3ZIJ A;  2H1B A;  5IOW A;  3TJB A;  3P90 A;  1FOH A;  2NTO A;  3EYT A;  3VLN A;  4HS1 A;  5AIS A;  4DSQ A;  3TOT A;  2MYG A;  1J0F A;  3GA4 A;  3H79 A;  3ZYW A;  1TU7 A;  2GVP A;  3L9S A;  3QPM A;  4GRF A;  3QDN A;  5CRW A;  1SD9 A;  1WOU A;  3MAK A;  1GNE A;  1HQO A;  5A4V A;  1ZL9 A;  1K0A A;  2N5F A;  2P31 A;  4G0L A;  2ON7 A;  3ZZX A;  2I81 A;  3G7J A;  1ERT A;  2H6Z A;  3LSZ A;  1PGT A;  2NPB A;  1CQG A;  2YWO A;  1K0B A;  1R5A A;  2TRX A;  4JBB A;  3FR6 A;  4AGS A;  2H6Y A;  3DYR A;  5DAL A;  3E9J B;  1OC3 A;  3HVX A;  1JZR A;  4PNF A;  1BAY A;  5EY6 A;  3TJJ A;  4KSM A;  3HVV A;  4IJ3 A;  1YEX A;  2OE3 A;  1OE7 A;  2OAC A;  4JRR A;  1PX6 A;  4MF6 A;  1JLW A;  3L78 A;  3HXS A;  4L0W A;  3KM6 A;  2DKH A;  4H86 A;  5E4W A;  4RQR A;  1EGO A;  3PH9 A;  2YZU A;  4GF0 A;  4MA9 A;  2VCX A;  3G9B A;  1Q4J A;  4E8E A;  4I97 A;  3V1W A;  1SEN A;  1TRV A;  1DSB A;  4FO5 A;  5F0G A;  3ISO A;  3UJ1 A;  1HD2 A;  2MMN A;  2X4A A;  1EV9 A;  4MJA A;  5ECP B;  4JE1 A;  4Q5F A;  4CW9 A;  2GTU A;  3ME7 A;  1NM3 A;  3A2V A;  3DXB A;  2DIZ A;  2G0F A;  4LL4 B;  2DJ1 A;  2FLS A;  1K0D A;  3TGZ A;  2FUG 2;  5ENU A;  3FHK A;  2R4V A;  2HZE A;  4HQZ A;  3QCP A;  3GL3 A;  4K5S A;  4WEY A;  5JCW A;  3KEB A;  5ECI B;  1ON4 A;  3EC3 A;  1M9B A;  1W89 A;  1TW9 A;  2VO4 A;  4GLT A;  5COH A;  5CO3 A;  3MDK A;  4TXO A;  5JWQ B;  3WD6 A;  1TI3 A;  2F8A A;  4HZ2 A;  5GST A;  5KN3 A;  2GSS A;  4OFT A;  3GYK A;  2A2P A;  2C3T A;  1V2A A;  4I8B A;  2GST A;  3UAR A;  3AY8 A;  2L5L A;  4EE0 A;  1W4V A;  3RBT A;  3TRP A;  1B9Y C;  4YQU A;  1X5C A;  5DJL A;  3ZVJ D;  4KCE A;  2JZT A;  4NPB A;  4PUA A;  1O8X A;  1TK0 B;  4XS6 A;  2GZP A;  2LNT A;  2LKU A;  2BMX A;  2PN8 A;  4E8H A;  4IP6 A;  5A4W A;  2GZZ A;  3HVN A;  4GTU A;  3QFA C;  5HFK A;  4BA7 A;  4RI6 A;  1XG8 A;  3FZ4 A;  1JFU A;  5HQP A;  2B1K A;  2MBT A;  2VLV A;  4PUR A;  3UMA A;  1F3A A;  1B4Q A;  4XRD A;  4PQH A;  3TB2 A;  3HJM A;  1NHY A;  1T8E B;  3HJP A;  1ZZY A;  1OC9 B;  3FR3 A;  2VM1 A;  4OD7 A;  4PQI A;  2PER A;  4Z2T A;  1THX A;  2I3Y A;  4WXT A;  5CRG A;  4X0X A;  5J3R A;  3MIX A;  5B8B A;  3UVH A;  5D73 A;  4IHU A;  3O6T A;  4MPF A;  2DLX A;  1TRW A;  1X9S B;  2ZCT A;  2VLU A;  1XWG A;  2P5R A;  4N11 A;  4F9Z A;  3BJ5 A;  5HR2 A;  4WKW A;  4KA0 A;  1F6M C;  3KD0 A;  1ZYN A;  5JCG A;  3EIN A;  6GSU A;  2RLI A;  4JR6 A;  3C7M A;  4FYU A;  2V6O A;  2M46 A;  2MMO A;  2H19 A;  2O8V B;  2WGR A;  2LEG A;  1AC1 A;  2QSI A;  2Z9S A;  13GS A;  4FQU A;  4KGI A;  5HR3 A;  6GSY A;  1AQV A;  2H0H A;  2L59 A;  4PXO A;  5GAP D;  5JWR B;  4TW5 A;  1ZOF A;  1M3J A;  1SYR A;  2HRA A;  2L57 A;  3M1G A;  2KHP A;  4EKZ A;  1GSY A;  3TRX A;  4RI7 A;  1QUW A;  4XS4 B;  2FY6 A;  1YDK A;  16GS A;  5H5R A;  1QK8 A;  1EOH A;  4K7I A;  1MEK A;  2C0D A;  2FHE A;  2CVD A;  2TIR A;  2YAN A;  4GST A;  3I9V 2;  5BRT A;  2MMA A;  3CMI A;  1X5D A;  3F3R A;  4KUN A;  1TK8 B;  3GUR A;  3IAM 2;  1F9M A;  2HI7 A;  3GN3 A;  4DSR A;  3IHQ A;  1JHB A;  3EVI A;  2LUS A;  1GTU A;  1KEB A;  1GSD A;  4NMU A;  2R0C A;  1XIY A;  5E59 A;  2A4V A;  2IMF A;  5D93 A;  3WYW A;  1GUH A;  1U6T A;  5DCG A;  1SU9 A;  4WBJ A;  2A4H A;  2E2G A;  1FVJ A;  3ZL5 A;  2CA8 A;  1H75 A;  1XWC A;  1Z5Y E;  4K0N A;  5IO0 A;  2HZF A;  5C04 A;  2B7K A;  2XBQ A;  3UIW A;  14GS A;  3GKX A;  2H70 A;  1PKZ A;  4N0V A;  2JU5 A;  4ZB9 A;  2REM A;  4IQA A;  2F3M A;  4GQF A;  4TR1 B;  4IW9 A;  2R5G A;  3D4M A;  5G31 A;  3ZRD A;  1ERV A;  1M7T A;  4YKF A;  2DJ2 A;  2WJU A;  1J08 A;  4Q5R A;  4YQV A;  4HSC X;  1TDI A;  1X0R A;  3D0Z A;  4KDY A;  3ERF A;  1SKW B;  2GT6 A;  3CXG A;  2CVB A;  4AJ8 A;  1ZYE A;  3F8U A;  2F8F A;  1O81 A;  3WT2 A;  4ZBB A;  4K9Z A;  4GSN A;  5HR1 A;  3WT1 A;  2NBS A;  5DQY A;  3DD3 A;  4KH7 A;  5CNW A;  3RHB A;  4EF0 A;  4TVE A;  3KGK A;  3TKR A;  1KBN A;  5HFG A;  3IV4 A;  2P5Q A;  1A2L A;  1B9X C;  3DRN A;  3Q6O A;  3KZQ A;  5EPF A;  4K1F A;  1AUC A;  1THO A;  4FIW A;  2C8U A;  3CQF A;  2B6M A;  4MJB A;  5DVB A;  4ACS A;  18GS A;  1EP7 A;  4MJC A;  2HFD A;  4EIQ A;  5KN2 A;  1G6Y A;  2OAD A;  2TRC P;  4PNG A;  2GQK A;  3GTU A;  3H4K A;  4TR0 A;  5ID2 B;  1SKS B;  2E0Q A;  4F82 A;  4V2L A;  1TRS A;  2C0F A;  2VAF A;  3DWV A;  1TP9 A;  2JZR A;  3QMX A;  4F2I A;  4MH2 A;  5ID2 A;  2DJK A;  3HJO A;  1I9D A;  4XCS A;  3GUS A;  3IHG A;  2GS3 A;  3ZLP A;  2V1M A;  3A5W A;  4EL1 A;  2JZS A;  4ML6 A;  1V98 A;  1O8W A;  2YN1 A;  3TKQ A;  5FT3 A;  2YJ7 A;  2GDR A;  2JAC A;  2C1Y A;  4O7H A;  3KTL A;  4XTS A;  4TKY A;  2H72 A;  1SJ6 A;  5AIV A;  5D9T A;  2AYT A;  2YWN A;  5L71 A;  1K3O A;  3WGD A;  3D5J A;  1PL1 A;  4XRA A;  4CY6 A;  4YKG A;  4ZL7 A;  4YH2 A;  1SKR B;  3L4N A;  5F07 A;  5IMF A;  4ICY A;  2CX4 A;  1Q98 A;  5FHI A;  2WFC A;  2HSM A;  2N5A A;  2I9H A;  2M80 A;  1UA5 A;  2O85 A;  3GX8 A;  2PVO C;  1T4Z A;  5DQS A;  2K8V A;  1Z3E A;  2QKE A;  4N0Z A;  2AJQ B;  1GSQ A;  3VWU A;  3FZ5 A;  5ABR A;  1SL0 B;  2B5E A;  3H8Q A;  5ECQ B;  1S3A A;  3K8N A;  2L6D A;  2GSR A;  2X64 A;  3O3T A;  3KH9 A;  5DAK B;  1VRS D;  3D22 A;  3ED3 A;  3QAV A;  4IQ1 A;  3VWW A;  5HR0 A;  5DAK A;  1OAZ A;  1OKD A;  5INY A;  2WRT A;  2YJH A;  4ZBA A;  2LRT A;  4BPY A;  3M8N A;  1MD4 A;  5A4U A;  3GSS A;  3M0F A;  4O5Q A;  3BD2 A;  1GNW A;  3F0I A;  4JED A;  1JZO A;  2MMZ A;  4MP4 A;  4DEJ A;  1DE2 A;  3CYN A;  1DBY A;  3EU4 A;  4JZQ A;  3J7Y k;  2CZ3 A;  1HNA A;  3LG6 A;  1EOG A;  1V40 A;  3A3T A;  4KAE A;  1URM A;  4P3Y B;  1WJK A;  5G2Z A;  1WIK A;  1C72 A;  3RPN A;  2FWG A;  2LV3 A;  4KF9 A;  4O92 A;  2OBI A;  1AW9 A;  4A5P A;  2LJK A;  5CP1 A;  4TR3 A;  4HU9 A;  3VFI A;  4IS0 A;  3BOA A;  5ELA A;  4OCE A;  4OFM A;  1BED A;  1GP1 A;  1YKA A;  1ST9 A;  1MD3 A;  4BVX B;  1HYU A;  3DVW A;  1T7P B;  2VCZ A;  3EUR A;  1O7U A;  4BWQ A;  1Y6E A;  1R7H A;  17GS A;  2IIY A;  2FGX A;  2LQO A;  3VI5 A;  2PGT A;  3F4R A;  2JSY A;  2X99 A;  1PX7 A;  4K5R A;  5ECM B;  1O73 A;  5J41 A;  3IK7 A;  1SJI A;  4IGJ A;  3HDC A;  5JCU A;  1FB6 A;  5CYY A;  1EWX A;  3R2Q A;  3LJR A;  4EIP A;  1GRX A;  3IDV A;  5A5K A;  2DJ0 A;  3TJG A;  1O85 A;  1R4W A;  1QXH A;  3LYK A;  3IRA A;  2CAQ A;  1SYX A;  3IOS A;  3Q74 A;  4K2D A;  2X8G A;  4RQX A;  2YZH A;  5H5S A;  1GLQ A;  1YKC A;  1YZX A;  1M9A A;  3PR8 A;  2HLS A;  5GAN D;  2RII A;  4OCF A;  8GSS A;  1NW2 A;  1GSS A;  4TR4 A;  2X8C A;  4HZ4 A;  3HD5 A;  4POK A;  4N10 A;  3KP9 A;  2FA4 A;  2F9S A;  5CAX A;  2VL2 A;  4OO5 A;  2V2G A;  1K0C A;  5IMC A;  5C00 A;  1BJX A;  3DKS A;  4I2U A;  4DVC A;  4JU5 A;  4IN0 A;  1MTC A;  1OKT A;  2XPD A;  1TKD B;  2R37 A;  3Q18 A;  1MDK A;  4TXV A;  2LNS A;  1PKW A;  4G10 A;  7GSS A;  3H1N A;  2R6K A;  4YQM A;  2DIY A;  1FVK A;  4ZBD A;  1YF1 A;  2CX3 A;  2UZ8 A;  4ML1 A;  5B8A A;  3LYP A;  1OC9 A;  4LL1 B;  1TRU A;  1GH2 A;  1R26 A;  1T4Y A;  4L5O A;  4V1A p;  3GIX A;  4EO3 A;  3KMO A;  1X9M B;  2XHF A;  3PPU A;  2WB9 A;  3GL5 A;  1F37 A;  1A8L A;  1U87 A;  1AQW A;  1PN0 A;  2R2J A;  3A5I A;  3RDW A;  3L9U A;  2I4A A;  2LQQ A;  1B8X A;  5GZZ B;  3Q19 A;  5J9B A;  4NHZ A;  2HSH A;  2EC4 A;  1G7E A;  1ZYP A;  3GKN A;  3JCM L;  3UOM A;  2R3X A;  1XCC A;  3EMP A;  2YV9 A;  2FWF A;  4LLR A;  1FG4 A;  5F06 A;  1A8Y A;  1S3C A;  2LJR A;  4ZB8 A;  5GSS A;  4MDC A;  5DCH A;  1X5E A;  4WR5 A;  2OBK A;  3LGC A;  2V32 A;  2DJ3 A;  3RAZ A;  3US3 A;  2WDU A;  4V2M A;  3HKR A;  3TCO A;  4POL A;  2PUK C;  2JAD A;  2H66 A;  1B4P A;  1BG5 A;  4X1U A;  3SWL A;  2VCV A;  3HZ4 A;  2VL9 A;  4KCA A;  4F03 A;  1T1V A;  4ZL8 A;  2H75 A;  4G0I A;  9GSS A;  4HEA 2;  3GMF A;  3L9V A;  3P7X A;  4QL9 A;  4XS4 A;  3CRU A;  5B7C A;  1M2A A;  3HYP A;  3CTG A;  2EIQ A;  1A0R P;  1XVQ A;  4PTS A;  3GKK A;  4OO4 A;  4RUV A;  3ZML A;  3W6G A;  3NIV A;  4K6X A;  5ELG A;  6GST A;  1EP8 A;  3CBU A;  4OMV A;  4EUY A;  4I6X A;  1AQX A;  1UC7 A;  2R0G A;  2K9F A;  1XVW A;  2OE1 A;  4WR4 A;  2QA2 A;  2DJJ A;  2LST A;  3IC8 A;  1S3R A;  1V57 A;  2KP2 A;  3UVT A;  5D8I A;  3C8E A;  2OJL A;  5KOW A;  2K18 A;  3E3E A;  4HU7 A;  5IMD A;  2AB6 A;  1CQH A;  2YWI A;  1V58 A;  3PGT A;  4O32 A;  4JR4 A;  3U5R E;  1EV4 A;  5EL8 A;  1A2M A;  2C80 A;  1XW9 A;  1OYJ A;  1HNB A;  5DBQ A;  2IFQ B;  3MYD A;  2WZ9 A;  4HJ2 A;  5LNK e;  3M9K A;  3FKF A;  3KIJ A;  4TR1 A;  4BVY B;  3D4T A;  1F3B A;  1XOA A;  1K3L A;  3C71 A;  4ID0 A;  1RW1 A;  2GZY A;  2IFQ A;  1R5P A;  4V1A g;  1NHO A;  5IPH A;  2BTO T;  5G30 A;  1ACV A;  4GSS A;  2CQ9 A;  3HHV A;  4IKH A;  4EC0 A;  3LWA A;  3MNG A;  1DUG A;  3D21 A;  4F0C A;  2AV4 A;  1PRX A;  1ILO A;  4MF7 A;  3LXT A;  4G2E A;  2NDO A;  2GGT A;  4MZB A;  2PWJ A;  2A2S A;  1EZK A;  1XZO A;  3G7Y A;  3EMX A;  4TN8 A;  5F05 A;  1ERU A;  3IE3 A;  5IMZ A;  2QC7 A;  1G6W A;  3EPT A;  4LMW A;  2X49 A;  2YOI A;  4USS A;  3APS A;  4MZW A;  3P2A A;  4KB3 A;  4N30 A;  3OR5 A;  5ECS A;  1YEP A;  4NV5 A;  5J4U A;  4IJI A;  2H1D A;  1J9B A;  3C1R A;  2VOC A;  2FD3 A;  5BMU A;  1GSU A;  3W8S A;  5D9X A;  1YJ6 A;  3A2W A;  5CRH A;  1U3I A;  1SD8 A;  2VL3 A;  1FW1 A;  3VI7 A;  4MAB A;  2LRC A;  3HCZ A;  1SK2 A;  2KLX A;  3FEU A;  1UVZ A;  1PA3 A;  2O87 A;  4Z7X A;  2YPM A;  3BCI A;  2H1A A;  3QAG A;  4GQC A;  1GLP A;  4QQ7 A;  2DKI A;  5AIX A;  2VL2 C;  5B6M A;  1WRY A;  2CZ2 A;  2WUL A;  5H5Q A;  2KP1 A;  1V9W A;  4BL7 B;  4AF2 A;  1ZMA A;  3C73 A;  2RUF A;  3KJY A;  2E2M A;  1TOF A;  2CAI A;  2F51 A;  3CSH A;  4BL7 A;  3F9U A;  3VUR A;  1WWJ A;  4KSO A;  2H6X A;  4NHW A;  2RM6 A;  4NV2 A;  1AIU A;  1Y25 A;  3WGE A;  5KN0 A;  2C0E A;  4FYB A;  1GUL A;  6GSS A;  2ON5 A;  1OE8 A;  3HZ8 A;  2IME A;  2HRN A;  1DE1 A;  1I5G A;  5J9C A;  3RPP A;  1ABA A;  2J9H A;  4HDE A;  1XW5 A;  3FR9 A;  4CHS A;  4IEL A;  1K0O A;  4KX4 A;  4ISD A;  3F4T A;  2YCD A;  1Z7R A;  3QD9 A;  2H01 A;  1IYI A;  1K0M A;  3TKS A;  3TJF A;  3KMN A;  4ZB6 A;  4MK3 A;  1PSQ A;  3I69 A;  4OFN A;  4MMM A;  3F4S A;  1VF3 A;  1XW6 A;  1TU8 A;  2XC2 A;  1SJZ A;  4MLY A;  2VCQ A;  4HJM A;  1QGV A;  4ECC A;  2VLT A;  1F2E A;  2PBJ A;  1PMT A;  5DAL B;  4MF5 A;  3QR6 A;  5EVO A;  3MWH A;  4I2T A;  3KXO A;  3I6A A;  1Z9H A;  2B5X A;  2DML A;  2A2R A;  4HUA A;  2L5O A;  2L4Q A;  1JZW A;  4NWY A;  2QGV A;  1M3I A;  1AXD A;  4G0K A;  2GQM A;  1G7O A;  4K8M A;  11GS A;  3KCM A;  4CDO A;  1N2A A;  5G1L A;  1PQN A;  1XWK A;  2VD0 A;  1VGL A;  3GH9 A;  2N5B A;  2JSZ A;  1PL2 A;  3S9F A;  4X43 A;  1A2J A;  3IBH A;  4ZIL A;  3TKS E;  5G5E A;  2B5Y A;  1IYH A;  3VWX A;  3R3E A;  4K7O A;  5KN1 A;  2PU9 C;  4EXJ A;  1LBK A;  2BJX A;  3PIN A;  1A0F A;  1KNG A;  3F3Q A;  1BX9 A;  4ZIJ A;  5ECK B;  1PN9 A;  10GS A;  3KH7 A;  3HA9 A;  2L6C A;  1GSE A;  3IPZ A;  3A2X A;  1GWC A;  1K0N A;  2FNO A;  2HYX A;  1X9W B;  2VUP A;  1JLV A;  2D2Z A;  2HZE B;  1EEJ A;  2GQL A;  4Z2U A;  4PX1 A;  3ME8 A;  3KTB A;  3L0H A;  3ZTL A;  1GTB A;  1MDJ A;  3TDG A;  2K8S A;  4BVX A;  5FWG A;  3FRC A;  1G0T A;  2VIM A;  4MPG A;  4TXO B;  3LQ7 A;  1TJD A;  1GTI A;  3DML A;  2ZUP A;  5IMV A;  5ECN B;  3TUE A;  2P0G A;  3M9J A;  2IWT A;  1ERW A;  3ZMK A;  3GKM A;  5AGY A;  5CRE A;  2YV7 A;  3E0U A;  1XBS A;  2B3S A;  4HQS A;  1MDI A;  5AN1 A;  1FHE A;  12GS A;  3DVX A;  2WCI A;  1XFL A;  4KE3 A;  4ZXG A;  2AHE A;  4POB A;  2L4C A;  4PGT A;  3NOF A;  2PMT A;  2H74 A;  3LW9 A;  2XPE A;  4Q5Q A;  3N5O A;  3FMW A;  4J57 E;  4KDU A;  1FOV A;  3GFK A;  3CSI A;  2O89 A;  1XWA A;  19GS A;  4GCI A;  3HY2 A;  4IP1 A;  1OVN A;  3GST A;  3DEX A;  5B6N A;  2HE3 A;  1LU4 A;  4WBR D;  4TRX A;  2IMD A;  3LFL A;  2JL4 A;  2H0G A;  2C4J A;  2IN3 A;  3D6I A;  2DC5 A;  1M2D A;  2K6V A;  4IVF A;  4FH8 A;  2H30 A;  1VF1 A;  4X4J A;  3KP8 A;  2VCT A;  2CV4 A;  1ZCP A;  1WMJ A;  1SL1 B;  1VF2 A;  1FB0 A;  3G7I A;  4IBP A;  4YAP A;  2XBI A;  4LA1 A;  5JWO B;  1TI1 A;  2HRK A;  2PVQ A;  2ALB A;  3APQ A;  3BBY A;  2AUV A;  3ZVJ A;  4XHM A;  2HXK A;  2LS5 A;  2H1G A;  1QQ2 A;  4J2F A;  3UBK A;  5DJM A;  2G2Q A;  4EDY A;  2YNX A;  2IPA A;  1ZGN A;  4DSS B;  4D73 B;  4BWS A;  1EEM A;  4BIK A;  3FW2 A;  2HSY A;  20GS A;  4O5U A;  3IAS 2;  1SK0 A;  2H0I A;  3ZIV A;  5DDL A;  4DSS A;  1SK1 A;  2VCW A;  3NZN A;  2OA7 A;  4D73 A;  4EVM A;  2DBC A;  3CTF A;  2VD1 A;  2DSA A;  1TXX A;  3GV1 A;  3F63 A;  4KW6 A;  2KOK A;  1TTZ A;  4G19 A;  3J7Y b;  4PUF C;  3UL3 A;  5IQY A;  2MZC A;  3LXZ A;  1E6B A;  1B48 A;  3IXR A;  2M72 A;  1PD2 1;  1WE0 A;  3H93 A;  1WP0 A;  5IOX A;  3TOU A;  5IMA A;  1GL8 A;  2R0P A;  5D96 A;  4V2N A;  2X8H A;  4GXZ A;  1VF4 A;  2RUE A;  4MZC A;  3TKS C;  1LJR A;  1BQ7 A;  5IPG A;  5F8B A;  2FWH A;  3FY7 A;  5D9W A;  3ERW A;  3VPQ A;  4L8E A;  1UN2 A;  4WET A;  1ZYQ B;  3WGX A;  2GLR A;  3GH6 A;  2VM2 A;  22GS A;  1GTA A;  2RM5 A;  1TK5 B;  4AJ6 A;  2CT6 A;  5CRD A;  4KND A;  2LJA A;  1BYE A;  1HNC A;  3ERG A;  2LRN A;  2H73 A;  3FZ9 A;  2B1L A;  6GSW A;  2WS2 A;  5ECH B;  4G9H A;  1USB A;  2FCH A;  3O76 A;  4MNN A;  2V41 A;  3VK9 A;  4QL7 A;  1QFN A;  2B7J A;  4CY8 A;  4ZL9 A;  1GSF A;  1EGR A;  1S3D A;  2IL3 A;  2V6K A;  4HI7 A;  4PQ1 A;  3I43 A;  4MJE A;  4POM A;  6GSV A;  1WPI A;  1A23 A;  2FA8 A;  4ULX A;  1RQM A;  4XS1 A;  3TRQ A;  2MBS A;  1M0U A;  2H76 A;  4L5L A;  1XOB A;  5ECO B;  2H71 A;  1O6J A;  3LEF A;  2NVL A;  5D9V A;  1AAZ A;  2IMI A;  1K3Y A;  2C3Q A;  1XWB A;  2LTK A;  1GUM A;  4MCU A;  1M2B A;  3UBL A;  3F6F A;  3EWL A;  1U3A A;  4K2X A;  3DIE A;  3RHC A;  4BVY A;  1N8J A;  5IO2 A;  4MH3 A;  3P8W A;  5LCZ A;  2CVK A;  3TJK A;  1KTE A;  1RK4 A;  2J23 A;  4LMV A;  5LD0 A;  3W8J A;  4K0G A;  1FO5 A;  2HNL A;  3C1S A;  1T00 A;  1A24 A;  3U6V A;  2ES7 A;  3GX0 A;  1PFO A;  2C3N A;  2AAW A;  2YP6 A;  3MSZ A;  1Z6N A;  2FWE A;  2QA1 A;  1H4O A;  4FYC A;  1ML6 A;  2IMK A;  3FK8 A;  6GSX A;  3VPT A;  3QFB C; 
#chains in the Genus database with same CATH homology
 1QMV A;  3BCK A;  4NAX A;  3UAP A;  4ECB A;  3M3M A;  1SL2 B;  2PPT A;  4WF5 A;  3FZA A;  5J5N A;  2KUC A;  5ECR B;  1M99 A;  3ZRE A;  3GTU B;  5HFI A;  5G5F A;  4HOJ A;  1OC8 A;  1GUK A;  2E7P A;  3N9J A;  2C0G A;  2OKA A;  2DMM A;  3HVS A;  2H8L A;  2HRF A;  2GSQ A;  3GNJ A;  5IM9 A;  4XIH A;  2EIR A;  4J56 E;  5KEJ A;  3APO A;  3ZFB A;  3F6D A;  3CRT A;  4AJ7 A;  4Q5N A;  3ZFL A;  3IR4 A;  3TKP A;  3EE2 A;  3IC4 A;  4I5Q A;  5ECL B;  1YY7 A;  1XPV A;  1YQ1 A;  3CSJ A;  3FYG A;  4GWR A;  4NXI A;  2ZNM A;  4OWY A;  2GT5 A;  1YF0 A;  5G1K A;  2YWM A;  3UEM A;  1Z7P A;  3SBC A;  4ECI A;  3EU3 A;  4EDZ A;  1JZD A;  4ILF A;  1U88 A;  2O7K A;  4O5R A;  1NSW A;  4ECJ A;  3QOU A;  4YAV A;  1XXU A;  4K7N A;  3QAW A;  4TOP A;  4WF4 A;  2EIO A;  4L0U A;  1T3B A;  1FAA A;  3LOR A;  1Z6M A;  2IJY A;  1E2Y A;  2HT9 A;  4Z2R A;  3IA1 A;  3DGQ A;  2I1U A;  5IIZ A;  2OE0 A;  3GRX A;  3IK9 A;  3VWV A;  4KDX A;  3GHA A;  3ZIT A;  5KOX A;  4F0B A;  3ZIJ A;  2H1B A;  5IOW A;  3TJB A;  3P90 A;  1FOH A;  2NTO A;  3EYT A;  3VLN A;  4HS1 A;  5AIS A;  4DSQ A;  3TOT A;  2MYG A;  1J0F A;  3GA4 A;  3H79 A;  3ZYW A;  1TU7 A;  2GVP A;  3L9S A;  3QPM A;  4GRF A;  3QDN A;  5CRW A;  1SD9 A;  1WOU A;  3MAK A;  1GNE A;  1HQO A;  5A4V A;  1ZL9 A;  1K0A A;  2N5F A;  2P31 A;  4G0L A;  2ON7 A;  3ZZX A;  2I81 A;  3G7J A;  1ERT A;  2H6Z A;  3LSZ A;  1PGT A;  2NPB A;  1CQG A;  2YWO A;  1K0B A;  1R5A A;  2TRX A;  4JBB A;  3FR6 A;  4AGS A;  2H6Y A;  3DYR A;  5DAL A;  3E9J B;  1OC3 A;  3HVX A;  1JZR A;  4PNF A;  1BAY A;  5EY6 A;  3TJJ A;  4KSM A;  3HVV A;  4IJ3 A;  1YEX A;  2OE3 A;  1OE7 A;  2OAC A;  4JRR A;  1PX6 A;  4MF6 A;  1JLW A;  3L78 A;  3HXS A;  4L0W A;  3KM6 A;  2DKH A;  4H86 A;  5E4W A;  4RQR A;  1EGO A;  3PH9 A;  2YZU A;  4GF0 A;  4MA9 A;  2VCX A;  3G9B A;  1Q4J A;  4E8E A;  4I97 A;  3V1W A;  1SEN A;  1TRV A;  1DSB A;  4FO5 A;  5F0G A;  3ISO A;  3UJ1 A;  1HD2 A;  2MMN A;  2X4A A;  1EV9 A;  4MJA A;  5ECP B;  4JE1 A;  4Q5F A;  4CW9 A;  2GTU A;  3ME7 A;  1NM3 A;  3A2V A;  3DXB A;  2DIZ A;  2G0F A;  4LL4 B;  2DJ1 A;  2FLS A;  1K0D A;  3TGZ A;  2FUG 2;  5ENU A;  3FHK A;  2R4V A;  2HZE A;  4HQZ A;  3QCP A;  3GL3 A;  4K5S A;  4WEY A;  5JCW A;  3KEB A;  5ECI B;  1ON4 A;  3EC3 A;  1M9B A;  1W89 A;  1TW9 A;  2VO4 A;  4GLT A;  5COH A;  5CO3 A;  3MDK A;  4TXO A;  5JWQ B;  3WD6 A;  1TI3 A;  2F8A A;  4HZ2 A;  5GST A;  5KN3 A;  2GSS A;  4OFT A;  3GYK A;  2A2P A;  2C3T A;  1V2A A;  4I8B A;  2GST A;  3UAR A;  3AY8 A;  2L5L A;  4EE0 A;  1W4V A;  3RBT A;  3TRP A;  1B9Y C;  4YQU A;  1X5C A;  5DJL A;  3ZVJ D;  4KCE A;  2JZT A;  4NPB A;  4PUA A;  1O8X A;  1TK0 B;  4XS6 A;  2GZP A;  2LNT A;  2LKU A;  2BMX A;  2PN8 A;  4E8H A;  4IP6 A;  5A4W A;  2GZZ A;  4GTU A;  3QFA C;  5HFK A;  4BA7 A;  4RI6 A;  3FZ4 A;  1JFU A;  5HQP A;  2B1K A;  2MBT A;  2VLV A;  4PUR A;  3UMA A;  1F3A A;  1B4Q A;  4XRD A;  4PQH A;  3TB2 A;  3HJM A;  1NHY A;  1T8E B;  3HJP A;  1ZZY A;  1OC9 B;  3FR3 A;  2VM1 A;  4OD7 A;  4PQI A;  2PER A;  4Z2T A;  1THX A;  2I3Y A;  4WXT A;  5CRG A;  4X0X A;  5J3R A;  3MIX A;  5B8B A;  3UVH A;  5D73 A;  4IHU A;  3O6T A;  4MPF A;  2DLX A;  1TRW A;  1X9S B;  2ZCT A;  2VLU A;  1XWG A;  2P5R A;  4N11 A;  4F9Z A;  3BJ5 A;  5HR2 A;  4WKW A;  4KA0 A;  1F6M C;  3KD0 A;  1ZYN A;  5JCG A;  3EIN A;  6GSU A;  2RLI A;  4JR6 A;  3C7M A;  4FYU A;  2V6O A;  2M46 A;  2MMO A;  2H19 A;  2O8V B;  2WGR A;  2LEG A;  1AC1 A;  2QSI A;  2Z9S A;  13GS A;  4FQU A;  4KGI A;  5HR3 A;  6GSY A;  1AQV A;  2H0H A;  2L59 A;  4PXO A;  5GAP D;  5JWR B;  4TW5 A;  1ZOF A;  1SYR A;  2HRA A;  2L57 A;  3M1G A;  2KHP A;  4EKZ A;  1GSY A;  3TRX A;  4RI7 A;  1QUW A;  4XS4 B;  2FY6 A;  1YDK A;  16GS A;  5H5R A;  1QK8 A;  1EOH A;  4K7I A;  1MEK A;  2C0D A;  2FHE A;  2CVD A;  2TIR A;  2YAN A;  4GST A;  3I9V 2;  5BRT A;  2MMA A;  3CMI A;  1X5D A;  3F3R A;  4KUN A;  1TK8 B;  3GUR A;  3IAM 2;  1F9M A;  2HI7 A;  3GN3 A;  4DSR A;  3IHQ A;  1JHB A;  3EVI A;  2LUS A;  1GTU A;  1KEB A;  1GSD A;  4NMU A;  2R0C A;  1XIY A;  5E59 A;  2A4V A;  2IMF A;  5D93 A;  3WYW A;  1GUH A;  1U6T A;  5DCG A;  1SU9 A;  4WBJ A;  2A4H A;  2E2G A;  1FVJ A;  3ZL5 A;  2CA8 A;  1H75 A;  1XWC A;  1Z5Y E;  4K0N A;  5IO0 A;  2HZF A;  5C04 A;  2B7K A;  2XBQ A;  3UIW A;  14GS A;  3GKX A;  2H70 A;  1PKZ A;  4N0V A;  2JU5 A;  4ZB9 A;  2REM A;  4IQA A;  2F3M A;  4GQF A;  4TR1 B;  4IW9 A;  2R5G A;  3D4M A;  5G31 A;  3ZRD A;  1ERV A;  1M7T A;  4YKF A;  2DJ2 A;  2WJU A;  1J08 A;  4Q5R A;  4YQV A;  1TDI A;  1X0R A;  3D0Z A;  4KDY A;  3ERF A;  1SKW B;  2GT6 A;  3CXG A;  2CVB A;  4AJ8 A;  1ZYE A;  3F8U A;  2F8F A;  1O81 A;  3WT2 A;  4ZBB A;  4K9Z A;  4GSN A;  5HR1 A;  3WT1 A;  2NBS A;  5DQY A;  3DD3 A;  4KH7 A;  5CNW A;  3RHB A;  4EF0 A;  4TVE A;  3KGK A;  3TKR A;  1KBN A;  5HFG A;  3IV4 A;  2P5Q A;  1A2L A;  1B9X C;  3DRN A;  3Q6O A;  3KZQ A;  5EPF A;  4K1F A;  1AUC A;  1THO A;  4FIW A;  2C8U A;  2B6M A;  4MJB A;  5DVB A;  4ACS A;  18GS A;  1EP7 A;  4MJC A;  2HFD A;  4EIQ A;  5KN2 A;  1G6Y A;  2OAD A;  2TRC P;  4PNG A;  2GQK A;  3GTU A;  3H4K A;  4TR0 A;  5ID2 B;  1SKS B;  2E0Q A;  4F82 A;  4V2L A;  1TRS A;  2C0F A;  2VAF A;  3DWV A;  1TP9 A;  2JZR A;  3QMX A;  4F2I A;  4MH2 A;  5ID2 A;  2DJK A;  3HJO A;  1I9D A;  4XCS A;  3GUS A;  3IHG A;  2GS3 A;  3ZLP A;  2V1M A;  3A5W A;  4EL1 A;  2JZS A;  4ML6 A;  1V98 A;  1O8W A;  2YN1 A;  3TKQ A;  5FT3 A;  2YJ7 A;  2GDR A;  2JAC A;  2C1Y A;  4O7H A;  3KTL A;  4XTS A;  4TKY A;  2H72 A;  1SJ6 A;  5AIV A;  5D9T A;  2AYT A;  2YWN A;  5L71 A;  1K3O A;  3WGD A;  3D5J A;  1PL1 A;  4XRA A;  4CY6 A;  4YKG A;  4ZL7 A;  4YH2 A;  1SKR B;  3L4N A;  5F07 A;  5IMF A;  4ICY A;  2CX4 A;  1Q98 A;  5FHI A;  2WFC A;  2HSM A;  2N5A A;  2I9H A;  2M80 A;  1UA5 A;  2O85 A;  3GX8 A;  2PVO C;  1T4Z A;  5DQS A;  2K8V A;  1Z3E A;  2QKE A;  4N0Z A;  2AJQ B;  1GSQ A;  3VWU A;  3FZ5 A;  5ABR A;  1SL0 B;  2B5E A;  3H8Q A;  5ECQ B;  1S3A A;  3K8N A;  2L6D A;  2GSR A;  2X64 A;  3O3T A;  3KH9 A;  5DAK B;  1VRS D;  3D22 A;  3ED3 A;  3QAV A;  4IQ1 A;  3VWW A;  5HR0 A;  5DAK A;  1OAZ A;  1OKD A;  5INY A;  2WRT A;  2YJH A;  4ZBA A;  2LRT A;  4BPY A;  3M8N A;  1MD4 A;  5A4U A;  3GSS A;  3M0F A;  4O5Q A;  3BD2 A;  1GNW A;  3F0I A;  4JED A;  1JZO A;  2MMZ A;  4MP4 A;  4DEJ A;  1DE2 A;  3CYN A;  1DBY A;  3EU4 A;  4JZQ A;  3J7Y k;  2CZ3 A;  1HNA A;  3LG6 A;  1EOG A;  1V40 A;  3A3T A;  4KAE A;  1URM A;  4P3Y B;  1WJK A;  5G2Z A;  1WIK A;  1C72 A;  3RPN A;  2FWG A;  2LV3 A;  4KF9 A;  4O92 A;  2OBI A;  1AW9 A;  4A5P A;  2LJK A;  5CP1 A;  4TR3 A;  4HU9 A;  3VFI A;  4IS0 A;  3BOA A;  5ELA A;  4OCE A;  4OFM A;  1BED A;  1GP1 A;  1YKA A;  1ST9 A;  1MD3 A;  4BVX B;  1HYU A;  3DVW A;  1T7P B;  2VCZ A;  3EUR A;  1O7U A;  4BWQ A;  1Y6E A;  1R7H A;  17GS A;  2IIY A;  2FGX A;  2LQO A;  3VI5 A;  2PGT A;  3F4R A;  2JSY A;  2X99 A;  1PX7 A;  4K5R A;  5ECM B;  1O73 A;  5J41 A;  3IK7 A;  1SJI A;  4IGJ A;  3HDC A;  5JCU A;  1FB6 A;  5CYY A;  1EWX A;  3R2Q A;  3LJR A;  4EIP A;  1GRX A;  3IDV A;  5A5K A;  2DJ0 A;  3TJG A;  1O85 A;  1R4W A;  1QXH A;  3LYK A;  3IRA A;  2CAQ A;  1SYX A;  3IOS A;  3Q74 A;  4K2D A;  2X8G A;  4RQX A;  2YZH A;  5H5S A;  1GLQ A;  1YKC A;  1YZX A;  1M9A A;  3PR8 A;  2HLS A;  5GAN D;  2RII A;  4OCF A;  8GSS A;  1NW2 A;  1GSS A;  4TR4 A;  2X8C A;  4HZ4 A;  3HD5 A;  4POK A;  4N10 A;  3KP9 A;  2FA4 A;  2F9S A;  5CAX A;  2VL2 A;  4OO5 A;  2V2G A;  1K0C A;  5IMC A;  5C00 A;  1BJX A;  3DKS A;  4I2U A;  4DVC A;  4JU5 A;  4IN0 A;  1MTC A;  1OKT A;  2XPD A;  1TKD B;  2R37 A;  3Q18 A;  1MDK A;  4TXV A;  2LNS A;  1PKW A;  4G10 A;  7GSS A;  3H1N A;  2R6K A;  4YQM A;  2DIY A;  1FVK A;  4ZBD A;  1YF1 A;  2CX3 A;  2UZ8 A;  4ML1 A;  5B8A A;  3LYP A;  1OC9 A;  4LL1 B;  1TRU A;  1GH2 A;  1R26 A;  1T4Y A;  4L5O A;  4V1A p;  3GIX A;  4EO3 A;  3KMO A;  1X9M B;  2XHF A;  3PPU A;  2WB9 A;  3GL5 A;  1F37 A;  1A8L A;  1U87 A;  1AQW A;  1PN0 A;  2R2J A;  3A5I A;  3RDW A;  3L9U A;  2I4A A;  2LQQ A;  1B8X A;  5GZZ B;  3Q19 A;  5J9B A;  4NHZ A;  2HSH A;  2EC4 A;  1G7E A;  1ZYP A;  3GKN A;  3JCM L;  3UOM A;  2R3X A;  1XCC A;  3EMP A;  2YV9 A;  2FWF A;  4LLR A;  1FG4 A;  5F06 A;  1A8Y A;  1S3C A;  2LJR A;  4ZB8 A;  5GSS A;  4MDC A;  5DCH A;  1X5E A;  4WR5 A;  2OBK A;  3LGC A;  2V32 A;  2DJ3 A;  3RAZ A;  3US3 A;  2WDU A;  4V2M A;  3HKR A;  3TCO A;  4POL A;  2PUK C;  2JAD A;  2H66 A;  1B4P A;  1BG5 A;  4X1U A;  3SWL A;  2VCV A;  3HZ4 A;  2VL9 A;  4KCA A;  4F03 A;  1T1V A;  4ZL8 A;  2H75 A;  4G0I A;  9GSS A;  4HEA 2;  3GMF A;  3L9V A;  3P7X A;  4QL9 A;  4XS4 A;  3CRU A;  5B7C A;  1M2A A;  3HYP A;  3CTG A;  2EIQ A;  1A0R P;  1XVQ A;  4PTS A;  3GKK A;  4OO4 A;  4RUV A;  3ZML A;  3W6G A;  3NIV A;  4K6X A;  5ELG A;  6GST A;  1EP8 A;  3CBU A;  4OMV A;  4EUY A;  4I6X A;  1AQX A;  1UC7 A;  2R0G A;  2K9F A;  1XVW A;  2OE1 A;  4WR4 A;  2QA2 A;  2DJJ A;  2LST A;  3IC8 A;  1V57 A;  2KP2 A;  3UVT A;  5D8I A;  3C8E A;  2OJL A;  5KOW A;  2K18 A;  3E3E A;  4HU7 A;  5IMD A;  2AB6 A;  1CQH A;  2YWI A;  1V58 A;  3PGT A;  4O32 A;  4JR4 A;  3U5R E;  1EV4 A;  5EL8 A;  1A2M A;  2C80 A;  1XW9 A;  1OYJ A;  1HNB A;  5DBQ A;  2IFQ B;  3MYD A;  2WZ9 A;  4HJ2 A;  5LNK e;  3M9K A;  3FKF A;  3KIJ A;  4TR1 A;  4BVY B;  3D4T A;  1F3B A;  1XOA A;  1K3L A;  3C71 A;  4ID0 A;  1RW1 A;  2GZY A;  2IFQ A;  1R5P A;  4V1A g;  1NHO A;  5IPH A;  2BTO T;  5G30 A;  1ACV A;  4GSS A;  2CQ9 A;  3HHV A;  4IKH A;  4EC0 A;  3LWA A;  3MNG A;  1DUG A;  3D21 A;  4F0C A;  2AV4 A;  1PRX A;  1ILO A;  4MF7 A;  3LXT A;  4G2E A;  2NDO A;  2GGT A;  4MZB A;  2PWJ A;  2A2S A;  1EZK A;  1XZO A;  3G7Y A;  3EMX A;  4TN8 A;  5F05 A;  1ERU A;  3IE3 A;  5IMZ A;  2QC7 A;  1G6W A;  3EPT A;  4LMW A;  2X49 A;  2YOI A;  4USS A;  3APS A;  4MZW A;  3P2A A;  4KB3 A;  4N30 A;  3OR5 A;  5ECS A;  1YEP A;  4NV5 A;  5J4U A;  4IJI A;  2H1D A;  1J9B A;  3C1R A;  2VOC A;  2FD3 A;  5BMU A;  1GSU A;  3W8S A;  5D9X A;  1YJ6 A;  3A2W A;  5CRH A;  1U3I A;  1SD8 A;  2VL3 A;  1FW1 A;  3VI7 A;  2LRC A;  4MAB A;  3HCZ A;  1SK2 A;  2KLX A;  3FEU A;  1UVZ A;  1PA3 A;  2O87 A;  4Z7X A;  2YPM A;  3BCI A;  2H1A A;  3QAG A;  4GQC A;  1GLP A;  4QQ7 A;  2DKI A;  5AIX A;  2VL2 C;  5B6M A;  1WRY A;  2CZ2 A;  2WUL A;  5H5Q A;  2KP1 A;  1V9W A;  4BL7 B;  4AF2 A;  1ZMA A;  3C73 A;  2RUF A;  3KJY A;  2E2M A;  1TOF A;  2CAI A;  2F51 A;  3CSH A;  4BL7 A;  3F9U A;  3VUR A;  1WWJ A;  4KSO A;  2H6X A;  4NHW A;  2RM6 A;  4NV2 A;  1AIU A;  1Y25 A;  3WGE A;  5KN0 A;  2C0E A;  4FYB A;  1GUL A;  6GSS A;  2ON5 A;  1OE8 A;  3HZ8 A;  2IME A;  2HRN A;  1DE1 A;  1I5G A;  5J9C A;  3RPP A;  1ABA A;  2J9H A;  4HDE A;  1XW5 A;  3FR9 A;  4CHS A;  4IEL A;  1K0O A;  4KX4 A;  4ISD A;  3F4T A;  2YCD A;  1Z7R A;  3QD9 A;  2H01 A;  1IYI A;  1K0M A;  3TKS A;  3TJF A;  3KMN A;  4ZB6 A;  4MK3 A;  1PSQ A;  3I69 A;  4OFN A;  4MMM A;  3F4S A;  1VF3 A;  1XW6 A;  1TU8 A;  2XC2 A;  1SJZ A;  4MLY A;  2VCQ A;  4HJM A;  1QGV A;  4ECC A;  2VLT A;  1F2E A;  2PBJ A;  1PMT A;  5DAL B;  4MF5 A;  3QR6 A;  5EVO A;  3MWH A;  4I2T A;  3KXO A;  3I6A A;  1Z9H A;  2B5X A;  2DML A;  2A2R A;  4HUA A;  2L5O A;  2L4Q A;  1JZW A;  4NWY A;  2QGV A;  1AXD A;  4G0K A;  2GQM A;  1G7O A;  4K8M A;  11GS A;  3KCM A;  4CDO A;  1N2A A;  5G1L A;  1PQN A;  1XWK A;  2VD0 A;  1VGL A;  3GH9 A;  2N5B A;  2JSZ A;  1PL2 A;  3S9F A;  4X43 A;  1A2J A;  3IBH A;  4ZIL A;  3TKS E;  5G5E A;  2B5Y A;  1IYH A;  3VWX A;  3R3E A;  4K7O A;  5KN1 A;  2PU9 C;  4EXJ A;  1LBK A;  2BJX A;  3PIN A;  1A0F A;  1KNG A;  3F3Q A;  1BX9 A;  4ZIJ A;  5ECK B;  1PN9 A;  10GS A;  3KH7 A;  3HA9 A;  2L6C A;  1GSE A;  3IPZ A;  3A2X A;  1GWC A;  1K0N A;  2FNO A;  2HYX A;  1X9W B;  2VUP A;  1JLV A;  2D2Z A;  2HZE B;  1EEJ A;  2GQL A;  4Z2U A;  4PX1 A;  3ME8 A;  3KTB A;  3L0H A;  3ZTL A;  1GTB A;  1MDJ A;  3TDG A;  2K8S A;  4BVX A;  5FWG A;  3FRC A;  1G0T A;  2VIM A;  4MPG A;  4TXO B;  3LQ7 A;  1TJD A;  1GTI A;  3DML A;  2ZUP A;  5IMV A;  5ECN B;  3TUE A;  2P0G A;  3M9J A;  2IWT A;  1ERW A;  3ZMK A;  3GKM A;  5AGY A;  5CRE A;  2YV7 A;  3E0U A;  1XBS A;  2B3S A;  4HQS A;  1MDI A;  5AN1 A;  1FHE A;  12GS A;  3DVX A;  2WCI A;  1XFL A;  4KE3 A;  4ZXG A;  2AHE A;  4POB A;  2L4C A;  4PGT A;  3NOF A;  2PMT A;  2H74 A;  3LW9 A;  2XPE A;  4Q5Q A;  3N5O A;  3FMW A;  4J57 E;  4KDU A;  1FOV A;  3GFK A;  3CSI A;  2O89 A;  1XWA A;  19GS A;  4GCI A;  3HY2 A;  4IP1 A;  1OVN A;  3GST A;  3DEX A;  5B6N A;  2HE3 A;  1LU4 A;  4WBR D;  4TRX A;  2IMD A;  3LFL A;  2JL4 A;  2H0G A;  2C4J A;  2IN3 A;  3D6I A;  2DC5 A;  1M2D A;  2K6V A;  4IVF A;  4FH8 A;  2H30 A;  1VF1 A;  4X4J A;  3KP8 A;  2VCT A;  2CV4 A;  1ZCP A;  1WMJ A;  1SL1 B;  1VF2 A;  1FB0 A;  3G7I A;  4IBP A;  4YAP A;  2XBI A;  4LA1 A;  5JWO B;  1TI1 A;  2HRK A;  2PVQ A;  2ALB A;  3APQ A;  3BBY A;  2AUV A;  3ZVJ A;  4XHM A;  2HXK A;  2LS5 A;  2H1G A;  1QQ2 A;  4J2F A;  3UBK A;  5DJM A;  2G2Q A;  4EDY A;  2YNX A;  2IPA A;  1ZGN A;  4DSS B;  4D73 B;  4BWS A;  1EEM A;  3FW2 A;  2HSY A;  20GS A;  4O5U A;  3IAS 2;  1SK0 A;  2H0I A;  3ZIV A;  5DDL A;  4DSS A;  1SK1 A;  2VCW A;  3NZN A;  2OA7 A;  4D73 A;  4EVM A;  2DBC A;  3CTF A;  2VD1 A;  2DSA A;  1TXX A;  3GV1 A;  3F63 A;  4KW6 A;  2KOK A;  1TTZ A;  4G19 A;  3J7Y b;  4PUF C;  3UL3 A;  5IQY A;  2MZC A;  3LXZ A;  1E6B A;  1B48 A;  3IXR A;  2M72 A;  1PD2 1;  1WE0 A;  3H93 A;  1WP0 A;  5IOX A;  3TOU A;  5IMA A;  1GL8 A;  2R0P A;  5D96 A;  4V2N A;  2X8H A;  4GXZ A;  1VF4 A;  2RUE A;  4MZC A;  3TKS C;  1LJR A;  1BQ7 A;  5IPG A;  5F8B A;  2FWH A;  3FY7 A;  5D9W A;  3ERW A;  3VPQ A;  4L8E A;  1UN2 A;  4WET A;  1ZYQ B;  3WGX A;  2GLR A;  3GH6 A;  2VM2 A;  22GS A;  1GTA A;  2RM5 A;  1TK5 B;  4AJ6 A;  2CT6 A;  5CRD A;  4KND A;  2LJA A;  1BYE A;  1HNC A;  3ERG A;  2LRN A;  2H73 A;  3FZ9 A;  2B1L A;  6GSW A;  2WS2 A;  5ECH B;  4G9H A;  1USB A;  2FCH A;  3O76 A;  4MNN A;  2V41 A;  3VK9 A;  4QL7 A;  1QFN A;  2B7J A;  4CY8 A;  4ZL9 A;  1GSF A;  1EGR A;  1S3D A;  2IL3 A;  2V6K A;  4HI7 A;  4PQ1 A;  3I43 A;  4MJE A;  4POM A;  6GSV A;  1WPI A;  1A23 A;  2FA8 A;  4ULX A;  1RQM A;  4XS1 A;  3TRQ A;  2MBS A;  1M0U A;  2H76 A;  4L5L A;  1XOB A;  5ECO B;  2H71 A;  1O6J A;  3LEF A;  2NVL A;  5D9V A;  1AAZ A;  2IMI A;  1K3Y A;  2C3Q A;  1XWB A;  2LTK A;  1GUM A;  4MCU A;  1M2B A;  3UBL A;  3F6F A;  3EWL A;  1U3A A;  4K2X A;  3DIE A;  3RHC A;  4BVY A;  1N8J A;  5IO2 A;  4MH3 A;  3P8W A;  5LCZ A;  2CVK A;  3TJK A;  1KTE A;  1RK4 A;  2J23 A;  4LMV A;  5LD0 A;  3W8J A;  4K0G A;  1FO5 A;  2HNL A;  3C1S A;  1T00 A;  1A24 A;  3U6V A;  2ES7 A;  3GX0 A;  2C3N A;  2AAW A;  2YP6 A;  3MSZ A;  1Z6N A;  2FWE A;  2QA1 A;  1H4O A;  4FYC A;  1ML6 A;  2IMK A;  3FK8 A;  6GSX A;  3VPT A;  3QFB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...